3KLJA

Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
378
structure length
378
Chain Sequence
KSTKILILGAGPAGFSAAKAALGKCDDITMINSEKYLPYYRPRLNEIIAKNKSIDDILIKKNDWYEKNNIKVITSEFATSIDPNNKLVTLKSGEKIKYEKLIIASGSIANKIKVPHADEIFSLYSYDDALKIKDECKNKGKAFIIGGGILGIELAQAIIDSGTPASIGIILEYPLERQLDRDGGLFLKDKLDRLGIKIYTNSNFEEMGDLIRSSCVITAVGVKPNLDFIKDTEIASKRGILVNDHMETSIKDIYACGDVAEFYGKNPGLINIANKQGEVAGLNACGEDASYSEIIPSPILKVSGISIISCGDIENNKPSKVFRSTQEDKYIVCMLKENKIDAAAVIGDVSLGTKLKKAIDSSKSFDNISSLDAILNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(FAD)-dependent dehydrogenase, NirB-family (N-terminal do
publication title Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
total genus 117
structure length 378
sequence length 378
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18267 Rubredoxin_C Rubredoxin NAD+ reductase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3kljA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA02
2VVLA 4A6NB 4Z44A 1NG4A 4RSLA 2XDOA 1AOGA 2FJEA 3RP7A 3IC9A 2OAMA 4J36A 4YWOA 1ZY8A 2ACZA 4C77A 1L0VA 2DKHA 2OALA 3D1CA 4A79A 5L46A 3NKSA 1PBBA 3AEBA 5C3JA 1TRBA 1IJHA 1X31B 3BI4A 4EIPA 2YLZA 1EL9A 1NEKA 4HA6A 2TPRA 3RP6A 4APNA 4M52A 2IVDA 5M10A 2WP9A 5TR3A 2WBAA 3H8IA 4JN9A 3UKQA 3NN0X 1PXAA 1YQZA 1GRHA 1CC4A 2R9ZA 1PXBA 1JOAA 3AEGA 2BK3A 4TM1A 1Q9IA 1ZK7A 3KD9A 1H7WA 1PDHA 3AEEA 1ZOYA 5KVIA 2PHHA 5HHFA 4EMIA 2E4GA 2YR4A 3AYLA 5JCMA 3UCLA 2R46A 5JCLA 1D7LA 1QJDA 2WDRA 3P9UA 4YSYA 1Q1WA 2CDUA 4BK2A 2GF3A 1GETA 2E5VA 4OCGA 1BGNA 2WHDA 2GAGB 4I59A 4JY2A 4PABA 1COYA 4PAAA 4U8LA 3P4RA 1N4WA 1CJCA 1S3EA 1Y56B 2V6OA 4U2LA 3OZ2A 3PVCA 1NHQA 3DGZA 4Z43A 1GRFA 1GTHA 2C70A 3LZWA 1JRYA 4A6NA 3ZDNA 3KKJA 4D03A 5C2TA 1PJ6A 4JY3A 2GQWA 2BABA 1CL0A 1H81A 3BI5A 3UTGA 1B37A 2HQMA 5JCIA 3OC4A 1CJ4A 3ICRA 1DODA 5KXJA 3LOVA 1B5QA 1S3BA 2R0PA 5KVHA 4U8JA 4YT0A 1BZLA 2JK6A 2EQ7A 3ALLA 2GR0A 3P4SA 1L9DA 2B9WA 1GREA 5BRTA 2C64A 3G5RA 3M12A 4IA6A 3NIXA 4DSGA 4GCMA 3H4KA 1DNCA 2WOWA 4ZCCA 2WETA 1D4DA 1F6MA 5JCKA 4LA1A 4Z24A 4U2SA 4BK3A 1JNRA 2YLSA 3UKPA 1ZP0A 4CNKA 4OPUA 4UDRA 3AYIA 1ELIA 5BULA 1FCDA 4AP3A 4B65A 5M0ZA 1IUUA 2C7GA 5EOWA 4H4RA 3COXA 1TDOA 4H4VA 2C66A 2ARDA 2C72A 3AB1A 2GR1A 1YY5A 3VRDB 4AOSA 1NPXA 1TYPA 1E1LA 4NTCA 4O5QA 1Y56A 4CRTA 5HXIA 4D04A 3UTEA 1IUTA 1CC2A 3QFBA 2C67A 5EB5A 1KF6A 2YLRA 4CY8A 1JU2A 3K7MX 2QA2A 1M64A 3NK2X 4UDQA 3AE6A 1ZX9A 3CNDA 2WPCA 2XVEA 3VR9A 1E1MA 2JAEA 4TM3A 5IQ4A 4OPTA 3CGBA 1JEHA 2QAEA 3VR8A 3S5WA 2VRLA 5FMHA 2IVEA 4B64A 2GMJA 4X4JA 1PN0A 4UP3A 3AE2A 1BGJA 3ATQA 1BF3A 2YLTA 2YM1A 3B3RA 3C96A 3EPTA 2WOVA 3SGLA 5EB4A 3HZLA 3UOZA 1CHUA 1JRXA 1ONFA 2WPEA 3UOVA 3AD7B 1VG0A 1GXFA 3C4NA 3GWDA 3KPFA 3CTYA 4IVOB 4TM4A 5CQFA 3AWIA 3AE7A 2CULA 2YG3A 4K8DA 2CVJA 5CKUA 5FS8A 2UZZA 1W4XA 4A65A 1K0LA 2WU5A 1NHSA 2XLPA 4H50A 4K2XA 3UTHA 4FDCB 2ZBWA 5U63A 4DGKA 2ZZCA 4JNAA 4H4ZA 4O5UA 3CGDA 4YSHA 1TDNA 3LB8A 2JB3A 4GR1A 3AD9B 1H86A 1YQ4A 1NDAA 3PO7A 3LXDA 1Q1RA 4AOXA 4H4PA 4CY6A 3D8XA 1YKJA 2WP5A 3GSIA 1IUSA 3DJJA 1DOEA 2VZ2A 4A5LA 4OVIA 4C3XA 1S2QA 4NEVA 4ECHA 5JCNA 3SFDA 4H4YA 1IUXA 4EMWA 4CCQA 4ICYA 3DK9A 3EAOA 4B69A 1XHCA 2WDVA 3REDA 1BKWA 4H4TA 1GV4A 2AR8A 3QFAA 1EL8A 2GRTA 4YTPA 2OA1A 2E1MA 1L9EA 3GRSA 4H2QA 3Q6JA 3DK4A 3AYJA 4B1BA 4YTNA 2X8HA 2YWLA 4WX1A 3CPIG 1VG9A 3UKLA 4NTEA 4WCTA 5DBJA 3F8PA 4IV9A 4B68A 4Z25A 3AE1A 3UOXA 4Y4NA 3AE5A 3F8RA 1NENA 1N4VA 1O95A 2VVMA 2YG7A 3ABVA 2GQFA 3S61A 1CBOA 3NYEA 4CNJA 4DSHA 3UOYA 1M6IA 4FX9A 4KPRA 3WE0A 4BV6A 4U8PA 2BS4A 1K4QA 4U8MA 3DA1A 1NHPA 1O5WA 4FK1C 4TLZA 1GPEA 2EQ6A 1QO8A 2Z5XA 4EQXA 2R4JA 1F8WA 1PBFA 1N1PA 3AD8B 3GWFA 1D5TA 4A99A 1B4VA 3CNPA 2XVFA 4C74A 2Q7VA 1EBDA 1CJ2A 3CGEA 3DH9A 3II4A 2GVCA 4J2WA 2YVGA 3AEDA 4AP1A 4BURA 4C5OA 2IIDA 3NT6A 3L8KA 3FIMB 4XWZA 3GD4A 2H88A 3EANA 3NLCA 5KWFA 1TDEA 3CNJA 2XLRA 4X9NA 1GALA 3V3OA 1GRTA 2YG5A 4ADWA 3H8LA 4LIIA 2GR3A 3KA7A 4CBQA 5HY5A 3RNMA 2FJAA 1UKVG 2JBVA 2QCUA 1K0IA 2B76A 2BS3A 2XVHA 2YLXA 1BWCA 1DXLA 3LADA 2XCGA 1VDCA 4AT2A 1KNRA 2EQ9A 3UKHA 2WS3A 2WP6A 2BC1A 3C4AA 4U8NA 2BC0A 1ZMDA 3CNSA 2X99A 2BYBA 1P2HA 1DJNA 1Z6LA 2XFNA 3IF9A 4USQA 2GR2A 1LQUA 4ZCDA 4OPLA 5HYMA 3QSEA 3QVPA 2GB0A 4BJYA 2R0CA 1S2YA 4X9MA 4B63A 3F8DA 3BNMA 5GRTA 2JB2A 1KNPA 2X3NA 4N9XA 4B67A 1PXCA 4CCRA 2NVKX 3I3LA 2RABA 5U1OA 1N4UA 4J56A 4MJWA 2WOIA 1IUWA 4H4QA 1OJDA 5U25A 1NHRA 1GRGA 4Z26A 1FEAA 4A7AA 3V3NA 4GDEA 3ITJA 1LPFA 1CC6A 3FMWA 1PS9A 4YSZA 3EF6A 1F8SA 4H4XA 2QA1A 3SQPA 3QSSA 1DOCA 1GOSA 2Q6UA 3IHMA 1GNDA 2C3DA 3AEFA 4JQ9A 2B7RA 4I58A 5BUKA 1F3PA 2WQYA 3GRTA 4K7ZA 3UTFA 3AEAA 2OLOA 1GERA 2B9YA 3AE8A 5IQ1A 3AXBA 3ALMA 5J60A 1CF3A 1E39A 4H4SA 4YKGA 4K5SA 3B6DA 3KLJA 3V76A 1REOA 5KRQA 1D7YA 1TDKA 2Q0KA 3JSKA 3P4QA 1ZOVA 3E1TA 2XFOA 4GDPA 1F8RA 4Y4MA 3NRNA 4J57A 2R4EA 4H2NA 3AE9A 2YR5A 4J33A 2XFUA 2WDQA 1E7PA 1NAAA 3NYFA 1EL7A 3BHKA 1MXTA 1JRZA 4JNQA 1OJCA 1RYIA 1OJAA 2V3AA 1JNZA 1KSSA 1XANA 1DOBA 4OPDA 3ALJA 4YSXA 1FL2A 1LV0A 4USRA 1KFYA 4AT0A 2ZZBA 3CIRA 3FPZA 1ZMCA 3DJDA 4NEWA 4GUVA 1IUVA 1H82A 3FBSA 2A8XA 3BHFA 2XYOA 3M13A 2FJDA 2FJBA 4NZHA 4H4UA 3ICSA 3NK1X 2BXSA 2FBWA 3Q9TA 1OJ9A 2YR6A 3IWAA 3UKKA 2XLSA 1PJ7A 2I0ZA 2Z5YA 2F5ZA 3UKFA 1RSGA 4EQRA 2R0GA 2VVLG 4Y4LA 4Z2UA 4RG3A 4KX6A 5FS9A 2W0HA 2GV8A 2YG4A 2YAUA 2EQ8A 1VRQB 4TM0A 3UP5A 3T37A 1H84A 1GTEA 3BNUA 4A9WA 1HYUA 4C3YA 5FS7A 1SEZA 3DGHA 4XXGA 1LQTA 3DK8A 1D4EA 3K7TA 2XVIA 4J31A 4H7UA 4U2TA 2CFYA 4B66A 3CPHG 4YXDA 1E1NA 3NGCX 3K7QX 3FG2P 1TDFA 2A89A 1NG3A 2BK4A 1DJQA 2C76A 3LZXA 4U8IA 5LV9A 2B9XA 2V61A 5GSNA 3ZYXA 1H83A 3M0OA 3R9UA 4IA5A 1P2EA 1QLBA 1EL5A 4TLXA 2C75A 1H6VA 4H2PA 4UDPA 1GSNA 3KVEA 1YQ3A 3NYCA 4OPIA 3O0HA 2BXRA 3UP4A 2PYXA 3NTAA 4EQSA 2YVJA 2V3BA 1XDIA 4EMJA 3K30A 3SFEA 3CN8A 4REKA 2NPXA 3SM8A 1B8SA 1H7XA 1XPQA 3DJGX 3KU9A 3P4PA 4FK1A 2BCPA 5J7XA 4ZN0A 2GEWA 3QJ4A 2WESA 2OLNA 2GAHB 2XFQA 2XLTA 4P9SA 3UKAA 3NNEA 4NTDA 2B7SA 1GRBA 3NTDA 2GMHA 3DJEA 2BK5A 5EBKA 2C73A 1L9CA 3G5SA 2WU2A 1V59A 4OPGA 5KOXA 2C65A 3VRAA 4GRTA 3NH3X 1D4CA 2BACA 2YM2A 3AE3A 4JDRA 4H4WA 2VOUA 3CNTA 1PBEA 3GD3A 1PBCA 4HB9A 5ER0A 3ISHA 2TMDA 3P1WA 4EM3A 2RGHA 1O94A 2V5ZA 1LTXR 2AAQA 3AE4A 4K22A 5BVAA 2RGOA 2WPFA 2JB1A 3QVRA 3GMCA 2RGJA 2VRMA 2YLWA 2R45A 2YG6A 4BK1A 1PBDA 4H2RA 3L1RA 2VQBA 4U8KA 1CJ3A 2XVJA 3NHOX 3CGCA 3LJPA 4U8OA 2J3NA 3G5QA 2ZZ0A 1GT8A 2X8GA 1GRAA 1RP0A 2C3CA 2BS2A 4J34A 4E0VA 3ATRA 4XWRA 5KOWA 4LU6A 3ICTA 2GH5A 3RP8A 1ZKQA 2JKCA 2XLUA 3PS9A 3NK0X 4YKFA 2DKIA 2AQJA 3ADAB 3VQRA 3QSMA 1OJTA 4EIQA 3IHGA 1FEBA 5IPYA 1LVLA 1ZDLA 2V60A 4IVMB 2O9ZA 3GDNA 4GF7A 4DNAA 2VQ7A 4YTMA 4BJZA 1LJ1A 4Z2RA 4K5RA 1TYTA 2YQUA 1Y0PA 2YVFA 2BA9A 3RHAA 1VQWA 1FECA 1PJ5A 3GYJA 3NN6X 3GDPA 1PHHA 3GMBA 3NG7X 1FOHA 4EQWA 2X50A 1MOKA 3URHA 1KDGA 4RG4A 3VRBA 3BI2A 4Z2TA 1GESA 2X8CA 2Y6RA 2Y6QA 3I6DA 1MO9A 4EM4A 1E6EA 2XFPA 1K0JA 2Q0LA 1KSUA 3DMEA 4OPCA 5FS6A 2APGA 1E1KA 2BCGG 1GEUA 3CPJG 2A87A 3AECA 2WEUA 2H89A 3GYIA
