3KLJA

Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
378
structure length
378
Chain Sequence
KSTKILILGAGPAGFSAAKAALGKCDDITMINSEKYLPYYRPRLNEIIAKNKSIDDILIKKNDWYEKNNIKVITSEFATSIDPNNKLVTLKSGEKIKYEKLIIASGSIANKIKVPHADEIFSLYSYDDALKIKDECKNKGKAFIIGGGILGIELAQAIIDSGTPASIGIILEYPLERQLDRDGGLFLKDKLDRLGIKIYTNSNFEEMGDLIRSSCVITAVGVKPNLDFIKDTEIASKRGILVNDHMETSIKDIYACGDVAEFYGKNPGLINIANKQGEVAGLNACGEDASYSEIIPSPILKVSGISIISCGDIENNKPSKVFRSTQEDKYIVCMLKENKIDAAAVIGDVSLGTKLKKAIDSSKSFDNISSLDAILNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(FAD)-dependent dehydrogenase, NirB-family (N-terminal do
publication title Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Oxidoreductase
total genus 117
structure length 378
sequence length 378
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18267 Rubredoxin_C Rubredoxin NAD+ reductase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3kljA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kljA02
1S3EA 2J3NA 3NYFA 4YKFA 2XVIA 2WESA 4Y4MA 3RP8A 3GWDA 4NTEA 1NHPA 3HZLA 1EL9A 3PS9A 1GREA 4USQA 3UCLA 2DKHA 2FJBA 3ADAB 3PVCA 4EQXA 5HXIA 1B8SA 4C74A 3ICTA 4YTMA 1PXCA 2JB3A 3NRNA 1CJ3A 3FG2P 1NHRA 1TYTA 3LADA 2VRMA 3REDA 3VRAA 2V3AA 2R46A 2RGOA 3P1WA 3AEBA 1L9EA 3AB1A 5JCNA 4EMJA 3UP4A 1X31B 3C4NA 3NN6X 2X8GA 2YLXA 3CPHG 1M6IA 3RNMA 4A7AA 1PBEA 3DJJA 3VRDB 1GRFA 1N1PA 2YLSA 4IA5A 3D1CA 1FCDA 1H82A 3EANA 4Z2UA 2PHHA 4B1BA 2Q0LA 3NN0X 2VQ7A 1SEZA 1D4EA 2X50A 4YSHA 1EL8A 2BCPA 2A8XA 2YR6A 3AE1A 2X8CA 3BI4A 2ZZ0A 1F8RA 3FIMB 2XYOA 2V5ZA 3LZXA 3JSKA 2BABA 3ICRA 3GDNA 1D7LA 4A65A 3VR9A 4CY8A 4OPUA 2UZZA 3KD9A 4Z25A 3DGHA 1KNPA 3CGDA 1E1MA 1REOA 3BNMA 3NYCA 1N4VA 5KOWA 4TM3A 3UKHA 2TPRA 2V3BA 3AE9A 3S61A 1ZMDA 3DH9A 1OJCA 3P4SA 2JAEA 1IJHA 2XVJA 3KA7A 2YG3A 4NTCA 5JCMA 3QFAA 4D03A 4H4YA 4H4SA 3L1RA 2B7SA 3VQRA 2XFNA 5GRTA 1BZLA 2B9XA 3O0HA 1D5TA 3CGBA 3CGEA 2A89A 3BI2A 3CN8A 4Y4LA 2Z5YA 3AEFA 1GRTA 2Z5XA 3AD9B 3GDPA 2XLUA 2WOVA 2DKIA 3V3OA 1CC2A 5EB4A 4AT2A 3GRTA 1EBDA 2VOUA 1FL2A 1P2HA 2BK5A 3LJPA 4JNQA 3SM8A 1PXAA 4JQ9A 2WP9A 1GTEA 1F3PA 1VQWA 4OPDA 2X3NA 4OPCA 4C3YA 3I6DA 5KOXA 1LQTA 1DNCA 1VG0A 5J7XA 1LPFA 3KPFA 3CGCA 2YG6A 3ALMA 4B69A 2JB1A 3G5RA 4FK1A 2GVCA 5IQ1A 4A99A 2WEUA 4OPLA 3DK8A 1GPEA 2CVJA 4B65A 3AECA 2FJDA 3UKLA 3AD7B 4K22A 2VZ2A 2GAGB 3NGCX 2RGJA 4H4TA 3NYEA 1NHQA 2VQBA 2HQMA 1PBBA 2C66A 3LXDA 5FS6A 4O5UA 4ECHA 5U1OA 1E1KA 2EQ6A 1CC4A 1N4UA 3UOZA 2ARDA 3UP5A 2XVEA 3M13A 1ZKQA 3NTAA 1DOEA 3IHMA 3GMBA 2YG7A 3B3RA 1JRZA 4DSGA 4YT0A 2BYBA 3IF9A 1YQ3A 4O5QA 4RG4A 5DBJA 5BUKA 1TDNA 2XLSA 4Z24A 1Y56B 2GV8A 3H4KA 4CY6A 1RSGA 2GQWA 1EL7A 5FS7A 1CBOA 3RP7A 4A79A 2ZZBA 3VR8A 1IUTA 1H7WA 1DOBA 4OVIA 2X99A 3QVRA 1ZK7A 3DA1A 2EQ7A 1CL0A 3UOXA 1M64A 1F8SA 1B5QA 2XDOA 4H50A 3IHGA 4ZCDA 1GRHA 2OA1A 1LVLA 2H89A 1O95A 1LV0A 3NTDA 1XDIA 2Y6RA 3UOYA 2C65A 1H81A 1GEUA 1Z6LA 3GYJA 1IUXA 2YWLA 3CPJG 1PS9A 2WS3A 2R0CA 4OPTA 4GRTA 2YM2A 5CQFA 4TM4A 2WOWA 1GRBA 1CJCA 4GF7A 3Q9TA 4U2LA 5EOWA 4YSXA 1LTXR 4H2QA 1CC6A 5FS8A 4J56A 2I0ZA 1FEBA 4K5RA 4P9SA 4H4RA 1GALA 4E0VA 1E7PA 4LIIA 1QJDA 1H6VA 3GMCA 2V60A 2E1MA 3CNTA 3VRBA 5FMHA 2C64A 3UOVA 3AYIA 1MXTA 1O5WA 4XWRA 3S5WA 3IC9A 1KF6A 5BRTA 3DGZA 1KDGA 4UDRA 1L9DA 2XVFA 4H4ZA 3WE0A 4CCQA 1ZOYA 3GD3A 1GRGA 4HB9A 2XFOA 3PO7A 4C5OA 4B66A 3BHFA 3GYIA 3EF6A 1DJQA 1LQUA 3COXA 3AEAA 3AWIA 4K7ZA 3K7QX 4B64A 4ICYA 5ER0A 1LJ1A 2C72A 2R9ZA 1BKWA 1ZX9A 4EM3A 2Q7VA 1YQZA 3AD8B 4TM0A 4FDCB 1CJ4A 4U8NA 4JY3A 1JOAA 4NEWA 5EBKA 1TDKA 4D04A 1W4XA 1YKJA 1NHSA 3LOVA 3UTHA 4BK1A 5KXJA 1Q1RA 3DJDA 2WU2A 4J2WA 4K8DA 2Q0KA 2OLNA 2VVMA 2WDRA 2YG4A 1S2QA 4RSLA 4XWZA 2CULA 2YR4A 3NNEA 2QAEA 3IWAA 2V61A 4UDQA 3QSEA 4DSHA 2GAHB 2H88A 1TDOA 2GR3A 2QCUA 3AEGA 3CNDA 4U2TA 4YTPA 1P2EA 4J31A 3AE2A 3NLCA 4ZN0A 1OJTA 3AE4A 2YVJA 2NPXA 1E1NA 4A6NB 1DXLA 3RHAA 2IIDA 2W0HA 4U8KA 1V59A 3QVPA 4FX9A 2C7GA 1VRQB 2YVFA 2BS4A 1VG9A 3DJGX 2A87A 3ICSA 3ITJA 5GSNA 3OC4A 4AOSA 5L46A 1D7YA 2XLPA 3AE7A 4REKA 3V3NA 1COYA 1GTHA 2ACZA 2FJAA 4C3XA 3CNSA 3ZDNA 2WP6A 2PYXA 4C77A 1BF3A 1KNRA 1NAAA 3R9UA 4CRTA 4I59A 2BXSA 1OJDA 3FPZA 4OPIA 2GR2A 3URHA 1N4WA 2C70A 2IVEA 3AE3A 4WX1A 5JCLA 2XLTA 2IVDA 1BGNA 1B37A 1B4VA 4JY2A 3ALJA 4Z2TA 2R4JA 2CFYA 3P4PA 2WOIA 4PABA 2GMHA 2WU5A 2B7RA 1MO9A 1OJ9A 2C73A 2VVLA 3BNUA 2C75A 3CNJA 2F5ZA 4DGKA 4J57A 4GUVA 4UDPA 4CNKA 4H2PA 1PJ6A 2BXRA 3G5SA 2WPFA 2QA2A 3DMEA 3AEEA 4BJYA 3ABVA 3KKJA 3P4QA 1KFYA 2XFUA 3D8XA 1CJ2A 4GDEA 2V6OA 3RP6A 5HY5A 2O9ZA 1NENA 3AE5A 3QSSA 3ALLA 3UKPA 1YY5A 2XCGA 4HA6A 4U8OA 5IQ4A 4IVMB 4XXGA 4U8MA 3F8RA 2EQ8A 1E1LA 4CNJA 3K30A 4LA1A 1TYPA 2GR0A 1EL5A 4WCTA 4GCMA 3SGLA 4ZCCA 2YR5A 5TR3A 2WETA 2FJEA 2YVGA 1GNDA 1FEAA 1TRBA 3LZWA 3UKFA 2BACA 4OCGA 4H4PA 1K0LA 3NT6A 1NDAA 4FK1C 1IUUA 1GOSA 1ELIA 2NVKX 4H7UA 1H7XA 4NZHA 2BC1A 4YTNA 4APNA 1JU2A 4H4VA 4I58A 5HHFA 2WQYA 1GV4A 1Y56A 3UKAA 2XVHA 4Z44A 2YLRA 4JNAA 4J34A 3EAOA 4MJWA 4J36A 3GRSA 1IUSA 1KSUA 3QSMA 3AYLA 2E4GA 4GR1A 1PDHA 4X4JA 4EIPA 4YXDA 5U63A 4RG3A 4AP3A 2ZBWA 2WPEA 3UKKA 1XHCA 2XFPA 4LU6A 4TLZA 2AR8A 4EQSA 1GETA 1L0VA 4CBQA 1GT8A 2JBVA 3SFEA 2GH5A 2TMDA 4H2NA 3K7MX 2QA1A 4BURA 4IVOB 1ZOVA 2YQUA 3CPIG 3UKQA 1BWCA 2BC0A 2R45A 1K0JA 5CKUA 2YM1A 4B63A 1H84A 3K7TA 5JCIA 5IPYA 2EQ9A 2WDQA 1AOGA 1L9CA 3GWFA 1PJ5A 2AQJA 2C3CA 1OJAA 4YKGA 5EB5A 1F8WA 4EMIA 4USRA 5M0ZA 1XANA 2ZZCA 4N9XA 1CHUA 1Y0PA 2BS2A 4IV9A 3M12A 1E39A 3C4AA 4OPGA 1JNZA 3BHKA 3M0OA 1NG4A 2B9YA 3KVEA 5JCKA 2APGA 4YSZA 3GD4A 4H4UA 2C3DA 2XLRA 1DJNA 3NHOX 3NK0X 3H8IA 3F8DA 3V76A 3I3LA 4CCRA 1IUVA 1JRXA 1PBFA 4B68A 2AAQA 1BGJA 2Q6UA 1H86A 3AXBA 3NG7X 3NH3X 4JN9A 4U2SA 4H4WA 2BA9A 3QJ4A 2X8HA 5BULA 3L8KA 1DODA 3H8LA 4NTDA 1D4CA 4Y4NA 4BJZA 2OLOA 4BK3A 4M52A 2FBWA 5LV9A 2GF3A 4U8IA 4AOXA 1S3BA 4IA6A 4U8LA 1PN0A 4Z43A 5BVAA 1PBCA 1VDCA 2B9WA 4PAAA 2GR1A 3E1TA 1FOHA 1FECA 1QLBA 4TM1A 4H2RA 1CF3A 3DJEA 2WBAA 1XPQA 1ZP0A 4TLXA 1PJ7A 5C3JA 4Z2RA 3ATRA 4YWOA 2R0PA 4A6NA 2WP5A 1HYUA 2JKCA 3FBSA 3P4RA 3GSIA 2YLTA 4EQWA 2GQFA 4DNAA 4Z26A 3AE8A 4A9WA 2OALA 3ISHA 5M10A 3C96A 1PBDA 1GRAA 1ONFA 5KVHA 1K0IA 4H4QA 2B76A 1E6EA 2RGHA 1QO8A 3SQPA 2RABA 2BS3A 2R0GA 5KWFA 4BK2A 1GERA 1IUWA 4NEVA 3P9UA 2JB2A 3DK4A 4JDRA 1NG3A 3SFDA 4EQRA 5KVIA 3Q6JA 3NK1X 4ADWA 1NEKA 1GXFA 1TDEA 1ZDLA 4A5LA 2GB0A 3NK2X 2WPCA 3OZ2A 4KX6A 3UTGA 4AP1A 5J60A 5KRQA 4X9MA 1H83A 1RYIA 3LB8A 3II4A 4U8PA 4X9NA 3UTEA 4EM4A 2CDUA 4B67A 1DOCA 2BCGG 4UP3A 3KU9A 1GSNA 1MOKA 4EMWA 2Y6QA 1UKVG 2YG5A 3F8PA 2R4EA 3CIRA 1F6MA 1O94A 1JEHA 1KSSA 4J33A 4AT0A 5C2TA 1JNRA 1GESA 2WHDA 4K5SA 1D4DA 4YSYA 2E5VA 1NPXA 2JK6A 3QFBA 3B6DA 2BK3A 3CNPA 2VVLG 4H4XA 3NIXA 1YQ4A 4U8JA 2XFQA 2BK4A 2GRTA 4GDPA 1Q9IA 1ZY8A 3ATQA 2GMJA 4K2XA 3KLJA 1Q1WA 3T37A 3FMWA 2GEWA 1K4QA 3G5QA 1ZMCA 3DK9A 5FS9A 2C67A 1RP0A 1PXBA 2VRLA 3AE6A 3AYJA 1TDFA 4KPRA 1S2YA 5U25A 2C76A 2YLZA 1PHHA 1JRYA 3CTYA 2WDVA 3NKSA 5HYMA 3ZYXA 2YAUA 3AEDA 3BI5A 4BV6A 2OAMA 4EIQA 2YLWA 3EPTA 3UTFA
