3KLJA

Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
378
structure length
378
Chain Sequence
KSTKILILGAGPAGFSAAKAALGKCDDITMINSEKYLPYYRPRLNEIIAKNKSIDDILIKKNDWYEKNNIKVITSEFATSIDPNNKLVTLKSGEKIKYEKLIIASGSIANKIKVPHADEIFSLYSYDDALKIKDECKNKGKAFIIGGGILGIELAQAIIDSGTPASIGIILEYPLERQLDRDGGLFLKDKLDRLGIKIYTNSNFEEMGDLIRSSCVITAVGVKPNLDFIKDTEIASKRGILVNDHMETSIKDIYACGDVAEFYGKNPGLINIANKQGEVAGLNACGEDASYSEIIPSPILKVSGISIISCGDIENNKPSKVFRSTQEDKYIVCMLKENKIDAAAVIGDVSLGTKLKKAIDSSKSFDNISSLDAILNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
molecule keywords NAD(FAD)-dependent dehydrogenase, NirB-family (N-terminal do
total genus 117
structure length 378
sequence length 378
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18267 Rubredoxin_C Rubredoxin NAD+ reductase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3kljA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA02
1NHRA 3NN0X 4Y4LA 1LQUA 2VRLA 1GRBA 2YLSA 4UDRA 2E1MA 2XLUA 2VRMA 1BZLA 3C96A 1D7LA 4H4SA 3EF6A 2AQJA 3DJEA 3I6DA 1H7XA 3S61A 2CFYA 3EAOA 4Z2RA 3ADAB 3UOZA 2B7RA 2GQWA 3GD4A 1K0LA 3LOVA 5M0ZA 3SFEA 3CNSA 3CNTA 5KWFA 4NEWA 2B9WA 2VVLG 1Q1WA 3WE0A 1FECA 3HZLA 1N1PA 1KF6A 2YG5A 2C3CA 1E1NA 1PDHA 4GCMA 2BK5A 2C65A 4U8PA 4CRTA 4J33A 4B65A 3DJDA 4H4QA 1LTXR 4ZN0A 1MXTA 1P2EA 1SEZA 4IV9A 4H4TA 1JRZA 2WETA 4LIIA 2GAHB 4H7UA 1VG0A 1GOSA 3GMBA 2CVJA 3UKLA 3UCLA 1CF3A 2VQBA 3RP7A 3UP5A 3P9UA 2B7SA 4WCTA 1ZY8A 1IJHA 2YG7A 2PHHA 1TDOA 1F3PA 4EQXA 1S3BA 2DKHA 3AEBA 3IWAA 4GDEA 4K5SA 4YTMA 4Z43A 2XVHA 1KNPA 3BNMA 2XDOA 3NYEA 4H4ZA 3DK8A 4J31A 5U1OA 1H7WA 2ARDA 3RNMA 1PXBA 4CY6A 2FBWA 3DH9A 2C75A 2WU5A 4HB9A 2IVDA 1ZK7A 3AYJA 1H86A 2YAUA 2YR4A 3NKSA 3VQRA 4AP3A 4CBQA 1MO9A 1GALA 2WHDA 4TM4A 4JY3A 1JRYA 1Y56B 1YQ4A 2C67A 2X8HA 3CGBA 1CHUA 1NEKA 2BACA 1K4QA 4BK1A 1GSNA 1S3EA 1VQWA 3LZXA 2R4JA 3LADA 3BI2A 3L1RA 2C72A 1DOBA 3L8KA 3QVRA 4UP3A 4B63A 3AYLA 5KRQA 4H2PA 1H6VA 3H8LA 3LJPA 2R46A 2BK3A 4EQRA 2BS3A 3QJ4A 3FPZA 4JQ9A 1PN0A 2BS4A 2XFPA 3C4NA 2YLWA 1ZKQA 1LJ1A 1PJ5A 4Z26A 2C66A 5KXJA 2V6OA 1L0VA 3NK2X 1YY5A 3D8XA 1OJDA 2Q6UA 2XCGA 5EB5A 4TLXA 4YTNA 3CNJA 4BV6A 4U8IA 1OJ9A 1Z6LA 1DNCA 4JDRA 2XVIA 4K8DA 2QA1A 5BRTA 1B8SA 3C4AA 2XFNA 3GDPA 1EL7A 1FL2A 4KPRA 3BHFA 2X50A 4BK2A 1YKJA 4K22A 4CCRA 3NRNA 5KVHA 4USRA 3ZYXA 2BA9A 4A99A 3DA1A 4JNQA 3NG7X 3GRTA 2R0PA 5KVIA 3UTFA 4ECHA 3GWFA 3LZWA 2V5ZA 1IUWA 1PJ7A 5JCIA 2GEWA 5M10A 4U8MA 3K7MX 3CGDA 2E4GA 5IPYA 4HA6A 3GMCA 2YG4A 1NG3A 4GRTA 4ADWA 2R45A 3UKPA 1UKVG 1B37A 4EIQA 4K7ZA 3SGLA 5IQ4A 4FX9A 4RG4A 1CBOA 3OC4A 1BGJA 1ZOVA 3NGCX 4RSLA 4IVOB 3ICTA 3KPFA 2WDRA 1VRQB 4TLZA 4AOSA 1D7YA 4UDQA 3AD9B 3P4RA 4J36A 4NEVA 1QJDA 4XWZA 1NAAA 4B64A 3QFAA 2WOIA 1JNZA 2RGJA 3OZ2A 4NZHA 5C2TA 3AE6A 2YG3A 4X9NA 1O94A 5HXIA 3CTYA 4YKFA 3K7QX 1COYA 3KD9A 1OJCA 3UP4A 2FJBA 3ZDNA 1EL8A 2B9YA 4IA6A 2WEUA 1ZMDA 2YVFA 2A87A 1DJQA 4MJWA 3P4PA 4H50A 2OLNA 4H4WA 3M12A 3FMWA 4GDPA 3LB8A 4D04A 1BWCA 1JOAA 3P1WA 2GVCA 4U8LA 4NTDA 5JCNA 3H8IA 1XDIA 3GD3A 2ZBWA 4YSHA 3FG2P 2CDUA 2GF3A 5JCLA 3K7TA 4U8NA 5JCMA 4ZCDA 2XFQA 2BC0A 1DXLA 2HQMA 1M64A 2AAQA 1XANA 1XHCA 3VRAA 2WOVA 1H84A 5U63A 5HY5A 2WP5A 1DOEA 1CJ3A 1K0JA 3FIMB 2W0HA 1IUUA 3IHGA 4YSYA 1D5TA 1GV4A 1RP0A 1JRXA 3DMEA 4Z24A 1D4DA 2XFUA 2TPRA 1GRGA 4EM4A 4EQSA 1IUSA 1IUTA 1N4UA 2VQ7A 2Z5XA 3GSIA 3QVPA 3VR8A 3H4KA 5J60A 3M0OA 4FK1A 1LVLA 4JY2A 2WPEA 3CIRA 5GSNA 3UKAA 3DJGX 2GR1A 1PHHA 3BI4A 3AYIA 4TM1A 2BYBA 3ATRA 3O0HA 1N4WA 1PJ6A 4C77A 1RSGA 4H2RA 1CC6A 5FMHA 3PO7A 1Q1RA 4C74A 1P2HA 3V3OA 2A89A 2WU2A 1XPQA 2YR5A 3CNDA 4Y4NA 4YT0A 3T37A 2X99A 2NPXA 1D4EA 3K30A 4A6NA 2V3AA 2XLRA 2QA2A 3KVEA 3CGEA 1KDGA 4AT0A 2EQ7A 1GEUA 1NDAA 4OPIA 4J2WA 3NK1X 4YSZA 3PS9A 2WPCA 2ACZA 2R4EA 3NYFA 4K2XA 4A9WA 1CC4A 1TYTA 3ITJA 4Z44A 2WS3A 3IC9A 2VVLA 2YQUA 3UTGA 1F8RA 1TRBA 3UOYA 3ABVA 3BNUA 4AP1A 1PBDA 1BGNA 1KNRA 4XXGA 4KX6A 1GERA 1D4CA 4B69A 1KSSA 3CPIG 4H4YA 3BI5A 4IA5A 3AD7B 4NTEA 1HYUA 3V3NA 1L9CA 1JEHA 1GPEA 3NTDA 4EQWA 3AE4A 2I0ZA 4B66A 4DSGA 3EPTA 3NK0X 3Q9TA 4OPDA 2YLRA 2OALA 2BC1A 5EBKA 2BXSA 4BURA 4U2LA 4OPCA 1LV0A 2X3NA 4PAAA 1ONFA 4OPGA 4A7AA 1K0IA 4K5RA 4A79A 1CL0A 1JNRA 1B4VA 3AE3A 3P4SA 4Z25A 1H81A 3NIXA 4O5QA 2UZZA 4EM3A 1F8WA 3NTAA 1MOKA 2APGA 3RHAA 4C5OA 1VG9A 3RP6A 2J3NA 4A65A 2QAEA 1PBEA 3F8PA 1TDFA 1L9DA 3ISHA 4CCQA 3GRSA 3CPJG 2R0CA 1X31B 3AEFA 4OCGA 2GR3A 1GT8A 2CULA 2C3DA 4X4JA 1S2QA 2WP6A 3AB1A 5HYMA 4C3YA 3UKFA 4GR1A 2RABA 2R9ZA 2XLPA 3ALMA 4U2TA 3DK4A 1YQ3A 2EQ9A 2Q0LA 2FJDA 4CY8A 2XVEA 1KFYA 4U8KA 5BVAA 1GRAA 3NHOX 4APNA 3G5RA 4J34A 3IF9A 3KA7A 1DODA 2QCUA 1LQTA 4Z2TA 5BULA 1NPXA 4UDPA 3VRDB 5C3JA 4TM0A 3UKQA 3ATQA 1PXAA 4B1BA 4H4VA 1QLBA 4FK1C 1PBBA 5BUKA 1O5WA 3S5WA 5KOXA 2XLTA 3DK9A 4M52A 1O95A 1RYIA 2Z5YA 4OPLA 2IVEA 3AECA 1QO8A 2H88A 2OAMA 3P4QA 1E7PA 3F8RA 1L9EA 3AXBA 2FJEA 4GF7A 2Y6QA 1GRHA 2TMDA 4B68A 1ZX9A 1AOGA 1E6EA 4U2SA 4ICYA 1FEAA 3UOVA 5LV9A 4WX1A 4LU6A 4U8JA 3B6DA 3CN8A 3II4A 2V61A 4JN9A 3ICRA 4H4UA 5J7XA 2JKCA 3REDA 3AE7A 3JSKA 1DOCA 4H2NA 1E1LA 4EMIA 3I3LA 3VRBA 1EBDA 1CC2A 1FEBA 4P9SA 2YVJA 1YQZA 3URHA 1Y0PA 1CJ2A 2GAGB 2YM1A 3CPHG 4RG3A 1PBCA 5EB4A 1NG4A 3VR9A 4J57A 3M13A 4OPTA 2YLXA 1GRFA 5L46A 1JU2A 2RGHA 4FDCB 4H4PA 1LPFA 2WOWA 1OJTA 2XVFA 1GNDA 2F5ZA 2VVMA 3SQPA 5TR3A 5HHFA 1ZOYA 4D03A 1ZMCA 1TDNA 2XLSA 3KKJA 2AR8A 2YG6A 3AE2A 4YSXA 5FS8A 3V76A 4C3XA 2OLOA 4BJZA 3UOXA 3COXA 4TM3A 1TDEA 4REKA 3UTEA 3D1CA 2O9ZA 2VOUA 3QSEA 1ELIA 3GYJA 4O5UA 3CNPA 2C76A 3GYIA 2NVKX 4Y4MA 3QSSA 4EMWA 3AE8A 3KLJA 5U25A 3GWDA 2XYOA 4U8OA 1F8SA 3CGCA 3DJJA 1F6MA 1S2YA 1ZP0A 1TDKA 3ALLA 3NLCA 4H4RA 4N9XA 4OPUA 3PVCA 5ER0A 2BCGG 3IHMA 5CKUA 1IUVA 1NENA 2WPFA 1Q9IA 4CNJA 4CNKA 1GESA 4H2QA 4X9MA 3EANA 1GXFA 2ZZBA 5GRTA 2GH5A 4OVIA 2BS2A 2WP9A 3DGZA 2WDQA 2EQ8A 2C7GA 4AT2A 2GR2A 1GTHA 2GRTA 3ALJA 3KU9A 1GETA 4XWRA 1E1KA 1PXCA 5KOWA 1E39A 5CQFA 2BK4A 2A8XA 2WDVA 2YLTA 1Y56A 2DKIA 1ZDLA 3G5QA 3QFBA 3AE9A 2GR0A 2IIDA 3SFDA 3UKHA 1E1MA 2E5VA 3Q6JA 2X8GA 1NHPA 2OA1A 1FCDA 2GQFA 2C73A 2RGOA 3UTHA 1FOHA 4E0VA 2H89A 1KSUA 4IVMB 1V59A 1NHSA 5FS6A 3SM8A 3AE1A 2X8CA 3RP8A 1GRTA 2JB2A 5FS7A 2JK6A 2XVJA 4JNAA 4YKGA 1REOA 2GB0A 1OJAA 4NTCA 1N4VA 3DGHA 2ZZ0A 4DSHA 3LXDA 3QSMA 4GUVA 2YWLA 3FBSA 3UKKA 1VDCA 2ZZCA 2PYXA 1EL5A 5JCKA 2JB3A 4YTPA 5DBJA 2YR6A 1B5QA 4BJYA 4EIPA 2BCPA 1CJ4A 1BKWA 1H83A 4USQA 4EMJA 4B67A 4DGKA 1PS9A 3AEAA 4ZCCA 2V3BA 4YWOA 2FJAA 1PBFA 2B76A 2GMJA 2YLZA 1W4XA 2YVGA 3F8DA 3NT6A 4DNAA 2WQYA 1GTEA 2VZ2A 3ICSA 5IQ1A 4YXDA 1GREA 1EL9A 1H82A 3NN6X 1M6IA 4H4XA 4A6NB 3AE5A 4BK3A 1IUXA 2GMHA 2GV8A 4PABA 3B3RA 1BF3A 1DJNA 3GDNA 3NYCA 3AEEA 2BXRA 3R9UA 2JB1A 2B9XA 3AEDA 3NH3X 4A5LA 4Z2UA 4I58A 1CJCA 3AWIA 2V60A 4LA1A 2R0GA 1TYPA 2Q7VA 2JAEA 2BABA 2C64A 4I59A 2C70A 3E1TA 4AOXA 2JBVA 3AEGA 3BHKA 1NHQA 2EQ6A 2Q0KA 5FS9A 2WESA 3NNEA 2Y6RA 5EOWA 4J56A 3G5SA 2XFOA 3AD8B 2YM2A 2WBAA
