3KLJA

Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
378
structure length
378
Chain Sequence
KSTKILILGAGPAGFSAAKAALGKCDDITMINSEKYLPYYRPRLNEIIAKNKSIDDILIKKNDWYEKNNIKVITSEFATSIDPNNKLVTLKSGEKIKYEKLIIASGSIANKIKVPHADEIFSLYSYDDALKIKDECKNKGKAFIIGGGILGIELAQAIIDSGTPASIGIILEYPLERQLDRDGGLFLKDKLDRLGIKIYTNSNFEEMGDLIRSSCVITAVGVKPNLDFIKDTEIASKRGILVNDHMETSIKDIYACGDVAEFYGKNPGLINIANKQGEVAGLNACGEDASYSEIIPSPILKVSGISIISCGDIENNKPSKVFRSTQEDKYIVCMLKENKIDAAAVIGDVSLGTKLKKAIDSSKSFDNISSLDAILNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
molecule keywords NAD(FAD)-dependent dehydrogenase, NirB-family (N-terminal do
total genus 117
structure length 378
sequence length 378
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18267 Rubredoxin_C Rubredoxin NAD+ reductase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3kljA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA02
3NN6X 2JBVA 1CC2A 3C96A 3GDPA 1PBEA 4N9XA 1DNCA 4CBQA 2OLOA 1N4VA 1KNRA 2E1MA 1H82A 1OJAA 2OLNA 3ZYXA 2GF3A 3AEGA 3CNSA 5KXJA 1CJCA 3P1WA 1NDAA 4E0VA 2XYOA 3FPZA 3GMBA 4DSGA 4LA1A 3GDNA 3P4PA 3QVPA 2I0ZA 4TM0A 3CTYA 3NK2X 3DK4A 3UKHA 3VRAA 3NYCA 4H2PA 1E1NA 1JRXA 4EQXA 4EMJA 1GRHA 1VG0A 5KOXA 3UP5A 4H4TA 4EIPA 3DJGX 5ER0A 3GSIA 3AE9A 3ICSA 2V3AA 3ALMA 3NGCX 1L9CA 1DJNA 4A5LA 1AOGA 1DOEA 3AWIA 1QO8A 1XHCA 4GR1A 3H8LA 1SEZA 5FS9A 1N4UA 4YKFA 4Z24A 5JCMA 1BWCA 4J2WA 1GRAA 1OJCA 4BJZA 1ZK7A 2WU2A 3UTFA 3F8DA 2Q6UA 3CNDA 4IV9A 1GXFA 2VVLG 1ZOVA 2GMJA 2X99A 1JU2A 2X8HA 5KWFA 1MXTA 3R9UA 2C70A 1N1PA 3KU9A 1GALA 1Z6LA 2C7GA 4Z2RA 3NN0X 4H4UA 4K5RA 2QA1A 4OPCA 4YKGA 2B7SA 2APGA 2YWLA 2Q7VA 4Y4NA 2IVDA 3D1CA 1GRBA 3BNUA 1Q1WA 4Z26A 1B37A 2VQ7A 4ADWA 4EMWA 1L9DA 3G5SA 5GRTA 2V5ZA 4J33A 4B69A 3P4SA 2YVJA 2Z5YA 5FS7A 3QJ4A 4EM4A 1QLBA 4U8MA 1ONFA 3AEEA 1H86A 2YVFA 4BK2A 3GYJA 1E7PA 3AEFA 3WE0A 1DODA 4HA6A 4Z43A 4LU6A 1CJ2A 3DJJA 4D03A 1ZMDA 3ICTA 4Z44A 1VDCA 2B9WA 1D4DA 3RNMA 2GR1A 1F8SA 3DMEA 4NZHA 5U25A 3UTGA 2EQ7A 2C73A 2VVMA 3NG7X 4IA6A 2YR5A 1ZKQA 2X50A 5KRQA 1QJDA 1ZOYA 4NEVA 2J3NA 3QSSA 2C65A 3SGLA 2JK6A 3H4KA 1GREA 2EQ9A 2VOUA 4B67A 1MO9A 4IVMB 4EQSA 1PS9A 4REKA 4BJYA 2C3DA 4ECHA 1H84A 4YTMA 2RGJA 1NEKA 3S5WA 3SFDA 3UKPA 3PVCA 1GT8A 4DNAA 4K2XA 1KFYA 4OPIA 3K7TA 4CY8A 2R0GA 3IF9A 3NK1X 4B1BA 4CNKA 3G5QA 3FG2P 1RP0A 2Y6RA 1K0IA 2YG6A 3ICRA 2R0PA 2VQBA 1GTHA 5J7XA 3AECA 2NVKX 2YR4A 1FEBA 1PXBA 4JDRA 4JN9A 4GDPA 4U8PA 1YQ3A 2WP9A 1VRQB 1FOHA 2YG3A 3M13A 4RG3A 4YSYA 3FIMB 1PN0A 3QFBA 1EL8A 2BC1A 3IWAA 2YVGA 1D4CA 2BS4A 4K7ZA 4YSXA 1XANA 4OPDA 3B3RA 4K22A 3NRNA 4OPGA 3CGCA 1Q9IA 3UOVA 4DSHA 2FBWA 3LZWA 2ARDA 4A79A 2WQYA 1E1LA 5IQ1A 3DJDA 1NENA 3NTDA 1L9EA 3LOVA 2WESA 2WP6A 1KF6A 4A99A 4B66A 4IA5A 3DH9A 3L1RA 2WPEA 1PBBA 1IUTA 1YQ4A 2GB0A 3ITJA 3LADA 4GF7A 4X4JA 3P4RA 1GV4A 2GR0A 1EL7A 2WHDA 3BI5A 4GCMA 4UDRA 4B63A 2AR8A 1GRFA 1UKVG 3EPTA 3FBSA 1P2EA 2YM1A 3V3OA 1D7YA 4XWRA 3EF6A 3SFEA 4YTNA 4EIQA 1CC4A 1PBCA 1PJ6A 3HZLA 2YAUA 1LV0A 5HXIA 1LQUA 1E1MA 3UOXA 3REDA 2RGOA 3DA1A 3OZ2A 4P9SA 3V76A 3LXDA 1BZLA 3GRSA 1PBDA 2QA2A 3AE5A 4A9WA 3LB8A 2VRMA 5FMHA 2GVCA 2DKIA 2CULA 4BURA 2R9ZA 2YM2A 3GD3A 2XFPA 3UTEA 4RG4A 1RSGA 4C5OA 3DK8A 1E1KA 3NYFA 5EB5A 4DGKA 5IQ4A 5KOWA 4H4YA 2QAEA 3FMWA 5TR3A 3IHMA 2PYXA 3AE2A 1F8WA 5GSNA 1IUXA 3KA7A 3V3NA 3GD4A 1IUWA 2YLZA 3AE7A 1H81A 3JSKA 1H7WA 1GSNA 2C67A 4FK1C 2C76A 3CPIG 2RGHA 4AP1A 4A65A 1Y56B 4BK1A 2XLRA 4JY2A 3UKQA 5BRTA 1CBOA 4H4VA 4I59A 1BF3A 4PABA 1S3EA 3M0OA 1COYA 4J36A 3IC9A 1H7XA 1YKJA 1GRTA 2GAGB 4M52A 1TRBA 2OAMA 2XVHA 3UOYA 1CL0A 4J34A 1D7LA 1IUVA 5BUKA 1TYTA 4WCTA 2X8CA 4XWZA 2C75A 5J60A 4FX9A 1LTXR 3CNJA 4OPUA 2XFOA 5JCLA 2XVJA 3I3LA 1PXCA 2XDOA 3F8RA 3ADAB 1NHPA 1L0VA 4FDCB 3KLJA 4H7UA 2YG7A 1JEHA 4YT0A 1NG4A 2NPXA 4NTCA 2WP5A 4U8LA 3K7MX 1FCDA 3DK9A 1NAAA 2XFNA 3RP6A 1D4EA 2BCPA 1GETA 5FS8A 1F6MA 5JCIA 4C3XA 2BXRA 4JNQA 1O95A 2GMHA 1TDEA 4ZCDA 5EOWA 1XPQA 1DJQA 5U63A 3QSMA 2BCGG 2H88A 2GAHB 3AYLA 1IUSA 2E4GA 4EMIA 2FJAA 4Z2TA 1GEUA 2V3BA 3VRDB 1REOA 1NHSA 3F8PA 1YY5A 3C4NA 4O5UA 5FS6A 3GRTA 2GV8A 1ZMCA 4KPRA 5JCKA 2JKCA 3AE8A 1ZP0A 1V59A 3I6DA 4TLZA 2JB3A 2V60A 3D8XA 1LQTA 2WPFA 1YQZA 2A89A 4TM1A 5DBJA 1ZX9A 3AD7B 4ZCCA 4NEWA 3RP7A 2BS2A 5L46A 4C3YA 1VQWA 3DGZA 4IVOB 1KDGA 2CDUA 4AP3A 4B65A 5M0ZA 1BKWA 3AEDA 2FJBA 3H8IA 3NIXA 1GPEA 4Z25A 3OC4A 4EM3A 3UKFA 3COXA 2XLUA 4AT0A 4YXDA 1GOSA 4O5QA 3ZDNA 3DJEA 2JB1A 2C72A 2WEUA 3NH3X 2BYBA 4H4RA 2YLRA 4TLXA 3LZXA 3UP4A 4YSHA 3BNMA 4C77A 1KNPA 2W0HA 4WX1A 2R45A 2CFYA 3P4QA 3GWDA 1TYPA 1PJ5A 4A6NB 1S3BA 3UCLA 2WDRA 1OJDA 2C66A 1HYUA 3LJPA 3QSEA 2YG4A 3CNPA 3CN8A 1GERA 1LPFA 3IHGA 1K0JA 4USQA 3KD9A 1KSSA 2WDVA 2F5ZA 2FJEA 2B76A 3NNEA 2B9XA 4TM3A 4A6NA 4X9NA 1TDOA 3BHFA 2XVEA 1BGJA 1CC6A 4H2QA 3ATRA 1E39A 1E6EA 4I58A 1OJ9A 2WOWA 3PO7A 5EBKA 3M12A 3UKLA 4Z2UA 2XLTA 5HHFA 2B9YA 2Q0LA 4XXGA 3AXBA 1KSUA 4U8IA 1FECA 4BV6A 3AE3A 2C3CA 3ATQA 2YLTA 2ZZBA 3AE1A 3CPHG 4A7AA 2VVLA 2WOVA 5U1OA 4B68A 1JRYA 3BI4A 1PXAA 2OALA 4J56A 3AE4A 1DOBA 1FEAA 4H2RA 2GR3A 1JRZA 3NKSA 3B6DA 1B8SA 2YG5A 3GYIA 2DKHA 3UOZA 4TM4A 3AEBA 3RP8A 2TPRA 4NTDA 1D5TA 3Q6JA 2WPCA 4JY3A 5BVAA 4APNA 5HY5A 2BK3A 2AAQA 2GRTA 2R0CA 3UKKA 5EB4A 2WDQA 3DGHA 3AYJA 3RHAA 1TDFA 1LVLA 2OA1A 3NK0X 2VRLA 4AOSA 1ELIA 4H4WA 1O94A 4BK3A 1VG9A 4JQ9A 1Q1RA 1JNRA 2UZZA 3KVEA 4K5SA 4ZN0A 4GUVA 2YLSA 2XCGA 4RSLA 1EL5A 1XDIA 2Q0KA 1O5WA 3CGEA 5KVIA 3VQRA 3P9UA 4C74A 2C64A 3NYEA 3KKJA 5C2TA 1Y0PA 3URHA 4YWOA 3K7QX 2WS3A 1CJ3A 3EANA 3QVRA 3NTAA 3G5RA 4U8OA 4YSZA 3AEAA 2EQ6A 2TMDA 1K4QA 4FK1A 5HYMA 2V6OA 4K8DA 1ZY8A 2BS3A 4X9MA 1FL2A 3NT6A 2EQ8A 2YLXA 5C3JA 3C4AA 3EAOA 1JNZA 3BI2A 2GH5A 1CHUA 1B4VA 2IIDA 2XLSA 1F3PA 4AT2A 1F8RA 1Y56A 4H4QA 4H2NA 1CJ4A 1W4XA 1GRGA 2Y6QA 4KX6A 4OCGA 1GNDA 4LIIA 1EBDA 1PJ7A 4UDPA 2GR2A 3SQPA 1S2QA 4U2TA 2GQWA 2BC0A 2IVEA 4NTEA 3E1TA 3CNTA 4YTPA 2YQUA 2ZZ0A 4H4XA 4EQRA 1EL9A 3SM8A 4D04A 4GDEA 1DOCA 3BHKA 3S61A 3Q9TA 4U2SA 4CNJA 4OPLA 1P2HA 2JAEA 3ALJA 2CVJA 4CRTA 2WOIA 1PDHA 2Z5XA 5BULA 1M64A 1JOAA 4HB9A 5CQFA 2B7RA 4B64A 1K0LA 1DXLA 1S2YA 3L8KA 2H89A 4UP3A 2XLPA 1GESA 3VRBA 4U2LA 2X8GA 5LV9A 2A8XA 2XVIA 4MJWA 3AB1A 3ISHA 2BK5A 2V61A 5JCNA 3VR8A 4CY6A 3UTHA 3QFAA 2BABA 1GTEA 1H6VA 3ALLA 4Y4LA 3II4A 2HQMA 3AD8B 1NPXA 3AD9B 1TDNA 5KVHA 4ICYA 1PBFA 3UKAA 1BGNA 4Y4MA 5M10A 2WETA 2WBAA 1IJHA 3CGDA 4H4PA 1TDKA 5CKUA 4J31A 2FJDA 1MOKA 1NHQA 3ABVA 1LJ1A 1RYIA 4GRTA 2XFQA 1B5QA 1OJTA 2YLWA 1PHHA 3CPJG 2YR6A 2ACZA 4CCQA 4USRA 3NHOX 3AYIA 3O0HA 2BK4A 4U8KA 4U8NA 2A87A 1M6IA 1H83A 2GEWA 3PS9A 2BACA 1ZDLA 4PAAA 2AQJA 2QCUA 2O9ZA 3AE6A 1X31B 2R46A 2R4EA 1CF3A 2R4JA 2PHHA 2BA9A 2E5VA 4U8JA 1IUUA 3GMCA 3GWFA 2X3NA 2XVFA 1NHRA 4AOXA 2XFUA 2GQFA 2VZ2A 4J57A 5IPYA 4UDQA 4JNAA 2ZZCA 4OVIA 2ZBWA 3VR9A 2BXSA 3NLCA 4EQWA 3K30A 2WU5A 1NG3A 4OPTA 3CGBA 4CCRA 2RABA 4H4ZA 3T37A 3KPFA 4H50A 4H4SA 3CIRA 1N4WA 2JB2A
