3KLJA

Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
378
structure length
378
Chain Sequence
b'KSTKILILGAGPAGFSAAKAALGKCDDITMINSEKYLPYYRPRLNEIIAKNKSIDDILIKKNDWYEKNNIKVITSEFATSIDPNNKLVTLKSGEKIKYEKLIIASGSIANKIKVPHADEIFSLYSYDDALKIKDECKNKGKAFIIGGGILGIELAQAIIDSGTPASIGIILEYPLERQLDRDGGLFLKDKLDRLGIKIYTNSNFEEMGDLIRSSCVITAVGVKPNLDFIKDTEIASKRGILVNDHMETSIKDIYACGDVAEFYGKNPGLINIANKQGEVAGLNACGEDASYSEIIPSPILKVSGISIISCGDIENNKPSKVFRSTQEDKYIVCMLKENKIDAAAVIGDVSLGTKLKKAIDSSKSFDNISSLDAILNNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(FAD)-dependent dehydrogenase, NirB-family (N-terminal do
publication title Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
total genus 117
structure length 378
sequence length 378
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18267 Rubredoxin_C Rubredoxin NAD+ reductase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3kljA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA02
4IA5A 4ADWA 4U8NA 3SM8A 3V3OA 3AE7A 1PJ5A 3EPTA 2WDVA 3ALLA 3C4AA 4BJYA 2PHHA 4H2NA 2GR3A 5FS8A 2WDRA 2YLWA 1CJCA 4A6NA 2BS3A 2X8HA 3DH9A 3URHA 2GVCA 3QFAA 4K8DA 4WX1A 4X4JA 1IUUA 1LQUA 4H4YA 4YTNA 4EMWA 2XFOA 3UKLA 3II4A 1ZMDA 2YAUA 4TLXA 4EIQA 3P1WA 5BUKA 1TYPA 2B76A 3KA7A 4XWRA 1B37A 3CGBA 4YT0A 4YSYA 2JB1A 3AEEA 4U8LA 4TM4A 4JDRA 3AEBA 1ZP0A 4GF7A 3M12A 4H4ZA 2R9ZA 2H88A 3UOZA 4AP1A 2GEWA 3QVRA 4Z43A 3AE6A 5EBKA 4Z24A 3FG2P 3L8KA 1PBBA 4GDEA 1EL9A 2AR8A 1GNDA 5IQ1A 4C5OA 2XFNA 4U2TA 2NPXA 1F3PA 1GRAA 2V5ZA 3P9UA 4H4SA 1BWCA 3WE0A 1YQ4A 2JBVA 5EB4A 2BXSA 3AECA 4IA6A 4J56A 1LJ1A 2V3BA 3CNJA 2HQMA 2XVFA 1OJAA 3GDPA 1E1LA 4NTDA 2VRMA 3AXBA 1ZMCA 1B8SA 4LA1A 1F8RA 4ZCCA 2B9XA 3CNDA 4B69A 3UP5A 1B5QA 2BS2A 5JCLA 3G5SA 3LZXA 1ZKQA 1GTEA 1GXFA 4GCMA 1P2HA 2XLPA 4EM3A 3FPZA 1IJHA 2QCUA 4GUVA 4USRA 3BHKA 1N1PA 1Y0PA 3F8PA 2GRTA 1PBCA 4EQWA 1O5WA 4B1BA 2YM2A 3DK4A 4J57A 2J3NA 4EM4A 3AEFA 3O0HA 1D5TA 3ATRA 4BJZA 4Y4NA 3NYEA 2WP6A 1DXLA 2WOVA 3SFDA 2APGA 4EMJA 4U2LA 5ER0A 3DK8A 3VRBA 5M10A 4J36A 4JNAA 4UP3A 5DBJA 1H82A 5TR3A 2GR2A 2I0ZA 3NYCA 5BULA 3UP4A 1GT8A 4BURA 1FCDA 2RABA 1NHRA 2YR5A 3NH3X 1B4VA 1NG4A 3I3LA 1E7PA 1N4VA 2WOIA 3CPIG 2B7RA 1L0VA 1JOAA 1K0IA 2C76A 2BK4A 5L46A 3SGLA 1F8WA 1OJTA 3NNEA 4J34A 2PYXA 2WQYA 2GB0A 2AQJA 1UKVG 5EB5A 2CVJA 2E5VA 4A79A 4KPRA 4YSZA 3CNTA 3NYFA 1KDGA 4C3XA 4K7ZA 2V6OA 2EQ6A 2YG5A 1GPEA 1JNRA 1GRFA 2BK5A 2R45A 2VQBA 2WDQA 3GYIA 4B64A 1ZK7A 1KF6A 1Q9IA 4TM0A 4APNA 1IUXA 3ZDNA 1PHHA 2BACA 3GMBA 4PAAA 3HZLA 3DGZA 1OJDA 4A99A 1PBDA 2YR4A 4B66A 3VQRA 4BV6A 1XHCA 1JRYA 5FS7A 1PDHA 5IPYA 3DGHA 3K7MX 1Q1WA 3K30A 3V76A 2C7GA 2YG6A 4A65A 4K22A 2B9WA 2V60A 3GD3A 2X50A 2GQWA 2ZBWA 1GRTA 3AYLA 4ZN0A 1H86A 2X8GA 1IUVA 2DKHA 3AE4A 4U8MA 2Z5XA 5KOXA 4U8PA 2WEUA 4U2SA 3GSIA 3UTHA 3D1CA 2TMDA 3P4PA 2XVEA 3ALJA 4TLZA 3V3NA 1VRQB 5C2TA 4EQRA 2YVJA 4RG3A 2VVLA 1GREA 2YQUA 1TDEA 2YLTA 3UKQA 2XVHA 3S61A 2XFPA 1E6EA 3SQPA 2FBWA 1IUTA 1FEBA 2JKCA 3CIRA 4REKA 2IVDA 1TDKA 4IVMB 4TM3A 4U8KA 4WCTA 2E1MA 2C3CA 4BK3A 4ZCDA 1JRXA 5J60A 1CC4A 2AAQA 4Z25A 3NN0X 4LIIA 1IUWA 4H4PA 1N4WA 2GAGB 3LADA 2WS3A 4H4XA 3AE3A 3BHFA 1CC6A 1PBFA 3B6DA 4OPGA 4YKFA 1VG0A 4A7AA 4U8JA 4BK2A 3BI5A 1FEAA 1DJNA 1P2EA 2GF3A 1EL8A 3E1TA 4J2WA 1DOEA 4P9SA 1PJ6A 4B68A 4CCRA 2BCGG 3VRAA 1L9DA 1NHQA 5GRTA 4GRTA 2Z5YA 1H83A 2QA1A 4XWZA 3AD7B 2OLOA 1GOSA 3RP7A 1TYTA 1NHSA 3ADAB 2VVMA 2GQFA 2CDUA 3GWDA 1Y56A 4CCQA 4UDRA 3AEGA 1ZDLA 1LVLA 2X8CA 3CTYA 3VR9A 2YLZA 2B7SA 1S2QA 4H4UA 4O5QA 2JK6A 2JAEA 1DNCA 5U63A 4JQ9A 1OJCA 3BNUA 5JCKA 2W0HA 4OPUA 1VG9A 4EQSA 2R4EA 1N4UA 2Y6RA 3BNMA 1EL5A 3AD8B 3QFBA 2GH5A 5M0ZA 3LJPA 4NZHA 1LPFA 2O9ZA 3C96A 3DA1A 2C3DA 3M0OA 4JNQA 3ATQA 2OAMA 1ZOYA 1F6MA 4C3YA 2ARDA 4Z2UA 2GMHA 3AEDA 1H81A 4YWOA 5HYMA 1BZLA 4IV9A 2Q7VA 5KXJA 1H6VA 2XVIA 1FL2A 3CPJG 2V3AA 4ECHA 2ZZ0A 3BI4A 3QSSA 2CULA 1CJ2A 4H2QA 4EIPA 5KRQA 4CRTA 3KU9A 4EMIA 3UKAA 1KNRA 2VQ7A 3K7TA 1RSGA 3S5WA 2RGHA 4AOSA 5GSNA 3COXA 3NTDA 1H7XA 1KSUA 1IUSA 4HA6A 1QJDA 2R0PA 4B65A 1E1MA 1NAAA 1PN0A 1PS9A 3NGCX 1JEHA 2WP5A 3VRDB 1D4CA 3ICRA 5U25A 4YTMA 2H89A 2GV8A 1BKWA 1GSNA 4JY2A 1TDNA 4FK1A 1EL7A 3NIXA 4LU6A 5FMHA 4IVOB 1LQTA 4OPTA 4H4WA 1GRHA 1S3BA 3FMWA 3UKFA 3GWFA 1GV4A 4X9MA 1JU2A 1S3EA 3GDNA 1LTXR 2EQ7A 2DKIA 1F8SA 1REOA 2XFQA 3ZYXA 1MXTA 4RG4A 2R0CA 1NENA 2GMJA 3G5QA 3IWAA 3GD4A 3JSKA 3GMCA 2BC0A 3B3RA 1E39A 1AOGA 1KFYA 3PS9A 1RP0A 4NTCA 1PBEA 5CQFA 1GRGA 2ACZA 1D7LA 5BVAA 1DOBA 4N9XA 2C67A 3Q9TA 2BYBA 3D8XA 2C72A 3CNSA 3AYIA 1Q1RA 3GRSA 2FJDA 2C75A 3F8DA 4H50A 2C65A 2RGJA 4C77A 2QAEA 2TPRA 1Z6LA 3FIMB 4FX9A 3RNMA 4B67A 1DODA 1H7WA 3AE1A 4Z44A 4D04A 1NG3A 5FS9A 5JCIA 2JB2A 3NN6X 3NRNA 3AB1A 5J7XA 4CNKA 3UOXA 3LZWA 2XLTA 3EF6A 4H2RA 1QO8A 4I58A 3RHAA 1ZOVA 3UCLA 3R9UA 4YSHA 1VDCA 1CJ3A 4MJWA 3SFEA 4NEWA 1JNZA 2RGOA 3UTGA 3BI2A 2EQ8A 4OCGA 3IHMA 1FECA 4UDPA 1BGNA 2X3NA 3C4NA 2WPCA 1TDFA 2WU5A 2XVJA 1COYA 4JN9A 2FJBA 1ZY8A 5IQ4A 2BC1A 3L1RA 1CBOA 1CL0A 2BK3A 3ICSA 3RP6A 1NEKA 1ZX9A 1PXBA 1NDAA 4Y4MA 1KSSA 4ICYA 5LV9A 2VVLG 5C3JA 1MOKA 3UKKA 1M6IA 2VOUA 3KLJA 2XCGA 4Z26A 1H84A 1MO9A 1KNPA 3IF9A 1D4DA 3ICTA 3ITJA 4H4VA 2GR1A 3H8LA 3LOVA 3NT6A 3DJGX 3PVCA 1M64A 3OZ2A 3QVPA 2OALA 2XDOA 3FBSA 1W4XA 2R46A 5BRTA 4UDQA 2X99A 1TRBA 3LB8A 2EQ9A 3DJJA 2V61A 3QSMA 2XYOA 3AWIA 4U8OA 1E1KA 1X31B 5KVIA 2OLNA 2VZ2A 1SEZA 5FS6A 1S2YA 4H4RA 1CC2A 2XFUA 4KX6A 3UOYA 2A89A 4H2PA 2Q6UA 4K2XA 1NPXA 4CNJA 3I6DA 3UOVA 3KVEA 3OC4A 2BABA 2WBAA 3LXDA 4O5UA 4H4TA 3H4KA 1ONFA 1JRZA 4CY6A 4YSXA 4A6NB 1GEUA 3DJDA 4OPLA 2ZZBA 1GERA 2YLSA 1L9CA 4Y4LA 3AE9A 2XLRA 3DMEA 3GYJA 3CGCA 1O94A 1E1NA 3F8RA 2C70A 3K7QX 3UKPA 1BF3A 1VQWA 5CKUA 2UZZA 4YTPA 2Q0KA 4OPCA 5JCMA 3UTFA 3H8IA 2XLSA 4A5LA 3NG7X 2NVKX 3NLCA 4M52A 3KKJA 4K5SA 5U1OA 3AE8A 1CJ4A 4Z2TA 2WETA 1YY5A 2ZZCA 2XLUA 3NK0X 3Q6JA 2QA2A 2YG7A 4U8IA 2IVEA 4EQXA 2GR0A 4NTEA 2Y6QA 4FDCB 4Z2RA 2YM1A 4B63A 2WPEA 2FJAA 3DK9A 4GR1A 3EAOA 4DNAA 1OJ9A 2R0GA 4E0VA 4I59A 1D4EA 2YG3A 3QSEA 4OVIA 1DJQA 2GAHB 3DJEA 3QJ4A 1Y56B 3RP8A 4AP3A 4NEVA 4DSHA 2BCPA 5KVHA 4A9WA 3AE5A 4AT2A 4J31A 3UKHA 1TDOA 4DSGA 2YVFA 2A87A 4PABA 5EOWA 4H4QA 1RYIA 1YQ3A 2Q0LA 3ABVA 2FJEA 1BGJA 3AYJA 1O95A 2CFYA 3IC9A 2C66A 2YVGA 3G5RA 3P4QA 4X9NA 3GRTA 2A8XA 3UTEA 4YXDA 1GETA 1YKJA 1K0LA 2YLRA 4FK1C 4TM1A 4CBQA 4HB9A 3CGDA 2F5ZA 2OA1A 2WESA 2YR6A 4AT0A 3ISHA 1GALA 2WPFA 2E4GA 4D03A 1CF3A 2WOWA 1K4QA 2JB3A 1GTHA 1K0JA 1PXAA 4YKGA 3ALMA 3P4SA 3AEAA 4USQA 2VRLA 1L9EA 3CN8A 3KPFA 1EBDA 1ELIA 1CHUA 3NHOX 4DGKA 4J33A 1HYUA 5HXIA 4XXGA 2BA9A 2YWLA 3IHGA 2YLXA 3NKSA 2B9YA 1QLBA 2C73A 2WHDA 2BXRA 2YG4A 1XPQA 4BK1A 1FOHA 3NTAA 4OPDA 3CGEA 3CPHG 3T37A 1NHPA 4C74A 4H7UA 5HHFA 5KOWA 2BS4A 4JY3A 1V59A 3AE2A 1D7YA 1PXCA 4AOXA 4CY8A 5KWFA 3PO7A 4K5RA 1XANA 2C64A 2R4JA 1DOCA 2WP9A 1GRBA 2WU2A 1XDIA 5JCNA 3CNPA 3P4RA 3NK2X 3KD9A 3AD9B 3M13A 1LV0A 1PJ7A 4OPIA 4RSLA 3REDA 2IIDA 4GDPA 3VR8A 5HY5A 3EANA 1YQZA 1GESA 3NK1X
