3KLJA

Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
378
structure length
378
Chain Sequence
KSTKILILGAGPAGFSAAKAALGKCDDITMINSEKYLPYYRPRLNEIIAKNKSIDDILIKKNDWYEKNNIKVITSEFATSIDPNNKLVTLKSGEKIKYEKLIIASGSIANKIKVPHADEIFSLYSYDDALKIKDECKNKGKAFIIGGGILGIELAQAIIDSGTPASIGIILEYPLERQLDRDGGLFLKDKLDRLGIKIYTNSNFEEMGDLIRSSCVITAVGVKPNLDFIKDTEIASKRGILVNDHMETSIKDIYACGDVAEFYGKNPGLINIANKQGEVAGLNACGEDASYSEIIPSPILKVSGISIISCGDIENNKPSKVFRSTQEDKYIVCMLKENKIDAAAVIGDVSLGTKLKKAIDSSKSFDNISSLDAILNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD(FAD)-dependent dehydrogenase, NirB-family (N-terminal do
publication title Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
pubmed doi rcsb
source organism Clostridium acetobutylicum
total genus 117
structure length 378
sequence length 378
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18267 Rubredoxin_C Rubredoxin NAD+ reductase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3kljA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA02
1VDCA 3NN0X 4LU6A 1AOGA 3DGZA 3NNEA 4U2LA 1P2HA 1PHHA 4Z43A 1YY5A 3NTDA 2CVJA 1LV0A 4YT0A 3V76A 4LIIA 3AB1A 5KVIA 4CBQA 1O95A 3LADA 1GRFA 3PS9A 2BCGG 3AE2A 1Y0PA 3UKAA 3CPHG 3S5WA 4B64A 1PN0A 4A6NA 4YTPA 4BURA 2YVGA 2GQFA 2JKCA 3G5QA 4U8NA 1ZMCA 3CNTA 3UTGA 2X8HA 1XDIA 1E1KA 4XWRA 4RG3A 3FBSA 3AD7B 1DXLA 1GRTA 1ZKQA 3CNJA 2BYBA 3RP7A 2XVIA 5J60A 5EOWA 2RGHA 2XFUA 5J7XA 1EL8A 1BGNA 3VRAA 4B63A 1CL0A 3GDPA 4OPCA 1LQUA 2B76A 3P9UA 4TM0A 3V3OA 2V6OA 2YR4A 2YVFA 1K0LA 1ZOVA 4ECHA 3PVCA 2JB3A 2BCPA 1CC4A 3IF9A 4ZN0A 2R46A 3VQRA 1OJTA 3IC9A 1H7WA 3B3RA 1GALA 1PBCA 1H84A 1PJ5A 1CC6A 4JNAA 2WOWA 4KX6A 2BK3A 4EIQA 1EBDA 4RG4A 2Z5XA 3KVEA 1D4CA 3H8IA 5BUKA 2WESA 4H2PA 1CC2A 1E6EA 3UKHA 4H2NA 1D5TA 1O5WA 3F8RA 1JOAA 5GRTA 4K5SA 3K7MX 1H83A 2BACA 1Y56A 4BK1A 4RSLA 2GR3A 3GD4A 1FOHA 4J2WA 5L46A 1H6VA 2IIDA 3ALLA 3GDNA 3UTHA 1ELIA 1M6IA 2XFNA 3AYJA 3GYJA 4TM3A 3S61A 1MXTA 4H2RA 3ALJA 3BNMA 3UOXA 4GF7A 2WPFA 3EANA 4H4VA 1Q9IA 1S2YA 2B9WA 2E1MA 3ICSA 4AP1A 3Q9TA 3DK8A 3AD9B 1GOSA 1LJ1A 5CQFA 1OJCA 3NHOX 4O5UA 3UTFA 3NIXA 4YSHA 2VZ2A 4C5OA 2EQ8A 4REKA 2XLTA 4AOSA 1CJ4A 3GD3A 3R9UA 4M52A 1GT8A 4CCQA 2FJDA 5C3JA 2GRTA 2XLRA 1N4UA 2WDQA 5JCMA 2X3NA 2X99A 2J3NA 2I0ZA 2A87A 4CCRA 3PO7A 3F8PA 2FJBA 3DJEA 2YM1A 1RYIA 3AXBA 3AYIA 2TMDA 2QA2A 3UKLA 1KSUA 1ZK7A 1LQTA 1B4VA 5BRTA 1NHPA 3ATQA 2GR2A 3COXA 5U25A 3D8XA 4BK3A 1FECA 5KOXA 1M64A 1KSSA 3KD9A 3QFAA 3NK1X 4Z25A 5IQ4A 3LOVA 2JAEA 3FMWA 1ZX9A 4Z24A 3P4QA 1COYA 3F8DA 4H4PA 2YQUA 2OLOA 2YG3A 3NK2X 3CIRA 3EF6A 1K0IA 4B69A 4Z2TA 4GDPA 3IWAA 4U8KA 2JB2A 3AE9A 4PAAA 1S2QA 5KXJA 3H4KA 3AE7A 4HB9A 3RP8A 2YVJA 4E0VA 2PHHA 4A9WA 1ZOYA 1JEHA 1CBOA 3H8LA 3I6DA 3AE6A 2JK6A 4J57A 1CJ3A 2R4EA 4CRTA 4OVIA 2C72A 4H4TA 2C70A 3BI5A 3NYEA 4EM3A 2GEWA 4U8JA 3NN6X 4IA6A 2X8GA 2ZZCA 4FDCB 2YLTA 3AE4A 1DODA 2IVEA 1IUUA 3ATRA 2WPEA 3ZYXA 4A6NB 4AOXA 2C3DA 2R0GA 2YLSA 2XLSA 4UP3A 4C3YA 3AECA 5IQ1A 1BKWA 5KOWA 1NHSA 4Y4NA 4U2SA 4CNKA 2VVLG 4U8PA 2RGJA 1ONFA 4H4QA 1REOA 3DMEA 4IA5A 4NZHA 3UKPA 1IUXA 2GF3A 3HZLA 2VQBA 4U8LA 1QLBA 2QCUA 2R4JA 4K7ZA 3E1TA 2BXSA 4K22A 3RHAA 4AT0A 1JRXA 1PBEA 2WDVA 2YWLA 1OJDA 1S3BA 1IJHA 4A79A 1TDKA 4N9XA 4FK1C 1JNZA 1B37A 4O5QA 2GH5A 3DH9A 2Z5YA 3REDA 4NEWA 2Y6QA 3M13A 5HXIA 1X31B 1TYPA 1YQ4A 2Q7VA 4MJWA 4WCTA 2A8XA 3OZ2A 2V60A 3NG7X 1YKJA 4Y4MA 2QA1A 3UOVA 1JU2A 1Q1RA 4C74A 1E1MA 3UTEA 4YSYA 2WP5A 3BI2A 4GUVA 1Y56B 1KNRA 1NDAA 2WEUA 4XWZA 1MOKA 4CY6A 1V59A 1NAAA 4NTCA 2YLZA 1GRAA 2Q0LA 4EQWA 2IVDA 4EMJA 3LJPA 4LA1A 3AEBA 1L9CA 2B9YA 4TLXA 4U8IA 2VRMA 4WX1A 2X50A 3NLCA 3Q6JA 3VR8A 4CNJA 2ARDA 4YSZA 2BS4A 1H86A 1HYUA 1NG3A 5BULA 2FBWA 4FK1A 2ZZBA 1GTEA 2YR6A 3GWDA 2BABA 1B8SA 2WHDA 5C2TA 5LV9A 4GDEA 5EB4A 2YR5A 1JRYA 2AR8A 3KA7A 3C96A 2R9ZA 1XHCA 2BK5A 4H4ZA 1ZP0A 1CJCA 3ZDNA 3SFDA 4BV6A 3AEEA 1PJ7A 1DOCA 1XPQA 1D4EA 4H4YA 4FX9A 2XYOA 2WPCA 4EMIA 1F8WA 3FG2P 4H4WA 3RP6A 1KF6A 3C4NA 4EQSA 1BZLA 3M12A 3II4A 1QO8A 2WP9A 4YXDA 5KVHA 1S3EA 3BHKA 3GMCA 3IHGA 4HA6A 1ZDLA 2TPRA 3AWIA 1GV4A 5EBKA 3DJJA 3CNDA 3NRNA 3DGHA 3V3NA 1DOEA 1QJDA 3UP4A 1IUWA 2C75A 4A7AA 1BF3A 4YKFA 3JSKA 5EB5A 4JDRA 3IHMA 3QVRA 1KFYA 1H82A 1PDHA 2YG7A 4JNQA 2EQ9A 2RABA 4EM4A 5FMHA 2GMHA 3CPIG 2XFPA 4BK2A 2R45A 2E5VA 1L0VA 1L9EA 4H4UA 3UKKA 5JCNA 2EQ6A 2VRLA 4EIPA 5ER0A 1NHRA 1DJQA 4UDRA 3K30A 4OPLA 1NG4A 4TLZA 4NEVA 3L8KA 4NTEA 3KPFA 3AEAA 2Q6UA 1EL9A 1GSNA 3AE1A 1H7XA 1PBDA 4DSGA 1GPEA 3UOYA 1LPFA 3RNMA 1PBFA 2C3CA 4YWOA 4EQRA 1GRHA 3LZWA 1LTXR 4B67A 2H89A 2YLRA 4C3XA 3CGCA 4ICYA 4JN9A 3NTAA 1ZMDA 3KLJA 3CGBA 1E1NA 1PBBA 2C73A 1FEAA 2ACZA 2DKIA 4J56A 3GMBA 3K7QX 5FS7A 3NGCX 2JB1A 3QSEA 1DOBA 4Z26A 3CN8A 2YAUA 1PXAA 1VG0A 4BJZA 1PXCA 1E39A 3GSIA 1F8SA 1TRBA 3G5RA 4IVOB 2Q0KA 5KRQA 3AE3A 4IVMB 4YKGA 4IV9A 3SQPA 2V3AA 2A89A 4I59A 3P4PA 2ZZ0A 1TDFA 3BNUA 2BC0A 2WETA 1N1PA 1RP0A 2GR1A 4B65A 4J36A 1DNCA 4AP3A 2B7RA 4H2QA 3GRTA 4P9SA 1L9DA 3GWFA 2BXRA 1FCDA 1YQZA 2H88A 1EL7A 2GAGB 1B5QA 4CY8A 1FL2A 1DJNA 2GR0A 1NPXA 1KDGA 2APGA 1W4XA 4X4JA 4K2XA 4NTDA 4Z2UA 3WE0A 1CF3A 2V5ZA 3AD8B 2YLXA 4J31A 3SM8A 2UZZA 5JCIA 1PXBA 4ZCCA 4DNAA 3LZXA 1K4QA 2WU2A 3O0HA 1N4WA 3EPTA 4X9MA 4H50A 3KKJA 3EAOA 3ITJA 1D4DA 2CULA 3C4AA 5CKUA 1GRGA 1OJ9A 4KPRA 3AE8A 1F6MA 3NYFA 3CGDA 1XANA 2CFYA 1NENA 4D04A 5HYMA 2VVMA 4OPIA 3T37A 1VG9A 1YQ3A 2C7GA 1ZY8A 1D7LA 4Z2RA 1VQWA 3QSMA 4K5RA 4TM1A 1E7PA 1BWCA 5U1OA 3CNPA 3ABVA 3AEGA 3AYLA 3QFBA 3ALMA 4B68A 3GRSA 5M10A 3GYIA 5HY5A 2PYXA 2YG5A 1MO9A 3DJDA 1TDOA 2DKHA 2RGOA 4H4XA 3DA1A 1F3PA 1GEUA 3ICRA 4EQXA 2C76A 3I3LA 3QVPA 4A5LA 1JNRA 3NH3X 4OPDA 2B7SA 2E4GA 2R0CA 4AT2A 1GTHA 3BHFA 2C66A 4DSHA 3P4RA 2V3BA 2XVEA 2WS3A 2C67A 2OA1A 2B9XA 2FJAA 2GB0A 4XXGA 4YSXA 4YTMA 3UOZA 2O9ZA 1TDEA 3D1CA 4OPGA 5U63A 2QAEA 1D7YA 5FS9A 2R0PA 2WDRA 2Y6RA 1Z6LA 2ZBWA 4JQ9A 3UP5A 4UDPA 3VRBA 3KU9A 5DBJA 2GV8A 2GVCA 1TYTA 3G5SA 3B6DA 3DJGX 4H4SA 5FS8A 1LVLA 5FS6A 1Q1WA 1F8RA 2WBAA 4I58A 2V61A 4APNA 2NPXA 4U2TA 4B66A 2XLPA 3CGEA 2JBVA 1K0JA 4BJYA 4H7UA 2XFOA 3UCLA 2BC1A 2WQYA 5GSNA 1GXFA 2BK4A 1H81A 3ISHA 4JY2A 3P1WA 3AEDA 1IUSA 1TDNA 3LXDA 2VVLA 5BVAA 4U8MA 2C65A 2BS3A 3SGLA 3NK0X 5HHFA 2FJEA 3UKFA 5TR3A 2XLUA 1IUTA 4GCMA 3VR9A 1KNPA 1CJ2A 2C64A 4H4RA 1VRQB 3ICTA 3QJ4A 1FEBA 1GESA 5JCLA 4GR1A 2F5ZA 3DK9A 1NEKA 1SEZA 2YG4A 4UDQA 1OJAA 2NVKX 2XCGA 2W0HA 1EL5A 2XVFA 2XFQA 3QSSA 1PS9A 2WOIA 2GAHB 1UKVG 2YG6A 2AAQA 3LB8A 3SFEA 4C77A 4B1BA 1O94A 1GRBA 3CNSA 1P2EA 1JRZA 3NT6A 1NHQA 4DGKA 4ZCDA 2YM2A 5JCKA 4JY3A 2VOUA 1BGJA 3AE5A 4OPTA 4J34A 2GQWA 4USRA 4TM4A 3NYCA 2OALA 1GETA 1IUVA 2XVJA 3DK4A 2YLWA 1GNDA 3AEFA 3L1RA 2XVHA 4U8OA 5M0ZA 2WP6A 4D03A 2BA9A 2HQMA 1PJ6A 4Y4LA 2X8CA 4EMWA 2AQJA 2VQ7A 3CTYA 3FIMB 4USQA 2WOVA 4A65A 4ADWA 2OAMA 2CDUA 1N4VA 3CPJG 2BS2A 3P4SA 5KWFA 4YTNA 3ADAB 3UKQA 4A99A 4X9NA 3OC4A 1GERA 1CHUA 3K7TA 4Z44A 4GRTA 3NKSA 4OCGA 1E1LA 1RSGA 3FPZA 3URHA 2WU5A 2OLNA 1GREA 2EQ7A 2XDOA 3M0OA 4PABA 4K8DA 4OPUA 3VRDB 2GMJA 4J33A 3BI4A 5IPYA