chains in the Genus database with same CATH superfamily
4II2A 2VVLA 1NG4A 3RP7A 4YWOA 2ACZA 3D1CA 4A79A 4GGBA 1X31B 1EL9A 3RP6A 4APNA 4M52A 2W3SA 2WBAA 3UKQA 1YQZA 1DTNA 2R9ZA 3NFUA 3AEGA 1JPDX 2BK3A 2OX4A 1ZK7A 1PDHA 3AEEA 5HHFA 5JCLA 3P9UA 2WDRA 1MNSA 1Q1WA 2MNRA 3A7UA 1FIQB 4PABA 3FV9A 1COYA 1N4WA 3DGZA 4Z43A 3LZWA 4JY3A 1KKRA 2GQWA 1CL0A 3BI5A 5JCIA 4M6UA 3LOVA 4YT0A 2B9WA 1GREA 2C64A 3M12A 4IA6A 3PG6A 3FCPA 4ZCCA 1STZA 1F6MA 2CHRA 4LA1A 4BK3A 4CNKA 4OPUA 3AYIA 5BULA 3TJIA 5M0ZA 5EOWA 1TZZA 4H4RA 3COXA 1TDOA 5HXIA 4D04A 4UDQA 2JAEA 4TM3A 2BRYA 4OPTA 3SSZA 2IVEA 1PN0A 4UP3A 2GGGA 3HZLA 3HPFA 1ONFA 2WPEA 3UOVA 3CTYA 3AWIA 3D47A 3AE7A 5CKUA 2AL2A 2CVJA 4GYPC 1W4XA 3QN3A 1NHSA 4K2XA 3V5FA 3H70A 4O5UA 2OQHA 3CGDA 1YQ4A 4H4PA 2PTYA 3DJJA 4OVIA 1S7MA 3SFDA 4H4YA 4MMWA 3EAOA 4HNLA 3QFAA 1EL8A 2GRTA 2OA1A 3Q6JA 3H12A 4B1BA 2X8HA 3UGVA 3SZ0A 3A7AA 3F8PA 1XS2A 1NENA 1M6IA 4H83A 3N4EA 1O5WA 2HXTA 4TLZA 1F8WA 1XPYA 2XVFA 5FJRA 2GVCA 3AEDA 3NT6A 3L8KA 3NLCA 1TDEA 3CNJA 2P8BA 3CK5A 1GRTA 2YG5A 4ADWA 3KA7A 2FJAA 2QCUA 2YLXA 4E4FA 3C4AA 2BC1A 4U8NA 1OEPA 3CNSA 1DJNA 1Z6LA 3IF9A 1LQUA 2P0IA 5HYMA 2W54A 5KMRA 1S2YA 4B63A 3R1ZA 1IUWA 4H4QA 4Z26A 4A7AA 3V3NA 3I4KA 4GDEA 1LPFA 1CC6A 4YSZA 2Q6UA 1GNDA 2C3DA 3AEFA 4JQ9A 2WQYA 3AN1A 1KD0A 3OW1A 2GGIA 3P4QA 1F8RA 2FYMA 1NAAA 3NYFA 4GYPA 3VA8A 1EL7A 3BHKA 1MXTA 3NXLA 4JNQA 3DG3A 2PMQA 1RYIA 2QDDA 1OJAA 1R0MA 1ZXIC 3U9IA 1JNZA 1KSSA 4FP1A 1XANA 3ALJA 3MWCA 3U4FA 1KFYA 4X2PA 2ZZBA 3D9XA 1EBGA 4GUVA 4ROPA 3FBSA 3M13A 2A8XA 2OZTA 3VC5A 2FJBA 3UJRA 1L8PA 3NK1X 2FBWA 4DWDA 3IWAA 3UKKA 3B9JB 2F5ZA 4K1WA 4EQRA 2VVLG 4RG3A 2GV8A 3T37A 1HYUA 3DK8A 1D4EA 4YXDA 3NGCX 1TDFA 1DJQA 3UJFA 5GSNA 2ONEA 4MGGA 3ZYXA 3R9UA 4E8GA 1QLBA 1EL5A 4UDPA 1H6VA 2GSHA 4HNCA 4EQSA 1XDIA 3K30A 3SFEA 4REKA 3DIPA 1B8SA 3SM8A 1H7XA 3DJGX 4IZGA 2OLAA 3NVYB 3R25A 2OLNA 2GAHB 2XFQA 1TKKA 4P9SA 3UKAA 2OKTA 4NTDA 2BK5A 1L9CA 2WU2A 1V59A 4OPGA 5KOXA 2I5QA 3ZVHB 4JDRA 1PBEA 4DXKA 3ISHA 3P1WA 1ONEA 4KWSA 1N63C 2V5ZA 4TVYA 4K22A 5BVAA 2JB1A 3PWIA 4IL2A 4U8KA 3NHOX 4K8GA 3HRDC 3T31A 2ZZ0A 3UJ2A 1GRAA 1RP0A 3ATRA 3IJQA 4LU6A 3R10A 1ZKQA 3NK0X 2DKIA 3VQRA 5KMSA 3Q45A 1FEBA 5IPYA 1ZDLA 3S5SA 3PK7A 4YTMA 3GDNA 4DNAA 2VQ7A 2OFJA 2YVFA 1VQWA 4G6GA 1FECA 3SZFA 3NN6X 1FOHA 3KUMA 2GDQA 1MOKA 3URHA 4H19A 3BI2A 2Y6QA 3T6CA 4EM4A 2Q0LA 1KSUA 3DFHA 5ENLA 2APGA 1GEUA 1NELA 4ZCWA 2H89A 3GYIA 1FHUA 4Z44A 2FJEA 2C4CA 2DKHA 2FKPA 1IJHA 4EIPA 2YLZA 1NU5A 3V4BA 5TR3A 1PXAA 1CC4A 5FJTA 1Q9IA 3KD9A 3VC6A 2YR4A 3ENLA 3CYJA 2PTWA 4BK2A 1GETA 1BGNA 4U8LA 4PAAA 3NVZB 1S3EA 3DESA 1Y56B 3EEZA 3IK4A 1NHQA 1JRYA 3KKJA 1SJCA 5C2TA 2BABA 1H81A 3UTGA 1B37A 2HQMA 3ICRA 3OC4A 1DODA 5KVHA 1BZLA 2OZ8A 3NIXA 4GCMA 3H4KA 1DNCA 1D4DA 2YLSA 3BJSA 3T14A 3OTRA 1FCDA 3UXLA 4AP3A 4B65A 2P3ZA 1IUUA 3TWAA 4H4VA 3AB1A 1YY5A 4CRTA 1NPXA 4O5QA 2QGYA 3UTEA 1CC2A 2C67A 1JU2A 3ZLFA 1ZX9A 2WPCA 2XVEA 1E1MA 1JPMA 5IQ4A 3MUCA 3CGBA 3VR8A 3S5WA 4G8TA 4B64A 2GMJA 3GD6A 3OPSA 1BGJA 3ATQA 2YLTA 2YM1A 4DN1A 2WOVA 3SGLA 3TW9A 3UOZA 1JRXA 3AD7B 1VG0A 3KPFA 2P88A 5CQFA 4K8DA 4IP5A 2WU5A 2GL5A 3UTHA 4FDCB 3RITA 2P8CA 4EWJA 3ZLHA 3LB8A 2GGHA 3LXDA 1Q1RA 3JW7A 4JHMA 2QJJA 3GSIA 1IUSA 1DOEA 4C3XA 4GIRA 4ECHA 1EC8A 4EMWA 4CCQA 2AR8A 4YTPA 4H2QA 3GRSA 2YWLA 3S47A 3UKLA 4E6MA 4MKSA 4NTEA 4WCTA 4IV9A 4B68A 3AE1A 4G74A 3F8RA 1N4VA 2BS4A 3TQPA 2Z5XA 3GWFA 1N1PA 3QLDA 1B4VA 2Q7VA 3SXIA 3II4A 2YVGA 4AP1A 4C5OA 3FIMB 3GD4A 5EU9A 5KWFA 3H8LA 2GR3A 2PGWA 2JBVA 2BS3A 3T4WA 1ELSA 3UKHA 1ZMDA 2QJMA 2XFNA 4ZCDA 2GB0A 4X9MA 2JB2A 1KNPA 2X3NA 4CCRA 5U1OA 1OJDA 5U25A 2OPJA 1NHRA 1GRGA 2PGEA 3UJEA 1FEAA 1MDLA 3DFYA 3ITJA 3FMWA 1PS9A 2XSXA 4KPLA 3EF6A 1WUEA 4H4XA 1GOSA 1VDVA 4I58A 5BUKA 5KMQA 3GRTA 3AEAA 2OLOA 5IDZA 5IQ1A 2HXUA 3AXBA 5J60A 1CF3A 4YKGA 3B6DA 2PCEA 3SBFA 1REOA 5KRQA 1TDKA 2Q0KA 3E1TA 3NRNA 4J57A 2R4EA 5JRBA 1E7PA 1FO4A 3TCSA 1EC9A 1DOBA 4OPDA 4YSXA 3FPZA 1IUVA 3BHFA 2BXSA 1OJ9A 3HYWA 2XLSA 1PJ7A 2I0ZA 5G5HB 2Z5YA 3UKFA 4GMEA 2R0GA 3TOYA 3HW2A 4Y4LA 4KX6A 2YAUA 4TM0A 3UP5A 4A9WA 4C3YA 5FS7A 4XXGA 4J31A 2XVIA 2CFYA 3CPHG 3K7QX 2BK4A 1NG3A 5LV9A 2C76A 3LZXA 4U8IA 3L5OA 1H83A 3FVDA 3T0KA 3CAWA 4IA5A 2C75A 4H2PA 3NYCA 3UP4A 3NTAA 2YVJA 4EMJA 3KU9A 3P4PA 3MZNA 3CXOA 2OVLA 5EBKA 3DDMA 3DG7A 3TTEA 2XH0A 1KKOA 3IJIA 3R0UA 4IL0A 1MDRA 1PBCA 3ZVIA 2TMDA 3SY4A 4EM3A 3AE4A 2E3TA 2HNEA 3H7VA 2RGJA 2YG6A 3JVAA 3L1RA 4NNJA 2XVJA 4KT2A 3G5QA 1GT8A 2X8GA 4XWRA 3MSYA 5KOWA 2JKCA 2XLUA 3PS9A 3QSMA 1OJTA 2PPGA 1LVLA 3R11A 3ZVHA 1LJ1A 4K5RA 3VCNA 2YQUA 3NVWB 2BA9A 3I6EA 4GISA 1PJ5A 3GYJA 3PWGA 2XGZA 3NG7X 4EQWA 1SJAA 2OG9A 4RG4A 2Y6RA 4DX3A 4OPCA 3T8QA 3EKGA 1E1KA 3CPJG 2PSNA 2WEUA 4A6NB 4RSLA 2OAMA 3IJLA 1L0VA 3NKSA 3AEBA 5C3JA 1TRBA 3MQTA 3BI4A 2DW6A 2GGEA 2TPRA 5M10A 2WP9A 2PP3A 3CB3A 2QVHA 3NN0X 1PXBA 1ZOYA 3GC2A 3MY9A 4EMIA 2E4GA 3AYLA 5JCMA 4YSYA 2GF3A 3KPKA 2DW7A 2GGJA 1CJCA 5BOFA 2V6OA 3OZ2A 3FJ4A 2PTXA 3ZDNA 4D03A 1PJ6A 4Z1YA 1B5QA 1S3BA 4U8JA 2JK6A 1X2GA 2EQ7A 2PTZA 3ALLA 3P4SA 3MKCA 3SR6B 3DEQA 2WOWA 5G5GB 5JCKA 4Z24A 3QTPA 1JNRA 3UKPA 1ZP0A 3RR1A 3T2ZA 1ELIA 2C7GA 2C66A 5KNLA 2C72A 2GR1A 3BSMA 4AOSA 1E1LA 4NTCA 1Y56A 1WUFA 1IUTA 3QFBA 3OP2A 3K7MX 1M64A 3AE6A 3CNDA 1SB3B 2QAEA 3FYYA 1BF3A 3B3RA 3C96A 1JROA 3C4NA 3GWDA 4IVOB 4TM4A 2CULA 2YG3A 5FS8A 2E5AA 4A65A 4H50A 4DGKA 2ZBWA 5U63A 2ZZCA 4YWSA 4H4ZA 1VQZA 4YSHA 1ECQA 1TDNA 1F9CA 1H86A 7ENLA 4CY6A 3D8XA 1YKJA 2WP5A 1V97A 2MUCA 4A5LA 2PU0A 5FJOA 4NEVA 3UXKA 5BOEA 1IUXA 4ICYA 4B69A 2WDVA 1BKWA 1GV4A 3OZMA 2E1MA 3PFRA 1L9EA 3AYJA 3SN1A 3N6JA 4WX1A 3CPIG 5FJUA 4KEMA 3UOXA 4Y4NA 2OQYA 2YG7A 3ABVA 2GQFA 3NS1B 4CNJA 4DSHA 4FX9A 4BV6A 4U8MA 3DA1A 1NHPA 2EQ6A 4EQXA 2R4JA 1D5TA 3CNPA 4G73A 4A3RA 4HCLA 2PS2A 1CJ2A 3DH9A 4J2WA 2IIDA 4XWZA 2H88A 2XLRA 1GALA 5HY5A 4LIIA 3RNMA 1UKVG 1K0IA 2B76A 2XVHA 1BWCA 1DXLA 2XCGA 3OZYA 4II3A 2BC0A 2X99A 3QVPA 3F8DA 3BNMA 5GRTA 2NVKX 2RABA 1BQGA 4MJWA 4NWZA 3SJNA 1F8SA 2B7RA 3UTFA 2B9YA 4FI4A 3ALMA 4H4SA 4ZOHB 3KLJA 3D46A 1D7YA 4IHCA 1P48A 3TJ4A 1ZOVA 4Y4MA 4H2NA 3AE9A 4J33A 2XFUA 2WDQA 1JRZA 1KN0A 2V3AA 3VCCA 2PP0A 4AT0A 4H4UA 4F4RA 3ICSA 3Q9TA 2YR6A 3BOXA 3V3WA 1RSGA 3UJSA 2EQ8A 3SZWA 3JZUA 1H84A 3FXGA 4G6HA 3K7TA 4B66A 1N5XA 2A89A 1MRAA 2B9XA 2V61A 3KVEA 1YQ3A 3O0HA 4TVWA 2V3BA 3CN8A 1XPQA 4HCHA 4E4UA 2BCPA 1FHVA 5J7XA 3A7RA 2GEWA 3QJ4A 3N4FA 2XLTA 4HPNA 5J04A 2B7SA 1GRBA 2GMHA 3DJEA 2C73A 2XH7A 4M0XA 1EBHA 4GRTA 4H4WA 2VOUA 3GD3A 2OO6A 4HB9A 5ER0A 1LTXR 3QVRA 3SYIA 3GMCA 1N62C 2YLWA 2R45A 1PBDA 3GY1A 4H2RA 2VQBA 3LJPA 2J3NA 2BS2A 2GH5A 3RP8A 4Z17A 3ADAB 2AQJA 2POZA 4EIQA 