chains in the Genus database with same CATH superfamily
3AE7A 3R1ZA 1N5WC 5FS8A 4A6NA 3IK4A 3SZFA 4X4JA 1LQUA 3UKLA 1ZMDA 4A35A 4TLXA 1TYPA 3KA7A 3CGBA 4YT0A 3AEEA 3NFUA 4G8TA 1ZP0A 3M12A 2H88A 2GEWA 5EBKA 3L8KA 4HNLA 4HCHA 1EL9A 2AR8A 3HYWA 5IQ1A 1BWCA 1OEPA 3GC2A 5EB4A 1FFUC 4NTDA 2GSHA 4LA1A 2B9XA 4DWDA 5JCLA 3G5SA 4K2SA 1MNSA 2BRYA 3QLDA 1N61C 1IJHA 4USRA 3BHKA 3F8PA 4EWJA 1TE6A 4JN8A 4EM4A 4BJZA 4IP5A 3VCNA 2WOVA 2APGA 4EMJA 3DFYA 5ER0A 5M10A 4J36A 5TR3A 3AN1A 2I0ZA 4GGBA 3ZLHA 2YR5A 1N4VA 2P8BA 1L0VA 5L46A 1FFVC 5KMPA 1OJTA 4J34A 3PG6A 3H7VA 2E5VA 3CNTA 4IL2A 2YG5A 1GPEA 2WDQA 2VQBA 3GYIA 3DDMA 1IUXA 4A99A 1PBDA 2YR4A 3QKEA 3DGHA 3K30A 4KT2A 2V60A 3AYLA 4ZN0A 1X2HA 2DKHA 3AE4A 2GL5A 2POZA 2TMDA 3P4PA 3HYXA 2QQ6A 1VRQB 5C2TA 3UKQA 3N6JA 2FBWA 2JKCA 3CIRA 3UJSA 3GD6A 4TM3A 2XGZA 4ZCDA 2AAQA 1N4WA 4UP3A 3LADA 3AE3A 3OTRA 1VG0A 3ZLGA 4BK2A 3BI5A 4J2WA 1L9DA 5GRTA 3AD7B 4DX3A 3ADAB 4UDRA 3AEGA 1LVLA 3VR9A 4JQ9A 4HPNA 4EQSA 3MY9A 2O9ZA 4JNQA 3ATQA 4C3YA 3NZGA 2ARDA 3EKGA 4Z2UA 3AEDA 4G6HA 1FHVA 5KMSA 1FL2A 3CPJG 2ZZ0A 3T14A 5KRQA 3KU9A 4EMIA 3NO1A 1KNRA 3K7TA 4HA6A 2WP5A 3B9JB 2H89A 4NWZA 1EL7A 3NIXA 4LU6A 3T2YA 5FMHA 1LQTA 4H4WA 3UKFA 3FMWA 2OZTA 4IHCA 3OW1A 3I6EA 1FIQB 1LTXR 2DKIA 3ZYXA 2HNEA 1MXTA 3NVYB 1NENA 2GMJA 3GD4A 4HNCA 4G6GA 2QDEA 2ACZA 2C72A 3CNSA 1STZA 3AYIA 4H2HA 1H2IA 1JPDX 4H50A 2C65A 2RGJA 2QAEA 2TPRA 1DODA 4Z44A 4D04A 4I58A 3VDGA 1VDCA 3I6TA 4NEWA 4OCGA 1FECA 4UDPA 2X3NA 4GMEA 3A7AA 1ZX9A 1PXBA 1NDAA 4ICYA 2VVLG 3CXOA 2XCGA 1D4DA 4NNJA 3LOVA 3OZ2A 3QVPA 2XDOA 1W4XA 3QSMA 3NS1B 5KVIA 2OKTA 1SJCA 1CC2A 4J1OA 3UOVA 1SB3B 1JRZA 4OPLA 2XLRA 3GYJA 5FJUA 3K7QX 1BF3A 1VQWA 2CHRA 3UTFA 2XLSA 3NG7X 4K5SA 1KCZA 4IT1A 5U1OA 1CJ4A 3Q6JA 1ELSA 3SSZA 4B63A 3DK9A 4ZCWA 4DNAA 3QSEA 3MZNA 4NEVA 2BCPA 4A9WA 4GGHA 4K1WA 1EBGA 1RYIA 2CFYA 3G5RA 2C66A 3P4QA 1K0LA 4H19A 2F5ZA 3RGTA 2WESA 3ZVIA 5G5HB 3EUB3 2E4GA 4D03A 2P88A 2JB3A 1GTHA 1K0JA 1PXAA 4USQA 3FV9A 3QPEA 3UCCA 1L9EA 1ELIA 4J33A 1HYUA 4XXGA 3NKSA 1QLBA 3NTAA 3D9XA 3CGEA 3T37A 3DG3A 2W55A 3CB3A 4H7UA 5HHFA 4C74A 5KOWA 3P3BA 4JY3A 1SJBA 1XANA 2R4JA 1GRBA 3CNPA 5JCNA 3P4RA 3NK2X 1E9IA 4GYPA 3M13A 3REDA 2IIDA 3NK1X 4U8NA 3V3OA 3SM8A 1PJ5A 3ALLA 2PHHA 4H2NA 5FJPA 2GVCA 4WX1A 4E4UA 4H4YA 3TJ4A 3OP2A 3II4A 3P1WA 2B76A 2QGYA 4XWRA 2RDXA 1B37A 4U8LA 3AEBA 4GF7A 2OZ3A 4H4ZA 3UOZA 1R6WA 2OPJA 4Z24A 3FG2P 3RITA 4GDEA 1EBHA 1GNDA 2PCEA 4C5OA 1F3PA 2V3BA 2HQMA 2XVFA 1OJAA 3GDPA 1E1LA 1F8RA 3CNDA 4B69A 1T3QC 3UP5A 2BS2A 3T4WA 4HCDA 1GXFA 4EM3A 4GUVA 2QCUA 2PTYA 1PBCA 2YM2A 3CYJA 4J57A 2PS2A 3AEFA 1D5TA 2GGJA 2GGEA 2WP6A 1DXLA 3SFDA 3SXIA 3DK8A 3VRBA 5KMQA 1YEYA 1WYGA 1GT8A 5FJOA 1FCDA 3TQPA 1B4VA 3I3LA 1E7PA 1KD0A 2B7RA 2C76A 2PYXA 1XS2A 2GB0A 1UKVG 2CVJA 4KPRA 4YSZA 2QVHA 4C3XA 4K7ZA 2V6OA 2EQ6A 4B64A 1KF6A 3UCDA 3CAWA 4PAAA 3HZLA 3DGZA 1XHCA 1KN0A 1JRYA 3K7MX 4Z1YA 2C7GA 2B9WA 2ZBWA 3SZWA 3TTEA 4U2SA 2PMQA 3FCPA 3GSIA 2AKMA 3V3NA 3IJIA 4RG3A 2YQUA 2XVHA 1FEBA 2P0IA 3DEQA 1TDKA 2IVDA 2ZADA 1JRXA 5J60A 1CC4A 4LIIA 4H4PA 5FJTA 1CC6A 3B6DA 1XPYA 4U8JA 3FXGA 3MUCA 1FEAA 2GF3A 1P2EA 3E1TA 4CCRA 4B68A 1BQGA 3VRAA 3U4FA 4XWZA 3T9PA 2OLOA 1GOSA 1TYTA 1NHSA 2VVMA 3SJNA 2GQFA 2CDUA 1Y56A 1MUCA 3CTYA 2YLZA 2B7SA 2JAEA 1DNCA 3N6HA 4KWSA 1VQZA 3OZMA 3UJ2A 1JDFA 3B97A 1EL5A 3AD8B 3QFBA 4NZHA 1LPFA 3DA1A 3C96A 3M0OA 2ZC8A 2OAMA 1ONEA 2MNRA 5HYMA 1BZLA 4IV9A 1L8PA 5KXJA 1H6VA 3ETRB 6ENLA 2V3AA 4IP4A 3BI4A 1CJ2A 4EIPA 4H83A 3UKAA 1RSGA 2E3TA 2RGHA 3TWBA 3COXA 1KSUA 3PFRA 1QJDA 1MRAA 1JCTA 3GO2A 4E6MA 4JY2A 4II2A 5BOFA 3CK5A 4IVOB 4GAPA 4TVWA 1GRHA 1GV4A 1JU2A 2HXTA 1S3EA 1N62C 1JPMA 1F8SA 1REOA 4RG4A 5EU9A 3JSKA 3GMCA 2C4CA 2XH2A 3SX6A 1RP0A 4NTCA 1GRGA 4G7FA 4ROPA 3K1GA 1N5XA 3F8DA 3RNMA 2OFJA 4B67A 1H7WA 3AE1A 4Z43A 2JB2A 3UOXA 3LZWA 2XLTA 1QO8A 1CJ3A 3UTGA 3IHMA 3V4BA 1KKOA 1W6TA 1COYA 3SN0A 2BC1A 3ICSA 3STPA 4E8GA 1KSSA 5LV9A 1MOKA 3UKKA 3KLJA 3JW7A 3IF9A 1MO9A 3ITJA 4H4VA 2GR1A 3H8LA 3FBSA 4UDQA 1TRBA 2V61A 3VC6A 4M0XA 1X31B 1SEZA 2XH4A 4KX6A 3UOYA 3KPKA 4H2PA 1N63C 3AM9A 3MWCA 2QJNA 4H4TA 4YWSA 4A6NB 1GERA 2YLSA 1L9CA 3DMEA 3CGCA 1E1NA 2C70A 7ENLA 4YTPA 2PTZA 4A5LA 4M52A 3KKJA 1FO4A 3AE8A 2DW7A 2XLUA 3NK0X 4U8IA 2GR0A 4NTEA 2FYMA 3TWAA 2Y6QA 4FDCB 2GGHA 3S5SA 2YM1A 2FJAA 3CT2A 4E0VA 4OVIA 4IL0A 2YG3A 2GAHB 1Y56B 3VFCA 4DSHA 4J31A 3UKHA 4HN8A 4DSGA 3BJSA 4K8GA 2YVFA 4PABA 5EOWA 3ABVA 2Q0LA 3L5OA 1YKJA 2YLRA 3CGDA 4AT0A 2YR6A 1GALA 2WPFA 3P0WA 3SBFA 3P4SA 2P8CA 3AEAA 1ZXIC 1EBDA 3NHOX 3JZUA 3IHGA 3NRZB 2C73A 1XPQA 3CPHG 4H1ZA 4X2PA 3TJIA 2E5AA 3AE2A 3BOXA 4K5RA 2WU2A 2XSXA 2C64A 2WP9A 3UGVA 3EANA 4ADWA 3EPTA 3C4AA 4BJYA 2GR3A 2PGEA 3DH9A 3URHA 1P48A 3V3WA 4K8DA 1IUUA 4YTNA 1VDVA 2YAUA 3UJEA 4YSYA 3SZCA 4JDRA 3DIPA 1PBBA 4U2TA 3PK7A 3WE0A 2QDDA 2BXSA 3AECA 1EC9A 2PODA 3AMZA 4J56A 3CNJA 3AXBA 4DHGA 1ZMCA 1B8SA 4DXKA 3ZVHA 3R0UA 1B5QA 3R11A 1GTEA 4ENLA 1P2HA 3RR1A 3SN1A 1N1PA 1Y0PA 2GRTA 1NU5A 4EQWA 3DK4A 3A7RA 3D46A 2O56A 3O0HA 3ATRA 3NYEA 3DERA 4JNAA 3CXBA 5DBJA 2GR2A 4G74A 1F9CA 5BULA 3UP4A 1NHRA 3NH3X 3CPIG 1JOAA 1K0IA 3NNEA 2WQYA 5EB5A 5KMRA 3DGBA 1KDGA 2FKPA 2BK5A 1GRFA 4HYRA 1ZK7A 4TM0A 4APNA 3ZDNA 3THUA 2BACA 2PP0A 1OJDA 3RRAA 4B66A 3VQRA 4BV6A 1PDHA 5IPYA 1V97A 3TOYA 1Q1WA 2YG6A 4K22A 3GD3A 3R10A 1GRTA 1H86A 3HPFA 4U8MA 4U8PA 2WEUA 3UTHA 3D1CA 3ALJA 1TZZA 2VVLA 1GREA 3P93A 3S61A 1E6EA 3SQPA 4REKA 2PGWA 4U8KA 4WCTA 2E1MA 2HXUA 3FJ4A 4Z25A 3NN0X 2GAGB 1IUWA 3T0KA 2WS3A 3BHFA 2P3ZA 2NQLA 4ZOHB 1DJNA 1N60C 4P9SA 1PJ6A 3RO6A 3H70A 4GRTA 3IJQA 1H83A 2Z5YA 3JVAA 3GWDA 4CCQA 1ZDLA 1S2QA 4H4UA 2JK6A 1OJCA 3BNUA 2W0HA 4OPUA 1VG9A 2R4EA 3BNMA 1WUFA 2GH5A 4GIRA 1X2GA 2GMHA 1H81A 4YWOA 4M6UA 2XVIA 3T2KA 4ECHA 3QSSA 4H2QA 4CRTA 4KEMA 3I4KA 4AOSA 5GSNA 3NTDA 1H7XA 2R0PA 2PSNA 1E1MA 1JEHA 3A7UA 1D4CA 3ICRA 5U25A 4YTMA 2GV8A 1TDNA 4OPTA 1S3BA 2OG9A 4X9MA 2EQ7A 2XFQA 2ONEA 3G5QA 4F4RA 1E39A 3B3RA 3PS9A 5CQFA 4HCLA 1D7LA 4N9XA 2C67A 3Q9TA 3GRSA 4C77A 3FIMB 4JHMA 3S47A 3NRNA 5J7XA 4CNKA 3AB1A 3RHAA 3UCLA 3R9UA 3FVDA 4MJWA 3SFEA 1JNZA 3BI2A 2EQ8A 4GYPC 1EC8A 1BGNA 3C4NA 1TDFA 2OX4A 2XVJA 1IYXA 3IJLA 4JN9A 1CBOA 2BK3A 3MSYA 1NEKA 5C3JA 3N4EA 2VOUA 4Z26A 1H84A 1KNPA 3ICTA 3DJGX 3VC5A 2OALA 2R46A 3TW9A 3ZLFA 3LB8A 2EQ9A 3DJJA 2PTWA 3AWIA 4U8OA 1DTNA 5FS6A 1S2YA 4H4RA 4DN1A 2A89A 2Q6UA 4K2XA 4CNJA 4Z17A 3OC4A 2BABA 3H4KA 1ONFA 4CY6A 3T31A 2ZZBA 4Y4LA 3AE9A 2MUCA 2QJMA 3F8RA 1ECQA 1PDYA 2Q0KA 4OPCA 3H8IA 2NVKX 4J3ZA 4ZA0A 5ENLA 4Z2TA 1YY5A 2ZZCA 3DG6A 2XH0A 1P43A 4EQXA 2DW6A 4Z2RA 2WPEA 3EAOA 1OJ9A 1D4EA 4GFIA 1DJQA 3DJEA 3QJ4A 4AP3A 1TDOA 