chains in the Genus database with same CATH superfamily
1CC2A 1H82A 3H7VA 5KNLA 1NDAA 4E0VA 5BOEA 3FPZA 4LA1A 3GDNA 2I0ZA 3NK2X 3DK4A 1JRXA 5KOXA 1MRAA 3DJGX 4K1WA 1DJNA 3AWIA 1QO8A 5JCMA 1GRAA 3STPA 3FYYA 3UTFA 3R10A 4IV9A 2VVLG 2GMJA 4IZGA 3CXBA 2GL5A 1JDFA 4H4UA 2QA1A 4YKGA 5FJPA 2P3ZA 2Q7VA 2IVDA 4EWJA 3H70A 4ADWA 2V5ZA 3A7RA 2QDEA 4EM4A 3S47A 1ONFA 4LU6A 3QLDA 3EEZA 3UTGA 4NZHA 5U25A 2EQ7A 2VVMA 3KPKA 5KRQA 3HW2A 1QJDA 2POZA 4IVMB 3N4EA 2RGJA 3SFDA 3T6CA 3ZVHA 1GT8A 1KFYA 4OPIA 4IL2A 3P3BA 3FG2P 2Y6RA 2R0PA 2VQBA 2NVKX 4DN1A 1PXBA 4U8PA 3T31A 2WP9A 3M13A 2PGWA 4RG3A 3QFBA 2OX4A 3TJIA 4YSXA 1XANA 4OPDA 3B3RA 4K22A 3NRNA 3SZWA 4B66A 1NENA 3NTDA 3LOVA 3ITJA 3LADA 1EL7A 2BRYA 2XSXA 2AR8A 2HNEA 2PODA 4JHMA 1CC4A 2O56A 3UOXA 3REDA 3LXDA 2FKPA 2P0IA 3NZGA 3N6HA 3LB8A 3ZVIA 3VA8A 3GD3A 2XFPA 2QQ6A 1E9IA 3DK8A 4E4FA 1E1KA 3SX6A 4H4YA 3UJFA 3AN1A 1TKKA 5GSNA 3V3NA 3GD4A 5FJRA 2YLZA 4FK1C 1H7WA 2C76A 2RGHA 3T2YA 3UKQA 4I59A 3UOYA 1CL0A 3NFUA 2OQHA 4MKSA 4FX9A 3CNJA 2XFOA 4HNLA 2XDOA 3F8RA 3ADAB 2PTWA 1L0VA 2YG7A 4E5TA 1NG4A 3K7MX 1FCDA 2BCPA 5JCIA 2BXRA 2GMHA 5G5HB 4ZCDA 1H2IA 4FI4A 2FYMA 1MNSA 3ETRB 4Z2TA 2V3BA 1T3QC 3VRDB 2C4CA 1REOA 2HXTA 1NHSA 4TVYA 3F8PA 1YY5A 3C4NA 1VDVA 5FS6A 1ZMCA 4KPRA 1JCTA 4IHCA 4ZCCA 4NEWA 3NVWB 1KDGA 4B65A 5M0ZA 1BKWA 3AEDA 4EM3A 3ZDNA 4II2A 3OZMA 2C72A 2BYBA 3T0KA 3Q45A 2C66A 1HYUA 3QSEA 2W55A 3IHGA 1K0JA 1KSSA 2F5ZA 3BHFA 2XVEA 4H2QA 3I4KA 1E39A 3ATRA 5EBKA 3UKLA 1FO4A 4K2SA 2B9YA 4ZCWA 3AXBA 3T14A 4DX3A 2VVLA 3QPEA 1BKHA 2OALA 4J56A 1FEAA 4DWDA 3NKSA 2DKHA 2TPRA 2OA1A 3NK0X 4BK3A 1Q1RA 1JNRA 4NWZA 3NRZB 2YLSA 3OTRA 4NNJA 4ROPA 1XDIA 3VCCA 2Q0KA 2W54A 2AL2B 3P9UA 3KKJA 1TE6A 4YSZA 1K4QA 2V6OA 4K8DA 2GSHA 1FL2A 2EQ8A 2YLXA 4GISA 3R11A 2XLSA 1F8RA 1EC9A 1GRGA 3AMZA 3SQPA 1S2QA 2GQWA 3ZLHA 2YQUA 4D04A 3B9JB 3CK5A 4CNJA 1ECQA 5BULA 4HB9A 1MDLA 3L8KA 3VRBA 2X8GA 2A8XA 3UCCA 4MJWA 3ISHA 2V61A 3VR8A 2AL1A 1H6VA 4Y4LA 3II4A 4J1OA 3QTPA 4ICYA 3T9PA 1BGNA 4Y4MA 1MOKA 4GRTA 1B5QA 2YR6A 3NHOX 4U8KA 4U8NA 1N63C 1H83A 3T2KA 1X31B 4X2PA 2BA9A 4J57A 3FJ4A 2HXUA 2WU5A 3DEQA 1X2HA 3CIRA 4CBQA 4N9XA 2E1MA 4II3A 3AEGA 5KXJA 3P1WA 2XYOA 2PSNA 4DSGA 3CTYA 3UXKA 3VRAA 1FFUC 1PDYA 1VG0A 2PTXA 5ER0A 3ICSA 1L9CA 4GR1A 1N4UA 4KWSA 4J2WA 2ZC8A 3CNDA 1ZOVA 4H2HA 1JPMA 2X8HA 3SYIA 1GALA 1Z6LA 4K5RA 4OPCA 2B7SA 2YWLA 2PS2A 4Y4NA 3TQPA 1GRBA 4Z26A 4MMWA 3G5SA 4J33A 3SZCA 3SN4A 1H86A 3MZNA 4BK2A 1DODA 4Z43A 3DJJA 4D03A 1ZMDA 2B9WA 1D4DA 3RNMA 1F8SA 3DMEA 3NG7X 4IA6A 3R25A 2X50A 2PMQA 1ZOYA 4NEVA 3H4KA 2EQ9A 2VOUA 1MO9A 4REKA 4ECHA 1H84A 3S5WA 3UKPA 3N6JA 4K2XA 1KN0A 4ENLA 2QDDA 2YG6A 3DG3A 3ICRA 3EUB3 4ZA0A 3TWBA 4GDPA 1YQ3A 1VRQB 4YSYA 3FIMB 3IWAA 2YVGA 1D4CA 4K7ZA 3CGCA 3MSYA 1Q9IA 4DSHA 3DJDA 3VCNA 1KF6A 4A99A 3DH9A 1YQ4A 4DXKA 1IUTA 4GF7A 2WHDA 3EPTA 1P2EA 2YM1A 3PG6A 3EF6A 1PBCA 2PP3A 1PJ6A 2PU0A 2GGGA 2OPJA 2RGOA 3PWGA 3BJSA 4A9WA 2YM2A 4IP5A 1WYGA 3D9XA 5EB5A 3UJ2A 3FMWA 2DW7A 1SJDA 3IHMA 1F8WA 1IUXA 2RDXA 3KA7A 3JSKA 3TJ4A 4A65A 3JZUA 1Y56B 3T2ZA 4G9KA 4BK1A 5BRTA 4H4VA 1TRBA 4J34A 1D7LA 1IUVA 1TYTA 2X8CA 4XWZA 2C75A 3RGTA 1JPDX 4OPUA 1BQGA 5JCLA 2XVJA 3I3LA 1PXCA 1NHPA 1JEHA 4E6MA 2ONEA 4YT0A 4GYPA 2WP5A 4U8LA 3DK9A 3R07C 3RP6A 5FS8A 4H1ZA 1F6MA 1TDEA 5EOWA 3S5SA 3QSMA 2H88A 4KEMA 3AYLA 4TVWA 4EMIA 2FJAA 2E3TA 1GEUA 4O5UA 3GRTA 2GV8A 2JKCA 3PWIA 1YQZA 2A89A 3PFRA 1ZX9A 3AD7B 3RP7A 2ZADA 1XPYA 4GMEA 3UKFA 3COXA 2XLUA 1GOSA 3DJEA 3I6EA 3NH3X 4YSHA 2W0HA 4WX1A 2R45A 2CFYA 4A6NB 1S3BA 1WUFA 3TCSA 2WDRA 2YG4A 3CNPA 3CN8A 1GERA 3KD9A 2WDVA 1N62C 2FJEA 4TM3A 4A6NA 4X9NA 3MKCA 1SJAA 2QJNA 3RCYA 1OJ9A 3PO7A 3MQTA 3SBFA 2XLTA 3AE3A 1TZZA 2YLTA 3AE1A 3ATQA 3CPHG 4A7AA 5G5GB 1X2GA 4B68A 1DOBA 4GFIA 1FHVA 2GR3A 4H2RA 1B8SA 1P48A 4TM4A 3AEBA 2QJMA 4JY3A 2WPCA 4APNA 1XS2A 5HY5A 4ZOHB 5EB4A 2WDQA 3RHAA 2W3SA 5EU9A 4AOSA 4H4WA 2UZZA 4GUVA 2XCGA 2AKZA 3CGEA 3GY1A 3VQRA 4C74A 3NYEA 3V3WA 4YWOA 1CJ3A 3UXLA 3HYXA 2EQ6A 2TMDA 1SJBA 3JW7A 4X9MA 5C3JA 1JNZA 1B4VA 4G73A 1Y56A 3CT2A 4H2NA 1CJ4A 4KX6A 1GNDA 2GR2A 4E8GA 2BC0A 2IVEA 2ZZ0A 3SM8A 3FXGA 1DOCA 3S61A 4OPLA 3ALJA 1PDHA 4HNCA 2Z5XA 2GGIA 1JOAA 3OPSA 1K0LA 1DXLA 1S2YA 2H89A 4UP3A 1GESA 2PTYA 4A6GA 2BK5A 1GTEA 6ENLA 3FVDA 2WBAA 3VDGA 3SN1A 4H4PA 1WUEA 1TDKA 5CKUA 4J31A 2FJDA 2XFQA 2YLWA 3IJQA 1PHHA 4CCQA 2A87A 2GEWA 2AQJA 2QCUA 3AE6A 2R46A 1CF3A 2R4JA 2PHHA 2E5VA 3SJNA 2X3NA 2XVFA 3P93A 2ZBWA 3VR9A 4EQWA 3SZFA 4OPTA 3R0UA 2QGYA 4CCRA 3T37A 1P43A 1OEPA 3DG6A 2JB2A 3NN6X 2JBVA 3C96A 3GDPA 1KNRA 1OJAA 1EBGA 2OLNA 1CJCA 2PGEA 3NO1A 3P4PA 3QVPA 4TM0A 1V97A 3NYCA 4IP4A 4H2PA 3RITA 4EMJA 1GRHA 3UP5A 4H4TA 4EIPA 3GSIA 1ONEA 1S7MA 2V3AA 3NGCX 4A5LA 1AOGA 1XHCA 3DERA 4YKFA 4Z24A 3TTEA 1IYXA 1OJCA 4BJZA 1ZK7A 1JU2A 4KT2A 5KWFA 1MXTA 2C70A 1N1PA 3NN0X 3R0KA 3IJLA 3FV9A 3D1CA 3BNUA 1MUCA 2VQ7A 3QKEA 5GRTA 4B69A 3P4SA 2YVJA 3QJ4A 5FS7A 4U8MA 1QLBA 2YVFA 5FJOA 3UCDA 4M6UA 1E7PA 3AEFA 3WE0A 4HA6A 1CJ2A 3ICTA 4Z44A 1VDCA 3UJEA 3DFHA 2GR1A 4DYEA 2YR5A 1EBHA 1ZKQA 2J3NA 3QSSA 1W6TA 3IK4A 4G74A 4EQSA 3BSMA 1PS9A 1NEKA 3FCPA 3K7TA 2R0GA 3IF9A 3NK1X 4B1BA 4CNKA 3G5QA 1N60C 1RP0A 3AECA 3V5FA 4JN9A 4JDRA 1RVKA 3R1ZA 2BC1A 4OPGA 3U9IA 4A79A 2ARDA 2WQYA 1E1LA 2OQYA 2WESA 2WP6A 3L1RA 2MNRA 2WPEA 4KPLA 3P4RA 4B63A 2NQLA 3BI5A 1GRFA 1UKVG 3V3OA 4XWRA 4EIQA 2PP1A 3HZLA 2YAUA 1LV0A 5HXIA 2P8CA 4GYPC 1E1MA 3OZ2A 4P9SA 2QA2A 3AE5A 2VRMA 5FMHA 2GVCA 2DKIA 2CULA 2R9ZA 1NELA 1RSGA 3NVZB 4DGKA 5KOWA 2QAEA 5IDZA 2PYXA 4JN7A 3NVVB 2AKMA 3AE7A 3UKAA 1H81A 2C67A 1GSNA 5J04A 3CPIG 3H8AA 4AP1A 2XLRA 3V4BA 1S3EA 3IC9A 1H7XA 2OAMA 1GRTA 2XVHA 4WCTA 3A7AA 5FJUA 3CAWA 4FDCB 2NPXA 4H19A 4NTCA 1D4EA 1GETA 4E4UA 4C3XA 5KMRA 3SR6B 3NS1B 1DJQA 5BOFA 4G7FA 2P8BA 2GAHB 2E4GA 3AM9A 2OFJA 1ZP0A 4TLZA 4J3ZA 2V60A 5DBJA 2I5QA 2GGHA 4C3YA 4F4RA 1VQWA 3DGZA 4IVOB 4IL0A 1NU5A 2FJBA 1GPEA 4Z25A 3D47A 4YXDA 4AT0A 2GGEA 4O5QA 2OO6A 2WEUA 4TLXA 2YLRA 3UP4A 3BNMA 1KNPA 3P4QA 1MDRA 1PJ5A 3B97A 3UCLA 3SY4A 3LJPA 1LPFA 4USQA 2B76A 1BGJA 1CC6A 1E6EA 4I58A 2GDQA 2WOWA 3ES7A 3M12A 4Z2UA 2Q0LA 3GC2A 4XXGA 1KSUA 4BV6A 3GO2A 2C3CA 5U1OA 1JRYA 3BI4A 3SZ0A 3AE4A 2OZ8A 3I6TA 3MUCA 4HPNA 1JRZA 3OW1A 3UOZA 3RP8A 3ENLA 1D5TA 5BVAA 2R0CA 3IJIA 2VRLA 1O94A 3JVAA 4ZN0A 4MGGA 1EC8A 3BOXA 2C64A 3H12A 1Y0PA 3URHA 1RM6B 3NTAA 4FK1A 5HYMA 2BS3A 1ZY8A 2PPGA 3NT6A 3BI2A 2XH4A 2IIDA 1F3PA 4AT2A 4H4QA 1W4XA 3EKGA 2Y6QA 4LIIA 1EBDA 1PJ7A 4U2TA 1EL9A 1FHUA 4GDEA 2MUCA 1P2HA 2JAEA 2CVJA 4H83A 2WOIA 1M64A 5CQFA 2B7RA 2XLPA 5JCNA 3UTHA 3QFAA 4HN8A 2BABA 4GGBA 1PBFA 5M10A 2WETA 2QVHA 1N5XA 1LJ1A 1RYIA 1OJTA 3CPJG 1JRPA 3AYIA 3O0HA 2BK4A 3SQSA 3PS9A 