chains in the Genus database with same CATH superfamily
4GMEA 1EL9A 3PS9A 5HXIA 3PVCA 4C74A 2XH2A 1PXCA 1NHRA 3LADA 1FIQB 3NFUA 2RGOA 3AB1A 2W3SA 4G9KA 1FHUA 3D46A 3TWBA 2XH7A 4H1ZA 3VRDB 3JZUA 2PHHA 4B1BA 2X50A 3SYIA 3AE1A 4KEMA 3ENLA 3LZXA 3A7RA 2BABA 3ICRA 4CY8A 3TJIA 4Z25A 3BOXA 3CGDA 1REOA 3CYJA 3NYCA 3STPA 3AE9A 3S61A 1ZMDA 1N61C 4GFIA 3SX6A 4H4YA 4G7FA 1BZLA 3U4FA 3T9PA 2Z5XA 2GL5A 3GDPA 2WOVA 1CC2A 3GRTA 2VOUA 2BK5A 2QJNA 4OPDA 3I4KA 2PP3A 2X3NA 4DN1A 3T6CA 4E4UA 4C3YA 3ZVHB 1LQTA 1DNCA 4G6GA 3CGCA 3EUB3 3G5RA 4FK1A 4A99A 2WEUA 4A35A 2CVJA 4HCDA 3KPKA 4IT1A 2FJDA 3UKLA 5KMQA 3NGCX 2RGJA 1CC4A 3UOZA 1ZKQA 3GMBA 3P0WA 4DSGA 4O5QA 4RG4A 1RSGA 5FS7A 1H7WA 4OVIA 1DOBA 2X99A 1ZK7A 3DA1A 2EQ7A 1F8SA 2OA1A 3JVAA 3NTDA 3OP2A 2C65A 1H81A 1IUXA 1PS9A 1N62C 2WS3A 3EKGA 4OPTA 4GRTA 1GRBA 5EOWA 1CC6A 4MKSA 4K5RA 1E7PA 3Q4DA 3VRBA 2XSXA 4H4ZA 2E3TA 4CCQA 3GD3A 3R0UA 3PO7A 1FFVC 3EF6A 1DJQA 3IJQA 3COXA 3K7QX 1MDLA 1ZX9A 1CJ4A 2PGWA 4JY3A 4K2SA 5EBKA 5KXJA 4BK1A 2WU2A 4K8DA 4II2A 2WDRA 1S2QA 4RSLA 3SJNA 3DGBA 2QJJA 3NVZB 4DSHA 2HNEA 1TDOA 4YTPA 4U2TA 3AE2A 3RHAA 4U8KA 3H7VA 1VG9A 3D47A 1GTHA 4C77A 4DWDA 3R9UA 4I59A 3FCPA 3RR1A 1OJDA 3QKEA 2C70A 3B9JB 4WX1A 2XLTA 2IVDA 1BGNA 3ALJA 2CFYA 3P4PA 2GMHA 2B7RA 1MO9A 1OJ9A 3U9IA 2C73A 3FJ4A 2VVLA 3SZFA 2F5ZA 2O56A 4GUVA 4H2PA 3IJLA 2QA2A 4BJYA 3ABVA 2OPJA 1KFYA 1R6WA 3ALLA 4HPNA 3F8RA 4CNJA 4ZCCA 5G5GB 2BACA 4H4PA 4FK1C 1GOSA 4NZHA 2PA6A 4HYRA 4DYEA 3NS1B 4GR1A 1PDHA 4RG3A 4AP3A 2ZBWA 3UKKA 4KPLA 4EQSA 4H83A 1WUEA 1WYGA 2JBVA 3SFEA 3K7MX 3DDMA 1ZOVA 3OPSA 2YQUA 4B63A 5CKUA 3MUCA 3GWFA 4IL2A 4GIRA 4EMIA 4HCLA 3M12A 4K8GA 1JNZA 3M0OA 3ZVIA 1JDFA 3UJRA 2XLRA 3HW2A 3F8DA 4H19A 4CCRA 1IUVA 1PBFA 1SJBA 4ZCDA 4U2SA 3NH3X 4IP4A 2MUCA 3DG3A 3H8LA 1D4CA 2FBWA 5LV9A 1S3BA 4IA6A 2B9WA 4PAAA 3E1TA 3B97A 4Z2RA 3H12A 3N4EA 1SJAA 3SZ0A 2YLTA 5M10A 3C96A 1ONFA 1K0IA 1QO8A 3SQPA 2RABA 1IUWA 3H70A 3DK4A 4JDRA 4EQRA 3QLDA 1ZDLA 3CMMA 4A5LA 2OZ3A 2GB0A 3RITA 3NK2X 4X9MA 1RYIA 3II4A 4X9NA 4UP3A 3SN0A 2R4EA 3CIRA 2PGEA 1O94A 2PMQA 1D4DA 4YSYA 3UJFA 1Q9IA 2AKMA 3DFYA 2GEWA 3DK9A 5FS9A 4MGGA 3AE6A 3AYJA 3PWIA 2P0IA 5U25A 2C76A 4G8TA 3CTYA 4HNCA 4K1WA 4GAPA 3BI5A 4BV6A 4GGHA 2OAMA 4EIQA 3HYWA 3NYFA 4Y4MA 3RP8A 3HZLA 1GREA 3DIPA 4EQXA 3ICTA 4YTMA 3BSMA 3N6HA 3VRAA 2V3AA 3MZNA 1N60C 3AEBA 3T31A 3NN6X 2YLXA 4Z1YA 2W55A 3DJJA 1GRFA 3D1CA 5FJTA 1FCDA 1H82A 2ZC8A 3NN0X 3OZMA 1SEZA 2A8XA 3BI4A 2ZZ0A 3V4BA 3FIMB 2P8CA 3JSKA 3GDNA 3CAWA 4A65A 2QJMA 3N6JA 2UZZA 3UKHA 1KN0A 2YG3A 5JCMA 3QFAA 4D03A 4H4SA 4A6GA 3RGTA 5GRTA 3O0HA 1D5TA 2E5AA 1GRTA 5EB4A 1EBDA 3LJPA 1FL2A 1P2HA 2C4CA 4JQ9A 3GO2A 4GAVA 1LPFA 1N5WC 3UJEA 4OPLA 3DK8A 3GY1A 4ZOHB 5KMPA 3AD7B 4K22A 1BQGA 2GAGB 5ENLA 2VZ2A 3VQRA 1NHQA 1KKOA 2C66A 5FS6A 4ECHA 1KKRA 1VQZA 1N4UA 3NTAA 1DOEA 3FV9A 3IF9A 5BUKA 5DBJA 3RO6A 4A79A 1IUTA 3I6EA 3NVYB 3UOXA 1B5QA 3IHGA 3SN1A 3ZLFA 5G5HB 3PFRA 3UOYA 1GEUA 4GYPA 3D9XA 3QPEA 3V3WA 4GF7A 4U2LA 3RRAA 1LTXR 4H2QA 5FS8A 1FEBA 4P9SA 3PK7A 1QJDA 3T2ZA 3UOVA 3AN1A 1MXTA 5BRTA 2HZGA 1L9DA 2XVFA 4X2PA 1GRGA 4ZCWA 4C5OA 1P43A 2W3RA 4B64A 4YT0A 4EM3A 3AD8B 5IDZA 3UXKA 1TDKA 1X2GA 3LOVA 1XS2A 1Q1RA 2OLNA 2YG4A 3JW7A 3VCCA 3NNEA 3IWAA 2P88A 2V61A 4UDQA 3ES8A 3NRZB 2GR3A 2QCUA 3AEGA 1V97A 4J31A 3NLCA 2YVJA 3NVWB 4A6NB 1DXLA 2IIDA 2OVLA 2W0HA 3DG6A 1VRQB 3DJGX 2A87A 3ICSA 3ITJA 5GSNA 3HPFA 3OC4A 3UXLA 3AE7A 4REKA 3V3NA 1COYA 1NAAA 4CRTA 3UJ2A 3SR6B 1B4VA 4Z2TA 1STZA 3VFCA 2C75A 1KCZA 4UDPA 1PJ6A 2BXRA 2WPFA 3AEEA 3HYXA 3KKJA 2XFUA 3D8XA 4YWSA 1CJ2A 3AM9A 1NENA 3QSSA 2XCGA 4HA6A 3T4WA 2CHRA 4U8MA 4XXGA 3T8QA 3R25A 3OTRA 2FJEA 1GNDA 3LZWA 3DFHA 1IUUA 2PS2A 1H7XA 4YTNA 5HHFA 3S5SA 2XVHA 1KSUA 2E4GA 4X4JA 4EIPA 3ZLGA 2WPEA 3IJIA 1GT8A 4G73A 3R10A 2TMDA 1E9IA 4IVOB 1TE6A 2R45A 1K0JA 3K7TA 4E4FA 5IPYA 2BRYA 4GYPC 1OJAA 1JPDX 1F8WA 4USRA 5M0ZA 2NQLA 3TW9A 1Y0PA 2BS2A 4TVYA 5KMRA 3R07C 4HCHA 2B9YA 4YSZA 3GD4A 1DJNA 4M6UA 5KMSA 3NHOX 3NK0X 4B68A 1BGJA 2Q6UA 1H86A 4H4WA 2BA9A 2X8HA 3L8KA 1DODA 2OLOA 4BK3A 4M52A 2OKTA 1PN0A 1XPYA 4H2RA 2DW7A 1PJ7A 5C3JA 2WP5A 3FBSA 2QGYA 3GSIA 4Z26A 1GRAA 1JRPA 3SZWA 1PDZA 2R0GA 4NEVA 1SJDA 2JB2A 2GDQA 1NG3A 5KVIA 1GXFA 1ECQA 2WPCA 1T3QC 2PTWA 3UTGA 5KRQA 3LB8A 3TOYA 3KU9A 1GSNA 3P3BA 2XGZA 3THUA 1JNRA 2WHDA 4G6HA 1MNSA 3B6DA 3CNPA 3CT2A 4U8JA 2BK4A 4GDPA 3ATQA 3T37A 3KLJA 1Q1WA 3FYYA 3FMWA 3G5QA 3GYXA 2C67A 3K1GA 1RP0A 4KPRA 1S2YA 4M0XA 3NKSA 2WDVA 2YAUA 2YLWA 3EPTA 2J3NA 2XVIA 3BJSA 4NTEA 1NHPA 3T2YA 3UCLA 2DKHA 2JB3A 3FG2P 2VRMA 1TYTA 3REDA 2R46A 5FJUA 5JCNA 2PSNA 4EMJA 3UP4A 1X31B 1ONEA 1JCTA 2X8GA 3GC2A 1M6IA 3CPHG 4FP1A 2YLSA 1N1PA 4IA5A 3EANA 1EC8A 2Q0LA 1EL8A 2BCPA 2YR6A 3NO1A 2XYOA 2V5ZA 4HNLA 5BOFA 1D7LA 4OPUA 1KNPA 1EC9A 3BNMA 5KOWA 1N4VA 4TM3A 2TPRA 3MSYA 2OQHA 1OJCA 3P4SA 2JAEA 1IJHA 2XVJA 3KA7A 4NTCA 3CB3A 2AL2B 2B9XA 3CGEA 2A89A 4Y4LA 1FHVA 2Z5YA 3AEFA 4IHCA 2QQ6A 1SB3B 2XLUA 3V3OA 4IZGA 4AT2A 1PXAA 2WP9A 1GTEA 1F3PA 3GD6A 4OPCA 1VG0A 1RVKA 3ALMA 2JB1A 2P3ZA 2GVCA 5IQ1A 3AECA 3I6TA 4H4TA 3NYEA 1VDVA 2VQBA 2HQMA 1PBBA 4O5UA 3FXGA 1E1KA 2ARDA 2OZTA 2XVEA 3IHMA 3B3RA 2BYBA 4A3RA 1YQ3A 4DHGA 1Y56B 2GV8A 2GQWA 3DEQA 3VR8A 2PTYA 3QVRA 1CL0A 2XDOA 4H50A 2H89A 5JRBA 1XDIA 2Y6RA 2PTZA 3UGVA 2YWLA 2R0CA 2YM2A 5CQFA 4ZA0A 1CJCA 4YSXA 4J56A 2PODA 1GALA 3GMCA 2V60A 2E1MA 5FJPA 1O5WA 4XWRA 3S5WA 1KF6A 3DGZA 4UDRA 4B66A 3BHFA 3GYIA 3AWIA 4K7ZA 4ICYA 2C72A 4TM0A 4CNKA 4U8NA 4D04A 1W4XA 3UTHA 2AL1A 4J2WA 2Q0KA 2VVMA 4XWZA 2CULA 2QAEA 3QSEA 2GAHB 2H88A 3V5CA 3CNDA 3MY9A 4ZN0A 2NPXA 3MWCA 4ENLA 3T2KA 3QVPA 4FX9A 2YVFA 5L46A 1D7YA 2ACZA 2FJAA 3CNSA 2WP6A 1BF3A 2BXSA 4OPIA 2GR2A 1N4WA 4NNJA 5JCLA 1R0MA 4JY2A 1B37A 1FFUC 2GGIA 2R4JA 2WOIA 2WU5A 3T0KA 4J57A 2OFJA 3G5SA 3DMEA 1BKHA 3TCSA 2XH4A 4GDEA 3RP6A 2O9ZA 4KT2A 3AE5A 2POZA 3UKPA 3VC5A 1YY5A 5IQ4A 3UCCA 2EQ8A 1S7MA 3Q45A 3A7AA 3SXIA 3A7UA 2GR0A 1EL5A 3SGLA 2WETA 2PU1A 1TRBA 4OCGA 1K0LA 3NT6A 1NDAA 1ELIA 2NVKX 2BC1A 4APNA 1JU2A 4I58A 3KUMA 4JNAA 4J34A 4MJWA 3OZYA 4J36A 2QVHA 3GRSA 1IUSA 7ENLA 3SN4A 3UJSA 5U63A 4JHMA 4TLZA 2AR8A 4H2HA 1GETA 3L5OA 2GH5A 1PDYA 4H2NA 1X2HA 2P8BA 4G74A 3CPIG 2BC0A 2YM1A 5JCIA 1AOGA 1L9CA 1PJ5A 2AQJA 5EB5A 1JPMA 1XANA 2ZZCA 3HYVA 1E39A 3C4AA 3BHKA 4MMWA 3KVEA 4H4UA 2C3DA 3SZCA 3HRDC 3H8IA 3I3LA 3UCDA 2QDDA 2AAQA 2DW6A 3NG7X 4JN9A 2OLAA 3TQPA 4Y4NA 1IYXA 2GF3A 4U8IA 3QN3A 4Z43A 5BVAA 1PBCA 1VDCA 1FECA 2WBAA 1XPQA 4II3A 4TLXA 4YWOA 2R0PA 4A6NA 4EQWA 2GQFA 3AE8A 4A9WA 3ISHA 3SY4A 2BS3A 4BK2A 1GERA 3SSZA 3SFDA 1F9CA 3R11A 2OQYA 1TDEA 3ZVHA 3OZ2A 4J3ZA 5J60A 3TWAA 4EM4A 