3SQSA 3TCSA 1BGJA 1TKKA 3SN4A 3GRTA 4YXDA 1GETA 4TM1A 4HB9A 2OA1A 3R07C 3BSMA 3KUMA 1CF3A 4YKGA 2VRLA 3CN8A 3KPFA 2BA9A 2YWLA 2YLXA 2B9YA 4JN7A 4BK1A 4OPDA 1NHPA 3GYXA 2HZGA 3DESA 1FHUA 2PU1A 3NVZB 1V59A 3D47A 1D7YA 4AOXA 4CY8A 5KWFA 3PO7A 1DOCA 3AD9B 1PJ7A 1EC7A 1GESA 3EEZA 4IA5A 3VCCA 2WDVA 2YLWA 2WDRA 1CJCA 3UJRA 2BS3A 2X8HA 3QFAA 3DFHA 4EMWA 2XFOA 4EIQA 5BUKA 2JB1A 4TM4A 4DYEA 2R9ZA 1S7MA 4AP1A 3FYYA 2GGGA 3ENLA 3QVRA 3AE6A 3MQTA 2XFNA 2NPXA 1GRAA 2V5ZA 3P9UA 4H4SA 1YQ4A 2JBVA 3UJFA 4IA6A 1LJ1A 2VRMA 4ZCCA 2AL2A 1WUEA 3LZXA 1ZKQA 3HRDC 4GCMA 2XLPA 3FPZA 3V5FA 1O5WA 4B1BA 3HW2A 2PA6A 2J3NA 4Y4NA 3NVVB 1JROA 4U2LA 1H82A 3NYCA 3SY4A 4A3RA 1MDLA 4BURA 3VA8A 3NXLA 2RABA 1NG4A 2WOIA 5J04A 5JRBA 2BK4A 3SGLA 1F8WA 2AQJA 4A79A 2QJJA 3NYFA 3PWIA 3H8AA 3T6CA 4G9KA 1JNRA 2R45A 1Q9IA 4MGGA 5G5GB 1PHHA 3GMBA 2I5QA 4MKSA 2PPGA 3OPSA 1SJDA 2W54A 3Q4DA 5FS7A 3RCYA 3V76A 4A65A 2X50A 2GQWA 2BRAA 2X8GA 1IUVA 5KOXA 2Z5XA 3R25A 2XVEA 4TLZA 4EQRA 2YVJA 1TDEA 2YLTA 2XFPA 1IUTA 4TVYA 4IVMB 3ES8A 2C3CA 4BK3A 2OQYA 1SJAA 2PP3A 4H4XA 1PBFA 4OPGA 4YKFA 4A7AA 2OZ8A 3V5CA 1EL8A 1DOEA 3GY1A 2BCGG 1NHQA 2QA1A 3RP7A 3T8QA 5FJRA 2X8CA 4GISA 4O5QA 5U63A 3DG7A 5JCKA 2PP1A 3MKCA 1N4UA 2Y6RA 2OLAA 5M0ZA 3LJPA 2C3DA 2XH7A 1ZOYA 3Q45A 1F6MA 1NELA 2Q7VA 2AL1A 2OO6A 2CULA 3T2ZA 2VQ7A 3S5WA 4IZGA 1IUSA 4B65A 1NAAA 1PN0A 1PS9A 3NGCX 3VRDB 1BKWA 1GSNA 4FK1A 4KPLA 2W3SA 3GWFA 3CMMA 3UXLA 5IDZA 3GDNA 2AL2B 2R0CA 3IWAA 3SZ0A 3R0KA 2BC0A 3QN3A 3UXKA 1AOGA 1KFYA 3ES7A 4E4FA 1PBEA 3N4FA 4MMWA 5BVAA 1DOBA 2BYBA 3D8XA 4G73A 1MDRA 1Q1RA 2AKZA 2FJDA 2C75A 1Z6LA 4FX9A 2GGIA 1PDZA 1NG3A 5FS9A 5JCIA 3NN6X 3EF6A 4H2RA 4FI4A 1ZOVA 4YSHA 3OZYA 2RGOA 3NVWB 2OVLA 2WPCA 2WU5A 4FP1A 2FJBA 4A6GA 1ZY8A 5IQ4A 3RP6A 3L1RA 1CL0A 1JRPA 3QTPA 4Y4MA 3SR6B 3SYIA 1M6IA 3HYVA 3NT6A 3PVCA 1M64A 4E5TA 5BRTA 2X99A 2XYOA 1E1KA 2OLNA 2VZ2A 2XFUA 1NPXA 3I6DA 1R0MA 3KVEA 2WBAA 3LXDA 4O5UA 4YSXA 1GEUA 3DJDA 1O94A 1KKRA 3UKPA 5CKUA 2UZZA 5JCMA 3NLCA 2WETA 4GAVA 2QA2A 2YG7A 2IVEA 2W3RA 4GR1A 2R0GA 2OQHA 4I59A 3RP8A 5KVHA 3AE5A 4AT2A 2A87A 4H4QA 1YQ3A 3U9IA 3AYJA 2FJEA 1O95A 3IC9A 4X9NA 2YVGA 3UTEA 2A8XA 3ZVHB 4FK1C 4CBQA 3ISHA 2WOWA 1K4QA 1RVKA 3ALMA 3H12A 1CHUA 5KNLA 4DGKA 5BOEA 5HXIA 2GDQA 2PTXA 3PWGA 1BKHA 2WHDA 2BXRA 2YG4A 1FOHA 2BS4A 2PU0A 1PXCA 1XDIA 3KD9A 1LV0A 4OPIA 4RSLA 4GDPA 3VR8A 5HY5A 1RM6B 1YQZA 4II3A
chains in the Genus database with same CATH topology
4IA5A 4ADWA 4U8NA 3SM8A 3V3OA 3AE7A 1PJ5A 3EPTA 2WDVA 3ALLA 3C4AA 4BJYA 2PHHA 4H2NA 2GR3A 5FS8A 2WDRA 2YLWA 1CJCA 4A6NA 2BS3A 3SZFA 2X8HA 3DH9A 3URHA 2GVCA 3QFAA 4K8DA 4WX1A 4X4JA 1IUUA 1LQUA 4H4YA 4YTNA 4EMWA 2XFOA 3UKLA 3II4A 1ZMDA 2YAUA 4TLXA 4EIQA 3P1WA 5BUKA 1TYPA 2B76A 3KA7A 4XWRA 1B37A 3CGBA 4YT0A 4YSYA 2JB1A 3SZCA 3AEEA 4U8LA 4TM4A 4JDRA 3AEBA 1ZP0A 4GF7A 3M12A 4H4ZA 2R9ZA 2H88A 1S7MA 3UOZA 2GEWA 4AP1A 3QVRA 4Z43A 3AE6A 5EBKA 4Z24A 3FG2P 3L8KA 1PBBA 4GDEA 1EL9A 2AR8A 1GNDA 3HYWA 5IQ1A 4C5OA 2XFNA 4U2TA 2NPXA 1F3PA 1GRAA 2V5ZA 3P9UA 4H4SA 1BWCA 3WE0A 1YQ4A 2JBVA 5EB4A 2BXSA 3AECA 4IA6A 4J56A 2V3BA 1LJ1A 3CNJA 2HQMA 2XVFA 1OJAA 3GDPA 1E1LA 4NTDA 2VRMA 3AXBA 1ZMCA 1B8SA 4LA1A 1F8RA 4ZCCA 2B9XA 3CNDA 4B69A 3UP5A 1B5QA 2BS2A 5JCLA 3G5SA 3LZXA 1ZKQA 1GTEA 1GXFA 2BRYA 4GCMA 1P2HA 2XLPA 4EM3A 3FPZA 1IJHA 2QCUA 4GUVA 4USRA 3BHKA 1N1PA 1Y0PA 3F8PA 2GRTA 1PBCA 4EQWA 1O5WA 4B1BA 2YM2A 3DK4A 4J57A 2J3NA 4EM4A 3AEFA 3O0HA 1D5TA 3ATRA 4BJZA 4Y4NA 3NYEA 2WP6A 1DXLA 2WOVA 3SFDA 2APGA 3SXIA 4EMJA 4U2LA 5ER0A 3DK8A 3VRBA 5M10A 5KMQA 4J36A 4JNAA 4UP3A 5DBJA 1H82A 5TR3A 2GR2A 2I0ZA 4G74A 3NYCA 3SY4A 5BULA 3UP4A 1GT8A 4BURA 1FCDA 2RABA 1NHRA 2YR5A 3NH3X 1B4VA 1NG4A 3I3LA 1E7PA 1N4VA 2WOIA 3CPIG 2B7RA 1L0VA 1JOAA 1K0IA 2C76A 5JRBA 2BK4A 5L46A 3SGLA 5KMPA 1F8WA 1OJTA 3NNEA 3PG6A 4J34A 2PYXA 2WQYA 2GB0A 2AQJA 1UKVG 5EB5A 2CVJA 5KMRA 2E5VA 4A79A 4KPRA 4YSZA 3CNTA 3NYFA 1KDGA 4C3XA 4K7ZA 2V6OA 3T0KA 2EQ6A 2YG5A 1GPEA 1JNRA 1GRFA 2BK5A 2R45A 2VQBA 2WDQA 3GYIA 4G9KA 4B64A 1ZK7A 1KF6A 1Q9IA 4TM0A 4APNA 1IUXA 3ZDNA 1PHHA 2BACA 3GMBA 4PAAA 3HZLA 3DGZA 1OJDA 4A99A 1PBDA 2YR4A 4B66A 3VQRA 4BV6A 1XHCA 1KN0A 1JRYA 5FS7A 1PDHA 5IPYA 3DGHA 3K7MX 1Q1WA 3K30A 3V76A 2C7GA 2YG6A 4A65A 4K22A 2B9WA 2V60A 3GD3A 2X50A 2GQWA 2ZBWA 1GRTA 3AYLA 3SZWA 4ZN0A 2BRAA 1H86A 2X8GA 1IUVA 2DKHA 3AE4A 4U8MA 2Z5XA 5KOXA 4U8PA 2WEUA 4U2SA 3GSIA 3UTHA 3D1CA 2TMDA 3P4PA 2XVEA 3HYXA 3ALJA 4TLZA 3V3NA 1VRQB 5C2TA 4EQRA 2YVJA 4RG3A 2VVLA 1GREA 2YQUA 1TDEA 2YLTA 3UKQA 2XVHA 3S61A 2XFPA 1E6EA 3SQPA 2FBWA 1IUTA 1FEBA 2JKCA 3CIRA 4REKA 2IVDA 1TDKA 4IVMB 4TM3A 4U8KA 4WCTA 2E1MA 2C3CA 4BK3A 4ZCDA 1JRXA 5J60A 1CC4A 2AAQA 4Z25A 3NN0X 4LIIA 1IUWA 4H4PA 1N4WA 2GAGB 3LADA 2WS3A 4H4XA 3AE3A 3BHFA 1CC6A 1PBFA 3B6DA 4OPGA 4YKFA 1VG0A 4A7AA 4U8JA 4BK2A 3BI5A 1FEAA 1DJNA 1P2EA 2GF3A 1EL8A 3E1TA 4J2WA 1DOEA 4P9SA 1PJ6A 4B68A 4CCRA 2BCGG 3VRAA 1L9DA 1NHQA 5GRTA 4GRTA 2Z5YA 1H83A 2QA1A 4XWZA 3AD7B 2OLOA 1GOSA 3RP7A 1TYTA 1NHSA 3ADAB 2VVMA 2GQFA 2CDUA 3GWDA 1Y56A 4CCQA 4UDRA 3AEGA 1ZDLA 1LVLA 2X8CA 3CTYA 3VR9A 2YLZA 2B7SA 1S2QA 4H4UA 4O5QA 2JK6A 2JAEA 1DNCA 5U63A 4JQ9A 1OJCA 3BNUA 5JCKA 2W0HA 4OPUA 1VG9A 4EQSA 2R4EA 1N4UA 2Y6RA 3BNMA 1EL5A 3AD8B 3QFBA 2GH5A 5M0ZA 3LJPA 4NZHA 1LPFA 2O9ZA 3C96A 3DA1A 2C3DA 3M0OA 4JNQA 3ATQA 2OAMA 1ZOYA 1F6MA 4C3YA 2ARDA 4Z2UA 2GMHA 3AEDA 1H81A 4G6HA 4YWOA 5HYMA 1BZLA 4IV9A 2Q7VA 5KXJA 5KMSA 1H6VA 2XVIA 3T2KA 1FL2A 3CPJG 2V3AA 4ECHA 2ZZ0A 3BI4A 3QSSA 2CULA 1CJ2A 4H2QA 3T14A 3T2ZA 4CRTA 3KU9A 4EIPA 5KRQA 4EMIA 3UKAA 1KNRA 2VQ7A 3K7TA 1RSGA 3S5WA 2RGHA 4AOSA 5GSNA 3COXA 3NTDA 1H7XA 1KSUA 1IUSA 4HA6A 1QJDA 2R0PA 4B65A 1E1MA 1NAAA 1PN0A 1PS9A 3NGCX 1JEHA 2WP5A 3VRDB 1D4CA 3ICRA 5U25A 4YTMA 2H89A 2GV8A 1BKWA 1GSNA 4JY2A 1TDNA 4FK1A 4II2A 1EL7A 3NIXA 4NWZA 4LU6A 3T2YA 5FMHA 4IVOB 1LQTA 4OPTA 4GAPA 4H4WA 1GRHA 1S3BA 3FMWA 3UKFA 3GWFA 3CMMA 1GV4A 4X9MA 1JU2A 1S3EA 3GDNA 1LTXR 2EQ7A 2DKIA 1F8SA 1REOA 2XFQA 3ZYXA 1MXTA 4RG4A 2R0CA 1NENA 2GMJA 3G5QA 3IWAA 3GD4A 3JSKA 3GMCA 2C4CA 3SZ0A 2BC0A 4G6GA 3B3RA 1E39A 1AOGA 1KFYA 3PS9A 1RP0A 4NTCA 3SX6A 1PBEA 5CQFA 1GRGA 2ACZA 1D7LA 5BVAA 1DOBA 4N9XA 2C67A 3Q9TA 2BYBA 3D8XA 2C72A 4G73A 3CNSA 3AYIA 1Q1RA 3GRSA 2FJDA 2C75A 3F8DA 1H2IA 4H50A 2C65A 2RGJA 4C77A 2QAEA 2TPRA 1Z6LA 3FIMB 4FX9A 3RNMA 4B67A 1DODA 1H7WA 3AE1A 4Z44A 4D04A 1NG3A 5FS9A 5JCIA 2JB2A 3NN6X 3NRNA 3AB1A 5J7XA 4CNKA 3UOXA 3LZWA 2XLTA 3EF6A 4H2RA 1QO8A 4I58A 3RHAA 1ZOVA 3UCLA 3R9UA 4YSHA 1VDCA 1CJ3A 4MJWA 3SFEA 4NEWA 1JNZA 2RGOA 3UTGA 3BI2A 2EQ8A 4OCGA 3IHMA 1FECA 4UDPA 1BGNA 2X3NA 3C4NA 2WPCA 1TDFA 2WU5A 2XVJA 1COYA 4JN9A 2FJBA 1ZY8A 5IQ4A 2BC1A 3L1RA 1CBOA 1CL0A 2BK3A 3ICSA 3RP6A 1NEKA 1ZX9A 1PXBA 1NDAA 4Y4MA 1KSSA 4ICYA 5LV9A 2VVLG 3SYIA 5C3JA 1MOKA 3UKKA 1M6IA 