chains in the Genus database with same CATH superfamily
1VDCA 4DHGA 1P2HA 1PHHA 1YY5A 3NTDA 3NVZB 3PK7A 1V97A 1O95A 1BKHA 2BCGG 3AE2A 1Y0PA 3CPHG 1PN0A 4A6NA 2YVGA 2OQYA 3UTGA 1E1KA 4GYPC 1GRTA 2XVIA 2XFUA 1EL8A 4OPCA 2B76A 2V6OA 2HXUA 2YVFA 3B9JB 2R46A 3SYIA 1EBGA 1H7WA 1H84A 4JNAA 2OO6A 5G5HB 4EIQA 1EBDA 1OEPA 2Z5XA 5BUKA 4H2PA 1E6EA 3NVWB 4H2NA 1D5TA 3K7MX 2FKPA 1FOHA 5L46A 1H6VA 2IIDA 3GDNA 1M6IA 3GYJA 3S61A 4H2RA 3BNMA 4DX3A 4H4VA 1S2YA 2B9WA 3ICSA 4FI4A 3N6HA 3Q9TA 3SY4A 3NHOX 3UTFA 3NIXA 2EQ8A 4AOSA 3GD3A 1R0MA 2GRTA 2WDQA 4CCRA 3DJEA 3DFYA 3UKLA 3SJNA 1ZK7A 4IZGA 1LQTA 3FXGA 1M64A 3QFAA 3NK1X 2JAEA 4Z24A 2YQUA 3NK2X 4J3ZA 3IWAA 4U8KA 3STPA 4HB9A 3RP8A 3PFRA 1JEHA 1CBOA 3I6DA 3AE6A 1CJ3A 4U8JA 3NN6X 4FDCB 3AE4A 4KT2A 3ZYXA 1DODA 4A6NB 2WPEA 2YLSA 4UP3A 2PU1A 5IQ1A 4Y4NA 2RGJA 1REOA 2VQBA 3E1TA 2BXSA 4K22A 1JRXA 1OJDA 1S3BA 2W3RA 3DH9A 2Z5YA 4NEWA 6ENLA 2V60A 1Q1RA 4II2A 4YSYA 2WEUA 2PA6A 1X2GA 2PCEA 3LJPA 4TLXA 4U8IA 1SJBA 3ZVHA 4TVYA 4WX1A 3NLCA 4G7FA 4CNJA 1H86A 4II3A 1NG3A 5BULA 4IP4A 2BABA 5C2TA 2PGWA 4GDEA 2AR8A 1T3QC 4HCLA 2R9ZA 4BV6A 1PJ7A 1DOCA 1F8WA 4H4WA 3ES7A 4EQSA 3M12A 3VC6A 3H7VA 3BHKA 3CNDA 3DGHA 3V3NA 3CT2A 4A7AA 2AL2A 5EB5A 2YG7A 4BK2A 4EM4A 1RM6B 3SXIA 4GGHA 3UKKA 1NHRA 1DJQA 3I6TA 3K30A 4TLZA 2Q6UA 1EL9A 1PBFA 4A35A 4YWOA 2OZTA 2YLRA 4JN9A 2C73A 3GMBA 1FEAA 5FS7A 2YAUA 3VCNA 1PXCA 4YKGA 1TDFA 3BNUA 4J1OA 3R1ZA 4M0XA 3NRZB 3D46A 3RRAA 1PDYA 3DFHA 3GRTA 3GWFA 3T2ZA 1JROA 3ZVHB 4CY8A 1DJNA 1FHVA 1FO4A 1ZXIC 4J31A 4IP5A 1PXBA 2WU2A 5CKUA 3TWBA 1OJ9A 3NYFA 3CGDA 1XANA 4D04A 1SJDA 2VVMA 3T37A 1JPDX 3A7RA 1VG9A 4KEMA 1VQWA 4K5RA 3ALMA 4B68A 1FFUC 2PYXA 2ZC8A 3DJDA 2AL2B 2DKHA 4H4XA 1F3PA 1GEUA 3ICRA 3QVPA 1JNRA 4OPDA 3BHFA 4DSHA 3P4RA 3IJQA 2OA1A 3IJLA 1TDEA 5U63A 2QAEA 2R0PA 3N6JA 5DBJA 2PMQA 4H4SA 1LVLA 5FS6A 4I58A 2V61A 4B66A 4A6GA 2XFOA 2WQYA 1SB3B 3MKCA 3AEDA 3SGLA 3SZCA 3Q45A 1IUTA 4GCMA 1KNPA 2C64A 5JCLA 4GR1A 2YG4A 3DK9A 4YWSA 2XVFA 2QJNA 2GAHB 1UKVG 2YG6A 3LB8A 3RITA 1O94A 4B1BA 1GRBA 1P2EA 1N61C 2W55A 4DGKA 5JCKA 3V5CA 4USRA 2GQWA 4TM4A 3NYCA 1GETA 1IUVA 3DK4A 2BA9A 2HQMA 1SJCA 1PJ6A 1TKKA 2X8CA 4EMWA 2VQ7A 2WOVA 2CDUA 2BS2A 4YTNA 3OC4A 4OCGA 3NVVB 1E1LA 1RSGA 2WU5A 4PABA 4K8DA 3VRDB 4HPNA 2BRAA 4J33A 5IPYA 3HYXA 3DGZA 1VDVA 4LIIA 4CBQA 3PS9A 3TTEA 1NU5A 3ES8A 2GQFA 4EWJA 3CNTA 5BOEA 3CXOA 3FBSA 3SZWA 3CNJA 2BYBA 1JPMA 2P8BA 5EOWA 2RGHA 3VRAA 4B63A 1LQUA 4TM0A 3PVCA 2BCPA 1EBHA 1KN0A 1IYXA 1PJ5A 4HN8A 3QPEA 4MKSA 5FJRA 1O5WA 3F8RA 3CB3A 2BACA 2QGYA 5KMPA 3H12A 3SN1A 1TZZA 2GR3A 4RSLA 3GD4A 1MRAA 3UTHA 3BSMA 4TM3A 3DG7A 3S47A 4AP1A 1LJ1A 5CQFA 4YSHA 4C5OA 4M6UA 2XLTA 2FJDA 1N4UA 2X99A 2I0ZA 2A87A 4GFIA 3UJEA 3PO7A 1KCZA 2YM1A 1RYIA 3AXBA 2TMDA 2QA2A 1KSUA 1NHPA 3COXA 3GY1A 5U25A 3D9XA 5IQ4A 3FYYA 3LOVA 3SSZA 2P88A 1KD0A 4IL0A 4H4PA 4B69A 4IHCA 3K1GA 3R10A 3AE9A 5KXJA 1S2QA 1EC8A 5KMRA 1ELSA 4ROPA 4E0VA 1ZOYA 3CXBA 3H8LA 3HYWA 3EEZA 3Q4DA 2JK6A 4J57A 4DXKA 2PP0A 1KKRA 3DDMA 2P3ZA 2ZZCA 1IUUA 4AOXA 1P48A 1JDFA 2XLSA 4U2SA 3UKPA 2C4CA 4NZHA 2GF3A 3HZLA 3IJIA 4U8LA 2QCUA 4AT0A 2WDVA 2YWLA 1IJHA 5G5GB 1TDKA 3T14A 1B37A 2GH5A 2PTWA 3M13A 5HXIA 3I4KA 4WCTA 3OZ2A 2E3TA 1JU2A 2WP5A 3P93A 4GUVA 3VC5A 1KNRA 4XWZA 4CY6A 4NTCA 3TQPA 1GRAA 4EQWA 4LA1A 3DGBA 2X50A 3Q6JA 2PODA 2FBWA 4FK1A 1GTEA 3GWDA 1JRYA 3KA7A 2BK5A 1XHCA 1RVKA 3SFDA 4IL2A 4FX9A 2XYOA 4EMIA 1KF6A 1X2HA 3II4A 3TW9A 2WP9A 4MGGA 1N60C 5EBKA 3UJFA 1DOEA 1IUWA 2C75A 4YKFA 1S7MA 1KFYA 3R0KA 2EQ9A 2RABA 3PWIA 1N5XA 3DESA 1L0VA 5JCNA 2EQ6A 2AKZA 4UDRA 3JVAA 4NTEA 3KPFA 1H7XA 1PBDA 4DSGA 3HRDC 3RNMA 4EQRA 1GRHA 2H89A 4C3XA 4ICYA 3NTAA 1ZMDA 1PBBA 3CGBA 2E5AA 1TRBA 1SJAA 4IVMB 1H2IA 3CAWA 2GGHA 2BC0A 3R11A 2WETA 4J36A 3T6CA 3SBFA 4AP3A 2B7RA 2OKTA 1EC7A 1FCDA 1YQZA 2H88A 3OP2A 4FP1A 1NPXA 2GGJA 7ENLA 4Z2UA 2OG9A 4ZCCA 1K4QA 4X9MA 4H50A 1D4DA 2CULA 1F6MA 3JW7A 3RO6A 2CFYA 3AMZA 2C7GA 1ZY8A 1D7LA 4Z2RA 4TM1A 5U1OA 3ABVA 3AEGA 3GRSA 5M10A 3V5FA 4EQXA 4A5LA 2R0CA 4NWZA 2C66A 2V3BA 2XVEA 3OZYA 2C67A 4XXGA 4YSXA 4YTMA 1FHUA 2O9ZA 1D7YA 5FS9A 2WDRA 2Y6RA 1Z6LA 3UP5A 3KU9A 3B6DA 3KUMA 2WBAA 4U2TA 2XLPA 3CGEA 1K0JA 4H7UA 3SQSA 3UCLA 2BC1A 4HYRA 1GXFA 3ZVIA 3ISHA 3BJSA 3MQTA 2BS3A 3NK0X 3A7AA 3UKFA 2XLUA 3VR9A 1CJ2A 1VRQB 2GGGA 3S5SA 1VQZA 1OJAA 1EL5A 1PS9A 4ZOHB 3SFEA 4C77A 1PDZA 4ZA0A 1YEYA 4JY3A 1BGJA 3AE5A 4J34A 3SN0A 1GNDA 2WP6A 4D03A 4Y4LA 4ADWA 2OAMA 3P4SA 3ZLFA 4ZCWA 3UKQA 4GRTA 2GGEA 1GREA 2XDOA 3M0OA 4GIRA 3AN1A 2GMJA 3BI4A 3R07C 4LU6A 3NNEA 4U2LA 4GAPA 4YT0A 3V76A 3AB1A 3LADA 2FYMA 2ZADA 1XPYA 3UKAA 3R25A 3GD6A 2GSHA 3ZLHA 3AD7B 2PP1A 3R0UA 1ZKQA 1CL0A 3GDPA 3V3OA 2PTXA 4ECHA 2AKMA 3IF9A 3VQRA 1OJTA 3IC9A 3B3RA 1CC6A 2WOWA 4KX6A 2WESA 1JOAA 1Y56A 4BK1A 1JRPA 3SZ0A 2QDEA 1ELIA 2XFNA 3UOXA 4GF7A 3EANA 3AD9B 1GOSA 1OJCA 4O5UA 3GC2A 2VZ2A 1CJ4A 1N5WC 3R9UA 4CCQA 5C3JA 2X3NA 5JCMA 2J3NA 3H8AA 5FJUA 3F8PA 2FJBA 2XH0A 3AYIA 2O56A 4BK3A 1FECA 4E8GA 4JHMA 3FMWA 3P4QA 5FJOA 3T9PA 2OLOA 2YG3A 1K0IA 4GDPA 3MWCA 2JB2A 4PAAA 1MUCA 3AE7A 4E4FA 3QLDA 3SN4A 3RR1A 4GISA 4CRTA 2AL1A 4H4TA 2C70A 2C72A 3BI5A 2GEWA 4IA6A 2X8GA 1MNSA 2IVEA 3KPKA 2C3DA 2R0GA 3TJIA 3GO2A 4C3YA 3FJ4A 3DIPA 1W6TA 1NHSA 2GGIA 2OLAA 4H4QA 4IA5A 1IUXA 1QLBA 4E5TA 2R4JA 3HW2A 3NVYB 3MUCA 4FK1C 4O5QA 3REDA 4MJWA 2Q7VA 3JZUA 1YKJA 4Y4MA 3UOVA 1Y56B 1ONEA 3VCCA 1MOKA 3HPFA 1V59A 2YLZA 2Q0LA 2IVDA 1P43A 3AEBA 3THUA 2VRMA 2ARDA 4YSZA 3MSYA 2BS4A 1HYUA 2YR6A 3P0WA 1B8SA 5LV9A 5EB4A 3ZDNA 5FJTA 4H4YA 2WPCA 2DW7A 1BZLA 3RCYA 1QO8A 5KVHA 4HA6A 1EC9A 3GMCA 3IHGA 4NNJA 1FFVC 3UJSA 1QJDA 3UP4A 1BF3A 4JDRA 3UCCA 3CYJA 3IHMA 2RDXA 3H70A 1H82A 1PDHA 5KNLA 5FMHA 2XFPA 2R45A 2E5VA 2VRLA 5ER0A 3NZGA 1NG4A 3L8KA 3AEAA 3AE1A 1GPEA 1LPFA 3EKGA 2C3CA 1LTXR 3CGCA 3KLJA 1E1NA 3CK5A 3NGCX 2DKIA 2JB1A 3CN8A 1VG0A 2PGEA 1E39A 1F8SA 3G5RA 3GSIA 3SQPA 2V3AA 2OZ8A 2ZZ0A 5EU9A 1L8PA 4B65A 1DNCA 4DYEA 3SX6A 4G6GA 5BOFA 4P9SA 1BQGA 2GAGB 1B5QA 2GR0A 1KDGA 2APGA 4X4JA 1W4XA 4K2XA 4NTDA 3WE0A 3QKEA 2YLXA 2UZZA 5JCIA 3NFUA 2HZGA 1MDLA 3EPTA 1N4WA 3EAOA 3C4AA 2MNRA 3AE8A 5HYMA 1YQ3A 3T8QA 3U4FA 3OTRA 1E7PA 1BWCA 3TWAA 3VFCA 2QDDA 1MO9A 2RGOA 2PTZA 4TVWA 2XH4A 2C76A 3I3LA 4AT2A 2E4GA 1GTHA 2PU0A 5KMQA 2FJAA 3UOZA 3TJ4A 3D1CA 3D47A 4JQ9A 4UDPA 4E6MA 5FS8A 2W54A 4APNA 4BJYA 5GSNA 2BK4A 1H81A 4JY2A 3P1WA 3CMMA 1TDNA 2VVLA 5BVAA 4U8MA 5HHFA 1TE6A 1DTNA 2OZ3A 1GESA 1R6WA 1NEKA 1SEZA 2XCGA 4F4RA 3QSSA 1E9IA 2WOIA 2AAQA 3CNSA 4H1ZA 1JRZA 3NT6A 1NHQA 4ZCDA 4GGBA 2PPGA 3MY9A 2YLWA 3AEFA 3L1RA 1WYGA 3CTYA 2AQJA 4A65A 1JCTA 5KWFA 