3NVVB 3IHGA 2PP1A 2V60A 2PODA 2O9ZA 3QPEA 1Y0PA 2RDXA 3QKEA 3ZLGA 1PHHA 2X50A 1KDGA 3VRBA 1R6WA 2X8CA 3I6DA 3T2YA 1MO9A 1E6EA 1PDZA 3DMEA 3GO2A 3B97A 3R0KA 2XDOA 1AOGA 3IC9A 4J36A 1ZY8A 4C77A 3RRAA 2OALA 5L46A 2HZGA 1PBBA 1NEKA 4HA6A 2IVDA 3THUA 4JN9A 2QDEA 3H8IA 1GRHA 4GGHA 4HCDA 1JOAA 4TM1A 1H7WA 5KVIA 2PHHA 4A6GA 3N6HA 3UCLA 3I6TA 2R46A 4G7FA 1D7LA 1QJDA 4K2SA 1JCTA 2CDUA 2E5VA 4OCGA 2WHDA 2GAGB 3ES8A 4I59A 4JY2A 3P4RA 4U2LA 3PVCA 1E9IA 3RGTA 1GRFA 1GTHA 2C70A 4A6NA 1EC7A 3HYVA 3CXBA 1CJ4A 5KXJA 2R0PA 2GR0A 3ES7A 1L9DA 5BRTA 3G5RA 4DSGA 2WETA 4U2SA 4UDRA 3GYXA 2AL2B 3RO6A 2ARDA 3VRDB 4G9KA 1TYPA 3SZCA 5EB5A 1X2HA 1KF6A 2YLRA 4CY8A 2QA2A 3NK2X 3R07C 1BKHA 3VR9A 1JEHA 1FFUC 2O56A 4JN7A 2VRLA 5FMHA 4X4JA 4DYEA 3RCYA 1P43A 3AE2A 3EPTA 5EB4A 1CHUA 1GXFA 2W55A 1N5WC 2UZZA 2OZ3A 1K0LA 2XLPA 3P0WA 2PU1A 4JNAA 1YEYA 2JB3A 4GR1A 3AD9B 1KCZA 1IYXA 1NDAA 3PO7A 4AOXA 4JN8A 4GAVA 1PDYA 1SJDA 2VZ2A 1S2QA 1H2IA 2ZC8A 5JCNA 1JDFA 3DK9A 1XHCA 3REDA 4H4TA 3EUB3 1N60C 2AL1A 3CMMA 3DK4A 4YTNA 3H8AA 1VG9A 2PA6A 5DBJA 4Z25A 3AE5A 1O95A 2VVMA 3DG6A 3S61A 4ZA0A 1CBOA 3NYEA 3T2KA 3UOYA 4KPRA 3WE0A 4U8PA 4GAPA 1K4QA 4FK1C 3Q4DA 1GPEA 1WYGA 1QO8A 3VDGA 3AD8B 1PBFA 4A99A 4C74A 1EBDA 3CGEA 4J3ZA 2ZADA 4IT1A 4BURA 2XH4A 3EANA 3V3OA 3UCDA 4X9NA 4CBQA 3STPA 3P3BA 4IP4A 3LADA 1VDCA 4AT2A 1KNRA 2EQ9A 2WS3A 2WP6A 5FJPA 2BYBA 1P2HA 4USQA 2GR2A 4OPLA 3QSEA 4BJYA 2R0CA 4N9XA 4B67A 1PXCA 3I3LA 1N4UA 4J56A 2WOIA 4ENLA 3V5CA 2QA1A 3QSSA 3SQPA 4H2HA 1DOCA 3IHMA 1F3PA 4K7ZA 1GERA 3AE8A 2AKZA 1E39A 3SN0A 4K5SA 3V76A 3JSKA 2XFOA 4GDPA 4HYRA 2YR5A 1MUCA 3AM9A 2W3RA 5KMPA 1T3QC 1OJCA 3CT2A 1FL2A 1LV0A 4USRA 2QJNA 3CIRA 1ZMCA 3DJDA 4NEWA 1H82A 2XYOA 2FJDA 4NZHA 1RM6B 3NRZB 1N61C 3SQSA 1RVKA 4Z2UA 3DGBA 5FS9A 2W0HA 2YG4A 1VRQB 3TWBA 1GTEA 3BNUA 1SEZA 3DGHA 3AMZA 1LQTA 4U2TA 4H7UA 2AKMA 1E1NA 3FG2P 4H1ZA 2NQLA 1W6TA 4J1OA 3M0OA 1P2EA 4TLXA 1GSNA 4OPIA 2BXRA 3T9PA 2PYXA 3NZGA 2NPXA 4FK1A 4ZN0A 4A35A 2WESA 3NNEA 6ENLA 4HN8A 3NTDA 3G5SA 4DHGA 2C65A 1TE6A 3VRAA 3DERA 3NH3X 1D4CA 2BACA 2YM2A 3AE3A 3CNTA 3ETRB 2RGHA 1O94A 2AAQA 2RGOA 2WPFA 2VRMA 3SN4A 4BK1A 2BRAA 4GFIA 1CJ3A 3CGCA 4U8OA 4J34A 2C3CA 4E0VA 3ICTA 2XH2A 4YKFA 1JRPA 1FFVC 3UCCA 1SJBA 2QQ6A 4IVMB 4GF7A 4BJZA 4Z2RA 3P93A 1TYTA 4E5TA 3RHAA 3NO1A 3GDPA 3GMBA 3SX6A 4Z2TA 1GESA 3HYXA 2XFPA 1K0JA 3K1GA 5FS6A 3VFCA 2BCGG 2A87A 3AECA
chains in the Genus database with same CATH topology
4II2A 2VVLA 4A6NB 4Z44A 1NG4A 4RSLA 2XDOA 1AOGA 2FJEA 3RP7A 3IC9A 2OAMA 4J36A 4YWOA 1ZY8A 2ACZA 4C77A 2C4CA 1L0VA 2DKHA 2OALA 3D1CA 4A79A 5L46A 3NKSA 1PBBA 3AEBA 5C3JA 1TRBA 1IJHA 1X31B 3BI4A 4EIPA 2YLZA 1EL9A 1NEKA 4HA6A 2TPRA 3RP6A 4APNA 4M52A 2IVDA 5M10A 2WP9A 5TR3A 2WBAA 3H8IA 4JN9A 3UKQA 3NN0X 1PXAA 1YQZA 1GRHA 1CC4A 2R9ZA 1PXBA 1JOAA 3AEGA 2BK3A 4TM1A 1Q9IA 1ZK7A 3KD9A 1H7WA 1PDHA 3AEEA 1ZOYA 5KVIA 2PHHA 5HHFA 4EMIA 2E4GA 2YR4A 3AYLA 5JCMA 3UCLA 2R46A 5JCLA 1D7LA 1QJDA 2WDRA 3P9UA 4YSYA 1Q1WA 2CDUA 4BK2A 2GF3A 1GETA 2E5VA 4OCGA 1BGNA 2WHDA 2GAGB 3KPKA 4I59A 4JY2A 1COYA 4PAAA 4PABA 4U8LA 3P4RA 1N4WA 1CJCA 1S3EA 1Y56B 2V6OA 4U2LA 3OZ2A 3PVCA 1NHQA 3DGZA 4Z43A 1GRFA 1GTHA 2C70A 3LZWA 1JRYA 4A6NA 3ZDNA 3KKJA 4D03A 5C2TA 1PJ6A 3HYVA 4JY3A 2GQWA 2BABA 1CL0A 1H81A 3BI5A 3UTGA 1B37A 2HQMA 5JCIA 3OC4A 1CJ4A 3ICRA 1DODA 5KXJA 3LOVA 1B5QA 1S3BA 2R0PA 5KVHA 4U8JA 4YT0A 1BZLA 2JK6A 2EQ7A 3ALLA 2GR0A 3P4SA 1L9DA 2B9WA 1GREA 5BRTA 2C64A 3G5RA 3M12A 4IA6A 3PG6A 3NIXA 4DSGA 4GCMA 3H4KA 1DNCA 2WOWA 4ZCCA 2WETA 1D4DA 1F6MA 5JCKA 4LA1A 4Z24A 4U2SA 4BK3A 1JNRA 2YLSA 3UKPA 1ZP0A 3T14A 4OPUA 4CNKA 4UDRA 3AYIA 3T2ZA 1ELIA 3GYXA 5BULA 1FCDA 4AP3A 4B65A 5M0ZA 1IUUA 2C7GA 5EOWA 4H4RA 3COXA 1TDOA 4H4VA 2C66A 5KNLA 2ARDA 2C72A 3AB1A 2GR1A 1YY5A 3VRDB 4AOSA 1NPXA 1TYPA 1E1LA 4G9KA 4NTCA 1Y56A 4O5QA 4CRTA 5HXIA 3SZCA 4D04A 3UTEA 1IUTA 1CC2A 3QFBA 2C67A 5EB5A 1KF6A 2YLRA 4CY8A 1JU2A 3K7MX 2QA2A 1M64A 3NK2X 4UDQA 3AE6A 1ZX9A 3CNDA 2WPCA 2XVEA 3VR9A 1E1MA 2JAEA 4TM3A 5IQ4A 2BRYA 4OPTA 3CGBA 1JEHA 2QAEA 3VR8A 3S5WA 2VRLA 5FMHA 2IVEA 4B64A 2GMJA 4X4JA 1PN0A 4UP3A 3AE2A 1BGJA 3ATQA 1BF3A 2YLTA 2YM1A 3B3RA 3C96A 3EPTA 2WOVA 3SGLA 5EB4A 3HZLA 3UOZA 1CHUA 1JRXA 1ONFA 2WPEA 3UOVA 3AD7B 1VG0A 1GXFA 3C4NA 3GWDA 3KPFA 3CTYA 4IVOB 4TM4A 5CQFA 3AWIA 3AE7A 2CULA 2YG3A 4K8DA 2CVJA 5CKUA 5FS8A 2UZZA 1W4XA 4A65A 1K0LA 2WU5A 1NHSA 2XLPA 4H50A 4K2XA 3UTHA 4FDCB 2ZBWA 5U63A 4DGKA 2ZZCA 4JNAA 4H4ZA 4O5UA 3CGDA 4YSHA 1TDNA 3LB8A 2JB3A 4GR1A 3AD9B 1H86A 1YQ4A 1NDAA 3PO7A 3LXDA 1Q1RA 4AOXA 4H4PA 4CY6A 3D8XA 1YKJA 2WP5A 4GAVA 3GSIA 1IUSA 3DJJA 1DOEA 2VZ2A 4A5LA 4OVIA 4C3XA 1S7MA 1S2QA 4NEVA 1H2IA 4ECHA 5JCNA 3SFDA 4H4YA 1IUXA 4EMWA 4CCQA 4ICYA 3DK9A 3EAOA 4B69A 1XHCA 2WDVA 3REDA 1BKWA 4H4TA 1GV4A 2AR8A 3QFAA 1EL8A 2GRTA 4YTPA 2OA1A 2E1MA 1L9EA 3GRSA 3CMMA 4H2QA 3Q6JA 3DK4A 3AYJA 4B1BA 4YTNA 2X8HA 2YWLA 4WX1A 3CPIG 1VG9A 3UKLA 3SZ0A 4NTEA 4WCTA 5DBJA 3F8PA 4IV9A 4B68A 4Z25A 3AE1A 4G74A 3UOXA 4Y4NA 3AE5A 3F8RA 1NENA 1N4VA 1O95A 2VVMA 2YG7A 3ABVA 2GQFA 3S61A 1CBOA 3NYEA 3T2KA 4CNJA 4DSHA 3UOYA 1M6IA 4FX9A 4KPRA 3WE0A 4BV6A 4U8PA 2BS4A 4GAPA 1K4QA 4U8MA 3DA1A 1NHPA 1O5WA 4FK1C 4TLZA 1GPEA 2EQ6A 1QO8A 2Z5XA 4EQXA 2R4JA 1F8WA 1PBFA 1N1PA 3AD8B 3GWFA 1D5TA 4A99A 1B4VA 3CNPA 2XVFA 4C74A 2Q7VA 4G73A 1EBDA 1CJ2A 3SXIA 3CGEA 3DH9A 3II4A 2GVCA 4J2WA 2YVGA 3AEDA 4AP1A 4BURA 4C5OA 2IIDA 3NT6A 3L8KA 3FIMB 4XWZA 3GD4A 2H88A 3EANA 3NLCA 5KWFA 1TDEA 3CNJA 2XLRA 4X9NA 1GALA 3V3OA 1GRTA 2YG5A 4ADWA 3H8LA 4LIIA 2GR3A 3KA7A 4CBQA 5HY5A 3RNMA 2FJAA 1UKVG 2JBVA 2QCUA 1K0IA 2B76A 2BS3A 2XVHA 2YLXA 1BWCA 1DXLA 3LADA 2XCGA 1VDCA 4AT2A 1KNRA 2EQ9A 3UKHA 2WS3A 2WP6A 2BC1A 3C4AA 4II3A 4U8NA 2BC0A 1ZMDA 3CNSA 2X99A 2BYBA 1P2HA 1DJNA 1Z6LA 2XFNA 3IF9A 4USQA 2GR2A 1LQUA 4ZCDA 4OPLA 5HYMA 3QSEA 3QVPA 2GB0A 4BJYA 2R0CA 5KMRA 1S2YA 4X9MA 4B63A 3F8DA 3BNMA 5GRTA 2JB2A 1KNPA 2X3NA 4N9XA 4B67A 1PXCA 4CCRA 2NVKX 3I3LA 2RABA 5U1OA 1N4UA 4J56A 4MJWA 2WOIA 1IUWA 4H4QA 1OJDA 5U25A 1NHRA 1GRGA 4Z26A 1FEAA 4A7AA 3V3NA 4GDEA 4NWZA 3ITJA 1LPFA 1CC6A 3FMWA 1PS9A 4YSZA 3EF6A 1F8SA 4H4XA 2QA1A 3SQPA 3QSSA 1DOCA 1GOSA 2Q6UA 3IHMA 1GNDA 2C3DA 3AEFA 4JQ9A 2B7RA 4I58A 5BUKA 1F3PA 2WQYA 5KMQA 3GRTA 4K7ZA 3UTFA 3AEAA 2OLOA 1GERA 2B9YA 3AE8A 5IQ1A 3AXBA 3ALMA 5J60A 1CF3A 1E39A 4H4SA 4YKGA 4K5SA 3B6DA 3KLJA 3V76A 1REOA 5KRQA 1D7YA 1TDKA 2Q0KA 3JSKA 3P4QA 1ZOVA 3E1TA 2XFOA 4GDPA 1F8RA 4Y4MA 3NRNA 4J57A 2R4EA 4H2NA 3AE9A 2YR5A 4J33A 5JRBA 2XFUA 2WDQA 1E7PA 1NAAA 3NYFA 1EL7A 3BHKA 1MXTA 1JRZA 1KN0A 4JNQA 5KMPA 1OJCA 1RYIA 1OJAA 2V3AA 1JNZA 1KSSA 1XANA 1DOBA 4OPDA 3ALJA 4YSXA 1FL2A 1LV0A 4USRA 1KFYA 4AT0A 2ZZBA 3CIRA 3FPZA 1ZMCA 3D9XA 4NEWA 3DJDA 4GUVA 1IUVA 1H82A 3FBSA 2A8XA 3BHFA 2XYOA 3M13A 2FJDA 2FJBA 4NZHA 4H4UA 3ICSA 