2VOUA 3KLJA 2XCGA 4Z26A 1H84A 1MO9A 1KNPA 3HYVA 1D4DA 3IF9A 3ICTA 4H4VA 2GR1A 3H8LA 3ITJA 3LOVA 3NT6A 4NNJA 3DJGX 3PVCA 1M64A 3OZ2A 3QVPA 2OALA 2XDOA 3FBSA 1W4XA 2R46A 5BRTA 4UDQA 2X99A 1TRBA 3LB8A 2EQ9A 3DJJA 2V61A 3QSMA 2XYOA 3AWIA 4U8OA 1E1KA 1X31B 5KVIA 2OLNA 2VZ2A 1SEZA 5FS6A 1S2YA 4H4RA 1CC2A 2XFUA 3KPKA 4KX6A 3UOYA 2A89A 4H2PA 2Q6UA 4K2XA 1NPXA 4CNJA 3I6DA 3UOVA 3KVEA 3OC4A 2BABA 2WBAA 3LXDA 4O5UA 4H4TA 3H4KA 1ONFA 1JRZA 4CY6A 4YSXA 3T31A 4A6NB 1GEUA 3DJDA 4OPLA 2ZZBA 1GERA 2YLSA 1L9CA 4Y4LA 3AE9A 2XLRA 3DMEA 3GYJA 3CGCA 1O94A 1E1NA 3F8RA 2C70A 3K7QX 3UKPA 1BF3A 1VQWA 5CKUA 2UZZA 4YTPA 2Q0KA 4OPCA 5JCMA 3UTFA 3H8IA 2XLSA 4A5LA 3NG7X 2NVKX 3NLCA 4M52A 3KKJA 4K5SA 5U1OA 3AE8A 1CJ4A 4Z2TA 2WETA 1YY5A 2ZZCA 2XLUA 3NK0X 4GAVA 3Q6JA 2QA2A 2YG7A 4U8IA 2IVEA 4EQXA 2GR0A 4NTEA 2Y6QA 4FDCB 4Z2RA 2YM1A 4B63A 2WPEA 2FJAA 3DK9A 4GR1A 3EAOA 4DNAA 1OJ9A 2R0GA 4E0VA 4I59A 1D4EA 2YG3A 3QSEA 4OVIA 1DJQA 2GAHB 3DJEA 3QJ4A 1Y56B 3RP8A 4AP3A 4NEVA 4DSHA 2BCPA 5KVHA 4A9WA 3AE5A 4AT2A 4J31A 3UKHA 1TDOA 4DSGA 2YVFA 2A87A 4PABA 5EOWA 4H4QA 1RYIA 1YQ3A 2Q0LA 3ABVA 2FJEA 1BGJA 3AYJA 1O95A 2CFYA 3IC9A 2C66A 2YVGA 3G5RA 3P4QA 4X9NA 3GRTA 2A8XA 3L5OA 3UTEA 4YXDA 1GETA 1YKJA 1K0LA 2YLRA 4FK1C 4TM1A 4CBQA 4HB9A 3CGDA 2F5ZA 2OA1A 2WESA 2YR6A 4AT0A 3ISHA 1GALA 2WPFA 2E4GA 4D03A 1CF3A 2WOWA 1K4QA 2JB3A 1GTHA 1K0JA 1PXAA 4YKGA 3ALMA 3P4SA 3AEAA 4USQA 2VRLA 1L9EA 3CN8A 3KPFA 1EBDA 1ELIA 1CHUA 5KNLA 3NHOX 4DGKA 4J33A 1HYUA 5HXIA 4XXGA 2BA9A 2YWLA 3IHGA 2YLXA 3NKSA 2B9YA 1QLBA 2C73A 2WHDA 2BXRA 2YG4A 1XPQA 4BK1A 1FOHA 3NTAA 4OPDA 3D9XA 3CGEA 3CPHG 3T37A 1NHPA 3GYXA 4C74A 4H7UA 5HHFA 5KOWA 2BS4A 4JY3A 1V59A 3AE2A 1D7YA 1PXCA 4AOXA 4CY8A 5KWFA 3PO7A 4K5RA 1XANA 2C64A 2R4JA 1DOCA 2WP9A 1GRBA 2WU2A 1XDIA 5JCNA 3CNPA 3P4RA 3NK2X 3KD9A 3AD9B 3M13A 1LV0A 1PJ7A 4OPIA 4RSLA 3REDA 2IIDA 4GDPA 3VR8A 5HY5A 3EANA 4II3A 1YQZA 1GESA 3NK1X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IA5 A;  4ADW A;  4U8N A;  3SM8 A;  3V3O A;  3AE7 A;  1PJ5 A;  3EPT A;  2WDV A;  3ALL A;  3C4A A;  4BJY A;  2PHH A;  4H2N A;  2GR3 A;  5FS8 A;  2WDR A;  2YLW A;  1CJC A;  4A6N A;  2BS3 A;  2X8H A;  3DH9 A;  3URH A;  2GVC A;  3QFA A;  4K8D A;  4WX1 A;  4X4J A;  1IUU A;  1LQU A;  4H4Y A;  4YTN A;  4EMW A;  2XFO A;  3UKL A;  3II4 A;  1ZMD A;  2YAU A;  4TLX A;  4EIQ A;  3P1W A;  5BUK A;  1TYP A;  2B76 A;  3KA7 A;  4XWR A;  1B37 A;  3CGB A;  4YT0 A;  4YSY A;  2JB1 A;  3AEE A;  4U8L A;  4TM4 A;  4JDR A;  3AEB A;  1ZP0 A;  4GF7 A;  3M12 A;  4H4Z A;  2R9Z A;  2H88 A;  3UOZ A;  4AP1 A;  2GEW A;  3QVR A;  4Z43 A;  3AE6 A;  5EBK A;  4Z24 A;  3FG2 P;  3L8K A;  1PBB A;  4GDE A;  1EL9 A;  2AR8 A;  1GND A;  5IQ1 A;  4C5O A;  2XFN A;  4U2T A;  2NPX A;  1F3P A;  1GRA A;  2V5Z A;  3P9U A;  4H4S A;  1BWC A;  3WE0 A;  1YQ4 A;  2JBV A;  5EB4 A;  2BXS A;  3AEC A;  4IA6 A;  4J56 A;  1LJ1 A;  2V3B A;  3CNJ A;  2HQM A;  2XVF A;  1OJA A;  3GDP A;  1E1L A;  4NTD A;  2VRM A;  3AXB A;  1ZMC A;  1B8S A;  4LA1 A;  1F8R A;  4ZCC A;  2B9X A;  3CND A;  4B69 A;  3UP5 A;  1B5Q A;  2BS2 A;  5JCL A;  3G5S A;  3LZX A;  1ZKQ A;  1GTE A;  1GXF A;  4GCM A;  1P2H A;  2XLP A;  4EM3 A;  3FPZ A;  1IJH A;  2QCU A;  4GUV A;  4USR A;  3BHK A;  1N1P A;  1Y0P A;  3F8P A;  2GRT A;  1PBC A;  4EQW A;  1O5W A;  4B1B A;  2YM2 A;  3DK4 A;  4J57 A;  2J3N A;  4EM4 A;  3AEF A;  3O0H A;  1D5T A;  3ATR A;  4BJZ A;  4Y4N A;  3NYE A;  2WP6 A;  1DXL A;  2WOV A;  3SFD A;  2APG A;  4EMJ A;  4U2L A;  5ER0 A;  3DK8 A;  3VRB A;  5M10 A;  4J36 A;  4JNA A;  4UP3 A;  5DBJ A;  1H82 A;  5TR3 A;  2GR2 A;  2I0Z A;  3NYC A;  5BUL A;  3UP4 A;  1GT8 A;  4BUR A;  1FCD A;  2RAB A;  1NHR A;  2YR5 A;  3NH3 X;  1B4V A;  1NG4 A;  3I3L A;  1E7P A;  1N4V A;  2WOI A;  3CPI G;  2B7R A;  1L0V A;  1JOA A;  1K0I A;  2C76 A;  2BK4 A;  5L46 A;  3SGL A;  1F8W A;  1OJT A;  3NNE A;  4J34 A;  2PYX A;  2WQY A;  2GB0 A;  2AQJ A;  1UKV G;  5EB5 A;  2CVJ A;  2E5V A;  4A79 A;  4KPR A;  4YSZ A;  3CNT A;  3NYF A;  1KDG A;  4C3X A;  4K7Z A;  2V6O A;  2EQ6 A;  2YG5 A;  1GPE A;  1JNR A;  1GRF A;  2BK5 A;  2R45 A;  2VQB A;  2WDQ A;  3GYI A;  4B64 A;  1ZK7 A;  1KF6 A;  1Q9I A;  4TM0 A;  4APN A;  1IUX A;  3ZDN A;  1PHH A;  2BAC A;  3GMB A;  4PAA A;  3HZL A;  3DGZ A;  1OJD A;  4A99 A;  1PBD A;  2YR4 A;  4B66 A;  3VQR A;  4BV6 A;  1XHC A;  1JRY A;  5FS7 A;  1PDH A;  5IPY A;  3DGH A;  3K7M X;  1Q1W A;  3K30 A;  3V76 A;  2C7G A;  2YG6 A;  4A65 A;  4K22 A;  2B9W A;  2V60 A;  3GD3 A;  2X50 A;  2GQW A;  2ZBW A;  1GRT A;  3AYL A;  4ZN0 A;  1H86 A;  2X8G A;  1IUV A;  2DKH A;  3AE4 A;  4U8M A;  2Z5X A;  5KOX A;  4U8P A;  2WEU A;  4U2S A;  3GSI A;  3UTH A;  3D1C A;  2TMD A;  3P4P A;  2XVE A;  3ALJ A;  4TLZ A;  3V3N A;  1VRQ B;  5C2T A;  4EQR A;  2YVJ A;  4RG3 A;  2VVL A;  1GRE A;  2YQU A;  1TDE A;  2YLT A;  3UKQ A;  2XVH A;  3S61 A;  2XFP A;  1E6E A;  3SQP A;  2FBW A;  1IUT A;  1FEB A;  2JKC A;  3CIR A;  4REK A;  2IVD A;  1TDK A;  4IVM B;  4TM3 A;  4U8K A;  4WCT A;  2E1M A;  2C3C A;  4BK3 A;  4ZCD A;  1JRX A;  5J60 A;  1CC4 A;  2AAQ A;  4Z25 A;  3NN0 X;  4LII A;  1IUW A;  4H4P A;  1N4W A;  2GAG B;  3LAD A;  2WS3 A;  4H4X A;  3AE3 A;  3BHF A;  1CC6 A;  1PBF A;  3B6D A;  4OPG A;  4YKF A;  1VG0 A;  4A7A A;  4U8J A;  4BK2 A;  3BI5 A;  1FEA A;  1DJN A;  1P2E A;  2GF3 A;  1EL8 A;  3E1T A;  4J2W A;  1DOE A;  4P9S A;  1PJ6 A;  4B68 A;  4CCR A;  2BCG G;  3VRA A;  1L9D A;  1NHQ A;  5GRT A;  4GRT A;  2Z5Y A;  1H83 A;  2QA1 A;  4XWZ A;  3AD7 B;  2OLO A;  1GOS A;  3RP7 A;  1TYT A;  1NHS A;  3ADA B;  2VVM A;  2GQF A;  2CDU A;  3GWD A;  1Y56 A;  4CCQ A;  4UDR A;  3AEG A;  1ZDL A;  1LVL A;  2X8C A;  3CTY A;  3VR9 A;  2YLZ A;  2B7S A;  1S2Q A;  4H4U A;  4O5Q A;  2JK6 A;  2JAE A;  1DNC A;  5U63 A;  4JQ9 A;  1OJC A;  3BNU A;  5JCK A;  2W0H A;  4OPU A;  1VG9 A;  4EQS A;  2R4E A;  1N4U A;  2Y6R A;  3BNM A;  1EL5 A;  3AD8 B;  3QFB A;  2GH5 A;  5M0Z A;  3LJP A;  4NZH A;  1LPF A;  2O9Z A;  3C96 A;  3DA1 A;  2C3D A;  3M0O A;  4JNQ A;  3ATQ A;  2OAM A;  1ZOY A;  1F6M A;  4C3Y A;  2ARD A;  4Z2U A;  2GMH A;  3AED A;  1H81 A;  4YWO A;  5HYM A;  1BZL A;  4IV9 A;  2Q7V A;  5KXJ A;  1H6V A;  2XVI A;  1FL2 A;  3CPJ G;  2V3A A;  4ECH A;  2ZZ0 A;  3BI4 A;  3QSS A;  2CUL A;  1CJ2 A;  4H2Q A;  4EIP A;  5KRQ A;  4CRT A;  3KU9 A;  4EMI A;  3UKA A;  1KNR A;  2VQ7 A;  3K7T A;  1RSG A;  3S5W A;  2RGH A;  4AOS A;  5GSN A;  3COX A;  3NTD A;  1H7X A;  1KSU A;  1IUS A;  4HA6 A;  1QJD A;  2R0P A;  4B65 A;  1E1M A;  1NAA A;  1PN0 A;  1PS9 A;  3NGC X;  1JEH A;  2WP5 A;  3VRD B;  1D4C A;  3ICR A;  5U25 A;  4YTM A;  2H89 A;  2GV8 A;  1BKW A;  1GSN A;  4JY2 A;  1TDN A;  4FK1 A;  1EL7 A;  3NIX A;  4LU6 A;  5FMH A;  4IVO B;  1LQT