4GAVA 2PP0A 4PAAA 2O9ZA 2R4EA 3QN3A 1IUUA 3GMCA 3GWFA 2AL2A 3ZVHB 4AOXA 2XFUA 2GQFA 2VZ2A 4Z17A 3L5OA 2OKTA 1YEYA 2BXSA 3NLCA 3CMMA 3SXIA 3CGBA 2RABA 4H4ZA 3KPFA 4H50A 1F9CA 3MWCA 1TDFA 1N4WA 1KD0A 1PBEA 1DNCA 2OLOA 1N4VA 3PK7A 3ZYXA 2GF3A 3CNSA 1VQZA 3HRDC 2GGJA 3GMBA 3UKHA 1E1NA 1KKOA 4EQXA 1PDZA 3AE9A 3ALMA 1DOEA 2QJJA 3H8LA 1SEZA 5FS9A 3D46A 1BWCA 2WU2A 3F8DA 2Q6UA 1GXFA 2X99A 1N61C 3R9UA 3KU9A 1JROA 2C7GA 4Z2RA 2APGA 1Q1WA 4GIRA 5KMQA 1B37A 2OVLA 4EMWA 1L9DA 2Z5YA 3AEEA 4G8TA 3VC6A 2OZ3A 3GYJA 5KMSA 2XH0A 3DESA 2C73A 4HYRA 2C65A 3SGLA 2JK6A 1GREA 4B67A 2XH2A 4BJYA 2C3DA 3V5CA 4YTMA 3PVCA 4DNAA 4CY8A 1ZXIC 3ZLFA 1K0IA 3HPFA 1GTHA 3UJSA 5J7XA 3U4FA 2YR4A 3VFCA 1FEBA 2YG3A 1FOHA 1PN0A 4Z1YA 1EL8A 2W3RA 2BS4A 3UOVA 2FBWA 3LZWA 5IQ1A 3CXOA 4FP1A 1L9EA 1SJCA 3ZLGA 4IA5A 3DIPA 1PBBA 2GB0A 4X4JA 1GV4A 2GR0A 4UDRA 4GCMA 3FBSA 1D7YA 3SFEA 4YTNA 4JN8A 1LQUA 3DA1A 3V76A 1BZLA 3GRSA 1PBDA 5ENLA 4G6GA 1KKRA 4BURA 4A3RA 3UTEA 4RG4A 4C5OA 3NYFA 5IQ4A 2DW6A 5TR3A 3OZYA 3AE2A 1IUWA 2XH7A 1ELSA 3GD6A 7ENLA 2CHRA 4JY2A 1CBOA 1BF3A 3SN0A 4PABA 4DHGA 3M0OA 1COYA 4J36A 2HZGA 1YKJA 2GAGB 4M52A 2PU1A 3TOYA 3UJRA 5BUKA 5J60A 2BRAA 1LTXR 5KMPA 2PTZA 3KLJA 4H7UA 1NAAA 2XFNA 3N4FA 3UGVA 4JNQA 1O95A 1XPQA 2E5AA 4HCDA 5U63A 4HCHA 1FFVC 2BCGG 1IUSA 3MY9A 2PCEA 3I6DA 5JCKA 2OZTA 3AE8A 1V59A 2JB3A 3D8XA 1LQTA 2WPFA 4TM1A 3P0WA 2BS2A 5L46A 2CDUA 4AP3A 3NVYB 3H8IA 3NIXA 3OC4A 1FIQB 2JB1A 4H4RA 3LZXA 4C77A 3SSZA 3GWDA 1TYPA 1OJDA 3HYWA 4YWSA 3NNEA 2B9XA 1TDOA 1EC7A 3RRAA 4A35A 5HHFA 4U8IA 1FECA 2ZZBA 1R0MA 2WOVA 1PXAA 3NXLA 3Q4DA 3B6DA 2YG5A 3GYIA 4K8GA 3DFYA 4NTDA 3THUA 3Q6JA 2BK3A 2AAQA 2GRTA 3UKKA 3AYJA 3DGHA 1LVLA 4M0XA 1ELIA 1VG9A 4JQ9A 3KVEA 4K5SA 4RSLA 1EL5A 1O5WA 5KVIA 4G6HA 4IT1A 5C2TA 2XGZA 3HYVA 3K7QX 2WS3A 3EANA 3GYXA 3QVRA 3DDMA 3G5RA 4U8OA 5JRBA 3AEAA 3DG7A 3C4AA 3EAOA 2GH5A 1CHUA 3K1GA 4OCGA 3RR1A 4UDPA 1DTNA 4NTEA 2P88A 3CNTA 3E1TA 4YTPA 4H4XA 4EQRA 3BHKA 3Q9TA 4U2SA 4CRTA 3TW9A 4B64A 2OLAA 3A7UA 4U2LA 5LV9A 3CB3A 2XVIA 3AB1A 3CYJA 4CY6A 3ALLA 2HQMA 3AD8B 1NPXA 3AD9B 1TDNA 4HCLA 5KVHA 3ES8A 1SB3B 1IJHA 3CGDA 4GGHA 1STZA 3KUMA 1NHQA 3ABVA 3T4WA 2PA6A 2ACZA 4USRA 1M6IA 3RO6A 1R6WA 2BACA 1ZDLA 2OG9A 3DGBA 3VC5A 4U8JA 1NHRA 5IPYA 4UDQA 4JNAA 2ZZCA 3OP2A 4OVIA 3T8QA 3TWAA 5FJTA 3K30A 4GAPA 1NG3A 1KCZA 1L8PA 1N5WC 4H4SA
chains in the Genus database with same CATH topology
3NN6X 2JBVA 1CC2A 3C96A 3GDPA 1PBEA 4N9XA 1DNCA 4CBQA 2OLOA 1N4VA 1KNRA 2E1MA 4II3A 1H82A 1OJAA 2OLNA 3ZYXA 2GF3A 3AEGA 3CNSA 5KNLA 5KXJA 1CJCA 3P1WA 1NDAA 4E0VA 2XYOA 3FPZA 3GMBA 4DSGA 4LA1A 3GDNA 3P4PA 3QVPA 2I0ZA 4TM0A 3CTYA 3NK2X 3DK4A 3UKHA 3VRAA 3NYCA 4H2PA 1E1NA 1JRXA 4EQXA 4EMJA 1GRHA 1VG0A 5KOXA 3UP5A 4H4TA 4EIPA 3DJGX 5ER0A 3GSIA 3AE9A 1S7MA 3ICSA 2V3AA 3ALMA 3NGCX 1L9CA 1DJNA 4A5LA 1AOGA 1DOEA 3AWIA 1QO8A 1XHCA 4GR1A 3H8LA 1SEZA 5FS9A 1N4UA 4YKFA 4Z24A 5JCMA 1BWCA 4J2WA 1GRAA 1OJCA 4BJZA 1ZK7A 2WU2A 3UTFA 3F8DA 2Q6UA 3CNDA 4IV9A 1GXFA 2VVLG 1ZOVA 2GMJA 2X99A 1JU2A 2X8HA 5KWFA 3SYIA 1MXTA 3R9UA 2C70A 1N1PA 3KU9A 1GALA 1Z6LA 2C7GA 4Z2RA 3NN0X 4H4UA 4K5RA 2QA1A 4OPCA 4YKGA 2B7SA 2APGA 2YWLA 2Q7VA 4Y4NA 2IVDA 3D1CA 1GRBA 3BNUA 1Q1WA 5KMQA 4Z26A 1B37A 2VQ7A 4ADWA 4EMWA 1L9DA 3G5SA 5GRTA 2V5ZA 4J33A 4B69A 3P4SA 2YVJA 3SZCA 2Z5YA 5FS7A 3QJ4A 4EM4A 1QLBA 4U8MA 1ONFA 3AEEA 1H86A 2YVFA 4BK2A 3GYJA 1E7PA 3AEFA 3WE0A 1DODA 4HA6A 4Z43A 4LU6A 1CJ2A 5KMSA 3DJJA 4D03A 1ZMDA 3ICTA 4Z44A 1VDCA 2B9WA 1D4DA 3RNMA 2GR1A 1F8SA 3DMEA 4NZHA 5U25A 3UTGA 2EQ7A 2C73A 2VVMA 3NG7X 4IA6A 2YR5A 3KPKA 1ZKQA 2X50A 5KRQA 1QJDA 1ZOYA 4NEVA 2J3NA 3QSSA 2C65A 3SGLA 2JK6A 3H4KA 1GREA 2EQ9A 2VOUA 4B67A 1MO9A 4G74A 4IVMB 4EQSA 1PS9A 4REKA 4BJYA 2C3DA 4ECHA 1H84A 4YTMA 2RGJA 1NEKA 3S5WA 3SFDA 3UKPA 3PVCA 1GT8A 4DNAA 4K2XA 1KFYA 4OPIA 3K7TA 4CY8A 2R0GA 1KN0A 3IF9A 3NK1X 4B1BA 4CNKA 3G5QA 3FG2P 1RP0A 2Y6RA 1K0IA 2YG6A 3ICRA 2R0PA 2VQBA 1GTHA 5J7XA 3AECA 2NVKX 2YR4A 1FEBA 1PXBA 4JDRA 4JN9A 4GDPA 4U8PA 3T31A 1YQ3A 2WP9A 1VRQB 1FOHA 2YG3A 3M13A 4RG3A 4YSYA 3FIMB 1PN0A 3QFBA 1EL8A 2BC1A 3IWAA 2YVGA 1D4CA 2BS4A 4K7ZA 4YSXA 1XANA 4OPDA 3B3RA 4K22A 3NRNA 4OPGA 3CGCA 1Q9IA 3UOVA 4DSHA 2FBWA 3LZWA 2ARDA 3SZWA 2WQYA 1E1LA 5IQ1A 4A79A 3DJDA 1NENA 3NTDA 1L9EA 3LOVA 2WESA 2WP6A 1KF6A 4A99A 4B66A 4IA5A 3DH9A 3L1RA 2WPEA 1PBBA 1IUTA 1YQ4A 2GB0A 3ITJA 3LADA 4GF7A 4X4JA 3P4RA 1GV4A 2GR0A 1EL7A 2BRYA 2WHDA 3BI5A 4GCMA 4UDRA 4B63A 2AR8A 1GRFA 1UKVG 3EPTA 3FBSA 1P2EA 2YM1A 3PG6A 3V3OA 1D7YA 4XWRA 3EF6A 3SFEA 4YTNA 4EIQA 1CC4A 1PBCA 1PJ6A 3HZLA 2YAUA 1LV0A 5HXIA 1LQUA 1E1MA 3UOXA 3REDA 2RGOA 3DA1A 3OZ2A 4P9SA 3V76A 3LXDA 1BZLA 3GRSA 1PBDA 2QA2A 3AE5A 4A9WA 3LB8A 2VRMA 4G6GA 5FMHA 2GVCA 2DKIA 2CULA 4BURA 2R9ZA 2YM2A 3GD3A 2XFPA 3UTEA 4RG4A 3D9XA 1RSGA 4C5OA 3DK8A 1E1KA 3NYFA 5EB5A 3SX6A 4DGKA 5IQ4A 5KOWA 4H4YA 2QAEA 3FMWA 5TR3A 3IHMA 2PYXA 3AE2A 1F8WA 5GSNA 1IUXA 3KA7A 3V3NA 3GD4A 1IUWA 2YLZA 3AE7A 1H81A 3JSKA 1H7WA 1GSNA 2C67A 4FK1C 2C76A 3CPIG 2RGHA 4AP1A 4A65A 1Y56B 4BK1A 3T2ZA 4G9KA 2XLRA 4JY2A 3T2YA 3UKQA 5BRTA 1CBOA 4H4VA 4I59A 1BF3A 4PABA 1S3EA 3M0OA 1COYA 4J36A 3IC9A 1H7XA 1YKJA 1GRTA 2GAGB 4M52A 1TRBA 2OAMA 2XVHA 3UOYA 1CL0A 4J34A 1D7LA 1IUVA 5BUKA 1TYTA 4WCTA 2X8CA 4XWZA 2C75A 5J60A 2BRAA 4FX9A 1LTXR 3CNJA 4OPUA 2XFOA 5JCLA 2XVJA 3I3LA 1PXCA 5KMPA 2XDOA 3F8RA 3ADAB 1NHPA 1L0VA 4FDCB 3KLJA 4H7UA 2YG7A 1JEHA 4YT0A 1NG4A 2NPXA 4NTCA 2WP5A 4U8LA 3K7MX 1FCDA 3DK9A 1NAAA 2XFNA 3RP6A 1D4EA 2BCPA 1GETA 5FS8A 1F6MA 5JCIA 4C3XA 2BXRA 4JNQA 1O95A 2GMHA 5KMRA 1TDEA 1H2IA 5EOWA 4ZCDA 1XPQA 1DJQA 5U63A 3QSMA 2BCGG 2H88A 2GAHB 3AYLA 1IUSA 2E4GA 4EMIA 2FJAA 4Z2TA 1GEUA 2V3BA 3VRDB 2C4CA 1REOA 1NHSA 3F8PA 1YY5A 3C4NA 4O5UA 5FS6A 3GRTA 2GV8A 1ZMCA 4KPRA 5JCKA 2JKCA 3AE8A 1ZP0A 1V59A 3I6DA 4TLZA 2JB3A 2V60A 3D8XA 1LQTA 2WPFA 1YQZA 2A89A 4TM1A 5DBJA 1ZX9A 3AD7B 4ZCCA 4NEWA 3RP7A 2BS2A 5L46A 4C3YA 1VQWA 3DGZA 4IVOB 1KDGA 2CDUA 4AP3A 4B65A 5M0ZA 1BKWA 3AEDA 2FJBA 3H8IA 3NIXA 1GPEA 4Z25A 3OC4A 4EM3A 3UKFA 3COXA 2XLUA 4AT0A 4YXDA 1GOSA 4O5QA 4II2A 3DJEA 3ZDNA 2JB1A 2C72A 2WEUA 3NH3X 2BYBA 4H4RA 2YLRA 4TLXA 3LZXA 3T0KA 3UP4A 4YSHA 3BNMA 4C77A 1KNPA 2W0HA 4WX1A 2R45A 2CFYA 3P4QA 3GWDA 1TYPA 1PJ5A 4A6NB 1S3BA 3UCLA 2WDRA 1OJDA 3SY4A 2C66A 1HYUA 3LJPA 3HYWA 2YG4A 3QSEA 3CNPA 3CN8A 1GERA 1LPFA 3IHGA 1K0JA 4USQA 3KD9A 1KSSA 2WDVA 2F5ZA 2FJEA 2B76A 3NNEA 2B9XA 4TM3A 4A6NA 4X9NA 1TDOA 3BHFA 2XVEA 1BGJA 1CC6A 4H2QA 3ATRA 1E39A 1E6EA 4I58A 1OJ9A 2WOWA 3PO7A 5EBKA 3M12A 3UKLA 4Z2UA 2XLTA 5HHFA 2B9YA 2Q0LA 4XXGA 3AXBA 1KSUA 4U8IA 1FECA 4BV6A 3T14A 3AE3A 2C3CA 3ATQA 2YLTA 2ZZBA 3AE1A 3CPHG 4A7AA 2VVLA 2WOVA 5U1OA 4B68A 1JRYA 3BI4A 1PXAA 3SZ0A 2OALA 4J56A 3AE4A 1DOBA 1FEAA 4H2RA 2GR3A 1JRZA 3NKSA 3B6DA 1B8SA 2YG5A 3GYIA 2DKHA 