3NVVB 2Y6QA 1UKVG 1WUFA 3NXLA 3VA8A 1ZXIC 1F6MA 2PTXA 6ENLA 1JEHA 1KSSA 4J33A 4AT0A 1GESA 4K5SA 3DERA 1NPXA 2JK6A 2PP0A 2VVLG 1OEPA 4H4XA 2XFQA 3MQTA 4K2XA 1K4QA 1ZMCA 4E6MA 2VRLA 1TDFA 4HN8A 2GSHA 2GGGA 2YLZA 1PHHA 1JRYA 5HYMA 4E5TA 3ZYXA 3AEDA 4ROPA 1S3EA 5EU9A 3AMZA 4YKFA 5J04A 2WESA 1W6TA 3GWDA 4USQA 2FJBA 3ADAB 1N5XA 1B8SA 3NRNA 4DXKA 1CJ3A 4Z17A 3P1WA 1L9EA 3C4NA 4EWJA 3RNMA 4A7AA 1PBEA 1N63C 4Z2UA 3DESA 2VQ7A 4YSHA 1D4EA 2AKZA 3FVDA 2X8CA 2RDXA 1F8RA 5KNLA 3VR9A 2I5QA 4E8GA 3KD9A 3DGHA 1E1MA 2V3BA 3DH9A 5FJRA 2OG9A 3L1RA 2B7SA 1EBHA 2XFNA 3T14A 3CGBA 3BI2A 3CN8A 2PCEA 4J1OA 3AD9B 2DKIA 3SM8A 4JNQA 1NELA 1VQWA 1SJCA 3I6DA 5KOXA 5J7XA 3KPFA 2YG6A 4B69A 1GPEA 4B65A 1MRAA 4GISA 3LXDA 5U1OA 2EQ6A 3UP5A 3M13A 4IP5A 2YG7A 1JROA 1JRZA 1TDNA 2XLSA 4Z24A 3H4KA 4CY6A 1EL7A 1CBOA 3RP7A 3MKCA 3SBFA 2ZZBA 1M64A 4KWSA 1GRHA 1LVLA 1O95A 1LV0A 4F4RA 4NWZA 1Z6LA 3GYJA 3CPJG 4TM4A 2WOWA 2HXUA 3Q9TA 2I0ZA 1DTNA 4H4RA 4E0VA 4LIIA 1H6VA 3CNTA 5FMHA 2C64A 2PU0A 3AYIA 3IC9A 2OZ8A 2PP1A 1KD0A 1KDGA 3WE0A 1ZOYA 4HB9A 2XFOA 3PG6A 3ES7A 1EBGA 1LQUA 3AEAA 5ER0A 1LJ1A 2R9ZA 1BKWA 2Q7VA 1YQZA 4FDCB 1JOAA 4NEWA 1YKJA 1NHSA 3DJDA 3ETRB 2YR4A 1P2EA 1OJTA 3AE4A 3R0KA 1E1NA 3CK5A 4GGBA 1V59A 2C7GA 2BS4A 4AOSA 2XLPA 1RM6B 4DX3A 4C3XA 3ZDNA 3H8AA 2PYXA 1KNRA 3FPZA 5FJOA 3URHA 2IVEA 3AE3A 4JN7A 4PABA 2AL2A 3BNUA 3CNJA 4DGKA 1FO4A 3N4FA 3RCYA 3R1ZA 2GGHA 3P4QA 2ZADA 2V6OA 5HY5A 2OO6A 1P48A 4U8OA 2XH0A 2W54A 4IVMB 1E1LA 3K30A 4LA1A 1TYPA 4WCTA 4GCMA 2YR5A 1MDRA 5TR3A 2YVGA 1FEAA 3UKFA 4H7UA 4H4VA 2WQYA 1GV4A 1Y56A 3TJ4A 3UKAA 4Z44A 2YLRA 3EAOA 3TTEA 3QSMA 3AYLA 4YXDA 1ELSA 1XHCA 2XFPA 2HXTA 4LU6A 1TKKA 1L0VA 4CBQA 4TVWA 2QA1A 4BURA 2GGJA 3UKQA 1BWCA 1H84A 2EQ9A 2WDQA 3OW1A 2FYMA 2C3CA 1H2IA 3DG7A 4YKGA 4N9XA 1CHUA 4IV9A 1YEYA 4OPGA 1NG4A 2PPGA 5JCKA 1NU5A 2APGA 2BRAA 3VCNA 5BOEA 3V76A 3S47A 1JRXA 3AXBA 3QJ4A 5BULA 2FKPA 4NTDA 4BJZA 4AOXA 4U8LA 2MNRA 3VDGA 2GR1A 1FOHA 1QLBA 4TM1A 1CF3A 3DJEA 1L8PA 1ZP0A 3ATRA 1HYUA 2JKCA 3P4RA 3CXOA 3V5FA 4DNAA 2OALA 1EC7A 1PBDA 5KVHA 4H4QA 4JN8A 2B76A 1E6EA 2RGHA 5KWFA 3IK4A 1MUCA 3P9UA 3VC6A 3Q6JA 3NK1X 4ADWA 1NEKA 4IL0A 4KX6A 4AP1A 1H83A 4U8PA 3UTEA 2CDUA 4B67A 1DOCA 2GGEA 2BCGG 3CXBA 1MOKA 4EMWA 2YG5A 3F8PA 3EEZA 3SQSA 5C2TA 2E5VA 3QFBA 2BK3A 3NIXA 1YQ4A 2QDEA 1TZZA 2GRTA 1ZY8A 3ZLHA 2GMJA 2ONEA 4FI4A 1PXBA 3QTPA 3NZGA 3PWGA 2OX4A 3P93A 3UTFA
chains in the Genus database with same CATH topology
1S3EA 2J3NA 3NYFA 4YKFA 2XVIA 2WESA 4Y4MA 3RP8A 3GWDA 4NTEA 1NHPA 3HZLA 1EL9A 3T2YA 3PS9A 1GREA 4USQA 3UCLA 2DKHA 2FJBA 3ADAB 3PVCA 4EQXA 5HXIA 1B8SA 4C74A 3ICTA 4YTMA 1PXCA 2JB3A 3NRNA 1CJ3A 3FG2P 1NHRA 1TYTA 3LADA 2VRMA 3REDA 3VRAA 2V3AA 2R46A 2RGOA 3P1WA 3AEBA 1L9EA 3AB1A 5JCNA 4EMJA 4G9KA 3UP4A 1X31B 3C4NA 3T31A 3NN6X 2X8GA 2YLXA 3CPHG 1M6IA 3RNMA 4A7AA 1PBEA 3DJJA 3VRDB 1GRFA 1N1PA 2YLSA 4IA5A 3D1CA 1FCDA 1H82A 3EANA 4Z2UA 2PHHA 4B1BA 2Q0LA 3NN0X 2VQ7A 1SEZA 1D4EA 2X50A 4YSHA 3SYIA 1EL8A 2BCPA 2A8XA 2YR6A 3AE1A 2X8CA 3BI4A 2ZZ0A 1F8RA 3FIMB 2XYOA 5KNLA 2V5ZA 3LZXA 3JSKA 2BABA 3ICRA 3GDNA 1D7LA 4A65A 3VR9A 4CY8A 4OPUA 2UZZA 3KD9A 4Z25A 3DGHA 1KNPA 3CGDA 1E1MA 1REOA 3BNMA 3NYCA 1N4VA 5KOWA 4TM3A 3UKHA 2TPRA 2V3BA 3AE9A 3S61A 1ZMDA 3DH9A 1OJCA 3P4SA 1KN0A 1IJHA 2JAEA 2XVJA 3KA7A 2YG3A 4NTCA 5JCMA 3QFAA 3SX6A 4D03A 4H4YA 4H4SA 3L1RA 2B7SA 3VQRA 2XFNA 5GRTA 1BZLA 3T14A 2B9XA 3O0HA 1D5TA 3CGBA 3CGEA 2A89A 3BI2A 3CN8A 4Y4LA 2Z5YA 3AEFA 1GRTA 2Z5XA 3AD9B 3GDPA 2XLUA 2WOVA 2DKIA 3V3OA 1CC2A 5EB4A 4AT2A 3GRTA 1EBDA 2VOUA 1FL2A 1P2HA 2BK5A 3LJPA 4JNQA 3SM8A 2C4CA 1PXAA 4JQ9A 2WP9A 1GTEA 1F3PA 1VQWA 4OPDA 2X3NA 4OPCA 4C3YA 3I6DA 5KOXA 4GAVA 1LQTA 1DNCA 1VG0A 5J7XA 1LPFA 3KPFA 3CGCA 2YG6A 3ALMA 4G6GA 2JB1A 4B69A 3G5RA 4FK1A 2GVCA 5IQ1A 4A99A 2WEUA 4OPLA 3DK8A 1GPEA 2CVJA 4B65A 3KPKA 3AECA 5KMPA 2FJDA 3UKLA 3AD7B 4K22A 2VZ2A 2GAGB 3NGCX 5KMQA 2RGJA 4H4TA 3NYEA 1NHQA 2VQBA 2HQMA 1PBBA 2C66A 3LXDA 5FS6A 4O5UA 4ECHA 5U1OA 1E1KA 2EQ6A 1CC4A 1N4UA 3UOZA 2ARDA 3UP5A 2XVEA 3M13A 1ZKQA 3NTAA 1DOEA 3IHMA 3GMBA 2YG7A 3B3RA 1JRZA 4DSGA 4YT0A 2BYBA 3IF9A 1YQ3A 4O5QA 4RG4A 5DBJA 5BUKA 1TDNA 2XLSA 4Z24A 1Y56B 2GV8A 3H4KA 4CY6A 1RSGA 2GQWA 1EL7A 5FS7A 1CBOA 3RP7A 4A79A 2ZZBA 3VR8A 1IUTA 1H7WA 1DOBA 4OVIA 2X99A 3QVRA 1ZK7A 3DA1A 2EQ7A 1CL0A 3UOXA 1M64A 1F8SA 1B5QA 2XDOA 4H50A 3IHGA 4ZCDA 1GRHA 2OA1A 1LVLA 2H89A 1O95A 1LV0A 5JRBA 3NTDA 1XDIA 2Y6RA 3UOYA 2C65A 1H81A 1GEUA 4NWZA 3D9XA 1Z6LA 3GYJA 1IUXA 2YWLA 3CPJG 1PS9A 2WS3A 2R0CA 4OPTA 4GRTA 2YM2A 5CQFA 4TM4A 2WOWA 1GRBA 1CJCA 4GF7A 3Q9TA 4U2LA 5EOWA 4YSXA 1LTXR 4H2QA 1CC6A 5FS8A 4J56A 2I0ZA 1FEBA 4K5RA 4P9SA 4H4RA 1GALA 4E0VA 1E7PA 4LIIA 1QJDA 1H6VA 3GMCA 2V60A 2E1MA 3CNTA 3T2ZA 3VRBA 5FMHA 2C64A 3UOVA 3AYIA 1MXTA 1O5WA 4XWRA 3S5WA 3IC9A 1KF6A 5BRTA 3DGZA 1KDGA 4UDRA 1L9DA 2XVFA 4H4ZA 3WE0A 4CCQA 1ZOYA 3GD3A 1GRGA 4HB9A 2XFOA 3PO7A 4C5OA 3PG6A 4B66A 3BHFA 3GYIA 3EF6A 1DJQA 1LQUA 3COXA 3AEAA 3AWIA 4K7ZA 3K7QX 4B64A 4ICYA 5ER0A 1LJ1A 2C72A 2R9ZA 1BKWA 1ZX9A 4EM3A 2Q7VA 1YQZA 3AD8B 4TM0A 4FDCB 1CJ4A 4U8NA 4JY3A 1JOAA 4NEWA 5EBKA 1TDKA 4D04A 1W4XA 1YKJA 1NHSA 3LOVA 3UTHA 4BK1A 5KXJA 1Q1RA 3DJDA 2WU2A 4J2WA 4K8DA 2Q0KA 2OLNA 4II2A 2VVMA 2WDRA 2YG4A 1S2QA 4RSLA 4XWZA 2CULA 2YR4A 3NNEA 2QAEA 3IWAA 2V61A 4UDQA 3QSEA 4DSHA 2GAHB 2H88A 1TDOA 2GR3A 2QCUA 3AEGA 3CNDA 4U2TA 4YTPA 1P2EA 4J31A 3AE2A 3NLCA 4ZN0A 1OJTA 3AE4A 2YVJA 2NPXA 1E1NA 4A6NB 1DXLA 3RHAA 2IIDA 3T2KA 2W0HA 4U8KA 1V59A 3QVPA 4FX9A 2C7GA 1VRQB 2YVFA 2BS4A 1VG9A 3DJGX 2A87A 3ICSA 3ITJA 5GSNA 3OC4A 4AOSA 5L46A 1D7YA 2XLPA 3AE7A 4REKA 3V3NA 1COYA 1GTHA 2ACZA 2FJAA 4C3XA 3CNSA 3ZDNA 2WP6A 2PYXA 4C77A 1BF3A 1KNRA 1NAAA 3R9UA 4CRTA 4I59A 2BXSA 1OJDA 3FPZA 4OPIA 2GR2A 3URHA 1N4WA 2C70A 2IVEA 4NNJA 3AE3A 4WX1A 5JCLA 2XLTA 2IVDA 1BGNA 1B37A 1B4VA 4JY2A 3ALJA 4Z2TA 2R4JA 2CFYA 3P4PA 2WOIA 4PABA 2GMHA 2WU5A 2B7RA 1MO9A 1OJ9A 2C73A 2VVLA 3T0KA 3SZFA 3BNUA 2C75A 3CNJA 2F5ZA 4DGKA 4J57A 4GUVA 4UDPA 4CNKA 4H2PA 1PJ6A 2BXRA 3G5SA 2WPFA 2QA2A 3DMEA 3AEEA 3HYXA 4BJYA 3ABVA 3KKJA 3P4QA 1KFYA 2XFUA 3D8XA 1CJ2A 4GDEA 2V6OA 3RP6A 5HY5A 2O9ZA 1NENA 3AE5A 3QSSA 3ALLA 3UKPA 1YY5A 2XCGA 4HA6A 4U8OA 5IQ4A 4IVMB 4XXGA 4U8MA 3F8RA 2EQ8A 1E1LA 1S7MA 4CNJA 3K30A 4LA1A 3SXIA 1TYPA 2GR0A 1EL5A 4WCTA 4GCMA 3SGLA 4ZCCA 2YR5A 5TR3A 2WETA 2FJEA 2YVGA 1GNDA 1FEAA 1TRBA 3LZWA 3UKFA 2BACA 4OCGA 4H4PA 1K0LA 3NT6A 1NDAA 4FK1C 1IUUA 1ELIA 1GOSA 2NVKX 4H7UA 1H7XA 4NZHA 2BC1A 4YTNA 4APNA 1JU2A 4H4VA 4I58A 5HHFA 2WQYA 1GV4A 1Y56A 3UKAA 2XVHA 4Z44A 2YLRA 4JNAA 4J34A 3EAOA 4MJWA 4J36A 3GRSA 1IUSA 1KSUA 3QSMA 3AYLA 2E4GA 4GR1A 1PDHA 4X4JA 4EIPA 4YXDA 5U63A 4RG3A 4AP3A 2ZBWA 2WPEA 3UKKA 1XHCA 2XFPA 4LU6A 4TLZA 2AR8A 4EQSA 1GETA 1L0VA 3L5OA 4CBQA 1GT8A 2JBVA 3SFEA 4G73A 2GH5A 