chains in the Genus database with same CATH superfamily
3KPKA 2VRLA 2E1MA 2XLUA 1BZLA 3I6DA 1H7XA 3GD4A 1K0LA 3R07C 1S7MA 2VVLG 5FJPA 1N1PA 4U8PA 4CRTA 4J33A 4B65A 4H4TA 3EEZA 3PFRA 2CVJA 1CF3A 2B7SA 1IJHA 1OEPA 3I4KA 3IWAA 1KNPA 3DESA 3NYEA 4IL0A 3DK8A 4J31A 5U1OA 1H7WA 4CY6A 3DH9A 3H12A 2GGJA 2WU5A 2IVDA 3VQRA 4AP3A 4CBQA 4TM4A 2C67A 1K4QA 4JN7A 3T2KA 1VQWA 3L8KA 3TCSA 4FP1A 2QDDA 1H6VA 5KNLA 3LJPA 4EQRA 4JQ9A 2XFPA 2YLWA 3SY4A 1L0VA 1YY5A 2Q6UA 2RDXA 2XCGA 2XVIA 4JDRA 2QA1A 5BRTA 3I6TA 2XFNA 4CCRA 2P0IA 2R0PA 3UTFA 3LZWA 3MZNA 4NNJA 1UKVG 4K7ZA 3THUA 2XH2A 3OC4A 4RSLA 3KPFA 4A35A 4TLZA 3H7VA 4UDQA 4NEVA 4XWZA 1NAAA 2PODA 2WOIA 2PTXA 2RGJA 4NZHA 5C2TA 4G8TA 2FJBA 3NO1A 4IA6A 1KKRA 2A87A 1DJQA 4MJWA 2OLNA 3M12A 1NELA 4GDPA 1BWCA 2OX4A 1N61C 3FG2P 3UJ2A 1XHCA 2PGEA 2GDQA 1RVKA 2W0HA 1GV4A 2XH7A 1JRXA 4Z24A 1D4DA 4MKSA 2TPRA 1GRGA 2VQ7A 1IUSA 5IDZA 3QVPA 3UCCA 1BQGA 3CIRA 2GR1A 3HPFA 3NRZB 3ATRA 4H2RA 1CC6A 3PO7A 4KPLA 4E8GA 5ENLA 3K1GA 3CNDA 1XPQA 4Y4NA 4YT0A 3R10A 3T37A 1N5XA 2XLRA 3ZVIA 1WUEA 3KVEA 3NK1X 4YSZA 3PS9A 3NYFA 1CC4A 3ITJA 4Z44A 2VVLA 2YQUA 3SZ0A 1F8RA 1TRBA 4XXGA 1GERA 3CPIG 3V3NA 4IA5A 3TW9A 1JEHA 3NTDA 4EQWA 3AE4A 4DSGA 3NK0X 3Q9TA 3IK4A 5FJRA 2BXSA 4BURA 2HXUA 2X3NA 1ONFA 2P8BA 1K0IA 4II3A 1H81A 3NIXA 1VG9A 2QAEA 3ISHA 1TDFA 1L9DA 4CCQA 3CPJG 3PG6A 3UCDA 1GT8A 3SN0A 3UKFA 3UJRA 3TTEA 2FJDA 2XVEA 5KMPA 4U8KA 5BVAA 4J34A 3SN1A 1DODA 2QCUA 4Z2TA 3SN4A 5BOFA 3VRDB 2QJMA 1KD0A 2OVLA 3DERA 4H4VA 4JHMA 1N60C 3SX6A 3P4QA 1L9EA 4HNCA 4GF7A 4H1ZA 2OZ3A 2TMDA 1ZX9A 1AOGA 4ICYA 3QKEA 5LV9A 5J7XA 2JKCA 1DOCA 4EMIA 4P9SA 3CAWA 3URHA 2YM1A 3CPHG 4RG3A 1JROA 1PBCA 3M13A 4OPTA 1GRFA 5L46A 4GAPA 4K1WA 4H4PA 2XVFA 3SQPA 4Z17A 3IJLA 4G6GA 3A7RA 1MUCA 3AE2A 4H2HA 4YSXA 3V76A 3UTEA 1PDZA 3GYJA 3GYIA 1N63C 5U25A 3GWDA 1XPYA 1F6MA 3DJJA 4MGGA 3ALLA 1S2YA 5BULA 1TDKA 5G5HB 6ENLA 4CNJA 4X9MA 4FI4A 2GH5A 2WP9A 2WDQA 2EQ8A 2GRTA 3KU9A 4XWRA 3SQSA 1E1KA 3CB3A 1PXCA 1E39A 5CQFA 2BK4A 2WDVA 2DKIA 1ZDLA 1E1MA 4Z1YA 2X8GA 1FCDA 2GQFA 2RGOA 1NU5A 3UTHA 4IVMB 1V59A 1NHSA 3AE1A 3ZLHA 1GRTA 2JB2A 3T2ZA 3FV9A 2E3TA 1OJAA 3DGHA 3ZLFA 3MKCA 4DSHA 3VA8A 2OZ8A 3GC2A 2QGYA 2ONEA 4EIPA 2BCPA 1SB3B 1R0MA 4ZCCA 1P48A 2FJAA 3R11A 2YLZA 2PMQA 2YVGA 4DNAA 2WQYA 5IQ1A 1EL9A 4H4XA 4BK3A 2PA6A 3B3RA 3R0UA 3AWIA 4J3ZA 4IZGA 3E1TA 1VQZA 4AOXA 3AEGA 2Q0KA 3T14A 4J56A 3G5SA 2XFOA 1N5WC 2WBAA 4Y4LA 1GRBA 4UDRA 3H70A 1XS2A 3HYXA 3OTRA 3B9JB 2B7RA 2GQWA 5M0ZA 3CNSA 5KMQA 1KF6A 1E1NA 2BK5A 2C65A 1LTXR 1JRZA 4H7UA 1GOSA 3GMBA 3RP7A 3NVVB 1ZY8A 4K5SA 3AEBA 4EQXA 1S3BA 2DKHA 4GDEA 3BNMA 3QLDA 3TQPA 3R25A 3JW7A 2FBWA 1ZK7A 2YAUA 2YR4A 3NS1B 2PSNA 1JRYA 1Y56B 1CHUA 4X2PA 2BACA 1TZZA 3GY1A 1S3EA 3LADA 3BI2A 2C72A 4UP3A 3NVYB 3AYLA 2PTWA 2BK3A 2BS3A 3FPZA 1PN0A 2BS4A 4Z26A 1FFVC 3PWIA 3NK2X 5EB5A 4U8IA 1OJ9A 3AN1A 3C4AA 1EL7A 3BHFA 4BK2A 4K22A 4J1OA 3OZMA 3ZYXA 2BA9A 4A99A 3DA1A 3RO6A 1PJ7A 4U8MA 2W54A 3GMCA 2R45A 3HRDC 5IQ4A 4FX9A 3D47A 4AOSA 3AD9B 4B64A 2PGWA 4YKFA 3KD9A 3UP4A 1OJCA 1MDLA 2WEUA 2YVFA 3V5CA 3P3BA 4JN8A 4H50A 4H4WA 3FMWA 3P1WA 1EC8A 3L5OA 4U8LA 3GD3A 2ZBWA 4U8NA 1L8PA 3T6CA 2HQMA 1XANA 3VRAA 2WOVA 1DOEA 3FIMB 3IHGA 4YSYA 1RP0A 3STPA 2XFUA 3GSIA 3A7UA 1IUTA 3VR8A 3M0OA 4FK1A 4JY2A 2WPEA 1FO4A 1RSGA 1EBHA 4DX3A 3CYJA 5FMHA 1Q1RA 2AKMA 3QTPA 2X99A 3SR6B 1D4EA 1EC7A 4AT0A 2EQ7A 1GEUA 4OPIA 4J2WA 1WYGA 2WPCA 3VC5A 4A9WA 1TYTA 3UTGA 3TJ4A 2P3ZA 1PBDA 1KNRA 1YEYA 3BI5A 3DDMA 3U4FA 3SJNA 1HYUA 3AD7B 4K2SA 4NWZA 4G6HA 4KEMA 3EPTA 3DFYA 2OALA 5EBKA 4OPCA 4K5RA 1CL0A 2DW6A 4HCDA 3DEQA 2UZZA 4EM3A 3NTAA 1MOKA 3OPSA 4A65A 3AEFA 4X4JA 1P43A 1S2QA 2WP6A 5HYMA 4C3YA 4GR1A 1ONEA 2RABA 2XLPA 3SSZA 2Q0LA 4CY8A 1EC9A 5FJUA 2XH4A 3IF9A 3KA7A 1NPXA 4UDPA 2AL1A 4TM0A 3HYWA 3UKQA 4G7FA 3ATQA 4FK1C 1O5WA 3DK9A 1O95A 1RYIA 3T0KA 2Z5YA 4OPLA 2OAMA 1E7PA 3AXBA 1FHVA 1E6EA 4U2SA 3KUMA 3UOVA 1JRPA 3B6DA 3CN8A 2V61A 4JN9A 4H4UA 4TVYA 3REDA 3AE7A 1E1LA 4GYPA 3I3LA 1EBDA 2P88A 1CJ2A 2GAGB 3VFCA 2RGHA 3NXLA 1LPFA 5TR3A 3CXOA 2PCEA 3KKJA 5FS8A 3ZVHB 4C3XA 3UOXA 2AKZA 3NZGA 4EMWA 1SJDA 3RCYA 3KLJA 4U8OA 1F8SA 3SGLA 1ZP0A 3IJQA 4TVWA 4GMEA 2BCGG 4HN8A 4KWSA 2WPFA 1Q9IA 4EWJA 4H2QA 2ZZBA 4OVIA 5G5GB 3CK5A 2BS2A 4IHCA 1GETA 4II2A 1TE6A 5KOWA 3DG7A 2A8XA 1Y56A 2OG9A 3SFDA 1NHPA 5FJOA 3P93A 2C73A 4E4FA 2X8CA 2XVJA 4NTCA 1KKOA 4GIRA 4HPNA 3TOYA 1FFUC 2DW7A 3FBSA 3UKKA 1VDCA 1EL5A 5JCKA 5DBJA 2YR6A 1B5QA 1BKHA 4USQA 4DGKA 4B67A 3AEAA 4A6GA 2GMJA 1W4XA 3F8DA 1DTNA 1GREA 3DGBA 4GFIA 4ENLA 4A6NB 1IUXA 3GDNA 3AEEA 3OP2A 2BXRA 3R9UA 4Z2UA 4I58A 1CJCA 4KT2A 2Q7VA 2C64A 2C70A 1R6WA 3BHKA 2EQ6A 3NNEA 1NHRA 3NN0X 1LQUA 4ZA0A 3MQTA 3EF6A 2XGZA 3DJEA 3S61A 2CFYA 5KWFA 3LOVA 4NEWA 3Q45A 3HZLA 2BRYA 2YG5A 4GCMA 1PDHA 3DJDA 3D9XA 4IV9A 2FYMA 2WETA 4LIIA 1VG0A 2CHRA 3UKLA 2VQBA 3QN3A 3P9UA 4WCTA 2YG7A 4DWDA 1TDOA 1F3PA 2GGHA 2XVHA 2XDOA 4H4ZA 3RR1A 3RNMA 1PXBA 2QJNA 4HB9A 1KN0A 1H86A 3NKSA 3BSMA 1MO9A 1GALA 4JY3A 3CGBA 3FYYA 1FHUA 4BK1A 1GSNA 3LZXA 3CT2A 2GSHA 3H8LA 3JZUA 3UJSA 1ZKQA 1LJ1A 2ZADA 2NQLA 1PJ5A 2C66A 5KXJA 2V6OA 1X2GA 1WUFA 1OJDA 1Z6LA 3GO2A 4K8DA 1B8SA 3GDPA 1FL2A 2GGIA 2X50A 2E5AA 3T2YA 4USRA 4JNQA 3GRTA 5KVIA 2V5ZA 1STZA 5JCIA 5M10A 4M0XA 3K7MX 1PDYA 5IPYA 1NG3A 2W3SA 1JPDX 4EIQA 3VC6A 4RG4A 1CBOA 1BGJA 4IVOB 2WDRA 1VRQB 3DIPA 3GYXA 1D7YA 1MDRA 3QFAA 3OZ2A 2YG3A 4X9NA 4GYPC 4IP5A 5HXIA 3CTYA 3K7QX 1COYA 4G73A 3ZDNA 1EL8A 2B9YA 1ECQA 3LB8A 1JOAA 3N4EA 2GVCA 4NTDA 3D46A 1XDIA 2OLAA 4YSHA 3K7TA 5FJTA 4ZCDA 2BC0A 1DXLA 3EUB3 3Q4DA 3SBFA 3AMZA 5U63A 2WP5A 3N6JA 1K0JA 5J04A 4A3RA 3ETRB 2QDEA 2Z5XA 4EM4A 1N4UA 3BOXA 3SZCA 5J60A 3H4KA 3FCPA 1T3QC 1LVLA 5GSNA 2PU0A 4TM1A 3DFHA 3O0HA 1N4WA 4C77A 3FVDA 1P2HA 4M6UA 3V3OA 2A89A 2YR5A 3ENLA 4A6NA 1NDAA 3R1ZA 2R4EA 2WS3A 1KCZA 3IC9A 2BRAA 3BNUA 4AP1A 1BGNA 4KX6A 4B69A 4NTEA 1GPEA 4ZOHB 4OPDA 2YLRA 2BC1A 3UJEA 1LV0A 4PAAA 2PPGA 1SJCA 4A7AA 3P4SA 1JNRA 3AE3A 4Z25A 4O5QA 3B97A 2APGA 4HCHA 2XSXA 3RITA 3UXLA 1PBEA 4DHGA 1X31B 4OCGA 2CULA 3H8AA 3ALMA 3DK4A 1KFYA 1GRAA 3NHOX 3G5RA 1PXAA 4B1BA 1PBBA 5BUKA 3S5WA 2XLTA 4M52A 3V4BA 2H88A 2OPJA 2FJEA 4GISA 3N6HA 2Y6QA 4B68A 1FEAA 3MY9A 3II4A 3VCCA 3JSKA 1CC2A 1FEBA 2YVJA 1YQZA 2OQHA 2OZTA 5EB4A 4J57A 2YLXA 2PP3A 4FDCB 3A7AA 1GNDA 5HHFA 2F5ZA 3TJIA 3U9IA 3N4FA 2XLSA 4DXKA 2AR8A 2YG6A 2OLOA 3COXA 4REKA 3D1CA 2VOUA 1ELIA 2C76A 3QPEA 2NVKX 4Y4MA 3QSSA 3AE8A 2XYOA 3CGCA 4C5OA 3NLCA 4N9XA 4H4RA 4OPUA 3PVCA 5ER0A 4F4RA 5CKUA 1IUVA 4DYEA 1NENA 3UXKA 4CNKA 1GTHA 3ALJA 2HNEA 1JDFA 4GGHA 2AL2A 3G5QA 3SYIA 3AE9A 4ZCWA 2IIDA 3NVWB 3UKHA 2E5VA 1KSUA 5FS6A 2PU1A 1W6TA 5FS7A 3HYVA 4JNAA 1REOA 3OW1A 