3UOZA 4TM4A 3AEBA 3RP8A 2TPRA 4NTDA 1D5TA 3Q6JA 2WPCA 4JY3A 5BVAA 4APNA 5HY5A 2BK3A 2AAQA 2GRTA 2R0CA 3UKKA 5EB4A 2WDQA 3DGHA 3AYJA 3RHAA 1TDFA 1LVLA 2OA1A 3NK0X 2VRLA 4AOSA 1ELIA 4H4WA 1O94A 4BK3A 1VG9A 4JQ9A 1Q1RA 1JNRA 2UZZA 3KVEA 4K5SA 4NWZA 4ZN0A 4GUVA 2YLSA 2XCGA 4NNJA 4RSLA 1EL5A 1XDIA 2Q0KA 1O5WA 3CGEA 5KVIA 3VQRA 3P9UA 4C74A 2C64A 4G6HA 3NYEA 3KKJA 5C2TA 1Y0PA 3URHA 4YWOA 3HYVA 3K7QX 2WS3A 1CJ3A 3EANA 3GYXA 3QVRA 3NTAA 3G5RA 3HYXA 4U8OA 4YSZA 5JRBA 3AEAA 2EQ6A 2TMDA 1K4QA 4FK1A 5HYMA 2V6OA 4K8DA 1ZY8A 2BS3A 4X9MA 1FL2A 3NT6A 2EQ8A 2YLXA 5C3JA 3C4AA 3EAOA 1JNZA 3BI2A 2GH5A 1CHUA 1B4VA 2IIDA 2XLSA 1F3PA 4AT2A 1F8RA 4G73A 1Y56A 4H4QA 4H2NA 1CJ4A 1W4XA 1GRGA 2Y6QA 4KX6A 4OCGA 1GNDA 4LIIA 1EBDA 1PJ7A 4UDPA 2GR2A 3SQPA 1S2QA 4U2TA 2GQWA 2BC0A 2IVEA 4NTEA 3E1TA 3CNTA 4YTPA 2YQUA 2ZZ0A 4H4XA 4EQRA 1EL9A 3SM8A 4D04A 4GDEA 1DOCA 3BHKA 3S61A 3Q9TA 4U2SA 4CNJA 4OPLA 1P2HA 2JAEA 3ALJA 2CVJA 4CRTA 2WOIA 1PDHA 2Z5XA 5BULA 1M64A 1JOAA 4HB9A 5CQFA 2B7RA 4B64A 1K0LA 1DXLA 1S2YA 3L8KA 2H89A 4UP3A 2XLPA 1GESA 3VRBA 4U2LA 2X8GA 5LV9A 2A8XA 2XVIA 4MJWA 3AB1A 3ISHA 2BK5A 2V61A 5JCNA 3VR8A 4CY6A 3UTHA 3QFAA 2BABA 1GTEA 1H6VA 3ALLA 4Y4LA 3II4A 2HQMA 3AD8B 1NPXA 3AD9B 1TDNA 5KVHA 4ICYA 1PBFA 3UKAA 1BGNA 4Y4MA 5M10A 2WETA 2WBAA 1IJHA 3CGDA 4H4PA 1TDKA 5CKUA 4J31A 2FJDA 1MOKA 1NHQA 3ABVA 1LJ1A 1RYIA 4GRTA 2XFQA 1B5QA 1OJTA 2YLWA 1PHHA 3CPJG 2YR6A 2ACZA 4CCQA 4USRA 3NHOX 3AYIA 3O0HA 2BK4A 4U8KA 4U8NA 2A87A 1M6IA 1H83A 2GEWA 3PS9A 4GAVA 2BACA 3T2KA 1ZDLA 4PAAA 2AQJA 2QCUA 2O9ZA 3AE6A 1X31B 2R46A 2R4EA 1CF3A 2R4JA 2PHHA 2BA9A 2E5VA 4U8JA 1IUUA 3GMCA 3GWFA 2X3NA 2XVFA 1NHRA 4AOXA 2XFUA 2GQFA 2VZ2A 4J57A 5IPYA 4UDQA 3L5OA 2ZZCA 4JNAA 4OVIA 2ZBWA 3VR9A 2BXSA 3NLCA 4EQWA 3CMMA 2WU5A 1NG3A 3K30A 4GAPA 4OPTA 3SXIA 3SZFA 3CGBA 4CCRA 2RABA 4H4ZA 3T37A 3KPFA 4H50A 4H4SA 3CIRA 1N4WA 2JB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NN6 X;  2JBV A;  1CC2 A;  3C96 A;  3GDP A;  1PBE A;  4N9X A;  1DNC A;  4CBQ A;  2OLO A;  1N4V A;  1KNR A;  2E1M A;  1H82 A;  1OJA A;  2OLN A;  3ZYX A;  2GF3 A;  3AEG A;  3CNS A;  5KXJ A;  1CJC A;  3P1W A;  1NDA A;  4E0V A;  2XYO A;  3FPZ A;  3GMB A;  4DSG A;  4LA1 A;  3GDN A;  3P4P A;  3QVP A;  2I0Z A;  4TM0 A;  3CTY A;  3NK2 X;  3DK4 A;  3UKH A;  3VRA A;  3NYC A;  4H2P A;  1E1N A;  1JRX A;  4EQX A;  4EMJ A;  1GRH A;  1VG0 A;  5KOX A;  3UP5 A;  4H4T A;  4EIP A;  3DJG X;  5ER0 A;  3GSI A;  3AE9 A;  3ICS A;  2V3A A;  3ALM A;  3NGC X;  1L9C A;  1DJN A;  4A5L A;  1AOG A;  1DOE A;  3AWI A;  1QO8 A;  1XHC A;  4GR1 A;  3H8L A;  1SEZ A;  5FS9 A;  1N4U A;  4YKF A;  4Z24 A;  5JCM A;  1BWC A;  4J2W A;  1GRA A;  1OJC A;  4BJZ A;  1ZK7 A;  2WU2 A;  3UTF A;  3F8D A;  2Q6U A;  3CND A;  4IV9 A;  1GXF A;  2VVL G;  1ZOV A;  2GMJ A;  2X99 A;  1JU2 A;  2X8H A;  5KWF A;  1MXT A;  3R9U A;  2C70 A;  1N1P A;  3KU9 A;  1GAL A;  1Z6L A;  2C7G A;  4Z2R A;  3NN0 X;  4H4U A;  4K5R A;  2QA1 A;  4OPC A;  4YKG A;  2B7S A;  2APG A;  2YWL A;  2Q7V A;  4Y4N A;  2IVD A;  3D1C A;  1GRB A;  3BNU A;  1Q1W A;  4Z26 A;  1B37 A;  2VQ7 A;  4ADW A;  4EMW A;  1L9D A;  3G5S A;  5GRT A;  2V5Z A;  4J33 A;  4B69 A;  3P4S A;  2YVJ A;  2Z5Y A;  5FS7 A;  3QJ4 A;  4EM4 A;  1QLB A;  4U8M A;  1ONF A;  3AEE A;  1H86 A;  2YVF A;  4BK2 A;  3GYJ A;  1E7P A;  3AEF A;  3WE0 A;  1DOD A;  4HA6 A;  4Z43 A;  4LU6 A;  1CJ2 A;  3DJJ A;  4D03 A;  1ZMD A;  3ICT A;  4Z44 A;  1VDC A;  2B9W A;  1D4D A;  3RNM A;  2GR1 A;  1F8S A;  3DME A;  4NZH A;  5U25 A;  3UTG A;  2EQ7 A;  2C73 A;  2VVM A;  3NG7 X;  4IA6 A;  2YR5 A;  1ZKQ A;  2X50 A;  5KRQ A;  1QJD A;  1ZOY A;  4NEV A;  2J3N A;  3QSS A;  2C65 A;  3SGL A;  2JK6 A;  3H4K A;  1GRE A;  2EQ9 A;  2VOU A;  4B67 A;  1MO9 A;  4IVM B;  4EQS A;  1PS9 A;  4REK A;  4BJY A;  2C3D A;  4ECH A;  1H84 A;  4YTM A;  2RGJ A;  1NEK A;  3S5W A;  3SFD A;  3UKP A;  3PVC A;  1GT8 A;  4DNA A;  4K2X A;  1KFY A;  4OPI A;  3K7T A;  4CY8 A;  2R0G A;  3IF9 A;  3NK1 X;  4B1B A;  4CNK A;  3G5Q A;  3FG2 P;  1RP0 A;  2Y6R A;  1K0I A;  2YG6 A;  3ICR A;  2R0P A;  2VQB A;  1GTH A;  5J7X A;  3AEC A;  2NVK X;  2YR4 A;  1FEB A;  1PXB A;  4JDR A;  4JN9 A;  4GDP A;  4U8P A;  1YQ3 A;  2WP9 A;  1VRQ B;  1FOH A;  2YG3 A;  3M13 A;  4RG3 A;  4YSY A;  3FIM B;  1PN0 A;  3QFB A;  1EL8 A;  2BC1 A;  3IWA A;  2YVG A;  1D4C A;  2BS4 A;  4K7Z A;  4YSX A;  1XAN A;  4OPD A;  3B3R A;  4K22 A;  3NRN A;  4OPG A;  3CGC A;  1Q9I A;  3UOV A;  4DSH A;  2FBW A;  3LZW A;  2ARD A;  4A79 A;  2WQY A;  1E1L A;  5IQ1 A;  3DJD A;  1NEN A;  3NTD A;  1L9E A;  3LOV A;  2WES A;  2WP6 A;  1KF6 A;  4A99 A;  4B66 A;  4IA5 A;  3DH9 A;  3L1R A;  2WPE A;  1PBB A;  1IUT A;  1YQ4 A;  2GB0 A;  3ITJ A;  3LAD A;  4GF7 A;  4X4J A;  3P4R A;  1GV4 A;  2GR0 A;  1EL7 A;  2WHD A;  3BI5 A;  4GCM A;  4UDR A;  4B63 A;  2AR8 A;  1GRF A;  1UKV G;  3EPT A;  3FBS A;  1P2E A;  2YM1 A;  3V3O A;  1D7Y A;  4XWR A;  3EF6 A;  3SFE A;  4YTN A;  4EIQ A;  1CC4 A;  1PBC A;  1PJ6 A;  3HZL A;  2YAU A;  1LV0 A;  5HXI A;  1LQU A;  1E1M A;  3UOX A;  3RED A;  2RGO A;  3DA1 A;  3OZ2 A;  4P9S A;  3V76 A;  3LXD A;  1BZL A;  3GRS A;  1PBD A;  2QA2 A;  3AE5 A;  4A9W A;  3LB8 A;  2VRM A;  5FMH A;  2GVC A;  2DKI A;  2CUL A;  4BUR A;  2R9Z A;  2YM2 A;  3GD3 A;  2XFP A;  3UTE A;  4RG4 A;  1RSG A;  4C5O A;  3DK8 A;  1E1K A;  3NYF A;  5EB5 A;  4DGK A;  5IQ4 A;  5KOW A;  4H4Y A;  2QAE A;  3FMW A;  5TR3 A;  3IHM A;  2PYX A;  3AE2 A;  1F8W A;  5GSN A;  1IUX A;  3KA7 A;  3V3N A;  3GD4 A;  1IUW A;  2YLZ A;  3AE7 A;  1H81 A;  3JSK A;  1H7W A;  1GSN A;  2C67 A;  4FK1 C;  2C76 A;  3CPI G;  2RGH A;  4AP1 A;  4A65 A;  1Y56 B;  4BK1 A;  2XLR A;  4JY2 A;  3UKQ A;  5BRT A;  1CBO A;  4H4V A;  4I59 A;  1BF3 A;  4PAB A;  1S3E A;  3M0O A;  1COY A;  4J36 A;  3IC9 A;  1H7X A;  1YKJ A;  1GRT A;  2GAG B;  4M52 A;  1TRB A;  2OAM A;  2XVH A;  3UOY A;  1CL0 A;  4J34 A;  1D7L A;  1IUV A;  5BUK A;  1TYT A;  4WCT A;  2X8C A;  4XWZ A;  2C75 A;  5J60 A;  4FX9 A;  1LTX R;  3CNJ A;  4OPU A;  2XFO A;  5JCL A;  2XVJ A;  3I3L A;  1PXC A;  2XDO A;  3F8R A;  3ADA B;  1NHP A;  1L0V A;  4FDC B;  3KLJ A;  4H7U A;  2YG7 A;  1JEH A;  4YT0 A;  1NG4 A;  2NPX A;  4NTC A;  2WP5 A;  4U8L A;  3K7M X;  1FCD A;  3DK9 A;  1NAA A;  2XFN A;  3RP6 A;  1D4E A;  2BCP A;  1GET A;  5FS8 A;  1F6M A;  5JCI A;  4C3X A;  2BXR A;  4JNQ A;  1O95 A;  2GMH A;  1TDE A;  4ZCD A;  5EOW A;  1XPQ A;  1DJQ A;  5U63 A;  3QSM A;  2BCG G;  2H88 A;  2GAH B;  3AYL A;  1IUS A;  2E4G A;  4EMI A;  2FJA A;  4Z2T A;  1GEU A;  2V3B A;  3VRD B;  1REO A;  1NHS A;  3F8P A;  1YY5 A;  3C4N A;  4O5U A;  5FS6 A;  3GRT A;  2GV8 A;  1ZMC A;  4KPR A;  5JCK A;  2JKC A;  3AE8 A;  1ZP0 A;  1V59 A;  3I6D A;  4TLZ A;  2JB3 