1F9CA

Crystal structure of mle d178n variant
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
360
Chain Sequence
SALIERIDAIIVDLPTIQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDALAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQNLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEARLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE I)
publication title Buried charged surface in proteins.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 133
structure length 360
sequence length 370
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1f9cA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1f9cA01
4JN8A 3H70A 3OP2A 2GDQA 2PTYA 4Z1YA 3NO1A 3CK5A 3VCCA 4JN7A 3RITA 3NXLA 3MWCA 3THUA 3TJ4A 2FKPA 2OX4A 4GYPA 2PTXA 1DTNA 3VDGA 3JW7A 4FI4A 3RGTA 4MGGA 3CXOA 3D46A 3H12A 3JZUA 4E4UA 3ES7A 3SBFA 4HYRA 1MUCA 4H19A 2PP1A 3DIPA 3EEZA 3PFRA 2OFJA 3IJIA 3TOYA 3PK7A 4E6MA 3VC5A 3SJNA 3OZYA 3HPFA 4IL2A 2OKTA 4DXKA 3OZMA 1R6WA 2P88A 4JHMA 3T9PA 1FHUA 1WUEA 3R0KA 3D47A 3V5FA 4X2PA 3UCCA 3DG6A 4HCLA 3FJ4A 4DN1A 1KD0A 3MY9A 3R1ZA 2QJJA 2XH4A 2HXUA 3T8QA 1EBGA 3FXGA 3T4WA 3OW1A 3V5CA 3P0WA 3ZVHB 1TE6A 3SN0A 3UCDA 1P43A 1MNSA 3GD6A 1PDZA 4HCHA 1L8PA 2HZGA 3N4FA 4IZGA 3P93A 1OEPA 1XPYA 2PA6A 2PSNA 2OQYA 3TW9A 2AL2A 2ZC8A 2XSXA 2P8BA 3TJIA 1JPDX 3UJRA 3VFCA 3DFYA 2QDEA 4J1OA 3DG3A 3VCNA 2OG9A 3UGVA 3P3BA 3QPEA 1ECQA 1KKRA 3BSMA 5J04A 1P48A 3QTPA 2QQ6A 4IP4A 2ZADA 2PU1A 3ZLFA 3RCYA 2QJMA 2OO6A 4HN8A 3UJSA 4F4RA 3NFUA 3JVAA 3KUMA 3IJLA 3ZLHA 3MQTA 3FYYA 3QKEA 3SN4A 3TWAA 2XH2A 2OQHA 3CB3A 4DYEA 1R0MA 4KEMA 1MDRA 4ENLA 3R10A 4HNCA 3VC6A 4DX3A 2AL2B 4GGBA 4J3ZA 3DDMA 4H83A 5BOEA 1EC7A 2GGIA 3VA8A 3UJ2A 1BQGA 5FJUA 2PCEA 1EC8A 3S47A 3T6CA 4E5TA 2GL5A 3CAWA 3DG7A 3K1GA 1EBHA 4GYPC 1KCZA 3GY1A 4ZA0A 4E8GA 4MMWA 2DW7A 1SJCA 3ES8A 3DEQA 2POZA 3V4BA 3FV9A 4HCDA 3RRAA 1W6TA 2P0IA 4A3RA 4M6UA 4IL0A 3V3WA 4GGHA 1EC9A 2PU0A 2QJNA 1MDLA 3R0UA 3SN1A 2P8CA 4M0XA 1FHVA 1XS2A 2XH7A 3RO6A 2PGEA 4IT1A 3I4KA 1NU5A 3EKGA 3MZNA 3N6HA 4KWSA 1RVKA 4FP1A 1ONEA 2GGGA 2P3ZA 3FCPA 2OZ3A 5FJRA 6ENLA 1PDYA 2OZ8A 3DESA 3IJQA 1NELA 2GGEA 2GGJA 4IHCA 3OPSA 1JDFA 2MUCA 3QN3A 3DGBA 3BOXA 5BOFA 4EWJA 3ENLA 3BJSA 2QVHA 3N6JA 3ZVIA 2I5QA 4A35A 3UXKA 2PS2A 2ONEA 4G7FA 3UJFA 3STPA 3FVDA 4K8GA 3PWGA 2AKMA 4HPNA 1E9IA 4KT2A 4A6GA 4H2HA 2PP3A 3N4EA 4DHGA 3UJEA 1MRAA 3RR1A 2PPGA 3IK4A 5EU9A 4KPLA 1WUFA 2PODA 3SQSA 4Z17A 2RDXA 3Q4DA 3U4FA 1ELSA 3UXLA 2OVLA 1YEYA 3ZVHA 3R11A 4GMEA 2AKZA 4H1ZA 3NZGA 3MKCA 1JCTA 2QDDA 4K1WA 4DWDA 3U9IA 3CYJA 2GGHA 3TWBA 3I6EA 2QGYA 2MNRA 2GSHA 3ZLGA 3OTRA 3I6TA 2PTZA 3R25A 2XGZA 5IDZA 2PP0A 4ROPA 4ZCWA 3MUCA 3QLDA 2PTWA 1F9CA 3TCSA 2PGWA 3GC2A 2FYMA 3H7VA 3DERA 3DFHA 1TZZA 3TQPA 3B97A 3TTEA 3CT2A 4YWSA 4HNLA 3Q45A 2NQLA 5ENLA 1SJDA 5FJOA 3S5SA 4GIRA 1IYXA 1KKOA 3GO2A 4IP5A 4GFIA 3H8AA 1TKKA 3MSYA 1JPMA 3PWIA 5FJPA 2CHRA 2XH0A 2DW6A 2OZTA 2OLAA 4E4FA 2AL1A 3SSZA 2O56A 1BKHA 4GISA 1SJAA 7ENLA 4K2SA 2PMQA 5FJTA 4MKSA 2HXTA 2OPJA 4G8TA 2HNEA 1SJBA
chains in the Genus database with same CATH superfamily
1UP3A 2GVEA 4WEVX 4AIEA 1QNPA 3NO1A 3WJWA 5I6SA 3O0HA 2FPTA 1TWWA 3QW3A 4M24A 1I75A 4WY0B 5DQPA 5E0KA 2YXXA 4NAFB 3VKAA 3H12A 2OODA 1V51A 1SB3B 2IPJA 3SURA 4CCCA 3DFQA 3SBFA 3BPWA 3B8WA 1Q8JA 1WDQA 1XUUA 3BJFA 4KWOA 3CV1A 3TE9A 5I00A 4O0KA 2OFJA 1IEVA 1O68A 4D1JA 3VZZA 2QCLA 3PK7A 2Q6ZA 4WOZA 5F7UA 1DQUA 3LS9A 3OZYA 4GJIA 2WNQA 2HRWA 2NV9A 1NM9A 1MW0A 1UD6A 2V5JA 2YAUA 2W67A 2XFFA 1LL7A 2QPSA 1NOUA 5ER0A 2O9TA 1TPH1 2X8HA 3OBAA 1GKQA 1TPUA 4EVZA 1SW3A 3WH5A 3FGCB 4HVXA 3BMXA 2G37A 5A6JA 2JEPA 3B9AA 2E8ZA 3ATYA 1I1WA 3RN6A 4JNZA 4TVDA 3WDIA 1BXCA 3A9IA 2QUTA 3FAXA 5DMYA 3UQNA 2W54A 3G0SA 4IF2A 4Q8NA 5DBTA 3VIIA 1BF2A 1Q2RA 4RZBA 3G8EA 3DC8A 1TYPA 1TREA 1KBBA 3KL3A 1AL7A 4CD7A 4GYFA 4DNAA 2Q3RA 1UKOA 1FY6A 4JTAA 4JQ3A 4LVBA 3IGSA 3A7UA 1MRQA 1W9UA 2PA6A 2XN1A 2O9PA 4BQ5A 3QV7A 3PZTA 1QI4A 1B1YA 7TAAA 3Q67A 3JR2A 2AL2A 5LNVA 1B90A 4B5WA 1UCWA 4PBFA 2V3FA 4FNQA 6TAAA 4XG1A 3QV6A 1TWSA 2J88A 1QPQA 2W63A 1F7BA 1SMDA 1UA3A 1ZL1A 4KQNA 1VFOA 4S3KA 1QJWA 3CV6A 3W2MA 3LBCA 3SUVA 3ITOA 4GKLA 5HMFA 2WNNA 1ZP3A 4GC4A 1QK0A 1ADSA 2VC7A 3HF3A 3RCYA 1P1MA 1XYBA 3CL7A 1VKFA 1SM9A 3O0FA 4D6GA 4ZTXA 3NSXA 1ICSA 2ABAA 3C2VA 3JVAA 1GZGA 4NJKA 1ITXA 1SO3A 1V8EA 1W9VA 1XDLA 2XH2A 4UNIA 3TTOA 3S4TA 4LQ1A 2EJ1A 2V38A 4DYEA 1ISWA 4KEMA 3NZPA 2WPEA 1S5WA 3E3HA 3R10A 1TPEA 2WYSA 4N0RA 4AD3A 4N9CA 3VC6A 5CZTA 1JFXA 4NZJA 4A22A 4C6LA 1N5XA 1CYGA 1VIWA 1KM4A 4E5TA 4G6CA 4C6MA 4MNMA 1VQZA 4O18A 4CKQA 3RLUA 2E5DA 2X40A 3QMSA 3SR6B 3MT1A 4DZIA 1GONA 1HKKA 3MS8A 2GFTA 3PZMA 1FH8A 5FEPA 2B7PA 4AZBA 4GY7A 4BY3A 4LGXA 3CTTA 4IFRA 2Q8LA 1FFVC 1GHSA 3NPWA 3PB2A 2DVTA 1QNQA 1J10A 4A8NA 5JCIA 2GQ3A 4JTFA 2FDSA 4XZWA 1W31A 1JNDA 2VR5A 4WUIA 2EG8A 2VWSA 4GUJA 3IIOA 1OYAA 2NQ9A 1VFFA 1XS2A 1O5RA 4QJ3B 1F76A 1GVEA 3EKGA 5BYWA 1RALA 3TJLA 1JUEA 4LUIA 2XIQA 4MB3A 4KWSA 2BWGA 5HPOA 3GQYA 3NQ7A 2Y5JA 1Y0EA 3VOHA 1GUVA 4DZAA 5E6YA 4A4AA 1DIEA 4LEQA 2VMFA 3CM4A 1BPLB 3VGEA 2B7QA 1T41A 3URBA 2R1LA 3IUHA 