A;  4OPT A;  4H4W A;  1GRH A;  1S3B A;  3FMW A;  3UKF A;  3GWF A;  1GV4 A;  4X9M A;  1JU2 A;  1S3E A;  3GDN A;  1LTX R;  2EQ7 A;  2DKI A;  1F8S A;  1REO A;  2XFQ A;  3ZYX A;  1MXT A;  4RG4 A;  2R0C A;  1NEN A;  2GMJ A;  3G5Q A;  3IWA A;  3GD4 A;  3JSK A;  3GMC A;  2BC0 A;  3B3R A;  1E39 A;  1AOG A;  1KFY A;  3PS9 A;  1RP0 A;  4NTC A;  1PBE A;  5CQF A;  1GRG A;  2ACZ A;  1D7L A;  5BVA A;  1DOB A;  4N9X A;  2C67 A;  3Q9T A;  2BYB A;  3D8X A;  2C72 A;  3CNS A;  3AYI A;  1Q1R A;  3GRS A;  2FJD A;  2C75 A;  3F8D A;  4H50 A;  2C65 A;  2RGJ A;  4C77 A;  2QAE A;  2TPR A;  1Z6L A;  3FIM B;  4FX9 A;  3RNM A;  4B67 A;  1DOD A;  1H7W A;  3AE1 A;  4Z44 A;  4D04 A;  1NG3 A;  5FS9 A;  5JCI A;  2JB2 A;  3NN6 X;  3NRN A;  3AB1 A;  5J7X A;  4CNK A;  3UOX A;  3LZW A;  2XLT A;  3EF6 A;  4H2R A;  1QO8 A;  4I58 A;  3RHA A;  1ZOV A;  3UCL A;  3R9U A;  4YSH A;  1VDC A;  1CJ3 A;  4MJW A;  3SFE A;  4NEW A;  1JNZ A;  2RGO A;  3UTG A;  3BI2 A;  2EQ8 A;  4OCG A;  3IHM A;  1FEC A;  4UDP A;  1BGN A;  2X3N A;  3C4N A;  2WPC A;  1TDF A;  2WU5 A;  2XVJ A;  1COY A;  4JN9 A;  2FJB A;  1ZY8 A;  5IQ4 A;  2BC1 A;  3L1R A;  1CBO A;  1CL0 A;  2BK3 A;  3ICS A;  3RP6 A;  1NEK A;  1ZX9 A;  1PXB A;  1NDA A;  4Y4M A;  1KSS A;  4ICY A;  5LV9 A;  2VVL G;  5C3J A;  1MOK A;  3UKK A;  1M6I A;  2VOU A;  3KLJ A;  2XCG A;  4Z26 A;  1H84 A;  1MO9 A;  1KNP A;  3IF9 A;  1D4D A;  3ICT A;  3ITJ A;  4H4V A;  2GR1 A;  3H8L A;  3LOV A;  3NT6 A;  3DJG X;  3PVC A;  1M64 A;  3OZ2 A;  3QVP A;  2OAL A;  2XDO A;  3FBS A;  1W4X A;  2R46 A;  5BRT A;  4UDQ A;  2X99 A;  1TRB A;  3LB8 A;  2EQ9 A;  3DJJ A;  2V61 A;  3QSM A;  2XYO A;  3AWI A;  4U8O A;  1E1K A;  1X31 B;  5KVI A;  2OLN A;  2VZ2 A;  1SEZ A;  5FS6 A;  1S2Y A;  4H4R A;  1CC2 A;  2XFU A;  4KX6 A;  3UOY A;  2A89 A;  4H2P A;  2Q6U A;  4K2X A;  1NPX A;  4CNJ A;  3I6D A;  3UOV A;  3KVE A;  3OC4 A;  2BAB A;  2WBA A;  3LXD A;  4O5U A;  4H4T A;  3H4K A;  1ONF A;  1JRZ A;  4CY6 A;  4YSX A;  4A6N B;  1GEU A;  3DJD A;  4OPL A;  2ZZB A;  1GER A;  2YLS A;  1L9C A;  4Y4L A;  3AE9 A;  2XLR A;  3DME A;  3GYJ A;  3CGC A;  1O94 A;  1E1N A;  3F8R A;  2C70 A;  3K7Q X;  3UKP A;  1BF3 A;  1VQW A;  5CKU A;  2UZZ A;  4YTP A;  2Q0K A;  4OPC A;  5JCM A;  3UTF A;  3H8I A;  2XLS A;  4A5L A;  3NG7 X;  2NVK X;  3NLC A;  4M52 A;  3KKJ A;  4K5S A;  5U1O A;  3AE8 A;  1CJ4 A;  4Z2T A;  2WET A;  1YY5 A;  2ZZC A;  2XLU A;  3NK0 X;  3Q6J A;  2QA2 A;  2YG7 A;  4U8I A;  2IVE A;  4EQX A;  2GR0 A;  4NTE A;  2Y6Q A;  4FDC B;  4Z2R A;  2YM1 A;  4B63 A;  2WPE A;  2FJA A;  3DK9 A;  4GR1 A;  3EAO A;  4DNA A;  1OJ9 A;  2R0G A;  4E0V A;  4I59 A;  1D4E A;  2YG3 A;  3QSE A;  4OVI A;  1DJQ A;  2GAH B;  3DJE A;  3QJ4 A;  1Y56 B;  3RP8 A;  4AP3 A;  4NEV A;  4DSH A;  2BCP A;  5KVH A;  4A9W A;  3AE5 A;  4AT2 A;  4J31 A;  3UKH A;  1TDO A;  4DSG A;  2YVF A;  2A87 A;  4PAB A;  5EOW A;  4H4Q A;  1RYI A;  1YQ3 A;  2Q0L A;  3ABV A;  2FJE A;  1BGJ A;  3AYJ A;  1O95 A;  2CFY A;  3IC9 A;  2C66 A;  2YVG A;  3G5R A;  3P4Q A;  4X9N A;  3GRT A;  2A8X A;  3UTE A;  4YXD A;  1GET A;  1YKJ A;  1K0L A;  2YLR A;  4FK1 C;  4TM1 A;  4CBQ A;  4HB9 A;  3CGD A;  2F5Z A;  2OA1 A;  2WES A;  2YR6 A;  4AT0 A;  3ISH A;  1GAL A;  2WPF A;  2E4G A;  4D03 A;  1CF3 A;  2WOW A;  1K4Q A;  2JB3 A;  1GTH A;  1K0J A;  1PXA A;  4YKG A;  3ALM A;  3P4S A;  3AEA A;  4USQ A;  2VRL A;  1L9E A;  3CN8 A;  3KPF A;  1EBD A;  1ELI A;  1CHU A;  3NHO X;  4DGK A;  4J33 A;  1HYU A;  5HXI A;  4XXG A;  2BA9 A;  2YWL A;  3IHG A;  2YLX A;  3NKS A;  2B9Y A;  1QLB A;  2C73 A;  2WHD A;  2BXR A;  2YG4 A;  1XPQ A;  4BK1 A;  1FOH A;  3NTA A;  4OPD A;  3CGE A;  3CPH G;  3T37 A;  1NHP A;  4C74 A;  4H7U A;  5HHF A;  5KOW A;  2BS4 A;  4JY3 A;  1V59 A;  3AE2 A;  1D7Y A;  1PXC A;  4AOX A;  4CY8 A;  5KWF A;  3PO7 A;  4K5R A;  1XAN A;  2C64 A;  2R4J A;  1DOC A;  2WP9 A;  1GRB A;  2WU2 A;  1XDI A;  5JCN A;  3CNP A;  3P4R A;  3NK2 X;  3KD9 A;  3AD9 B;  3M13 A;  1LV0 A;  1PJ7 A;  4OPI A;  4RSL A;  3RED A;  2IID A;  4GDP A;  3VR8 A;  5HY5 A;  3EAN A;  1YQZ A;  1GES A;  3NK1 X; 
#chains in the Genus database with same CATH topology
 3AE7 A;  3R1Z A;  1N5W C;  5FS8 A;  4A6N A;  3IK4 A;  3SZF A;  4X4J A;  1LQU A;  3UKL A;  1ZMD A;  4A35 A;  4TLX A;  1TYP A;  3KA7 A;  3CGB A;  4YT0 A;  3AEE A;  3NFU A;  4G8T A;  1ZP0 A;  3M12 A;  2H88 A;  2GEW A;  5EBK A;  3L8K A;  4HNL A;  4HCH A;  1EL9 A;  2AR8 A;  3HYW A;  5IQ1 A;  1BWC A;  1OEP A;  3GC2 A;  5EB4 A;  1FFU C;  4NTD A;  2GSH A;  4LA1 A;  2B9X A;  4DWD A;  5JCL A;  3G5S A;  4K2S A;  1MNS A;  2BRY A;  3QLD A;  1N61 C;  1IJH A;  4USR A;  3BHK A;  3F8P A;  4EWJ A;  1TE6 A;  4JN8 A;  4EM4 A;  4BJZ A;  4IP5 A;  3VCN A;  2WOV A;  2APG A;  4EMJ A;  3DFY A;  5ER0 A;  5M10 A;  4J36 A;  5TR3 A;  3AN1 A;  2I0Z A;  4GGB A;  3ZLH A;  2YR5 A;  1N4V A;  2P8B A;  1L0V A;  5L46 A;  1FFV C;  5KMP A;  1OJT A;  4J34 A;  3PG6 A;  3H7V A;  2E5V A;  3CNT A;  4IL2 A;  2YG5 A;  1GPE A;  2WDQ A;  2VQB A;  3GYI A;  3DDM A;  1IUX A;  4A99 A;  1PBD A;  2YR4 A;  3QKE A;  3DGH A;  3K30 A;  4KT2 A;  2V60 A;  3AYL A;  4ZN0 A;  1X2H A;  2DKH A;  3AE4 A;  2GL5 A;  2POZ A;  2TMD A;  3P4P A;  3HYX A;  2QQ6 A;  1VRQ B;  5C2T A;  3UKQ A;  3N6J A;  2FBW A;  2JKC A;  3CIR A;  3UJS A;  3GD6 A;  4TM3 A;  2XGZ A;  4ZCD A;  2AAQ A;  1N4W A;  4UP3 A;  3LAD A;  3AE3 A;  3OTR A;  1VG0 A;  3ZLG A;  4BK2 A;  3BI5 A;  4J2W A;  1L9D A;  5GRT A;  3AD7 B;  4DX3 A;  3ADA B;  4UDR A;  3AEG A;  1LVL A;  3VR9 A;  4JQ9 A;  4HPN A;  4EQS A;  3MY9 A;  2O9Z A;  4JNQ A;  3ATQ A;  4C3Y A;  3NZG A;  2ARD A;  3EKG A;  4Z2U A;  3AED A;  4G6H A;  1FHV A;  5KMS A;  1FL2 A;  3CPJ G;  2ZZ0 A;  3T14 A;  5KRQ A;  3KU9 A;  4EMI A;  3NO1 A;  1KNR A;  3K7T A;  4HA6 A;  2WP5 A;  3B9J B;  2H89 A;  4NWZ A;  1EL7 A;  3NIX A;  4LU6 A;  3T2Y A;  5FMH A;  1LQT A;  4H4W A;  3UKF A;  3FMW A;  2OZT A;  4IHC A;  3OW1 A;  3I6E A;  1FIQ B;  1LTX R;  2DKI A;  3ZYX A;  2HNE A;  1MXT A;  3NVY B;  1NEN A;  2GMJ A;  3GD4 A;  4HNC A;  4G6G A;  2QDE A;  2ACZ A;  2C72 A;  3CNS A;  1STZ A;  3AYI A;  4H2H A;  1H2I A;  1JPD X;  4H50 A;  2C65 A;  2RGJ A;  2QAE A;  2TPR A;  1DOD A;  4Z44 A;  4D04 A;  4I58 A;  3VDG A;  1VDC A;  3I6T A;  4NEW A;  4OCG A;  1FEC A;  4UDP A;  2X3N A;  4GME A;  3A7A A;  1ZX9 A;  1PXB A;  1NDA A;  4ICY A;  2VVL G;  3CXO A;  2XCG A;  1D4D A;  4NNJ A;  3LOV A;  3OZ2 A;  3QVP A;  2XDO A;  1W4X A;  3QSM A;  3NS1 B;  5KVI A;  2OKT A;  1SJC A;  1CC2 A;  4J1O A;  3UOV A;  1SB3 B;  1JRZ A;  4OPL A;  2XLR A;  3GYJ A;  5FJU A;  3K7Q X;  1BF3 A;  1VQW A;  2CHR A;  3UTF A;  2XLS A;  3NG7 X;  4K5S A;  1KCZ A;  4IT1 A;  5U1O A;  1CJ4 A;  3Q6J A;  1ELS A;  3SSZ A;  4B63 A;  3DK9 