2PTZA 1N4VA 2GGEA 2ZZCA 2PYXA 2JB3A 4YTPA 1TKKA 2MUCA 4DN1A 1BKWA 1CJ4A 1H83A 4EMJA 3MSYA 3T4WA 2B76A 2PP1A 4IL2A 3ICSA 4YXDA 2OQYA 1H82A 3NN6X 1M6IA 3AE5A 2GV8A 2GMHA 1BF3A 1DJNA 2JB1A 2B9XA 3AEDA 4A5LA 2V60A 5EU9A 4LA1A 2R0GA 4I59A 1NHQA 4YTMA 2YM2A 2YLSA 2VRMA 3C96A 1D7LA 4H4SA 2AQJA 3FJ4A 3PWGA 3EAOA 4Z2RA 3ADAB 3UOZA 3SFEA 3CNTA 2B9WA 1Q1WA 3WE0A 1F9CA 1FECA 3EKGA 2C3CA 3TWBA 3UJFA 5KMRA 2XH0A 4H4QA 4ZN0A 1MXTA 1P2EA 1SEZA 1JCTA 1V97A 2GAHB 3UCLA 2PS2A 3UP5A 2W3RA 4GGBA 2PHHA 2OKTA 4Z43A 3TWAA 2ARDA 3IJIA 2C75A 2ZC8A 3AYJA 2WHDA 1YQ4A 2X8HA 1NEKA 2R4JA 2POZA 3L1RA 3QVRA 1DOBA 4B63A 5KRQA 4H2PA 2R46A 3QJ4A 3C4NA 3D8XA 3T31A 3NFUA 3OZYA 4TLXA 4YTNA 3CNJA 4BV6A 3ZVHA 1DNCA 4KPRA 1YKJA 3NRNA 5KVHA 3NG7X 4ECHA 3GWFA 4ROPA 2I5QA 1IUWA 2GEWA 3CGDA 2E4GA 4HA6A 2YG4A 4GRTA 4ADWA 3UKPA 1B37A 4IP4A 3S47A 4H83A 1E9IA 1ZOVA 3NGCX 1RM6B 3ICTA 1X2HA 3P4RA 4J36A 1QJDA 1JNZA 3AE6A 1O94A 2O56A 4HNLA 1ZMDA 3P4PA 4D04A 5JCNA 3H8IA 3I6EA 2CDUA 1ELSA 2GF3A 5JCLA 4HCLA 5JCMA 2XFQA 1M64A 2AAQA 4E5TA 1H84A 5HY5A 1CJ3A 1IUUA 1D5TA 3DMEA 1ZXIC 4EQSA 3BJSA 3DG6A 3UKAA 3DJGX 1PHHA 3BI4A 3AYIA 2BYBA 1PJ6A 3DG3A 4C74A 3VCNA 3MUCA 2WU2A 2NPXA 3K30A 3V5FA 2V3AA 2QA2A 2FKPA 3CGEA 1KDGA 1FIQB 3HW2A 3ES8A 2ACZA 4K2XA 4MMWA 3UOYA 4IT1A 3ABVA 3CMMA 2GGGA 1D4CA 1KSSA 4H4YA 1H2IA 1L9CA 4B66A 2I0ZA 3SXIA 4K8GA 4U2LA 1N62C 4OPGA 4A79A 1B4VA 2OFJA 1SJAA 1F8WA 3V3WA 2QQ6A 3RHAA 3RP6A 2J3NA 3PK7A 3F8PA 2C4CA 3GRSA 3VDGA 2R0CA 2GR3A 2C3DA 4HYRA 3AB1A 4E6MA 2OO6A 2R9ZA 4U2TA 1YQ3A 2EQ9A 5KMSA 4APNA 2AL2B 1LQTA 5C3JA 4E4UA 2HXTA 1QLBA 5KOXA 3CXBA 2IVEA 3AECA 1QO8A 3F8RA 3SZFA 1SJBA 1GRHA 4WX1A 4LU6A 4U8JA 3GD6A 3ICRA 4H2NA 3VRBA 2MNRA 1Y0PA 1NG4A 4G74A 3VR9A 1JU2A 4G9KA 5JRBA 2PP0A 3P0WA 2WOWA 1OJTA 2VVMA 2QVHA 1ZOYA 1MRAA 4D03A 2HZGA 1ZMCA 1TDNA 4BJZA 4TM3A 3ZLGA 1TDEA 2O9ZA 1MNSA 3QSEA 4O5UA 3CNPA 1VDVA 1IYXA 2P8CA 4GAVA 1JPMA 3RRAA 3IHMA 1GESA 3EANA 1GXFA 5GRTA 3DGZA 4AT2A 2C7GA 2GR2A 3T9PA 1EBGA 2YLTA 3NVZB 3QFBA 3T8QA 2GR0A 3S5SA 4YWSA 3Q6JA 2OA1A 5BOEA 1FOHA 4E0VA 2H89A 3SM8A 3RP8A 2JK6A 4YKGA 2GB0A 3JVAA 2ZZ0A 3LXDA 3QSMA 4GUVA 2YWLA 2W55A 4BJYA 2PTYA 3MWCA 1PS9A 3FXGA 2V3BA 3AM9A 4YWOA 1PBFA 2GL5A 3NT6A 3UGVA 1GTEA 7ENLA 2VZ2A 4H19A 4PABA 3SZWA 3NYCA 3ES7A 3NH3X 3R0KA 3RGTA 1TYPA 2JAEA 2BABA 2QJJA 2JBVA 2WESA 5FS9A 2Y6RA 5EOWA 3AD8B
chains in the Genus database with same CATH topology
1NHRA 3NN0X 4Y4LA 1LQUA 3KPKA 2VRLA 1GRBA 2YLSA 4UDRA 2E1MA 2XLUA 2VRMA 1BZLA 3HYXA 3C96A 1D7LA 4H4SA 3EF6A 2AQJA 3DJEA 3I6DA 1H7XA 3S61A 2CFYA 3EAOA 4Z2RA 3ADAB 3UOZA 2B7RA 2GQWA 3GD4A 1K0LA 3LOVA 5M0ZA 3SFEA 3CNSA 3CNTA 5KWFA 4NEWA 2B9WA 1S7MA 1Q1WA 2VVLG 5KMQA 3WE0A 1FECA 3HZLA 1N1PA 1KF6A 2BRYA 2C3CA 1E1NA 1PDHA 2YG5A 4GCMA 2BK5A 2C65A 5KMRA 4U8PA 4CRTA 4J33A 4B65A 3DJDA 4H4QA 1LTXR 3D9XA 4ZN0A 1MXTA 1P2EA 1SEZA 4IV9A 4H4TA 1JRZA 2WETA 4LIIA 2GAHB 4H7UA 1VG0A 1GOSA 3GMBA 2CVJA 3UKLA 3UCLA 1CF3A 2VQBA 3RP7A 3UP5A 3P9UA 2B7SA 4WCTA 1ZY8A 1IJHA 2YG7A 2PHHA 1TDOA 1F3PA 4EQXA 1S3BA 2DKHA 3AEBA 3IWAA 4GDEA 4K5SA 4YTMA 4Z43A 2XVHA 1KNPA 3BNMA 2XDOA 3NYEA 4H4ZA 3DK8A 4J31A 5U1OA 1H7WA 2ARDA 3RNMA 1PXBA 4CY6A 2FBWA 3DH9A 2C75A 2WU5A 4HB9A 2IVDA 1KN0A 1ZK7A 3AYJA 1H86A 2YAUA 2YR4A 3NKSA 3VQRA 4AP3A 4CBQA 1MO9A 1GALA 2WHDA 4TM4A 4JY3A 1JRYA 1Y56B 1YQ4A 2C67A 2X8HA 3CGBA 1CHUA 1NEKA 2BACA 1K4QA 4BK1A 1GSNA 3T2KA 1S3EA 1VQWA 3LZXA 2R4JA 3LADA 3BI2A 3L1RA 2C72A 1DOBA 3L8KA 3QVRA 4UP3A 4B63A 3AYLA 5KRQA 4H2PA 1H6VA 3H8LA 3LJPA 5KNLA 2R46A 2BK3A 4EQRA 2BS3A 3QJ4A 3FPZA 4JQ9A 1PN0A 2BS4A 2XFPA 3C4NA 2YLWA 1ZKQA 1LJ1A 1PJ5A 3SY4A 4Z26A 2C66A 5KXJA 2V6OA 1L0VA 3NK2X 1YY5A 3D8XA 3T31A 1OJDA 2Q6UA 2XCGA 5EB5A 4TLXA 4YTNA 3CNJA 4BV6A 4U8IA 1OJ9A 1Z6LA 1DNCA 4JDRA 2XVIA 4K8DA 2QA1A 5BRTA 1B8SA 3C4AA 2XFNA 3GDPA 1EL7A 1FL2A 4KPRA 3BHFA 2X50A 4BK2A 1YKJA 4K22A 4CCRA 3NRNA 3T2YA 5KVHA 4USRA 3ZYXA 2BA9A 4A99A 3DA1A 4JNQA 3NG7X 3GRTA 2R0PA 5KVIA 3UTFA 4ECHA 3GWFA 3LZWA 2V5ZA 1IUWA 1PJ7A 5JCIA 2GEWA 5M10A 4U8MA 3K7MX 3CGDA 2E4GA 5IPYA 4NNJA 4HA6A 3GMCA 2YG4A 1NG3A 4GRTA 4ADWA 2R45A 3UKPA 1UKVG 1B37A 4EIQA 4K7ZA 3SGLA 5IQ4A 4FX9A 4RG4A 1CBOA 3OC4A 1BGJA 1ZOVA 3NGCX 4RSLA 4IVOB 3ICTA 3KPFA 2WDRA 1VRQB 4TLZA 3GYXA 4AOSA 1D7YA 4UDQA 3AD9B 3P4RA 4J36A 4NEVA 1QJDA 4XWZA 1NAAA 4B64A 3QFAA 2WOIA 1JNZA 2RGJA 3OZ2A 4NZHA 5C2TA 3AE6A 2YG3A 4X9NA 1O94A 5HXIA 3CTYA 4YKFA 3K7QX 1COYA 3KD9A 1OJCA 4G73A 2FJBA 3UP4A 3ZDNA 1EL8A 2B9YA 4IA6A 2WEUA 1ZMDA 2YVFA 2A87A 1DJQA 4MJWA 3P4PA 4H50A 2OLNA 4H4WA 3M12A 3FMWA 4GDPA 3LB8A 4D04A 1BWCA 1JOAA 3P1WA 3L5OA 2GVCA 4U8LA 4NTDA 5JCNA 3H8IA 1XDIA 3GD3A 2ZBWA 4YSHA 3FG2P 2CDUA 2GF3A 5JCLA 3K7TA 4U8NA 5JCMA 4ZCDA 2XFQA 2BC0A 1DXLA 2HQMA 1M64A 2AAQA 1XANA 1XHCA 3VRAA 2WOVA 1H84A 5U63A 5HY5A 2WP5A 1DOEA 1CJ3A 1K0JA 3FIMB 2W0HA 1IUUA 3IHGA 4YSYA 1D5TA 1GV4A 1RP0A 1JRXA 3DMEA 4Z24A 1D4DA 2XFUA 2TPRA 1GRGA 4EM4A 4EQSA 1IUSA 1IUTA 1N4UA 2VQ7A 2Z5XA 3GSIA 3QVPA 3SZCA 3VR8A 3H4KA 5J60A 3M0OA 4FK1A 1LVLA 4JY2A 2WPEA 3CIRA 5GSNA 3UKAA 3DJGX 2GR1A 1PHHA 3BI4A 3AYIA 4TM1A 2BYBA 3ATRA 3O0HA 1N4WA 1PJ6A 4C77A 1RSGA 4H2RA 1CC6A 5FMHA 3PO7A 1Q1RA 4C74A 1P2HA 3V3OA 2A89A 2WU2A 1XPQA 2YR5A 3CNDA 4Y4NA 4YT0A 3T37A 2X99A 2NPXA 1D4EA 3K30A 4A6NA 2V3AA 2XLRA 2QA2A 3KVEA 3CGEA 1KDGA 4AT0A 2EQ7A 1GEUA 1NDAA 4OPIA 4J2WA 3NK1X 4YSZA 3PS9A 2WPCA 2ACZA 2R4EA 3NYFA 4K2XA 4A9WA 1CC4A 1TYTA 3ITJA 4Z44A 2WS3A 3IC9A 2VVLA 2YQUA 3SZ0A 2BRAA 3UTGA 1F8RA 1TRBA 3UOYA 3ABVA 3CMMA 3BNUA 4AP1A 1PBDA 1BGNA 1KNRA 4XXGA 4KX6A 1GERA 1D4CA 4B69A 1KSSA 3CPIG 4H4YA 3BI5A 4IA5A 3AD7B 4NTEA 1H2IA 1HYUA 3V3NA 1L9CA 1JEHA 1GPEA 3NTDA 4NWZA 4EQWA 3AE4A 2I0ZA 4B66A 4DSGA 4G6HA 3EPTA 3NK0X 3Q9TA 4OPDA 2YLRA 3SXIA 2OALA 2BC1A 5EBKA 2BXSA 4BURA 4U2LA 4OPCA 1LV0A 2X3NA 4PAAA 1ONFA 4OPGA 4A7AA 1K0IA 4K5RA 4A79A 1CL0A 1JNRA 1B4VA 3AE3A 3P4SA 4II3A 1H81A 3NIXA 4O5QA 4Z25A 2UZZA 4EM3A 1F8WA 3NTAA 1MOKA 2APGA 3RHAA 4C5OA 1VG9A 3RP6A 2J3NA 4A65A 2QAEA 1PBEA 3F8PA 1TDFA 1L9DA 2C4CA 3ISHA 3GRSA 3PG6A 2R0CA 1X31B 3AEFA 3CPJG 4CCQA 4OCGA 2GR3A 1GT8A 2CULA 2C3DA 4X4JA 1S2QA 2WP6A 3AB1A 5HYMA 4C3YA 3UKFA 4GR1A 2RABA 2R9ZA 2XLPA 3ALMA 4U2TA 3DK4A 1YQ3A 2EQ9A 2Q0LA 2FJDA 4CY8A 2XVEA 5KMPA 5KMSA 1KFYA 4U8KA 5BVAA 1GRAA 3NHOX 4APNA 3G5RA 4J34A 3IF9A 3KA7A 1DODA 2QCUA 1LQTA 4Z2TA 5BULA 1NPXA 4UDPA 3VRDB 5C3JA 4TM0A 3HYWA 3UKQA 3ATQA 1PXAA 4B1BA 4H4VA 1QLBA 4FK1C 1PBBA 5BUKA 1O5WA 3S5WA 5KOXA 2XLTA 3DK9A 4M52A 1O95A 1RYIA 3SX6A 2Z5YA 4OPLA 2IVEA 3AECA 3T0KA 1QO8A 2H88A 2OAMA 3P4QA 1E7PA 3F8RA 1L9EA 3AXBA 2FJEA 3SZFA 4GF7A 2Y6QA 1GRHA 2TMDA 4B68A 1ZX9A 1AOGA 1E6EA 4U2SA 4ICYA 1FEAA 3UOVA 5LV9A 4WX1A 4LU6A 4U8JA 3B6DA 3CN8A 3II4A 2V61A 4JN9A 3ICRA 4H4UA 5J7XA 2JKCA 3REDA 3AE7A 3JSKA 1DOCA 4H2NA 1E1LA 4EMIA 3I3LA 3VRBA 