2WHJA 5BOFA 2O55A 3RMEA 2CLKA 3CH9A 3GYEA 1J11A 4FSAA 5DBUA 2QUVA 3VGBA 4RE3A 3CZEA 3INPA 4FIQA 4W88A 4NJJA 1S2VA 2VR2A 2FJKA 2CCRA 2QYGA 3VDHA 1ME7A 1DVJA 2TYSA 1UC4A 2W79A 2RDWA 3UJEA 5EU9A 4JN6A 4RX0A 3M6YA 1FWGC 1G7VA 2EGZA 3EOSA 1RVGA 3K1DA 4PBGA 3PJXA 3EEGA 2DJLA 4QCEA 3ZT5A 3DJGX 5G5HB 4JIHA 1JCTA 2QDDA 3E02A 1AZ1A 3REQA 1E3XA 3GTXA 4JIEA 2VFDA 4JTKA 1EX5A 3DOPA 4KGLA 5G2WA 1AMYA 4OOZA 3CH0A 2IQDA 1WXYA 5JBEA 4CD8A 3C6CA 3EDFA 4LAZA 1F9CA 3KLKA 3W82A 1EP1A 4KWVA 1LQAA 4D6HA 1KXHA 1US2A 1ONXA 4LF2A 3C0SA 3A4XA 3LCHA 3PAOA 1NHRA 4DF0A 2HBXA 3BW3A 3WD1A 2OYLA 1K77A 2V81A 1KGUA 2IPGA 1GRAA 3UWZA 4IFKB 1IV8A 2G5WA 1XSJA 1TYGA 3AYRA 4IMDA 5FAJA 5GVJA 3L7RA 3ZM8A 4NNAA 1E6ZA 3NGFA 4MWAE 4QLKA 3GW0A 3N2TA 5LNUA 2GOKA 4ORMA 4ECLA 3TTYA 2OZTA 2OLAA 3NR0A 3EMCA 2AL1A 2W66A 2G4JA 2ZFAA 4UFJA 1J6OA 2XZ9A 1AUSL 4WF7A 2FLIA 4CCDA 4X9SA 3W1RA 2GDQA 1L6SA 3QBUA 3THUA 4CD4A 2YFOA 3LRKA 3T55A 4DWSD 2ISDA 3L4XA 3WBAA 4OJYA 3JW7A 3VDGA 1UWSA 3LCXA 4K1GA 4E4UA 5HQEA 2XGIA 5JBDA 3P8JA 5EBKA 1E6NA 5DCDA 5JQ9A 1UKSA 2VHLA 4US5A 3DYOA 5H8PA 5AZ1A 1EDGA 3CAKA 3FNDA 3AFBA 2VZTA 3DAQA 3EEZA 1E9ZB 5JIPA 1RBAA 1HQTA 3A4WA 1XLHA 4Y2WA 1IWPA 3M0LA 3LLXA 4JTCA 4XVEA 1JYXA 4ZMGA 3SAZA 4JGDA 1QR7A 4ZTYA 3S1GA 1XH2A 4RJEA 1FUYA 1EXPA 1NQ6A 3ITYA 4LB4A 3BZGA 3W53A 5B7ZA 2ZZ4A 4LVDA 5I3KA 1GRTA 2Y7FA 1YNPA 2GVYA 3WUFA 1GJWA 2FMNA 4NAEB 2ZZ6A 3GTHA 4QISA 4HNVA 3F5JA 1JYVA 4D9PA 2BHUA 2OEMA 1GQJA 4B90A 4YTRA 3R8GA 4FLOA 3W88A 4IIHA 3C3UA 1O66A 3NYDA 4GXWA 3GXPA 3W2UA 5BRPA 4DZHA 1W9PA 5BMWA 4WOQA 3GS6A 1IEIA 1DWFM 2VGBA 1VIZA 5CZKA 3LPPA 3UY8A 3HTWA 3OLGA 4KBXA 3GFZA 3ITTA 2W62A 3TR9A 8TIMA 4BI6A 1QNSA 3URAA 4C6KA 1S2AA 1S1PA 5F4WA 3W02A 1TTJA 1WYIA 2WKLA 3LBMA 3T09A 1JAKA 3DN5A 4QITA 5D38A 1TMLA 3VOIA 4H01A 4NJGA 1L6GA 1I6NA 2H3DA 2ESCA 5D2XA 3SUSA 3QPEA 3W1QA 4BI7A 4G56A 1R3SA 2PAJA 1XX1A 3IRSA 5BRQA 2VEFA 2A3CA 1U1UA 1E1CA 4H9MA 1OC7A 2P3EA 1YMYA 3ITVA 3ONBA 2OKOA 4W85A 5EBAA 4KH2A 3MHUA 1Q63A 2QDHA 5HWJA 4ZE5A 1ZJAA 1ZBWA 1BAGA 3HG5A 2EF9A 5E93A 1ZJIA 3DFPA 2REQB 3HPXA 1VFSA 4PMDA 3SCSA 3W74A 1WDPA 4UTKA 1DWHM 1IXQA 4S3EA 3O07A 3A3HA 3W7DA 2PCEA 2R8WA 1EC8A 3KVMA 4GYKA 4O13A 1TJPA 1R9XA 3VKJA 2NLIA 2A7NA 1BVZA 3SB0A 2QT3A 3R4IA 1QI5A 3TYAA 4F66A 1AMKA 4LUYA 1E43A 2FTPA 1XLJA 3I7SA 5I7GA 1H5YA 1AK5A 2VC6A 3RRAA 1K8YA 1W6TA 1CEOA 4V33A 5HWMA 2X2GA 5HXMA 2X99A 5FF3A 3ALGA 4B4HA 1EF2A 2QPUA 4OE7A 2QIWA 5HINA 3GW3A 1GKRA 1W8GA 2WVVB 1ADDA 2R9RA 1IEWA 1CI1A 2D0FA 2CC0A 3SN1A 4MIMA 3SQMA 1EZ2A 2XH7A 3IJ9A 4QTGA 3DFSA 3W7KA 3TAOA 3CEUA 1X7IA 1TJ1A 4YLWA 4CNTA 5I0DA 3T40A 1WBJA 2I14A 1PHQA 1TA3B 4MSSA 2I9UA 3DGBA 1PS9A 4G1KA 1E51A 2PLMA 4NX0A 1RLDA 1QTWA 2PS2A 1V4YA 2Z0IA 1SW7A 4FR1A 2V5BA 2Y7DA 3O05A 3WH9A 3N6QA 3VIHA 1Q6DA 2WNZA 1DJHA 3VGFA 4J57A 4O4WA 2WSPA 5ECVA 3UA3A 3WNPA 5CAKA 2V30A 3KBVA 4O4VA 3TNOA 3BICA 1J2BA 4UQDA 3F2BA 4D6EA 4A3HA 4TR9A 3USZA 1KNWA 4GOAA 1J96A 2B31A 1ELSA 2WOQA 3NVYB 2QIIA 2W0HA 2P50A 2ZRVA 4XTDA 5F1VA 3O9NA 3TUUA 3NM1A 3H23A 3CV7A 4HHHA 4LB3A 4ML9A 2JKEA 1PTAA 4JTDA 3G8RA 2EKGA 2WHLA 1GPFA 3WQOA 5I78A 1BWCA 2QGYA 3FSTA 3UPWA 1Q6QA 2MNRA 4L6HA 4WSHA 4OGZA 3YPIA 2BDQA 1K8ZA 3THAA 4W7VA 4DF2A 3M5VA 3HFTA 5FSEC 3VXGA 1R2TA 2GPTA 1E0VA 3TCSA 3TC3A 1V77A 5CC5A 1GZJA 2FYMA 2CNCA 1K8XA 4O54A 1B3WA 4KRZA 4C6BA 1A50A 2QS8A 1FWCC 1HJVA 3VNDA 4O1FA 5I23A 4XTIA 3NQ8A 3USBA 4LBUA 1MO9A 3H2NA 1ZY9A 1O60A 4R33A 3T81A 2AGKA 1A5UA 1GEHA 3PZGA 3N11A 5LNRA 1A5SA 1SJDA 4XAYA 3KS5A 5I3FA 4YCOA 1O7AA 1SVDA 3L66A 2CEQA 2VWTA 4S3FA 3UWEA 1FECA 4R88A 2CHRA 4Q32A 1JI2A 1XINA 1U2YA 2W61A 2PRHA 1AZ2A 5G4HC 3QEZA 3KOYA 4TUFA 1SJAA 1P6CA 1GQLA 1UKQA 4K2SA 4G8TA 1WDWA 3G1DA 3NZRA 1WCGA 1H49A 1AH0A 3EWBX 3WF2A 2E5CA 3UG5A 1AD4A 3JU2A 3RMJA 3N18A 3GDKA 3MV11 5D02A 4GJJA 3MO7A 1ISYA 5HULA 1X1NA 3ZJ8A 2ZRZA 3MDWA 1I2QA 1LP6A 1MEWA 3V5OA 3P14A 5EPDA 2OLHA 4J3VA 3LNPA 3XISA 3B9EA 3CPRA 4FDCB 3LN3A 3W72A 2PP1A 1F3EA 2D0GA 3IIPA 3R12A 1E73M 3IUDA 4UQEA 1KFKA 2ISVA 3VNZA 4IQEA 3P60A 2Q09A 1XGDA 4FZIA 4QNWA 1W2PA 3OZOA 4Z2IA 2QUUA 3L4WA 3STCA 5CG0A 2BZNA 1LLWA 2OR2A 1Q85A 3N4AA 1IR1A 1C9DA 1FHUA 1VLIA 4FO4A 4LJ3A 3WLMA 2NUWA 2OCZA 4M5PA 1MEHA 1UZHA 3FJ4A 1K9DA 1DXIA 3MC5A 1KD0A 3PY2A 4LYRA 1E56A 2CDUA 3NS1B 5BWFA 1KN0A 3AMZA 3PNZA 3W1XA 1KXQA 1QDSA 2QCDB 2WJZA 4PN2A 4KEUA 1Z6KA 5LZLA 4CGTA 4UUIA 5JH2A 4LH8A 1EPXA 3QHNA 3S83A 4ZR8A 4BQ4A 2A2IA 1H1NA 2GLKA 3B03A 3N4FA 4NIRA 3OC4A 3CMJA 2YCLB 5D03A 2YVJA 1ME8A 4JTRA 3ITCA 3NO3A 1QAPA 4S1FA 1CGWA 2ZC8A 5EFFA 1EJSC 4HNTA 3BQ6A 1W91A 4R5EA 2E28A 4PMRA 3VD5A 1YPFA 1XLLA 3UGVA 4QNEA 5HATA 2ZXQA 1EOMA 2YL5A 1GQNA 1QI3A 3DX5A 3WQVA 5AC4A 3DBNA 4I9MA 3R7MA 1M65A 4GINA 3IIZA 4YPJA 3VNMA 1V6VA 5HUPA 2ZXBA 1ZJHA 5HJYA 1ZXIC 1ESWA 5KZ6A 2A85A 3EGJA 4ZEPA 1JCJA 1KA9F 2V8ZA 4J4KA 2F5ZA 2IPFA 1XBYA 3WQCA 3TOPA 1WKEA 3UZXA 4HU3A 3H2AA 4QJ4B 1HX0A 2VX6A 4JTGA 1KGWA 4HOWA 2JQXA 4ZFCA 1FWHC 1I2NA 1XLGA 3GZ3A 2BY1A 3BW2A 3TROA 4PMNA 1YRRA 1QBBA 2ZDSA 4IPJA 3TK7A 3DK8A 3RX2A 4DJEA 3PP7A 1MQQA 3RJXA 3UNDA 1VPYA 3NYZA 4YWIA 4BQ3A 3PC0A 4L9YA 4GYPC 3U6WA 