A;  4ZCW A;  4DNA A;  3QSE A;  3MZN A;  4NEV A;  2BCP A;  4A9W A;  4GGH A;  4K1W A;  1EBG A;  1RYI A;  2CFY A;  3G5R A;  2C66 A;  3P4Q A;  1K0L A;  4H19 A;  2F5Z A;  3RGT A;  2WES A;  3ZVI A;  5G5H B;  3EUB 3;  2E4G A;  4D03 A;  2P88 A;  2JB3 A;  1GTH A;  1K0J A;  1PXA A;  4USQ A;  3FV9 A;  3QPE A;  3UCC A;  1L9E A;  1ELI A;  4J33 A;  1HYU A;  4XXG A;  3NKS A;  1QLB A;  3NTA A;  3D9X A;  3CGE A;  3T37 A;  3DG3 A;  2W55 A;  3CB3 A;  4H7U A;  5HHF A;  4C74 A;  5KOW A;  3P3B A;  4JY3 A;  1SJB A;  1XAN A;  2R4J A;  1GRB A;  3CNP A;  5JCN A;  3P4R A;  3NK2 X;  1E9I A;  4GYP A;  3M13 A;  3RED A;  2IID A;  3NK1 X;  4U8N A;  3V3O A;  3SM8 A;  1PJ5 A;  3ALL A;  2PHH A;  4H2N A;  5FJP A;  2GVC A;  4WX1 A;  4E4U A;  4H4Y A;  3TJ4 A;  3OP2 A;  3II4 A;  3P1W A;  2B76 A;  2QGY A;  4XWR A;  2RDX A;  1B37 A;  4U8L A;  3AEB A;  4GF7 A;  2OZ3 A;  4H4Z A;  3UOZ A;  1R6W A;  2OPJ A;  4Z24 A;  3FG2 P;  3RIT A;  4GDE A;  1EBH A;  1GND A;  2PCE A;  4C5O A;  1F3P A;  2V3B A;  2HQM A;  2XVF A;  1OJA A;  3GDP A;  1E1L A;  1F8R A;  3CND A;  4B69 A;  1T3Q C;  3UP5 A;  2BS2 A;  3T4W A;  4HCD A;  1GXF A;  4EM3 A;  4GUV A;  2QCU A;  2PTY A;  1PBC A;  2YM2 A;  3CYJ A;  4J57 A;  2PS2 A;  3AEF A;  1D5T A;  2GGJ A;  2GGE A;  2WP6 A;  1DXL A;  3SFD A;  3SXI A;  3DK8 A;  3VRB A;  5KMQ A;  1YEY A;  1WYG A;  1GT8 A;  5FJO A;  1FCD A;  3TQP A;  1B4V A;  3I3L A;  1E7P A;  1KD0 A;  2B7R A;  2C76 A;  2PYX A;  1XS2 A;  2GB0 A;  1UKV G;  2CVJ A;  4KPR A;  4YSZ A;  2QVH A;  4C3X A;  4K7Z A;  2V6O A;  2EQ6 A;  4B64 A;  1KF6 A;  3UCD A;  3CAW A;  4PAA A;  3HZL A;  3DGZ A;  1XHC A;  1KN0 A;  1JRY A;  3K7M X;  4Z1Y A;  2C7G A;  2B9W A;  2ZBW A;  3SZW A;  3TTE A;  4U2S A;  2PMQ A;  3FCP A;  3GSI A;  2AKM A;  3V3N A;  3IJI A;  4RG3 A;  2YQU A;  2XVH A;  1FEB A;  2P0I A;  3DEQ A;  1TDK A;  2IVD A;  2ZAD A;  1JRX A;  5J60 A;  1CC4 A;  4LII A;  4H4P A;  5FJT A;  1CC6 A;  3B6D A;  1XPY A;  4U8J A;  3FXG A;  3MUC A;  1FEA A;  2GF3 A;  1P2E A;  3E1T A;  4CCR A;  4B68 A;  1BQG A;  3VRA A;  3U4F A;  4XWZ A;  3T9P A;  2OLO A;  1GOS A;  1TYT A;  1NHS A;  2VVM A;  3SJN A;  2GQF A;  2CDU A;  1Y56 A;  1MUC A;  3CTY A;  2YLZ A;  2B7S A;  2JAE A;  1DNC A;  3N6H A;  4KWS A;  1VQZ A;  3OZM A;  3UJ2 A;  1JDF A;  3B97 A;  1EL5 A;  3AD8 B;  3QFB A;  4NZH A;  1LPF A;  3DA1 A;  3C96 A;  3M0O A;  2ZC8 A;  2OAM A;  1ONE A;  2MNR A;  5HYM A;  1BZL A;  4IV9 A;  1L8P A;  5KXJ A;  1H6V A;  3ETR B;  6ENL A;  2V3A A;  4IP4 A;  3BI4 A;  1CJ2 A;  4EIP A;  4H83 A;  3UKA A;  1RSG A;  2E3T A;  2RGH A;  3TWB A;  3COX A;  1KSU A;  3PFR A;  1QJD A;  1MRA A;  1JCT A;  3GO2 A;  4E6M A;  4JY2 A;  4II2 A;  5BOF A;  3CK5 A;  4IVO B;  4GAP A;  4TVW A;  1GRH A;  1GV4 A;  1JU2 A;  2HXT A;  1S3E A;  1N62 C;  1JPM A;  1F8S A;  1REO A;  4RG4 A;  5EU9 A;  3JSK A;  3GMC A;  2C4C A;  2XH2 A;  3SX6 A;  1RP0 A;  4NTC A;  1GRG A;  4G7F A;  4ROP A;  3K1G A;  1N5X A;  3F8D A;  3RNM A;  2OFJ A;  4B67 A;  1H7W A;  3AE1 A;  4Z43 A;  2JB2 A;  3UOX A;  3LZW A;  2XLT A;  1QO8 A;  1CJ3 A;  3UTG A;  3IHM A;  3V4B A;  1KKO A;  1W6T A;  1COY A;  3SN0 A;  2BC1 A;  3ICS A;  3STP A;  4E8G A;  1KSS A;  5LV9 A;  1MOK A;  3UKK A;  3KLJ A;  3JW7 A;  3IF9 A;  1MO9 A;  3ITJ A;  4H4V A;  2GR1 A;  3H8L A;  3FBS A;  4UDQ A;  1TRB A;  2V61 A;  3VC6 A;  4M0X A;  1X31 B;  1SEZ A;  2XH4 A;  4KX6 A;  3UOY A;  3KPK A;  4H2P A;  1N63 C;  3AM9 A;  3MWC A;  2QJN A;  4H4T A;  4YWS A;  4A6N B;  1GER A;  2YLS A;  1L9C A;  3DME A;  3CGC A;  1E1N A;  2C70 A;  7ENL A;  4YTP A;  2PTZ A;  4A5L A;  4M52 A;  3KKJ A;  1FO4 A;  3AE8 A;  2DW7 A;  2XLU A;  3NK0 X;  4U8I A;  2GR0 A;  4NTE A;  2FYM A;  3TWA A;  2Y6Q A;  4FDC B;  2GGH A;  3S5S A;  2YM1 A;  2FJA A;  3CT2 A;  4E0V A;  4OVI A;  4IL0 A;  2YG3 A;  2GAH B;  1Y56 B;  3VFC A;  4DSH A;  4J31 A;  3UKH A;  4HN8 A;  4DSG A;  3BJS A;  4K8G A;  2YVF A;  4PAB A;  5EOW A;  3ABV A;  2Q0L A;  3L5O A;  1YKJ A;  2YLR A;  3CGD A;  4AT0 A;  2YR6 A;  1GAL A;  2WPF A;  3P0W A;  3SBF A;  3P4S A;  2P8C A;  3AEA A;  1ZXI C;  1EBD A;  3NHO X;  3JZU A;  3IHG A;  3NRZ B;  2C73 A;  1XPQ A;  3CPH G;  4H1Z A;  4X2P A;  3TJI A;  2E5A A;  3AE2 A;  3BOX A;  4K5R A;  2WU2 A;  2XSX A;  2C64 A;  2WP9 A;  3UGV A;  3EAN A;  4ADW A;  3EPT A;  3C4A A;  4BJY A;  2GR3 A;  2PGE A;  3DH9 A;  3URH A;  1P48 A;  3V3W A;  4K8D A;  1IUU A;  4YTN A;  1VDV A;  2YAU A;  3UJE A;  4YSY A;  3SZC A;  4JDR A;  3DIP A;  1PBB A;  4U2T A;  3PK7 A;  3WE0 A;  2QDD A;  2BXS A;  3AEC A;  1EC9 A;  2POD A;  3AMZ A;  4J56 A;  3CNJ A;  3AXB A;  4DHG A;  1ZMC A;  1B8S A;  4DXK A;  3ZVH A;  3R0U A;  1B5Q A;  3R11 A;  1GTE A;  4ENL A;  1P2H A;  3RR1 A;  3SN1 A;  1N1P A;  1Y0P A;  2GRT A;  1NU5 A;  4EQW A;  3DK4 A;  3A7R A;  3D46 A;  2O56 A;  3O0H A;  3ATR A;  3NYE A;  3DER A;  4JNA A;  3CXB A;  5DBJ A;  2GR2 A;  4G74 A;  1F9C A;  5BUL A;  3UP4 A;  1NHR A;  3NH3 X;  3CPI G;  1JOA A;  1K0I A;  3NNE A;  2WQY A;  5EB5 A;  5KMR A;  3DGB A;  1KDG A;  2FKP A;  2BK5 A;  1GRF A;  4HYR A;  1ZK7 A;  4TM0 A;  4APN A;  3ZDN A;  3THU A;  2BAC A;  2PP0 A;  1OJD A;  3RRA A;  4B66 A;  3VQR A;  4BV6 A;  1PDH A;  5IPY A;  1V97 A;  3TOY A;  1Q1W A;  2YG6 A;  4K22 A;  3GD3 A;  3R10 A;  1GRT A;  1H86 A;  3HPF A;  4U8M A;  4U8P A;  2WEU A;  3UTH A;  3D1C A;  3ALJ A;  1TZZ A;  2VVL A;  1GRE A;  3P93 A;  3S61 A;  1E6E A;  3SQP A;  4REK A;  2PGW A;  4U8K A;  4WCT A;  2E1M A;  2HXU A;  3FJ4 A;  4Z25 A;  3NN0 X;  2GAG B;  1IUW A;  3T0K A;  2WS3 A;  3BHF A;  2P3Z A;  2NQL A;  4ZOH B;  1DJN A;  1N60 C;  4P9S A;  1PJ6 A;  3RO6 A;  3H70 A;  4GRT A;  3IJQ A;  1H83 A;  2Z5Y A;  3JVA A;  3GWD A;  4CCQ A;  1ZDL A;  1S2Q A;  4H4U A;  2JK6 A;  1OJC A;  3BNU A;  2W0H A;  4OPU A;  1VG9 A;  2R4E A;  3BNM A;  1WUF A;  2GH5 A;  4GIR A;  1X2G A;  2GMH A;  1H81 A;  4YWO A;  4M6U A;  2XVI A;  3T2K A;  4ECH A;  3QSS A;  4H2Q A;  4CRT A;  4KEM A;  3I4K A;  4AOS A;  5GSN A;  3NTD A;  1H7X A;  2R0P A;  2PSN A;  1E1M A;  1JEH A;  3A7U A;  1D4C A;  3ICR A;  5U25 A;  4YTM A;  2GV8 A;  1TDN A;  4OPT A;  1S3B A;  2OG9 A;  4X9M A;  2EQ7 A;  2XFQ A;  2ONE A;  3G5Q A;  4F4R A;  1E39 A;  3B3R A;  3PS9 A;  5CQF A;  4HCL A;  1D7L A;  4N9X A;  2C67 A;  3Q9T A;  3GRS A;  4C77 A;  3FIM B;  4JHM A;  3S47 A;  3NRN A;  5J7X A;  4CNK A;  3AB1 A;  3RHA A;  3UCL A;  3R9U A;  3FVD A;  4MJW A;  3SFE A;  1JNZ A;  3BI2 A;  2EQ8 A;  4GYP C;  1EC8 A;  1BGN A;  3C4N A;  1TDF A;  2OX4 A;  2XVJ A;  1IYX A;  3IJL A;  4JN9 A;  1CBO A;  2BK3 A;  3MSY A;  1NEK A;  5C3J A;  3N4E A;  2VOU A;  4Z26 A;  1H84 A;  1KNP A;  3ICT A;  3DJG X;  3VC5 A;  2OAL A;  2R46 A;  3TW9 A;  3ZLF A;  3LB8 A;  2EQ9 A;  3DJJ A;  2PTW A;  3AWI A;  4U8O A;  