3OW1A 3ADAB 3TOYA 4X9NA 4A99A 1GERA 1CHUA 3K7TA 4Z44A 3NKSA 4KWSA 3FPZA 3URHA 2OLNA 1ECQA 3QTPA 4OPUA 4G74A 4G9KA 3NN0X 1AOGA 4Z43A 2CVJA 1LV0A 5KVIA 1GRFA 4Z1YA 3S5WA 4B64A 4YTPA 4BURA 3G5QA 2JKCA 4U8NA 1ZMCA 4MMWA 2X8HA 1XDIA 4XWRA 2POZA 4RG3A 2QVHA 1DXLA 3RP7A 5J60A 5J7XA 1BGNA 3P9UA 2YR4A 1K0LA 1ZOVA 4HNLA 2JB3A 1CC4A 4ZN0A 3T31A 3U9IA 1GALA 1PBCA 2BK3A 4RG4A 3KVEA 1D4CA 3H8IA 4K2SA 2OX4A 1CC2A 3UKHA 3T0KA 4HCDA 5GRTA 4K5SA 1H83A 4GYPA 2OQHA 4J2WA 2PTYA 3ALLA 3AYJA 1MXTA 3ALJA 2WPFA 1Q9IA 2E1MA 3T4WA 3DK8A 4REKA 4M52A 1GT8A 3NXLA 3OPSA 1STZA 2XLRA 3SZFA 5JRBA 2QQ6A 4IT1A 1B4VA 5BRTA 3ATQA 2GR2A 3UXKA 3D8XA 5KOXA 3KD9A 1KSSA 4Z25A 2BRYA 1ZX9A 2HNEA 4HNCA 1COYA 3F8DA 4Z2TA 3CIRA 3EF6A 3PG6A 2MUCA 2DW6A 4H83A 3H4KA 2GDQA 2YVJA 2PHHA 4A9WA 3QN3A 2R4EA 3UGVA 4OVIA 1WUEA 3NYEA 4EM3A 2P0IA 2YLTA 3ATRA 3T2KA 3VDGA 4X2PA 3AECA 1BKWA 3PWGA 5KOWA 4CNKA 2VVLG 4U8PA 1ONFA 3DMEA 2NQLA 3RHAA 4K7ZA 2OPJA 5FJPA 1PBEA 1WUFA 4A79A 4N9XA 1JNZA 3V4BA 2Y6QA 3BOXA 4H2HA 1X31B 1TYPA 1YQ4A 2A8XA 3UJRA 3NG7X 2QA1A 4C74A 1E1MA 3UTEA 3BI2A 4DWDA 1NDAA 1NAAA 3RGTA 4EMJA 1L9CA 2B9YA 4G6HA 3VR8A 3B97A 2ZZBA 3GYXA 2WHDA 3UJ2A 2YR5A 1FIQB 5ENLA 3C96A 4H4ZA 1ZP0A 1CJCA 3AEEA 1XPQA 1D4EA 4DN1A 3RP6A 3FG2P 3C4NA 4YXDA 3UXLA 1S3EA 1ZDLA 2TPRA 1NELA 3AWIA 1GV4A 3TCSA 3DJJA 3NRNA 2GL5A 4GMEA 3JSKA 3QVRA 4JNQA 3ETRB 2GMHA 3CPIG 2XGZA 3N4FA 2XSXA 4G73A 1L9EA 3EUB3 4H4UA 5IDZA 3T2YA 4EIPA 4OPLA 3IK4A 4NEVA 3FVDA 3OZMA 1GSNA 3UOYA 3LZWA 2XH2A 4B67A 1XS2A 4JN8A 3K7QX 3V3WA 2ACZA 4J56A 3QSEA 3VA8A 3P3BA 4Z26A 1DOBA 1PXAA 4BJZA 5KRQA 4IVOB 2Q0KA 3FV9A 3AE3A 4IV9A 2XH7A 3HYVA 2A89A 4I59A 3P4PA 4GAVA 2P8CA 3DERA 1N1PA 1RP0A 2GR1A 5J04A 4H2QA 1N63C 3A7UA 1L9DA 2PSNA 2BXRA 3FCPA 4ENLA 1EL7A 1FL2A 3DG3A 4E4UA 1F9CA 2OFJA 1CF3A 2V5ZA 3AD8B 3SM8A 4DNAA 3LZXA 4KPLA 4K8GA 3O0HA 3KKJA 3ITJA 1GRGA 4KPRA 1NENA 4OPIA 3MZNA 3QSMA 3CNPA 3AYLA 3QFBA 2PS2A 3UCDA 3GYIA 5HY5A 2YG5A 1TDOA 3DG6A 3DA1A 3NH3X 2B7SA 4JN7A 2WS3A 2B9XA 2GB0A 3N4EA 1N62C 4OPGA 4K1WA 4A3RA 2ZBWA 3AM9A 3VRBA 2GV8A 2GVCA 1TYTA 2HXTA 4H19A 3G5SA 3DJGX 3SR6B 1Q1WA 1F8RA 2NPXA 2PP3A 2JBVA 2ONEA 3L5OA 1IUSA 3LXDA 2QJMA 2C65A 2FJEA 5TR3A 2W3SA 4H4RA 2QJJA 1KKOA 3ICTA 3QJ4A 1FEBA 2F5ZA 4UDQA 3ENLA 2NVKX 2W0HA 2XFQA 1MDRA 2CHRA 2I5QA 4Z17A 2YM2A 3DEQA 2VOUA 4OPTA 2OALA 2XVJA 5M0ZA 4U8OA 4HCHA 2XVHA 5KMSA 3FIMB 4USQA 1N4VA 3CPJG 3NS1B 2OVLA 3NO1A 4G8TA 2EQ7A 3I6EA 3ZLGA
chains in the Genus database with same CATH topology
1VDCA 3NN0X 4LU6A 1AOGA 3DGZA 3NNEA 4U2LA 1P2HA 1PHHA 4Z43A 1YY5A 3NTDA 2CVJA 1LV0A 4GAPA 4YT0A 3V76A 4LIIA 3AB1A 5KVIA 4CBQA 1O95A 3LADA 1GRFA 3PS9A 2BCGG 3AE2A 1Y0PA 3UKAA 3CPHG 3S5WA 4B64A 1PN0A 4A6NA 4YTPA 4BURA 2YVGA 2GQFA 2JKCA 3G5QA 4U8NA 1ZMCA 3CNTA 3UTGA 2X8HA 1XDIA 1E1KA 4XWRA 4RG3A 3FBSA 3AD7B 1DXLA 3SZWA 1GRTA 1ZKQA 3CNJA 2BYBA 3RP7A 2XVIA 5J60A 5EOWA 2RGHA 2XFUA 5J7XA 1EL8A 1BGNA 3VRAA 4B63A 1CL0A 3GDPA 4OPCA 1LQUA 2B76A 3P9UA 4TM0A 3V3OA 2V6OA 2YR4A 2YVFA 1K0LA 1ZOVA 4ECHA 3PVCA 2JB3A 2BCPA 1CC4A 3IF9A 3T31A 2R46A 3SYIA 3VQRA 4ZN0A 1OJTA 3IC9A 1KN0A 1H7WA 3B3RA 1GALA 1PBCA 1H84A 1PJ5A 1CC6A 4JNAA 2WOWA 4KX6A 2BK3A 4EIQA 1EBDA 4RG4A 2Z5XA 3KVEA 1D4CA 3H8IA 5BUKA 2WESA 4H2PA 1CC2A 1E6EA 3UKHA 3T0KA 4H2NA 1D5TA 1O5WA 3F8RA 1JOAA 5GRTA 4K5SA 3K7MX 1H83A 2BACA 1Y56A 4BK1A 5KMPA 4RSLA 2GR3A 3GD4A 1FOHA 4J2WA 5L46A 1H6VA 2IIDA 3ALLA 3GDNA 3SZ0A 3UTHA 1ELIA 1M6IA 2XFNA 3AYJA 3GYJA 4TM3A 3S61A 1MXTA 4H2RA 3ALJA 3BNMA 3UOXA 4GF7A 2WPFA 3EANA 4H4VA 1Q9IA 1S2YA 2B9WA 2E1MA 3ICSA 4AP1A 3Q9TA 3DK8A 3AD9B 3SY4A 1GOSA 1LJ1A 5CQFA 1OJCA 3NHOX 4O5UA 3UTFA 3NIXA 4YSHA 2VZ2A 4C5OA 2EQ8A 4REKA 2XLTA 4AOSA 1CJ4A 3GD3A 3R9UA 4M52A 1GT8A 4CCQA 2FJDA 5C3JA 2GRTA 2XLRA 1N4UA 2WDQA 5JCMA 2X3NA 2X99A 2J3NA 3SZFA 2I0ZA 2A87A 4CCRA 3PO7A 3F8PA 5JRBA 2FJBA 3DJEA 2YM1A 1RYIA 3AXBA 3AYIA 2TMDA 2QA2A 3UKLA 1KSUA 1ZK7A 1LQTA 1B4VA 5BRTA 1NHPA 3ATQA 2GR2A 3COXA 5U25A 3D8XA 4BK3A 1FECA 5KOXA 3D9XA 1M64A 1KSSA 3KD9A 3QFAA 3NK1X 4Z25A 5IQ4A 3LOVA 2BRYA 2JAEA 3FMWA 1ZX9A 4Z24A 3P4QA 1COYA 3F8DA 4H4PA 2YQUA 2OLOA 2YG3A 3NK2X 3CIRA 3EF6A 3PG6A 1K0IA 4B69A 4Z2TA 4GDPA 3IWAA 4U8KA 2JB2A 3AE9A 4PAAA 1S2QA 5KXJA 3H4KA 3AE7A 5KMRA 4HB9A 3RP8A 2YVJA 4E0VA 2PHHA 4A9WA 1ZOYA 1JEHA 1CBOA 3H8LA 3HYWA 3I6DA 3AE6A 2JK6A 4J57A 1CJ3A 2R4EA 4CRTA 4OVIA 2C72A 4H4TA 2C70A 3BI5A 3NYEA 4EM3A 2GEWA 4U8JA 3NN6X 4IA6A 2X8GA 2ZZCA 4FDCB 2YLTA 3AE4A 1DODA 2IVEA 1IUUA 3ATRA 2WPEA 3KPKA 3T2KA 3ZYXA 4A6NB 4AOXA 2C3DA 2R0GA 2YLSA 2XLSA 4UP3A 4C3YA 3AECA 5IQ1A 1BKWA 5KOWA 1NHSA 4Y4NA 4U2SA 4CNKA 2VVLG 4U8PA 2RGJA 1ONFA 4H4QA 1REOA 3DMEA 4IA5A 2C4CA 4NZHA 1IUXA 2GF3A 3HZLA 3UKPA 2VQBA 4U8LA 1QLBA 2QCUA 2R4JA 4K7ZA 3E1TA 2BXSA 4K22A 3RHAA 4AT0A 1JRXA 1PBEA 2WDVA 2YWLA 1OJDA 1S3BA 1IJHA 4A79A 1TDKA 4N9XA 3T14A 4FK1C 1JNZA 1B37A 4O5QA 2GH5A 3DH9A 2Z5YA 3REDA 4NEWA 2Y6QA 3M13A 5HXIA 1X31B 1TYPA 1YQ4A 2Q7VA 4MJWA 4WCTA 2A8XA 3OZ2A 2V60A 3NG7X 1YKJA 4Y4MA 2QA1A 3UOVA 1JU2A 1Q1RA 4C74A 4II2A 1E1MA 3UTEA 4YSYA 2WP5A 3BI2A 4GUVA 1Y56B 1KNRA 1NDAA 2WEUA 4XWZA 1MOKA 4CY6A 1V59A 1NAAA 4NTCA 2YLZA 1GRAA 2Q0LA 4EQWA 2IVDA 4EMJA 3LJPA 4LA1A 3AEBA 1L9CA 2B9YA 4G6HA 4TLXA 4U8IA 2VRMA 4WX1A 2X50A 3NLCA 3Q6JA 3VR8A 4CNJA 2ARDA 4YSZA 2BS4A 1H86A 1HYUA 4II3A 1NG3A 5BULA 2FBWA 4FK1A 2ZZBA 3GYXA 1GTEA 2YR6A 3GWDA 2BABA 1B8SA 2WHDA 5C2TA 5LV9A 4GDEA 5EB4A 2YR5A 1JRYA 2AR8A 3KA7A 3C96A 2R9ZA 1XHCA 2BK5A 4H4ZA 1ZP0A 1CJCA 3ZDNA 3SFDA 4BV6A 3AEEA 1PJ7A 1DOCA 1XPQA 1D4EA 4H4YA 4FX9A 2XYOA 2WPCA 4EMIA 1F8WA 3FG2P 4H4WA 3RP6A 1KF6A 3C4NA 4EQSA 1BZLA 3M12A 3II4A 1QO8A 2WP9A 4YXDA 5KVHA 1S3EA 3BHKA 3GMCA 3IHGA 4HA6A 1ZDLA 2TPRA 3AWIA 4NNJA 1GV4A 5EBKA 3DJJA 3CNDA 3NRNA 3DGHA 3V3NA 1DOEA 1QJDA 3UP4A 1IUWA 2C75A 4A7AA 1BF3A 4YKFA 3JSKA 5EB5A 4JDRA 3IHMA 1S7MA 3QVRA 1KFYA 1H82A 1PDHA 2YG7A 4JNQA 2EQ9A 2RABA 4EM4A 5FMHA 2GMHA 3CPIG 2XFPA 4BK2A 5KNLA 2R45A 2E5VA 4G73A 1L0VA 1L9EA 3SXIA 4H4UA 3T2YA 3UKKA 5JCNA 2EQ6A 2VRLA 4EIPA 5ER0A 1NHRA 1DJQA 4UDRA 3K30A 4OPLA 1NG4A 4TLZA 4NEVA 3L8KA 4NTEA 3KPFA 3AEAA 2Q6UA 1EL9A 1GSNA 3AE1A 1H7XA 1PBDA 4DSGA 1GPEA 3UOYA 1LPFA 3RNMA 1PBFA 2C3CA 4YWOA 4EQRA 1GRHA 3LZWA 1LTXR 4B67A 2H89A 2YLRA 4C3XA 3CGCA 4ICYA 4JN9A 3NTAA 1ZMDA 3KLJA 3CGBA 1E1NA 1PBBA 2C73A 1FEAA 2ACZA 2DKIA 4J56A 3GMBA 3K7QX 5FS7A 3NGCX 2JB1A 3QSEA 1DOBA 4Z26A 3CN8A 2YAUA 1PXAA 1VG0A 4BJZA 1PXCA 1E39A 3GSIA 1F8SA 1TRBA 3G5RA 4IVOB 2Q0KA 5KRQA 3AE3A 4IVMB 1H2IA 4IV9A 3SQPA 2V3AA 4YKGA 3HYVA 2A89A 4I59A 3P4PA 2ZZ0A 1TDFA 3BNUA 2BC0A 4GAVA 2WETA 1N1PA 1RP0A 2GR1A 4B65A 4J36A 1DNCA 4AP3A 2B7RA 3SX6A 4G6GA 4H2QA 3GRTA 4P9SA 1L9DA 3GWFA 2BXRA 1FCDA 3T2ZA 1YQZA 2H88A 1EL7A 2GAGB 1B5QA 4CY8A 1FL2A 1DJNA 2GR0A 1NPXA 1KDGA 2APGA 1W4XA 4X4JA 4K2XA 4NTDA 4Z2UA 3WE0A 1CF3A 2V5ZA 