1EBDA 1CC2A 1FEBA 4P9SA 2YVJA 1YQZA 3URHA 1Y0PA 1CJ2A 2GAGB 2YM1A 3CPHG 4RG3A 1PBCA 5EB4A 1NG4A 4G74A 3VR9A 4J57A 3M13A 4OPTA 2YLXA 1GRFA 5L46A 1JU2A 2RGHA 4G9KA 4FDCB 5JRBA 4H4PA 4GAPA 1LPFA 2WOWA 1OJTA 2XVFA 1GNDA 2F5ZA 2VVMA 3SQPA 5TR3A 5HHFA 1ZOYA 4G6GA 4D03A 1ZMCA 1TDNA 2XLSA 3KKJA 2AR8A 2YG6A 3AE2A 4YSXA 5FS8A 3V76A 4C3XA 2OLOA 4BJZA 3UOXA 3COXA 4TM3A 1TDEA 4REKA 3UTEA 3D1CA 2O9ZA 2VOUA 3QSEA 1ELIA 3GYJA 4O5UA 3CNPA 2C76A 3GYIA 2NVKX 4Y4MA 3QSSA 4EMWA 3AE8A 3KLJA 5U25A 3GWDA 2XYOA 4U8OA 1F8SA 3CGCA 3DJJA 1F6MA 1S2YA 1ZP0A 1TDKA 3ALLA 3NLCA 4H4RA 4GAVA 4N9XA 4OPUA 3PVCA 5ER0A 2BCGG 3IHMA 5CKUA 1IUVA 1NENA 2WPFA 1Q9IA 4CNJA 4CNKA 1GESA 4H2QA 4X9MA 3EANA 1GXFA 2ZZBA 5GRTA 2GH5A 4OVIA 2BS2A 2WP9A 3DGZA 2WDQA 2EQ8A 2C7GA 4AT2A 2GR2A 1GTHA 2GRTA 3ALJA 3KU9A 1GETA 4XWRA 4II2A 1E1KA 1PXCA 5KOWA 1E39A 5CQFA 2BK4A 2A8XA 2WDVA 2YLTA 1Y56A 2DKIA 1ZDLA 3G5QA 3QFBA 3SYIA 3AE9A 2GR0A 2IIDA 3SFDA 3UKHA 1E1MA 2E5VA 3Q6JA 2X8GA 1NHPA 2OA1A 1FCDA 2GQFA 2C73A 2RGOA 3UTHA 1FOHA 4E0VA 2H89A 1KSUA 4IVMB 1V59A 1NHSA 5FS6A 3SM8A 3AE1A 2X8CA 3RP8A 1GRTA 2JB2A 5FS7A 3HYVA 3T2ZA 2JK6A 2XVJA 4JNAA 4YKGA 1REOA 2GB0A 1OJAA 4NTCA 1N4VA 3DGHA 2ZZ0A 4DSHA 3LXDA 3QSMA 4GUVA 2YWLA 3FBSA 3UKKA 1VDCA 2ZZCA 2PYXA 1EL5A 5JCKA 2JB3A 4YTPA 5DBJA 2YR6A 1B5QA 4BJYA 4EIPA 2BCPA 1CJ4A 1BKWA 1H83A 4USQA 4EMJA 4B67A 4DGKA 1PS9A 3AEAA 4ZCCA 2V3BA 4YWOA 2FJAA 1PBFA 2B76A 2GMJA 2YLZA 1W4XA 2YVGA 3F8DA 3NT6A 4DNAA 2WQYA 1GTEA 2VZ2A 3ICSA 5IQ1A 4YXDA 1GREA 1EL9A 1H82A 3NN6X 1M6IA 4H4XA 4A6NB 3AE5A 4BK3A 1IUXA 2GMHA 2GV8A 4PABA 3B3RA 1BF3A 3SZWA 1DJNA 3GDNA 3NYCA 3AEEA 2BXRA 3R9UA 2JB1A 2B9XA 3AEDA 3NH3X 4A5LA 4Z2UA 4I58A 1CJCA 3AWIA 2V60A 4LA1A 2R0GA 1TYPA 2Q7VA 2JAEA 2BABA 2C64A 4I59A 2C70A 3E1TA 4AOXA 2JBVA 3AEGA 3BHKA 1NHQA 2EQ6A 2Q0KA 5FS9A 2WESA 3NNEA 3T14A 2Y6RA 5EOWA 4J56A 3G5SA 2XFOA 3AD8B 2YM2A 2WBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHR A;  3NN0 X;  4Y4L A;  1LQU A;  2VRL A;  1GRB A;  2YLS A;  4UDR A;  2E1M A;  2XLU A;  2VRM A;  1BZL A;  3C96 A;  1D7L A;  4H4S A;  3EF6 A;  2AQJ A;  3DJE A;  3I6D A;  1H7X A;  3S61 A;  2CFY A;  3EAO A;  4Z2R A;  3ADA B;  3UOZ A;  2B7R A;  2GQW A;  3GD4 A;  1K0L A;  3LOV A;  5M0Z A;  3SFE A;  3CNS A;  3CNT A;  5KWF A;  4NEW A;  2B9W A;  2VVL G;  1Q1W A;  3WE0 A;  1FEC A;  3HZL A;  1N1P A;  1KF6 A;  2YG5 A;  2C3C A;  1E1N A;  1PDH A;  4GCM A;  2BK5 A;  2C65 A;  4U8P A;  4CRT A;  4J33 A;  4B65 A;  3DJD A;  4H4Q A;  1LTX R;  4ZN0 A;  1MXT A;  1P2E A;  1SEZ A;  4IV9 A;  4H4T A;  1JRZ A;  2WET A;  4LII A;  2GAH B;  4H7U A;  1VG0 A;  1GOS A;  3GMB A;  2CVJ A;  3UKL A;  3UCL A;  1CF3 A;  2VQB A;  3RP7 A;  3UP5 A;  3P9U A;  2B7S A;  4WCT A;  1ZY8 A;  1IJH A;  2YG7 A;  2PHH A;  1TDO A;  1F3P A;  4EQX A;  1S3B A;  2DKH A;  3AEB A;  3IWA A;  4GDE A;  4K5S A;  4YTM A;  4Z43 A;  2XVH A;  1KNP A;  3BNM A;  2XDO A;  3NYE A;  4H4Z A;  3DK8 A;  4J31 A;  5U1O A;  1H7W A;  2ARD A;  3RNM A;  1PXB A;  4CY6 A;  2FBW A;  3DH9 A;  2C75 A;  2WU5 A;  4HB9 A;  2IVD A;  1ZK7 A;  3AYJ A;  1H86 A;  2YAU A;  2YR4 A;  3NKS A;  3VQR A;  4AP3 A;  4CBQ A;  1MO9 A;  1GAL A;  2WHD A;  4TM4 A;  4JY3 A;  1JRY A;  1Y56 B;  1YQ4 A;  2C67 A;  2X8H A;  3CGB A;  1CHU A;  1NEK A;  2BAC A;  1K4Q A;  4BK1 A;  1GSN A;  1S3E A;  1VQW A;  3LZX A;  2R4J A;  3LAD A;  3BI2 A;  3L1R A;  2C72 A;  1DOB A;  3L8K A;  3QVR A;  4UP3 A;  4B63 A;  3AYL A;  5KRQ A;  4H2P A;  1H6V A;  3H8L A;  3LJP A;  2R46 A;  2BK3 A;  4EQR A;  2BS3 A;  3QJ4 A;  3FPZ A;  4JQ9 A;  1PN0 A;  2BS4 A;  2XFP A;  3C4N A;  2YLW A;  1ZKQ A;  1LJ1 A;  1PJ5 A;  4Z26 A;  2C66 A;  5KXJ A;  2V6O A;  1L0V A;  3NK2 X;  1YY5 A;  3D8X A;  1OJD A;  2Q6U A;  2XCG A;  5EB5 A;  4TLX A;  4YTN A;  3CNJ A;  4BV6 A;  4U8I A;  1OJ9 A;  1Z6L A;  1DNC A;  4JDR A;  2XVI A;  4K8D A;  2QA1 A;  5BRT A;  1B8S A;  3C4A A;  2XFN A;  3GDP A;  1EL7 A;  1FL2 A;  4KPR A;  3BHF A;  2X50 A;  4BK2 A;  1YKJ A;  4K22 A;  4CCR A;  3NRN A;  5KVH A;  4USR A;  3ZYX A;  2BA9 A;  4A99 A;  3DA1 A;  4JNQ A;  3NG7 X;  3GRT A;  2R0P A;  5KVI A;  3UTF A;  4ECH A;  3GWF A;  3LZW A;  2V5Z A;  1IUW A;  1PJ7 A;  5JCI A;  2GEW A;  5M10 A;  4U8M A;  3K7M X;  3CGD A;  2E4G A;  5IPY A;  4HA6 A;  3GMC A;  2YG4 A;  1NG3 A;  4GRT A;  4ADW A;  2R45 A;  3UKP A;  1UKV G;  1B37 A;  4EIQ A;  4K7Z A;  3SGL A;  5IQ4 A;  4FX9 A;  4RG4 A;  1CBO A;  3OC4 A;  1BGJ A;  1ZOV A;  3NGC X;  4RSL A;  4IVO B;  3ICT A;  3KPF A;  2WDR A;  1VRQ B;  4TLZ A;  4AOS A;  1D7Y A;  4UDQ A;  3AD9 B;  3P4R A;  4J36 A;  4NEV A;  1QJD A;  4XWZ A;  1NAA A;  4B64 A;  3QFA A;  2WOI A;  1JNZ A;  2RGJ A;  3OZ2 A;  4NZH A;  5C2T A;  3AE6 A;  2YG3 A;  4X9N A;  1O94 A;  5HXI A;  3CTY A;  4YKF A;  3K7Q X;  1COY A;  3KD9 A;  1OJC A;  3UP4 A;  2FJB A;  3ZDN A;  1EL8 A;  2B9Y A;  4IA6 A;  2WEU A;  1ZMD A;  2YVF A;  2A87 A;  1DJQ A;  4MJW A;  3P4P A;  4H50 A;  2OLN A;  4H4W A;  3M12 A;  3FMW A;  4GDP A;  3LB8 A;  4D04 A;  1BWC A;  1JOA A;  3P1W A;  2GVC A;  4U8L A;  4NTD A;  5JCN A;  3H8I A;  1XDI A;  3GD3 A;  2ZBW A;  4YSH A;  3FG2 P;  2CDU A;  2GF3 A;  5JCL A;  3K7T A;  4U8N A;  5JCM A;  4ZCD A;  2XFQ A;  2BC0 A;  1DXL A;  2HQM A;  1M64 A;  2AAQ A;  1XAN A;  1XHC A;  3VRA A;  2WOV A;  1H84 A;  5U63 A;  5HY5 A;  2WP5 A;  1DOE A;  1CJ3 A;  1K0J A;  3FIM B;  2W0H A;  1IUU A;  3IHG A;  4YSY A;  1D5T A;  1GV4 A;  1RP0 A;  1JRX A;  3DME A;  4Z24 A;  1D4D A;  2XFU A;  2TPR A;  1GRG A;  4EM4 A;  4EQS A;  1IUS A;  1IUT A;  1N4U A;  2VQ7 A;  2Z5X A;  3GSI A;  3QVP A;  3VR8 A;  3H4K A;  5J60 A;  3M0O A;  4FK1 A;  1LVL A;  4JY2 A;  2WPE A;  3CIR A;  5GSN A;  3UKA A;  3DJG X;  2GR1 A;  1PHH A;  3BI4 A;  3AYI A;  4TM1 A;  2BYB A;  3ATR A;  3O0H A;  1N4W A;  1PJ6 A;  4C77 A;  1RSG A;  4H2R A;  1CC6 A;  5FMH A;  3PO7 A;  1Q1R A;  4C74 A;  1P2H A;  3V3O A;  2A89 A;  2WU2 A;  1XPQ A;  2YR5 A;  3CND A;  4Y4N A;  4YT0 A;  3T37 A;  2X99 A;  2NPX A;  1D4E A;  3K30 A;  4A6N A;  2V3A A;  2XLR A;  2QA2 A;  3KVE A;  3CGE A;  1KDG A;  4AT0 A;  2EQ7 A;  1GEU A;  1NDA A;  4OPI A;  4J2W A;  3NK1 X;  4YSZ A;  3PS9 A;  2WPC A;  2ACZ A;  2R4E A;  3NYF A;  4K2X A;  4A9W A;  1CC4 A;  1TYT A;  3ITJ A;  4Z44 A;  2WS3 A;  3IC9 A;  2VVL A;  2YQU A;  3UTG A;  1F8R A;  1TRB A;  3UOY A;  3ABV A;  3BNU A;  4AP1 A;  1PBD A;  1BGN A;  1KNR A;  4XXG A;  4KX6 A;  1GER A;  1D4C A;  4B69 A;  1KSS A;  3CPI G;  4H4Y A;  3BI5 A;  4IA5 A;  3AD7 B;  4NTE A;  1HYU A;  3V3N A;  1L9C A;  1JEH A;  1GPE A;  3NTD A;  4EQW A;  3AE4 A;  2I0Z A;  4B66 A;  4DSG A;  3EPT A;  3NK0 X;  3Q9T A;  4OPD A;  2YLR A;  2OAL A;  2BC1 A;  5EBK A;  2BXS A;  4BUR A;  4U2L A;  4OPC A;  1LV0 A;  2X3N A;  4PAA A;  1ONF A;  4OPG A;  4A7A A;  1K0I