2TMDA 4H2NA 3K7MX 2QA1A 4BURA 4IVOB 1ZOVA 4G74A 2YQUA 3CPIG 3UKQA 1BWCA 2BC0A 2R45A 1K0JA 5CKUA 2YM1A 4B63A 1H84A 3K7TA 5JCIA 5IPYA 2EQ9A 2WDQA 2BRYA 1AOGA 1L9CA 3GWFA 1PJ5A 2AQJA 2C3CA 1H2IA 1OJAA 4YKGA 5EB5A 1F8WA 4EMIA 4USRA 5M0ZA 1XANA 2ZZCA 4N9XA 1CHUA 1Y0PA 2BS2A 3HYVA 4IV9A 3M12A 1E39A 5KMRA 3C4AA 4OPGA 1JNZA 3BHKA 3M0OA 1NG4A 2B9YA 3KVEA 5JCKA 2APGA 4YSZA 2BRAA 3GD4A 4H4UA 2C3DA 2XLRA 1DJNA 3SZCA 5KMSA 3NHOX 3NK0X 3H8IA 3F8DA 3V76A 3I3LA 4CCRA 1IUVA 1JRXA 1PBFA 4B68A 2AAQA 1BGJA 2Q6UA 1H86A 3AXBA 3NG7X 3NH3X 4JN9A 4U2SA 4H4WA 2BA9A 3QJ4A 2X8HA 5BULA 3L8KA 1DODA 3H8LA 4NTDA 1D4CA 4Y4NA 4BJZA 2OLOA 4BK3A 4M52A 2FBWA 5LV9A 2GF3A 4U8IA 4AOXA 1S3BA 4IA6A 4U8LA 1PN0A 4Z43A 5BVAA 1PBCA 1VDCA 2B9WA 4PAAA 2GR1A 3E1TA 1FOHA 1FECA 1QLBA 4TM1A 4H2RA 1CF3A 3DJEA 2WBAA 1XPQA 1ZP0A 4II3A 1PJ7A 4TLXA 4Z2RA 5C3JA 3ATRA 4YWOA 2R0PA 4A6NA 2WP5A 1HYUA 2JKCA 3FBSA 3P4RA 3GSIA 3SZ0A 2YLTA 4EQWA 2GQFA 4DNAA 4Z26A 3AE8A 4A9WA 2OALA 3ISHA 5M10A 3C96A 1PBDA 1GRAA 1ONFA 5KVHA 1K0IA 4H4QA 2B76A 3SZWA 1E6EA 2RGHA 3SY4A 1QO8A 3SQPA 2RABA 2BS3A 2R0GA 5KWFA 4BK2A 1GERA 1IUWA 4NEVA 3P9UA 2JB2A 3DK4A 4JDRA 1NG3A 3SFDA 4EQRA 5KVIA 3Q6JA 3NK1X 4ADWA 1NEKA 1GXFA 1TDEA 1ZDLA 3CMMA 4A5LA 2GB0A 3NK2X 2WPCA 3OZ2A 4KX6A 3UTGA 4AP1A 5J60A 5KRQA 4X9MA 1H83A 1RYIA 3LB8A 3II4A 4U8PA 4X9NA 3UTEA 4EM4A 2CDUA 4B67A 1DOCA 2BCGG 4UP3A 3KU9A 1GSNA 1MOKA 4EMWA 2Y6QA 1UKVG 2YG5A 3F8PA 2R4EA 3CIRA 1F6MA 1O94A 1JEHA 1KSSA 4J33A 4AT0A 5C2TA 1JNRA 1GESA 2WHDA 4G6HA 4K5SA 1D4DA 4YSYA 2E5VA 1NPXA 2JK6A 3QFBA 3B6DA 2BK3A 3CNPA 2VVLG 4H4XA 3NIXA 1YQ4A 4U8JA 2XFQA 2BK4A 2GRTA 4GDPA 1Q9IA 1ZY8A 3ATQA 2GMJA 4K2XA 3KLJA 1Q1WA 3T37A 3FMWA 2GEWA 1K4QA 3G5QA 1ZMCA 3DK9A 3GYXA 5FS9A 2C67A 1RP0A 1PXBA 2VRLA 3AE6A 3AYJA 1TDFA 4KPRA 1S2YA 5U25A 2C76A 2YLZA 1PHHA 1JRYA 3CTYA 2WDVA 3NKSA 5HYMA 3ZYXA 4GAPA 2YAUA 3AEDA 3BI5A 4BV6A 2OAMA 4EIQA 2YLWA 3EPTA 3UTFA 3HYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3E A;  2J3N A;  3NYF A;  4YKF A;  2XVI A;  2WES A;  4Y4M A;  3RP8 A;  3GWD A;  4NTE A;  1NHP A;  3HZL A;  1EL9 A;  3PS9 A;  1GRE A;  4USQ A;  3UCL A;  2DKH A;  2FJB A;  3ADA B;  3PVC A;  4EQX A;  5HXI A;  1B8S A;  4C74 A;  3ICT A;  4YTM A;  1PXC A;  2JB3 A;  3NRN A;  1CJ3 A;  3FG2 P;  1NHR A;  1TYT A;  3LAD A;  2VRM A;  3RED A;  3VRA A;  2V3A A;  2R46 A;  2RGO A;  3P1W A;  3AEB A;  1L9E A;  3AB1 A;  5JCN A;  4EMJ A;  3UP4 A;  1X31 B;  3C4N A;  3NN6 X;  2X8G A;  2YLX A;  3CPH G;  1M6I A;  3RNM A;  4A7A A;  1PBE A;  3DJJ A;  3VRD B;  1GRF A;  1N1P A;  2YLS A;  4IA5 A;  3D1C A;  1FCD A;  1H82 A;  3EAN A;  4Z2U A;  2PHH A;  4B1B A;  2Q0L A;  3NN0 X;  2VQ7 A;  1SEZ A;  1D4E A;  2X50 A;  4YSH A;  1EL8 A;  2BCP A;  2A8X A;  2YR6 A;  3AE1 A;  2X8C A;  3BI4 A;  2ZZ0 A;  1F8R A;  3FIM B;  2XYO A;  2V5Z A;  3LZX A;  3JSK A;  2BAB A;  3ICR A;  3GDN A;  1D7L A;  4A65 A;  3VR9 A;  4CY8 A;  4OPU A;  2UZZ A;  3KD9 A;  4Z25 A;  3DGH A;  1KNP A;  3CGD A;  1E1M A;  1REO A;  3BNM A;  3NYC A;  1N4V A;  5KOW A;  4TM3 A;  3UKH A;  2TPR A;  2V3B A;  3AE9 A;  3S61 A;  1ZMD A;  3DH9 A;  1OJC A;  3P4S A;  2JAE A;  1IJH A;  2XVJ A;  3KA7 A;  2YG3 A;  4NTC A;  5JCM A;  3QFA A;  4D03 A;  4H4Y A;  4H4S A;  3L1R A;  2B7S A;  3VQR A;  2XFN A;  5GRT A;  1BZL A;  2B9X A;  3O0H A;  1D5T A;  3CGB A;  3CGE A;  2A89 A;  3BI2 A;  3CN8 A;  4Y4L A;  2Z5Y A;  3AEF A;  1GRT A;  2Z5X A;  3AD9 B;  3GDP A;  2XLU A;  2WOV A;  2DKI A;  3V3O A;  1CC2 A;  5EB4 A;  4AT2 A;  3GRT A;  1EBD A;  2VOU A;  1FL2 A;  1P2H A;  2BK5 A;  3LJP A;  4JNQ A;  3SM8 A;  1PXA A;  4JQ9 A;  2WP9 A;  1GTE A;  1F3P A;  1VQW A;  4OPD A;  2X3N A;  4OPC A;  4C3Y A;  3I6D A;  5KOX A;  1LQT A;  1DNC A;  1VG0 A;  5J7X A;  1LPF A;  3KPF A;  3CGC A;  2YG6 A;  3ALM A;  4B69 A;  2JB1 A;  3G5R A;  4FK1 A;  2GVC A;  5IQ1 A;  4A99 A;  2WEU A;  4OPL A;  3DK8 A;  1GPE A;  2CVJ A;  4B65 A;  3AEC A;  2FJD A;  3UKL A;  3AD7 B;  4K22 A;  2VZ2 A;  2GAG B;  3NGC X;  2RGJ A;  4H4T A;  3NYE A;  1NHQ A;  2VQB A;  2HQM A;  1PBB A;  2C66 A;  3LXD A;  5FS6 A;  4O5U A;  4ECH A;  5U1O A;  1E1K A;  2EQ6 A;  1CC4 A;  1N4U A;  3UOZ A;  2ARD A;  3UP5 A;  2XVE A;  3M13 A;  1ZKQ A;  3NTA A;  1DOE A;  3IHM A;  3GMB A;  2YG7 A;  3B3R A;  1JRZ A;  4DSG A;  4YT0 A;  2BYB A;  3IF9 A;  1YQ3 A;  4O5Q A;  4RG4 A;  5DBJ A;  5BUK A;  1TDN A;  2XLS A;  4Z24 A;  1Y56 B;  2GV8 A;  3H4K A;  4CY6 A;  1RSG A;  2GQW A;  1EL7 A;  5FS7 A;  1CBO A;  3RP7 A;  4A79 A;  2ZZB A;  3VR8 A;  1IUT A;  1H7W A;  1DOB A;  4OVI A;  2X99 A;  3QVR A;  1ZK7 A;  3DA1 A;  2EQ7 A;  1CL0 A;  3UOX A;  1M64 A;  1F8S A;  1B5Q A;  2XDO A;  4H50 A;  3IHG A;  4ZCD A;  1GRH A;  2OA1 A;  1LVL A;  2H89 A;  1O95 A;  1LV0 A;  3NTD A;  1XDI A;  2Y6R A;  3UOY A;  2C65 A;  1H81 A;  1GEU A;  1Z6L A;  3GYJ A;  1IUX A;  2YWL A;  3CPJ G;  1PS9 A;  2WS3 A;  2R0C A;  4OPT A;  4GRT A;  2YM2 A;  5CQF A;  4TM4 A;  2WOW A;  1GRB A;  1CJC A;  4GF7 A;  3Q9T A;  4U2L A;  5EOW A;  4YSX A;  1LTX R;  4H2Q A;  1CC6 A;  5FS8 A;  4J56 A;  2I0Z A;  1FEB A;  4K5R A;  4P9S A;  4H4R A;  1GAL A;  4E0V A;  1E7P A;  4LII A;  1QJD A;  1H6V A;  3GMC A;  2V60 A;  2E1M A;  3CNT A;  3VRB A;  5FMH A;  2C64 A;  3UOV A;  3AYI A;  1MXT A;  1O5W A;  4XWR A;  3S5W A;  3IC9 A;  1KF6 A;  5BRT A;  3DGZ A;  1KDG A;  4UDR A;  1L9D A;  2XVF A;  4H4Z A;  3WE0 A;  4CCQ A;  1ZOY A;  3GD3 A;  1GRG A;  4HB9 A;  2XFO A;  3PO7 A;  4C5O A;  4B66 A;  3BHF A;  3GYI A;  3EF6 A;  1DJQ A;  1LQU A;  3COX A;  3AEA A;  3AWI A;  4K7Z A;  3K7Q X;  4B64 A;  4ICY A;  5ER0 A;  1LJ1 A;  2C72 A;  2R9Z A;  1BKW A;  1ZX9 A;  4EM3 A;  2Q7V A;  1YQZ A;  3AD8 B;  4TM0 A;  4FDC B;  1CJ4 A;  4U8N A;  4JY3 A;  1JOA A;  4NEW A;  5EBK A;  1TDK A;  4D04 A;  1W4X A;  1YKJ A;  1NHS A;  3LOV A;  3UTH A;  4BK1 A;  5KXJ A;  1Q1R A;  3DJD A;  2WU2 A;  4J2W A;  4K8D A;  2Q0K A;  2OLN A;  2VVM A;  2WDR A;  2YG4 A;  1S2Q A;  4RSL A;  4XWZ A;  2CUL A;  2YR4 A;  3NNE A;  2QAE A;  3IWA A;  2V61 A;  4UDQ A;  3QSE A;  4DSH A;  2GAH B;  2H88 A;  1TDO A;  2GR3 A;  2QCU A;  3AEG A;  3CND A;  4U2T A;  4YTP A;  1P2E A;  4J31 A;  3AE2 A;  3NLC A;  4ZN0 A;  1OJT A;  3AE4 A;  2YVJ A;  2NPX A;  1E1N A;  4A6N B;  1DXL A;  3RHA A;  2IID A;  2W0H A;  4U8K A;  1V59 A;  3QVP A;  4FX9 A;  2C7G A;  1VRQ B;  2YVF A;  2BS4 A;  1VG9 A;  3DJG X;  2A87 A;  3ICS A;  3ITJ A;  5GSN A;  3OC4 A;  4AOS A;  5L46 A;  1D7Y A;  2XLP A;  3AE7 A;  4REK A;  3V3N A;  1COY A;  1GTH A;  2ACZ A;  2FJA A;  4C3X A;  3CNS A;  3ZDN A;  2WP6 A;  2PYX A;  4C77 A;  1BF3 A;  1KNR A;  1NAA A;  3R9U A;  4CRT A;  4I59 A;  2BXS A;  1OJD A;  3FPZ A;  4OPI A;  2GR2 A;  3URH A;  1N4W A;  2C70 A;  2IVE A;  3AE3 A;  4WX1 A;  5JCL A;  2XLT A;  2IVD A;  