A;  2V60 A;  3D8X A;  1LQT A;  2WPF A;  1YQZ A;  2A89 A;  4TM1 A;  5DBJ A;  1ZX9 A;  3AD7 B;  4ZCC A;  4NEW A;  3RP7 A;  2BS2 A;  5L46 A;  4C3Y A;  1VQW A;  3DGZ A;  4IVO B;  1KDG A;  2CDU A;  4AP3 A;  4B65 A;  5M0Z A;  1BKW A;  3AED A;  2FJB A;  3H8I A;  3NIX A;  1GPE A;  4Z25 A;  3OC4 A;  4EM3 A;  3UKF A;  3COX A;  2XLU A;  4AT0 A;  4YXD A;  1GOS A;  4O5Q A;  3ZDN A;  3DJE A;  2JB1 A;  2C72 A;  2WEU A;  3NH3 X;  2BYB A;  4H4R A;  2YLR A;  4TLX A;  3LZX A;  3UP4 A;  4YSH A;  3BNM A;  4C77 A;  1KNP A;  2W0H A;  4WX1 A;  2R45 A;  2CFY A;  3P4Q A;  3GWD A;  1TYP A;  1PJ5 A;  4A6N B;  1S3B A;  3UCL A;  2WDR A;  1OJD A;  2C66 A;  1HYU A;  3LJP A;  3QSE A;  2YG4 A;  3CNP A;  3CN8 A;  1GER A;  1LPF A;  3IHG A;  1K0J A;  4USQ A;  3KD9 A;  1KSS A;  2WDV A;  2F5Z A;  2FJE A;  2B76 A;  3NNE A;  2B9X A;  4TM3 A;  4A6N A;  4X9N A;  1TDO A;  3BHF A;  2XVE A;  1BGJ A;  1CC6 A;  4H2Q A;  3ATR A;  1E39 A;  1E6E A;  4I58 A;  1OJ9 A;  2WOW A;  3PO7 A;  5EBK A;  3M12 A;  3UKL A;  4Z2U A;  2XLT A;  5HHF A;  2B9Y A;  2Q0L A;  4XXG A;  3AXB A;  1KSU A;  4U8I A;  1FEC A;  4BV6 A;  3AE3 A;  2C3C A;  3ATQ A;  2YLT A;  2ZZB A;  3AE1 A;  3CPH G;  4A7A A;  2VVL A;  2WOV A;  5U1O A;  4B68 A;  1JRY A;  3BI4 A;  1PXA A;  2OAL A;  4J56 A;  3AE4 A;  1DOB A;  1FEA A;  4H2R A;  2GR3 A;  1JRZ A;  3NKS A;  3B6D A;  1B8S A;  2YG5 A;  3GYI A;  2DKH A;  3UOZ A;  4TM4 A;  3AEB A;  3RP8 A;  2TPR A;  4NTD A;  1D5T A;  3Q6J A;  2WPC A;  4JY3 A;  5BVA A;  4APN A;  5HY5 A;  2BK3 A;  2AAQ A;  2GRT A;  2R0C A;  3UKK A;  5EB4 A;  2WDQ A;  3DGH A;  3AYJ A;  3RHA A;  1TDF A;  1LVL A;  2OA1 A;  3NK0 X;  2VRL A;  4AOS A;  1ELI A;  4H4W A;  1O94 A;  4BK3 A;  1VG9 A;  4JQ9 A;  1Q1R A;  1JNR A;  2UZZ A;  3KVE A;  4K5S A;  4ZN0 A;  4GUV A;  2YLS A;  2XCG A;  4RSL A;  1EL5 A;  1XDI A;  2Q0K A;  1O5W A;  3CGE A;  5KVI A;  3VQR A;  3P9U A;  4C74 A;  2C64 A;  3NYE A;  3KKJ A;  5C2T A;  1Y0P A;  3URH A;  4YWO A;  3K7Q X;  2WS3 A;  1CJ3 A;  3EAN A;  3QVR A;  3NTA A;  3G5R A;  4U8O A;  4YSZ A;  3AEA A;  2EQ6 A;  2TMD A;  1K4Q A;  4FK1 A;  5HYM A;  2V6O A;  4K8D A;  1ZY8 A;  2BS3 A;  4X9M A;  1FL2 A;  3NT6 A;  2EQ8 A;  2YLX A;  5C3J A;  3C4A A;  3EAO A;  1JNZ A;  3BI2 A;  2GH5 A;  1CHU A;  1B4V A;  2IID A;  2XLS A;  1F3P A;  4AT2 A;  1F8R A;  1Y56 A;  4H4Q A;  4H2N A;  1CJ4 A;  1W4X A;  1GRG A;  2Y6Q A;  4KX6 A;  4OCG A;  1GND A;  4LII A;  1EBD A;  1PJ7 A;  4UDP A;  2GR2 A;  3SQP A;  1S2Q A;  4U2T A;  2GQW A;  2BC0 A;  2IVE A;  4NTE A;  3E1T A;  3CNT A;  4YTP A;  2YQU A;  2ZZ0 A;  4H4X A;  4EQR A;  1EL9 A;  3SM8 A;  4D04 A;  4GDE A;  1DOC A;  3BHK A;  3S61 A;  3Q9T A;  4U2S A;  4CNJ A;  4OPL A;  1P2H A;  2JAE A;  3ALJ A;  2CVJ A;  4CRT A;  2WOI A;  1PDH A;  2Z5X A;  5BUL A;  1M64 A;  1JOA A;  4HB9 A;  5CQF A;  2B7R A;  4B64 A;  1K0L A;  1DXL A;  1S2Y A;  3L8K A;  2H89 A;  4UP3 A;  2XLP A;  1GES A;  3VRB A;  4U2L A;  2X8G A;  5LV9 A;  2A8X A;  2XVI A;  4MJW A;  3AB1 A;  3ISH A;  2BK5 A;  2V61 A;  5JCN A;  3VR8 A;  4CY6 A;  3UTH A;  3QFA A;  2BAB A;  1GTE A;  1H6V A;  3ALL A;  4Y4L A;  3II4 A;  2HQM A;  3AD8 B;  1NPX A;  3AD9 B;  1TDN A;  5KVH A;  4ICY A;  1PBF A;  3UKA A;  1BGN A;  4Y4M A;  5M10 A;  2WET A;  2WBA A;  1IJH A;  3CGD A;  4H4P A;  1TDK A;  5CKU A;  4J31 A;  2FJD A;  1MOK A;  1NHQ A;  3ABV A;  1LJ1 A;  1RYI A;  4GRT A;  2XFQ A;  1B5Q A;  1OJT A;  2YLW A;  1PHH A;  3CPJ G;  2YR6 A;  2ACZ A;  4CCQ A;  4USR A;  3NHO X;  3AYI A;  3O0H A;  2BK4 A;  4U8K A;  4U8N A;  2A87 A;  1M6I A;  1H83 A;  2GEW A;  3PS9 A;  2BAC A;  1ZDL A;  4PAA A;  2AQJ A;  2QCU A;  2O9Z A;  3AE6 A;  1X31 B;  2R46 A;  2R4E A;  1CF3 A;  2R4J A;  2PHH A;  2BA9 A;  2E5V A;  4U8J A;  1IUU A;  3GMC A;  3GWF A;  2X3N A;  2XVF A;  1NHR A;  4AOX A;  2XFU A;  2GQF A;  2VZ2 A;  4J57 A;  5IPY A;  4UDQ A;  4JNA A;  2ZZC A;  4OVI A;  2ZBW A;  3VR9 A;  2BXS A;  3NLC A;  4EQW A;  3K30 A;  2WU5 A;  1NG3 A;  4OPT A;  3CGB A;  4CCR A;  2RAB A;  4H4Z A;  3T37 A;  3KPF A;  4H50 A;  4H4S A;  3CIR A;  1N4W A;  2JB2 A; 
#chains in the Genus database with same CATH topology
 1CC2 A;  1H82 A;  3H7V A;  5KNL A;  1NDA A;  4E0V A;  5BOE A;  3FPZ A;  4LA1 A;  3GDN A;  2I0Z A;  3NK2 X;  3DK4 A;  1JRX A;  5KOX A;  1MRA A;  3DJG X;  4K1W A;  1DJN A;  3AWI A;  1QO8 A;  5JCM A;  1GRA A;  3STP A;  3FYY A;  3UTF A;  3R10 A;  4IV9 A;  2VVL G;  2GMJ A;  4IZG A;  3CXB A;  2GL5 A;  1JDF A;  4H4U A;  2QA1 A;  4YKG A;  5FJP A;  2P3Z A;  2Q7V A;  2IVD A;  4EWJ A;  3H70 A;  4ADW A;  2V5Z A;  3A7R A;  2QDE A;  4EM4 A;  3S47 A;  1ONF A;  4LU6 A;  3QLD A;  3EEZ A;  3UTG A;  4NZH A;  5U25 A;  2EQ7 A;  2VVM A;  3KPK A;  5KRQ A;  3HW2 A;  1QJD A;  2POZ A;  4IVM B;  3N4E A;  2RGJ A;  3SFD A;  3T6C A;  3ZVH A;  1GT8 A;  1KFY A;  4OPI A;  4IL2 A;  3P3B A;  3FG2 P;  2Y6R A;  2R0P A;  2VQB A;  2NVK X;  4DN1 A;  1PXB A;  4U8P A;  3T31 A;  2WP9 A;  3M13 A;  2PGW A;  4RG3 A;  3QFB A;  2OX4 A;  3TJI A;  4YSX A;  1XAN A;  4OPD A;  3B3R A;  4K22 A;  3NRN A;  3SZW A;  4B66 A;  1NEN A;  3NTD A;  3LOV A;  3ITJ A;  3LAD A;  1EL7 A;  2BRY A;  2XSX A;  2AR8 A;  2HNE A;  2POD A;  4JHM A;  1CC4 A;  2O56 A;  3UOX A;  3RED A;  3LXD A;  2FKP A;  2P0I A;  3NZG A;  3N6H A;  3LB8 A;  3ZVI A;  3VA8 A;  3GD3 A;  2XFP A;  2QQ6 A;  1E9I A;  3DK8 A;  4E4F A;  1E1K A;  3SX6 A;  4H4Y A;  3UJF A;  3AN1 A;  1TKK A;  5GSN A;  3V3N A;  3GD4 A;  5FJR A;  2YLZ A;  4FK1 C;  1H7W A;  2C76 A;  2RGH A;  3T2Y A;  3UKQ A;  4I59 A;  3UOY A;  1CL0 A;  3NFU A;  2OQH A;  4MKS A;  4FX9 A;  3CNJ A;  2XFO A;  4HNL A;  2XDO A;  3F8R A;  3ADA B;  2PTW A;  1L0V A;  2YG7 A;  4E5T A;  1NG4 A;  3K7M X;  1FCD A;  2BCP A;  5JCI A;  2BXR A;  2GMH A;  5G5H B;  4ZCD A;  1H2I A;  4FI4 A;  2FYM A;  1MNS A;  3ETR B;  4Z2T A;  2V3B A;  1T3Q C;  3VRD B;  2C4C A;  1REO A;  2HXT A;  1NHS A;  4TVY A;  3F8P A;  1YY5 A;  3C4N A;  1VDV A;  5FS6 A;  1ZMC A;  4KPR A;  1JCT A;  4IHC A;  4ZCC A;  4NEW A;  3NVW B;  1KDG A;  4B65 A;  5M0Z A;  1BKW A;  3AED A;  4EM3 A;  3ZDN A;  4II2 A;  3OZM A;  2C72 A;  2BYB A;  3T0K A;  3Q45 A;  2C66 A;  1HYU A;  3QSE A;  2W55 A;  3IHG A;  1K0J A;  1KSS A;  2F5Z A;  3BHF A;  2XVE A;  4H2Q A;  3I4K A;  1E39 A;  3ATR A;  5EBK A;  3UKL A;  1FO4 A;  4K2S A;  2B9Y A;  4ZCW A;  3AXB A;  3T14 A;  4DX3 A;  2VVL A;  3QPE A;  1BKH A;  2OAL A;  4J56 A;  1FEA A;  4DWD A;  3NKS A;  2DKH A;  2TPR A;  2OA1 A;  3NK0 X;  4BK3 A;  1Q1R A;  1JNR A;  4NWZ A;  3NRZ B;  2YLS A;  3OTR A;  4NNJ A;  4ROP A;  1XDI A;  3VCC A;  2Q0K A;  2W54 A;  2AL2 B;  3P9U A;  3KKJ A;  1TE6 A;  4YSZ A;  1K4Q A;  2V6O A;  4K8D A;  2GSH A;  1FL2 A;  2EQ8 A;  2YLX A;  4GIS A;  3R11 A;  2XLS A;  1F8R A;  1EC9 