3AD8B 2YLXA 4J31A 3SM8A 2UZZA 5JCIA 1PXBA 4ZCCA 4DNAA 3LZXA 1K4QA 2WU2A 3O0HA 1N4WA 3EPTA 4X9MA 4H50A 3KKJA 3EAOA 3ITJA 1D4DA 2CULA 3C4AA 5CKUA 1GRGA 1OJ9A 4KPRA 3AE8A 1F6MA 3NYFA 3CGDA 1XANA 2CFYA 1NENA 4D04A 5HYMA 2VVMA 4OPIA 3T37A 1VG9A 1YQ3A 2C7GA 1ZY8A 1D7LA 4Z2RA 1VQWA 3QSMA 4K5RA 4TM1A 1E7PA 1BWCA 5U1OA 3CNPA 3ABVA 3AEGA 3AYLA 3QFBA 3ALMA 4B68A 3GRSA 5M10A 3GYIA 5HY5A 2PYXA 2YG5A 1MO9A 3DJDA 1TDOA 2DKHA 2RGOA 4H4XA 3DA1A 1F3PA 1GEUA 3ICRA 4EQXA 2C76A 3I3LA 3QVPA 4A5LA 1JNRA 3NH3X 4OPDA 2B7SA 2E4GA 2R0CA 4NWZA 4AT2A 1GTHA 3BHFA 2C66A 4DSHA 3P4RA 2V3BA 2XVEA 2WS3A 5KMQA 2C67A 2OA1A 2B9XA 2FJAA 2GB0A 4XXGA 4YSXA 4YTMA 3UOZA 2O9ZA 1TDEA 3D1CA 4OPGA 5U63A 2QAEA 1D7YA 5FS9A 2R0PA 2WDRA 2Y6RA 1Z6LA 2ZBWA 4JQ9A 3UP5A 4UDPA 3VRBA 3KU9A 5DBJA 2GV8A 2GVCA 1TYTA 3G5SA 3B6DA 3DJGX 4H4SA 5FS8A 1LVLA 5FS6A 1Q1WA 1F8RA 2WBAA 4I58A 2V61A 4APNA 2NPXA 4U2TA 4B66A 2XLPA 3CGEA 2JBVA 1K0JA 4BJYA 4H7UA 2XFOA 3UCLA 2BC1A 3L5OA 2WQYA 5GSNA 1GXFA 2BK4A 1H81A 3ISHA 4JY2A 3P1WA 3AEDA 1IUSA 1TDNA 3CMMA 3LXDA 2VVLA 5BVAA 4U8MA 2C65A 2BS3A 3SGLA 3NK0X 5HHFA 2FJEA 3SZCA 3UKFA 5TR3A 2XLUA 1IUTA 4GCMA 3VR9A 1KNPA 1CJ2A 2C64A 4H4RA 1VRQB 3ICTA 3QJ4A 1FEBA 1GESA 5JCLA 4GR1A 2F5ZA 3DK9A 1NEKA 1SEZA 2YG4A 4UDQA 1OJAA 2NVKX 2XCGA 2W0HA 1EL5A 2XVFA 2XFQA 3QSSA 1PS9A 2WOIA 2GAHB 1UKVG 2YG6A 2AAQA 3LB8A 3SFEA 4C77A 4B1BA 1O94A 1GRBA 3CNSA 1P2EA 1JRZA 3NT6A 1NHQA 4DGKA 4ZCDA 2YM2A 5JCKA 4JY3A 2VOUA 1BGJA 3AE5A 4OPTA 4J34A 2GQWA 4USRA 4TM4A 3NYCA 2OALA 1GETA 1IUVA 2XVJA 3DK4A 2YLWA 1GNDA 3AEFA 3L1RA 2XVHA 4U8OA 5M0ZA 2WP6A 4D03A 2BA9A 2HQMA 5KMSA 1PJ6A 4Y4LA 2X8CA 4EMWA 2AQJA 2VQ7A 3CTYA 3FIMB 4USQA 2WOVA 4A65A 4ADWA 2OAMA 2CDUA 1N4VA 3CPJG 2BS2A 3P4SA 5KWFA 4YTNA 3ADAB 3UKQA 4A99A 4X9NA 3OC4A 1GERA 1CHUA 3K7TA 4Z44A 4GRTA 3NKSA 4OCGA 1E1LA 1RSGA 3FPZA 3URHA 2WU5A 2OLNA 1GREA 2EQ7A 2XDOA 3M0OA 4PABA 4K8DA 4OPUA 3VRDB 2BRAA 2GMJA 4G74A 4G9KA 4J33A 3BI4A 5IPYA 3HYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDC A;  3NN0 X;  4LU6 A;  1AOG A;  3DGZ A;  3NNE A;  4U2L A;  1P2H A;  1PHH A;  4Z43 A;  1YY5 A;  3NTD A;  2CVJ A;  1LV0 A;  4YT0 A;  3V76 A;  4LII A;  3AB1 A;  5KVI A;  4CBQ A;  1O95 A;  3LAD A;  1GRF A;  3PS9 A;  2BCG G;  3AE2 A;  1Y0P A;  3UKA A;  3CPH G;  3S5W A;  4B64 A;  1PN0 A;  4A6N A;  4YTP A;  4BUR A;  2YVG A;  2GQF A;  2JKC A;  3G5Q A;  4U8N A;  1ZMC A;  3CNT A;  3UTG A;  2X8H A;  1XDI A;  1E1K A;  4XWR A;  4RG3 A;  3FBS A;  3AD7 B;  1DXL A;  1GRT A;  1ZKQ A;  3CNJ A;  2BYB A;  3RP7 A;  2XVI A;  5J60 A;  5EOW A;  2RGH A;  2XFU A;  5J7X A;  1EL8 A;  1BGN A;  3VRA A;  4B63 A;  1CL0 A;  3GDP A;  4OPC A;  1LQU A;  2B76 A;  3P9U A;  4TM0 A;  3V3O A;  2V6O A;  2YR4 A;  2YVF A;  1K0L A;  1ZOV A;  4ECH A;  3PVC A;  2JB3 A;  2BCP A;  1CC4 A;  3IF9 A;  4ZN0 A;  2R46 A;  3VQR A;  1OJT A;  3IC9 A;  1H7W A;  3B3R A;  1GAL A;  1PBC A;  1H84 A;  1PJ5 A;  1CC6 A;  4JNA A;  2WOW A;  4KX6 A;  2BK3 A;  4EIQ A;  1EBD A;  4RG4 A;  2Z5X A;  3KVE A;  1D4C A;  3H8I A;  5BUK A;  2WES A;  4H2P A;  1CC2 A;  1E6E A;  3UKH A;  4H2N A;  1D5T A;  1O5W A;  3F8R A;  1JOA A;  5GRT A;  4K5S A;  3K7M X;  1H83 A;  2BAC A;  1Y56 A;  4BK1 A;  4RSL A;  2GR3 A;  3GD4 A;  1FOH A;  4J2W A;  5L46 A;  1H6V A;  2IID A;  3ALL A;  3GDN A;  3UTH A;  1ELI A;  1M6I A;  2XFN A;  3AYJ A;  3GYJ A;  4TM3 A;  3S61 A;  1MXT A;  4H2R A;  3ALJ A;  3BNM A;  3UOX A;  4GF7 A;  2WPF A;  3EAN A;  4H4V A;  1Q9I A;  1S2Y A;  2B9W A;  2E1M A;  3ICS A;  4AP1 A;  3Q9T A;  3DK8 A;  3AD9 B;  1GOS A;  1LJ1 A;  5CQF A;  1OJC A;  3NHO X;  4O5U A;  3UTF A;  3NIX A;  4YSH A;  2VZ2 A;  4C5O A;  2EQ8 A;  4REK A;  2XLT A;  4AOS A;  1CJ4 A;  3GD3 A;  3R9U A;  4M52 A;  1GT8 A;  4CCQ A;  2FJD A;  5C3J A;  2GRT A;  2XLR A;  1N4U A;  2WDQ A;  5JCM A;  2X3N A;  2X99 A;  2J3N A;  2I0Z A;  2A87 A;  4CCR A;  3PO7 A;  3F8P A;  2FJB A;  3DJE A;  2YM1 A;  1RYI A;  3AXB A;  3AYI A;  2TMD A;  2QA2 A;  3UKL A;  1KSU A;  1ZK7 A;  1LQT A;  1B4V A;  5BRT A;  1NHP A;  3ATQ A;  2GR2 A;  3COX A;  5U25 A;  3D8X A;  4BK3 A;  1FEC A;  5KOX A;  1M64 A;  1KSS A;  3KD9 A;  3QFA A;  3NK1 X;  4Z25 A;  5IQ4 A;  3LOV A;  2JAE A;  3FMW A;  1ZX9 A;  4Z24 A;  3P4Q A;  1COY A;  3F8D A;  4H4P A;  2YQU A;  2OLO A;  2YG3 A;  3NK2 X;  3CIR A;  3EF6 A;  1K0I A;  4B69 A;  4Z2T A;  4GDP A;  3IWA A;  4U8K A;  2JB2 A;  3AE9 A;  4PAA A;  1S2Q A;  5KXJ A;  3H4K A;  3AE7 A;  4HB9 A;  3RP8 A;  2YVJ A;  4E0V A;  2PHH A;  4A9W A;  1ZOY A;  1JEH A;  1CBO A;  3H8L A;  3I6D A;  3AE6 A;  2JK6 A;  4J57 A;  1CJ3 A;  2R4E A;  4CRT A;  4OVI A;  2C72 A;  4H4T A;  2C70 A;  3BI5 A;  3NYE A;  4EM3 A;  2GEW A;  4U8J A;  3NN6 X;  4IA6 A;  2X8G A;  2ZZC A;  4FDC B;  2YLT A;  3AE4 A;  1DOD A;  2IVE A;  1IUU A;  3ATR A;  2WPE A;  3ZYX A;  4A6N B;  4AOX A;  2C3D A;  2R0G A;  2YLS A;  2XLS A;  4UP3 A;  4C3Y A;  3AEC A;  5IQ1 A;  1BKW A;  5KOW A;  1NHS A;  4Y4N A;  4U2S A;  4CNK A;  2VVL G;  4U8P A;  2RGJ A;  1ONF A;  4H4Q A;  1REO A;  3DME A;  4IA5 A;  4NZH A;  3UKP A;  1IUX A;  2GF3 A;  3HZL A;  2VQB A;  4U8L A;  1QLB A;  2QCU A;  2R4J A;  4K7Z A;  3E1T A;  2BXS A;  4K22 A;  3RHA A;  4AT0 A;  1JRX A;  1PBE A;  2WDV A;  2YWL A;  1OJD A;  1S3B A;  1IJH A;  4A79 A;  1TDK A;  4N9X A;  4FK1 C;  1JNZ A;  1B37 A;  4O5Q A;  2GH5 A;  3DH9 A;  2Z5Y A;  3RED A;  4NEW A;  2Y6Q A;  3M13 A;  5HXI A;  1X31 B;  1TYP A;  1YQ4 A;  2Q7V A;  4MJW A;  4WCT A;  2A8X A;  3OZ2 A;  2V60 A;  3NG7 X;  1YKJ A;  4Y4M A;  2QA1 A;  3UOV A;  1JU2 A;  1Q1R A;  4C74 A;  1E1M A;  3UTE A;  4YSY A;  2WP5 A;  3BI2 A;  4GUV A;  1Y56 B;  1KNR A;  1NDA A;  2WEU A;  4XWZ A;  1MOK A;  4CY6 A;  1V59 A;  1NAA A;  4NTC A;  2YLZ A;  1GRA A;  2Q0L A;  4EQW A;  2IVD A;  4EMJ A;  3LJP A;  4LA1 A;  3AEB A;  1L9C A;  2B9Y A;  4TLX A;  4U8I A;  2VRM A;  4WX1 A;  2X50 A;  3NLC A;  3Q6J A;  3VR8 A;  4CNJ A;  2ARD A;  4YSZ A;  2BS4 A;  1H86 A;  1HYU A;  1NG3 A;  5BUL A;  2FBW A;  4FK1 A;  2ZZB A;  1GTE A;  2YR6 A;  3GWD A;  2BAB A;  1B8S A;  2WHD A;  5C2T A;  5LV9 A;  4GDE A;  5EB4 A;  2YR5 A;  1JRY A;  2AR8 A;  3KA7 A;  3C96 A;  2R9Z A;  1XHC A;  2BK5 A;  4H4Z A;  1ZP0 A;  1CJC A;  3ZDN A;  3SFD A;  4BV6 A;  3AEE A;  1PJ7 A;  1DOC A;  1XPQ A;  1D4E A;  4H4Y A;  4FX9 A;  2XYO A;  2WPC A;  4EMI A;  1F8W A;  3FG2 P;  4H4W A;  3RP6 A;  1KF6 A;  3C4N A;  4EQS A;  1BZL A;  3M12 A;  3II4 A;  1QO8 A;  2WP9 A;  4YXD A;  5KVH A;  1S3E A;  3BHK A;  3GMC A;  3IHG A;  4HA6 A;  1ZDL A;  2TPR A;  3AWI A;  1GV4 A;  5EBK A;  3DJJ A;  3CND A;  3NRN A;  3DGH A;  3V3N A;  1DOE A;  1QJD A;  3UP4 A;  1IUW A;  2C75 A;  4A7A A;  1BF3 A;  4YKF A;  3JSK A;  5EB5 A;  4JDR A;  3IHM A;  3QVR A;  1KFY A;  1H82 A;  1PDH A;  2YG7 A;  4JNQ A;  2EQ9 