3LHZA 1H1YA 4E8GA 3BC9A 1WV2A 5JCKA 1EP2A 1RUSA 1EL3A 2PRMA 2J75A 2CKSA 1JF5A 5ABFA 2WMKA 2CBJA 1GJUA 1QHOA 3M4HA 2X8CA 4XZ9A 1VCVA 4YS1A 1QI2A 4CNNA 2QCNA 3EWYA 1P5BA 4W8BA 5LXEA 1FXQA 3ARZA 4D2JA 3HIJA 1RM6B 1FCQA 3NVTA 1W5PA 1RQEA 2Z24A 5AVNA 5HNNA 4DO6A 1L2UA 2GUYA 3QLLA 3VPLA 4FP1A 4LV9A 1E55A 4P7QA 3DFNA 4C6OA 4QLLA 1W32A 3PTDA 2VRQA 3HN3A 3MYPA 5AYYA 1AW1A 2DZBA 2QZRA 1TIWA 4UTWC 3V0SA 3KRSA 2WB5A 2QJIA 7REQA 4ADTA 1QOQA 3NURA 2ONEA 3STPA 3G18A 3G0XA 3EX2A 3IGUA 4AVOA 3VK5A 2QW5A 1IT8A 3FVDA 1SZRA 4MY8A 4GNKB 5BZAA 1GG0A 1HKIA 3NTYA 4AEEA 3PSVA 3KHJA 4TIMA 1KXTA 4N7QA 2PPGA 2ZQ0A 5DXYA 3KFTA 1XYFA 2Y89A 5HMSA 3Q4DA 2GZXA 3U4FA 2ZTKA 1YXDA 3AS0A 2PFHA 4PFMA 3AIQA 3BO9A 1I8JA 4MB5A 3UA4A 3IGXA 2NWSA 4H1ZA 1IZKA 3WUGA 3WLRA 2ZWYA 3LEPA 4WY0F 3AUJA 3OVQA 1V7AA 2PBOA 5C9ZA 4LANA 3PBGA 4JFTA 5HNTA 4H4XA 2FHCA 2TODA 3GHTA 3OVGA 2GSHA 1JCYA 1F3TA 2J4GA 3GBEA 1EO7A 2OWWA 5KSWA 4GVIA 3BWWA 2W3RA 5ECUA 4AWEA 3LXAA 3S42A 3H54A 1B2YA 4ZO8A 2NQJA 4LY4A 1RZMA 5I79A 5KETA 3A47A 4LUSB 2X0HA 1GOWA 1XL9A 3KZSA 2INEA 3IGHX 1W2VA 1G67A 1IR2A 5D2WA 2FPVA 3S5NA 4XZMX 3EPMA 3DUGA 1YNQA 4GC3A 3RHGA 3FA4A 2IW0A 3THDA 3K4AA 2GDVA 4NYYA 5F2MA 3ZWTA 2YDQA 2EPLX 4O0ZA 4XZLX 2CU0A 1ECEA 1E9YB 3FFSA 3PBMA 1QW7A 1RLCL 3M47A 3ZR5A 3W9ZA 2QCFA 3NQ2A 3S46A 2VYOA 3M0IA 1TVNA 1D9EA 2DPEA 2HV5A 3CMGA 3WX7A 4J27A 2CFFA 3UXAA 1MI3A 3KBWA 3MVIA 1PB0A 1QPOA 1E4NA 4D1IA 3TN3A 4HU0A 2FH8A 2PDBA 2PDUA 5CSYA 1W1ZA 1BKSA 3PULA 4GE8A 4K7YA 3OA5A 4GYPA 3UR5A 5FS8A 1GREA 3P2VA 1HFBA 3EB3A 3IJDA 3D46A 4NZCA 1B31A 1Q4NX 3HQPA 3WZ0E 1JRCA 2UY5A 4KFOA 1XI3A 4B2DA 4EPDC 3M0ZA 3N2MA 3FN9A 3UZYA 3SJNA 3VIJA 3H4KA 2VVNA 4PUKA 4EKJA 1OFRA 1VRXA 4GUFA 4LC6A 3WUBA 1BSLA 4S23A 2Q71A 3V18A 4DXKA 2J9ZA 4WVXA 2V5CA 3FK4A 3UVIA 3TSBA 4JHMA 3T9PA 4JFWA 5I06A 3AIEA 4LVGA 1PX8A 1DL3A 1GYMA 3AXIA 2OOGA 3SJ3A 2XSAA 3IPWA 5C8BB 3DGZA 4MNLA 3RCMA 4CUCA 4DN1A 2OSYA 2BS9A 5MKGA 4CNUA 3A24A 4IIBA 1TJRA 2ADAA 4EAYA 1EBGA 1EEPA 2E25A 2R82A 1R2SA 4UTWA 3WSUA 4GO9A 3H55A 5LIKX 4J3XA 4GRTA 3HGJA 1QOPA 5LIYX 1FWTA 1J12A 3WLLA 2HS8A 2HZGA 1ZHAA 1U83A 4IZGA 3RXZA 1VHCA 2ZBTA 3E49A 3BAKA 3UBPC 4AISA 4OTKA 9RUBA 1LM1A 4PB3A 4B5UA 4GQGA 4XUGA 5DO8A 4DO7A 3AHZA 3EWCA 3IVUA 1BYBA 4QROA 2Z7GA 3PHAA 3IAPA 5AHEA 2ANUA 4PUEA 3KL5A 5GNXA 4ACYA 2OSWA 1LZOA 4XO6A 2P5NA 4B5VA 4LPCA 1KKRA 2Z1XA 4AHPA 5I3GA 4CN1A 3NQEA 2B81A 2ZADA 3KX6A 3LDVA 1DXFA 2W3ZA 1WNOA 4J2PA 4EANA 1V02E 7CGTA 2ZVRA 1TVLA 3AROA 4XBJA 4XUYA 1EO5A 1TJ0A 4Q3MA 3S1WA 2VX4A 1GEQA 1XLBA 2WJEA 3RILA 3T1GA 4NU7A 4JNMA 1T0OA 4H3DA 4QSHA 3B06A 2CETA 4MDPA 3HBLA 1YHTA 3DDMA 5BOEA 3CS2A 1V6TA 1P1XA 3RNMA 2V67A 2E1DA 3NO5A 1FH9A 1J18A 1E40A 1YDYA 5JUVA 2G0WA 4ZQPA 1ALDA 4FMVA 4G7EA 3CGCA 3K4DA 1GQIA 4Q4MA 1UYQA 4EMJA 2CXGA 4IJBA 5E09A 2FVKA 3L21A 2DV0A 2YGYA 1G7UA 1UROA 4UBPC 3CLMA 1UWTA 4RNFA 4IGNA 4J7RA 4S3JA 4ZO7A 3BV7A 4GXPA 2YCEA 2G95A 5HQMA 3SQPA 2GRTA 4ZB2A 4LOCA 1S2WA 1H7RA 3DGHA 1V3HA 1FBAA 2FH6A 3W27A 5KZEA 1UOKA 2J66A 2YX0A 3KDNA 1OYBA 4HSHA 1CTNA 3R0UA 5L9FA 4M0XA 4GBUA 2BC1A 5LHFA 3SFKA 1X6LA 2O0TA 1UJQA 3I4KA 1PSCA 3VO0A 2FZNA 1W9BM 3VIKA 1NARA 5DRCA 2HCVA 2Y61A 3K4WA 3DESA 2J62A 4M56A 1BFNA 4AF0A 4RV8A 3QN3A 2WBKA 3BV4A 1GOMA 2V69A 4YCPA 1ZY8A 1FXPA 5JVLA 4GY0A 3VI2A 3U7VA 3EOEA 4RW3A 1DIOA 1EDQA 3SRDA 3RPDA 5CZSA 3GVGA 1OC5A 3O63A 1UR4A 2TMDA 4AWUA 1TWIA 1IZJA 3S9ZA 1M68A 5EKYA 1Q65A 1HF6A 2JKPA 3P5YA 2VFGA 2HISA 3GC4A 1RK5A 3WJYA 1THFD 2D0HA 3R11A 3AYTA 1OFDA 3R13A 2WC4A 4NI3A 1J01A 3PR2A 4XAFA 1E4IA 1I2PA 3W25A 4AUBA 1EKOA 1PX3A 1I9CB 2BVDA 4J3UA 2DZTA 3C56A 2VDHA 1ZS2A 3CYJA 1QK2A 3D9XA 2X1UA 2YA1A 2F9RA 1E6QM 5F4SA 1X7FA 4H9UA 2WZEA 3WLSA 4M1BA 1XC6A 4MAVA 2R1PA 1I45A 3NA8A 2GJRA 2VOTA 3BGAA 3GC2A 4B5TA 4Z1AA 3WFLA 1RCOB 4JICA 3THCA 4B3ZA 4DF1A 1HP5A 4WY0A 3SRFA 3STFA 4NAFA 3BAWA 4BF7A 2HNHA 3KAOA 3CT2A 3NM3A 3I7RA 2C0AA 4OUIA 3AIBA 2ZZBA 4JQ9A 1E1EA 2DY3A 2VEPA 3HPAA 1GOXA 4BJHA 4Q8VA 3KEHA 2WBAA 1OCJA 1O1HA 3TYEA 4C1NA 2A3LA 2FDMA 2YZRA 3HG4A 4W9TA 4J5NA 4C6PA 2EHHA 3ONCA 3QC0A 4NILA 2Z6JA 3G6MA 3C8FA 1UZDA 3GDLA 4MKSA 1BZLA 3RF9A 3COTA 5BXSA 3GDRA 3SUTA 5G5IA 5GNYA 3HGRA 4IPNB 3LRLA 4GZEA 1OX5A 3QY8A 4KETA 3UXIA 3LPOA 2A7RA 1D3HA 1W3JA 2OO0A 3C8NA 1CCWB 2GUBA 3AS2A 5TNVA 3CB8A 1VYPX 2X1RA 3UZ5A 4ZL1A 1Q6RA 3SSJA 3PF3A 2NXIA 3F4NA 1TYTA 3CUZA 3MP4A 5EA9A 1W1VA 3CBWA 1TCMA 4GR1A 6XIAA 3RIKA 1ODUA 4RXFA 3PTQA 1A47A 1A5CA 3AXHA 1O12A 4AD4A 2OKTA 3LXDA 4DJDD 5CEWA 2DVUA 1QVBA 1QW8A 1WKFA 3OZMA 4BEUA 4JEQA 2C7FA 2WOIA 2E3TA 1HVQA 2GQAA 1DHKA 1J93A 3CUGA 2YA2A 5G4WA 3DG6A 1ZRQA 2Y7EA 2YFNA 2WMHA 2ZWZA 5GPRA 4OECA 1H51A 4ZQMA 2XH4A 1BYDA 4FLSA 1VBRA 2PWFA 1W5NA 1HGYA 3B8IA 1VEPA 2WMFA 3RRXA 1XWYA 4UTUA 3DI1A 3WDHA 3H7RA 1DWJM 3LLDA 3OLDA 5DANA 1WKYA 1QPRA 4V15A 1HGWA 2VC5A 2VEIA 3XIMA 1RR2A 1C92A 4XIMA 3HU7A 4OZOA 3T0CA 1OEPA 3EX6A 3QPYA 3WIJA 4O53A 4WR3A 1C9WA 1N8WA 2C18A 3AXKA 3EWDA 3TW9A 5SWUA 4JX6A 1G01A 4PC8A 2DEPA 3WNOA 4PCSA 2QDEA 3VD9A 1SSGA 3POHA 2QHAA 4PFHA 2C15A 1AFSA 3HA1A 2V0TA 2VURA 3G0UA 2ZE3A 4JZ5A 3W7EA 3T7VA 3BSHA 1YX1A 5C9XA 2UBPC 