A;  4K5R A;  4A79 A;  1CL0 A;  1JNR A;  1B4V A;  3AE3 A;  3P4S A;  4Z25 A;  1H81 A;  3NIX A;  4O5Q A;  2UZZ A;  4EM3 A;  1F8W A;  3NTA A;  1MOK A;  2APG A;  3RHA A;  4C5O A;  1VG9 A;  3RP6 A;  2J3N A;  4A65 A;  2QAE A;  1PBE A;  3F8P A;  1TDF A;  1L9D A;  3ISH A;  4CCQ A;  3GRS A;  3CPJ G;  2R0C A;  1X31 B;  3AEF A;  4OCG A;  2GR3 A;  1GT8 A;  2CUL A;  2C3D A;  4X4J A;  1S2Q A;  2WP6 A;  3AB1 A;  5HYM A;  4C3Y A;  3UKF A;  4GR1 A;  2RAB A;  2R9Z A;  2XLP A;  3ALM A;  4U2T A;  3DK4 A;  1YQ3 A;  2EQ9 A;  2Q0L A;  2FJD A;  4CY8 A;  2XVE A;  1KFY A;  4U8K A;  5BVA A;  1GRA A;  3NHO X;  4APN A;  3G5R A;  4J34 A;  3IF9 A;  3KA7 A;  1DOD A;  2QCU A;  1LQT A;  4Z2T A;  5BUL A;  1NPX A;  4UDP A;  3VRD B;  5C3J A;  4TM0 A;  3UKQ A;  3ATQ A;  1PXA A;  4B1B A;  4H4V A;  1QLB A;  4FK1 C;  1PBB A;  5BUK A;  1O5W A;  3S5W A;  5KOX A;  2XLT A;  3DK9 A;  4M52 A;  1O95 A;  1RYI A;  2Z5Y A;  4OPL A;  2IVE A;  3AEC A;  1QO8 A;  2H88 A;  2OAM A;  3P4Q A;  1E7P A;  3F8R A;  1L9E A;  3AXB A;  2FJE A;  4GF7 A;  2Y6Q A;  1GRH A;  2TMD A;  4B68 A;  1ZX9 A;  1AOG A;  1E6E A;  4U2S A;  4ICY A;  1FEA A;  3UOV A;  5LV9 A;  4WX1 A;  4LU6 A;  4U8J A;  3B6D A;  3CN8 A;  3II4 A;  2V61 A;  4JN9 A;  3ICR A;  4H4U A;  5J7X A;  2JKC A;  3RED A;  3AE7 A;  3JSK A;  1DOC A;  4H2N A;  1E1L A;  4EMI A;  3I3L A;  3VRB A;  1EBD A;  1CC2 A;  1FEB A;  4P9S A;  2YVJ A;  1YQZ A;  3URH A;  1Y0P A;  1CJ2 A;  2GAG B;  2YM1 A;  3CPH G;  4RG3 A;  1PBC A;  5EB4 A;  1NG4 A;  3VR9 A;  4J57 A;  3M13 A;  4OPT A;  2YLX A;  1GRF A;  5L46 A;  1JU2 A;  2RGH A;  4FDC B;  4H4P A;  1LPF A;  2WOW A;  1OJT A;  2XVF A;  1GND A;  2F5Z A;  2VVM A;  3SQP A;  5TR3 A;  5HHF A;  1ZOY A;  4D03 A;  1ZMC A;  1TDN A;  2XLS A;  3KKJ A;  2AR8 A;  2YG6 A;  3AE2 A;  4YSX A;  5FS8 A;  3V76 A;  4C3X A;  2OLO A;  4BJZ A;  3UOX A;  3COX A;  4TM3 A;  1TDE A;  4REK A;  3UTE A;  3D1C A;  2O9Z A;  2VOU A;  3QSE A;  1ELI A;  3GYJ A;  4O5U A;  3CNP A;  2C76 A;  3GYI A;  2NVK X;  4Y4M A;  3QSS A;  4EMW A;  3AE8 A;  3KLJ A;  5U25 A;  3GWD A;  2XYO A;  4U8O A;  1F8S A;  3CGC A;  3DJJ A;  1F6M A;  1S2Y A;  1ZP0 A;  1TDK A;  3ALL A;  3NLC A;  4H4R A;  4N9X A;  4OPU A;  3PVC A;  5ER0 A;  2BCG G;  3IHM A;  5CKU A;  1IUV A;  1NEN A;  2WPF A;  1Q9I A;  4CNJ A;  4CNK A;  1GES A;  4H2Q A;  4X9M A;  3EAN A;  1GXF A;  2ZZB A;  5GRT A;  2GH5 A;  4OVI A;  2BS2 A;  2WP9 A;  3DGZ A;  2WDQ A;  2EQ8 A;  2C7G A;  4AT2 A;  2GR2 A;  1GTH A;  2GRT A;  3ALJ A;  3KU9 A;  1GET A;  4XWR A;  1E1K A;  1PXC A;  5KOW A;  1E39 A;  5CQF A;  2BK4 A;  2A8X A;  2WDV A;  2YLT A;  1Y56 A;  2DKI A;  1ZDL A;  3G5Q A;  3QFB A;  3AE9 A;  2GR0 A;  2IID A;  3SFD A;  3UKH A;  1E1M A;  2E5V A;  3Q6J A;  2X8G A;  1NHP A;  2OA1 A;  1FCD A;  2GQF A;  2C73 A;  2RGO A;  3UTH A;  1FOH A;  4E0V A;  2H89 A;  1KSU A;  4IVM B;  1V59 A;  1NHS A;  5FS6 A;  3SM8 A;  3AE1 A;  2X8C A;  3RP8 A;  1GRT A;  2JB2 A;  5FS7 A;  2JK6 A;  2XVJ A;  4JNA A;  4YKG A;  1REO A;  2GB0 A;  1OJA A;  4NTC A;  1N4V A;  3DGH A;  2ZZ0 A;  4DSH A;  3LXD A;  3QSM A;  4GUV A;  2YWL A;  3FBS A;  3UKK A;  1VDC A;  2ZZC A;  2PYX A;  1EL5 A;  5JCK A;  2JB3 A;  4YTP A;  5DBJ A;  2YR6 A;  1B5Q A;  4BJY A;  4EIP A;  2BCP A;  1CJ4 A;  1BKW A;  1H83 A;  4USQ A;  4EMJ A;  4B67 A;  4DGK A;  1PS9 A;  3AEA A;  4ZCC A;  2V3B A;  4YWO A;  2FJA A;  1PBF A;  2B76 A;  2GMJ A;  2YLZ A;  1W4X A;  2YVG A;  3F8D A;  3NT6 A;  4DNA A;  2WQY A;  1GTE A;  2VZ2 A;  3ICS A;  5IQ1 A;  4YXD A;  1GRE A;  1EL9 A;  1H82 A;  3NN6 X;  1M6I A;  4H4X A;  4A6N B;  3AE5 A;  4BK3 A;  1IUX A;  2GMH A;  2GV8 A;  4PAB A;  3B3R A;  1BF3 A;  1DJN A;  3GDN A;  3NYC A;  3AEE A;  2BXR A;  3R9U A;  2JB1 A;  2B9X A;  3AED A;  3NH3 X;  4A5L A;  4Z2U A;  4I58 A;  1CJC A;  3AWI A;  2V60 A;  4LA1 A;  2R0G A;  1TYP A;  2Q7V A;  2JAE A;  2BAB A;  2C64 A;  4I59 A;  2C70 A;  3E1T A;  4AOX A;  2JBV A;  3AEG A;  3BHK A;  1NHQ A;  2EQ6 A;  2Q0K A;  5FS9 A;  2WES A;  3NNE A;  2Y6R A;  5EOW A;  4J56 A;  3G5S A;  2XFO A;  3AD8 B;  2YM2 A;  2WBA A; 
#chains in the Genus database with same CATH topology
 3KPK A;  2VRL A;  2E1M A;  2XLU A;  1BZL A;  3I6D A;  1H7X A;  3GD4 A;  1K0L A;  3R07 C;  1S7M A;  2VVL G;  5FJP A;  1N1P A;  4U8P A;  4CRT A;  4J33 A;  4B65 A;  4H4T A;  3EEZ A;  3PFR A;  2CVJ A;  1CF3 A;  2B7S A;  1IJH A;  1OEP A;  3I4K A;  3IWA A;  1KNP A;  3DES A;  3NYE A;  4IL0 A;  3DK8 A;  4J31 A;  5U1O A;  1H7W A;  4CY6 A;  3DH9 A;  3H12 A;  2GGJ A;  2WU5 A;  2IVD A;  3VQR A;  4AP3 A;  4CBQ A;  4TM4 A;  2C67 A;  1K4Q A;  4JN7 A;  3T2K A;  1VQW A;  3L8K A;  3TCS A;  4FP1 A;  2QDD A;  1H6V A;  5KNL A;  3LJP A;  4EQR A;  4JQ9 A;  2XFP A;  2YLW A;  3SY4 A;  1L0V A;  1YY5 A;  2Q6U A;  2RDX A;  2XCG A;  2XVI A;  4JDR A;  2QA1 A;  5BRT A;  3I6T A;  2XFN A;  4CCR A;  2P0I A;  2R0P A;  3UTF A;  3LZW A;  3MZN A;  4NNJ A;  1UKV G;  4K7Z A;  3THU A;  2XH2 A;  3OC4 A;  4RSL A;  3KPF A;  4A35 A;  4TLZ A;  3H7V A;  4UDQ A;  4NEV A;  4XWZ A;  1NAA A;  2POD A;  2WOI A;  2PTX A;  2RGJ A;  4NZH A;  5C2T A;  4G8T A;  2FJB A;  3NO1 A;  4IA6 A;  1KKR A;  2A87 A;  1DJQ A;  4MJW A;  2OLN A;  3M12 A;  1NEL A;  4GDP A;  1BWC A;  2OX4 A;  1N61 C;  3FG2 P;  3UJ2 A;  1XHC A;  2PGE A;  2GDQ A;  1RVK A;  2W0H A;  1GV4 A;  2XH7 A;  1JRX A;  4Z24 A;  1D4D A;  4MKS A;  2TPR A;  1GRG A;  2VQ7 A;  1IUS A;  5IDZ A;  3QVP A;  3UCC A;  1BQG A;  3CIR A;  2GR1 A;  3HPF A;  3NRZ B;  3ATR A;  4H2R A;  1CC6 A;  3PO7 A;  4KPL A;  4E8G A;  5ENL A;  3K1G A;  3CND A;  1XPQ A;  4Y4N A;  4YT0 A;  3R10 A;  3T37 A;  1N5X A;  2XLR A;  3ZVI A;  1WUE A;  3KVE A;  3NK1 X;  4YSZ A;  3PS9 A;  3NYF A;  1CC4 A;  3ITJ A;  4Z44 A;  2VVL A;  2YQU A;  3SZ0 A;  1F8R A;  1TRB A;  4XXG A;  1GER A;  3CPI G;  3V3N A;  4IA5 A;  3TW9 A;  1JEH A;  3NTD A;  4EQW A;  3AE4 A;  4DSG A;  3NK0 X;  3Q9T A;  3IK4 A;  5FJR A;  2BXS A;  4BUR A;  2HXU A;  2X3N A;  1ONF A;  2P8B A;  1K0I A;  4II3 A;  1H81 A;  3NIX A;  1VG9 A;  2QAE A;  3ISH A;  1TDF A;  1L9D A;  4CCQ A;  3CPJ G;  3PG6 A;  3UCD A;  1GT8 A;  3SN0 A;  3UKF A;  3UJR A;  3TTE A;  2FJD A;  2XVE A;  5KMP A;  4U8K A;  5BVA A;  4J34 A;  3SN1 A;  1DOD A;  2QCU A;  4Z2T A;  3SN4 A;  5BOF A;  3VRD B;  2QJM A;  1KD0 A;  2OVL A;  3DER A;  4H4V A;  4JHM A;  1N60 C;  3SX6 A;  3P4Q A;  1L9E A;  4HNC A;  4GF7 A;  4H1Z A;  2OZ3 A;  2TMD A;  1ZX9 A;  1AOG A;  4ICY A;  3QKE A;  5LV9 A;  5J7X A;  2JKC A;  1DOC A;  4EMI A;  4P9S A;  3CAW A;  3URH A;  2YM1 A;  3CPH G;  4RG3 A;  1JRO A;  1PBC A;  3M13 A;  4OPT A;  1GRF A;  5L46 A;  4GAP A;  4K1W A;  4H4P A;  2XVF A;  3SQP A;  4Z17 A;  3IJL A;  4G6G A;  3A7R A;  1MUC A;  3AE2 A;  4H2H A;  4YSX A;  3V76 A;  3UTE