3NK1X 2BXSA 2FBWA 3Q9TA 1OJ9A 3HYWA 2YR6A 3IWAA 3UKKA 2XLSA 1PJ7A 2I0ZA 2Z5YA 2F5ZA 3UKFA 1RSGA 4EQRA 2R0GA 2VVLG 4Y4LA 4Z2UA 4RG3A 4KX6A 5FS9A 2W0HA 2GV8A 2YG4A 2YAUA 2EQ8A 1VRQB 4TM0A 3SZWA 3T37A 3UP5A 1H84A 1GTEA 3BNUA 4A9WA 1HYUA 4C3YA 5FS7A 1SEZA 3DGHA 4XXGA 1LQTA 3DK8A 1D4EA 3K7TA 2XVIA 4G6HA 4H7UA 4J31A 4U2TA 2CFYA 4B66A 3CPHG 4YXDA 1E1NA 3NGCX 3K7QX 3FG2P 1TDFA 2A89A 1NG3A 2BK4A 1DJQA 2C76A 3LZXA 4U8IA 5LV9A 2B9XA 2V61A 5GSNA 3ZYXA 3L5OA 1H83A 3M0OA 3R9UA 3T0KA 4IA5A 1P2EA 1QLBA 1EL5A 4TLXA 2C75A 1H6VA 4H2PA 4UDPA 1GSNA 3KVEA 1YQ3A 3NYCA 4OPIA 3O0HA 2BXRA 3UP4A 2PYXA 3NTAA 2V3BA 2YVJA 4EQSA 1XDIA 4EMJA 3K30A 3SFEA 3CN8A 4REKA 2NPXA 3SM8A 1B8SA 1H7XA 1XPQA 3DJGX 3KU9A 3P4PA 4FK1A 2BCPA 5J7XA 4ZN0A 2GEWA 3QJ4A 2WESA 2OLNA 2GAHB 2XFQA 2XLTA 4P9SA 3UKAA 3NNEA 4NTDA 2B7SA 1GRBA 3NTDA 2GMHA 3DJEA 2BK5A 5EBKA 2C73A 1L9CA 3G5SA 2WU2A 1V59A 4OPGA 5KOXA 2C65A 3VRAA 4GRTA 3NH3X 1D4CA 2BACA 2YM2A 3AE3A 4JDRA 4H4WA 2VOUA 3CNTA 1PBEA 3GD3A 1PBCA 4HB9A 5ER0A 3ISHA 3SY4A 2TMDA 3P1WA 4EM3A 2RGHA 1O94A 2V5ZA 2AAQA 1LTXR 3AE4A 4K22A 5BVAA 2RGOA 2WPFA 2JB1A 3QVRA 3SYIA 3GMCA 2RGJA 2VRMA 2YLWA 2R45A 2YG6A 4BK1A 1PBDA 2BRAA 3L1RA 4H2RA 2VQBA 4NNJA 4U8KA 1CJ3A 2XVJA 3NHOX 3CGCA 3LJPA 4U8OA 3T31A 2J3NA 3G5QA 2ZZ0A 1GT8A 2X8GA 1GRAA 1RP0A 2C3CA 2BS2A 4J34A 4E0VA 3ATRA 4XWRA 5KOWA 4LU6A 3ICTA 2GH5A 3RP8A 1ZKQA 2JKCA 2XLUA 3PS9A 3NK0X 4YKFA 2DKIA 2AQJA 3ADAB 3VQRA 5KMSA 3QSMA 1OJTA 4EIQA 3IHGA 1FEBA 5IPYA 1LVLA 1ZDLA 2V60A 4IVMB 2O9ZA 3GDNA 4GF7A 4DNAA 2VQ7A 4YTMA 4BJZA 1LJ1A 4Z2RA 4K5RA 1TYTA 2YQUA 1Y0PA 2YVFA 2BA9A 3RHAA 1VQWA 4G6GA 1FECA 3SZFA 1PJ5A 3GYJA 3NN6X 3GDPA 1PHHA 3GMBA 3NG7X 1FOHA 3SX6A 4EQWA 2X50A 1MOKA 3URHA 1KDGA 4RG4A 3VRBA 3BI2A 4Z2TA 1GESA 2X8CA 2Y6RA 2Y6QA 3I6DA 3T2YA 3HYXA 1MO9A 4EM4A 1E6EA 2XFPA 1K0JA 2Q0LA 1KSUA 3DMEA 4OPCA 5FS6A 2APGA 1E1KA 2BCGG 1GEUA 3CPJG 2A87A 3AECA 2WEUA 2H89A 3GYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VVL A;  4A6N B;  4Z44 A;  1NG4 A;  4RSL A;  2XDO A;  1AOG A;  2FJE A;  3RP7 A;  3IC9 A;  2OAM A;  4J36 A;  4YWO A;  1ZY8 A;  2ACZ A;  4C77 A;  1L0V A;  2DKH A;  2OAL A;  3D1C A;  4A79 A;  5L46 A;  3NKS A;  1PBB A;  3AEB A;  5C3J A;  1TRB A;  1IJH A;  1X31 B;  3BI4 A;  4EIP A;  2YLZ A;  1EL9 A;  1NEK A;  4HA6 A;  2TPR A;  3RP6 A;  4APN A;  4M52 A;  2IVD A;  5M10 A;  2WP9 A;  5TR3 A;  2WBA A;  3H8I A;  4JN9 A;  3UKQ A;  3NN0 X;  1PXA A;  1YQZ A;  1GRH A;  1CC4 A;  2R9Z A;  1PXB A;  1JOA A;  3AEG A;  2BK3 A;  4TM1 A;  1Q9I A;  1ZK7 A;  3KD9 A;  1H7W A;  1PDH A;  3AEE A;  1ZOY A;  5KVI A;  2PHH A;  5HHF A;  4EMI A;  2E4G A;  2YR4 A;  3AYL A;  5JCM A;  3UCL A;  2R46 A;  5JCL A;  1D7L A;  1QJD A;  2WDR A;  3P9U A;  4YSY A;  1Q1W A;  2CDU A;  4BK2 A;  2GF3 A;  1GET A;  2E5V A;  4OCG A;  1BGN A;  2WHD A;  2GAG B;  4I59 A;  4JY2 A;  4PAB A;  1COY A;  4PAA A;  4U8L A;  3P4R A;  1N4W A;  1CJC A;  1S3E A;  1Y56 B;  2V6O A;  4U2L A;  3OZ2 A;  3PVC A;  1NHQ A;  3DGZ A;  4Z43 A;  1GRF A;  1GTH A;  2C70 A;  3LZW A;  1JRY A;  4A6N A;  3ZDN A;  3KKJ A;  4D03 A;  5C2T A;  1PJ6 A;  4JY3 A;  2GQW A;  2BAB A;  1CL0 A;  1H81 A;  3BI5 A;  3UTG A;  1B37 A;  2HQM A;  5JCI A;  3OC4 A;  1CJ4 A;  3ICR A;  1DOD A;  5KXJ A;  3LOV A;  1B5Q A;  1S3B A;  2R0P A;  5KVH A;  4U8J A;  4YT0 A;  1BZL A;  2JK6 A;  2EQ7 A;  3ALL A;  2GR0 A;  3P4S A;  1L9D A;  2B9W A;  1GRE A;  5BRT A;  2C64 A;  3G5R A;  3M12 A;  4IA6 A;  3NIX A;  4DSG A;  4GCM A;  3H4K A;  1DNC A;  2WOW A;  4ZCC A;  2WET A;  1D4D A;  1F6M A;  5JCK A;  4LA1 A;  4Z24 A;  4U2S A;  4BK3 A;  1JNR A;  2YLS A;  3UKP A;  1ZP0 A;  4CNK A;  4OPU A;  4UDR A;  3AYI A;  1ELI A;  5BUL A;  1FCD A;  4AP3 A;  4B65 A;  5M0Z A;  1IUU A;  2C7G A;  5EOW A;  4H4R A;  3COX A;  1TDO A;  4H4V A;  2C66 A;  2ARD A;  2C72 A;  3AB1 A;  2GR1 A;  1YY5 A;  3VRD B;  4AOS A;  1NPX A;  1TYP A;  1E1L A;  4NTC A;  4O5Q A;  1Y56 A;  4CRT A;  5HXI A;  4D04 A;  3UTE A;  1IUT A;  1CC2 A;  3QFB A;  2C67 A;  5EB5 A;  1KF6 A;  2YLR A;  4CY8 A;  1JU2 A;  3K7M X;  2QA2 A;  1M64 A;  3NK2 X;  4UDQ A;  3AE6 A;  1ZX9 A;  3CND A;  2WPC A;  2XVE A;  3VR9 A;  1E1M A;  2JAE A;  4TM3 A;  5IQ4 A;  4OPT A;  3CGB A;  1JEH A;  2QAE A;  3VR8 A;  3S5W A;  2VRL A;  5FMH A;  2IVE A;  4B64 A;  2GMJ A;  4X4J A;  1PN0 A;  4UP3 A;  3AE2 A;  1BGJ A;  3ATQ A;  1BF3 A;  2YLT A;  2YM1 A;  3B3R A;  3C96 A;  3EPT A;  2WOV A;  3SGL A;  5EB4 A;  3HZL A;  3UOZ A;  1CHU A;  1JRX A;  1ONF A;  2WPE A;  3UOV A;  3AD7 B;  1VG0 A;  1GXF A;  3C4N A;  3GWD A;  3KPF A;  3CTY A;  4IVO B;  4TM4 A;  5CQF A;  3AWI A;  3AE7 A;  2CUL A;  2YG3 A;  4K8D A;  2CVJ A;  5CKU A;  5FS8 A;  2UZZ A;  1W4X A;  4A65 A;  1K0L A;  2WU5 A;  1NHS A;  2XLP A;  4H50 A;  4K2X A;  3UTH A;  4FDC B;  2ZBW A;  5U63 A;  4DGK A;  2ZZC A;  4JNA A;  4H4Z A;  4O5U A;  3CGD A;  4YSH A;  1TDN A;  3LB8 A;  2JB3 A;  4GR1 A;  3AD9 B;  1H86 A;  1YQ4 A;  1NDA A;  3PO7 A;  3LXD A;  1Q1R A;  4AOX A;  4H4P A;  4CY6 A;  3D8X A;  1YKJ A;  2WP5 A;  3GSI A;  1IUS A;  3DJJ A;  1DOE A;  2VZ2 A;  4A5L A;  4OVI A;  4C3X A;  1S2Q A;  4NEV A;  4ECH A;  5JCN A;  3SFD A;  4H4Y A;  1IUX A;  4EMW A;  4CCQ A;  4ICY A;  3DK9 A;  3EAO A;  4B69 A;  1XHC A;  2WDV A;  3RED A;  1BKW A;  4H4T A;  1GV4 A;  2AR8 A;  3QFA A;  1EL8 A;  2GRT A;  4YTP A;  2OA1 A;  2E1M A;  1L9E A;  3GRS A;  4H2Q A;  3Q6J A;  3DK4 A;  3AYJ A;  4B1B A;  4YTN A;  2X8H A;  2YWL A;  4WX1 A;  3CPI G;  1VG9 A;  3UKL A;  4NTE A;  4WCT A;  5DBJ A;  3F8P A;  4IV9 A;  4B68 A;  4Z25 A;  3AE1 A;  3UOX A;  4Y4N A;  3AE5 A;  3F8R A;  1NEN A;  1N4V A;  1O95 A;  2VVM A;  2YG7 A;  3ABV A;  2GQF A;  3S61 A;  1CBO A;  3NYE A;  4CNJ A;  4DSH A;  3UOY A;  1M6I A;  4FX9 A;  4KPR A;  3WE0 A;  4BV6 A;  4U8P A;  2BS4 A;  1K4Q A;  4U8M A;  3DA1 A;  1NHP A;  1O5W A;  4FK1 C;  4TLZ A;  1GPE A;  2EQ6 A;  1QO8 A;  2Z5X A;  4EQX A;  2R4J A;  1F8W A;  1PBF A;  1N1P A;  3AD8 B;  3GWF A;  1D5T A;  4A99 A;  1B4V A;  3CNP A;  2XVF A;  4C74 A;  2Q7V A;  1EBD A;  1CJ2 A;  3CGE A;  3DH9 A;  3II4 A;  2GVC A;  4J2W A;  2YVG A;  3AED A;  4AP1 A;  4BUR A;  4C5O A;  2IID A;  3NT6 A;  3L8K A;  3FIM B;  4XWZ A;  3GD4 A;  2H88 A;  3EAN A;  3NLC A;  5KWF A;  1TDE A;  3CNJ A;  2XLR A;  4X9N A;  1GAL A;  3V3O A;  1GRT A;  2YG5 A;  4ADW A;  3H8L A;  4LII A;  2GR3 A;  3KA7 A;  4CBQ A;  5HY5 A;  3RNM A;  2FJA A;  1UKV G;  2JBV A;  2QCU A;  1K0I A;  2B76 A;  2BS3 A;  2XVH A;  2YLX A;  1BWC A;  1DXL A;  3LAD A;  2XCG A;  1VDC A;  4AT2 A;  1KNR A;  2EQ9 A;  3UKH A;  2WS3 A;  2WP6 A;  2BC1 A;  3C4A A;  4U8N A;  2BC0 A;  1ZMD A;  3CNS A;  2X99 A;  2BYB A;  1P2H A;  1DJN A;  1Z6L A;  2XFN A;  3IF9 A;  4USQ A;  2GR2 A;  1LQU A;  4ZCD A;  4OPL A;  5HYM A;  3QSE A;  