1BGN A;  1B37 A;  1B4V A;  4JY2 A;  3ALJ A;  4Z2T A;  2R4J A;  2CFY A;  3P4P A;  2WOI A;  4PAB A;  2GMH A;  2WU5 A;  2B7R A;  1MO9 A;  1OJ9 A;  2C73 A;  2VVL A;  3BNU A;  2C75 A;  3CNJ A;  2F5Z A;  4DGK A;  4J57 A;  4GUV A;  4UDP A;  4CNK A;  4H2P A;  1PJ6 A;  2BXR A;  3G5S A;  2WPF A;  2QA2 A;  3DME A;  3AEE A;  4BJY A;  3ABV A;  3KKJ A;  3P4Q A;  1KFY A;  2XFU A;  3D8X A;  1CJ2 A;  4GDE A;  2V6O A;  3RP6 A;  5HY5 A;  2O9Z A;  1NEN A;  3AE5 A;  3QSS A;  3ALL A;  3UKP A;  1YY5 A;  2XCG A;  4HA6 A;  4U8O A;  5IQ4 A;  4IVM B;  4XXG A;  4U8M A;  3F8R A;  2EQ8 A;  1E1L A;  4CNJ A;  3K30 A;  4LA1 A;  1TYP A;  2GR0 A;  1EL5 A;  4WCT A;  4GCM A;  3SGL A;  4ZCC A;  2YR5 A;  5TR3 A;  2WET A;  2FJE A;  2YVG A;  1GND A;  1FEA A;  1TRB A;  3LZW A;  3UKF A;  2BAC A;  4OCG A;  4H4P A;  1K0L A;  3NT6 A;  1NDA A;  4FK1 C;  1IUU A;  1GOS A;  1ELI A;  2NVK X;  4H7U A;  1H7X A;  4NZH A;  2BC1 A;  4YTN A;  4APN A;  1JU2 A;  4H4V A;  4I58 A;  5HHF A;  2WQY A;  1GV4 A;  1Y56 A;  3UKA A;  2XVH A;  4Z44 A;  2YLR A;  4JNA A;  4J34 A;  3EAO A;  4MJW A;  4J36 A;  3GRS A;  1IUS A;  1KSU A;  3QSM A;  3AYL A;  2E4G A;  4GR1 A;  1PDH A;  4X4J A;  4EIP A;  4YXD A;  5U63 A;  4RG3 A;  4AP3 A;  2ZBW A;  2WPE A;  3UKK A;  1XHC A;  2XFP A;  4LU6 A;  4TLZ A;  2AR8 A;  4EQS A;  1GET A;  1L0V A;  4CBQ A;  1GT8 A;  2JBV A;  3SFE A;  2GH5 A;  2TMD A;  4H2N A;  3K7M X;  2QA1 A;  4BUR A;  4IVO B;  1ZOV A;  2YQU A;  3CPI G;  3UKQ A;  1BWC A;  2BC0 A;  2R45 A;  1K0J A;  5CKU A;  2YM1 A;  4B63 A;  1H84 A;  3K7T A;  5JCI A;  5IPY A;  2EQ9 A;  2WDQ A;  1AOG A;  1L9C A;  3GWF A;  1PJ5 A;  2AQJ A;  2C3C A;  1OJA A;  4YKG A;  5EB5 A;  1F8W A;  4EMI A;  4USR A;  5M0Z A;  1XAN A;  2ZZC A;  4N9X A;  1CHU A;  1Y0P A;  2BS2 A;  4IV9 A;  3M12 A;  1E39 A;  3C4A A;  4OPG A;  1JNZ A;  3BHK A;  3M0O A;  1NG4 A;  2B9Y A;  3KVE A;  5JCK A;  2APG A;  4YSZ A;  3GD4 A;  4H4U A;  2C3D A;  2XLR A;  1DJN A;  3NHO X;  3NK0 X;  3H8I A;  3F8D A;  3V76 A;  3I3L A;  4CCR A;  1IUV A;  1JRX A;  1PBF A;  4B68 A;  2AAQ A;  1BGJ A;  2Q6U A;  1H86 A;  3AXB A;  3NG7 X;  3NH3 X;  4JN9 A;  4U2S A;  4H4W A;  2BA9 A;  3QJ4 A;  2X8H A;  5BUL A;  3L8K A;  1DOD A;  3H8L A;  4NTD A;  1D4C A;  4Y4N A;  4BJZ A;  2OLO A;  4BK3 A;  4M52 A;  2FBW A;  5LV9 A;  2GF3 A;  4U8I A;  4AOX A;  1S3B A;  4IA6 A;  4U8L A;  1PN0 A;  4Z43 A;  5BVA A;  1PBC A;  1VDC A;  2B9W A;  4PAA A;  2GR1 A;  3E1T A;  1FOH A;  1FEC A;  1QLB A;  4TM1 A;  4H2R A;  1CF3 A;  3DJE A;  2WBA A;  1XPQ A;  1ZP0 A;  4TLX A;  1PJ7 A;  5C3J A;  4Z2R A;  3ATR A;  4YWO A;  2R0P A;  4A6N A;  2WP5 A;  1HYU A;  2JKC A;  3FBS A;  3P4R A;  3GSI A;  2YLT A;  4EQW A;  2GQF A;  4DNA A;  4Z26 A;  3AE8 A;  4A9W A;  2OAL A;  3ISH A;  5M10 A;  3C96 A;  1PBD A;  1GRA A;  1ONF A;  5KVH A;  1K0I A;  4H4Q A;  2B76 A;  1E6E A;  2RGH A;  1QO8 A;  3SQP A;  2RAB A;  2BS3 A;  2R0G A;  5KWF A;  4BK2 A;  1GER A;  1IUW A;  4NEV A;  3P9U A;  2JB2 A;  3DK4 A;  4JDR A;  1NG3 A;  3SFD A;  4EQR A;  5KVI A;  3Q6J A;  3NK1 X;  4ADW A;  1NEK A;  1GXF A;  1TDE A;  1ZDL A;  4A5L A;  2GB0 A;  3NK2 X;  2WPC A;  3OZ2 A;  4KX6 A;  3UTG A;  4AP1 A;  5J60 A;  5KRQ A;  4X9M A;  1H83 A;  1RYI A;  3LB8 A;  3II4 A;  4U8P A;  4X9N A;  3UTE A;  4EM4 A;  2CDU A;  4B67 A;  1DOC A;  2BCG G;  4UP3 A;  3KU9 A;  1GSN A;  1MOK A;  4EMW A;  2Y6Q A;  1UKV G;  2YG5 A;  3F8P A;  2R4E A;  3CIR A;  1F6M A;  1O94 A;  1JEH A;  1KSS A;  4J33 A;  4AT0 A;  5C2T A;  1JNR A;  1GES A;  2WHD A;  4K5S A;  1D4D A;  4YSY A;  2E5V A;  1NPX A;  2JK6 A;  3QFB A;  3B6D A;  2BK3 A;  3CNP A;  2VVL G;  4H4X A;  3NIX A;  1YQ4 A;  4U8J A;  2XFQ A;  2BK4 A;  2GRT A;  4GDP A;  1Q9I A;  1ZY8 A;  3ATQ A;  2GMJ A;  4K2X A;  3KLJ A;  1Q1W A;  3T37 A;  3FMW A;  2GEW A;  1K4Q A;  3G5Q A;  1ZMC A;  3DK9 A;  5FS9 A;  2C67 A;  1RP0 A;  1PXB A;  2VRL A;  3AE6 A;  3AYJ A;  1TDF A;  4KPR A;  1S2Y A;  5U25 A;  2C76 A;  2YLZ A;  1PHH A;  1JRY A;  3CTY A;  2WDV A;  3NKS A;  5HYM A;  3ZYX A;  2YAU A;  3AED A;  3BI5 A;  4BV6 A;  2OAM A;  4EIQ A;  2YLW A;  3EPT A;  3UTF A; 
#chains in the Genus database with same CATH topology
 4GME A;  1EL9 A;  3PS9 A;  5HXI A;  3PVC A;  4C74 A;  2XH2 A;  1PXC A;  1NHR A;  3LAD A;  1FIQ B;  3NFU A;  2RGO A;  3AB1 A;  2W3S A;  4G9K A;  1FHU A;  3D46 A;  3TWB A;  2XH7 A;  4H1Z A;  3VRD B;  3JZU A;  2PHH A;  4B1B A;  2X50 A;  3SYI A;  3AE1 A;  4KEM A;  3ENL A;  3LZX A;  3A7R A;  2BAB A;  3ICR A;  4CY8 A;  3TJI A;  4Z25 A;  3BOX A;  3CGD A;  1REO A;  3CYJ A;  3NYC A;  3STP A;  3AE9 A;  3S61 A;  1ZMD A;  1N61 C;  4GFI A;  3SX6 A;  4H4Y A;  4G7F A;  1BZL A;  3U4F A;  3T9P A;  2Z5X A;  2GL5 A;  3GDP A;  2WOV A;  1CC2 A;  3GRT A;  2VOU A;  2BK5 A;  2QJN A;  4OPD A;  3I4K A;  2PP3 A;  2X3N A;  4DN1 A;  3T6C A;  4E4U A;  4C3Y A;  3ZVH B;  1LQT A;  1DNC A;  4G6G A;  3CGC A;  3EUB 3;  3G5R A;  4FK1 A;  4A99 A;  2WEU A;  4A35 A;  2CVJ A;  4HCD A;  3KPK A;  4IT1 A;  2FJD A;  3UKL A;  5KMQ A;  3NGC X;  2RGJ A;  1CC4 A;  3UOZ A;  1ZKQ A;  3GMB A;  3P0W A;  4DSG A;  4O5Q A;  4RG4 A;  1RSG A;  5FS7 A;  1H7W A;  4OVI A;  1DOB A;  2X99 A;  1ZK7 A;  3DA1 A;  2EQ7 A;  1F8S A;  2OA1 A;  3JVA A;  3NTD A;  3OP2 A;  2C65 A;  1H81 A;  1IUX A;  1PS9 A;  1N62 C;  2WS3 A;  3EKG A;  4OPT A;  4GRT A;  1GRB A;  5EOW A;  1CC6 A;  4MKS A;  4K5R A;  1E7P A;  3Q4D A;  3VRB A;  2XSX A;  4H4Z A;  2E3T A;  4CCQ A;  3GD3 A;  3R0U A;  3PO7 A;  1FFV C;  3EF6 A;  1DJQ A;  3IJQ A;  3COX A;  3K7Q X;  1MDL A;  1ZX9 A;  1CJ4 A;  2PGW A;  4JY3 A;  4K2S A;  5EBK A;  5KXJ A;  4BK1 A;  2WU2 A;  4K8D A;  4II2 A;  2WDR A;  1S2Q A;  4RSL A;  3SJN A;  3DGB A;  2QJJ A;  3NVZ B;  4DSH A;  2HNE A;  1TDO A;  4YTP A;  4U2T A;  3AE2 A;  3RHA A;  4U8K A;  3H7V A;  1VG9 A;  3D47 A;  1GTH A;  4C77 A;  4DWD A;  3R9U A;  4I59 A;  3FCP A;  3RR1 A;  1OJD A;  3QKE A;  2C70 A;  3B9J B;  4WX1 A;  2XLT A;  2IVD A;  1BGN A;  3ALJ A;  2CFY A;  3P4P A;  2GMH A;  2B7R A;  1MO9 A;  1OJ9 A;  3U9I A;  2C73 A;  3FJ4 A;  2VVL A;  3SZF A;  2F5Z A;  2O56 A;  4GUV A;  4H2P A;  3IJL A;  2QA2 A;  4BJY A;  3ABV A;  2OPJ A;  1KFY A;  1R6W A;  3ALL A;  4HPN A;  3F8R A;  4CNJ A;  4ZCC A;  5G5G B;  2BAC A;  4H4P A;  4FK1 C;  1GOS A;  4NZH A;  2PA6 A;  4HYR A;  4DYE A;  3NS1 B;  4GR1 A;  1PDH A;  4RG3 A;  4AP3 A;  2ZBW A;  3UKK A;  4KPL A;  4EQS A;  4H83 A;  1WUE A;  1WYG A;  2JBV A;  3SFE A;  3K7M X;  3DDM A;  1ZOV A;  3OPS A;  2YQU A;  4B63 A;  5CKU A;  3MUC A;  3GWF A;  4IL2 A;  4GIR A;  4EMI A;  4HCL A;  3M12 A;  4K8G A;  1JNZ A;  3M0O A;  3ZVI A;  1JDF A;  3UJR A;  2XLR A;  3HW2 A;  3F8D A;  4H19 A;  4CCR A;  1IUV A;  1PBF A;  1SJB A;  4ZCD A;  4U2S A;  3NH3 X;  4IP4 A;  2MUC A;  