4A3UA 1JPHA 4JHOA 4ATWA 3GNNA 1AOGA 3S6OA 4HSNA 1ZKQA 3M43A 4Q8QA 3M64A 3AS3A 4MY1A 3W29A 3RU6A 2VX5A 4QR6A 4Q33A 2OO6A 5IOBA 4AQLA 3F1QA 3T0TA 4HZ8A 1KTCA 1Z41A 2ZA1A 3V0UA 3S3GA 3IVSA 4IXXA 2BFGA 2AGTA 4N4QA 4EXBA 3UWUA 3GIQA 5CQ1A 3NSMA 4ATDA 1JXJA 2G4FA 2CXEA 1EC7A 1KFCA 4C90A 3EXRA 3VUPA 1AD1A 4XAPA 4LX4A 1XFCA 4IMAA 3VD4A 1SW0A 1TSIA 3WUEA 3AWNA 2J47A 3K8KA 4NZ5A 1HW6A 4HPXA 1P0NA 1EBHA 1TE1A 3C0JA 3IAQA 3WQDA 3GY1A 1B30A 2DZSA 4RZ4A 5C54A 3VABA 3VNLA 4HNOA 4DB7A 2PZNA 3ZJ7A 4I9JA 1JDEA 1NPXA 1JGIA 2W55A 3HW2A 1UJPA 1D7KA 5BOOA 1EJXC 3KOFA 2PE4A 5KITA 1TZ9A 1JROA 4HMDA 2V6AA 4IL0A 1UKTA 3PTKA 2OSXA 2PUZA 3B4YA 3VU2A 1AODA 1TWZA 3AJXA 3H6OA 4PMZA 3SIMA 4AZCB 1LCOA 1FDYA 3G24A 7TIMA 3WD2A 2XPKA 1XLCA 3WQ4A 3GBDA 1Z7AA 2G41A 3IJQA 2E9LA 4LTSA 2PC8A 3FDGA 4GXMA 3TZFA 1J0HA 2VCAA 1UWRA 2CLLA 4LYQA 3UXKA 4G7FA 2JE8A 4CU6A 3CUIA 2IS7A 4TVUA 2C1HA 4PRWA 3O6CA 3DKJA 3UPBA 2HPMA 4GUIA 4OU1A 4JQ1A 1GETA 1VJZA 3NQBA 4HHLA 2OQLA 4MZYA 2CZ5A 4DBDA 3W1UA 4GACA 3ZIZA 2GJPA 1OJXA 2UY2A 1AQ0A 3K8LA 1BRLB 3FHQA 2RAGA 1K4GA 1S46A 2A3AA 1FQ0A 1PV8A 1FX6A 3CXBA 2HROA 2EXOA 3F03K 3VOJA 4GVHA 4H7CA 1OD0A 1TELA 3R58A 2OWCA 3W38A 3APTA 4UCGA 1NWTA 1M03A 3W1MA 4XZIA 4R9XA 1POKA 2OTDA 3CHDA 3FXYA 5AY7A 4N9DA 1MZRA 4CCZA 1MFVA 3GFXA 2JALA 1E4MM 5D4YA 2NXHA 3FS2A 3UR8A 2XIJA 3R25A 1TUXA 3VKCA 1NH6A 3VE9A 4EOUA 4QE4A 4M81A 2OLSA 7A3HA 2HE8A 1ME9A 2X41A 3N17A 5HAOA 1NDZA 3DERA 2OJPA 3XINA 1NWSA 5C9WA 3MJMA 4ACZB 3B8SA 4JOMA 4XKYB 5BRBA 1LOLA 2CHOA 2EQ6A 3CZGA 3UWWA 5DELA 1E1FA 4HQVA 1R9YA 2VCCA 3TKFA 3E2VA 3BL3A 3WK3A 1KKOA 4EE9A 1S1RA 2ZIDA 2E6YA 3MUY1 1HN1A 2Z1BA 3EF6A 3QY6A 5CGTA 4MAZA 4Y9PA 4BF9A 4DNHA 4L6DA 3LRMA 4GNJA 2QGHA 5DMLA 4OFCA 5A6AA 1SFJA 4NZ3A 1F5ZA 2YIHA 1BKHA 2BY3A 1GVFA 1E70M 2CW6A 1DJZA 3RM4A 3RCNA 4L1XA 4YYCA 4FIRA 4MJMA 1PBGA 5D33A 4ZO6A 1NDAA 4JN8A 1KLYA 4PCTA 3AISA 5K7JA 1WP6A 4JN7A 1A0EA 3NDZA 1G4EA 3STGA 4UFIA 4C6JA 3W2LA 1TVPA 4PTXA 3TAKA 2OX4A 1DTNA 1OF6A 3NDOA 4DUVA 1N8IA 4IMFA 5HJLA 3W7HA 1S7MA 3NSNA 3LCLA 3E12A 2PDQA 2X50A 1NDYA 2WZMA 4Y9NA 5DXXA 4H4QA 3ELFA 3M5YA 1YDOA 3ZWSA 2J27A 4MYAA 4Q7IA 4E6MA 3SCUA 1E0UA 3AYVA 4H4TA 3RG6A 1TTPA 2WMJA 3II1A 2HPIA 3KRBA 4A2SA 4CD6A 1M04A 5CAHA 2DFAA 4K37A 2G3FA 1R6WA 3WENA 4QE1A 4CCEA 3V16A 1B57A 1M7JA 2BTMA 2FGLA 2R1NA 1QT1A 3CEPA 4LV4A 1Z3NA 3UYIA 1W3TA 4YTUA 3SI9A 2ZA2A 3FA3A 3LHUA 1GV4A 1B54A 1W3NA 2XIBA 3QC3A 3NQMA 4DBWA 3H4XA 2A21A 1LBMA 1GGOA 2OEKA 4EAMA 3W7NA 3SN0A 1TQXA 3URQA 1P43A 5HMDA 1PDZA 1C3FA 2FVMA 1PYFA 3EWUA 4AC1X 3N34A 2GR2A 1FEAA 1PUDA 4BWLC 5EL1A 2WK2A 4JHZA 4R7WA 3IARA 3VDCA 5CSRA 3KTXA 5ABEA 1JPDX 2VR4A 4MZ1A 5CCZA 3BK0A 4WKHA 4AEFA 2V9DA 1UIPA 3B9DA 2DSVA 2VVSA 1G4SA 3C0LA 4GWEA 3E5BA 3GVRA 4TVCA 3BSMA 2F6KA 1PIFA 4Z2LA 2ACUA 2VD9A 1UQYA 3TFXA 3KCJA 4ZFMA 5FOOA 2W3SA 1O95A 3H2CA 1WE5A 2QQ6A 2P76A 3KBNA 4Z1CA 4CEUC 2PU1A 3SECA 4L9XA 3WLNA 1J79A 2WWDA 3LX9A 4CLMA 2BVYA 1ML1A 3GNOA 3GXMA 5DMNA 4TOQA 5TIMA 1BWKA 2BOEX 4PTNA 3UJSA 1TV8A 1YTDA 1GSNA 3ZLHA 4QFUA 1FCUA 3MQTA 3CUXA 1WZLA 2OXNA 4PCNA 1Z48A 2DQXA 4LRTA 4AAJA 3DJJA 3R6IA 4EQXA 5C6MA 1Q3NA 3B04A 3O06A 4RUBA 4AU0A 4ENLA 4MWAC 3CGDA 3OGVA 3UFYA 4IUGA 1NIUA 4GFSA 4XX6A 5DCEA 1C8YA 1J2WA 4S39A 4GG9A 2Z27A 5D8ZA 4QLJA 3S2NA 5AECA 4MDOA 3EDEA 3S47A 4GYJA 5JCNA 3AM9A 4EXAA 1PAMA 4CNPA 4DWSC 3TYDA 3CC1A 3RU8X 4AIOA 1FDJA 4F9JA 3SY1A 4JAWA 1US0A 1RBOB 2QAPA 3MUIA 3OLIA 4B5NA 2Z1SA 4MMWA 3GXNA 3L23A 3GXIA 4NNCA 2PGRA 3SCOA 5A95A 1Q13A 1TX0A 4M3PA 1DWAM 3CZKA 3G1YA 2DIJA 2XVLA 1XCFA 4YTQA 4ZGYA 2C3CA 3JRKA 1TPC1 2QDGA 4KEZA 2RGMA 3ANUA 3O16A 3PFMA 1NP2A 3WBEA 3HO8A 5J5DA 5BXTA 3I65A 4AXNA 3LZ5A 4FX7A 4IP7A 3QPZA 3POCA 1Q6OA 5D2VA 1EC9A 2VP8A 3NL2A 4MUZA 2XWDA 5CGMA 2P8CA 4F0MA 3H2MA 2YQUA 1FWWA 1XLIA 3IV8A 2YDSA 3NQ6A 3W7MA 1U22A 3CZ8A 3MZNA 1VBJA 4JNYA 2YVFA 4UTHA 1SFLA 1KM2A 5F2LA 1E9LA 4O1CA 3AHXA 4FOUA 4WXYA 4QEEA 3TH6A 5DN1A 1KLZA 3DYMA 6ENLA 4H8VA 1XLFA 5FA5A 4EM3A 3ITXA 3UY7A 4Q22A 2GGJA 4DUXA 4L4MA 2OGJA 1OFAA 3DHUA 1CLXA 5JU6A 3HG3A 1TTIA 3UJFA 3W7CA 1WBHA 3BAIA 4V1XA 4O1DA 3G77A 2AKMA 1Y65A 1HG3A 4KEVA 2PDNA 4B5XA 4DHGA 3QV8A 4JPGA 1MRAA 5U7SA 4PE8A 4DYKA 1A3HA 4KPLA 4FR6A 3DYPA 3SQSA 1W1YA 4UWMA 1YW1A 5LKYA 3W37A 2XISA 3P8IA 4NT0A 1U5VA 2FZMA 2RH9A 3DXIA 3ZVHA 3KHDA 2FZBA 1GYLA 1UBSA 5HANA 2ZDRA 3VGGA 4PUUA 3GHUA 3MKCA 3QR0A 3CLWA 4QDPA 3GE7A 4B3KA 4E2BA 3R5EA 2UWFA 3AS1A 3ZJKA 4FA3A 1V97A 3GR8A 3QYSA 1XP3A 3ZLGA 1TCDA 2C91A 1EX1A 4BK9A 1PJ9A 3FKRA 1TPVA 4DUWA 2AAQA 1BF6A 3UD6A 5H91A 5HUOA 4AB4A 2V63A 4E8DA 2PGWA 4IXHA 5FAGA 4IOTA 3ZMRA 4F0HA 5A8NA 1DKWA 3UCQA 3C3NA 3WQWA 4MB1A 4KW2A 2ZX5A 2F7FA 2NQZA 2Z1KA 2WSRA 3B97A 3TYUA 4GIAA 4XD3A 3ABRA 2W4XA 2H8ZA 4TX6A 3UVAA 1DJGA 4GIYA 4ZE4A 3MI6A 3AO0A 4UTTC 1UWQA 3ITGA 2WANA 1QFEA 3KVLA 1B4EA 1PWMA 4QM1A 1Q4WA 1DWGM 3WQ5A 4QG6A 4S38A 4GISA 4FPSA 2EPHA 1NHSA 4CN6A 1UOZA 1F61A 2C71A 4GCAA 1NDVA 4IIGA 4Q8UA 4CNOA 3C2OA 3E0WA 4FLQA 4O10A 4B9ZA 2E6AA 4OT7A 4GABA 1REQA 2VENA 1JZ3A 3SY5A 3GIYA 3BSGA 3I3BA 3GDMA 3MWCA 4DWSA 3HJEA 4RZ6A 4JTUA 4FI4A 3HV8A 4PUMA 2QCDA 4C7FA 1D3CA 