3QVP A;  2GB0 A;  4BJY A;  2R0C A;  1S2Y A;  4X9M A;  4B63 A;  3F8D A;  3BNM A;  5GRT A;  2JB2 A;  1KNP A;  2X3N A;  4N9X A;  4B67 A;  1PXC A;  4CCR A;  2NVK X;  3I3L A;  2RAB A;  5U1O A;  1N4U A;  4J56 A;  4MJW A;  2WOI A;  1IUW A;  4H4Q A;  1OJD A;  5U25 A;  1NHR A;  1GRG A;  4Z26 A;  1FEA A;  4A7A A;  3V3N A;  4GDE A;  3ITJ A;  1LPF A;  1CC6 A;  3FMW A;  1PS9 A;  4YSZ A;  3EF6 A;  1F8S A;  4H4X A;  2QA1 A;  3SQP A;  3QSS A;  1DOC A;  1GOS A;  2Q6U A;  3IHM A;  1GND A;  2C3D A;  3AEF A;  4JQ9 A;  2B7R A;  4I58 A;  5BUK A;  1F3P A;  2WQY A;  3GRT A;  4K7Z A;  3UTF A;  3AEA A;  2OLO A;  1GER A;  2B9Y A;  3AE8 A;  5IQ1 A;  3AXB A;  3ALM A;  5J60 A;  1CF3 A;  1E39 A;  4H4S A;  4YKG A;  4K5S A;  3B6D A;  3KLJ A;  3V76 A;  1REO A;  5KRQ A;  1D7Y A;  1TDK A;  2Q0K A;  3JSK A;  3P4Q A;  1ZOV A;  3E1T A;  2XFO A;  4GDP A;  1F8R A;  4Y4M A;  3NRN A;  4J57 A;  2R4E A;  4H2N A;  3AE9 A;  2YR5 A;  4J33 A;  2XFU A;  2WDQ A;  1E7P A;  1NAA A;  3NYF A;  1EL7 A;  3BHK A;  1MXT A;  1JRZ A;  4JNQ A;  1OJC A;  1RYI A;  1OJA A;  2V3A A;  1JNZ A;  1KSS A;  1XAN A;  1DOB A;  4OPD A;  3ALJ A;  4YSX A;  1FL2 A;  1LV0 A;  4USR A;  1KFY A;  4AT0 A;  2ZZB A;  3CIR A;  3FPZ A;  1ZMC A;  3DJD A;  4NEW A;  4GUV A;  1IUV A;  1H82 A;  3FBS A;  2A8X A;  3BHF A;  2XYO A;  3M13 A;  2FJD A;  2FJB A;  4NZH A;  4H4U A;  3ICS A;  3NK1 X;  2BXS A;  2FBW A;  3Q9T A;  1OJ9 A;  2YR6 A;  3IWA A;  3UKK A;  2XLS A;  1PJ7 A;  2I0Z A;  2Z5Y A;  2F5Z A;  3UKF A;  1RSG A;  4EQR A;  2R0G A;  2VVL G;  4Y4L A;  4Z2U A;  4RG3 A;  4KX6 A;  5FS9 A;  2W0H A;  2GV8 A;  2YG4 A;  2YAU A;  2EQ8 A;  1VRQ B;  4TM0 A;  3UP5 A;  3T37 A;  1H84 A;  1GTE A;  3BNU A;  4A9W A;  1HYU A;  4C3Y A;  5FS7 A;  1SEZ A;  3DGH A;  4XXG A;  1LQT A;  3DK8 A;  1D4E A;  3K7T A;  2XVI A;  4J31 A;  4H7U A;  4U2T A;  2CFY A;  4B66 A;  3CPH G;  4YXD A;  1E1N A;  3NGC X;  3K7Q X;  3FG2 P;  1TDF A;  2A89 A;  1NG3 A;  2BK4 A;  1DJQ A;  2C76 A;  3LZX A;  4U8I A;  5LV9 A;  2B9X A;  2V61 A;  5GSN A;  3ZYX A;  1H83 A;  3M0O A;  3R9U A;  4IA5 A;  1P2E A;  1QLB A;  1EL5 A;  4TLX A;  2C75 A;  1H6V A;  4H2P A;  4UDP A;  1GSN A;  3KVE A;  1YQ3 A;  3NYC A;  4OPI A;  3O0H A;  2BXR A;  3UP4 A;  2PYX A;  3NTA A;  4EQS A;  2YVJ A;  2V3B A;  1XDI A;  4EMJ A;  3K30 A;  3SFE A;  3CN8 A;  4REK A;  2NPX A;  3SM8 A;  1B8S A;  1H7X A;  1XPQ A;  3DJG X;  3KU9 A;  3P4P A;  4FK1 A;  2BCP A;  5J7X A;  4ZN0 A;  2GEW A;  3QJ4 A;  2WES A;  2OLN A;  2GAH B;  2XFQ A;  2XLT A;  4P9S A;  3UKA A;  3NNE A;  4NTD A;  2B7S A;  1GRB A;  3NTD A;  2GMH A;  3DJE A;  2BK5 A;  5EBK A;  2C73 A;  1L9C A;  3G5S A;  2WU2 A;  1V59 A;  4OPG A;  5KOX A;  2C65 A;  3VRA A;  4GRT A;  3NH3 X;  1D4C A;  2BAC A;  2YM2 A;  3AE3 A;  4JDR A;  4H4W A;  2VOU A;  3CNT A;  1PBE A;  3GD3 A;  1PBC A;  4HB9 A;  5ER0 A;  3ISH A;  2TMD A;  3P1W A;  4EM3 A;  2RGH A;  1O94 A;  2V5Z A;  1LTX R;  2AAQ A;  3AE4 A;  4K22 A;  5BVA A;  2RGO A;  2WPF A;  2JB1 A;  3QVR A;  3GMC A;  2RGJ A;  2VRM A;  2YLW A;  2R45 A;  2YG6 A;  4BK1 A;  1PBD A;  4H2R A;  3L1R A;  2VQB A;  4U8K A;  1CJ3 A;  2XVJ A;  3NHO X;  3CGC A;  3LJP A;  4U8O A;  2J3N A;  3G5Q A;  2ZZ0 A;  1GT8 A;  2X8G A;  1GRA A;  1RP0 A;  2C3C A;  2BS2 A;  4J34 A;  4E0V A;  3ATR A;  4XWR A;  5KOW A;  4LU6 A;  3ICT A;  2GH5 A;  3RP8 A;  1ZKQ A;  2JKC A;  2XLU A;  3PS9 A;  3NK0 X;  4YKF A;  2DKI A;  2AQJ A;  3ADA B;  3VQR A;  3QSM A;  1OJT A;  4EIQ A;  3IHG A;  1FEB A;  5IPY A;  1LVL A;  1ZDL A;  2V60 A;  4IVM B;  2O9Z A;  3GDN A;  4GF7 A;  4DNA A;  2VQ7 A;  4YTM A;  4BJZ A;  1LJ1 A;  4Z2R A;  4K5R A;  1TYT A;  2YQU A;  1Y0P A;  2YVF A;  2BA9 A;  3RHA A;  1VQW A;  1FEC A;  1PJ5 A;  3GYJ A;  3NN6 X;  3GDP A;  1PHH A;  3GMB A;  3NG7 X;  1FOH A;  4EQW A;  2X50 A;  1MOK A;  3URH A;  1KDG A;  4RG4 A;  3VRB A;  3BI2 A;  4Z2T A;  1GES A;  2X8C A;  2Y6R A;  2Y6Q A;  3I6D A;  1MO9 A;  4EM4 A;  1E6E A;  2XFP A;  1K0J A;  2Q0L A;  1KSU A;  3DME A;  4OPC A;  5FS6 A;  2APG A;  1E1K A;  2BCG G;  1GEU A;  3CPJ G;  2A87 A;  3AEC A;  2WEU A;  2H89 A;  3GYI A; 
#chains in the Genus database with same CATH topology
 4II2 A;  2VVL A;  1NG4 A;  3RP7 A;  4YWO A;  2ACZ A;  3D1C A;  4A79 A;  4GGB A;  1X31 B;  1EL9 A;  3RP6 A;  4APN A;  4M52 A;  2W3S A;  2WBA A;  3UKQ A;  1YQZ A;  1DTN A;  2R9Z A;  3NFU A;  3AEG A;  1JPD X;  2BK3 A;  2OX4 A;  1ZK7 A;  1PDH A;  3AEE A;  5HHF A;  5JCL A;  3P9U A;  2WDR A;  1MNS A;  1Q1W A;  2MNR A;  3A7U A;  1FIQ B;  4PAB A;  3FV9 A;  1COY A;  1N4W A;  3DGZ A;  4Z43 A;  3LZW A;  4JY3 A;  1KKR A;  2GQW A;  1CL0 A;  3BI5 A;  5JCI A;  4M6U A;  3LOV A;  4YT0 A;  2B9W A;  1GRE A;  2C64 A;  3M12 A;  4IA6 A;  3PG6 A;  3FCP A;  4ZCC A;  1STZ A;  1F6M A;  2CHR A;  4LA1 A;  4BK3 A;  4CNK A;  4OPU A;  3AYI A;  5BUL A;  3TJI A;  5M0Z A;  5EOW A;  1TZZ A;  4H4R A;  3COX A;  1TDO A;  5HXI A;  4D04 A;  4UDQ A;  2JAE A;  4TM3 A;  2BRY A;  4OPT A;  3SSZ A;  2IVE A;  1PN0 A;  4UP3 A;  2GGG A;  3HZL A;  3HPF A;  1ONF A;  2WPE A;  3UOV A;  3CTY A;  3AWI A;  3D47 A;  3AE7 A;  5CKU A;  2AL2 A;  2CVJ A;  4GYP C;  1W4X A;  3QN3 A;  1NHS A;  4K2X A;  3V5F A;  3H70 A;  4O5U A;  2OQH A;  3CGD A;  1YQ4 A;  4H4P A;  2PTY A;  3DJJ A;  4OVI A;  1S7M A;  3SFD A;  4H4Y A;  4MMW A;  3EAO A;  4HNL A;  3QFA A;  1EL8 A;  2GRT A;  2OA1 A;  3Q6J A;  3H12 A;  4B1B A;  2X8H A;  3UGV A;  3SZ0 A;  3A7A A;  3F8P A;  1XS2 A;  1NEN A;  1M6I A;  4H83 A;  3N4E A;  1O5W A;  2HXT A;  4TLZ A;  1F8W A;  1XPY A;  2XVF A;  5FJR A;  2GVC A;  3AED A;  3NT6 A;  3L8K A;  3NLC A;  1TDE A;  3CNJ A;  2P8B A;  3CK5 A;  1GRT A;  2YG5 A;  4ADW A;  3KA7 A;  2FJA A;  2QCU A;  2YLX A;  4E4F A;  3C4A A;  2BC1 A;  4U8N A;  1OEP A;  3CNS A;  1DJN A;  1Z6L A;  3IF9 A;  1LQU A;  2P0I A;  5HYM A;  2W54 A;  5KMR A;  1S2Y A;  4B63 A;  3R1Z A;  1IUW A;  4H4Q A;  4Z26 A;  4A7A A;  3V3N A;  3I4K A;  4GDE A;  1LPF A;  1CC6 A;  4YSZ A;  2Q6U A;  1GND A;  2C3D A;  3AEF A;  4JQ9 A;  2WQY A;  3AN1 A;  1KD0 A;  3OW1 A;  2GGI A;  3P4Q A;  1F8R A;  2FYM A;  1NAA A;  3NYF A;  4GYP A;  3VA8 A;  1EL7 A;  3BHK A;  1MXT A;  3NXL A;  4JNQ A;  3DG3 A;  2PMQ A;  1RYI A;  2QDD A;  1OJA A;  1R0M A;  1ZXI C;  3U9I A;  1JNZ A;  1KSS A;  4FP1 A;  1XAN A;  3ALJ A;  3MWC A;  3U4F A;  1KFY A;  4X2P A;  2ZZB A;  3D9X A;  1EBG A;  4GUV A;  4ROP A;  3FBS A;  3M13 A;  2A8X A;  2OZT A;  3VC5 A;  2FJB A;  3UJR A;  1L8P A;  3NK1 X;  2FBW A;  4DWD A;  3IWA A;  3UKK A;  3B9J B;  2F5Z A;  4K1W A;  4EQR A;  2VVL G;  4RG3 A;  2GV8 A;  3T37 A;  1HYU A;  3DK8 A;  1D4E A;  4YXD A;  3NGC X;  1TDF A;  1DJQ A;  3UJF A;  5GSN A;  2ONE A;  4MGG A;  3ZYX A;  3R9U A;  4E8G A;  1QLB A;  1EL5 A;  4UDP A;  1H6V A;  2GSH