3DG3 A;  3H8L A;  1D4C A;  2FBW A;  5LV9 A;  1S3B A;  4IA6 A;  2B9W A;  4PAA A;  3E1T A;  3B97 A;  4Z2R A;  3H12 A;  3N4E A;  1SJA A;  3SZ0 A;  2YLT A;  5M10 A;  3C96 A;  1ONF A;  1K0I A;  1QO8 A;  3SQP A;  2RAB A;  1IUW A;  3H70 A;  3DK4 A;  4JDR A;  4EQR A;  3QLD A;  1ZDL A;  3CMM A;  4A5L A;  2OZ3 A;  2GB0 A;  3RIT A;  3NK2 X;  4X9M A;  1RYI A;  3II4 A;  4X9N A;  4UP3 A;  3SN0 A;  2R4E A;  3CIR A;  2PGE A;  1O94 A;  2PMQ A;  1D4D A;  4YSY A;  3UJF A;  1Q9I A;  2AKM A;  3DFY A;  2GEW A;  3DK9 A;  5FS9 A;  4MGG A;  3AE6 A;  3AYJ A;  3PWI A;  2P0I A;  5U25 A;  2C76 A;  4G8T A;  3CTY A;  4HNC A;  4K1W A;  4GAP A;  3BI5 A;  4BV6 A;  4GGH A;  2OAM A;  4EIQ A;  3HYW A;  3NYF A;  4Y4M A;  3RP8 A;  3HZL A;  1GRE A;  3DIP A;  4EQX A;  3ICT A;  4YTM A;  3BSM A;  3N6H A;  3VRA A;  2V3A A;  3MZN A;  1N60 C;  3AEB A;  3T31 A;  3NN6 X;  2YLX A;  4Z1Y A;  2W55 A;  3DJJ A;  1GRF A;  3D1C A;  5FJT A;  1FCD A;  1H82 A;  2ZC8 A;  3NN0 X;  3OZM A;  1SEZ A;  2A8X A;  3BI4 A;  2ZZ0 A;  3V4B A;  3FIM B;  2P8C A;  3JSK A;  3GDN A;  3CAW A;  4A65 A;  2QJM A;  3N6J A;  2UZZ A;  3UKH A;  1KN0 A;  2YG3 A;  5JCM A;  3QFA A;  4D03 A;  4H4S A;  4A6G A;  3RGT A;  5GRT A;  3O0H A;  1D5T A;  2E5A A;  1GRT A;  5EB4 A;  1EBD A;  3LJP A;  1FL2 A;  1P2H A;  2C4C A;  4JQ9 A;  3GO2 A;  4GAV A;  1LPF A;  1N5W C;  3UJE A;  4OPL A;  3DK8 A;  3GY1 A;  4ZOH B;  5KMP A;  3AD7 B;  4K22 A;  1BQG A;  2GAG B;  5ENL A;  2VZ2 A;  3VQR A;  1NHQ A;  1KKO A;  2C66 A;  5FS6 A;  4ECH A;  1KKR A;  1VQZ A;  1N4U A;  3NTA A;  1DOE A;  3FV9 A;  3IF9 A;  5BUK A;  5DBJ A;  3RO6 A;  4A79 A;  1IUT A;  3I6E A;  3NVY B;  3UOX A;  1B5Q A;  3IHG A;  3SN1 A;  3ZLF A;  5G5H B;  3PFR A;  3UOY A;  1GEU A;  4GYP A;  3D9X A;  3QPE A;  3V3W A;  4GF7 A;  4U2L A;  3RRA A;  1LTX R;  4H2Q A;  5FS8 A;  1FEB A;  4P9S A;  3PK7 A;  1QJD A;  3T2Z A;  3UOV A;  3AN1 A;  1MXT A;  5BRT A;  2HZG A;  1L9D A;  2XVF A;  4X2P A;  1GRG A;  4ZCW A;  4C5O A;  1P43 A;  2W3R A;  4B64 A;  4YT0 A;  4EM3 A;  3AD8 B;  5IDZ A;  3UXK A;  1TDK A;  1X2G A;  3LOV A;  1XS2 A;  1Q1R A;  2OLN A;  2YG4 A;  3JW7 A;  3VCC A;  3NNE A;  3IWA A;  2P88 A;  2V61 A;  4UDQ A;  3ES8 A;  3NRZ B;  2GR3 A;  2QCU A;  3AEG A;  1V97 A;  4J31 A;  3NLC A;  2YVJ A;  3NVW B;  4A6N B;  1DXL A;  2IID A;  2OVL A;  2W0H A;  3DG6 A;  1VRQ B;  3DJG X;  2A87 A;  3ICS A;  3ITJ A;  5GSN A;  3HPF A;  3OC4 A;  3UXL A;  3AE7 A;  4REK A;  3V3N A;  1COY A;  1NAA A;  4CRT A;  3UJ2 A;  3SR6 B;  1B4V A;  4Z2T A;  1STZ A;  3VFC A;  2C75 A;  1KCZ A;  4UDP A;  1PJ6 A;  2BXR A;  2WPF A;  3AEE A;  3HYX A;  3KKJ A;  2XFU A;  3D8X A;  4YWS A;  1CJ2 A;  3AM9 A;  1NEN A;  3QSS A;  2XCG A;  4HA6 A;  3T4W A;  2CHR A;  4U8M A;  4XXG A;  3T8Q A;  3R25 A;  3OTR A;  2FJE A;  1GND A;  3LZW A;  3DFH A;  1IUU A;  2PS2 A;  1H7X A;  4YTN A;  5HHF A;  3S5S A;  2XVH A;  1KSU A;  2E4G A;  4X4J A;  4EIP A;  3ZLG A;  2WPE A;  3IJI A;  1GT8 A;  4G73 A;  3R10 A;  2TMD A;  1E9I A;  4IVO B;  1TE6 A;  2R45 A;  1K0J A;  3K7T A;  4E4F A;  5IPY A;  2BRY A;  4GYP C;  1OJA A;  1JPD X;  1F8W A;  4USR A;  5M0Z A;  2NQL A;  3TW9 A;  1Y0P A;  2BS2 A;  4TVY A;  5KMR A;  3R07 C;  4HCH A;  2B9Y A;  4YSZ A;  3GD4 A;  1DJN A;  4M6U A;  5KMS A;  3NHO X;  3NK0 X;  4B68 A;  1BGJ A;  2Q6U A;  1H86 A;  4H4W A;  2BA9 A;  2X8H A;  3L8K A;  1DOD A;  2OLO A;  4BK3 A;  4M52 A;  2OKT A;  1PN0 A;  1XPY A;  4H2R A;  2DW7 A;  1PJ7 A;  5C3J A;  2WP5 A;  3FBS A;  2QGY A;  3GSI A;  4Z26 A;  1GRA A;  1JRP A;  3SZW A;  1PDZ A;  2R0G A;  4NEV A;  1SJD A;  2JB2 A;  2GDQ A;  1NG3 A;  5KVI A;  1GXF A;  1ECQ A;  2WPC A;  1T3Q C;  2PTW A;  3UTG A;  5KRQ A;  3LB8 A;  3TOY A;  3KU9 A;  1GSN A;  3P3B A;  2XGZ A;  3THU A;  1JNR A;  2WHD A;  4G6H A;  1MNS A;  3B6D A;  3CNP A;  3CT2 A;  4U8J A;  2BK4 A;  4GDP A;  3ATQ A;  3T37 A;  3KLJ A;  1Q1W A;  3FYY A;  3FMW A;  3G5Q A;  3GYX A;  2C67 A;  3K1G A;  1RP0 A;  4KPR A;  1S2Y A;  4M0X A;  3NKS A;  2WDV A;  2YAU A;  2YLW A;  3EPT A;  2J3N A;  2XVI A;  3BJS A;  4NTE A;  1NHP A;  3T2Y A;  3UCL A;  2DKH A;  2JB3 A;  3FG2 P;  2VRM A;  1TYT A;  3RED A;  2R46 A;  5FJU A;  5JCN A;  2PSN A;  4EMJ A;  3UP4 A;  1X31 B;  1ONE A;  1JCT A;  2X8G A;  3GC2 A;  1M6I A;  3CPH G;  4FP1 A;  2YLS A;  1N1P A;  4IA5 A;  3EAN A;  1EC8 A;  2Q0L A;  1EL8 A;  2BCP A;  2YR6 A;  3NO1 A;  2XYO A;  2V5Z A;  4HNL A;  5BOF A;  1D7L A;  4OPU A;  1KNP A;  1EC9 A;  3BNM A;  5KOW A;  1N4V A;  4TM3 A;  2TPR A;  3MSY A;  2OQH A;  1OJC A;  3P4S A;  2JAE A;  1IJH A;  2XVJ A;  3KA7 A;  4NTC A;  3CB3 A;  2AL2 B;  2B9X A;  3CGE A;  2A89 A;  4Y4L A;  1FHV A;  2Z5Y A;  3AEF A;  4IHC A;  2QQ6 A;  1SB3 B;  2XLU A;  3V3O A;  4IZG A;  4AT2 A;  1PXA A;  2WP9 A;  1GTE A;  1F3P A;  3GD6 A;  4OPC A;  1VG0 A;  1RVK A;  3ALM A;  2JB1 A;  2P3Z A;  2GVC A;  5IQ1 A;  3AEC A;  3I6T A;  4H4T A;  3NYE A;  1VDV A;  2VQB A;  2HQM A;  1PBB A;  4O5U A;  3FXG A;  1E1K A;  2ARD A;  2OZT A;  2XVE A;  3IHM A;  3B3R A;  2BYB A;  4A3R A;  1YQ3 A;  4DHG A;  1Y56 B;  2GV8 A;  2GQW A;  3DEQ A;  3VR8 A;  2PTY A;  3QVR A;  1CL0 A;  2XDO A;  4H50 A;  2H89 A;  5JRB A;  1XDI A;  2Y6R A;  2PTZ A;  3UGV A;  2YWL A;  2R0C A;  2YM2 A;  5CQF A;  4ZA0 A;  1CJC A;  4YSX A;  4J56 A;  2POD A;  1GAL A;  3GMC A;  2V60 A;  2E1M A;  5FJP A;  1O5W A;  4XWR A;  3S5W A;  1KF6 A;  3DGZ A;  4UDR A;  4B66 A;  3BHF A;  3GYI A;  3AWI A;  4K7Z A;  4ICY A;  2C72 A;  4TM0 A;  4CNK A;  4U8N A;  4D04 A;  1W4X A;  3UTH A;  2AL1 A;  4J2W A;  2Q0K A;  2VVM A;  4XWZ A;  2CUL A;  2QAE A;  3QSE A;  2GAH B;  2H88 A;  3V5C A;  3CND A;  3MY9 A;  4ZN0 A;  2NPX A;  3MWC A;  4ENL A;  3T2K A;  3QVP A;  4FX9 A;  2YVF A;  5L46 A;  1D7Y A;  2ACZ A;  2FJA A;  3CNS A;  2WP6 A;  1BF3 A;  2BXS A;  4OPI A;  2GR2 A;  1N4W A;  4NNJ A;  5JCL A;  1R0M A;  4JY2 A;  1B37 A;  1FFU C;  2GGI A;  2R4J A;  2WOI A;  2WU5 A;  3T0K A;  4J57 A;  2OFJ A;  3G5S A;  3DME A;  1BKH A;  3TCS A;  2XH4 A;  4GDE A;  3RP6 A;  2O9Z A;  4KT2 A;  3AE5 A;  2POZ A;  3UKP A;  3VC5 A;  1YY5 A;  5IQ4 A;  3UCC A;  2EQ8 A;  1S7M A;  3Q45 A;  3A7A A;  3SXI A;  3A7U A;  2GR0 A;  1EL5 A;  3SGL A;  2WET A;  2PU1 A;  1TRB A;  4OCG A;  1K0L A;  3NT6 A;  1NDA A;  1ELI A;  2NVK X;  2BC1 A;  4APN A;  1JU2 A;  4I58 A;  3KUM A;  4JNA A;  4J34 A;  4MJW A;  3OZY A;  4J36 A;  2QVH A;  3GRS A;  1IUS A;  7ENL A;  3SN4 A;  3UJS A;  5U63 A;  4JHM A;  4TLZ A;  2AR8 A;  4H2H A;  1GET A;  3L5O A;  2GH5 A;  1PDY A;  4H2N A;  1X2H A;  2P8B A;  4G74 A;  3CPI G;  2BC0 A;  2YM1 A;  5JCI A;  1AOG A;  1L9C A;  1PJ5 A;  2AQJ A;  5EB5 A;  1JPM A;  1XAN A;  2ZZC A;  3HYV A;  1E39 A;  3C4A A;  3BHK A;  4MMW A;  3KVE A;  4H4U A;  2C3D A;  3SZC A;  3HRD