A;  2RAB A;  4EM4 A;  5FMH A;  2GMH A;  3CPI G;  2XFP A;  4BK2 A;  2R45 A;  2E5V A;  1L0V A;  1L9E A;  4H4U A;  3UKK A;  5JCN A;  2EQ6 A;  2VRL A;  4EIP A;  5ER0 A;  1NHR A;  1DJQ A;  4UDR A;  3K30 A;  4OPL A;  1NG4 A;  4TLZ A;  4NEV A;  3L8K A;  4NTE A;  3KPF A;  3AEA A;  2Q6U A;  1EL9 A;  1GSN A;  3AE1 A;  1H7X A;  1PBD A;  4DSG A;  1GPE A;  3UOY A;  1LPF A;  3RNM A;  1PBF A;  2C3C A;  4YWO A;  4EQR A;  1GRH A;  3LZW A;  1LTX R;  4B67 A;  2H89 A;  2YLR A;  4C3X A;  3CGC A;  4ICY A;  4JN9 A;  3NTA A;  1ZMD A;  3KLJ A;  3CGB A;  1E1N A;  1PBB A;  2C73 A;  1FEA A;  2ACZ A;  2DKI A;  4J56 A;  3GMB A;  3K7Q X;  5FS7 A;  3NGC X;  2JB1 A;  3QSE A;  1DOB A;  4Z26 A;  3CN8 A;  2YAU A;  1PXA A;  1VG0 A;  4BJZ A;  1PXC A;  1E39 A;  3GSI A;  1F8S A;  1TRB A;  3G5R A;  4IVO B;  2Q0K A;  5KRQ A;  3AE3 A;  4IVM B;  4YKG A;  4IV9 A;  3SQP A;  2V3A A;  2A89 A;  4I59 A;  3P4P A;  2ZZ0 A;  1TDF A;  3BNU A;  2BC0 A;  2WET A;  1N1P A;  1RP0 A;  2GR1 A;  4B65 A;  4J36 A;  1DNC A;  4AP3 A;  2B7R A;  4H2Q A;  3GRT A;  4P9S A;  1L9D A;  3GWF A;  2BXR A;  1FCD A;  1YQZ A;  2H88 A;  1EL7 A;  2GAG B;  1B5Q A;  4CY8 A;  1FL2 A;  1DJN A;  2GR0 A;  1NPX A;  1KDG A;  2APG A;  1W4X A;  4X4J A;  4K2X A;  4NTD A;  4Z2U A;  3WE0 A;  1CF3 A;  2V5Z A;  3AD8 B;  2YLX A;  4J31 A;  3SM8 A;  2UZZ A;  5JCI A;  1PXB A;  4ZCC A;  4DNA A;  3LZX A;  1K4Q A;  2WU2 A;  3O0H A;  1N4W A;  3EPT A;  4X9M A;  4H50 A;  3KKJ A;  3EAO A;  3ITJ A;  1D4D A;  2CUL A;  3C4A A;  5CKU A;  1GRG A;  1OJ9 A;  4KPR A;  3AE8 A;  1F6M A;  3NYF A;  3CGD A;  1XAN A;  2CFY A;  1NEN A;  4D04 A;  5HYM A;  2VVM A;  4OPI A;  3T37 A;  1VG9 A;  1YQ3 A;  2C7G A;  1ZY8 A;  1D7L A;  4Z2R A;  1VQW A;  3QSM A;  4K5R A;  4TM1 A;  1E7P A;  1BWC A;  5U1O A;  3CNP A;  3ABV A;  3AEG A;  3AYL A;  3QFB A;  3ALM A;  4B68 A;  3GRS A;  5M10 A;  3GYI A;  5HY5 A;  2PYX A;  2YG5 A;  1MO9 A;  3DJD A;  1TDO A;  2DKH A;  2RGO A;  4H4X A;  3DA1 A;  1F3P A;  1GEU A;  3ICR A;  4EQX A;  2C76 A;  3I3L A;  3QVP A;  4A5L A;  1JNR A;  3NH3 X;  4OPD A;  2B7S A;  2E4G A;  2R0C A;  4AT2 A;  1GTH A;  3BHF A;  2C66 A;  4DSH A;  3P4R A;  2V3B A;  2XVE A;  2WS3 A;  2C67 A;  2OA1 A;  2B9X A;  2FJA A;  2GB0 A;  4XXG A;  4YSX A;  4YTM A;  3UOZ A;  2O9Z A;  1TDE A;  3D1C A;  4OPG A;  5U63 A;  2QAE A;  1D7Y A;  5FS9 A;  2R0P A;  2WDR A;  2Y6R A;  1Z6L A;  2ZBW A;  4JQ9 A;  3UP5 A;  4UDP A;  3VRB A;  3KU9 A;  5DBJ A;  2GV8 A;  2GVC A;  1TYT A;  3G5S A;  3B6D A;  3DJG X;  4H4S A;  5FS8 A;  1LVL A;  5FS6 A;  1Q1W A;  1F8R A;  2WBA A;  4I58 A;  2V61 A;  4APN A;  2NPX A;  4U2T A;  4B66 A;  2XLP A;  3CGE A;  2JBV A;  1K0J A;  4BJY A;  4H7U A;  2XFO A;  3UCL A;  2BC1 A;  2WQY A;  5GSN A;  1GXF A;  2BK4 A;  1H81 A;  3ISH A;  4JY2 A;  3P1W A;  3AED A;  1IUS A;  1TDN A;  3LXD A;  2VVL A;  5BVA A;  4U8M A;  2C65 A;  2BS3 A;  3SGL A;  3NK0 X;  5HHF A;  2FJE A;  3UKF A;  5TR3 A;  2XLU A;  1IUT A;  4GCM A;  3VR9 A;  1KNP A;  1CJ2 A;  2C64 A;  4H4R A;  1VRQ B;  3ICT A;  3QJ4 A;  1FEB A;  1GES A;  5JCL A;  4GR1 A;  2F5Z A;  3DK9 A;  1NEK A;  1SEZ A;  2YG4 A;  4UDQ A;  1OJA A;  2NVK X;  2XCG A;  2W0H A;  1EL5 A;  2XVF A;  2XFQ A;  3QSS A;  1PS9 A;  2WOI A;  2GAH B;  1UKV G;  2YG6 A;  2AAQ A;  3LB8 A;  3SFE A;  4C77 A;  4B1B A;  1O94 A;  1GRB A;  3CNS A;  1P2E A;  1JRZ A;  3NT6 A;  1NHQ A;  4DGK A;  4ZCD A;  2YM2 A;  5JCK A;  4JY3 A;  2VOU A;  1BGJ A;  3AE5 A;  4OPT A;  4J34 A;  2GQW A;  4USR A;  4TM4 A;  3NYC A;  2OAL A;  1GET A;  1IUV A;  2XVJ A;  3DK4 A;  2YLW A;  1GND A;  3AEF A;  3L1R A;  2XVH A;  4U8O A;  5M0Z A;  2WP6 A;  4D03 A;  2BA9 A;  2HQM A;  1PJ6 A;  4Y4L A;  2X8C A;  4EMW A;  2AQJ A;  2VQ7 A;  3CTY A;  3FIM B;  4USQ A;  2WOV A;  4A65 A;  4ADW A;  2OAM A;  2CDU A;  1N4V A;  3CPJ G;  2BS2 A;  3P4S A;  5KWF A;  4YTN A;  3ADA B;  3UKQ A;  4A99 A;  4X9N A;  3OC4 A;  1GER A;  1CHU A;  3K7T A;  4Z44 A;  4GRT A;  3NKS A;  4OCG A;  1E1L A;  1RSG A;  3FPZ A;  3URH A;  2WU5 A;  2OLN A;  1GRE A;  2EQ7 A;  2XDO A;  3M0O A;  4PAB A;  4K8D A;  4OPU A;  3VRD B;  2GMJ A;  4J33 A;  3BI4 A;  5IPY A; 
#chains in the Genus database with same CATH topology
 1VDC A;  4DHG A;  1P2H A;  1PHH A;  1YY5 A;  3NTD A;  3NVZ B;  3PK7 A;  1V97 A;  1O95 A;  1BKH A;  2BCG G;  3AE2 A;  1Y0P A;  3CPH G;  1PN0 A;  4A6N A;  2YVG A;  2OQY A;  3UTG A;  1E1K A;  4GYP C;  1GRT A;  2XVI A;  2XFU A;  1EL8 A;  4OPC A;  2B76 A;  2V6O A;  2HXU A;  2YVF A;  3B9J B;  2R46 A;  3SYI A;  1EBG A;  1H7W A;  1H84 A;  4JNA A;  2OO6 A;  5G5H B;  4EIQ A;  1EBD A;  1OEP A;  2Z5X A;  5BUK A;  4H2P A;  1E6E A;  3NVW B;  4H2N A;  1D5T A;  3K7M X;  2FKP A;  1FOH A;  5L46 A;  1H6V A;  2IID A;  3GDN A;  1M6I A;  3GYJ A;  3S61 A;  4H2R A;  3BNM A;  4DX3 A;  4H4V A;  1S2Y A;  2B9W A;  3ICS A;  4FI4 A;  3N6H A;  3Q9T A;  3SY4 A;  3NHO X;  3UTF A;  3NIX A;  2EQ8 A;  4AOS A;  3GD3 A;  1R0M A;  2GRT A;  2WDQ A;  4CCR A;  3DJE A;  3DFY A;  3UKL A;  3SJN A;  1ZK7 A;  4IZG A;  1LQT A;  3FXG A;  1M64 A;  3QFA A;  3NK1 X;  2JAE A;  4Z24 A;  2YQU A;  3NK2 X;  4J3Z A;  3IWA A;  4U8K A;  3STP A;  4HB9 A;  3RP8 A;  3PFR A;  1JEH A;  1CBO A;  3I6D A;  3AE6 A;  1CJ3 A;  4U8J A;  3NN6 X;  4FDC B;  3AE4 A;  4KT2 A;  3ZYX A;  1DOD A;  4A6N B;  2WPE A;  2YLS A;  4UP3 A;  2PU1 A;  5IQ1 A;  4Y4N A;  2RGJ A;  1REO A;  2VQB A;  3E1T A;  2BXS A;  4K22 A;  1JRX A;  1OJD A;  1S3B A;  2W3R A;  3DH9 A;  2Z5Y A;  4NEW A;  6ENL A;  2V60 A;  1Q1R A;  4II2 A;  4YSY A;  2WEU A;  2PA6 A;  1X2G A;  2PCE A;  3LJP A;  4TLX A;  4U8I A;  1SJB A;  3ZVH A;  4TVY A;  4WX1 A;  3NLC A;  4G7F A;  4CNJ A;  1H86 A;  4II3 A;  1NG3 A;  5BUL A;  4IP4 A;  2BAB A;  5C2T A;  2PGW A;  4GDE A;  2AR8 A;  1T3Q C;  4HCL A;  2R9Z A;  4BV6 A;  1PJ7 A;  1DOC A;  1F8W A;  4H4W A;  3ES7 A;  4EQS A;  3M12 A;  3VC6 A;  3H7V A;  3BHK A;  3CND A;  3DGH A;  3V3N A;  3CT2 A;  4A7A A;  2AL2 A;  5EB5 A;  2YG7 A;  4BK2 A;  4EM4 A;  1RM6 B;  3SXI A;  4GGH A;  3UKK A;  1NHR A;  1DJQ A;  3I6T A;  3K30 A;  4TLZ A;  2Q6U A;  1EL9 A;  1PBF A;  4A35 A;  4YWO A;  2OZT A;  2YLR A;  4JN9 A;  2C73 A;  3GMB A;  1FEA A;  5FS7 A;  2YAU A;  3VCN A;  1PXC A;  4YKG A;  1TDF A;  3BNU A;  4J1O A;  3R1Z A;  4M0X A;  3NRZ B;  3D46 A;  3RRA A;  1PDY A;  3DFH A;  3GRT A;  3GWF A;  3T2Z A;  1JRO A;  3ZVH B;  4CY8 A;  1DJN A;  1FHV A;  1FO4 A;  1ZXI C;  4J31 A;  4IP5 A;  1PXB A;  2WU2 A;  5CKU A;  3TWB A;  1OJ9 A;  3NYF A;  3CGD A;  1XAN A;  4D04 A;  1SJD A;  2VVM A;  3T37 A;  1JPD X;  3A7R A;  1VG9 A;  4KEM A;  1VQW A;  4K5R A;  3ALM A;  4B68 A;  1FFU C;  2PYX A;  2ZC8 A;  3DJD A;  2AL2 B;  2DKH A;  4H4X A;  1F3P A;  1GEU A;  3ICR A;  3QVP A;  1JNR A;  4OPD A;  3BHF A;  4DSH A;  