A;  1PDZ A;  3GYJ A;  3GYI A;  1N63 C;  5U25 A;  3GWD A;  1XPY A;  1F6M A;  3DJJ A;  4MGG A;  3ALL A;  1S2Y A;  5BUL A;  1TDK A;  5G5H B;  6ENL A;  4CNJ A;  4X9M A;  4FI4 A;  2GH5 A;  2WP9 A;  2WDQ A;  2EQ8 A;  2GRT A;  3KU9 A;  4XWR A;  3SQS A;  1E1K A;  3CB3 A;  1PXC A;  1E39 A;  5CQF A;  2BK4 A;  2WDV A;  2DKI A;  1ZDL A;  1E1M A;  4Z1Y A;  2X8G A;  1FCD A;  2GQF A;  2RGO A;  1NU5 A;  3UTH A;  4IVM B;  1V59 A;  1NHS A;  3AE1 A;  3ZLH A;  1GRT A;  2JB2 A;  3T2Z A;  3FV9 A;  2E3T A;  1OJA A;  3DGH A;  3ZLF A;  3MKC A;  4DSH A;  3VA8 A;  2OZ8 A;  3GC2 A;  2QGY A;  2ONE A;  4EIP A;  2BCP A;  1SB3 B;  1R0M A;  4ZCC A;  1P48 A;  2FJA A;  3R11 A;  2YLZ A;  2PMQ A;  2YVG A;  4DNA A;  2WQY A;  5IQ1 A;  1EL9 A;  4H4X A;  4BK3 A;  2PA6 A;  3B3R A;  3R0U A;  3AWI A;  4J3Z A;  4IZG A;  3E1T A;  1VQZ A;  4AOX A;  3AEG A;  2Q0K A;  3T14 A;  4J56 A;  3G5S A;  2XFO A;  1N5W C;  2WBA A;  4Y4L A;  1GRB A;  4UDR A;  3H70 A;  1XS2 A;  3HYX A;  3OTR A;  3B9J B;  2B7R A;  2GQW A;  5M0Z A;  3CNS A;  5KMQ A;  1KF6 A;  1E1N A;  2BK5 A;  2C65 A;  1LTX R;  1JRZ A;  4H7U A;  1GOS A;  3GMB A;  3RP7 A;  3NVV B;  1ZY8 A;  4K5S A;  3AEB A;  4EQX A;  1S3B A;  2DKH A;  4GDE A;  3BNM A;  3QLD A;  3TQP A;  3R25 A;  3JW7 A;  2FBW A;  1ZK7 A;  2YAU A;  2YR4 A;  3NS1 B;  2PSN A;  1JRY A;  1Y56 B;  1CHU A;  4X2P A;  2BAC A;  1TZZ A;  3GY1 A;  1S3E A;  3LAD A;  3BI2 A;  2C72 A;  4UP3 A;  3NVY B;  3AYL A;  2PTW A;  2BK3 A;  2BS3 A;  3FPZ A;  1PN0 A;  2BS4 A;  4Z26 A;  1FFV C;  3PWI A;  3NK2 X;  5EB5 A;  4U8I A;  1OJ9 A;  3AN1 A;  3C4A A;  1EL7 A;  3BHF A;  4BK2 A;  4K22 A;  4J1O A;  3OZM A;  3ZYX A;  2BA9 A;  4A99 A;  3DA1 A;  3RO6 A;  1PJ7 A;  4U8M A;  2W54 A;  3GMC A;  2R45 A;  3HRD C;  5IQ4 A;  4FX9 A;  3D47 A;  4AOS A;  3AD9 B;  4B64 A;  2PGW A;  4YKF A;  3KD9 A;  3UP4 A;  1OJC A;  1MDL A;  2WEU A;  2YVF A;  3V5C A;  3P3B A;  4JN8 A;  4H50 A;  4H4W A;  3FMW A;  3P1W A;  1EC8 A;  3L5O A;  4U8L A;  3GD3 A;  2ZBW A;  4U8N A;  1L8P A;  3T6C A;  2HQM A;  1XAN A;  3VRA A;  2WOV A;  1DOE A;  3FIM B;  3IHG A;  4YSY A;  1RP0 A;  3STP A;  2XFU A;  3GSI A;  3A7U A;  1IUT A;  3VR8 A;  3M0O A;  4FK1 A;  4JY2 A;  2WPE A;  1FO4 A;  1RSG A;  1EBH A;  4DX3 A;  3CYJ A;  5FMH A;  1Q1R A;  2AKM A;  3QTP A;  2X99 A;  3SR6 B;  1D4E A;  1EC7 A;  4AT0 A;  2EQ7 A;  1GEU A;  4OPI A;  4J2W A;  1WYG A;  2WPC A;  3VC5 A;  4A9W A;  1TYT A;  3UTG A;  3TJ4 A;  2P3Z A;  1PBD A;  1KNR A;  1YEY A;  3BI5 A;  3DDM A;  3U4F A;  3SJN A;  1HYU A;  3AD7 B;  4K2S A;  4NWZ A;  4G6H A;  4KEM A;  3EPT A;  3DFY A;  2OAL A;  5EBK A;  4OPC A;  4K5R A;  1CL0 A;  2DW6 A;  4HCD A;  3DEQ A;  2UZZ A;  4EM3 A;  3NTA A;  1MOK A;  3OPS A;  4A65 A;  3AEF A;  4X4J A;  1P43 A;  1S2Q A;  2WP6 A;  5HYM A;  4C3Y A;  4GR1 A;  1ONE A;  2RAB A;  2XLP A;  3SSZ A;  2Q0L A;  4CY8 A;  1EC9 A;  5FJU A;  2XH4 A;  3IF9 A;  3KA7 A;  1NPX A;  4UDP A;  2AL1 A;  4TM0 A;  3HYW A;  3UKQ A;  4G7F A;  3ATQ A;  4FK1 C;  1O5W A;  3DK9 A;  1O95 A;  1RYI A;  3T0K A;  2Z5Y A;  4OPL A;  2OAM A;  1E7P A;  3AXB A;  1FHV A;  1E6E A;  4U2S A;  3KUM A;  3UOV A;  1JRP A;  3B6D A;  3CN8 A;  2V61 A;  4JN9 A;  4H4U A;  4TVY A;  3RED A;  3AE7 A;  1E1L A;  4GYP A;  3I3L A;  1EBD A;  2P88 A;  1CJ2 A;  2GAG B;  3VFC A;  2RGH A;  3NXL A;  1LPF A;  5TR3 A;  3CXO A;  2PCE A;  3KKJ A;  5FS8 A;  3ZVH B;  4C3X A;  3UOX A;  2AKZ A;  3NZG A;  4EMW A;  1SJD A;  3RCY A;  3KLJ A;  4U8O A;  1F8S A;  3SGL A;  1ZP0 A;  3IJQ A;  4TVW A;  4GME A;  2BCG G;  4HN8 A;  4KWS A;  2WPF A;  1Q9I A;  4EWJ A;  4H2Q A;  2ZZB A;  4OVI A;  5G5G B;  3CK5 A;  2BS2 A;  4IHC A;  1GET A;  4II2 A;  1TE6 A;  5KOW A;  3DG7 A;  2A8X A;  1Y56 A;  2OG9 A;  3SFD A;  1NHP A;  5FJO A;  3P93 A;  2C73 A;  4E4F A;  2X8C A;  2XVJ A;  4NTC A;  1KKO A;  4GIR A;  4HPN A;  3TOY A;  1FFU C;  2DW7 A;  3FBS A;  3UKK A;  1VDC A;  1EL5 A;  5JCK A;  5DBJ A;  2YR6 A;  1B5Q A;  1BKH A;  4USQ A;  4DGK A;  4B67 A;  3AEA A;  4A6G A;  2GMJ A;  1W4X A;  3F8D A;  1DTN A;  1GRE A;  3DGB A;  4GFI A;  4ENL A;  4A6N B;  1IUX A;  3GDN A;  3AEE A;  3OP2 A;  2BXR A;  3R9U A;  4Z2U A;  4I58 A;  1CJC A;  4KT2 A;  2Q7V A;  2C64 A;  2C70 A;  1R6W A;  3BHK A;  2EQ6 A;  3NNE A;  1NHR A;  3NN0 X;  1LQU A;  4ZA0 A;  3MQT A;  3EF6 A;  2XGZ A;  3DJE A;  3S61 A;  2CFY A;  5KWF A;  3LOV A;  4NEW A;  3Q45 A;  3HZL A;  2BRY A;  2YG5 A;  4GCM A;  1PDH A;  3DJD A;  3D9X A;  4IV9 A;  2FYM A;  2WET A;  4LII A;  1VG0 A;  2CHR A;  3UKL A;  2VQB A;  3QN3 A;  3P9U A;  4WCT A;  2YG7 A;  4DWD A;  1TDO A;  1F3P A;  2GGH A;  2XVH A;  2XDO A;  4H4Z A;  3RR1 A;  3RNM A;  1PXB A;  2QJN A;  4HB9 A;  1KN0 A;  1H86 A;  3NKS A;  3BSM A;  1MO9 A;  1GAL A;  4JY3 A;  3CGB A;  3FYY A;  1FHU A;  4BK1 A;  1GSN A;  3LZX A;  3CT2 A;  2GSH A;  3H8L A;  3JZU A;  3UJS A;  1ZKQ A;  1LJ1 A;  2ZAD A;  2NQL A;  1PJ5 A;  2C66 A;  5KXJ A;  2V6O A;  1X2G A;  1WUF A;  1OJD A;  1Z6L A;  3GO2 A;  4K8D A;  1B8S A;  3GDP A;  1FL2 A;  2GGI A;  2X50 A;  2E5A A;  3T2Y A;  4USR A;  4JNQ A;  3GRT A;  5KVI A;  2V5Z A;  1STZ A;  5JCI A;  5M10 A;  4M0X A;  3K7M X;  1PDY A;  5IPY A;  1NG3 A;  2W3S A;  1JPD X;  4EIQ A;  3VC6 A;  4RG4 A;  1CBO A;  1BGJ A;  4IVO B;  2WDR A;  1VRQ B;  3DIP A;  3GYX A;  1D7Y A;  1MDR A;  3QFA A;  3OZ2 A;  2YG3 A;  4X9N A;  4GYP C;  4IP5 A;  5HXI A;  3CTY A;  3K7Q X;  1COY A;  4G73 A;  3ZDN A;  1EL8 A;  2B9Y A;  1ECQ A;  3LB8 A;  1JOA A;  3N4E A;  2GVC A;  4NTD A;  3D46 A;  1XDI A;  2OLA A;  4YSH A;  3K7T A;  5FJT A;  4ZCD A;  2BC0 A;  1DXL A;  3EUB 3;  3Q4D A;  3SBF A;  3AMZ A;  5U63 A;  2WP5 A;  3N6J A;  1K0J A;  5J04 A;  4A3R A;  3ETR B;  2QDE A;  2Z5X A;  4EM4 A;  1N4U A;  3BOX A;  3SZC A;  5J60 A;  3H4K A;  3FCP A;  1T3Q C;  1LVL A;  5GSN A;  2PU0 A;  4TM1 A;  3DFH A;  3O0H A;  1N4W A;  4C77 A;  3FVD A;  1P2H A;  4M6U A;  3V3O A;  2A89 A;  2YR5 A;  3ENL A;  4A6N A;  1NDA A;  3R1Z A;  2R4E A;  2WS3 A;  1KCZ A;  3IC9 A;  2BRA A;  3BNU A;  4AP1 A;  1BGN A;  4KX6 A;  4B69 A;  4NTE A;  1GPE A;  4ZOH B;  4OPD A;  2YLR A;  2BC1 A;  3UJE A;  1LV0 A;  4PAA A;  2PPG A;  1SJC A;  4A7A A;  3P4S A;  1JNR A;  3AE3 A;  4Z25 A;  4O5Q A;  3B97 A;  2APG A;  4HCH A;  2XSX A;  3RIT A;  3UXL A;  1PBE A;  4DHG A;  1X31 B;  4OCG A;  2CUL A;  3H8A A;  3ALM A;  3DK4 A;  1KFY A;  1GRA A;  3NHO X;  3G5R A;  1PXA A;  4B1B A;  1PBB A;  5BUK A;  3S5W A;  2XLT A;  4M52 A;  3V4B A;  2H88 A;  2OPJ A;  2FJE A;  4GIS A;  3N6H A;  2Y6Q A;  4B68 A;  1FEA A;  3MY9 A;  3II4 A;  3VCC A;  3JSK A;  1CC2 A;  1FEB A;  2YVJ A;  1YQZ A;  2OQH A;  2OZT A;  5EB4 A;  4J57 A;  2YLX A;  2PP3 A;  4FDC B;  3A7A A;  1GND A;  5HHF A;  2F5Z A;  3TJI A;  3U9I A;  3N4F A;  2XLS