A;  1GRG A;  3AMZ A;  3SQP A;  1S2Q A;  2GQW A;  3ZLH A;  2YQU A;  4D04 A;  3B9J B;  3CK5 A;  4CNJ A;  1ECQ A;  5BUL A;  4HB9 A;  1MDL A;  3L8K A;  3VRB A;  2X8G A;  2A8X A;  3UCC A;  4MJW A;  3ISH A;  2V61 A;  3VR8 A;  2AL1 A;  1H6V A;  4Y4L A;  3II4 A;  4J1O A;  3QTP A;  4ICY A;  3T9P A;  1BGN A;  4Y4M A;  1MOK A;  4GRT A;  1B5Q A;  2YR6 A;  3NHO X;  4U8K A;  4U8N A;  1N63 C;  1H83 A;  3T2K A;  1X31 B;  4X2P A;  2BA9 A;  4J57 A;  3FJ4 A;  2HXU A;  2WU5 A;  3DEQ A;  1X2H A;  3CIR A;  4CBQ A;  4N9X A;  2E1M A;  4II3 A;  3AEG A;  5KXJ A;  3P1W A;  2XYO A;  2PSN A;  4DSG A;  3CTY A;  3UXK A;  3VRA A;  1FFU C;  1PDY A;  1VG0 A;  2PTX A;  5ER0 A;  3ICS A;  1L9C A;  4GR1 A;  1N4U A;  4KWS A;  4J2W A;  2ZC8 A;  3CND A;  1ZOV A;  4H2H A;  1JPM A;  2X8H A;  3SYI A;  1GAL A;  1Z6L A;  4K5R A;  4OPC A;  2B7S A;  2YWL A;  2PS2 A;  4Y4N A;  3TQP A;  1GRB A;  4Z26 A;  4MMW A;  3G5S A;  4J33 A;  3SZC A;  3SN4 A;  1H86 A;  3MZN A;  4BK2 A;  1DOD A;  4Z43 A;  3DJJ A;  4D03 A;  1ZMD A;  2B9W A;  1D4D A;  3RNM A;  1F8S A;  3DME A;  3NG7 X;  4IA6 A;  3R25 A;  2X50 A;  2PMQ A;  1ZOY A;  4NEV A;  3H4K A;  2EQ9 A;  2VOU A;  1MO9 A;  4REK A;  4ECH A;  1H84 A;  3S5W A;  3UKP A;  3N6J A;  4K2X A;  1KN0 A;  4ENL A;  2QDD A;  2YG6 A;  3DG3 A;  3ICR A;  3EUB 3;  4ZA0 A;  3TWB A;  4GDP A;  1YQ3 A;  1VRQ B;  4YSY A;  3FIM B;  3IWA A;  2YVG A;  1D4C A;  4K7Z A;  3CGC A;  3MSY A;  1Q9I A;  4DSH A;  3DJD A;  3VCN A;  1KF6 A;  4A99 A;  3DH9 A;  1YQ4 A;  4DXK A;  1IUT A;  4GF7 A;  2WHD A;  3EPT A;  1P2E A;  2YM1 A;  3PG6 A;  3EF6 A;  1PBC A;  2PP3 A;  1PJ6 A;  2PU0 A;  2GGG A;  2OPJ A;  2RGO A;  3PWG A;  3BJS A;  4A9W A;  2YM2 A;  4IP5 A;  1WYG A;  3D9X A;  5EB5 A;  3UJ2 A;  3FMW A;  2DW7 A;  1SJD A;  3IHM A;  1F8W A;  1IUX A;  2RDX A;  3KA7 A;  3JSK A;  3TJ4 A;  4A65 A;  3JZU A;  1Y56 B;  3T2Z A;  4G9K A;  4BK1 A;  5BRT A;  4H4V A;  1TRB A;  4J34 A;  1D7L A;  1IUV A;  1TYT A;  2X8C A;  4XWZ A;  2C75 A;  3RGT A;  1JPD X;  4OPU A;  1BQG A;  5JCL A;  2XVJ A;  3I3L A;  1PXC A;  1NHP A;  1JEH A;  4E6M A;  2ONE A;  4YT0 A;  4GYP A;  2WP5 A;  4U8L A;  3DK9 A;  3R07 C;  3RP6 A;  5FS8 A;  4H1Z A;  1F6M A;  1TDE A;  5EOW A;  3S5S A;  3QSM A;  2H88 A;  4KEM A;  3AYL A;  4TVW A;  4EMI A;  2FJA A;  2E3T A;  1GEU A;  4O5U A;  3GRT A;  2GV8 A;  2JKC A;  3PWI A;  1YQZ A;  2A89 A;  3PFR A;  1ZX9 A;  3AD7 B;  3RP7 A;  2ZAD A;  1XPY A;  4GME A;  3UKF A;  3COX A;  2XLU A;  1GOS A;  3DJE A;  3I6E A;  3NH3 X;  4YSH A;  2W0H A;  4WX1 A;  2R45 A;  2CFY A;  4A6N B;  1S3B A;  1WUF A;  3TCS A;  2WDR A;  2YG4 A;  3CNP A;  3CN8 A;  1GER A;  3KD9 A;  2WDV A;  1N62 C;  2FJE A;  4TM3 A;  4A6N A;  4X9N A;  3MKC A;  1SJA A;  2QJN A;  3RCY A;  1OJ9 A;  3PO7 A;  3MQT A;  3SBF A;  2XLT A;  3AE3 A;  1TZZ A;  2YLT A;  3AE1 A;  3ATQ A;  3CPH G;  4A7A A;  5G5G B;  1X2G A;  4B68 A;  1DOB A;  4GFI A;  1FHV A;  2GR3 A;  4H2R A;  1B8S A;  1P48 A;  4TM4 A;  3AEB A;  2QJM A;  4JY3 A;  2WPC A;  4APN A;  1XS2 A;  5HY5 A;  4ZOH B;  5EB4 A;  2WDQ A;  3RHA A;  2W3S A;  5EU9 A;  4AOS A;  4H4W A;  2UZZ A;  4GUV A;  2XCG A;  2AKZ A;  3CGE A;  3GY1 A;  3VQR A;  4C74 A;  3NYE A;  3V3W A;  4YWO A;  1CJ3 A;  3UXL A;  3HYX A;  2EQ6 A;  2TMD A;  1SJB A;  3JW7 A;  4X9M A;  5C3J A;  1JNZ A;  1B4V A;  4G73 A;  1Y56 A;  3CT2 A;  4H2N A;  1CJ4 A;  4KX6 A;  1GND A;  2GR2 A;  4E8G A;  2BC0 A;  2IVE A;  2ZZ0 A;  3SM8 A;  3FXG A;  1DOC A;  3S61 A;  4OPL A;  3ALJ A;  1PDH A;  4HNC A;  2Z5X A;  2GGI A;  1JOA A;  3OPS A;  1K0L A;  1DXL A;  1S2Y A;  2H89 A;  4UP3 A;  1GES A;  2PTY A;  4A6G A;  2BK5 A;  1GTE A;  6ENL A;  3FVD A;  2WBA A;  3VDG A;  3SN1 A;  4H4P A;  1WUE A;  1TDK A;  5CKU A;  4J31 A;  2FJD A;  2XFQ A;  2YLW A;  3IJQ A;  1PHH A;  4CCQ A;  2A87 A;  2GEW A;  2AQJ A;  2QCU A;  3AE6 A;  2R46 A;  1CF3 A;  2R4J A;  2PHH A;  2E5V A;  3SJN A;  2X3N A;  2XVF A;  3P93 A;  2ZBW A;  3VR9 A;  4EQW A;  3SZF A;  4OPT A;  3R0U A;  2QGY A;  4CCR A;  3T37 A;  1P43 A;  1OEP A;  3DG6 A;  2JB2 A;  3NN6 X;  2JBV A;  3C96 A;  3GDP A;  1KNR A;  1OJA A;  1EBG A;  2OLN A;  1CJC A;  2PGE A;  3NO1 A;  3P4P A;  3QVP A;  4TM0 A;  1V97 A;  3NYC A;  4IP4 A;  4H2P A;  3RIT A;  4EMJ A;  1GRH A;  3UP5 A;  4H4T A;  4EIP A;  3GSI A;  1ONE A;  1S7M A;  2V3A A;  3NGC X;  4A5L A;  1AOG A;  1XHC A;  3DER A;  4YKF A;  4Z24 A;  3TTE A;  1IYX A;  1OJC A;  4BJZ A;  1ZK7 A;  1JU2 A;  4KT2 A;  5KWF A;  1MXT A;  2C70 A;  1N1P A;  3NN0 X;  3R0K A;  3IJL A;  3FV9 A;  3D1C A;  3BNU A;  1MUC A;  2VQ7 A;  3QKE A;  5GRT A;  4B69 A;  3P4S A;  2YVJ A;  3QJ4 A;  5FS7 A;  4U8M A;  1QLB A;  2YVF A;  5FJO A;  3UCD A;  4M6U A;  1E7P A;  3AEF A;  3WE0 A;  4HA6 A;  1CJ2 A;  3ICT A;  4Z44 A;  1VDC A;  3UJE A;  3DFH A;  2GR1 A;  4DYE A;  2YR5 A;  1EBH A;  1ZKQ A;  2J3N A;  3QSS A;  1W6T A;  3IK4 A;  4G74 A;  4EQS A;  3BSM A;  1PS9 A;  1NEK A;  3FCP A;  3K7T A;  2R0G A;  3IF9 A;  3NK1 X;  4B1B A;  4CNK A;  3G5Q A;  1N60 C;  1RP0 A;  3AEC A;  3V5F A;  4JN9 A;  4JDR A;  1RVK A;  3R1Z A;  2BC1 A;  4OPG A;  3U9I A;  4A79 A;  2ARD A;  2WQY A;  1E1L A;  2OQY A;  2WES A;  2WP6 A;  3L1R A;  2MNR A;  2WPE A;  4KPL A;  3P4R A;  4B63 A;  2NQL A;  3BI5 A;  1GRF A;  1UKV G;  3V3O A;  4XWR A;  4EIQ A;  2PP1 A;  3HZL A;  2YAU A;  1LV0 A;  5HXI A;  2P8C A;  4GYP C;  1E1M A;  3OZ2 A;  4P9S A;  2QA2 A;  3AE5 A;  2VRM A;  5FMH A;  2GVC A;  2DKI A;  2CUL A;  2R9Z A;  1NEL A;  1RSG A;  3NVZ B;  4DGK A;  5KOW A;  2QAE A;  5IDZ A;  2PYX A;  4JN7 A;  3NVV B;  2AKM A;  3AE7 A;  3UKA A;  1H81 A;  2C67 A;  1GSN A;  5J04 A;  3CPI G;  3H8A A;  4AP1 A;  2XLR A;  3V4B A;  1S3E A;  3IC9 A;  1H7X A;  2OAM A;  1GRT A;  2XVH A;  4WCT A;  3A7A A;  5FJU A;  3CAW A;  4FDC B;  2NPX A;  4H19 A;  4NTC A;  1D4E A;  1GET A;  4E4U A;  4C3X A;  5KMR A;  3SR6 B;  3NS1 B;  1DJQ A;  5BOF A;  4G7F A;  2P8B A;  2GAH B;  2E4G A;  3AM9 A;  2OFJ A;  1ZP0 A;  4TLZ A;  4J3Z A;  2V60 A;  5DBJ A;  2I5Q A;  2GGH A;  4C3Y A;  4F4R A;  1VQW A;  3DGZ A;  4IVO B;  4IL0 A;  1NU5 A;  2FJB A;  1GPE A;  4Z25 A;  3D47 A;  4YXD A;  4AT0 A;  2GGE A;  4O5Q A;  2OO6 A;  2WEU A;  4TLX A;  2YLR A;  3UP4 A;  3BNM A;  1KNP A;  3P4Q A;  1MDR A;  1PJ5 A;  3B97 A;  3UCL A;  3SY4 A;  3LJP A;  1LPF A;  4USQ A;  2B76 A;  1BGJ A;  1CC6 A;  1E6E A;  4I58 A;  2GDQ A;  2WOW A;  3ES7 A;  3M12 A;  4Z2U A;  2Q0L A;  3GC2 A;  4XXG A;  1KSU A;  4BV6 A;  3GO2 A;  2C3C A;  5U1O A;  1JRY A;  3BI4 A;  3SZ0 A;  3AE4 A;  2OZ8 A;  3I6T A;  3MUC A;  4HPN A;  1JRZ A;  3OW1 A;  3UOZ A;  3RP8 A;  3ENL A;  1D5T A;  5BVA A;  2R0C A;  3IJI A;  2VRL A;  1O94 A;  3JVA A;  4ZN0 A;  4MGG A;  1EC8 A;  3BOX A;  2C64 A;  3H12 A;  1Y0P A;  3URH A;  1RM6 