A;  4HNC A;  4EQS A;  1XDI A;  3K30 A;  3SFE A;  4REK A;  3DIP A;  1B8S A;  3SM8 A;  1H7X A;  3DJG X;  4IZG A;  2OLA A;  3NVY B;  3R25 A;  2OLN A;  2GAH B;  2XFQ A;  1TKK A;  4P9S A;  3UKA A;  2OKT A;  4NTD A;  2BK5 A;  1L9C A;  2WU2 A;  1V59 A;  4OPG A;  5KOX A;  2I5Q A;  3ZVH B;  4JDR A;  1PBE A;  4DXK A;  3ISH A;  3P1W A;  1ONE A;  4KWS A;  1N63 C;  2V5Z A;  4TVY A;  4K22 A;  5BVA A;  2JB1 A;  3PWI A;  4IL2 A;  4U8K A;  3NHO X;  4K8G A;  3HRD C;  3T31 A;  2ZZ0 A;  3UJ2 A;  1GRA A;  1RP0 A;  3ATR A;  3IJQ A;  4LU6 A;  3R10 A;  1ZKQ A;  3NK0 X;  2DKI A;  3VQR A;  5KMS A;  3Q45 A;  1FEB A;  5IPY A;  1ZDL A;  3S5S A;  3PK7 A;  4YTM A;  3GDN A;  4DNA A;  2VQ7 A;  2OFJ A;  2YVF A;  1VQW A;  4G6G A;  1FEC A;  3SZF A;  3NN6 X;  1FOH A;  3KUM A;  2GDQ A;  1MOK A;  3URH A;  4H19 A;  3BI2 A;  2Y6Q A;  3T6C A;  4EM4 A;  2Q0L A;  1KSU A;  3DFH A;  5ENL A;  2APG A;  1GEU A;  1NEL A;  4ZCW A;  2H89 A;  3GYI A;  1FHU A;  4Z44 A;  2FJE A;  2C4C A;  2DKH A;  2FKP A;  1IJH A;  4EIP A;  2YLZ A;  1NU5 A;  3V4B A;  5TR3 A;  1PXA A;  1CC4 A;  5FJT A;  1Q9I A;  3KD9 A;  3VC6 A;  2YR4 A;  3ENL A;  3CYJ A;  2PTW A;  4BK2 A;  1GET A;  1BGN A;  4U8L A;  4PAA A;  3NVZ B;  1S3E A;  3DES A;  1Y56 B;  3EEZ A;  3IK4 A;  1NHQ A;  1JRY A;  3KKJ A;  1SJC A;  5C2T A;  2BAB A;  1H81 A;  3UTG A;  1B37 A;  2HQM A;  3ICR A;  3OC4 A;  1DOD A;  5KVH A;  1BZL A;  2OZ8 A;  3NIX A;  4GCM A;  3H4K A;  1DNC A;  1D4D A;  2YLS A;  3BJS A;  3T14 A;  3OTR A;  1FCD A;  3UXL A;  4AP3 A;  4B65 A;  2P3Z A;  1IUU A;  3TWA A;  4H4V A;  3AB1 A;  1YY5 A;  4CRT A;  1NPX A;  4O5Q A;  2QGY A;  3UTE A;  1CC2 A;  2C67 A;  1JU2 A;  3ZLF A;  1ZX9 A;  2WPC A;  2XVE A;  1E1M A;  1JPM A;  5IQ4 A;  3MUC A;  3CGB A;  3VR8 A;  3S5W A;  4G8T A;  4B64 A;  2GMJ A;  3GD6 A;  3OPS A;  1BGJ A;  3ATQ A;  2YLT A;  2YM1 A;  4DN1 A;  2WOV A;  3SGL A;  3TW9 A;  3UOZ A;  1JRX A;  3AD7 B;  1VG0 A;  3KPF A;  2P88 A;  5CQF A;  4K8D A;  4IP5 A;  2WU5 A;  2GL5 A;  3UTH A;  4FDC B;  3RIT A;  2P8C A;  4EWJ A;  3ZLH A;  3LB8 A;  2GGH A;  3LXD A;  1Q1R A;  3JW7 A;  4JHM A;  2QJJ A;  3GSI A;  1IUS A;  1DOE A;  4C3X A;  4GIR A;  4ECH A;  1EC8 A;  4EMW A;  4CCQ A;  2AR8 A;  4YTP A;  4H2Q A;  3GRS A;  2YWL A;  3S47 A;  3UKL A;  4E6M A;  4MKS A;  4NTE A;  4WCT A;  4IV9 A;  4B68 A;  3AE1 A;  4G74 A;  3F8R A;  1N4V A;  2BS4 A;  3TQP A;  2Z5X A;  3GWF A;  1N1P A;  3QLD A;  1B4V A;  2Q7V A;  3SXI A;  3II4 A;  2YVG A;  4AP1 A;  4C5O A;  3FIM B;  3GD4 A;  5EU9 A;  5KWF A;  3H8L A;  2GR3 A;  2PGW A;  2JBV A;  2BS3 A;  3T4W A;  1ELS A;  3UKH A;  1ZMD A;  2QJM A;  2XFN A;  4ZCD A;  2GB0 A;  4X9M A;  2JB2 A;  1KNP A;  2X3N A;  4CCR A;  5U1O A;  1OJD A;  5U25 A;  2OPJ A;  1NHR A;  1GRG A;  2PGE A;  3UJE A;  1FEA A;  1MDL A;  3DFY A;  3ITJ A;  3FMW A;  1PS9 A;  2XSX A;  4KPL A;  3EF6 A;  1WUE A;  4H4X A;  1GOS A;  1VDV A;  4I58 A;  5BUK A;  5KMQ A;  3GRT A;  3AEA A;  2OLO A;  5IDZ A;  5IQ1 A;  2HXU A;  3AXB A;  5J60 A;  1CF3 A;  4YKG A;  3B6D A;  2PCE A;  3SBF A;  1REO A;  5KRQ A;  1TDK A;  2Q0K A;  3E1T A;  3NRN A;  4J57 A;  2R4E A;  5JRB A;  1E7P A;  1FO4 A;  3TCS A;  1EC9 A;  1DOB A;  4OPD A;  4YSX A;  3FPZ A;  1IUV A;  3BHF A;  2BXS A;  1OJ9 A;  3HYW A;  2XLS A;  1PJ7 A;  2I0Z A;  5G5H B;  2Z5Y A;  3UKF A;  4GME A;  2R0G A;  3TOY A;  3HW2 A;  4Y4L A;  4KX6 A;  2YAU A;  4TM0 A;  3UP5 A;  4A9W A;  4C3Y A;  5FS7 A;  4XXG A;  4J31 A;  2XVI A;  2CFY A;  3CPH G;  3K7Q X;  2BK4 A;  1NG3 A;  5LV9 A;  2C76 A;  3LZX A;  4U8I A;  3L5O A;  1H83 A;  3FVD A;  3T0K A;  3CAW A;  4IA5 A;  2C75 A;  4H2P A;  3NYC A;  3UP4 A;  3NTA A;  2YVJ A;  4EMJ A;  3KU9 A;  3P4P A;  3MZN A;  3CXO A;  2OVL A;  5EBK A;  3DDM A;  3DG7 A;  3TTE A;  2XH0 A;  1KKO A;  3IJI A;  3R0U A;  4IL0 A;  1MDR A;  1PBC A;  3ZVI A;  2TMD A;  3SY4 A;  4EM3 A;  3AE4 A;  2E3T A;  2HNE A;  3H7V A;  2RGJ A;  2YG6 A;  3JVA A;  3L1R A;  4NNJ A;  2XVJ A;  4KT2 A;  3G5Q A;  1GT8 A;  2X8G A;  4XWR A;  3MSY A;  5KOW A;  2JKC A;  2XLU A;  3PS9 A;  3QSM A;  1OJT A;  2PPG A;  1LVL A;  3R11 A;  3ZVH A;  1LJ1 A;  4K5R A;  3VCN A;  2YQU A;  3NVW B;  2BA9 A;  3I6E A;  4GIS A;  1PJ5 A;  3GYJ A;  3PWG A;  2XGZ A;  3NG7 X;  4EQW A;  1SJA A;  2OG9 A;  4RG4 A;  2Y6R A;  4DX3 A;  4OPC A;  3T8Q A;  3EKG A;  1E1K A;  3CPJ G;  2PSN A;  2WEU A;  4A6N B;  4RSL A;  2OAM A;  3IJL A;  1L0V A;  3NKS A;  3AEB A;  5C3J A;  1TRB A;  3MQT A;  3BI4 A;  2DW6 A;  2GGE A;  2TPR A;  5M10 A;  2WP9 A;  2PP3 A;  3CB3 A;  2QVH A;  3NN0 X;  1PXB A;  1ZOY A;  3GC2 A;  3MY9 A;  4EMI A;  2E4G A;  3AYL A;  5JCM A;  4YSY A;  2GF3 A;  3KPK A;  2DW7 A;  2GGJ A;  1CJC A;  5BOF A;  2V6O A;  3OZ2 A;  3FJ4 A;  2PTX A;  3ZDN A;  4D03 A;  1PJ6 A;  4Z1Y A;  1B5Q A;  1S3B A;  4U8J A;  2JK6 A;  1X2G A;  2EQ7 A;  2PTZ A;  3ALL A;  3P4S A;  3MKC A;  3SR6 B;  3DEQ A;  2WOW A;  5G5G B;  5JCK A;  4Z24 A;  3QTP A;  1JNR A;  3UKP A;  1ZP0 A;  3RR1 A;  3T2Z A;  1ELI A;  2C7G A;  2C66 A;  5KNL A;  2C72 A;  2GR1 A;  3BSM A;  4AOS A;  1E1L A;  4NTC A;  1Y56 A;  1WUF A;  1IUT A;  3QFB A;  3OP2 A;  3K7M X;  1M64 A;  3AE6 A;  3CND A;  1SB3 B;  2QAE A;  3FYY A;  1BF3 A;  3B3R A;  3C96 A;  1JRO A;  3C4N A;  3GWD A;  4IVO B;  4TM4 A;  2CUL A;  2YG3 A;  5FS8 A;  2E5A A;  4A65 A;  4H50 A;  4DGK A;  2ZBW A;  5U63 A;  2ZZC A;  4YWS A;  4H4Z A;  1VQZ A;  4YSH A;  1ECQ A;  1TDN A;  1F9C A;  1H86 A;  7ENL A;  4CY6 A;  3D8X A;  1YKJ A;  2WP5 A;  1V97 A;  2MUC A;  4A5L A;  2PU0 A;  5FJO A;  4NEV A;  3UXK A;  5BOE A;  1IUX A;  4ICY A;  4B69 A;  2WDV A;  1BKW A;  1GV4 A;  3OZM A;  2E1M A;  3PFR A;  1L9E A;  3AYJ A;  3SN1 A;  3N6J A;  4WX1 A;  3CPI G;  5FJU A;  4KEM A;  3UOX A;  4Y4N A;  2OQY A;  2YG7 A;  3ABV A;  2GQF A;  3NS1 B;  4CNJ A;  4DSH A;  4FX9 A;  4BV6 A;  4U8M A;  3DA1 A;  1NHP A;  2EQ6 A;  4EQX A;  2R4J A;  1D5T A;  3CNP A;  4G73 A;  4A3R A;  4HCL A;  2PS2 A;  1CJ2 A;  3DH9 A;  4J2W A;  2IID A;  4XWZ A;  2H88 A;  2XLR A;  1GAL A;  5HY5 A;  4LII A;  3RNM A;  1UKV G;  1K0I A;  2B76 A;  2XVH A;  1BWC A;  1DXL A;  2XCG A;  3OZY A;  4II3 A;  2BC0 A;  2X99 A;  3QVP A;  3F8D A;  3BNM A;  5GRT A;  2NVK X;  2RAB A;  1BQG A;  4MJW A;  4NWZ A;  3SJN A;  1F8S A;  2B7R A;  3UTF A;  2B9Y A;  4FI4 A;  3ALM A;  4H4S A;  4ZOH B;  3KLJ A;  3D46 A;  1D7Y A;  4IHC A;  1P48 A;  3TJ4 A;  1ZOV A;  4Y4M A;  4H2N A;  3AE9 A;  4J33 A;  2XFU A;  2WDQ A;  1JRZ A;  1KN0 A;  2V3A A;  3VCC A;  2PP0 A;  4AT0 A;  4H4U A;  4F4R A;  3ICS A;  3Q9T A;  2YR6 A;  3BOX A;  3V3W A;  1RSG A;  3UJS A;  2EQ8 A;  3SZW A;  3JZU A;  1H84 A;  3FXG A;  4G6H A;  3K7T A;  4B66 A;  1N5X A;  2A89 A;  1MRA A;  2B9X A;  2V61 A;  3KVE A;  1YQ3 A;  3O0H A;  4TVW A;  2V3B A;  