A;  4DXK A;  2AR8 A;  2YG6 A;  2OLO A;  3COX A;  4REK A;  3D1C A;  2VOU A;  1ELI A;  2C76 A;  3QPE A;  2NVK X;  4Y4M A;  3QSS A;  3AE8 A;  2XYO A;  3CGC A;  4C5O A;  3NLC A;  4N9X A;  4H4R A;  4OPU A;  3PVC A;  5ER0 A;  4F4R A;  5CKU A;  1IUV A;  4DYE A;  1NEN A;  3UXK A;  4CNK A;  1GTH A;  3ALJ A;  2HNE A;  1JDF A;  4GGH A;  2AL2 A;  3G5Q A;  3SYI A;  3AE9 A;  4ZCW A;  2IID A;  3NVW B;  3UKH A;  2E5V A;  1KSU A;  5FS6 A;  2PU1 A;  1W6T A;  5FS7 A;  3HYV A;  4JNA A;  1REO A;  3OW1 A;  2PTZ A;  1N4V A;  2GGE A;  2ZZC A;  2PYX A;  2JB3 A;  4YTP A;  1TKK A;  2MUC A;  4DN1 A;  1BKW A;  1CJ4 A;  1H83 A;  4EMJ A;  3MSY A;  3T4W A;  2B76 A;  2PP1 A;  4IL2 A;  3ICS A;  4YXD A;  2OQY A;  1H82 A;  3NN6 X;  1M6I A;  3AE5 A;  2GV8 A;  2GMH A;  1BF3 A;  1DJN A;  2JB1 A;  2B9X A;  3AED A;  4A5L A;  2V60 A;  5EU9 A;  4LA1 A;  2R0G A;  4I59 A;  1NHQ A;  4YTM A;  2YM2 A;  2YLS A;  2VRM A;  3C96 A;  1D7L A;  4H4S A;  2AQJ A;  3FJ4 A;  3PWG A;  3EAO A;  4Z2R A;  3ADA B;  3UOZ A;  3SFE A;  3CNT A;  2B9W A;  1Q1W A;  3WE0 A;  1F9C A;  1FEC A;  3EKG A;  2C3C A;  3TWB A;  3UJF A;  5KMR A;  2XH0 A;  4H4Q A;  4ZN0 A;  1MXT A;  1P2E A;  1SEZ A;  1JCT A;  1V97 A;  2GAH B;  3UCL A;  2PS2 A;  3UP5 A;  2W3R A;  4GGB A;  2PHH A;  2OKT A;  4Z43 A;  3TWA A;  2ARD A;  3IJI A;  2C75 A;  2ZC8 A;  3AYJ A;  2WHD A;  1YQ4 A;  2X8H A;  1NEK A;  2R4J A;  2POZ A;  3L1R A;  3QVR A;  1DOB A;  4B63 A;  5KRQ A;  4H2P A;  2R46 A;  3QJ4 A;  3C4N A;  3D8X A;  3T31 A;  3NFU A;  3OZY A;  4TLX A;  4YTN A;  3CNJ A;  4BV6 A;  3ZVH A;  1DNC A;  4KPR A;  1YKJ A;  3NRN A;  5KVH A;  3NG7 X;  4ECH A;  3GWF A;  4ROP A;  2I5Q A;  1IUW A;  2GEW A;  3CGD A;  2E4G A;  4HA6 A;  2YG4 A;  4GRT A;  4ADW A;  3UKP A;  1B37 A;  4IP4 A;  3S47 A;  4H83 A;  1E9I A;  1ZOV A;  3NGC X;  1RM6 B;  3ICT A;  1X2H A;  3P4R A;  4J36 A;  1QJD A;  1JNZ A;  3AE6 A;  1O94 A;  2O56 A;  4HNL A;  1ZMD A;  3P4P A;  4D04 A;  5JCN A;  3H8I A;  3I6E A;  2CDU A;  1ELS A;  2GF3 A;  5JCL A;  4HCL A;  5JCM A;  2XFQ A;  1M64 A;  2AAQ A;  4E5T A;  1H84 A;  5HY5 A;  1CJ3 A;  1IUU A;  1D5T A;  3DME A;  1ZXI C;  4EQS A;  3BJS A;  3DG6 A;  3UKA A;  3DJG X;  1PHH A;  3BI4 A;  3AYI A;  2BYB A;  1PJ6 A;  3DG3 A;  4C74 A;  3VCN A;  3MUC A;  2WU2 A;  2NPX A;  3K30 A;  3V5F A;  2V3A A;  2QA2 A;  2FKP A;  3CGE A;  1KDG A;  1FIQ B;  3HW2 A;  3ES8 A;  2ACZ A;  4K2X A;  4MMW A;  3UOY A;  4IT1 A;  3ABV A;  3CMM A;  2GGG A;  1D4C A;  1KSS A;  4H4Y A;  1H2I A;  1L9C A;  4B66 A;  2I0Z A;  3SXI A;  4K8G A;  4U2L A;  1N62 C;  4OPG A;  4A79 A;  1B4V A;  2OFJ A;  1SJA A;  1F8W A;  3V3W A;  2QQ6 A;  3RHA A;  3RP6 A;  2J3N A;  3PK7 A;  3F8P A;  2C4C A;  3GRS A;  3VDG A;  2R0C A;  2GR3 A;  2C3D A;  4HYR A;  3AB1 A;  4E6M A;  2OO6 A;  2R9Z A;  4U2T A;  1YQ3 A;  2EQ9 A;  5KMS A;  4APN A;  2AL2 B;  1LQT A;  5C3J A;  4E4U A;  2HXT A;  1QLB A;  5KOX A;  3CXB A;  2IVE A;  3AEC A;  1QO8 A;  3F8R A;  3SZF A;  1SJB A;  1GRH A;  4WX1 A;  4LU6 A;  4U8J A;  3GD6 A;  3ICR A;  4H2N A;  3VRB A;  2MNR A;  1Y0P A;  1NG4 A;  4G74 A;  3VR9 A;  1JU2 A;  4G9K A;  5JRB A;  2PP0 A;  3P0W A;  2WOW A;  1OJT A;  2VVM A;  2QVH A;  1ZOY A;  1MRA A;  4D03 A;  2HZG A;  1ZMC A;  1TDN A;  4BJZ A;  4TM3 A;  3ZLG A;  1TDE A;  2O9Z A;  1MNS A;  3QSE A;  4O5U A;  3CNP A;  1VDV A;  1IYX A;  2P8C A;  4GAV A;  1JPM A;  3RRA A;  3IHM A;  1GES A;  3EAN A;  1GXF A;  5GRT A;  3DGZ A;  4AT2 A;  2C7G A;  2GR2 A;  3T9P A;  1EBG A;  2YLT A;  3NVZ B;  3QFB A;  3T8Q A;  2GR0 A;  3S5S A;  4YWS A;  3Q6J A;  2OA1 A;  5BOE A;  1FOH A;  4E0V A;  2H89 A;  3SM8 A;  3RP8 A;  2JK6 A;  4YKG A;  2GB0 A;  3JVA A;  2ZZ0 A;  3LXD A;  3QSM A;  4GUV A;  2YWL A;  2W55 A;  4BJY A;  2PTY A;  3MWC A;  1PS9 A;  3FXG A;  2V3B A;  3AM9 A;  4YWO A;  1PBF A;  2GL5 A;  3NT6 A;  3UGV A;  1GTE A;  7ENL A;  2VZ2 A;  4H19 A;  4PAB A;  3SZW A;  3NYC A;  3ES7 A;  3NH3 X;  3R0K A;  3RGT A;  1TYP A;  2JAE A;  2BAB A;  2QJJ A;  2JBV A;  2WES A;  5FS9 A;  2Y6R A;  5EOW A;  3AD8 B; 
#chains in the Genus database with same CATH homology
 1NHR A;  3NN0 X;  4Y4L A;  1LQU A;  3KPK A;  2VRL A;  1GRB A;  2YLS A;  4UDR A;  2E1M A;  2XLU A;  2VRM A;  1BZL A;  3HYX A;  3C96 A;  1D7L A;  4H4S A;  3EF6 A;  2AQJ A;  3DJE A;  3I6D A;  1H7X A;  3S61 A;  2CFY A;  3EAO A;  4Z2R A;  3ADA B;  3UOZ A;  2B7R A;  2GQW A;  3GD4 A;  1K0L A;  3LOV A;  5M0Z A;  3SFE A;  3CNS A;  3CNT A;  5KWF A;  4NEW A;  2B9W A;  1S7M A;  1Q1W A;  2VVL G;  5KMQ A;  3WE0 A;  1FEC A;  3HZL A;  1N1P A;  1KF6 A;  2BRY A;  2C3C A;  1E1N A;  1PDH A;  2YG5 A;  4GCM A;  2BK5 A;  2C65 A;  5KMR A;  4U8P A;  4CRT A;  4J33 A;  4B65 A;  3DJD A;  4H4Q A;  1LTX R;  3D9X A;  4ZN0 A;  1MXT A;  1P2E A;  1SEZ A;  4IV9 A;  4H4T A;  1JRZ A;  2WET A;  4LII A;  2GAH B;  4H7U A;  1VG0 A;  1GOS A;  3GMB A;  2CVJ A;  3UKL A;  3UCL A;  1CF3 A;  2VQB A;  3RP7 A;  3UP5 A;  3P9U A;  2B7S A;  4WCT A;  1ZY8 A;  1IJH A;  2YG7 A;  2PHH A;  1TDO A;  1F3P A;  4EQX A;  1S3B A;  2DKH A;  3AEB A;  3IWA A;  4GDE A;  4K5S A;  4YTM A;  4Z43 A;  2XVH A;  1KNP A;  3BNM A;  2XDO A;  3NYE A;  4H4Z A;  3DK8 A;  4J31 A;  5U1O A;  1H7W A;  2ARD A;  3RNM A;  1PXB A;  4CY6 A;  2FBW A;  3DH9 A;  2C75 A;  2WU5 A;  4HB9 A;  2IVD A;  1KN0 A;  1ZK7 A;  3AYJ A;  1H86 A;  2YAU A;  2YR4 A;  3NKS A;  3VQR A;  4AP3 A;  4CBQ A;  1MO9 A;  1GAL A;  2WHD A;  4TM4 A;  4JY3 A;  1JRY A;  1Y56 B;  1YQ4 A;  2C67 A;  2X8H A;  3CGB A;  1CHU A;  1NEK A;  2BAC A;  1K4Q A;  4BK1 A;  1GSN A;  3T2K A;  1S3E A;  1VQW A;  3LZX A;  2R4J A;  3LAD A;  3BI2 A;  3L1R A;  2C72 A;  1DOB A;  3L8K A;  3QVR A;  4UP3 A;  4B63 A;  3AYL A;  5KRQ A;  4H2P A;  1H6V A;  3H8L A;  3LJP A;  5KNL A;  2R46 A;  2BK3 A;  4EQR A;  2BS3 A;  3QJ4 A;  3FPZ A;  4JQ9 A;  1PN0 A;  2BS4 A;  2XFP A;  3C4N A;  2YLW A;  1ZKQ A;  1LJ1 A;  1PJ5 A;  3SY4 A;  4Z26 A;  2C66 A;  5KXJ A;  2V6O A;  1L0V A;  3NK2 X;  1YY5 A;  3D8X A;  3T31 A;  1OJD A;  2Q6U A;  2XCG A;  5EB5 A;  4TLX A;  4YTN A;  3CNJ A;  4BV6 A;  4U8I A;  1OJ9 A;  1Z6L A;  1DNC A;  4JDR A;  2XVI A;  4K8D A;  2QA1 A;  5BRT A;  1B8S A;  3C4A A;  2XFN A;  3GDP A;  1EL7 A;  1FL2 A;  4KPR A;  3BHF A;  2X50 A;  4BK2 A;  1YKJ A;  4K22 A;  4CCR A;  3NRN A;  3T2Y A;  5KVH A;  4USR A;  3ZYX A;  2BA9 A;  4A99 A;  3DA1 A;  4JNQ A;  3NG7 X;  3GRT A;  2R0P A;  5KVI A;  3UTF A;  4ECH A;  3GWF A;  3LZW A;  2V5Z A;  1IUW A;  1PJ7 A;  5JCI A;  2GEW A;  5M10 A;  4U8M A;  3K7M X;  3CGD A;  2E4G A;  5IPY A;  4NNJ A;  4HA6 A;  3GMC A;  2YG4 A;  1NG3 A;  4GRT A;  4ADW A;  2R45 A;  3UKP A;  1UKV G;  1B37 A;  4EIQ A;  4K7Z A;  3SGL A;  5IQ4 A;  4FX9 A;  4RG4 A;  1CBO A;  3OC4 A;  1BGJ A;  1ZOV A;  3NGC X;  4RSL