C;  3H8I A;  3I3L A;  3UCD A;  2QDD A;  2AAQ A;  2DW6 A;  3NG7 X;  4JN9 A;  2OLA A;  3TQP A;  4Y4N A;  1IYX A;  2GF3 A;  4U8I A;  3QN3 A;  4Z43 A;  5BVA A;  1PBC A;  1VDC A;  1FEC A;  2WBA A;  1XPQ A;  4II3 A;  4TLX A;  4YWO A;  2R0P A;  4A6N A;  4EQW A;  2GQF A;  3AE8 A;  4A9W A;  3ISH A;  3SY4 A;  2BS3 A;  4BK2 A;  1GER A;  3SSZ A;  3SFD A;  1F9C A;  3R11 A;  2OQY A;  1TDE A;  3ZVH A;  3OZ2 A;  4J3Z A;  5J60 A;  3TWA A;  4EM4 A;  3NVV B;  2Y6Q A;  1UKV G;  1WUF A;  3NXL A;  3VA8 A;  1ZXI C;  1F6M A;  2PTX A;  6ENL A;  1JEH A;  1KSS A;  4J33 A;  4AT0 A;  1GES A;  4K5S A;  3DER A;  1NPX A;  2JK6 A;  2PP0 A;  2VVL G;  1OEP A;  4H4X A;  2XFQ A;  3MQT A;  4K2X A;  1K4Q A;  1ZMC A;  4E6M A;  2VRL A;  1TDF A;  4HN8 A;  2GSH A;  2GGG A;  2YLZ A;  1PHH A;  1JRY A;  5HYM A;  4E5T A;  3ZYX A;  3AED A;  4ROP A;  1S3E A;  5EU9 A;  3AMZ A;  4YKF A;  5J04 A;  2WES A;  1W6T A;  3GWD A;  4USQ A;  2FJB A;  3ADA B;  1N5X A;  1B8S A;  3NRN A;  4DXK A;  1CJ3 A;  4Z17 A;  3P1W A;  1L9E A;  3C4N A;  4EWJ A;  3RNM A;  4A7A A;  1PBE A;  1N63 C;  4Z2U A;  3DES A;  2VQ7 A;  4YSH A;  1D4E A;  2AKZ A;  3FVD A;  2X8C A;  2RDX A;  1F8R A;  5KNL A;  3VR9 A;  2I5Q A;  4E8G A;  3KD9 A;  3DGH A;  1E1M A;  2V3B A;  3DH9 A;  5FJR A;  2OG9 A;  3L1R A;  2B7S A;  1EBH A;  2XFN A;  3T14 A;  3CGB A;  3BI2 A;  3CN8 A;  2PCE A;  4J1O A;  3AD9 B;  2DKI A;  3SM8 A;  4JNQ A;  1NEL A;  1VQW A;  1SJC A;  3I6D A;  5KOX A;  5J7X A;  3KPF A;  2YG6 A;  4B69 A;  1GPE A;  4B65 A;  1MRA A;  4GIS A;  3LXD A;  5U1O A;  2EQ6 A;  3UP5 A;  3M13 A;  4IP5 A;  2YG7 A;  1JRO A;  1JRZ A;  1TDN A;  2XLS A;  4Z24 A;  3H4K A;  4CY6 A;  1EL7 A;  1CBO A;  3RP7 A;  3MKC A;  3SBF A;  2ZZB A;  1M64 A;  4KWS A;  1GRH A;  1LVL A;  1O95 A;  1LV0 A;  4F4R A;  4NWZ A;  1Z6L A;  3GYJ A;  3CPJ G;  4TM4 A;  2WOW A;  2HXU A;  3Q9T A;  2I0Z A;  1DTN A;  4H4R A;  4E0V A;  4LII A;  1H6V A;  3CNT A;  5FMH A;  2C64 A;  2PU0 A;  3AYI A;  3IC9 A;  2OZ8 A;  2PP1 A;  1KD0 A;  1KDG A;  3WE0 A;  1ZOY A;  4HB9 A;  2XFO A;  3PG6 A;  3ES7 A;  1EBG A;  1LQU A;  3AEA A;  5ER0 A;  1LJ1 A;  2R9Z A;  1BKW A;  2Q7V A;  1YQZ A;  4FDC B;  1JOA A;  4NEW A;  1YKJ A;  1NHS A;  3DJD A;  3ETR B;  2YR4 A;  1P2E A;  1OJT A;  3AE4 A;  3R0K A;  1E1N A;  3CK5 A;  4GGB A;  1V59 A;  2C7G A;  2BS4 A;  4AOS A;  2XLP A;  1RM6 B;  4DX3 A;  4C3X A;  3ZDN A;  3H8A A;  2PYX A;  1KNR A;  3FPZ A;  5FJO A;  3URH A;  2IVE A;  3AE3 A;  4JN7 A;  4PAB A;  2AL2 A;  3BNU A;  3CNJ A;  4DGK A;  1FO4 A;  3N4F A;  3RCY A;  3R1Z A;  2GGH A;  3P4Q A;  2ZAD A;  2V6O A;  5HY5 A;  2OO6 A;  1P48 A;  4U8O A;  2XH0 A;  2W54 A;  4IVM B;  1E1L A;  3K30 A;  4LA1 A;  1TYP A;  4WCT A;  4GCM A;  2YR5 A;  1MDR A;  5TR3 A;  2YVG A;  1FEA A;  3UKF A;  4H7U A;  4H4V A;  2WQY A;  1GV4 A;  1Y56 A;  3TJ4 A;  3UKA A;  4Z44 A;  2YLR A;  3EAO A;  3TTE A;  3QSM A;  3AYL A;  4YXD A;  1ELS A;  1XHC A;  2XFP A;  2HXT A;  4LU6 A;  1TKK A;  1L0V A;  4CBQ A;  4TVW A;  2QA1 A;  4BUR A;  2GGJ A;  3UKQ A;  1BWC A;  1H84 A;  2EQ9 A;  2WDQ A;  3OW1 A;  2FYM A;  2C3C A;  1H2I A;  3DG7 A;  4YKG A;  4N9X A;  1CHU A;  4IV9 A;  1YEY A;  4OPG A;  1NG4 A;  2PPG A;  5JCK A;  1NU5 A;  2APG A;  2BRA A;  3VCN A;  5BOE A;  3V76 A;  3S47 A;  1JRX A;  3AXB A;  3QJ4 A;  5BUL A;  2FKP A;  4NTD A;  4BJZ A;  4AOX A;  4U8L A;  2MNR A;  3VDG A;  2GR1 A;  1FOH A;  1QLB A;  4TM1 A;  1CF3 A;  3DJE A;  1L8P A;  1ZP0 A;  3ATR A;  1HYU A;  2JKC A;  3P4R A;  3CXO A;  3V5F A;  4DNA A;  2OAL A;  1EC7 A;  1PBD A;  5KVH A;  4H4Q A;  4JN8 A;  2B76 A;  1E6E A;  2RGH A;  5KWF A;  3IK4 A;  1MUC A;  3P9U A;  3VC6 A;  3Q6J A;  3NK1 X;  4ADW A;  1NEK A;  4IL0 A;  4KX6 A;  4AP1 A;  1H83 A;  4U8P A;  3UTE A;  2CDU A;  4B67 A;  1DOC A;  2GGE A;  2BCG G;  3CXB A;  1MOK A;  4EMW A;  2YG5 A;  3F8P A;  3EEZ A;  3SQS A;  5C2T A;  2E5V A;  3QFB A;  2BK3 A;  3NIX A;  1YQ4 A;  2QDE A;  1TZZ A;  2GRT A;  1ZY8 A;  3ZLH A;  2GMJ A;  2ONE A;  4FI4 A;  1PXB A;  3QTP A;  3NZG A;  3PWG A;  2OX4 A;  3P93 A;  3UTF A; 
#chains in the Genus database with same CATH homology
 1S3E A;  2J3N A;  3NYF A;  4YKF A;  2XVI A;  2WES A;  4Y4M A;  3RP8 A;  3GWD A;  4NTE A;  1NHP A;  3HZL A;  1EL9 A;  3T2Y A;  3PS9 A;  1GRE A;  4USQ A;  3UCL A;  2DKH A;  2FJB A;  3ADA B;  3PVC A;  4EQX A;  5HXI A;  1B8S A;  4C74 A;  3ICT A;  4YTM A;  1PXC A;  2JB3 A;  3NRN A;  1CJ3 A;  3FG2 P;  1NHR A;  1TYT A;  3LAD A;  2VRM A;  3RED A;  3VRA A;  2V3A A;  2R46 A;  2RGO A;  3P1W A;  3AEB A;  1L9E A;  3AB1 A;  5JCN A;  4EMJ A;  4G9K A;  3UP4 A;  1X31 B;  3C4N A;  3T31 A;  3NN6 X;  2X8G A;  2YLX A;  3CPH G;  1M6I A;  3RNM A;  4A7A A;  1PBE A;  3DJJ A;  3VRD B;  1GRF A;  1N1P A;  2YLS A;  4IA5 A;  3D1C A;  1FCD A;  1H82 A;  3EAN A;  4Z2U A;  2PHH A;  4B1B A;  2Q0L A;  3NN0 X;  2VQ7 A;  1SEZ A;  1D4E A;  2X50 A;  4YSH A;  3SYI A;  1EL8 A;  2BCP A;  2A8X A;  2YR6 A;  3AE1 A;  2X8C A;  3BI4 A;  2ZZ0 A;  1F8R A;  3FIM B;  2XYO A;  5KNL A;  2V5Z A;  3LZX A;  3JSK A;  2BAB A;  3ICR A;  3GDN A;  1D7L A;  4A65 A;  3VR9 A;  4CY8 A;  4OPU A;  2UZZ A;  3KD9 A;  4Z25 A;  3DGH A;  1KNP A;  3CGD A;  1E1M A;  1REO A;  3BNM A;  3NYC A;  1N4V A;  5KOW A;  4TM3 A;  3UKH A;  2TPR A;  2V3B A;  3AE9 A;  3S61 A;  1ZMD A;  3DH9 A;  1OJC A;  3P4S A;  1KN0 A;  1IJH A;  2JAE A;  2XVJ A;  3KA7 A;  2YG3 A;  4NTC A;  5JCM A;  3QFA A;  3SX6 A;  4D03 A;  4H4Y A;  4H4S A;  3L1R A;  2B7S A;  3VQR A;  2XFN A;  5GRT A;  1BZL A;  3T14 A;  2B9X A;  3O0H A;  1D5T A;  3CGB A;  3CGE A;  2A89 A;  3BI2 A;  3CN8 A;  4Y4L A;  2Z5Y A;  3AEF A;  1GRT A;  2Z5X A;  3AD9 B;  3GDP A;  2XLU A;  2WOV A;  2DKI A;  3V3O A;  1CC2 A;  5EB4 A;  4AT2 A;  3GRT A;  1EBD A;  2VOU A;  1FL2 A;  1P2H A;  2BK5 A;  3LJP A;  4JNQ A;  3SM8 A;  2C4C A;  1PXA A;  4JQ9 A;  2WP9 A;  1GTE A;  1F3P A;  1VQW A;  4OPD A;  2X3N A;  4OPC A;  4C3Y A;  3I6D A;  5KOX A;  4GAV A;  1LQT A;  1DNC A;  1VG0 A;  5J7X A;  1LPF A;  3KPF A;  3CGC A;  2YG6 A;  3ALM A;  4G6G A;  2JB1 A;  4B69 A;  3G5R A;  4FK1 A;  2GVC A;  5IQ1 A;  4A99 A;  2WEU A;  4OPL A;  3DK8 A;  1GPE A;  2CVJ A;  4B65 A;  3KPK A;  3AEC A;  5KMP A;  2FJD A;  3UKL A;  3AD7 B;  4K22 A;  2VZ2 A;  2GAG B;  3NGC X;  5KMQ A;  2RGJ A;  4H4T A;  3NYE A;  1NHQ A;  2VQB A;  2HQM A;  1PBB A;  2C66 A;  3LXD A;  5FS6 A;  4O5U A;  4ECH A;  5U1O A;  1E1K A;  2EQ6 A;  1CC4 A;  1N4U A;  3UOZ A;  2ARD A;  3UP5 A;  2XVE A;  3M13 A;  1ZKQ A;  3NTA A;  1DOE A;  3IHM A;  3GMB A;  2YG7 A;  3B3R A;  1JRZ A;  4DSG A;  4YT0 A;  2BYB A;  3IF9 A;  1YQ3 A;  4O5Q A;  4RG4 A;  5DBJ A;  5BUK A;  1TDN A;  2XLS A;  4Z24 A;  1Y56 B;  2GV8 A;  3H4K A;  4CY6 A;  1RSG A;  2GQW A;  1EL7 A;  5FS7 A;  1CBO A;  3RP7 