B;  3NTA A;  4FK1 A;  5HYM A;  2BS3 A;  1ZY8 A;  2PPG A;  3NT6 A;  3BI2 A;  2XH4 A;  2IID A;  1F3P A;  4AT2 A;  4H4Q A;  1W4X A;  3EKG A;  2Y6Q A;  4LII A;  1EBD A;  1PJ7 A;  4U2T A;  1EL9 A;  1FHU A;  4GDE A;  2MUC A;  1P2H A;  2JAE A;  2CVJ A;  4H83 A;  2WOI A;  1M64 A;  5CQF A;  2B7R A;  2XLP A;  5JCN A;  3UTH A;  3QFA A;  4HN8 A;  2BAB A;  4GGB A;  1PBF A;  5M10 A;  2WET A;  2QVH A;  1N5X A;  1LJ1 A;  1RYI A;  1OJT A;  3CPJ G;  1JRP A;  3AYI A;  3O0H A;  2BK4 A;  3SQS A;  3PS9 A;  4GAV A;  2PP0 A;  4PAA A;  2O9Z A;  2R4E A;  3QN3 A;  1IUU A;  3GMC A;  3GWF A;  2AL2 A;  3ZVH B;  4AOX A;  2XFU A;  2GQF A;  2VZ2 A;  4Z17 A;  3L5O A;  2OKT A;  1YEY A;  2BXS A;  3NLC A;  3CMM A;  3SXI A;  3CGB A;  2RAB A;  4H4Z A;  3KPF A;  4H50 A;  1F9C A;  3MWC A;  1TDF A;  1N4W A;  1KD0 A;  1PBE A;  1DNC A;  2OLO A;  1N4V A;  3PK7 A;  3ZYX A;  2GF3 A;  3CNS A;  1VQZ A;  3HRD C;  2GGJ A;  3GMB A;  3UKH A;  1E1N A;  1KKO A;  4EQX A;  1PDZ A;  3AE9 A;  3ALM A;  1DOE A;  2QJJ A;  3H8L A;  1SEZ A;  5FS9 A;  3D46 A;  1BWC A;  2WU2 A;  3F8D A;  2Q6U A;  1GXF A;  2X99 A;  1N61 C;  3R9U A;  3KU9 A;  1JRO A;  2C7G A;  4Z2R A;  2APG A;  1Q1W A;  4GIR A;  5KMQ A;  1B37 A;  2OVL A;  4EMW A;  1L9D A;  2Z5Y A;  3AEE A;  4G8T A;  3VC6 A;  2OZ3 A;  3GYJ A;  5KMS A;  2XH0 A;  3DES A;  2C73 A;  4HYR A;  2C65 A;  3SGL A;  2JK6 A;  1GRE A;  4B67 A;  2XH2 A;  4BJY A;  2C3D A;  3V5C A;  4YTM A;  3PVC A;  4DNA A;  4CY8 A;  1ZXI C;  3ZLF A;  1K0I A;  3HPF A;  1GTH A;  3UJS A;  5J7X A;  3U4F A;  2YR4 A;  3VFC A;  1FEB A;  2YG3 A;  1FOH A;  1PN0 A;  4Z1Y A;  1EL8 A;  2W3R A;  2BS4 A;  3UOV A;  2FBW A;  3LZW A;  5IQ1 A;  3CXO A;  4FP1 A;  1L9E A;  1SJC A;  3ZLG A;  4IA5 A;  3DIP A;  1PBB A;  2GB0 A;  4X4J A;  1GV4 A;  2GR0 A;  4UDR A;  4GCM A;  3FBS A;  1D7Y A;  3SFE A;  4YTN A;  4JN8 A;  1LQU A;  3DA1 A;  3V76 A;  1BZL A;  3GRS A;  1PBD A;  5ENL A;  4G6G A;  1KKR A;  4BUR A;  4A3R A;  3UTE A;  4RG4 A;  4C5O A;  3NYF A;  5IQ4 A;  2DW6 A;  5TR3 A;  3OZY A;  3AE2 A;  1IUW A;  2XH7 A;  1ELS A;  3GD6 A;  7ENL A;  2CHR A;  4JY2 A;  1CBO A;  1BF3 A;  3SN0 A;  4PAB A;  4DHG A;  3M0O A;  1COY A;  4J36 A;  2HZG A;  1YKJ A;  2GAG B;  4M52 A;  2PU1 A;  3TOY A;  3UJR A;  5BUK A;  5J60 A;  2BRA A;  1LTX R;  5KMP A;  2PTZ A;  3KLJ A;  4H7U A;  1NAA A;  2XFN A;  3N4F A;  3UGV A;  4JNQ A;  1O95 A;  1XPQ A;  2E5A A;  4HCD A;  5U63 A;  4HCH A;  1FFV C;  2BCG G;  1IUS A;  3MY9 A;  2PCE A;  3I6D A;  5JCK A;  2OZT A;  3AE8 A;  1V59 A;  2JB3 A;  3D8X A;  1LQT A;  2WPF A;  4TM1 A;  3P0W A;  2BS2 A;  5L46 A;  2CDU A;  4AP3 A;  3NVY B;  3H8I A;  3NIX A;  3OC4 A;  1FIQ B;  2JB1 A;  4H4R A;  3LZX A;  4C77 A;  3SSZ A;  3GWD A;  1TYP A;  1OJD A;  3HYW A;  4YWS A;  3NNE A;  2B9X A;  1TDO A;  1EC7 A;  3RRA A;  4A35 A;  5HHF A;  4U8I A;  1FEC A;  2ZZB A;  1R0M A;  2WOV A;  1PXA A;  3NXL A;  3Q4D A;  3B6D A;  2YG5 A;  3GYI A;  4K8G A;  3DFY A;  4NTD A;  3THU A;  3Q6J A;  2BK3 A;  2AAQ A;  2GRT A;  3UKK A;  3AYJ A;  3DGH A;  1LVL A;  4M0X A;  1ELI A;  1VG9 A;  4JQ9 A;  3KVE A;  4K5S A;  4RSL A;  1EL5 A;  1O5W A;  5KVI A;  4G6H A;  4IT1 A;  5C2T A;  2XGZ A;  3HYV A;  3K7Q X;  2WS3 A;  3EAN A;  3GYX A;  3QVR A;  3DDM A;  3G5R A;  4U8O A;  5JRB A;  3AEA A;  3DG7 A;  3C4A A;  3EAO A;  2GH5 A;  1CHU A;  3K1G A;  4OCG A;  3RR1 A;  4UDP A;  1DTN A;  4NTE A;  2P88 A;  3CNT A;  3E1T A;  4YTP A;  4H4X A;  4EQR A;  3BHK A;  3Q9T A;  4U2S A;  4CRT A;  3TW9 A;  4B64 A;  2OLA A;  3A7U A;  4U2L A;  5LV9 A;  3CB3 A;  2XVI A;  3AB1 A;  3CYJ A;  4CY6 A;  3ALL A;  2HQM A;  3AD8 B;  1NPX A;  3AD9 B;  1TDN A;  4HCL A;  5KVH A;  3ES8 A;  1SB3 B;  1IJH A;  3CGD A;  4GGH A;  1STZ A;  3KUM A;  1NHQ A;  3ABV A;  3T4W A;  2PA6 A;  2ACZ A;  4USR A;  1M6I A;  3RO6 A;  1R6W A;  2BAC A;  1ZDL A;  2OG9 A;  3DGB A;  3VC5 A;  4U8J A;  1NHR A;  5IPY A;  4UDQ A;  4JNA A;  2ZZC A;  3OP2 A;  4OVI A;  3T8Q A;  3TWA A;  5FJT A;  3K30 A;  4GAP A;  1NG3 A;  1KCZ A;  1L8P A;  1N5W C;  4H4S A; 
#chains in the Genus database with same CATH homology
 3NN6 X;  2JBV A;  1CC2 A;  3C96 A;  3GDP A;  1PBE A;  4N9X A;  1DNC A;  4CBQ A;  2OLO A;  1N4V A;  1KNR A;  2E1M A;  4II3 A;  1H82 A;  1OJA A;  2OLN A;  3ZYX A;  2GF3 A;  3AEG A;  3CNS A;  5KNL A;  5KXJ A;  1CJC A;  3P1W A;  1NDA A;  4E0V A;  2XYO A;  3FPZ A;  3GMB A;  4DSG A;  4LA1 A;  3GDN A;  3P4P A;  3QVP A;  2I0Z A;  4TM0 A;  3CTY A;  3NK2 X;  3DK4 A;  3UKH A;  3VRA A;  3NYC A;  4H2P A;  1E1N A;  1JRX A;  4EQX A;  4EMJ A;  1GRH A;  1VG0 A;  5KOX A;  3UP5 A;  4H4T A;  4EIP A;  3DJG X;  5ER0 A;  3GSI A;  3AE9 A;  1S7M A;  3ICS A;  2V3A A;  3ALM A;  3NGC X;  1L9C A;  1DJN A;  4A5L A;  1AOG A;  1DOE A;  3AWI A;  1QO8 A;  1XHC A;  4GR1 A;  3H8L A;  1SEZ A;  5FS9 A;  1N4U A;  4YKF A;  4Z24 A;  5JCM A;  1BWC A;  4J2W A;  1GRA A;  1OJC A;  4BJZ A;  1ZK7 A;  2WU2 A;  3UTF A;  3F8D A;  2Q6U A;  3CND A;  4IV9 A;  1GXF A;  2VVL G;  1ZOV A;  2GMJ A;  2X99 A;  1JU2 A;  2X8H A;  5KWF A;  3SYI A;  1MXT A;  3R9U A;  2C70 A;  1N1P A;  3KU9 A;  1GAL A;  1Z6L A;  2C7G A;  4Z2R A;  3NN0 X;  4H4U A;  4K5R A;  2QA1 A;  4OPC A;  4YKG A;  2B7S A;  2APG A;  2YWL A;  2Q7V A;  4Y4N A;  2IVD A;  3D1C A;  1GRB A;  3BNU A;  1Q1W A;  5KMQ A;  4Z26 A;  1B37 A;  2VQ7 A;  4ADW A;  4EMW A;  1L9D A;  3G5S A;  5GRT A;  2V5Z A;  4J33 A;  4B69 A;  3P4S A;  2YVJ A;  3SZC A;  2Z5Y A;  5FS7 A;  3QJ4 A;  4EM4 A;  1QLB A;  4U8M A;  1ONF A;  3AEE A;  1H86 A;  2YVF A;  4BK2 A;  3GYJ A;  1E7P A;  3AEF A;  3WE0 A;  1DOD A;  4HA6 A;  4Z43 A;  4LU6 A;  1CJ2 A;  5KMS A;  3DJJ A;  4D03 A;  1ZMD A;  3ICT A;  4Z44 A;  1VDC A;  2B9W A;  1D4D A;  3RNM A;  2GR1 A;  1F8S A;  3DME A;  4NZH A;  5U25 A;  3UTG A;  2EQ7 A;  2C73 A;  2VVM A;  3NG7 X;  4IA6 A;  2YR5 A;  3KPK A;  1ZKQ A;  2X50 A;  5KRQ A;  1QJD A;  1ZOY A;  4NEV A;  2J3N A;  3QSS A;  2C65 A;  3SGL A;  2JK6 A;  3H4K A;  1GRE A;  2EQ9 A;  2VOU A;  4B67 A;  1MO9 A;  4G74 A;  4IVM B;  4EQS A;  1PS9 A;  4REK A;  4BJY A;  2C3D A;  4ECH A;  1H84 A;  4YTM A;  2RGJ A;  1NEK A;  3S5W A;  3SFD A;  3UKP A;  3PVC A;  1GT8 A;  4DNA A;  4K2X A;  1KFY A;  4OPI A;  3K7T A;  4CY8 A;  2R0G A;  1KN0 A;  3IF9 A;  3NK1 X;  4B1B A;  4CNK A;  3G5Q A;  3FG2 P;  1RP0 A;  2Y6R A;  1K0I A;  2YG6 A;  3ICR A;  2R0P A;  2VQB A;  1GTH A;  5J7X A;  3AEC A;  2NVK X;  2YR4 A;  1FEB A;  1PXB A;  4JDR A;  4JN9 A;  4GDP A;  4U8P A;  3T31 A;  1YQ3 A;  2WP9 A;  1VRQ B;  1FOH A;  2YG3 A;  3M13 A;  4RG3 A;  4YSY A;  3FIM B;  1PN0 A;  3QFB A;  1EL8 A;  2BC1 A;  3IWA A;  2YVG A;  1D4C A;  2BS4 A;  4K7Z A;  4YSX A;  1XAN A;  4OPD A;  3B3R A;  4K22 A;  3NRN A;  4OPG A;  3CGC A;  1Q9I A;  3UOV A;  4DSH