A;  4IVO B;  3ICT A;  3KPF A;  2WDR A;  1VRQ B;  4TLZ A;  3GYX A;  4AOS A;  1D7Y A;  4UDQ A;  3AD9 B;  3P4R A;  4J36 A;  4NEV A;  1QJD A;  4XWZ A;  1NAA A;  4B64 A;  3QFA A;  2WOI A;  1JNZ A;  2RGJ A;  3OZ2 A;  4NZH A;  5C2T A;  3AE6 A;  2YG3 A;  4X9N A;  1O94 A;  5HXI A;  3CTY A;  4YKF A;  3K7Q X;  1COY A;  3KD9 A;  1OJC A;  4G73 A;  2FJB A;  3UP4 A;  3ZDN A;  1EL8 A;  2B9Y A;  4IA6 A;  2WEU A;  1ZMD A;  2YVF A;  2A87 A;  1DJQ A;  4MJW A;  3P4P A;  4H50 A;  2OLN A;  4H4W A;  3M12 A;  3FMW A;  4GDP A;  3LB8 A;  4D04 A;  1BWC A;  1JOA A;  3P1W A;  3L5O A;  2GVC A;  4U8L A;  4NTD A;  5JCN A;  3H8I A;  1XDI A;  3GD3 A;  2ZBW A;  4YSH A;  3FG2 P;  2CDU A;  2GF3 A;  5JCL A;  3K7T A;  4U8N A;  5JCM A;  4ZCD A;  2XFQ A;  2BC0 A;  1DXL A;  2HQM A;  1M64 A;  2AAQ A;  1XAN A;  1XHC A;  3VRA A;  2WOV A;  1H84 A;  5U63 A;  5HY5 A;  2WP5 A;  1DOE A;  1CJ3 A;  1K0J A;  3FIM B;  2W0H A;  1IUU A;  3IHG A;  4YSY A;  1D5T A;  1GV4 A;  1RP0 A;  1JRX A;  3DME A;  4Z24 A;  1D4D A;  2XFU A;  2TPR A;  1GRG A;  4EM4 A;  4EQS A;  1IUS A;  1IUT A;  1N4U A;  2VQ7 A;  2Z5X A;  3GSI A;  3QVP A;  3SZC A;  3VR8 A;  3H4K A;  5J60 A;  3M0O A;  4FK1 A;  1LVL A;  4JY2 A;  2WPE A;  3CIR A;  5GSN A;  3UKA A;  3DJG X;  2GR1 A;  1PHH A;  3BI4 A;  3AYI A;  4TM1 A;  2BYB A;  3ATR A;  3O0H A;  1N4W A;  1PJ6 A;  4C77 A;  1RSG A;  4H2R A;  1CC6 A;  5FMH A;  3PO7 A;  1Q1R A;  4C74 A;  1P2H A;  3V3O A;  2A89 A;  2WU2 A;  1XPQ A;  2YR5 A;  3CND A;  4Y4N A;  4YT0 A;  3T37 A;  2X99 A;  2NPX A;  1D4E A;  3K30 A;  4A6N A;  2V3A A;  2XLR A;  2QA2 A;  3KVE A;  3CGE A;  1KDG A;  4AT0 A;  2EQ7 A;  1GEU A;  1NDA A;  4OPI A;  4J2W A;  3NK1 X;  4YSZ A;  3PS9 A;  2WPC A;  2ACZ A;  2R4E A;  3NYF A;  4K2X A;  4A9W A;  1CC4 A;  1TYT A;  3ITJ A;  4Z44 A;  2WS3 A;  3IC9 A;  2VVL A;  2YQU A;  3SZ0 A;  2BRA A;  3UTG A;  1F8R A;  1TRB A;  3UOY A;  3ABV A;  3CMM A;  3BNU A;  4AP1 A;  1PBD A;  1BGN A;  1KNR A;  4XXG A;  4KX6 A;  1GER A;  1D4C A;  4B69 A;  1KSS A;  3CPI G;  4H4Y A;  3BI5 A;  4IA5 A;  3AD7 B;  4NTE A;  1H2I A;  1HYU A;  3V3N A;  1L9C A;  1JEH A;  1GPE A;  3NTD A;  4NWZ A;  4EQW A;  3AE4 A;  2I0Z A;  4B66 A;  4DSG A;  4G6H A;  3EPT A;  3NK0 X;  3Q9T A;  4OPD A;  2YLR A;  3SXI A;  2OAL A;  2BC1 A;  5EBK A;  2BXS A;  4BUR A;  4U2L A;  4OPC A;  1LV0 A;  2X3N A;  4PAA A;  1ONF A;  4OPG A;  4A7A A;  1K0I A;  4K5R A;  4A79 A;  1CL0 A;  1JNR A;  1B4V A;  3AE3 A;  3P4S A;  4II3 A;  1H81 A;  3NIX A;  4O5Q A;  4Z25 A;  2UZZ A;  4EM3 A;  1F8W A;  3NTA A;  1MOK A;  2APG A;  3RHA A;  4C5O A;  1VG9 A;  3RP6 A;  2J3N A;  4A65 A;  2QAE A;  1PBE A;  3F8P A;  1TDF A;  1L9D A;  2C4C A;  3ISH A;  3GRS A;  3PG6 A;  2R0C A;  1X31 B;  3AEF A;  3CPJ G;  4CCQ A;  4OCG A;  2GR3 A;  1GT8 A;  2CUL A;  2C3D A;  4X4J A;  1S2Q A;  2WP6 A;  3AB1 A;  5HYM A;  4C3Y A;  3UKF A;  4GR1 A;  2RAB A;  2R9Z A;  2XLP A;  3ALM A;  4U2T A;  3DK4 A;  1YQ3 A;  2EQ9 A;  2Q0L A;  2FJD A;  4CY8 A;  2XVE A;  5KMP A;  5KMS A;  1KFY A;  4U8K A;  5BVA A;  1GRA A;  3NHO X;  4APN A;  3G5R A;  4J34 A;  3IF9 A;  3KA7 A;  1DOD A;  2QCU A;  1LQT A;  4Z2T A;  5BUL A;  1NPX A;  4UDP A;  3VRD B;  5C3J A;  4TM0 A;  3HYW A;  3UKQ A;  3ATQ A;  1PXA A;  4B1B A;  4H4V A;  1QLB A;  4FK1 C;  1PBB A;  5BUK A;  1O5W A;  3S5W A;  5KOX A;  2XLT A;  3DK9 A;  4M52 A;  1O95 A;  1RYI A;  3SX6 A;  2Z5Y A;  4OPL A;  2IVE A;  3AEC A;  3T0K A;  1QO8 A;  2H88 A;  2OAM A;  3P4Q A;  1E7P A;  3F8R A;  1L9E A;  3AXB A;  2FJE A;  3SZF A;  4GF7 A;  2Y6Q A;  1GRH A;  2TMD A;  4B68 A;  1ZX9 A;  1AOG A;  1E6E A;  4U2S A;  4ICY A;  1FEA A;  3UOV A;  5LV9 A;  4WX1 A;  4LU6 A;  4U8J A;  3B6D A;  3CN8 A;  3II4 A;  2V61 A;  4JN9 A;  3ICR A;  4H4U A;  5J7X A;  2JKC A;  3RED A;  3AE7 A;  3JSK A;  1DOC A;  4H2N A;  1E1L A;  4EMI A;  3I3L A;  3VRB A;  1EBD A;  1CC2 A;  1FEB A;  4P9S A;  2YVJ A;  1YQZ A;  3URH A;  1Y0P A;  1CJ2 A;  2GAG B;  2YM1 A;  3CPH G;  4RG3 A;  1PBC A;  5EB4 A;  1NG4 A;  4G74 A;  3VR9 A;  4J57 A;  3M13 A;  4OPT A;  2YLX A;  1GRF A;  5L46 A;  1JU2 A;  2RGH A;  4G9K A;  4FDC B;  5JRB A;  4H4P A;  4GAP A;  1LPF A;  2WOW A;  1OJT A;  2XVF A;  1GND A;  2F5Z A;  2VVM A;  3SQP A;  5TR3 A;  5HHF A;  1ZOY A;  4G6G A;  4D03 A;  1ZMC A;  1TDN A;  2XLS A;  3KKJ A;  2AR8 A;  2YG6 A;  3AE2 A;  4YSX A;  5FS8 A;  3V76 A;  4C3X A;  2OLO A;  4BJZ A;  3UOX A;  3COX A;  4TM3 A;  1TDE A;  4REK A;  3UTE A;  3D1C A;  2O9Z A;  2VOU A;  3QSE A;  1ELI A;  3GYJ A;  4O5U A;  3CNP A;  2C76 A;  3GYI A;  2NVK X;  4Y4M A;  3QSS A;  4EMW A;  3AE8 A;  3KLJ A;  5U25 A;  3GWD A;  2XYO A;  4U8O A;  1F8S A;  3CGC A;  3DJJ A;  1F6M A;  1S2Y A;  1ZP0 A;  1TDK A;  3ALL A;  3NLC A;  4H4R A;  4GAV A;  4N9X A;  4OPU A;  3PVC A;  5ER0 A;  2BCG G;  3IHM A;  5CKU A;  1IUV A;  1NEN A;  2WPF A;  1Q9I A;  4CNJ A;  4CNK A;  1GES A;  4H2Q A;  4X9M A;  3EAN A;  1GXF A;  2ZZB A;  5GRT A;  2GH5 A;  4OVI A;  2BS2 A;  2WP9 A;  3DGZ A;  2WDQ A;  2EQ8 A;  2C7G A;  4AT2 A;  2GR2 A;  1GTH A;  2GRT A;  3ALJ A;  3KU9 A;  1GET A;  4XWR A;  4II2 A;  1E1K A;  1PXC A;  5KOW A;  1E39 A;  5CQF A;  2BK4 A;  2A8X A;  2WDV A;  2YLT A;  1Y56 A;  2DKI A;  1ZDL A;  3G5Q A;  3QFB A;  3SYI A;  3AE9 A;  2GR0 A;  2IID A;  3SFD A;  3UKH A;  1E1M A;  2E5V A;  3Q6J A;  2X8G A;  1NHP A;  2OA1 A;  1FCD A;  2GQF A;  2C73 A;  2RGO A;  3UTH A;  1FOH A;  4E0V A;  2H89 A;  1KSU A;  4IVM B;  1V59 A;  1NHS A;  5FS6 A;  3SM8 A;  3AE1 A;  2X8C A;  3RP8 A;  1GRT A;  2JB2 A;  5FS7 A;  3HYV A;  3T2Z A;  2JK6 A;  2XVJ A;  4JNA A;  4YKG A;  1REO A;  2GB0 A;  1OJA A;  4NTC A;  1N4V A;  3DGH A;  2ZZ0 A;  4DSH A;  3LXD A;  3QSM A;  4GUV A;  2YWL A;  3FBS A;  3UKK A;  1VDC A;  2ZZC A;  2PYX A;  1EL5 A;  5JCK A;  2JB3 A;  4YTP A;  5DBJ A;  2YR6 A;  1B5Q A;  4BJY A;  4EIP A;  2BCP A;  1CJ4 A;  1BKW A;  1H83 A;  4USQ A;  4EMJ A;  4B67 A;  4DGK A;  1PS9 A;  3AEA A;  4ZCC A;  2V3B A;  4YWO A;  2FJA A;  1PBF A;  2B76 A;  2GMJ A;  2YLZ A;  1W4X A;  2YVG A;  3F8D A;  3NT6 A;  4DNA A;  2WQY A;  1GTE A;  2VZ2 A;  3ICS A;  5IQ1 A;  4YXD A;  1GRE A;  1EL9 A;  1H82 A;  3NN6 X;  1M6I A;  4H4X A;  4A6N B;  3AE5 A;  4BK3 A;  1IUX A;  2GMH A;  2GV8 A;  4PAB A;  3B3R A;  1BF3 A;  3SZW A;  1DJN A;  3GDN A;  3NYC A;  3AEE A;  2BXR A;  3R9U A;  2JB1 A;  2B9X A;  3AED A;  3NH3 X;  4A5L A;  4Z2U A;  4I58 A;  1CJC A;  3AWI A;  2V60 A;  4LA1 A;  2R0G A;  1TYP A;  2Q7V A;  2JAE A;  2BAB A;  2C64 A;  4I59 A;  2C70 A;  3E1T A;  4AOX A;  2JBV A;  3AEG A;  3BHK A;  1NHQ A;  2EQ6 A;  2Q0K A;  5FS9 A;  2WES A;  3NNE A;  3T14 A;  2Y6R A;  5EOW A;  4J56 A;  3G5S A;  2XFO A;  3AD8 B;  2YM2 A;  2WBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...