3P4R A;  3IJQ A;  2OA1 A;  3IJL A;  1TDE A;  5U63 A;  2QAE A;  2R0P A;  3N6J A;  5DBJ A;  2PMQ A;  4H4S A;  1LVL A;  5FS6 A;  4I58 A;  2V61 A;  4B66 A;  4A6G A;  2XFO A;  2WQY A;  1SB3 B;  3MKC A;  3AED A;  3SGL A;  3SZC A;  3Q45 A;  1IUT A;  4GCM A;  1KNP A;  2C64 A;  5JCL A;  4GR1 A;  2YG4 A;  3DK9 A;  4YWS A;  2XVF A;  2QJN A;  2GAH B;  1UKV G;  2YG6 A;  3LB8 A;  3RIT A;  1O94 A;  4B1B A;  1GRB A;  1P2E A;  1N61 C;  2W55 A;  4DGK A;  5JCK A;  3V5C A;  4USR A;  2GQW A;  4TM4 A;  3NYC A;  1GET A;  1IUV A;  3DK4 A;  2BA9 A;  2HQM A;  1SJC A;  1PJ6 A;  1TKK A;  2X8C A;  4EMW A;  2VQ7 A;  2WOV A;  2CDU A;  2BS2 A;  4YTN A;  3OC4 A;  4OCG A;  3NVV B;  1E1L A;  1RSG A;  2WU5 A;  4PAB A;  4K8D A;  3VRD B;  4HPN A;  2BRA A;  4J33 A;  5IPY A;  3HYX A;  3DGZ A;  1VDV A;  4LII A;  4CBQ A;  3PS9 A;  3TTE A;  1NU5 A;  3ES8 A;  2GQF A;  4EWJ A;  3CNT A;  5BOE A;  3CXO A;  3FBS A;  3SZW A;  3CNJ A;  2BYB A;  1JPM A;  2P8B A;  5EOW A;  2RGH A;  3VRA A;  4B63 A;  1LQU A;  4TM0 A;  3PVC A;  2BCP A;  1EBH A;  1KN0 A;  1IYX A;  1PJ5 A;  4HN8 A;  3QPE A;  4MKS A;  5FJR A;  1O5W A;  3F8R A;  3CB3 A;  2BAC A;  2QGY A;  5KMP A;  3H12 A;  3SN1 A;  1TZZ A;  2GR3 A;  4RSL A;  3GD4 A;  1MRA A;  3UTH A;  3BSM A;  4TM3 A;  3DG7 A;  3S47 A;  4AP1 A;  1LJ1 A;  5CQF A;  4YSH A;  4C5O A;  4M6U A;  2XLT A;  2FJD A;  1N4U A;  2X99 A;  2I0Z A;  2A87 A;  4GFI A;  3UJE A;  3PO7 A;  1KCZ A;  2YM1 A;  1RYI A;  3AXB A;  2TMD A;  2QA2 A;  1KSU A;  1NHP A;  3COX A;  3GY1 A;  5U25 A;  3D9X A;  5IQ4 A;  3FYY A;  3LOV A;  3SSZ A;  2P88 A;  1KD0 A;  4IL0 A;  4H4P A;  4B69 A;  4IHC A;  3K1G A;  3R10 A;  3AE9 A;  5KXJ A;  1S2Q A;  1EC8 A;  5KMR A;  1ELS A;  4ROP A;  4E0V A;  1ZOY A;  3CXB A;  3H8L A;  3HYW A;  3EEZ A;  3Q4D A;  2JK6 A;  4J57 A;  4DXK A;  2PP0 A;  1KKR A;  3DDM A;  2P3Z A;  2ZZC A;  1IUU A;  4AOX A;  1P48 A;  1JDF A;  2XLS A;  4U2S A;  3UKP A;  2C4C A;  4NZH A;  2GF3 A;  3HZL A;  3IJI A;  4U8L A;  2QCU A;  4AT0 A;  2WDV A;  2YWL A;  1IJH A;  5G5G B;  1TDK A;  3T14 A;  1B37 A;  2GH5 A;  2PTW A;  3M13 A;  5HXI A;  3I4K A;  4WCT A;  3OZ2 A;  2E3T A;  1JU2 A;  2WP5 A;  3P93 A;  4GUV A;  3VC5 A;  1KNR A;  4XWZ A;  4CY6 A;  4NTC A;  3TQP A;  1GRA A;  4EQW A;  4LA1 A;  3DGB A;  2X50 A;  3Q6J A;  2POD A;  2FBW A;  4FK1 A;  1GTE A;  3GWD A;  1JRY A;  3KA7 A;  2BK5 A;  1XHC A;  1RVK A;  3SFD A;  4IL2 A;  4FX9 A;  2XYO A;  4EMI A;  1KF6 A;  1X2H A;  3II4 A;  3TW9 A;  2WP9 A;  4MGG A;  1N60 C;  5EBK A;  3UJF A;  1DOE A;  1IUW A;  2C75 A;  4YKF A;  1S7M A;  1KFY A;  3R0K A;  2EQ9 A;  2RAB A;  3PWI A;  1N5X A;  3DES A;  1L0V A;  5JCN A;  2EQ6 A;  2AKZ A;  4UDR A;  3JVA A;  4NTE A;  3KPF A;  1H7X A;  1PBD A;  4DSG A;  3HRD C;  3RNM A;  4EQR A;  1GRH A;  2H89 A;  4C3X A;  4ICY A;  3NTA A;  1ZMD A;  1PBB A;  3CGB A;  2E5A A;  1TRB A;  1SJA A;  4IVM B;  1H2I A;  3CAW A;  2GGH A;  2BC0 A;  3R11 A;  2WET A;  4J36 A;  3T6C A;  3SBF A;  4AP3 A;  2B7R A;  2OKT A;  1EC7 A;  1FCD A;  1YQZ A;  2H88 A;  3OP2 A;  4FP1 A;  1NPX A;  2GGJ A;  7ENL A;  4Z2U A;  2OG9 A;  4ZCC A;  1K4Q A;  4X9M A;  4H50 A;  1D4D A;  2CUL A;  1F6M A;  3JW7 A;  3RO6 A;  2CFY A;  3AMZ A;  2C7G A;  1ZY8 A;  1D7L A;  4Z2R A;  4TM1 A;  5U1O A;  3ABV A;  3AEG A;  3GRS A;  5M10 A;  3V5F A;  4EQX A;  4A5L A;  2R0C A;  4NWZ A;  2C66 A;  2V3B A;  2XVE A;  3OZY A;  2C67 A;  4XXG A;  4YSX A;  4YTM A;  1FHU A;  2O9Z A;  1D7Y A;  5FS9 A;  2WDR A;  2Y6R A;  1Z6L A;  3UP5 A;  3KU9 A;  3B6D A;  3KUM A;  2WBA A;  4U2T A;  2XLP A;  3CGE A;  1K0J A;  4H7U A;  3SQS A;  3UCL A;  2BC1 A;  4HYR A;  1GXF A;  3ZVI A;  3ISH A;  3BJS A;  3MQT A;  2BS3 A;  3NK0 X;  3A7A A;  3UKF A;  2XLU A;  3VR9 A;  1CJ2 A;  1VRQ B;  2GGG A;  3S5S A;  1VQZ A;  1OJA A;  1EL5 A;  1PS9 A;  4ZOH B;  3SFE A;  4C77 A;  1PDZ A;  4ZA0 A;  1YEY A;  4JY3 A;  1BGJ A;  3AE5 A;  4J34 A;  3SN0 A;  1GND A;  2WP6 A;  4D03 A;  4Y4L A;  4ADW A;  2OAM A;  3P4S A;  3ZLF A;  4ZCW A;  3UKQ A;  4GRT A;  2GGE A;  1GRE A;  2XDO A;  3M0O A;  4GIR A;  3AN1 A;  2GMJ A;  3BI4 A;  3R07 C;  4LU6 A;  3NNE A;  4U2L A;  4GAP A;  4YT0 A;  3V76 A;  3AB1 A;  3LAD A;  2FYM A;  2ZAD A;  1XPY A;  3UKA A;  3R25 A;  3GD6 A;  2GSH A;  3ZLH A;  3AD7 B;  2PP1 A;  3R0U A;  1ZKQ A;  1CL0 A;  3GDP A;  3V3O A;  2PTX A;  4ECH A;  2AKM A;  3IF9 A;  3VQR A;  1OJT A;  3IC9 A;  3B3R A;  1CC6 A;  2WOW A;  4KX6 A;  2WES A;  1JOA A;  1Y56 A;  4BK1 A;  1JRP A;  3SZ0 A;  2QDE A;  1ELI A;  2XFN A;  3UOX A;  4GF7 A;  3EAN A;  3AD9 B;  1GOS A;  1OJC A;  4O5U A;  3GC2 A;  2VZ2 A;  1CJ4 A;  1N5W C;  3R9U A;  4CCQ A;  5C3J A;  2X3N A;  5JCM A;  2J3N A;  3H8A A;  5FJU A;  3F8P A;  2FJB A;  2XH0 A;  3AYI A;  2O56 A;  4BK3 A;  1FEC A;  4E8G A;  4JHM A;  3FMW A;  3P4Q A;  5FJO A;  3T9P A;  2OLO A;  2YG3 A;  1K0I A;  4GDP A;  3MWC A;  2JB2 A;  4PAA A;  1MUC A;  3AE7 A;  4E4F A;  3QLD A;  3SN4 A;  3RR1 A;  4GIS A;  4CRT A;  2AL1 A;  4H4T A;  2C70 A;  2C72 A;  3BI5 A;  2GEW A;  4IA6 A;  2X8G A;  1MNS A;  2IVE A;  3KPK A;  2C3D A;  2R0G A;  3TJI A;  3GO2 A;  4C3Y A;  3FJ4 A;  3DIP A;  1W6T A;  1NHS A;  2GGI A;  2OLA A;  4H4Q A;  4IA5 A;  1IUX A;  1QLB A;  4E5T A;  2R4J A;  3HW2 A;  3NVY B;  3MUC A;  4FK1 C;  4O5Q A;  3RED A;  4MJW A;  2Q7V A;  3JZU A;  1YKJ A;  4Y4M A;  3UOV A;  1Y56 B;  1ONE A;  3VCC A;  1MOK A;  3HPF A;  1V59 A;  2YLZ A;  2Q0L A;  2IVD A;  1P43 A;  3AEB A;  3THU A;  2VRM A;  2ARD A;  4YSZ A;  3MSY A;  2BS4 A;  1HYU A;  2YR6 A;  3P0W A;  1B8S A;  5LV9 A;  5EB4 A;  3ZDN A;  5FJT A;  4H4Y A;  2WPC A;  2DW7 A;  1BZL A;  3RCY A;  1QO8 A;  5KVH A;  4HA6 A;  1EC9 A;  3GMC A;  3IHG A;  4NNJ A;  1FFV C;  3UJS A;  1QJD A;  3UP4 A;  1BF3 A;  4JDR A;  3UCC A;  3CYJ A;  3IHM A;  2RDX A;  3H70 A;  1H82 A;  1PDH A;  5KNL A;  5FMH A;  2XFP A;  2R45 A;  2E5V A;  2VRL A;  5ER0 A;  3NZG A;  1NG4 A;  3L8K A;  3AEA A;  3AE1 A;  1GPE A;  1LPF A;  3EKG A;  2C3C A;  1LTX R;  3CGC A;  3KLJ A;  1E1N A;  3CK5 A;  3NGC X;  2DKI A;  2JB1 A;  3CN8 A;  1VG0 A;  2PGE A;  1E39 A;  1F8S A;  3G5R A;  3GSI A;  3SQP A;  2V3A A;  2OZ8 A;  2ZZ0 A;  5EU9 A;  1L8P A;  4B65 A;  1DNC A;  4DYE A;  3SX6 A;  4G6G A;  5BOF A;  4P9S A;  1BQG A;  2GAG B;  1B5Q A;  2GR0 A;  1KDG A;  2APG A;  4X4J A;  1W4X A;  4K2X A;  4NTD A;  3WE0 A;  3QKE A;  2YLX A;  2UZZ A;  5JCI A;  3NFU A;  2HZG A;  1MDL A;  3EPT A;  1N4W A;  3EAO A;  3C4A A;  2MNR A;  3AE8 A;  5HYM A;  1YQ3 A;  3T8Q A;  3U4F A;  3OTR A;  1E7P A;  1BWC A;  3TWA A;  3VFC A;  2QDD A;  1MO9 A;  2RGO A;  2PTZ A;  4TVW A;  2XH4 A;  2C76 A;  3I3L A;  4AT2 A;  2E4G A;  1GTH A;  2PU0 A;  5KMQ A;  2FJA A;  3UOZ A;  3TJ4 A;  3D1C A;  3D47 A;  4JQ9 A;  4UDP A;  4E6M A;  5FS8 A;  2W54 