3CN8 A;  1XPQ A;  4HCH A;  4E4U A;  2BCP A;  1FHV A;  5J7X A;  3A7R A;  2GEW A;  3QJ4 A;  3N4F A;  2XLT A;  4HPN A;  5J04 A;  2B7S A;  1GRB A;  2GMH A;  3DJE A;  2C73 A;  2XH7 A;  4M0X A;  1EBH A;  4GRT A;  4H4W A;  2VOU A;  3GD3 A;  2OO6 A;  4HB9 A;  5ER0 A;  1LTX R;  3QVR A;  3SYI A;  3GMC A;  1N62 C;  2YLW A;  2R45 A;  1PBD A;  3GY1 A;  4H2R A;  2VQB A;  3LJP A;  2J3N A;  2BS2 A;  2GH5 A;  3RP8 A;  4Z17 A;  3ADA B;  2AQJ A;  2POZ A;  4EIQ A;  3NVV B;  3IHG A;  2PP1 A;  2V60 A;  2POD A;  2O9Z A;  3QPE A;  1Y0P A;  2RDX A;  3QKE A;  3ZLG A;  1PHH A;  2X50 A;  1KDG A;  3VRB A;  1R6W A;  2X8C A;  3I6D A;  3T2Y A;  1MO9 A;  1E6E A;  1PDZ A;  3DME A;  3GO2 A;  3B97 A;  3R0K A;  2XDO A;  1AOG A;  3IC9 A;  4J36 A;  1ZY8 A;  4C77 A;  3RRA A;  2OAL A;  5L46 A;  2HZG A;  1PBB A;  1NEK A;  4HA6 A;  2IVD A;  3THU A;  4JN9 A;  2QDE A;  3H8I A;  1GRH A;  4GGH A;  4HCD A;  1JOA A;  4TM1 A;  1H7W A;  5KVI A;  2PHH A;  4A6G A;  3N6H A;  3UCL A;  3I6T A;  2R46 A;  4G7F A;  1D7L A;  1QJD A;  4K2S A;  1JCT A;  2CDU A;  2E5V A;  4OCG A;  2WHD A;  2GAG B;  3ES8 A;  4I59 A;  4JY2 A;  3P4R A;  4U2L A;  3PVC A;  1E9I A;  3RGT A;  1GRF A;  1GTH A;  2C70 A;  4A6N A;  1EC7 A;  3HYV A;  3CXB A;  1CJ4 A;  5KXJ A;  2R0P A;  2GR0 A;  3ES7 A;  1L9D A;  5BRT A;  3G5R A;  4DSG A;  2WET A;  4U2S A;  4UDR A;  3GYX A;  2AL2 B;  3RO6 A;  2ARD A;  3VRD B;  4G9K A;  1TYP A;  3SZC A;  5EB5 A;  1X2H A;  1KF6 A;  2YLR A;  4CY8 A;  2QA2 A;  3NK2 X;  3R07 C;  1BKH A;  3VR9 A;  1JEH A;  1FFU C;  2O56 A;  4JN7 A;  2VRL A;  5FMH A;  4X4J A;  4DYE A;  3RCY A;  1P43 A;  3AE2 A;  3EPT A;  5EB4 A;  1CHU A;  1GXF A;  2W55 A;  1N5W C;  2UZZ A;  2OZ3 A;  1K0L A;  2XLP A;  3P0W A;  2PU1 A;  4JNA A;  1YEY A;  2JB3 A;  4GR1 A;  3AD9 B;  1KCZ A;  1IYX A;  1NDA A;  3PO7 A;  4AOX A;  4JN8 A;  4GAV A;  1PDY A;  1SJD A;  2VZ2 A;  1S2Q A;  1H2I A;  2ZC8 A;  5JCN A;  1JDF A;  3DK9 A;  1XHC A;  3RED A;  4H4T A;  3EUB 3;  1N60 C;  2AL1 A;  3CMM A;  3DK4 A;  4YTN A;  3H8A A;  1VG9 A;  2PA6 A;  5DBJ A;  4Z25 A;  3AE5 A;  1O95 A;  2VVM A;  3DG6 A;  3S61 A;  4ZA0 A;  1CBO A;  3NYE A;  3T2K A;  3UOY A;  4KPR A;  3WE0 A;  4U8P A;  4GAP A;  1K4Q A;  4FK1 C;  3Q4D A;  1GPE A;  1WYG A;  1QO8 A;  3VDG A;  3AD8 B;  1PBF A;  4A99 A;  4C74 A;  1EBD A;  3CGE A;  4J3Z A;  2ZAD A;  4IT1 A;  4BUR A;  2XH4 A;  3EAN A;  3V3O A;  3UCD A;  4X9N A;  4CBQ A;  3STP A;  3P3B A;  4IP4 A;  3LAD A;  1VDC A;  4AT2 A;  1KNR A;  2EQ9 A;  2WS3 A;  2WP6 A;  5FJP A;  2BYB A;  1P2H A;  4USQ A;  2GR2 A;  4OPL A;  3QSE A;  4BJY A;  2R0C A;  4N9X A;  4B67 A;  1PXC A;  3I3L A;  1N4U A;  4J56 A;  2WOI A;  4ENL A;  3V5C A;  2QA1 A;  3QSS A;  3SQP A;  4H2H A;  1DOC A;  3IHM A;  1F3P A;  4K7Z A;  1GER A;  3AE8 A;  2AKZ A;  1E39 A;  3SN0 A;  4K5S A;  3V76 A;  3JSK A;  2XFO A;  4GDP A;  4HYR A;  2YR5 A;  1MUC A;  3AM9 A;  2W3R A;  5KMP A;  1T3Q C;  1OJC A;  3CT2 A;  1FL2 A;  1LV0 A;  4USR A;  2QJN A;  3CIR A;  1ZMC A;  3DJD A;  4NEW A;  1H82 A;  2XYO A;  2FJD A;  4NZH A;  1RM6 B;  3NRZ B;  1N61 C;  3SQS A;  1RVK A;  4Z2U A;  3DGB A;  5FS9 A;  2W0H A;  2YG4 A;  1VRQ B;  3TWB A;  1GTE A;  3BNU A;  1SEZ A;  3DGH A;  3AMZ A;  1LQT A;  4U2T A;  4H7U A;  2AKM A;  1E1N A;  3FG2 P;  4H1Z A;  2NQL A;  1W6T A;  4J1O A;  3M0O A;  1P2E A;  4TLX A;  1GSN A;  4OPI A;  2BXR A;  3T9P A;  2PYX A;  3NZG A;  2NPX A;  4FK1 A;  4ZN0 A;  4A35 A;  2WES A;  3NNE A;  6ENL A;  4HN8 A;  3NTD A;  3G5S A;  4DHG A;  2C65 A;  1TE6 A;  3VRA A;  3DER A;  3NH3 X;  1D4C A;  2BAC A;  2YM2 A;  3AE3 A;  3CNT A;  3ETR B;  2RGH A;  1O94 A;  2AAQ A;  2RGO A;  2WPF A;  2VRM A;  3SN4 A;  4BK1 A;  2BRA A;  4GFI A;  1CJ3 A;  3CGC A;  4U8O A;  4J34 A;  2C3C A;  4E0V A;  3ICT A;  2XH2 A;  4YKF A;  1JRP A;  1FFV C;  3UCC A;  1SJB A;  2QQ6 A;  4IVM B;  4GF7 A;  4BJZ A;  4Z2R A;  3P93 A;  1TYT A;  4E5T A;  3RHA A;  3NO1 A;  3GDP A;  3GMB A;  3SX6 A;  4Z2T A;  1GES A;  3HYX A;  2XFP A;  1K0J A;  3K1G A;  5FS6 A;  3VFC A;  2BCG G;  2A87 A;  3AEC A; 
#chains in the Genus database with same CATH homology
 4II2 A;  2VVL A;  4A6N B;  4Z44 A;  1NG4 A;  4RSL A;  2XDO A;  1AOG A;  2FJE A;  3RP7 A;  3IC9 A;  2OAM A;  4J36 A;  4YWO A;  1ZY8 A;  2ACZ A;  4C77 A;  2C4C A;  1L0V A;  2DKH A;  2OAL A;  3D1C A;  4A79 A;  5L46 A;  3NKS A;  1PBB A;  3AEB A;  5C3J A;  1TRB A;  1IJH A;  1X31 B;  3BI4 A;  4EIP A;  2YLZ A;  1EL9 A;  1NEK A;  4HA6 A;  2TPR A;  3RP6 A;  4APN A;  4M52 A;  2IVD A;  5M10 A;  2WP9 A;  5TR3 A;  2WBA A;  3H8I A;  4JN9 A;  3UKQ A;  3NN0 X;  1PXA A;  1YQZ A;  1GRH A;  1CC4 A;  2R9Z A;  1PXB A;  1JOA A;  3AEG A;  2BK3 A;  4TM1 A;  1Q9I A;  1ZK7 A;  3KD9 A;  1H7W A;  1PDH A;  3AEE A;  1ZOY A;  5KVI A;  2PHH A;  5HHF A;  4EMI A;  2E4G A;  2YR4 A;  3AYL A;  5JCM A;  3UCL A;  2R46 A;  5JCL A;  1D7L A;  1QJD A;  2WDR A;  3P9U A;  4YSY A;  1Q1W A;  2CDU A;  4BK2 A;  2GF3 A;  1GET A;  2E5V A;  4OCG A;  1BGN A;  2WHD A;  2GAG B;  3KPK A;  4I59 A;  4JY2 A;  1COY A;  4PAA A;  4PAB A;  4U8L A;  3P4R A;  1N4W A;  1CJC A;  1S3E A;  1Y56 B;  2V6O A;  4U2L A;  3OZ2 A;  3PVC A;  1NHQ A;  3DGZ A;  4Z43 A;  1GRF A;  1GTH A;  2C70 A;  3LZW A;  1JRY A;  4A6N A;  3ZDN A;  3KKJ A;  4D03 A;  5C2T A;  1PJ6 A;  3HYV A;  4JY3 A;  2GQW A;  2BAB A;  1CL0 A;  1H81 A;  3BI5 A;  3UTG A;  1B37 A;  2HQM A;  5JCI A;  3OC4 A;  1CJ4 A;  3ICR A;  1DOD A;  5KXJ A;  3LOV A;  1B5Q A;  1S3B A;  2R0P A;  5KVH A;  4U8J A;  4YT0 A;  1BZL A;  2JK6 A;  2EQ7 A;  3ALL A;  2GR0 A;  3P4S A;  1L9D A;  2B9W A;  1GRE A;  5BRT A;  2C64 A;  3G5R A;  3M12 A;  4IA6 A;  3PG6 A;  3NIX A;  4DSG A;  4GCM A;  3H4K A;  1DNC A;  2WOW A;  4ZCC A;  2WET A;  1D4D A;  1F6M A;  5JCK A;  4LA1 A;  4Z24 A;  4U2S A;  4BK3 A;  1JNR A;  2YLS A;  3UKP A;  1ZP0 A;  3T14 A;  4OPU A;  4CNK A;  4UDR A;  3AYI A;  3T2Z A;  1ELI A;  3GYX A;  5BUL A;  1FCD A;  4AP3 A;  4B65 A;  5M0Z A;  1IUU A;  2C7G A;  5EOW A;  4H4R A;  3COX A;  1TDO A;  4H4V A;  2C66 A;  5KNL A;  2ARD A;  2C72 A;  3AB1 A;  2GR1 A;  1YY5 A;  3VRD B;  4AOS A;  1NPX A;  1TYP A;  1E1L A;  4G9K A;  4NTC A;  1Y56 A;  4O5Q A;  4CRT A;  5HXI A;  3SZC A;  4D04 A;  3UTE A;  1IUT A;  1CC2 A;  3QFB A;  2C67 A;  5EB5 A;  1KF6 A;  2YLR A;  4CY8 A;  1JU2 A;  3K7M X;  2QA2 A;  1M64 A;  3NK2 X;  4UDQ A;  3AE6 A;  1ZX9 A;  3CND A;  2WPC A;  2XVE A;  3VR9 A;  1E1M A;  2JAE A;  4TM3 A;  5IQ4 A;  2BRY A;  4OPT A;  3CGB A;  1JEH A;  2QAE A;  3VR8 A;  3S5W A;  2VRL A;  5FMH A;  2IVE A;  4B64 A;  2GMJ A;  4X4J A;  1PN0 A;  4UP3 A;  3AE2 A;  1BGJ A;  3ATQ A;  1BF3 A;  2YLT A;  2YM1 A;  3B3R A;  3C96 A;  3EPT A;  2WOV A;  3SGL A;  5EB4 A;  3HZL A;  3UOZ A;  1CHU A;  1JRX A;  1ONF A;  2WPE A;  