1Z42A 2IMRA 1SMAA 1SU5A 4J40A 4KS0A 3BAYA 2QULA 3MVTA 3IWPA 4H19A 4RE2A 1EGZA 3TOYA 1LL4A 4UTFA 2EG6A 3ARSA 3A3WA 2NSOA 3AYSA 1LORA 2XFYA 1HJUA 3SCQA 3ABSA 5AC6A 4YMZA 3H53A 4I5XA 1BGAA 3VMNA 4AIUA 5AC5A 3H2FA 4W86A 2J13A 5D9OA 3KOWA 4EQRA 1OCNA 2HEJA 1RP9A 2C79A 1ZAIA 4GVFA 3SCPA 1ZMDA 1I2OA 5D2TA 1CLKA 2XDFA 3R0DA 3OIXA 1KRCC 4AEOA 2WZHA 2Y24A 2Z28A 1QPKA 3FYOA 3S1UA 4MJ4A 3I3EA 2YLLA 3H21A 4A3YA 3FXGA 4A2RA 1H6VA 1FIQB 1G6CA 4P7NA 1DYSA 4P8VA 5K4ZA 1CXFA 2VNCA 3ZSTA 5D9MA 4GD0A 3C0QA 2XM1A 2JK6A 2GSJA 5CSSA 2G8ZA 2NZLA 4R9OA 1A3WA 1Y7VA 3G6LA 4MB4A 3REQB 1JIBA 4DI9A 4GQBA 1W37A 1E5JA 1ZLPA 5CJMA 4Q4SA 1H5VA 1O94A 2YCIX 1PXGA 2DH2A 3PBWA 4NY2A 5FL1A 1VQTA 2Y4SA 1N55A 4HZMA 2RHGA 4PTMA 3WY1A 3PZIA 5M03A 3UZJA 4JFSA 6REQB 2QCHA 3D0CA 1NY1A 4DIAA 2WZTA 4E3TA 2YPIA 4O1BA 1CGXA 1LRQA 4O1EA 5K9XA 3KLJA 2O9RA 5H8UA 2QJMA 1V3JA 1VB9A 2BBFA 1AA1B 3OU8A 3IJLA 1Y5VA 3P7YA 4AG0A 3UGRA 5DT5A 1CX9A 2F2HA 1LTDA 4S2BA 1H2JA 1EWEA 4S3DA 1N60C 4YTTA 3AN1A 5EFDA 4F9DA 1XDMA 1A5AA 4J3ZA 2NSXA 5KZDA 2OYMA 4XO7A 4JTJA 1M3UA 2A79A 4KRTA 2TPSA 5CG7A 4CQ9A 3OIHA 4QEHA 4Q8MA 4MKNA 2A6NA 5CBBA 1F6KA 2H6RA 1KCZA 1N61C 1W56A 5C70A 4CVUA 2DSZA 5CH9A 1UC5A 2YYUA 1ZCCA 3V7PA 4J35A 5A6SA 3UG3A 1F6PA 3NWRA 4O14A 3EKLA 1K4HA 4KCUA 5DMMA 4X0VA 1Z89A 3VNIA 4HPGA 1WQ5A 4LCQA 2PDCA 1WYGA 2X05A 4DXVA 1F05A 3BOLA 4ASTA 4A3RA 3A9BA 4HHMA 4LWWA 4EM4A 1EPVA 1V6XA 4HN4A 3N2CA 3L12A 2C16A 4GH3A 3WMCA 2PGEA 7PTDA 3A4JA 3U5UA 1SQ7A 3GD3A 1JPIA 4REQB 4GO8A 1TTQA 3TEVA 1XLEA 1N5WC 2VZUA 4GI8A 3DECA 2Q3OA 4JTEA 4NJHA 4A8LA 3CGTA 4G1NA 4JDRA 5FS7A 3FW6A 1V5XA 3UNTA 3OPSA 3QFWA 3OGSA 4NXKA 2JBMA 5FF7A 4MLRA 3GDBA 4H6RA 3G2GA 4HP5A 4IQDA 4YN5A 3NDYA 2QVHA 3FJ6A 3WYZA 4V28A 2I5QA 4Z2KA 3TYCA 4F0SA 3CQHA 5I3IA 1XIGA 2ZE0A 2JF7A 1B3ZA 2WBGA 4KCVA 1J5TA 1GOKA 1U5HA 3FX4A 3LM7A 3W22A 1G0CA 4U2YA 2ATMA 2FJUB 3SFWA 4C6IA 3PZUA 2WAGA 3OGRA 3GG0A 4Y9AA 2FTYA 3FDKA 1K6AA 3OBEA 1WO2A 2BGNE 4OVXA 1F74A 3FA5A 3BLPX 4BEQA 2AKZA 1AH3A 1B9ZA 4Z1BA 1V6WA 4MOZA 1EGMA 1DP0A 3E0FA 3SCWA 2PDIA 4K1WA 2PDYA 3IJ8A 4JFVA 1E1CB 4ZXLA 2CWNA 4BV6A 2C1IA 3L4TA 3O1NA 3I6EA 5HOSA 1IXOA 3EXSA 4JDYA 2D1ZA 2B7OA 1GORA 2YL6A 3EBVA 4BQ2A 3O6DA 5EMLA 1V7YA 1FEBA 4Y8FA 4IG2B 3GU9A 1WX0A 4F0LA 3H7VA 2DZWA 3W1NA 3Q6JA 1FH7A 1RJQA 1V6YA 3HURA 1MUWA 3GVVA 3KZPA 4XV0A 1CGUA 4AD2A 4YWSA 1XYAA 4HNLA 4OOUA 3LI0A 1BD0A 1ZGDA 2E67A 1F8MA 2YVGA 3UZWA 5J8LA 4JTTA 3P81A 4GFIA 2Z25A 3GH5A 5G2IA 2J7BA 2PWVA 3TYZA 2AAAA 1JCNA 4PTVA 5K2ZA 3LNMA 1H4PA 3W01A 2ZICA 3EX3A 3OHIA 3CWOX 2Q02A 4MNKA 1S3HA 3MUXA 3AU2A 4Q4QA 5L6UA 2OPJA 3GG7A 1Z69A 2BXYA 3QGVA 5FD0A 2B0MA 5A1AA 4Z1YA 3QFEA 3GD4A 3EOOA 3VKDA 2W6RA 5IHRA 1XUZA 1WXZA 3N73A 1R2RA 1RD5A 3RLGA 1DJXA 3ME3A 4MJ2A 4GNVA 2PD9A 4AWSA 1NFBA 2CZVA 4ZOHB 2DIEA 4M29A 3GHSA 5FF4A 2OOFA 3ES7A 5KVHA 3LXBA 3Q94A 4TVWA 2XN2A 2CITA 4J9JA 3GC5A 3VINA 1BHGA 3DIPA 3PFRA 1FWNA 2YBUA 3CIVA 2CFYA 4M1RA 3AXMA 1BVWA 3WBYA 2E0PA 2INFA 5IDIA 1SFTA 1AJ2A 1UPPA 2GVLA 1ICQA 1PTDA 3CNYA 4HYVA 4M6QA 8XIMA 1YTEA 4URIA 1OGGA 4L4OA 3GAKA 3TW7A 2GOUA 4I7WA 3U2OA 3KM8A 4PMQA 2VL4A 5JCMA 3ECQA 4WCJA 1GYNA 1JJKA 1QASA 1LLZA 3MY9A 1OFQA 5LXXA 2QJJA 3SRHA 1T3QC 1JDAA 1PKMA 2YOCA 4JFUA 4YU1A 4UXDA 3AICA 4UQBA 2GR0A 1B9BA 3O7UA 4RLIA 2JF6A 3MSGA 3WDRA 1VGAA 4HCHA 5JMUA 2BCPA 1I0DA 4ZO9A 4YTSA 4I5RA 3AHTA 2P53A 2X0SA 3M5XA 2XSXA 3ISIX 4DPPA 4AXKA 1HKVA 1E0XA 3OEXA 1PYMA 3FOKA 1XIHA 3VFLA 4UR7A 1ZUAX 1HKMA 5FACA 3G3DA 3HMCA 4ROQA 3LB8A 4QS6A 1SO6A 5BROA 4KPRA 4IP4A 2G3NA 1EF3A 3A23A 3LI1A 2GYIA 1PCKA 1GPWA 1EOKA 3G1SA 4Y6GA 1GTHA 2OELA 4MLJA 1DOSA 3W3OA 3BAXA 2PDXA 3KRZA 3KBMA 4DBEA 3UR7A 3PZVA 4UFHA 3QF0A 4HNUA 1R0MA 4X2RA 4QHRA 4K68A 2VT0A 1K7EA 3N13A 1QATA 3WNKA 5I07A 1EJTC 2GGIA 4WRHA 3LLFA 2J79A 3ARYA 4OUEA 3WFAA 1GESA 4LBSA 3THQA 3MMTA 4S3GA 4H4PA 4ERAA 3G1AA 4FXFA 4AFYA 3WLPA 3MYOA 3W7IA 3NOEA 3V0TA 3EPNA 5LGZA 2D2JA 2WPCA 3PJWA 5CLWA 1DE5A 1BWLA 1YLVA 5FSDC 1XKYA 3LY0A 2Z1VA 1XG3A 1N7KA 2V5LA 2POZA 2Y7GA 5C71A 2XU2A 2CZDA 5M5DA 1XH1A 1DV7A 4JY9A 2ICSA 3F4WA 5AHMA 5FJIA 3WD0A 3LERA 4IICA 2DSUA 2W27A 2JGQA 3RX4A 4UQAA 2NV1A 1B3XA 1EEXA 2QJNA 4LA1A 3LCIA 1I60A 4PUNA 2ZZ0A 5BNKA 2WO5A 3RO6A 2OX1A 5XIMA 3IVTA 3SIZA 3AAMA 3H2OA 3VGDA 3PS7A 1CXEA 2CLEA 2WSYA 4PR4A 3ARVA 3FIGA 1WKDA 4QJ5B 5FJRA 1ADOA 3EA1A 2WHMA 2OZ8A 3EA3A 5A2AA 1SSDA 3K13A 2VO5A 4M7TA 3L0NA 1HT6A 2QV5A 3BOXA 4TX9A 1V93A 2CZFA 2VX7A 2WMIA 1ZCOA 3WN6A 1SGJA 3MB9A 2ZRWA 2E8YA 1O6IA 4N02A 4NQ1A 3H26A 4NSBA 3G1FA 1ZBVA 4UTLA 4HSOA 1AG1O 3VMPA 1C29A 3W75A 1NHPA 4UIOA 1JRBA 1G4PA 1HKJA 3IK4A 2D2OA 2BP1A 2EQ8A 1MFUA 2A5HA 1RA5A 3VIFA 3QZ6A 1GZ1A 4NEWA 4UNKA 3CTLA 5F2IA 2WW5A 3OQ8A 4D8AA 3VIGA 3ERPA 1NAL1 2XVKA 1AJZA 4H4WA 3ZT7A 5I24A 4M6PA 2PC4A 1JD7A 1Q7ZA 4HA4A 5FESA 1VRDA 3F7JA 1K1DA 4N9EA 3W70A 1AQHA 2W0UA 3BLKA 1UWAA 3N1AA 2PDLA 2PP0A 4B16A 5AYZA 3KVJA 5FIPA 4ZCWA 5D2YA 2ZUSA 1NJJA 4H7ZA 5ABHA 4QG8A 4QSFA 3HPSA 2DT0A 3CHVA 4ZSTA 1VFUA 4MF4A 3SW6A 4TVYA 2V2CA 1KGXA 4L6OA 1XICA 3SRKA 1UR0A 3UU0A 4AYGA 2XVPA 4UC5A 1ONFA 1H50A 3TTEA 1X98A 3G22A 2NV2A 3DFTA 4H9VA 2XWEA 