A;  4APN A;  4BJY A;  5GSN A;  2BK4 A;  1H81 A;  4JY2 A;  3P1W A;  3CMM A;  1TDN A;  2VVL A;  5BVA A;  4U8M A;  5HHF A;  1TE6 A;  1DTN A;  2OZ3 A;  1GES A;  1R6W A;  1NEK A;  1SEZ A;  2XCG A;  4F4R A;  3QSS A;  1E9I A;  2WOI A;  2AAQ A;  3CNS A;  4H1Z A;  1JRZ A;  3NT6 A;  1NHQ A;  4ZCD A;  4GGB A;  2PPG A;  3MY9 A;  2YLW A;  3AEF A;  3L1R A;  1WYG A;  3CTY A;  2AQJ A;  4A65 A;  1JCT A;  5KWF A;  3OW1 A;  3ADA B;  3TOY A;  4X9N A;  4A99 A;  1GER A;  1CHU A;  3K7T A;  4Z44 A;  3NKS A;  4KWS A;  3FPZ A;  3URH A;  2OLN A;  1ECQ A;  3QTP A;  4OPU A;  4G74 A;  4G9K A;  3NN0 X;  1AOG A;  4Z43 A;  2CVJ A;  1LV0 A;  5KVI A;  1GRF A;  4Z1Y A;  3S5W A;  4B64 A;  4YTP A;  4BUR A;  3G5Q A;  2JKC A;  4U8N A;  1ZMC A;  4MMW A;  2X8H A;  1XDI A;  4XWR A;  2POZ A;  4RG3 A;  2QVH A;  1DXL A;  3RP7 A;  5J60 A;  5J7X A;  1BGN A;  3P9U A;  2YR4 A;  1K0L A;  1ZOV A;  4HNL A;  2JB3 A;  1CC4 A;  4ZN0 A;  3T31 A;  3U9I A;  1GAL A;  1PBC A;  2BK3 A;  4RG4 A;  3KVE A;  1D4C A;  3H8I A;  4K2S A;  2OX4 A;  1CC2 A;  3UKH A;  3T0K A;  4HCD A;  5GRT A;  4K5S A;  1H83 A;  4GYP A;  2OQH A;  4J2W A;  2PTY A;  3ALL A;  3AYJ A;  1MXT A;  3ALJ A;  2WPF A;  1Q9I A;  2E1M A;  3T4W A;  3DK8 A;  4REK A;  4M52 A;  1GT8 A;  3NXL A;  3OPS A;  1STZ A;  2XLR A;  3SZF A;  5JRB A;  2QQ6 A;  4IT1 A;  1B4V A;  5BRT A;  3ATQ A;  2GR2 A;  3UXK A;  3D8X A;  5KOX A;  3KD9 A;  1KSS A;  4Z25 A;  2BRY A;  1ZX9 A;  2HNE A;  4HNC A;  1COY A;  3F8D A;  4Z2T A;  3CIR A;  3EF6 A;  3PG6 A;  2MUC A;  2DW6 A;  4H83 A;  3H4K A;  2GDQ A;  2YVJ A;  2PHH A;  4A9W A;  3QN3 A;  2R4E A;  3UGV A;  4OVI A;  1WUE A;  3NYE A;  4EM3 A;  2P0I A;  2YLT A;  3ATR A;  3T2K A;  3VDG A;  4X2P A;  3AEC A;  1BKW A;  3PWG A;  5KOW A;  4CNK A;  2VVL G;  4U8P A;  1ONF A;  3DME A;  2NQL A;  3RHA A;  4K7Z A;  2OPJ A;  5FJP A;  1PBE A;  1WUF A;  4A79 A;  4N9X A;  1JNZ A;  3V4B A;  2Y6Q A;  3BOX A;  4H2H A;  1X31 B;  1TYP A;  1YQ4 A;  2A8X A;  3UJR A;  3NG7 X;  2QA1 A;  4C74 A;  1E1M A;  3UTE A;  3BI2 A;  4DWD A;  1NDA A;  1NAA A;  3RGT A;  4EMJ A;  1L9C A;  2B9Y A;  4G6H A;  3VR8 A;  3B97 A;  2ZZB A;  3GYX A;  2WHD A;  3UJ2 A;  2YR5 A;  1FIQ B;  5ENL A;  3C96 A;  4H4Z A;  1ZP0 A;  1CJC A;  3AEE A;  1XPQ A;  1D4E A;  4DN1 A;  3RP6 A;  3FG2 P;  3C4N A;  4YXD A;  3UXL A;  1S3E A;  1ZDL A;  2TPR A;  1NEL A;  3AWI A;  1GV4 A;  3TCS A;  3DJJ A;  3NRN A;  2GL5 A;  4GME A;  3JSK A;  3QVR A;  4JNQ A;  3ETR B;  2GMH A;  3CPI G;  2XGZ A;  3N4F A;  2XSX A;  4G73 A;  1L9E A;  3EUB 3;  4H4U A;  5IDZ A;  3T2Y A;  4EIP A;  4OPL A;  3IK4 A;  4NEV A;  3FVD A;  3OZM A;  1GSN A;  3UOY A;  3LZW A;  2XH2 A;  4B67 A;  1XS2 A;  4JN8 A;  3K7Q X;  3V3W A;  2ACZ A;  4J56 A;  3QSE A;  3VA8 A;  3P3B A;  4Z26 A;  1DOB A;  1PXA A;  4BJZ A;  5KRQ A;  4IVO B;  2Q0K A;  3FV9 A;  3AE3 A;  4IV9 A;  2XH7 A;  3HYV A;  2A89 A;  4I59 A;  3P4P A;  4GAV A;  2P8C A;  3DER A;  1N1P A;  1RP0 A;  2GR1 A;  5J04 A;  4H2Q A;  1N63 C;  3A7U A;  1L9D A;  2PSN A;  2BXR A;  3FCP A;  4ENL A;  1EL7 A;  1FL2 A;  3DG3 A;  4E4U A;  1F9C A;  2OFJ A;  1CF3 A;  2V5Z A;  3AD8 B;  3SM8 A;  4DNA A;  3LZX A;  4KPL A;  4K8G A;  3O0H A;  3KKJ A;  3ITJ A;  1GRG A;  4KPR A;  1NEN A;  4OPI A;  3MZN A;  3QSM A;  3CNP A;  3AYL A;  3QFB A;  2PS2 A;  3UCD A;  3GYI A;  5HY5 A;  2YG5 A;  1TDO A;  3DG6 A;  3DA1 A;  3NH3 X;  2B7S A;  4JN7 A;  2WS3 A;  2B9X A;  2GB0 A;  3N4E A;  1N62 C;  4OPG A;  4K1W A;  4A3R A;  2ZBW A;  3AM9 A;  3VRB A;  2GV8 A;  2GVC A;  1TYT A;  2HXT A;  4H19 A;  3G5S A;  3DJG X;  3SR6 B;  1Q1W A;  1F8R A;  2NPX A;  2PP3 A;  2JBV A;  2ONE A;  3L5O A;  1IUS A;  3LXD A;  2QJM A;  2C65 A;  2FJE A;  5TR3 A;  2W3S A;  4H4R A;  2QJJ A;  1KKO A;  3ICT A;  3QJ4 A;  1FEB A;  2F5Z A;  4UDQ A;  3ENL A;  2NVK X;  2W0H A;  2XFQ A;  1MDR A;  2CHR A;  2I5Q A;  4Z17 A;  2YM2 A;  3DEQ A;  2VOU A;  4OPT A;  2OAL A;  2XVJ A;  5M0Z A;  4U8O A;  4HCH A;  2XVH A;  5KMS A;  3FIM B;  4USQ A;  1N4V A;  3CPJ G;  3NS1 B;  2OVL A;  3NO1 A;  4G8T A;  2EQ7 A;  3I6E A;  3ZLG A; 
#chains in the Genus database with same CATH homology
 1VDC A;  3NN0 X;  4LU6 A;  1AOG A;  3DGZ A;  3NNE A;  4U2L A;  1P2H A;  1PHH A;  4Z43 A;  1YY5 A;  3NTD A;  2CVJ A;  1LV0 A;  4GAP A;  4YT0 A;  3V76 A;  4LII A;  3AB1 A;  5KVI A;  4CBQ A;  1O95 A;  3LAD A;  1GRF A;  3PS9 A;  2BCG G;  3AE2 A;  1Y0P A;  3UKA A;  3CPH G;  3S5W A;  4B64 A;  1PN0 A;  4A6N A;  4YTP A;  4BUR A;  2YVG A;  2GQF A;  2JKC A;  3G5Q A;  4U8N A;  1ZMC A;  3CNT A;  3UTG A;  2X8H A;  1XDI A;  1E1K A;  4XWR A;  4RG3 A;  3FBS A;  3AD7 B;  1DXL A;  3SZW A;  1GRT A;  1ZKQ A;  3CNJ A;  2BYB A;  3RP7 A;  2XVI A;  5J60 A;  5EOW A;  2RGH A;  2XFU A;  5J7X A;  1EL8 A;  1BGN A;  3VRA A;  4B63 A;  1CL0 A;  3GDP A;  4OPC A;  1LQU A;  2B76 A;  3P9U A;  4TM0 A;  3V3O A;  2V6O A;  2YR4 A;  2YVF A;  1K0L A;  1ZOV A;  4ECH A;  3PVC A;  2JB3 A;  2BCP A;  1CC4 A;  3IF9 A;  3T31 A;  2R46 A;  3SYI A;  3VQR A;  4ZN0 A;  1OJT A;  3IC9 A;  1KN0 A;  1H7W A;  3B3R A;  1GAL A;  1PBC A;  1H84 A;  1PJ5 A;  1CC6 A;  4JNA A;  2WOW A;  4KX6 A;  2BK3 A;  4EIQ A;  1EBD A;  4RG4 A;  2Z5X A;  3KVE A;  1D4C A;  3H8I A;  5BUK A;  2WES A;  4H2P A;  1CC2 A;  1E6E A;  3UKH A;  3T0K A;  4H2N A;  1D5T A;  1O5W A;  3F8R A;  1JOA A;  5GRT A;  4K5S A;  3K7M X;  1H83 A;  2BAC A;  1Y56 A;  4BK1 A;  5KMP A;  4RSL A;  2GR3 A;  3GD4 A;  1FOH A;  4J2W A;  5L46 A;  1H6V A;  2IID A;  3ALL A;  3GDN A;  3SZ0 A;  3UTH A;  1ELI A;  1M6I A;  2XFN A;  3AYJ A;  3GYJ A;  4TM3 A;  3S61 A;  1MXT A;  4H2R A;  3ALJ A;  3BNM A;  3UOX A;  4GF7 A;  2WPF A;  3EAN A;  4H4V A;  1Q9I A;  1S2Y A;  2B9W A;  2E1M A;  3ICS A;  4AP1 A;  3Q9T A;  3DK8 A;  3AD9 B;  3SY4 A;  1GOS A;  1LJ1 A;  5CQF A;  1OJC A;  3NHO X;  4O5U A;  3UTF A;  3NIX A;  4YSH A;  2VZ2 A;  4C5O A;  2EQ8 A;  4REK A;  2XLT A;  4AOS A;  1CJ4 A;  3GD3 A;  3R9U A;  4M52 A;  1GT8 A;  4CCQ A;  2FJD A;  5C3J A;  2GRT A;  2XLR A;  1N4U A;  2WDQ A;  5JCM A;  2X3N A;  2X99 A;  2J3N A;  3SZF A;  2I0Z A;  2A87 A;  4CCR A;  3PO7 A;  3F8P A;  5JRB A;  2FJB A;  3DJE A;  2YM1 A;  1RYI A;  3AXB A;  3AYI A;  2TMD A;  2QA2 A;  3UKL A;  1KSU A;  1ZK7 A;  1LQT A;  1B4V A;  5BRT A;  1NHP A;  3ATQ A;  2GR2 A;  3COX A;  5U25 A;  3D8X A;  4BK3 A;  1FEC A;  5KOX A;  3D9X A;  1M64 A;  1KSS A;  3KD9 A;  3QFA A;  3NK1 X;  4Z25 A;  5IQ4 A;  3LOV A;  2BRY A;  2JAE A;  3FMW A;  1ZX9 A;  4Z24 A;  3P4Q A;  1COY A;  3F8D A;  4H4P A;  2YQU A;  2OLO A;  2YG3 A;  3NK2 X;  3CIR A;  3EF6 A;  3PG6 A;  1K0I A;  4B69 A;  4Z2T A;  4GDP A;  3IWA A;  4U8K A;  2JB2 A;  3AE9 A;  4PAA A;  1S2Q A;  5KXJ A;  3H4K A;  3AE7 A;  5KMR A;  4HB9 A;  3RP8 A;  2YVJ A;  4E0V A;  2PHH A;  4A9W A;  