A;  4A79 A;  2ZZB A;  3VR8 A;  1IUT A;  1H7W A;  1DOB A;  4OVI A;  2X99 A;  3QVR A;  1ZK7 A;  3DA1 A;  2EQ7 A;  1CL0 A;  3UOX A;  1M64 A;  1F8S A;  1B5Q A;  2XDO A;  4H50 A;  3IHG A;  4ZCD A;  1GRH A;  2OA1 A;  1LVL A;  2H89 A;  1O95 A;  1LV0 A;  5JRB A;  3NTD A;  1XDI A;  2Y6R A;  3UOY A;  2C65 A;  1H81 A;  1GEU A;  4NWZ A;  3D9X A;  1Z6L A;  3GYJ A;  1IUX A;  2YWL A;  3CPJ G;  1PS9 A;  2WS3 A;  2R0C A;  4OPT A;  4GRT A;  2YM2 A;  5CQF A;  4TM4 A;  2WOW A;  1GRB A;  1CJC A;  4GF7 A;  3Q9T A;  4U2L A;  5EOW A;  4YSX A;  1LTX R;  4H2Q A;  1CC6 A;  5FS8 A;  4J56 A;  2I0Z A;  1FEB A;  4K5R A;  4P9S A;  4H4R A;  1GAL A;  4E0V A;  1E7P A;  4LII A;  1QJD A;  1H6V A;  3GMC A;  2V60 A;  2E1M A;  3CNT A;  3T2Z A;  3VRB A;  5FMH A;  2C64 A;  3UOV A;  3AYI A;  1MXT A;  1O5W A;  4XWR A;  3S5W A;  3IC9 A;  1KF6 A;  5BRT A;  3DGZ A;  1KDG A;  4UDR A;  1L9D A;  2XVF A;  4H4Z A;  3WE0 A;  4CCQ A;  1ZOY A;  3GD3 A;  1GRG A;  4HB9 A;  2XFO A;  3PO7 A;  4C5O A;  3PG6 A;  4B66 A;  3BHF A;  3GYI A;  3EF6 A;  1DJQ A;  1LQU A;  3COX A;  3AEA A;  3AWI A;  4K7Z A;  3K7Q X;  4B64 A;  4ICY A;  5ER0 A;  1LJ1 A;  2C72 A;  2R9Z A;  1BKW A;  1ZX9 A;  4EM3 A;  2Q7V A;  1YQZ A;  3AD8 B;  4TM0 A;  4FDC B;  1CJ4 A;  4U8N A;  4JY3 A;  1JOA A;  4NEW A;  5EBK A;  1TDK A;  4D04 A;  1W4X A;  1YKJ A;  1NHS A;  3LOV A;  3UTH A;  4BK1 A;  5KXJ A;  1Q1R A;  3DJD A;  2WU2 A;  4J2W A;  4K8D A;  2Q0K A;  2OLN A;  4II2 A;  2VVM A;  2WDR A;  2YG4 A;  1S2Q A;  4RSL A;  4XWZ A;  2CUL A;  2YR4 A;  3NNE A;  2QAE A;  3IWA A;  2V61 A;  4UDQ A;  3QSE A;  4DSH A;  2GAH B;  2H88 A;  1TDO A;  2GR3 A;  2QCU A;  3AEG A;  3CND A;  4U2T A;  4YTP A;  1P2E A;  4J31 A;  3AE2 A;  3NLC A;  4ZN0 A;  1OJT A;  3AE4 A;  2YVJ A;  2NPX A;  1E1N A;  4A6N B;  1DXL A;  3RHA A;  2IID A;  3T2K A;  2W0H A;  4U8K A;  1V59 A;  3QVP A;  4FX9 A;  2C7G A;  1VRQ B;  2YVF A;  2BS4 A;  1VG9 A;  3DJG X;  2A87 A;  3ICS A;  3ITJ A;  5GSN A;  3OC4 A;  4AOS A;  5L46 A;  1D7Y A;  2XLP A;  3AE7 A;  4REK A;  3V3N A;  1COY A;  1GTH A;  2ACZ A;  2FJA A;  4C3X A;  3CNS A;  3ZDN A;  2WP6 A;  2PYX A;  4C77 A;  1BF3 A;  1KNR A;  1NAA A;  3R9U A;  4CRT A;  4I59 A;  2BXS A;  1OJD A;  3FPZ A;  4OPI A;  2GR2 A;  3URH A;  1N4W A;  2C70 A;  2IVE A;  4NNJ A;  3AE3 A;  4WX1 A;  5JCL A;  2XLT A;  2IVD A;  1BGN A;  1B37 A;  1B4V A;  4JY2 A;  3ALJ A;  4Z2T A;  2R4J A;  2CFY A;  3P4P A;  2WOI A;  4PAB A;  2GMH A;  2WU5 A;  2B7R A;  1MO9 A;  1OJ9 A;  2C73 A;  2VVL A;  3T0K A;  3SZF A;  3BNU A;  2C75 A;  3CNJ A;  2F5Z A;  4DGK A;  4J57 A;  4GUV A;  4UDP A;  4CNK A;  4H2P A;  1PJ6 A;  2BXR A;  3G5S A;  2WPF A;  2QA2 A;  3DME A;  3AEE A;  3HYX A;  4BJY A;  3ABV A;  3KKJ A;  3P4Q A;  1KFY A;  2XFU A;  3D8X A;  1CJ2 A;  4GDE A;  2V6O A;  3RP6 A;  5HY5 A;  2O9Z A;  1NEN A;  3AE5 A;  3QSS A;  3ALL A;  3UKP A;  1YY5 A;  2XCG A;  4HA6 A;  4U8O A;  5IQ4 A;  4IVM B;  4XXG A;  4U8M A;  3F8R A;  2EQ8 A;  1E1L A;  1S7M A;  4CNJ A;  3K30 A;  4LA1 A;  3SXI A;  1TYP A;  2GR0 A;  1EL5 A;  4WCT A;  4GCM A;  3SGL A;  4ZCC A;  2YR5 A;  5TR3 A;  2WET A;  2FJE A;  2YVG A;  1GND A;  1FEA A;  1TRB A;  3LZW A;  3UKF A;  2BAC A;  4OCG A;  4H4P A;  1K0L A;  3NT6 A;  1NDA A;  4FK1 C;  1IUU A;  1ELI A;  1GOS A;  2NVK X;  4H7U A;  1H7X A;  4NZH A;  2BC1 A;  4YTN A;  4APN A;  1JU2 A;  4H4V A;  4I58 A;  5HHF A;  2WQY A;  1GV4 A;  1Y56 A;  3UKA A;  2XVH A;  4Z44 A;  2YLR A;  4JNA A;  4J34 A;  3EAO A;  4MJW A;  4J36 A;  3GRS A;  1IUS A;  1KSU A;  3QSM A;  3AYL A;  2E4G A;  4GR1 A;  1PDH A;  4X4J A;  4EIP A;  4YXD A;  5U63 A;  4RG3 A;  4AP3 A;  2ZBW A;  2WPE A;  3UKK A;  1XHC A;  2XFP A;  4LU6 A;  4TLZ A;  2AR8 A;  4EQS A;  1GET A;  1L0V A;  3L5O A;  4CBQ A;  1GT8 A;  2JBV A;  3SFE A;  4G73 A;  2GH5 A;  2TMD A;  4H2N A;  3K7M X;  2QA1 A;  4BUR A;  4IVO B;  1ZOV A;  4G74 A;  2YQU A;  3CPI G;  3UKQ A;  1BWC A;  2BC0 A;  2R45 A;  1K0J A;  5CKU A;  2YM1 A;  4B63 A;  1H84 A;  3K7T A;  5JCI A;  5IPY A;  2EQ9 A;  2WDQ A;  2BRY A;  1AOG A;  1L9C A;  3GWF A;  1PJ5 A;  2AQJ A;  2C3C A;  1H2I A;  1OJA A;  4YKG A;  5EB5 A;  1F8W A;  4EMI A;  4USR A;  5M0Z A;  1XAN A;  2ZZC A;  4N9X A;  1CHU A;  1Y0P A;  2BS2 A;  3HYV A;  4IV9 A;  3M12 A;  1E39 A;  5KMR A;  3C4A A;  4OPG A;  1JNZ A;  3BHK A;  3M0O A;  1NG4 A;  2B9Y A;  3KVE A;  5JCK A;  2APG A;  4YSZ A;  2BRA A;  3GD4 A;  4H4U A;  2C3D A;  2XLR A;  1DJN A;  3SZC A;  5KMS A;  3NHO X;  3NK0 X;  3H8I A;  3F8D A;  3V76 A;  3I3L A;  4CCR A;  1IUV A;  1JRX A;  1PBF A;  4B68 A;  2AAQ A;  1BGJ A;  2Q6U A;  1H86 A;  3AXB A;  3NG7 X;  3NH3 X;  4JN9 A;  4U2S A;  4H4W A;  2BA9 A;  3QJ4 A;  2X8H A;  5BUL A;  3L8K A;  1DOD A;  3H8L A;  4NTD A;  1D4C A;  4Y4N A;  4BJZ A;  2OLO A;  4BK3 A;  4M52 A;  2FBW A;  5LV9 A;  2GF3 A;  4U8I A;  4AOX A;  1S3B A;  4IA6 A;  4U8L A;  1PN0 A;  4Z43 A;  5BVA A;  1PBC A;  1VDC A;  2B9W A;  4PAA A;  2GR1 A;  3E1T A;  1FOH A;  1FEC A;  1QLB A;  4TM1 A;  4H2R A;  1CF3 A;  3DJE A;  2WBA A;  1XPQ A;  1ZP0 A;  4II3 A;  1PJ7 A;  4TLX A;  4Z2R A;  5C3J A;  3ATR A;  4YWO A;  2R0P A;  4A6N A;  2WP5 A;  1HYU A;  2JKC A;  3FBS A;  3P4R A;  3GSI A;  3SZ0 A;  2YLT A;  4EQW A;  2GQF A;  4DNA A;  4Z26 A;  3AE8 A;  4A9W A;  2OAL A;  3ISH A;  5M10 A;  3C96 A;  1PBD A;  1GRA A;  1ONF A;  5KVH A;  1K0I A;  4H4Q A;  2B76 A;  3SZW A;  1E6E A;  2RGH A;  3SY4 A;  1QO8 A;  3SQP A;  2RAB A;  2BS3 A;  2R0G A;  5KWF A;  4BK2 A;  1GER A;  1IUW A;  4NEV A;  3P9U A;  2JB2 A;  3DK4 A;  4JDR A;  1NG3 A;  3SFD A;  4EQR A;  5KVI A;  3Q6J A;  3NK1 X;  4ADW A;  1NEK A;  1GXF A;  1TDE A;  1ZDL A;  3CMM A;  4A5L A;  2GB0 A;  3NK2 X;  2WPC A;  3OZ2 A;  4KX6 A;  3UTG A;  4AP1 A;  5J60 A;  5KRQ A;  4X9M A;  1H83 A;  1RYI A;  3LB8 A;  3II4 A;  4U8P A;  4X9N A;  3UTE A;  4EM4 A;  2CDU A;  4B67 A;  1DOC A;  2BCG G;  4UP3 A;  3KU9 A;  1GSN A;  1MOK A;  4EMW A;  2Y6Q A;  1UKV G;  2YG5 A;  3F8P A;  2R4E A;  3CIR A;  1F6M A;  1O94 A;  1JEH A;  1KSS A;  4J33 A;  4AT0 A;  5C2T A;  1JNR A;  1GES A;  2WHD A;  4G6H A;  4K5S A;  1D4D A;  4YSY A;  2E5V A;  1NPX A;  2JK6 A;  3QFB A;  3B6D A;  2BK3 A;  3CNP A;  2VVL G;  4H4X A;  3NIX A;  1YQ4 A;  4U8J A;  2XFQ A;  2BK4 A;  2GRT A;  4GDP A;  1Q9I A;  1ZY8 A;  3ATQ A;  2GMJ A;  4K2X A;  3KLJ A;  1Q1W A;  3T37 A;  3FMW A;  2GEW A;  1K4Q A;  3G5Q A;  1ZMC A;  3DK9 A;  3GYX A;  5FS9 A;  2C67 A;  1RP0 A;  1PXB A;  2VRL A;  3AE6 A;  3AYJ A;  1TDF A;  4KPR A;  1S2Y A;  5U25 A;  2C76 A;  2YLZ A;  1PHH A;  1JRY A;  3CTY A;  2WDV A;  3NKS A;  5HYM A;  3ZYX A;  4GAP A;  2YAU A;  3AED A;  3BI5 A;  4BV6 A;  2OAM A;  4EIQ A;  2YLW A;  3EPT A;  3UTF A;  3HYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...