1DTN A;  5FS6 A;  1S2Y A;  4H4R A;  4DN1 A;  2A89 A;  2Q6U A;  4K2X A;  4CNJ A;  4Z17 A;  3OC4 A;  2BAB A;  3H4K A;  1ONF A;  4CY6 A;  3T31 A;  2ZZB A;  4Y4L A;  3AE9 A;  2MUC A;  2QJM A;  3F8R A;  1ECQ A;  1PDY A;  2Q0K A;  4OPC A;  3H8I A;  2NVK X;  4J3Z A;  4ZA0 A;  5ENL A;  4Z2T A;  1YY5 A;  2ZZC A;  3DG6 A;  2XH0 A;  1P43 A;  4EQX A;  2DW6 A;  4Z2R A;  2WPE A;  3EAO A;  1OJ9 A;  1D4E A;  4GFI A;  1DJQ A;  3DJE A;  3QJ4 A;  4AP3 A;  1TDO A;  3SQS A;  3TCS A;  1BGJ A;  1TKK A;  3SN4 A;  3GRT A;  4YXD A;  1GET A;  4TM1 A;  4HB9 A;  2OA1 A;  3R07 C;  3BSM A;  3KUM A;  1CF3 A;  4YKG A;  2VRL A;  3CN8 A;  3KPF A;  2BA9 A;  2YWL A;  2YLX A;  2B9Y A;  4JN7 A;  4BK1 A;  4OPD A;  1NHP A;  3GYX A;  2HZG A;  3DES A;  1FHU A;  2PU1 A;  3NVZ B;  1V59 A;  3D47 A;  1D7Y A;  4AOX A;  4CY8 A;  5KWF A;  3PO7 A;  1DOC A;  3AD9 B;  1PJ7 A;  1EC7 A;  1GES A;  3EEZ A;  4IA5 A;  3VCC A;  2WDV A;  2YLW A;  2WDR A;  1CJC A;  3UJR A;  2BS3 A;  2X8H A;  3QFA A;  3DFH A;  4EMW A;  2XFO A;  4EIQ A;  5BUK A;  2JB1 A;  4TM4 A;  4DYE A;  2R9Z A;  1S7M A;  4AP1 A;  3FYY A;  2GGG A;  3ENL A;  3QVR A;  3AE6 A;  3MQT A;  2XFN A;  2NPX A;  1GRA A;  2V5Z A;  3P9U A;  4H4S A;  1YQ4 A;  2JBV A;  3UJF A;  4IA6 A;  1LJ1 A;  2VRM A;  4ZCC A;  2AL2 A;  1WUE A;  3LZX A;  1ZKQ A;  3HRD C;  4GCM A;  2XLP A;  3FPZ A;  3V5F A;  1O5W A;  4B1B A;  3HW2 A;  2PA6 A;  2J3N A;  4Y4N A;  3NVV B;  1JRO A;  4U2L A;  1H82 A;  3NYC A;  3SY4 A;  4A3R A;  1MDL A;  4BUR A;  3VA8 A;  3NXL A;  2RAB A;  1NG4 A;  2WOI A;  5J04 A;  5JRB A;  2BK4 A;  3SGL A;  1F8W A;  2AQJ A;  4A79 A;  2QJJ A;  3NYF A;  3PWI A;  3H8A A;  3T6C A;  4G9K A;  1JNR A;  2R45 A;  1Q9I A;  4MGG A;  5G5G B;  1PHH A;  3GMB A;  2I5Q A;  4MKS A;  2PPG A;  3OPS A;  1SJD A;  2W54 A;  3Q4D A;  5FS7 A;  3RCY A;  3V76 A;  4A65 A;  2X50 A;  2GQW A;  2BRA A;  2X8G A;  1IUV A;  5KOX A;  2Z5X A;  3R25 A;  2XVE A;  4TLZ A;  4EQR A;  2YVJ A;  1TDE A;  2YLT A;  2XFP A;  1IUT A;  4TVY A;  4IVM B;  3ES8 A;  2C3C A;  4BK3 A;  2OQY A;  1SJA A;  2PP3 A;  4H4X A;  1PBF A;  4OPG A;  4YKF A;  4A7A A;  2OZ8 A;  3V5C A;  1EL8 A;  1DOE A;  3GY1 A;  2BCG G;  1NHQ A;  2QA1 A;  3RP7 A;  3T8Q A;  5FJR A;  2X8C A;  4GIS A;  4O5Q A;  5U63 A;  3DG7 A;  5JCK A;  2PP1 A;  3MKC A;  1N4U A;  2Y6R A;  2OLA A;  5M0Z A;  3LJP A;  2C3D A;  2XH7 A;  1ZOY A;  3Q45 A;  1F6M A;  1NEL A;  2Q7V A;  2AL1 A;  2OO6 A;  2CUL A;  3T2Z A;  2VQ7 A;  3S5W A;  4IZG A;  1IUS A;  4B65 A;  1NAA A;  1PN0 A;  1PS9 A;  3NGC X;  3VRD B;  1BKW A;  1GSN A;  4FK1 A;  4KPL A;  2W3S A;  3GWF A;  3CMM A;  3UXL A;  5IDZ A;  3GDN A;  2AL2 B;  2R0C A;  3IWA A;  3SZ0 A;  3R0K A;  2BC0 A;  3QN3 A;  3UXK A;  1AOG A;  1KFY A;  3ES7 A;  4E4F A;  1PBE A;  3N4F A;  4MMW A;  5BVA A;  1DOB A;  2BYB A;  3D8X A;  4G73 A;  1MDR A;  1Q1R A;  2AKZ A;  2FJD A;  2C75 A;  1Z6L A;  4FX9 A;  2GGI A;  1PDZ A;  1NG3 A;  5FS9 A;  5JCI A;  3NN6 X;  3EF6 A;  4H2R A;  4FI4 A;  1ZOV A;  4YSH A;  3OZY A;  2RGO A;  3NVW B;  2OVL A;  2WPC A;  2WU5 A;  4FP1 A;  2FJB A;  4A6G A;  1ZY8 A;  5IQ4 A;  3RP6 A;  3L1R A;  1CL0 A;  1JRP A;  3QTP A;  4Y4M A;  3SR6 B;  3SYI A;  1M6I A;  3HYV A;  3NT6 A;  3PVC A;  1M64 A;  4E5T A;  5BRT A;  2X99 A;  2XYO A;  1E1K A;  2OLN A;  2VZ2 A;  2XFU A;  1NPX A;  3I6D A;  1R0M A;  3KVE A;  2WBA A;  3LXD A;  4O5U A;  4YSX A;  1GEU A;  3DJD A;  1O94 A;  1KKR A;  3UKP A;  5CKU A;  2UZZ A;  5JCM A;  3NLC A;  2WET A;  4GAV A;  2QA2 A;  2YG7 A;  2IVE A;  2W3R A;  4GR1 A;  2R0G A;  2OQH A;  4I59 A;  3RP8 A;  5KVH A;  3AE5 A;  4AT2 A;  2A87 A;  4H4Q A;  1YQ3 A;  3U9I A;  3AYJ A;  2FJE A;  1O95 A;  3IC9 A;  4X9N A;  2YVG A;  3UTE A;  2A8X A;  3ZVH B;  4FK1 C;  4CBQ A;  3ISH A;  2WOW A;  1K4Q A;  1RVK A;  3ALM A;  3H12 A;  1CHU A;  5KNL A;  4DGK A;  5BOE A;  5HXI A;  2GDQ A;  2PTX A;  3PWG A;  1BKH A;  2WHD A;  2BXR A;  2YG4 A;  1FOH A;  2BS4 A;  2PU0 A;  1PXC A;  1XDI A;  3KD9 A;  1LV0 A;  4OPI A;  4RSL A;  4GDP A;  3VR8 A;  5HY5 A;  1RM6 B;  1YQZ A;  4II3 A; 
#chains in the Genus database with same CATH homology
 4IA5 A;  4ADW A;  4U8N A;  3SM8 A;  3V3O A;  3AE7 A;  1PJ5 A;  3EPT A;  2WDV A;  3ALL A;  3C4A A;  4BJY A;  2PHH A;  4H2N A;  2GR3 A;  5FS8 A;  2WDR A;  2YLW A;  1CJC A;  4A6N A;  2BS3 A;  3SZF A;  2X8H A;  3DH9 A;  3URH A;  2GVC A;  3QFA A;  4K8D A;  4WX1 A;  4X4J A;  1IUU A;  1LQU A;  4H4Y A;  4YTN A;  4EMW A;  2XFO A;  3UKL A;  3II4 A;  1ZMD A;  2YAU A;  4TLX A;  4EIQ A;  3P1W A;  5BUK A;  1TYP A;  2B76 A;  3KA7 A;  4XWR A;  1B37 A;  3CGB A;  4YT0 A;  4YSY A;  2JB1 A;  3SZC A;  3AEE A;  4U8L A;  4TM4 A;  4JDR A;  3AEB A;  1ZP0 A;  4GF7 A;  3M12 A;  4H4Z A;  2R9Z A;  2H88 A;  1S7M A;  3UOZ A;  2GEW A;  4AP1 A;  3QVR A;  4Z43 A;  3AE6 A;  5EBK A;  4Z24 A;  3FG2 P;  3L8K A;  1PBB A;  4GDE A;  1EL9 A;  2AR8 A;  1GND A;  3HYW A;  5IQ1 A;  4C5O A;  2XFN A;  4U2T A;  2NPX A;  1F3P A;  1GRA A;  2V5Z A;  3P9U A;  4H4S A;  1BWC A;  3WE0 A;  1YQ4 A;  2JBV A;  5EB4 A;  2BXS A;  3AEC A;  4IA6 A;  4J56 A;  2V3B A;  1LJ1 A;  3CNJ A;  2HQM A;  2XVF A;  1OJA A;  3GDP A;  1E1L A;  4NTD A;  2VRM A;  3AXB A;  1ZMC A;  1B8S A;  4LA1 A;  1F8R A;  4ZCC A;  2B9X A;  3CND A;  4B69 A;  3UP5 A;  1B5Q A;  2BS2 A;  5JCL A;  3G5S A;  3LZX A;  1ZKQ A;  1GTE A;  1GXF A;  2BRY A;  4GCM A;  1P2H A;  2XLP A;  4EM3 A;  3FPZ A;  1IJH A;  2QCU A;  4GUV A;  4USR A;  3BHK A;  1N1P A;  1Y0P A;  3F8P A;  2GRT A;  1PBC A;  4EQW A;  1O5W A;  4B1B A;  2YM2 A;  3DK4 A;  4J57 A;  2J3N A;  4EM4 A;  3AEF A;  3O0H A;  1D5T A;  3ATR A;  4BJZ A;  4Y4N A;  3NYE A;  2WP6 A;  1DXL A;  2WOV A;  3SFD A;  2APG A;  3SXI A;  4EMJ A;  4U2L A;  5ER0 A;  3DK8 A;  3VRB A;  5M10 A;  5KMQ A;  4J36 A;  4JNA A;  4UP3 A;  5DBJ A;  1H82 A;  5TR3 A;  2GR2 A;  2I0Z A;  4G74 A;  3NYC A;  3SY4 A;  5BUL A;  3UP4 A;  1GT8 A;  4BUR A;  1FCD A;  2RAB A;  1NHR A;  2YR5 A;  3NH3 X;  1B4V A;  1NG4 A;  3I3L A;  1E7P A;  1N4V A;  2WOI A;  3CPI G;  2B7R A;  1L0V A;  1JOA A;  1K0I A;  2C76 A;  5JRB A;  2BK4 A;  5L46 A;  3SGL A;  5KMP A;  1F8W A;  1OJT A;  3NNE A;  3PG6 A;  4J34 A;  2PYX A;  2WQY A;  2GB0 A;  2AQJ A;  1UKV G;  5EB5 A;  2CVJ A;  5KMR A;  2E5V A;  4A79 A;  4KPR A;  4YSZ A;  3CNT A;  3NYF A;  1KDG A;  4C3X A;  4K7Z A;  2V6O A;  3T0K A;  2EQ6 A;  2YG5 A;  1GPE A;  1JNR A;  1GRF A;  2BK5 A;  2R45 A;  2VQB A;  2WDQ A;  3GYI A;  4G9K A;  4B64 A;  1ZK7 A;  1KF6 A;  1Q9I A;  4TM0 A;  4APN A;  1IUX A;  3ZDN A;  1PHH A;  2BAC A;  3GMB A;  4PAA A;  3HZL A;  3DGZ A;  1OJD A;  4A99 A;  1PBD A;  2YR4 A;  4B66 A;  3VQR A;  4BV6 A;  1XHC A;  1KN0 A;  1JRY A;  5FS7 A;  1PDH A;  5IPY A;  3DGH A;  3K7M X;  1Q1W A;  3K30 A;  3V76 A;  2C7G A;  