1ZOY A;  1JEH A;  1CBO A;  3H8L A;  3HYW A;  3I6D A;  3AE6 A;  2JK6 A;  4J57 A;  1CJ3 A;  2R4E A;  4CRT A;  4OVI A;  2C72 A;  4H4T A;  2C70 A;  3BI5 A;  3NYE A;  4EM3 A;  2GEW A;  4U8J A;  3NN6 X;  4IA6 A;  2X8G A;  2ZZC A;  4FDC B;  2YLT A;  3AE4 A;  1DOD A;  2IVE A;  1IUU A;  3ATR A;  2WPE A;  3KPK A;  3T2K A;  3ZYX A;  4A6N B;  4AOX A;  2C3D A;  2R0G A;  2YLS A;  2XLS A;  4UP3 A;  4C3Y A;  3AEC A;  5IQ1 A;  1BKW A;  5KOW A;  1NHS A;  4Y4N A;  4U2S A;  4CNK A;  2VVL G;  4U8P A;  2RGJ A;  1ONF A;  4H4Q A;  1REO A;  3DME A;  4IA5 A;  2C4C A;  4NZH A;  1IUX A;  2GF3 A;  3HZL A;  3UKP A;  2VQB A;  4U8L A;  1QLB A;  2QCU A;  2R4J A;  4K7Z A;  3E1T A;  2BXS A;  4K22 A;  3RHA A;  4AT0 A;  1JRX A;  1PBE A;  2WDV A;  2YWL A;  1OJD A;  1S3B A;  1IJH A;  4A79 A;  1TDK A;  4N9X A;  3T14 A;  4FK1 C;  1JNZ A;  1B37 A;  4O5Q A;  2GH5 A;  3DH9 A;  2Z5Y A;  3RED A;  4NEW A;  2Y6Q A;  3M13 A;  5HXI A;  1X31 B;  1TYP A;  1YQ4 A;  2Q7V A;  4MJW A;  4WCT A;  2A8X A;  3OZ2 A;  2V60 A;  3NG7 X;  1YKJ A;  4Y4M A;  2QA1 A;  3UOV A;  1JU2 A;  1Q1R A;  4C74 A;  4II2 A;  1E1M A;  3UTE A;  4YSY A;  2WP5 A;  3BI2 A;  4GUV A;  1Y56 B;  1KNR A;  1NDA A;  2WEU A;  4XWZ A;  1MOK A;  4CY6 A;  1V59 A;  1NAA A;  4NTC A;  2YLZ A;  1GRA A;  2Q0L A;  4EQW A;  2IVD A;  4EMJ A;  3LJP A;  4LA1 A;  3AEB A;  1L9C A;  2B9Y A;  4G6H A;  4TLX A;  4U8I A;  2VRM A;  4WX1 A;  2X50 A;  3NLC A;  3Q6J A;  3VR8 A;  4CNJ A;  2ARD A;  4YSZ A;  2BS4 A;  1H86 A;  1HYU A;  4II3 A;  1NG3 A;  5BUL A;  2FBW A;  4FK1 A;  2ZZB A;  3GYX A;  1GTE A;  2YR6 A;  3GWD A;  2BAB A;  1B8S A;  2WHD A;  5C2T A;  5LV9 A;  4GDE A;  5EB4 A;  2YR5 A;  1JRY A;  2AR8 A;  3KA7 A;  3C96 A;  2R9Z A;  1XHC A;  2BK5 A;  4H4Z A;  1ZP0 A;  1CJC A;  3ZDN A;  3SFD A;  4BV6 A;  3AEE A;  1PJ7 A;  1DOC A;  1XPQ A;  1D4E A;  4H4Y A;  4FX9 A;  2XYO A;  2WPC A;  4EMI A;  1F8W A;  3FG2 P;  4H4W A;  3RP6 A;  1KF6 A;  3C4N A;  4EQS A;  1BZL A;  3M12 A;  3II4 A;  1QO8 A;  2WP9 A;  4YXD A;  5KVH A;  1S3E A;  3BHK A;  3GMC A;  3IHG A;  4HA6 A;  1ZDL A;  2TPR A;  3AWI A;  4NNJ A;  1GV4 A;  5EBK A;  3DJJ A;  3CND A;  3NRN A;  3DGH A;  3V3N A;  1DOE A;  1QJD A;  3UP4 A;  1IUW A;  2C75 A;  4A7A A;  1BF3 A;  4YKF A;  3JSK A;  5EB5 A;  4JDR A;  3IHM A;  1S7M A;  3QVR A;  1KFY A;  1H82 A;  1PDH A;  2YG7 A;  4JNQ A;  2EQ9 A;  2RAB A;  4EM4 A;  5FMH A;  2GMH A;  3CPI G;  2XFP A;  4BK2 A;  5KNL A;  2R45 A;  2E5V A;  4G73 A;  1L0V A;  1L9E A;  3SXI A;  4H4U A;  3T2Y A;  3UKK A;  5JCN A;  2EQ6 A;  2VRL A;  4EIP A;  5ER0 A;  1NHR A;  1DJQ A;  4UDR A;  3K30 A;  4OPL A;  1NG4 A;  4TLZ A;  4NEV A;  3L8K A;  4NTE A;  3KPF A;  3AEA A;  2Q6U A;  1EL9 A;  1GSN A;  3AE1 A;  1H7X A;  1PBD A;  4DSG A;  1GPE A;  3UOY A;  1LPF A;  3RNM A;  1PBF A;  2C3C A;  4YWO A;  4EQR A;  1GRH A;  3LZW A;  1LTX R;  4B67 A;  2H89 A;  2YLR A;  4C3X A;  3CGC A;  4ICY A;  4JN9 A;  3NTA A;  1ZMD A;  3KLJ A;  3CGB A;  1E1N A;  1PBB A;  2C73 A;  1FEA A;  2ACZ A;  2DKI A;  4J56 A;  3GMB A;  3K7Q X;  5FS7 A;  3NGC X;  2JB1 A;  3QSE A;  1DOB A;  4Z26 A;  3CN8 A;  2YAU A;  1PXA A;  1VG0 A;  4BJZ A;  1PXC A;  1E39 A;  3GSI A;  1F8S A;  1TRB A;  3G5R A;  4IVO B;  2Q0K A;  5KRQ A;  3AE3 A;  4IVM B;  1H2I A;  4IV9 A;  3SQP A;  2V3A A;  4YKG A;  3HYV A;  2A89 A;  4I59 A;  3P4P A;  2ZZ0 A;  1TDF A;  3BNU A;  2BC0 A;  4GAV A;  2WET A;  1N1P A;  1RP0 A;  2GR1 A;  4B65 A;  4J36 A;  1DNC A;  4AP3 A;  2B7R A;  3SX6 A;  4G6G A;  4H2Q A;  3GRT A;  4P9S A;  1L9D A;  3GWF A;  2BXR A;  1FCD A;  3T2Z A;  1YQZ A;  2H88 A;  1EL7 A;  2GAG B;  1B5Q A;  4CY8 A;  1FL2 A;  1DJN A;  2GR0 A;  1NPX A;  1KDG A;  2APG A;  1W4X A;  4X4J A;  4K2X A;  4NTD A;  4Z2U A;  3WE0 A;  1CF3 A;  2V5Z A;  3AD8 B;  2YLX A;  4J31 A;  3SM8 A;  2UZZ A;  5JCI A;  1PXB A;  4ZCC A;  4DNA A;  3LZX A;  1K4Q A;  2WU2 A;  3O0H A;  1N4W A;  3EPT A;  4X9M A;  4H50 A;  3KKJ A;  3EAO A;  3ITJ A;  1D4D A;  2CUL A;  3C4A A;  5CKU A;  1GRG A;  1OJ9 A;  4KPR A;  3AE8 A;  1F6M A;  3NYF A;  3CGD A;  1XAN A;  2CFY A;  1NEN A;  4D04 A;  5HYM A;  2VVM A;  4OPI A;  3T37 A;  1VG9 A;  1YQ3 A;  2C7G A;  1ZY8 A;  1D7L A;  4Z2R A;  1VQW A;  3QSM A;  4K5R A;  4TM1 A;  1E7P A;  1BWC A;  5U1O A;  3CNP A;  3ABV A;  3AEG A;  3AYL A;  3QFB A;  3ALM A;  4B68 A;  3GRS A;  5M10 A;  3GYI A;  5HY5 A;  2PYX A;  2YG5 A;  1MO9 A;  3DJD A;  1TDO A;  2DKH A;  2RGO A;  4H4X A;  3DA1 A;  1F3P A;  1GEU A;  3ICR A;  4EQX A;  2C76 A;  3I3L A;  3QVP A;  4A5L A;  1JNR A;  3NH3 X;  4OPD A;  2B7S A;  2E4G A;  2R0C A;  4NWZ A;  4AT2 A;  1GTH A;  3BHF A;  2C66 A;  4DSH A;  3P4R A;  2V3B A;  2XVE A;  2WS3 A;  5KMQ A;  2C67 A;  2OA1 A;  2B9X A;  2FJA A;  2GB0 A;  4XXG A;  4YSX A;  4YTM A;  3UOZ A;  2O9Z A;  1TDE A;  3D1C A;  4OPG A;  5U63 A;  2QAE A;  1D7Y A;  5FS9 A;  2R0P A;  2WDR A;  2Y6R A;  1Z6L A;  2ZBW A;  4JQ9 A;  3UP5 A;  4UDP A;  3VRB A;  3KU9 A;  5DBJ A;  2GV8 A;  2GVC A;  1TYT A;  3G5S A;  3B6D A;  3DJG X;  4H4S A;  5FS8 A;  1LVL A;  5FS6 A;  1Q1W A;  1F8R A;  2WBA A;  4I58 A;  2V61 A;  4APN A;  2NPX A;  4U2T A;  4B66 A;  2XLP A;  3CGE A;  2JBV A;  1K0J A;  4BJY A;  4H7U A;  2XFO A;  3UCL A;  2BC1 A;  3L5O A;  2WQY A;  5GSN A;  1GXF A;  2BK4 A;  1H81 A;  3ISH A;  4JY2 A;  3P1W A;  3AED A;  1IUS A;  1TDN A;  3CMM A;  3LXD A;  2VVL A;  5BVA A;  4U8M A;  2C65 A;  2BS3 A;  3SGL A;  3NK0 X;  5HHF A;  2FJE A;  3SZC A;  3UKF A;  5TR3 A;  2XLU A;  1IUT A;  4GCM A;  3VR9 A;  1KNP A;  1CJ2 A;  2C64 A;  4H4R A;  1VRQ B;  3ICT A;  3QJ4 A;  1FEB A;  1GES A;  5JCL A;  4GR1 A;  2F5Z A;  3DK9 A;  1NEK A;  1SEZ A;  2YG4 A;  4UDQ A;  1OJA A;  2NVK X;  2XCG A;  2W0H A;  1EL5 A;  2XVF A;  2XFQ A;  3QSS A;  1PS9 A;  2WOI A;  2GAH B;  1UKV G;  2YG6 A;  2AAQ A;  3LB8 A;  3SFE A;  4C77 A;  4B1B A;  1O94 A;  1GRB A;  3CNS A;  1P2E A;  1JRZ A;  3NT6 A;  1NHQ A;  4DGK A;  4ZCD A;  2YM2 A;  5JCK A;  4JY3 A;  2VOU A;  1BGJ A;  3AE5 A;  4OPT A;  4J34 A;  2GQW A;  4USR A;  4TM4 A;  3NYC A;  2OAL A;  1GET A;  1IUV A;  2XVJ A;  3DK4 A;  2YLW A;  1GND A;  3AEF A;  3L1R A;  2XVH A;  4U8O A;  5M0Z A;  2WP6 A;  4D03 A;  2BA9 A;  2HQM A;  5KMS A;  1PJ6 A;  4Y4L A;  2X8C A;  4EMW A;  2AQJ A;  2VQ7 A;  3CTY A;  3FIM B;  4USQ A;  2WOV A;  4A65 A;  4ADW A;  2OAM A;  2CDU A;  1N4V A;  3CPJ G;  2BS2 A;  3P4S A;  5KWF A;  4YTN A;  3ADA B;  3UKQ A;  4A99 A;  4X9N A;  3OC4 A;  1GER A;  1CHU A;  3K7T A;  4Z44 A;  4GRT A;  3NKS A;  4OCG A;  1E1L A;  1RSG A;  3FPZ A;  3URH A;  2WU5 A;  2OLN A;  1GRE A;  2EQ7 A;  2XDO A;  3M0O A;  4PAB A;  4K8D A;  4OPU A;  3VRD B;  2BRA A;  2GMJ A;  4G74 A;  4G9K A;  4J33 A;  3BI4 A;  5IPY A;  3HYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...