3W84A 3SCNA 4LBRA 1LUCA 4D6IA 1XYZA 3H22A 2GWNA 1LG1A 3BOFA 4GIRA 3LCWA 3IACA 1R9ZA 3KXQA 4IMEA 4Y96A 3I68A 2YDRA 4FALA 1BGGA 4O52A 4FK9A 2CKRA 4IM4A 3WD4A 3F2CA 4QS5A 2DW6A 3WK2A 1TPDA 5FJJA 4EQWA 4XD4A 3W24A 1EQPA 3ZT6A 4AC7C 5I09A 3NIYA 3PANA 2WPBA 1UR1A 1KBJA 4WIWA 3W6LA 1B5TA 3A6OA 1IIHA 3PG9A 5I3JA 5D32A 2BODX 3KTSA 4PCPA 3I10A 4W5ZA 2QNEA 4P7RA 1ZB5A 3T2QA 1VH7A 4ALDA 3RLHA 1XSIA 2W92A 4C6NA 1XFBA 1K7FA 1F6YA 2Y1HA 2Z26A 1EIBA 5DF0A 4RR4A 3NXFA 1QPNA 4QBXA 4OKDA 2Z2UA 4W5UA 4RPQA 2VJXA 2ZA3A 3HJZA 4H9ZA 3WJZA 3ID7A 3RK8A 3CHFA 3L2LA 2CLPA 3LTSA 4OV4A 3GIPA 1V3LA 2OT1A 4DXXA 1LQ2A 3LMYA 2ZUVA 3I3DA 4QIUA 3MJYA 4IL2A 3B4UA 2WPGA 5CPTA 1OX4A 3F4VA 4IWWA 4WDTA 4Z2HA 3GTFA 7REQB 4DJFD 1Q6LA 3MANA 2DSWA 3CUHA 4R3UA 4FNPA 4WLCA 4DBUA 2P88A 1WUEA 1XCWA 3W28A 3B9NA 4E8CA 2NW0A 3WO8A 2DZPA 1TR1A 3PZOA 4LUTA 2A6LA 3MWAA 3NL3A 4C91A 2GK1B 3WF3A 2YXOA 1LL6A 1JEHA 3B0YA 3WCZA 5E9XA 1W3LA 3MUZ1 4FLRA 4K8EA 2X1TA 1IXPA 3WLOA 1JUBA 2WOWA 3EA2A 3K2GA 3S1VA 3DENA 3N9RA 4IPIA 3U3HA 5CKSA 1UH4A 2Y5SA 3TQ0A 1CECA 1E6RA 4O12A 3FJLA 1VC4A 3MSRA 4IIDA 1KFJA 5CPOA 1A4MA 1JZ6A 2BC0A 3VZXA 2VI0A 1FWFC 3AIWA 3QW4B 4NZ1A 2ZVIA 3AMLA 4MADA 3KWSA 1KBKA 4XD6A 3DK9A 4HK5A 2YYTA 1EJWC 2BLEA 3K30A 3EUB3 3P84A 1DJWA 4F0RA 3BDKA 1ZP4A 2E5BA 4AVFA 1EFZA 1R7OA 3HB9A 1VCGA 2A1YA 3SUWA 1MO0A 1CZ1A 3RM8A 3BGJA 4Q8OA 4Y90A 2VELA 1BG4A 3QFAA 3G5EA 3VKBA 3O2LA 4PTWA 1QNOA 1LVLA 2J7FA 1DQXA 3T44A 2WKGA 3FAWA 3HQ1A 4RCXA 3I4EA 4MTVA 3W1PA 1BYAA 1P6BA 3LXCA 3VGHA 1EIXA 3QHOA 1GOIA 1Q6CA 4K38A 3KBJA 4H4IA 1N2VA 1KW1A 4I6KA 1RCXB 4AD0A 1E71M 1V02A 1XIDA 1ZU8A 1GNXA 1KM1A 3U57A 2OWXA 1MQRA 4ADSA 5HR6A 5HR7A 3C86A 1JULA 1OCQA 3GNRA 4AZCA 5BXRA 1BQGA 3E5PA 5FJUA 1UP0A 1VENA 4IIEA 1Q7MA 1G5AA 2QPXA 3WH8A 5IBXC 4IFOA 2HTMA 3O3RA 1JZ7A 3CO8A 4WGXA 1GG1A 1KCXA 5GJNA 4I5UA 5CBIA 2E6FA 2FTWA 1GVQA 3S9IA 4LNYA 1VBUA 3GG1A 1IIGA 2QVNA 4KCTA 1VF8A 3ARWA 1EH9A 1T7LA 3TN5A 1AQMA 1TPWA 2NVDA 4C5ZA 3DEQA 1PZ0A 2EPOA 4EPEC 5TQLA 3V4BA 1M7PA 2WQPA 3FV9A 1G94A 2VD8A 3ZFHA 3PG6A 3TMLA 4NL1A 4YL2A 4C6QA 2GR1A 1XIMA 5TD4A 1JQXA 1NOFA 1XRTA 1RY0A 1XM3A 1RXOB 4DJEC 1YQ2A 1BRLA 3W6YA 1W3IA 3DI0A 2GR3A 4CN4A 3QM3A 3M16A 3URNA 1QO5A 1M7XA 2AQWA 5LNWA 3GXDA 4MKVA 2J7GA 3ZS4A 2KAUC 4HA1A 1V0NA 2WJDA 5F4XA 4K39A 3S6DA 1HUVA 4XWUA 1JYWA 3LYEA 5MKGB 1PIGA 2KX9A 3PJTA 5AVHA 4DO5A 3W81A 3UW6A 2HDJA 3BJSA 2XUCA 1M6IA 3UT0A 1GT8A 1SPQA 1XKJA 2EQDA 2GJXA 4WDWA 2YCKX 3A5FA 4H04A 3GRTA 3LQGA 1A0CA 3QSTA 4OBTA 5BW6A 4EMWA 4KT2A 4A6GA 2YBVA 3CJPA 1V3KA 1JZ2A 2PCQA 2VGFA 1XIFA 1CXHA 1HJSA 5KVIA 1B3VA 2RABA 4XKYA 1SYTA 3LG3A 4M82A 5EMYA 3NQDA 3QXBA 1FWJC 2PRLA 2G50A 3B0PA 5D9PA 2OYKA 3VZYA 2PB1A 2H8XA 4IJRA 2ASHA 1DQWA 2TRSA 4JBRA 4WJXA 3EPOA 5G1YA 4UR9A 1CGTA 1UD8A 3PPFA 3GVWA 3LGDA 2J7EA 2Y0FA 4NEVA 3N15A 4FEZA 2QCEA 1EJUC 3SR7A 5A3HA 5F1UA 3M7WA 3R89A 4WD0A 1C93A 3NPXA 1L2QA 1OQFA 1IXNA 5GJMA 3ZZ1A 6A3HA 3BZJA 3TQPA 2HK0A 4XSMA 5DEZA 4MVAA 1HO4A 4DEFA 4XKMA 4PUDA 5FJOA 4EPBC 2ISFA 1G4TA 2RKXA 1ZQ5A 3ZR6A 2VM8A 4DLMA 3U0HA 3L4YA 1EDTA 3CQJA 4NP7A 2AOSA 2IKHA 4C60A 1V03A 1YYAA 1YXYA 4XK2A 3L2IA 3M07A 3QQWA 2ZUMA 2GQWA 1Q8AA 2PMQA 3AC0A 4WSJA 3B8TA 5FJTA 4RNJA 3MBFA 1QOXA 4HU8A 3OG3A 3CMFA 2GQ9A 4U2ZA 3VCCA 4Q7NA 5IBXA 3CYVA 4LAUA 3NXLA 2WP6A 3ABZA 4ZQNA 1ISZA 3CQIA 3TJ4A 2PTXA 3ARPA 4NUWA 4XBSA 4F79A 3AOFA 3B9OA 1H7OA 3K46A 3SM0A 3QKZA 1VYRA 4NG3A 3HV9A 5TF0A 3ICJA 1OIMA 3AUOA 1NF0A 5MHBA 1L0PA 3ZXWA 3CAQA 5E70A 4P7OA 4OWGA 4DJDA 4AYSA 1KM0A 1PCWA 5BU9A 2J8FA 3GDTA 1YBQA 5RUBA 3CHEA 3PAJA 3MW7A 2OMAA 1H7PA 2X30A 1UD3A 5FS9A 3P74A 1S5TA 4I9TA 5MF5A 3RAOA 4H2CA 1H0IA 4CQDA 5HWNA 3WEZA 4JTQA 4X2PA 2MANA 4US6A 1YADA 4I8DA 3GB6A 1JR1A 4X9YA 5TR3A 2DZAA 4C7DA 1UR3M 1IF2A 1UMLA 3OJGA 4WHBA 3T08A 2DSKA 4GX9A 2ZCGA 3V5CA 3EB4A 3P0WA 1XXXA 4KFNA 3ARRA 4UOQA 1UUOA 2O7SA 4Q8TA 5G1MA 1FWSA 3UXDA 1RK6A 4F0KA 1O1ZA 2HVMA 2PSNA 4HTBA 1JD9A 4DPQA 2OQYA 2PURA 4ZODA 4I8YA 1SO5A 3FJNA 2PDWA 4NJIA 3UJRA 3VYLA 3E96A 2QEZA 3AMGA 5GNZA 8CGTA 1NFGA 2I17A 2WHKA 4PMVA 1HJXA 1X6NA 3WLJA 5J04A 1CLVA 3AMDA 3B0XA 3OBKA 4L80A 4O8RA 2NVAA 3W7LA 3H24A 1SZFA 1OYCA 3GUWA 5KZMA 1QCWA 1WDRA 3U5YA 4H4ZA 4TX8A 1CB7B 4HN8A 3CPGA 3NFUA 5CPSA 1JF6A 4W93A 4QDMA 4GI9A 1X96A 3SDOA 1HKWA 3D6NA 1ENUA 1P7TA 1W5QA 2D73A 3CB3A 3BCFA 5HQLA 1QBAA 1VS1A 3JUGA 4C1NB 1G69A 3UETA 4LS2A 1YDNA 2ODOA 2X1IA 3A4AA 1XYLA 2VTFA 3TONA 3CZLA 2GL5A 3CAWA 1CT5A 4KF1A 2JFEX 3WQEA 3GHRA 4MFDA 4S2CA 1NF7A 2FGZA 1GTEA 4KCWA 2EQ9A 2I5IA 1UD4A 4QQUA 2CLFA 5G4EA 3II4A 2ZZ1A 1XLKA 1BWVA 4HIBA 4LVAA 5BXPA 9CGTA 2H9AB 1XQLA 2P0IA 1LBFA 1GK8A 1MMFA 1DTUA 5LA0A 3CQ0A 4CEXC 3N12A 3RR4A 2NLYA 3K8MA 4GGHA 3E2RA 2Y63A 4PUWA 3DZ1A 3CUJA 5GRTA 4DLFA 2PWGA 1NU5A 1OZMA 3A21A 4MZ8A 3AMCA 3BMWA 1Z8AA 3GTIA 2J74A 4GBDA 4LYPA 2GGGA 3CWHA 3W6MA 4RPPA 4LEFA 2A7PA 2NVCA 2FQIA 4GZIA 1JZ8A 4M51A 1OB0A 4UMAA 4Q8PA 2NXGA 1NELA 2GGEA 3ZQ9A 1S5NA 1TWDA 4QGCA 5A6BD 4EWJA 3F2DA 1KRBC 1M5WA 1OM0A 3Q65A 5H8MA 4QCFA 3ZVIA 4ICCX 1OF8A 3MP5A 1W1B1 3QY7A 2I16A 1PVNA 1ZENA 5KMYA 3EOUA 3LOTA 2PWDA 3AHYA 3OO2A 5A94A 4O1AA 1Q66A 