A;  2FBW A;  3LZW A;  2ARD A;  3SZW A;  2WQY A;  1E1L A;  5IQ1 A;  4A79 A;  3DJD A;  1NEN A;  3NTD A;  1L9E A;  3LOV A;  2WES A;  2WP6 A;  1KF6 A;  4A99 A;  4B66 A;  4IA5 A;  3DH9 A;  3L1R A;  2WPE A;  1PBB A;  1IUT A;  1YQ4 A;  2GB0 A;  3ITJ A;  3LAD A;  4GF7 A;  4X4J A;  3P4R A;  1GV4 A;  2GR0 A;  1EL7 A;  2BRY A;  2WHD A;  3BI5 A;  4GCM A;  4UDR A;  4B63 A;  2AR8 A;  1GRF A;  1UKV G;  3EPT A;  3FBS A;  1P2E A;  2YM1 A;  3PG6 A;  3V3O A;  1D7Y A;  4XWR A;  3EF6 A;  3SFE A;  4YTN A;  4EIQ A;  1CC4 A;  1PBC A;  1PJ6 A;  3HZL A;  2YAU A;  1LV0 A;  5HXI A;  1LQU A;  1E1M A;  3UOX A;  3RED A;  2RGO A;  3DA1 A;  3OZ2 A;  4P9S A;  3V76 A;  3LXD A;  1BZL A;  3GRS A;  1PBD A;  2QA2 A;  3AE5 A;  4A9W A;  3LB8 A;  2VRM A;  4G6G A;  5FMH A;  2GVC A;  2DKI A;  2CUL A;  4BUR A;  2R9Z A;  2YM2 A;  3GD3 A;  2XFP A;  3UTE A;  4RG4 A;  3D9X A;  1RSG A;  4C5O A;  3DK8 A;  1E1K A;  3NYF A;  5EB5 A;  3SX6 A;  4DGK A;  5IQ4 A;  5KOW A;  4H4Y A;  2QAE A;  3FMW A;  5TR3 A;  3IHM A;  2PYX A;  3AE2 A;  1F8W A;  5GSN A;  1IUX A;  3KA7 A;  3V3N A;  3GD4 A;  1IUW A;  2YLZ A;  3AE7 A;  1H81 A;  3JSK A;  1H7W A;  1GSN A;  2C67 A;  4FK1 C;  2C76 A;  3CPI G;  2RGH A;  4AP1 A;  4A65 A;  1Y56 B;  4BK1 A;  3T2Z A;  4G9K A;  2XLR A;  4JY2 A;  3T2Y A;  3UKQ A;  5BRT A;  1CBO A;  4H4V A;  4I59 A;  1BF3 A;  4PAB A;  1S3E A;  3M0O A;  1COY A;  4J36 A;  3IC9 A;  1H7X A;  1YKJ A;  1GRT A;  2GAG B;  4M52 A;  1TRB A;  2OAM A;  2XVH A;  3UOY A;  1CL0 A;  4J34 A;  1D7L A;  1IUV A;  5BUK A;  1TYT A;  4WCT A;  2X8C A;  4XWZ A;  2C75 A;  5J60 A;  2BRA A;  4FX9 A;  1LTX R;  3CNJ A;  4OPU A;  2XFO A;  5JCL A;  2XVJ A;  3I3L A;  1PXC A;  5KMP A;  2XDO A;  3F8R A;  3ADA B;  1NHP A;  1L0V A;  4FDC B;  3KLJ A;  4H7U A;  2YG7 A;  1JEH A;  4YT0 A;  1NG4 A;  2NPX A;  4NTC A;  2WP5 A;  4U8L A;  3K7M X;  1FCD A;  3DK9 A;  1NAA A;  2XFN A;  3RP6 A;  1D4E A;  2BCP A;  1GET A;  5FS8 A;  1F6M A;  5JCI A;  4C3X A;  2BXR A;  4JNQ A;  1O95 A;  2GMH A;  5KMR A;  1TDE A;  1H2I A;  5EOW A;  4ZCD A;  1XPQ A;  1DJQ A;  5U63 A;  3QSM A;  2BCG G;  2H88 A;  2GAH B;  3AYL A;  1IUS A;  2E4G A;  4EMI A;  2FJA A;  4Z2T A;  1GEU A;  2V3B A;  3VRD B;  2C4C A;  1REO A;  1NHS A;  3F8P A;  1YY5 A;  3C4N A;  4O5U A;  5FS6 A;  3GRT A;  2GV8 A;  1ZMC A;  4KPR A;  5JCK A;  2JKC A;  3AE8 A;  1ZP0 A;  1V59 A;  3I6D A;  4TLZ A;  2JB3 A;  2V60 A;  3D8X A;  1LQT A;  2WPF A;  1YQZ A;  2A89 A;  4TM1 A;  5DBJ A;  1ZX9 A;  3AD7 B;  4ZCC A;  4NEW A;  3RP7 A;  2BS2 A;  5L46 A;  4C3Y A;  1VQW A;  3DGZ A;  4IVO B;  1KDG A;  2CDU A;  4AP3 A;  4B65 A;  5M0Z A;  1BKW A;  3AED A;  2FJB A;  3H8I A;  3NIX A;  1GPE A;  4Z25 A;  3OC4 A;  4EM3 A;  3UKF A;  3COX A;  2XLU A;  4AT0 A;  4YXD A;  1GOS A;  4O5Q A;  4II2 A;  3DJE A;  3ZDN A;  2JB1 A;  2C72 A;  2WEU A;  3NH3 X;  2BYB A;  4H4R A;  2YLR A;  4TLX A;  3LZX A;  3T0K A;  3UP4 A;  4YSH A;  3BNM A;  4C77 A;  1KNP A;  2W0H A;  4WX1 A;  2R45 A;  2CFY A;  3P4Q A;  3GWD A;  1TYP A;  1PJ5 A;  4A6N B;  1S3B A;  3UCL A;  2WDR A;  1OJD A;  3SY4 A;  2C66 A;  1HYU A;  3LJP A;  3HYW A;  2YG4 A;  3QSE A;  3CNP A;  3CN8 A;  1GER A;  1LPF A;  3IHG A;  1K0J A;  4USQ A;  3KD9 A;  1KSS A;  2WDV A;  2F5Z A;  2FJE A;  2B76 A;  3NNE A;  2B9X A;  4TM3 A;  4A6N A;  4X9N A;  1TDO A;  3BHF A;  2XVE A;  1BGJ A;  1CC6 A;  4H2Q A;  3ATR A;  1E39 A;  1E6E A;  4I58 A;  1OJ9 A;  2WOW A;  3PO7 A;  5EBK A;  3M12 A;  3UKL A;  4Z2U A;  2XLT A;  5HHF A;  2B9Y A;  2Q0L A;  4XXG A;  3AXB A;  1KSU A;  4U8I A;  1FEC A;  4BV6 A;  3T14 A;  3AE3 A;  2C3C A;  3ATQ A;  2YLT A;  2ZZB A;  3AE1 A;  3CPH G;  4A7A A;  2VVL A;  2WOV A;  5U1O A;  4B68 A;  1JRY A;  3BI4 A;  1PXA A;  3SZ0 A;  2OAL A;  4J56 A;  3AE4 A;  1DOB A;  1FEA A;  4H2R A;  2GR3 A;  1JRZ A;  3NKS A;  3B6D A;  1B8S A;  2YG5 A;  3GYI A;  2DKH A;  3UOZ A;  4TM4 A;  3AEB A;  3RP8 A;  2TPR A;  4NTD A;  1D5T A;  3Q6J A;  2WPC A;  4JY3 A;  5BVA A;  4APN A;  5HY5 A;  2BK3 A;  2AAQ A;  2GRT A;  2R0C A;  3UKK A;  5EB4 A;  2WDQ A;  3DGH A;  3AYJ A;  3RHA A;  1TDF A;  1LVL A;  2OA1 A;  3NK0 X;  2VRL A;  4AOS A;  1ELI A;  4H4W A;  1O94 A;  4BK3 A;  1VG9 A;  4JQ9 A;  1Q1R A;  1JNR A;  2UZZ A;  3KVE A;  4K5S A;  4NWZ A;  4ZN0 A;  4GUV A;  2YLS A;  2XCG A;  4NNJ A;  4RSL A;  1EL5 A;  1XDI A;  2Q0K A;  1O5W A;  3CGE A;  5KVI A;  3VQR A;  3P9U A;  4C74 A;  2C64 A;  4G6H A;  3NYE A;  3KKJ A;  5C2T A;  1Y0P A;  3URH A;  4YWO A;  3HYV A;  3K7Q X;  2WS3 A;  1CJ3 A;  3EAN A;  3GYX A;  3QVR A;  3NTA A;  3G5R A;  3HYX A;  4U8O A;  4YSZ A;  5JRB A;  3AEA A;  2EQ6 A;  2TMD A;  1K4Q A;  4FK1 A;  5HYM A;  2V6O A;  4K8D A;  1ZY8 A;  2BS3 A;  4X9M A;  1FL2 A;  3NT6 A;  2EQ8 A;  2YLX A;  5C3J A;  3C4A A;  3EAO A;  1JNZ A;  3BI2 A;  2GH5 A;  1CHU A;  1B4V A;  2IID A;  2XLS A;  1F3P A;  4AT2 A;  1F8R A;  4G73 A;  1Y56 A;  4H4Q A;  4H2N A;  1CJ4 A;  1W4X A;  1GRG A;  2Y6Q A;  4KX6 A;  4OCG A;  1GND A;  4LII A;  1EBD A;  1PJ7 A;  4UDP A;  2GR2 A;  3SQP A;  1S2Q A;  4U2T A;  2GQW A;  2BC0 A;  2IVE A;  4NTE A;  3E1T A;  3CNT A;  4YTP A;  2YQU A;  2ZZ0 A;  4H4X A;  4EQR A;  1EL9 A;  3SM8 A;  4D04 A;  4GDE A;  1DOC A;  3BHK A;  3S61 A;  3Q9T A;  4U2S A;  4CNJ A;  4OPL A;  1P2H A;  2JAE A;  3ALJ A;  2CVJ A;  4CRT A;  2WOI A;  1PDH A;  2Z5X A;  5BUL A;  1M64 A;  1JOA A;  4HB9 A;  5CQF A;  2B7R A;  4B64 A;  1K0L A;  1DXL A;  1S2Y A;  3L8K A;  2H89 A;  4UP3 A;  2XLP A;  1GES A;  3VRB A;  4U2L A;  2X8G A;  5LV9 A;  2A8X A;  2XVI A;  4MJW A;  3AB1 A;  3ISH A;  2BK5 A;  2V61 A;  5JCN A;  3VR8 A;  4CY6 A;  3UTH A;  3QFA A;  2BAB A;  1GTE A;  1H6V A;  3ALL A;  4Y4L A;  3II4 A;  2HQM A;  3AD8 B;  1NPX A;  3AD9 B;  1TDN A;  5KVH A;  4ICY A;  1PBF A;  3UKA A;  1BGN A;  4Y4M A;  5M10 A;  2WET A;  2WBA A;  1IJH A;  3CGD A;  4H4P A;  1TDK A;  5CKU A;  4J31 A;  2FJD A;  1MOK A;  1NHQ A;  3ABV A;  1LJ1 A;  1RYI A;  4GRT A;  2XFQ A;  1B5Q A;  1OJT A;  2YLW A;  1PHH A;  3CPJ G;  2YR6 A;  2ACZ A;  4CCQ A;  4USR A;  3NHO X;  3AYI A;  3O0H A;  2BK4 A;  4U8K A;  4U8N A;  2A87 A;  1M6I A;  1H83 A;  2GEW A;  3PS9 A;  4GAV A;  2BAC A;  3T2K A;  1ZDL A;  4PAA A;  2AQJ A;  2QCU A;  2O9Z A;  3AE6 A;  1X31 B;  2R46 A;  2R4E A;  1CF3 A;  2R4J A;  2PHH A;  2BA9 A;  2E5V A;  4U8J A;  1IUU A;  3GMC A;  3GWF A;  2X3N A;  2XVF A;  1NHR A;  4AOX A;  2XFU A;  2GQF A;  2VZ2 A;  4J57 A;  5IPY A;  4UDQ A;  3L5O A;  2ZZC A;  4JNA A;  4OVI A;  2ZBW A;  3VR9 A;  2BXS A;  3NLC A;  4EQW A;  3CMM A;  2WU5 A;  1NG3 A;  3K30 A;  4GAP A;  4OPT A;  3SXI A;  3SZF A;  3CGB A;  4CCR A;  2RAB A;  4H4Z A;  3T37 A;  3KPF A;  4H50 A;  4H4S A;  3CIR A;  1N4W A;  2JB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...