3UOV A;  3AD7 B;  1VG0 A;  1GXF A;  3C4N A;  3GWD A;  3KPF A;  3CTY A;  4IVO B;  4TM4 A;  5CQF A;  3AWI A;  3AE7 A;  2CUL A;  2YG3 A;  4K8D A;  2CVJ A;  5CKU A;  5FS8 A;  2UZZ A;  1W4X A;  4A65 A;  1K0L A;  2WU5 A;  1NHS A;  2XLP A;  4H50 A;  4K2X A;  3UTH A;  4FDC B;  2ZBW A;  5U63 A;  4DGK A;  2ZZC A;  4JNA A;  4H4Z A;  4O5U A;  3CGD A;  4YSH A;  1TDN A;  3LB8 A;  2JB3 A;  4GR1 A;  3AD9 B;  1H86 A;  1YQ4 A;  1NDA A;  3PO7 A;  3LXD A;  1Q1R A;  4AOX A;  4H4P A;  4CY6 A;  3D8X A;  1YKJ A;  2WP5 A;  4GAV A;  3GSI A;  1IUS A;  3DJJ A;  1DOE A;  2VZ2 A;  4A5L A;  4OVI A;  4C3X A;  1S7M A;  1S2Q A;  4NEV A;  1H2I A;  4ECH A;  5JCN A;  3SFD A;  4H4Y A;  1IUX A;  4EMW A;  4CCQ A;  4ICY A;  3DK9 A;  3EAO A;  4B69 A;  1XHC A;  2WDV A;  3RED A;  1BKW A;  4H4T A;  1GV4 A;  2AR8 A;  3QFA A;  1EL8 A;  2GRT A;  4YTP A;  2OA1 A;  2E1M A;  1L9E A;  3GRS A;  3CMM A;  4H2Q A;  3Q6J A;  3DK4 A;  3AYJ A;  4B1B A;  4YTN A;  2X8H A;  2YWL A;  4WX1 A;  3CPI G;  1VG9 A;  3UKL A;  3SZ0 A;  4NTE A;  4WCT A;  5DBJ A;  3F8P A;  4IV9 A;  4B68 A;  4Z25 A;  3AE1 A;  4G74 A;  3UOX A;  4Y4N A;  3AE5 A;  3F8R A;  1NEN A;  1N4V A;  1O95 A;  2VVM A;  2YG7 A;  3ABV A;  2GQF A;  3S61 A;  1CBO A;  3NYE A;  3T2K A;  4CNJ A;  4DSH A;  3UOY A;  1M6I A;  4FX9 A;  4KPR A;  3WE0 A;  4BV6 A;  4U8P A;  2BS4 A;  4GAP A;  1K4Q A;  4U8M A;  3DA1 A;  1NHP A;  1O5W A;  4FK1 C;  4TLZ A;  1GPE A;  2EQ6 A;  1QO8 A;  2Z5X A;  4EQX A;  2R4J A;  1F8W A;  1PBF A;  1N1P A;  3AD8 B;  3GWF A;  1D5T A;  4A99 A;  1B4V A;  3CNP A;  2XVF A;  4C74 A;  2Q7V A;  4G73 A;  1EBD A;  1CJ2 A;  3SXI A;  3CGE A;  3DH9 A;  3II4 A;  2GVC A;  4J2W A;  2YVG A;  3AED A;  4AP1 A;  4BUR A;  4C5O A;  2IID A;  3NT6 A;  3L8K A;  3FIM B;  4XWZ A;  3GD4 A;  2H88 A;  3EAN A;  3NLC A;  5KWF A;  1TDE A;  3CNJ A;  2XLR A;  4X9N A;  1GAL A;  3V3O A;  1GRT A;  2YG5 A;  4ADW A;  3H8L A;  4LII A;  2GR3 A;  3KA7 A;  4CBQ A;  5HY5 A;  3RNM A;  2FJA A;  1UKV G;  2JBV A;  2QCU A;  1K0I A;  2B76 A;  2BS3 A;  2XVH A;  2YLX A;  1BWC A;  1DXL A;  3LAD A;  2XCG A;  1VDC A;  4AT2 A;  1KNR A;  2EQ9 A;  3UKH A;  2WS3 A;  2WP6 A;  2BC1 A;  3C4A A;  4II3 A;  4U8N A;  2BC0 A;  1ZMD A;  3CNS A;  2X99 A;  2BYB A;  1P2H A;  1DJN A;  1Z6L A;  2XFN A;  3IF9 A;  4USQ A;  2GR2 A;  1LQU A;  4ZCD A;  4OPL A;  5HYM A;  3QSE A;  3QVP A;  2GB0 A;  4BJY A;  2R0C A;  5KMR A;  1S2Y A;  4X9M A;  4B63 A;  3F8D A;  3BNM A;  5GRT A;  2JB2 A;  1KNP A;  2X3N A;  4N9X A;  4B67 A;  1PXC A;  4CCR A;  2NVK X;  3I3L A;  2RAB A;  5U1O A;  1N4U A;  4J56 A;  4MJW A;  2WOI A;  1IUW A;  4H4Q A;  1OJD A;  5U25 A;  1NHR A;  1GRG A;  4Z26 A;  1FEA A;  4A7A A;  3V3N A;  4GDE A;  4NWZ A;  3ITJ A;  1LPF A;  1CC6 A;  3FMW A;  1PS9 A;  4YSZ A;  3EF6 A;  1F8S A;  4H4X A;  2QA1 A;  3SQP A;  3QSS A;  1DOC A;  1GOS A;  2Q6U A;  3IHM A;  1GND A;  2C3D A;  3AEF A;  4JQ9 A;  2B7R A;  4I58 A;  5BUK A;  1F3P A;  2WQY A;  5KMQ A;  3GRT A;  4K7Z A;  3UTF A;  3AEA A;  2OLO A;  1GER A;  2B9Y A;  3AE8 A;  5IQ1 A;  3AXB A;  3ALM A;  5J60 A;  1CF3 A;  1E39 A;  4H4S A;  4YKG A;  4K5S A;  3B6D A;  3KLJ A;  3V76 A;  1REO A;  5KRQ A;  1D7Y A;  1TDK A;  2Q0K A;  3JSK A;  3P4Q A;  1ZOV A;  3E1T A;  2XFO A;  4GDP A;  1F8R A;  4Y4M A;  3NRN A;  4J57 A;  2R4E A;  4H2N A;  3AE9 A;  2YR5 A;  4J33 A;  5JRB A;  2XFU A;  2WDQ A;  1E7P A;  1NAA A;  3NYF A;  1EL7 A;  3BHK A;  1MXT A;  1JRZ A;  1KN0 A;  4JNQ A;  5KMP A;  1OJC A;  1RYI A;  1OJA A;  2V3A A;  1JNZ A;  1KSS A;  1XAN A;  1DOB A;  4OPD A;  3ALJ A;  4YSX A;  1FL2 A;  1LV0 A;  4USR A;  1KFY A;  4AT0 A;  2ZZB A;  3CIR A;  3FPZ A;  1ZMC A;  3D9X A;  4NEW A;  3DJD A;  4GUV A;  1IUV A;  1H82 A;  3FBS A;  2A8X A;  3BHF A;  2XYO A;  3M13 A;  2FJD A;  2FJB A;  4NZH A;  4H4U A;  3ICS A;  3NK1 X;  2BXS A;  2FBW A;  3Q9T A;  1OJ9 A;  3HYW A;  2YR6 A;  3IWA A;  3UKK A;  2XLS A;  1PJ7 A;  2I0Z A;  2Z5Y A;  2F5Z A;  3UKF A;  1RSG A;  4EQR A;  2R0G A;  2VVL G;  4Y4L A;  4Z2U A;  4RG3 A;  4KX6 A;  5FS9 A;  2W0H A;  2GV8 A;  2YG4 A;  2YAU A;  2EQ8 A;  1VRQ B;  4TM0 A;  3SZW A;  3T37 A;  3UP5 A;  1H84 A;  1GTE A;  3BNU A;  4A9W A;  1HYU A;  4C3Y A;  5FS7 A;  1SEZ A;  3DGH A;  4XXG A;  1LQT A;  3DK8 A;  1D4E A;  3K7T A;  2XVI A;  4G6H A;  4H7U A;  4J31 A;  4U2T A;  2CFY A;  4B66 A;  3CPH G;  4YXD A;  1E1N A;  3NGC X;  3K7Q X;  3FG2 P;  1TDF A;  2A89 A;  1NG3 A;  2BK4 A;  1DJQ A;  2C76 A;  3LZX A;  4U8I A;  5LV9 A;  2B9X A;  2V61 A;  5GSN A;  3ZYX A;  3L5O A;  1H83 A;  3M0O A;  3R9U A;  3T0K A;  4IA5 A;  1P2E A;  1QLB A;  1EL5 A;  4TLX A;  2C75 A;  1H6V A;  4H2P A;  4UDP A;  1GSN A;  3KVE A;  1YQ3 A;  3NYC A;  4OPI A;  3O0H A;  2BXR A;  3UP4 A;  2PYX A;  3NTA A;  2V3B A;  2YVJ A;  4EQS A;  1XDI A;  4EMJ A;  3K30 A;  3SFE A;  3CN8 A;  4REK A;  2NPX A;  3SM8 A;  1B8S A;  1H7X A;  1XPQ A;  3DJG X;  3KU9 A;  3P4P A;  4FK1 A;  2BCP A;  5J7X A;  4ZN0 A;  2GEW A;  3QJ4 A;  2WES A;  2OLN A;  2GAH B;  2XFQ A;  2XLT A;  4P9S A;  3UKA A;  3NNE A;  4NTD A;  2B7S A;  1GRB A;  3NTD A;  2GMH A;  3DJE A;  2BK5 A;  5EBK A;  2C73 A;  1L9C A;  3G5S A;  2WU2 A;  1V59 A;  4OPG A;  5KOX A;  2C65 A;  3VRA A;  4GRT A;  3NH3 X;  1D4C A;  2BAC A;  2YM2 A;  3AE3 A;  4JDR A;  4H4W A;  2VOU A;  3CNT A;  1PBE A;  3GD3 A;  1PBC A;  4HB9 A;  5ER0 A;  3ISH A;  3SY4 A;  2TMD A;  3P1W A;  4EM3 A;  2RGH A;  1O94 A;  2V5Z A;  2AAQ A;  1LTX R;  3AE4 A;  4K22 A;  5BVA A;  2RGO A;  2WPF A;  2JB1 A;  3QVR A;  3SYI A;  3GMC A;  2RGJ A;  2VRM A;  2YLW A;  2R45 A;  2YG6 A;  4BK1 A;  1PBD A;  2BRA A;  3L1R A;  4H2R A;  2VQB A;  4NNJ A;  4U8K A;  1CJ3 A;  2XVJ A;  3NHO X;  3CGC A;  3LJP A;  4U8O A;  3T31 A;  2J3N A;  3G5Q A;  2ZZ0 A;  1GT8 A;  2X8G A;  1GRA A;  1RP0 A;  2C3C A;  2BS2 A;  4J34 A;  4E0V A;  3ATR A;  4XWR A;  5KOW A;  4LU6 A;  3ICT A;  2GH5 A;  3RP8 A;  1ZKQ A;  2JKC A;  2XLU A;  3PS9 A;  3NK0 X;  4YKF A;  2DKI A;  2AQJ A;  3ADA B;  3VQR A;  5KMS A;  3QSM A;  1OJT A;  4EIQ A;  3IHG A;  1FEB A;  5IPY A;  1LVL A;  1ZDL A;  2V60 A;  4IVM B;  2O9Z A;  3GDN A;  4GF7 A;  4DNA A;  2VQ7 A;  4YTM A;  4BJZ A;  1LJ1 A;  4Z2R A;  4K5R A;  1TYT A;  2YQU A;  1Y0P A;  2YVF A;  2BA9 A;  3RHA A;  1VQW A;  4G6G A;  1FEC A;  3SZF A;  1PJ5 A;  3GYJ A;  3NN6 X;  3GDP A;  1PHH A;  3GMB A;  3NG7 X;  1FOH A;  3SX6 A;  4EQW A;  2X50 A;  1MOK A;  3URH A;  1KDG A;  4RG4 A;  3VRB A;  3BI2 A;  4Z2T A;  1GES A;  2X8C A;  2Y6R A;  2Y6Q A;  3I6D A;  3T2Y A;  3HYX A;  1MO9 A;  4EM4 A;  1E6E A;  2XFP A;  1K0J A;  2Q0L A;  1KSU A;  3DME A;  4OPC A;  5FS6 A;  2APG A;  1E1K A;  2BCG G;  1GEU A;  3CPJ G;  2A87 A;  3AEC A;  2WEU A;  2H89 A;  3GYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...