1OCBA 2PF8A 3TN4A 4N6FA 3RR1A 5K4XA 5CC7A 1CGVA 3HZ3A 3AZRA 1FHDA 4ERGA 2RDXA 1ONRA 2Y5EA 4JQ2A 4PZVA 4XZHA 4H8NA 1YEYA 1XV8A 1R3TA 2NPXA 3BUVA 2V3AA 2IXVA 1PTGA 3F4DA 5DLCA 1VZWA 1FVPA 3RDKA 2R14A 1VLWA 4JYEA 2OEJA 1BSIA 4B3LA 4Y9OA 5A8QA 1XIIA 3QRHA 1BTCA 2BY0A 1LT7A 4GHRA 3L67A 4JYFA 1UUQA 1LQ0A 3APGA 3NEVA 3TWBA 4JKMA 1YIXA 3I6TA 3LPGA 1WDDA 5IDZA 4YVXA 4H6KA 4PYSA 5HA7A 3AIRA 3BMVA 3OA3A 3GU1A 3TX9A 4WGHA 4Z1DA 3BG5A 3CIXA 3WLQA 3NAVA 3EDDA 3FEMA 5DT7A 2CERA 1FWEC 3NUKA 2NUYA 1FKXA 1D7FA 4ML4A 4L61A 4FF7A 1QHZA 3KCLA 3U2EA 4WJ8A 1W1A1 4P8XA 2Z4GA 3E9AA 3R94A 3MO4A 2NQLA 2JKAA 1R30A 1IYXA 5FEXA 4RDVA 2NX1A 2FHFA 1YNYA 3UEQA 4AD5A 1VJSA 1ZX9A 1NHQA 3ARUA 4EF9A 3C2YA 1LJYA 1K9EA 3H8AA 5XINA 1TKKA 3LU2A 3PWIA 3M1ZA 4X60A 1KWKA 3RPTA 1ODZA 3WQ6A 2J9XA 3P61A 2R24A 3C2RA 4U10A 4C6EA 3TSDA 4AX6A 1H09A 2YW3A 5D30A 4HD5A 4YWOA 1LRTA 3VIOA 7ENLA 3D3FA 1X1ZA 4D6DA 2D2HA 3UWVA 3TLLA 3QVQA 1R8LA 3GXFA 2HS6A 3TVAA 4FNSA 4CD5A 3H2EA 4XVDA 2V82A 1A4LA 3TJXA 3RITA 4RDWA 2QLYA 3NNTA 4NYUA 1UD5A 5I77A 4NRSA 1P0DA 2EAWA 3E1F1 3T42A 1W9DM 2P0OA 4R85A 1EBDA 4MGGA 4L7ZA 1GXFA 3W2KA 2ZKMX 1W1IE 1RSCA 1UMYA 1F07A 3NCOA 1TFVA 3T0BA 1UB3A 1XRVA 3FYPA 4B91A 2D23A 3LD5A 1DIDA 4QX4A 1ZBCA 3DFOA 3LA4A 1YQZA 3N3TA 4RW5A 1MXGA 3SO7A 1XANA 2Q01A 4Q4KA 4ERIA 4WXZA 1DNCA 4WZHA 3GRSA 1GQKA 3V5FA 8A3HA 3FVMA 3MKVA 4LAMA 6REQA 4XISA 4LF1A 5BMXA 1EWDA 1KQYA 1RA0A 3A7AA 4ADWA 3D5HA 4KWUA 2HXUA 2P1FA 1N63C 4F40A 4W8LA 4LAKA 4Z0JA 3L0KA 1FFRA 3OW1A 2IQTA 1TE6A 4GUHA 3VAVA 3LENA 1TV4A 1MNSA 4FB7A 1TB3A 2XG9A 4EF8A 1CPUA 3CHCA 1QWKA 1PKLA 5C9RA 1PKYA 3T07A 1Q5MA 4E2DA 4PSRA 4H00A 2UV8G 3R79A 2G3MA 3V75A 2YL8A 3ARTA 3WKZA 2E40A 5EMKA 2G97A 3G1HA 4U31A 5M17A 4MWAD 4K8HA 3NPUA 4OQVA 3E74A 1XCXA 4HJWA 1JZ5A 4NHVA 1EJVC 2QV4A 1E6XM 4Z08A 4A05A 3GG8A 2NQ5A 1E5NA 2PLJA 4YVVA 5LIUX 5U25A 1US3A 1O5KA 1HL8A 4XZNX 1YKWA 2EBNA 1K8CA 4G9PA 1NDWA 3S8HA 2EQ7A 1LOQA 1U1JA 3QKEA 1B3OA 1F3PA 1MEIA 4IQLA 2ZC1A 3NJ3A 3MHFA 2EKCA 3L4UA 5HNUA 4A29A 3EKZA 1QNRA 4H83A 3N9SA 4RNIA 1XR2A 3W7QA 3T05A 3PPGA 1VR6A 3BURA 4ZBCA 3BG3A 1KBLA 4REQA 3T6CA 3L4VA 4P61A 3DG7A 1DXLA 3G1XA 1KV5A 1JQVA 2HWGA 4YHGA 1X2HA 4HMEA 2XIIA 4PB5A 3PUEA 2WSKA 5B80A 1BXBA 4JS3A 1VEOA 4LNCA 2YA0A 3CV2A 4HHPA 5AYXA 1P4CA 3KVKA 4EIVA 5HBFA 4AZHA 1FWBC 2DU2A 1RCQA 1U30A 3U4AA 3QMTA 5E9AA 2C1GA 4J28A 3BG9A 5AHNA 1OT1A 3VNJA 5JXQA 4NNBA 3ABQA 2YDAA 3MMWA 4FOJA 3V3WA 5C2XA 2X0YA 5FEWA 4KIEA 2PU0A 3QQ1A 1XBVA 5BCAA 2TPRA 7ODCA 3NG3A 2OU4A 3MSDA 2E9BA 3KBSA 3TTQA 1V0MA 2GVJA 4O28A 3TC7A 3WBXA 3WELA 1RVKA 3FCPA 2LLEA 3VX1A 3AJ7A 5FMHA 4DM2A 3WLIA 5AC8A 4GCXA 3GRIA 2CIPA 1EUNA 3NL6A 2G96A 3RLVA 3M41A 1UIOA 1K3UA 2V3GA 1ITCA 2ZX9A 4QQ3A 1S38A 2WMGA 1HIZA 1Q7QA 4M80A 1AW5A 4FS9A 4POCA 1H60A 2ZZ7A 3FGCA 2X09A 4GA8A 4IG2A 3M0YA 1O5QA 4HPNA 1DIKA 1LPFA 3AU6A 3N4EA 4UTJA 3AZSA 4AH7A 4JKLA 5TBOA 3QHMA 2RDUA 2VUYA 3MCNA 5CC3A 3P62A 2RGLA 4WK9A 3QQ0A 3ITLA 1OZQA 3N9KA 4JX4A 2WCGA 5AHIA 3EAUA 3WK0A 1OADA 2ZRXA 1W5MA 1VEMA 2PDGA 5HDRA 1XRSA 3RX3A 5G5GB 2PBGA 4Z2GA 1VFTA 1FCVA 3S0CA 3S5OA 4EX4A 5C2GA 4O8AA 4AX7A 3PVFA 4KESA 2WCSA 4GRSA 1OK4A 2ZZ3A 2XHYA 1M7OA 3OTRA 5KEZA 2I7GA 1XHCA 2XGZA 4AIBA 4ROPA 1S5MA 5IFTA 2TSYA 2XIMA 4MPQA 3SCTA 4HPHA 2J3NA 4JCLA 1MVYA 1DBTA 1PEZA 1YXCA 3DC0A 3WD3A 3UERA 5K9CA 5I03A 1LLOA 4G2DA 4FXSA 3IRDA 1F8IA 1GVOA 2XIOA 5H1WA 3CT7A 3KOZA 4H9TA 2NWRA 1TV7A 3NL5A 2VGIA 2GVGA 2Q8XA 2DDXA 4X61A 1DJYA 5BWAA 5ENLA 9XIMA 4BA0A 5HMEA 3W73A 1M01A 4KERA 1PHWA 1ZJBA 2BX7A 1KM3A 4Q4PA 3WLHA 2F61A 2D69A 1XH0A 1W17A 2YW4A 4M7SA 1F3XA 4B92A 1FWAC 5JH1A 4E4FA 3M7SA 3KP1A 3T2OA 4L9ZA 3SSZA 1F4HA 4ZQRA 1H0GA 3VDBA 2O4MA 3A3XA 2X8GA 1MW2A 1XLDA 1EHNA 1XSKA 1MW1A 4BFAA 4W87A 5AYIA 1GRHA 3N29A 1X8FA 4FNTA 3ZYZA 5D9NA 2R94A 4X22A 1YE6A 3RGTA 3MKKA 3M0JA 1AL8A 5DX7A 1TV5A 1CXLA 1HL2A 2CLHA 3VX0A 3DH7A 4UNLA 4XQ6A 1DJQA 1EYEA 3ALFA 1ITUA 3TZNA 3CL8A 3NQVA 3OYZA 3NVVB 4JL2A 2WLZA 2EEXA 4LXFA 1OT2A 2E1WA 1X1OA 2OT0A 3PZ9A 2A4AA 4Q4RA 3NRZB 2ATSA 1QU4A 1JGMA 4AY1A 2ACQA 4PTDA 3IEBA 2HE5A 3VM7A 1GERA 3P0XA 3IV3A 2BGQA 3QYQA 3GM8A 2PLCA 2YSWA 1STZA 3CIWA 1OGBA 2I56A 1QI0A 3PBVA 5A8GA 3LZ3A 1XG4A 5M3WA 3LCGA 1D2KA 1ZTVA 4E2OA 1DE6A 3OHMB 4PL2A 1E4LA 2WVSA 2OB3A 1IWBA 1MYRA 3LCFA 1W54A 5A2BA 3ZVHB 4FNRA 3GD6A 4U5KA 1V0LA 3W1LA 3FEQA 1L8PA 2XYLA 3P93A 5I5RA 5CZJA 3NVDA 1T96A 3CQKA 4PMJA 3E2SA 1DXEA 1T40A 3DFYA 1QWGA 1FFQA 3SY8A 2JEQA 2X7WA 2ALRA 3LHTA 3TTSA 1R87A 2VUNA 4AZ5A 3TU9A 3PBYA 4LRSA 3A7RA 3DU0A 3OYXA 4DAIA 2BY2A 1L6WA 1H7WA 2DT2A 1CGYA 3VDAA 1Z32X 8XIAA 4R53A 4BHYA 1XYCA 1K03A 3P80A 2AMXA 4UQ9A 5FF0A 4Y8EA 3MA8A 1GRFA 1NOWA 4CU7A 1TRDA 1KXVA 1OD8A 2CBVA 4JIQA 3LPFA 1UD2A 3MHGA 4TQTA 3FY1A 4ZENA 1SUXA 4JDBA 1H62A 3GR7A 1W0MA 2D2GA 1V79A 3VA8A 2FHBA 3EOLA 4MWAB 1KCKA 2O9OA 2JIWA 2WQDA 5EMJA 1J0KA 4AY7A 4UCFA 4IFKA 2HQAA 3BANA 1GOQA 2J25A 3PB0A 4FX9A 4YNGA 2QMKA 4HB7A 1JL8A 3KLLA 1IWAA 1REQB 3LSCA 2YL9A 5T9CE 4DWSB 2BVTA 4EACA 4JQAA 3RO8A 4YJ5A 1SJCA 2BASA 1NVMA 4KWWA 1UWUA 3KCOA 1R47A 4UMBA 5IRPA 1A5MC 1GOOA 3OVPA 4A8IA 1YTKA 3PN8A 4HCDA 1CENA 