2YG6 A;  4A65 A;  4K22 A;  2B9W A;  2V60 A;  3GD3 A;  2X50 A;  2GQW A;  2ZBW A;  1GRT A;  3AYL A;  3SZW A;  4ZN0 A;  2BRA A;  1H86 A;  2X8G A;  1IUV A;  2DKH A;  3AE4 A;  4U8M A;  2Z5X A;  5KOX A;  4U8P A;  2WEU A;  4U2S A;  3GSI A;  3UTH A;  3D1C A;  2TMD A;  3P4P A;  2XVE A;  3HYX A;  3ALJ A;  4TLZ A;  3V3N A;  1VRQ B;  5C2T A;  4EQR A;  2YVJ A;  4RG3 A;  2VVL A;  1GRE A;  2YQU A;  1TDE A;  2YLT A;  3UKQ A;  2XVH A;  3S61 A;  2XFP A;  1E6E A;  3SQP A;  2FBW A;  1IUT A;  1FEB A;  2JKC A;  3CIR A;  4REK A;  2IVD A;  1TDK A;  4IVM B;  4TM3 A;  4U8K A;  4WCT A;  2E1M A;  2C3C A;  4BK3 A;  4ZCD A;  1JRX A;  5J60 A;  1CC4 A;  2AAQ A;  4Z25 A;  3NN0 X;  4LII A;  1IUW A;  4H4P A;  1N4W A;  2GAG B;  3LAD A;  2WS3 A;  4H4X A;  3AE3 A;  3BHF A;  1CC6 A;  1PBF A;  3B6D A;  4OPG A;  4YKF A;  1VG0 A;  4A7A A;  4U8J A;  4BK2 A;  3BI5 A;  1FEA A;  1DJN A;  1P2E A;  2GF3 A;  1EL8 A;  3E1T A;  4J2W A;  1DOE A;  4P9S A;  1PJ6 A;  4B68 A;  4CCR A;  2BCG G;  3VRA A;  1L9D A;  1NHQ A;  5GRT A;  4GRT A;  2Z5Y A;  1H83 A;  2QA1 A;  4XWZ A;  3AD7 B;  2OLO A;  1GOS A;  3RP7 A;  1TYT A;  1NHS A;  3ADA B;  2VVM A;  2GQF A;  2CDU A;  3GWD A;  1Y56 A;  4CCQ A;  4UDR A;  3AEG A;  1ZDL A;  1LVL A;  2X8C A;  3CTY A;  3VR9 A;  2YLZ A;  2B7S A;  1S2Q A;  4H4U A;  4O5Q A;  2JK6 A;  2JAE A;  1DNC A;  5U63 A;  4JQ9 A;  1OJC A;  3BNU A;  5JCK A;  2W0H A;  4OPU A;  1VG9 A;  4EQS A;  2R4E A;  1N4U A;  2Y6R A;  3BNM A;  1EL5 A;  3AD8 B;  3QFB A;  2GH5 A;  5M0Z A;  3LJP A;  4NZH A;  1LPF A;  2O9Z A;  3C96 A;  3DA1 A;  2C3D A;  3M0O A;  4JNQ A;  3ATQ A;  2OAM A;  1ZOY A;  1F6M A;  4C3Y A;  2ARD A;  4Z2U A;  2GMH A;  3AED A;  1H81 A;  4G6H A;  4YWO A;  5HYM A;  1BZL A;  4IV9 A;  2Q7V A;  5KXJ A;  5KMS A;  1H6V A;  2XVI A;  3T2K A;  1FL2 A;  3CPJ G;  2V3A A;  4ECH A;  2ZZ0 A;  3BI4 A;  3QSS A;  2CUL A;  1CJ2 A;  4H2Q A;  3T14 A;  3T2Z A;  4CRT A;  3KU9 A;  4EIP A;  5KRQ A;  4EMI A;  3UKA A;  1KNR A;  2VQ7 A;  3K7T A;  1RSG A;  3S5W A;  2RGH A;  4AOS A;  5GSN A;  3COX A;  3NTD A;  1H7X A;  1KSU A;  1IUS A;  4HA6 A;  1QJD A;  2R0P A;  4B65 A;  1E1M A;  1NAA A;  1PN0 A;  1PS9 A;  3NGC X;  1JEH A;  2WP5 A;  3VRD B;  1D4C A;  3ICR A;  5U25 A;  4YTM A;  2H89 A;  2GV8 A;  1BKW A;  1GSN A;  4JY2 A;  1TDN A;  4FK1 A;  4II2 A;  1EL7 A;  3NIX A;  4NWZ A;  4LU6 A;  3T2Y A;  5FMH A;  4IVO B;  1LQT A;  4OPT A;  4GAP A;  4H4W A;  1GRH A;  1S3B A;  3FMW A;  3UKF A;  3GWF A;  3CMM A;  1GV4 A;  4X9M A;  1JU2 A;  1S3E A;  3GDN A;  1LTX R;  2EQ7 A;  2DKI A;  1F8S A;  1REO A;  2XFQ A;  3ZYX A;  1MXT A;  4RG4 A;  2R0C A;  1NEN A;  2GMJ A;  3G5Q A;  3IWA A;  3GD4 A;  3JSK A;  3GMC A;  2C4C A;  3SZ0 A;  2BC0 A;  4G6G A;  3B3R A;  1E39 A;  1AOG A;  1KFY A;  3PS9 A;  1RP0 A;  4NTC A;  3SX6 A;  1PBE A;  5CQF A;  1GRG A;  2ACZ A;  1D7L A;  5BVA A;  1DOB A;  4N9X A;  2C67 A;  3Q9T A;  2BYB A;  3D8X A;  2C72 A;  4G73 A;  3CNS A;  3AYI A;  1Q1R A;  3GRS A;  2FJD A;  2C75 A;  3F8D A;  1H2I A;  4H50 A;  2C65 A;  2RGJ A;  4C77 A;  2QAE A;  2TPR A;  1Z6L A;  3FIM B;  4FX9 A;  3RNM A;  4B67 A;  1DOD A;  1H7W A;  3AE1 A;  4Z44 A;  4D04 A;  1NG3 A;  5FS9 A;  5JCI A;  2JB2 A;  3NN6 X;  3NRN A;  3AB1 A;  5J7X A;  4CNK A;  3UOX A;  3LZW A;  2XLT A;  3EF6 A;  4H2R A;  1QO8 A;  4I58 A;  3RHA A;  1ZOV A;  3UCL A;  3R9U A;  4YSH A;  1VDC A;  1CJ3 A;  4MJW A;  3SFE A;  4NEW A;  1JNZ A;  2RGO A;  3UTG A;  3BI2 A;  2EQ8 A;  4OCG A;  3IHM A;  1FEC A;  4UDP A;  1BGN A;  2X3N A;  3C4N A;  2WPC A;  1TDF A;  2WU5 A;  2XVJ A;  1COY A;  4JN9 A;  2FJB A;  1ZY8 A;  5IQ4 A;  2BC1 A;  3L1R A;  1CBO A;  1CL0 A;  2BK3 A;  3ICS A;  3RP6 A;  1NEK A;  1ZX9 A;  1PXB A;  1NDA A;  4Y4M A;  1KSS A;  4ICY A;  5LV9 A;  2VVL G;  3SYI A;  5C3J A;  1MOK A;  3UKK A;  1M6I A;  2VOU A;  3KLJ A;  2XCG A;  4Z26 A;  1H84 A;  1MO9 A;  1KNP A;  3HYV A;  1D4D A;  3IF9 A;  3ICT A;  4H4V A;  2GR1 A;  3H8L A;  3ITJ A;  3LOV A;  3NT6 A;  4NNJ A;  3DJG X;  3PVC A;  1M64 A;  3OZ2 A;  3QVP A;  2OAL A;  2XDO A;  3FBS A;  1W4X A;  2R46 A;  5BRT A;  4UDQ A;  2X99 A;  1TRB A;  3LB8 A;  2EQ9 A;  3DJJ A;  2V61 A;  3QSM A;  2XYO A;  3AWI A;  4U8O A;  1E1K A;  1X31 B;  5KVI A;  2OLN A;  2VZ2 A;  1SEZ A;  5FS6 A;  1S2Y A;  4H4R A;  1CC2 A;  2XFU A;  3KPK A;  4KX6 A;  3UOY A;  2A89 A;  4H2P A;  2Q6U A;  4K2X A;  1NPX A;  4CNJ A;  3I6D A;  3UOV A;  3KVE A;  3OC4 A;  2BAB A;  2WBA A;  3LXD A;  4O5U A;  4H4T A;  3H4K A;  1ONF A;  1JRZ A;  4CY6 A;  4YSX A;  3T31 A;  4A6N B;  1GEU A;  3DJD A;  4OPL A;  2ZZB A;  1GER A;  2YLS A;  1L9C A;  4Y4L A;  3AE9 A;  2XLR A;  3DME A;  3GYJ A;  3CGC A;  1O94 A;  1E1N A;  3F8R A;  2C70 A;  3K7Q X;  3UKP A;  1BF3 A;  1VQW A;  5CKU A;  2UZZ A;  4YTP A;  2Q0K A;  4OPC A;  5JCM A;  3UTF A;  3H8I A;  2XLS A;  4A5L A;  3NG7 X;  2NVK X;  3NLC A;  4M52 A;  3KKJ A;  4K5S A;  5U1O A;  3AE8 A;  1CJ4 A;  4Z2T A;  2WET A;  1YY5 A;  2ZZC A;  2XLU A;  3NK0 X;  4GAV A;  3Q6J A;  2QA2 A;  2YG7 A;  4U8I A;  2IVE A;  4EQX A;  2GR0 A;  4NTE A;  2Y6Q A;  4FDC B;  4Z2R A;  2YM1 A;  4B63 A;  2WPE A;  2FJA A;  3DK9 A;  4GR1 A;  3EAO A;  4DNA A;  1OJ9 A;  2R0G A;  4E0V A;  4I59 A;  1D4E A;  2YG3 A;  3QSE A;  4OVI A;  1DJQ A;  2GAH B;  3DJE A;  3QJ4 A;  1Y56 B;  3RP8 A;  4AP3 A;  4NEV A;  4DSH A;  2BCP A;  5KVH A;  4A9W A;  3AE5 A;  4AT2 A;  4J31 A;  3UKH A;  1TDO A;  4DSG A;  2YVF A;  2A87 A;  4PAB A;  5EOW A;  4H4Q A;  1RYI A;  1YQ3 A;  2Q0L A;  3ABV A;  2FJE A;  1BGJ A;  3AYJ A;  1O95 A;  2CFY A;  3IC9 A;  2C66 A;  2YVG A;  3G5R A;  3P4Q A;  4X9N A;  3GRT A;  2A8X A;  3L5O A;  3UTE A;  4YXD A;  1GET A;  1YKJ A;  1K0L A;  2YLR A;  4FK1 C;  4TM1 A;  4CBQ A;  4HB9 A;  3CGD A;  2F5Z A;  2OA1 A;  2WES A;  2YR6 A;  4AT0 A;  3ISH A;  1GAL A;  2WPF A;  2E4G A;  4D03 A;  1CF3 A;  2WOW A;  1K4Q A;  2JB3 A;  1GTH A;  1K0J A;  1PXA A;  4YKG A;  3ALM A;  3P4S A;  3AEA A;  4USQ A;  2VRL A;  1L9E A;  3CN8 A;  3KPF A;  1EBD A;  1ELI A;  1CHU A;  5KNL A;  3NHO X;  4DGK A;  4J33 A;  1HYU A;  5HXI A;  4XXG A;  2BA9 A;  2YWL A;  3IHG A;  2YLX A;  3NKS A;  2B9Y A;  1QLB A;  2C73 A;  2WHD A;  2BXR A;  2YG4 A;  1XPQ A;  4BK1 A;  1FOH A;  3NTA A;  4OPD A;  3D9X A;  3CGE A;  3CPH G;  3T37 A;  1NHP A;  3GYX A;  4C74 A;  4H7U A;  5HHF A;  5KOW A;  2BS4 A;  4JY3 A;  1V59 A;  3AE2 A;  1D7Y A;  1PXC A;  4AOX A;  4CY8 A;  5KWF A;  3PO7 A;  4K5R A;  1XAN A;  2C64 A;  2R4J A;  1DOC A;  2WP9 A;  1GRB A;  2WU2 A;  1XDI A;  5JCN A;  3CNP A;  3P4R A;  3NK2 X;  3KD9 A;  3AD9 B;  3M13 A;  1LV0 A;  1PJ7 A;  4OPI A;  4RSL A;  3RED A;  2IID A;  4GDP A;  3VR8 A;  5HY5 A;  3EAN A;  4II3 A;  1YQZ A;  1GES A;  3NK1 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...