4XIAA 1GW1A 3WH7A 1SZGA 5CPLA 4JIRA 2VRKA 4W8AA 4X3ZA 4TTUA 3BJTA 4O57A 4D8ZA 3BXWA 2C3ZA 5D8WA 1ZFJA 1UWIA 2SFPA 2FZDA 1MDLA 1E0WA 4GKTA 3N25A 1XD1A 2X1SA 3N6HA 1M6JA 1XHGA 3C4UA 2P3ZA 3QMRA 4HBKA 2DIKA 3TP4A 3L5AA 4JKKA 1KM6A 1SR0A 4K36A 4XAZA 5IFPA 1OG6A 5C55A 4IHCA 3LHVA 4LY8A 1KV8A 3TDFA 4DBSA 4RL3A 3S2LA 2BMBA 2ZZ2A 3QV9A 4NF7A 2YZ5A 1GVSA 4L56A 2GJNA 3PPHA 2Z7KA 4NZ4A 1UKPA 4KIRA 5REQB 3W07A 5LIXX 3UWYA 3T0DA 4RDYA 2CBUA 1A53A 4PMOA 3QSRA 1HL9A 3HGSA 1NWUA 2AQOA 1RPXA 4NAEA 3H4WA 1OWQA 1W3HA 1WUFA 1XISA 5I2UA 3UXLA 2ZRYA 1IGSA 5CJNA 2VOMA 2V6OA 3QOKA 4E38A 4INFA 2YLAA 5K3VA 1OJTA 2PZ0A 3EMZA 5D09A 3AALA 2DT3A 3ZJ6A 2DP3A 4DWDA 3L5OA 2DZXA 3VOFA 4IH3A 1QXLA 2FPYA 1UPMB 3WQ8A 1J5SA 1Q1RA 2GGHA 4NI8A 4E0CA 2FIQA 2Y8KA 3WDQA 3S2JA 3BARA 2QXWA 3JZEA 4HK7A 2VEMA 1TJ2A 3MUCA 3PSWA 2OZ0A 3IJ6A 2Q8ZA 4UOJA 2Y6ZA 1BG9A 3RFAA 4XD5A 2J77A 3N2XA 2HVOA 4D6FA 3LHWA 3M0XA 4MPKA 4X0NA 4L4LA 3SGZA 4H8UA 1CW2A 2YXGA 2D3NA 2Y8VA 4DY1A 1F8WA 1CNVA 2CYGA 3LBOA 1KCLA 4HMNA 3T8LA 5DY2A 4IJCA 4QG9A 2VEKA 3HGOA 1H1ZA 2QJGA 2REQA 1VP5A 5IHSA 3MSYA 2I5GA 3DHFA 2O92A 2XH0A 3W76A 1HXJA 1XJBA 2NT1A 4DQWA 4TMBA 5T9BG 3WLTA 1WPCA 1NSJA 1L9WA 3WL1A 1N8FA 4PH6A 2QCGA 3OVRA 4E2VA 3GU2A 1EUAA 5LSMA 1EJ7L 3MV01 1JI1A 4QAIA 1ZAHA 1FKWA 3B0UX 3MI2A 3HMJG 3CK5A 2QF7A 1VAHA 1GCYA 3V36A 1DEDA 2ZTJA 2DUZA 2GK1A 5A5WA 4I3GA 2R6OA 2WXDM 1WXJA 5LGXA 3EDJA 4R34A 3TMQA 2JIEA 1X8CA 2E3ZA 3MMDA 3R07C 3BTNA 4S3BA 1R3YA 2F38A 1XIBA 4US5D 3IJIA 1IHIA 4LCRA 4APNA 2WVVA 6TIMA 1HP4A 4XB3A 3O6YX 1R3WA 2FVLA 1VPXA 4CVWA 3M9YA 5AB3A 3RPMA 2GQ8A 4ZXOA 3R8RA 1J8VA 1PWLA 4EPKA 3W71A 5F2GA 1XF0A 2BXZA 2JGYA 4NRRA 4PSPA 4BF5A 2WJFA 3A5VA 3WQGA 3ABOA 4U4MA 1UR9A 4PRRA 1TA3A 5LA2A 3KWXA 3PUOA 5ABGA 4H9YA 1JCXA 3T8QA 1ISXA 2BNJA 1J0YA 3T4WA 4JR5A 1P0EA 3IS4A 1CWYA 3M0HA 4O11A 3DHPA 3W2NA 2YJQA 6ALDA 3HG2A 4UTIA 3BE7A 3QR3A 3KOXA 1JAEA 1YPIA 2FZ8A 1WZMA 1W8SA 1U33A 4QP0A 5JIWA 3NOYA 3HPZA 2VDIA 4N9BA 3WL0A 4OIFA 2NX9A 3NQGA 4KKXA 3TJIA 2CPUA 1GHRA 5FS6A 2ABBA 1KR1A 1ICPA 1S39A 1KFBA 2HBVA 1H3GA 3DG3A 2XGBA 3SZ8A 3EANA 1PIIA 4AHQA 3P3BA 4Q7BA 3LB0A 1MUMA 2L5HA 1T5AA 1RQBA 3TR2A 2IKGA 1QO2A 1P48A 1PE1A 3TSMA 2IUZA 5EY5A 4W7WA 1EB3A 5CGQA 4RXGA 3EYPA 3ZLFA 2DUXA 1VJIA 4WQ6A 4MJZA 4GQRA 4F2TA 2RFGA 3RNDA 3TN6A 3TXZA 2DORA 4NVTA 4HK6A 2XTKA 2WLYA 3FYYA 1QMLA 2E4TA 4HYWA 3TWAA 5FL0A 2POTA 1NTHA 4AZ6A 1MXSA 1S3TC 4HNCA 4H4YA 2AL2B 1S5VA 2WVTA 5E6ZA 3CGBA 2VQTA 3UJ2A 1Y8BA 2ZZCA 5B7YA 3LGGA 1LOSA 5A6LA 4HA3A 3OLEA 1K6WA 3OZPA 3G1RA 2RJHA 3A22A 3PTMA 2V3DA 3WNMA 2ZYFA 1NWRA 2ZRUA 1LF1A 3W7RA 1OIFA 2VQUA 3EAOA 4ZOBA 1V3MA 3TYBA 3ES8A 1TG7A 3VUSA 2C0HA 1JCMP 1OSEA 3GTNA 3KRUA 2QCMA 1RPKA 5T91A 1GVIA 3F5KA 3BAJA 3N14A 1R86A 3WF1A 1XPGA 3SUUA 1Y5WA 3VKKA 2VFEA 1KRMA 4DYJA 4HOXA 4YVPA 3MU7A 4DJFC 1BEUA 3W7JA 4QRNA 2HMCA 5E1QA 3ARQA 1J0IA 3PJUA 1WAWA 3KL0A 1FHLA 5DRIA 2J8TA 3WJXA 4GQ0A 2GSEA 3GNDA 5U4NA 4K7ZA 3UP8A 5AC7A 4WKFA 2G3JA 1JUKA 2C13A 4DNMA 4MG4A 1HJWA 3FHAA 3VOGA 4ONVA 3GH7A 5A6MA 3ZO9A 1AW2A 3C52A 4F3HA 3PZNA 3AI0A 4XZBA 1OGSA 2IKJA 4QE5A 2E09A 5JRBA 1VD6A 1E9IA 4HT3A 4ZOAA 3LTYA 1LRNA 3W2JA 3U8GA 2RDTA 5IM51 3GWQA 1I1XA 2PODA 3EWXA 4GI4A 4N2YA 4DO4A 4X63A 4V1YA 3TQVA 3W7PA 1QHPA 2OVLA 2QMJA 1B3YA 2VZVA 1M53A 4GQQA 2ACRA 3RUBL 3N04A 4MM1A 1IZCA 1K9TA 2DGAA 2YCLA 2R1MA 2PDPA 3U9IA 3WNNA 1MXDA 1VPQA 4S3AA 2ZX7A 2CZEA 4TV6A 1WOBA 3LMZA 1LG2A 3GNPA 4D6CA 1NQKA 3TA6A 4B5SA 1E6SM 2HVNA 3L9CA 2W9MA 3TNBA 4HJFA 5BU6A 1JRPA 3N2BA 4HMCA 1KC7A 5I02A 4H7VA 3KW3A 3DFHA 4LS1A 3BCDA 1GVRA 3LV5A 1C7SA 3CASA 3FG2P 1EHAA 2ALDA 1OBAA 3QFBA 4PB4A 2EPMX 3B8UA 4GJ1A 1K9FA 1RP8A 2Y8UA 4U3AA 2WZIA 2XVNA 3MI3A 2E5AA 3L5MA 3AXXA 1PZ2A 5AHFA 4O15A 2WSQA 3NGJA 4H9XA 2HK1A 3GO2A 5I3DA 1CBGA 1ZAJA 5FJPA 3O0KA 4F8XA 1BYCA 4Y9MA 1NFPA 3GSMA 1V0KA 4ORIA 3VNKA 1EJRC 3EXTA 2ZUWA 4ZOCA 2A3BA 3PPCA 1IEXA 4ZSUA 1XBXA 4I9AA 3OB8A 1DJNA 3S9YA 3R43A 3RM9A 2I57A 1RAKA 2HXTA 3E6EA 1OK6A 1OVDA 3L0GA 1Q6GA 3KE0A 3P6LA 2Y62A 1C8QA 2A3HA 1R85A 4MUPA 4ZOEA 4UTMA 1I0BA 2XJ7A 4C1KA 1W5OA 3TV8A 1A0DA 4OBRA 3VMOA 1JG9A 4PL1A 1CDGA 2DVXA 1XIEA 2VGGA 3WF4A 4UOZA 3WMBA 1UUMA 4K7VA 5LNSA 1S2CA 1MUCA 4W84A 3W83A 2F6UA 4P8WA 4I6VA 3VD3A 4MHBA 1TRIA 2C3DA 1E15A 4HA0A 4ZVJA 3W0KA 1T8XA 2HSAA 2IKIA 5EB8A 4OHQA 2PDKA 4EWND 1RV8A 3HPFA 2BXVA 1HJQA 4DJFA 3C2EA 1TV2A 3Q2DA 1CXKA 4AY8A 2WMIB 4L65A 3U48A 3QOMA 3O6AA 3HOJA 4U3CA 1LWHA 1PKNA 5HK4A 4EMIA 4PBEA 3E2QA 1K02A 3WG6A 1UA7A 1FO4A 2PD5A 3GVQA 3L5LA 3CGEA 2B4GA 2IXUA 5G2HA 5FF2A 2FFIA 4TXEA 3DH9A 3R8HA 5JBFA 3B9JB 4UQCA 1R38A 2UY3A 2VEGA 4C6DA 2J8GA 4IGSA 4O19A 1KR0A 1MW3A 3EWWA 1FCBA 3GYCA 2D22A 1O4UA 3MCOA 3TCEA 1IEQA 3C2FA 2GJLA 1KWGA 1LYXA 1FTXA 4W4QA 3PNUA 1E72M 5M1TA 1HZYA 2PDHA 4N6EA 1L8NA 5LA1A 1M1BA 4LVFA 1D7YA 4OV9A 2OG9A 3ABXA 4GIEA 4JTSA 1FP8A 5E0FA 4E3VA 1TX2A 3BQ5A 1PPIA 2RUSA 1P0BA 5HPCA 1KFWA 1HO1A 3MUAA 3M5ZA 4HU4A 4UMCA 3LM3A 1HNYA 3QTPA 4H4RA 4BS0A 3LADA 2WM0A 5AZ0A 5AFDA 4AVNA 3SEPA 1IGWA 1KB3A 2QAEA 1LWJA 3SCRA 1KO0A 4IGHA 4BCEA 2TAAA 1KFLA 2I1OA 1VHNA 1TPB1 1JPKA 1JOAA 3KUMA 2V2DA 5CXP