1F9CA

Crystal structure of mle d178n variant
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
360
Chain Sequence
SALIERIDAIIVDLPTIQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDALAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQNLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEARLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Buried charged surface in proteins.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE I)
total genus 133
structure length 360
sequence length 370
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1f9cA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1f9cA01
4J3ZA 1E9IA 4MMWA 1MRAA 4YWSA 1ELSA 3CK5A 3ZLGA 3QPEA 4GYPC 4E5TA 3R0UA 3OW1A 4KEMA 4H2HA 3U4FA 3UCDA 3TW9A 4G8TA 4GMEA 4KPLA 3GY1A 3DG6A 4H83A 4GFIA 3BSMA 3PK7A 3VA8A 1WUFA 3DFYA 1PDZA 3GO2A 2HNEA 2MUCA 2GGEA 3H12A 3EEZA 4GGHA 3V3WA 3UXKA 4KWSA 3S5SA 3BJSA 2OQHA 3BOXA 4K2SA 1DTNA 2PU1A 1WUEA 4H1ZA 1JCTA 2GGGA 4E6MA 2QQ6A 3VFCA 1XS2A 3DIPA 1NU5A 3R0KA 3SJNA 2PCEA 3S47A 3OP2A 5IDZA 1OEPA 3K1GA 1SJBA 1W6TA 1EBHA 1BKHA 2I5QA 2PSNA 3IJLA 2XGZA 3Q45A 4JHMA 3SBFA 2QDDA 3UJSA 3N4EA 1MNSA 3SQSA 3DEQA 1L8PA 2OFJA 3PWGA 4A3RA 3MQTA 2P8BA 2PP3A 2OZ8A 3HPFA 4IL2A 3TQPA 4MKSA 3V4BA 2QJNA 1MDRA 3IJQA 2OQYA 1EC7A 4KT2A 1ECQA 2OPJA 3VDGA 3QN3A 5J04A 2PTWA 2PTZA 3FCPA 3OZYA 3TCSA 2NQLA 2ONEA 4FP1A 3CB3A 2XSXA 3FVDA 2GGIA 2AL2B 4K8GA 3SN4A 5BOFA 2FYMA 3DFHA 3N6JA 3JZUA 2QVHA 2HXUA 2RDXA 1JDFA 1KKOA 2GGHA 4ROPA 4GIRA 3UCCA 3ENLA 2XH7A 4IP5A 3UJEA 3DG7A 3OTRA 3IK4A 3ES8A 1FHVA 3MKCA 5ENLA 3EKGA 2PP0A 1JPDX 3RO6A 3N4FA 3RGTA 3I4KA 2P0IA 2GSHA 3DERA 3TWBA 3T9PA 3OZMA 2OG9A 4GISA 4DX3A 2PPGA 3KUMA 3OPSA 4IHCA 2PODA 2OLAA 3H8AA 3TJIA 2QJJA 3V5FA 7ENLA 1TZZA 3DG3A 3N6HA 3T4WA 3GD6A 3FV9A 2AL2A 5FJRA 3MSYA 4HCDA 3DDMA 2OVLA 3RCYA 4M6UA 3JW7A 3P0WA 3P93A 4Z1YA 3FJ4A 1SJCA 5BOEA 2ZC8A 3QTPA 2OKTA 4IT1A 1FHUA 3MWCA 3IJIA 2FKPA 3CXOA 4Z17A 2AKMA 1R0MA 2MNRA 1SJAA 3FXGA 1EC8A 4X2PA 4DN1A 2PMQA 4ZCWA 3DESA 1MUCA 1EBGA 1JPMA 3GC2A 2PGEA 4DHGA 3MUCA 2PP1A 3T8QA 2OX4A 3NZGA 3V5CA 6ENLA 1ONEA 4HPNA 3UJRA 3UGVA 3MZNA 2QDEA 1P48A 2POZA 3R10A 3TTEA 3R1ZA 3ZLFA 1SJDA 2P88A 3H7VA 1MDLA 2PA6A 4G7FA 3VC5A 3RITA 3PFRA 4IP4A 3D46A 3UXLA 1F9CA 1P43A 4M0XA 5FJPA 3TOYA 4H19A 2CHRA 3THUA 3ZVHB 2OZ3A 2OO6A 2XH2A 3VC6A 4F4RA 2HZGA 2OZTA 3U9IA 3SSZA 4JN7A 4FI4A 3CAWA 3QKEA 3RRAA 1XPYA 3QLDA 4K1WA 3T6CA 1BQGA 3VCNA 3JVAA 3NO1A 4HNLA 3SN0A 1KD0A 4GYPA 3P3BA 3I6TA 2O56A 4IL0A 4MGGA 3ZVIA 4HCHA 3DGBA 3I6EA 4E4FA 5FJOA 2PTYA 3FYYA 4IZGA 1R6WA 4A6GA 1NELA 2PGWA 3VCCA 3PWIA 4HYRA 5FJUA 2PTXA 2P3ZA 4HCLA 3R25A 2AL1A 2DW6A 3UJ2A 3CT2A 3R11A 3Q4DA 2HXTA 3UJFA 4ENLA 1PDYA 3RR1A 2XH4A 4HNCA 1IYXA 4ZA0A 4DYEA 2PU0A 3TJ4A 4A35A 4JN8A 4HN8A 4GGBA 3D47A 3ES7A 3NXLA 4DWDA 2QJMA 3NFUA 4E4UA 3ZVHA 2QGYA 3MY9A 2ZADA 1YEYA 2P8CA 2DW7A 2XH0A 4J1OA 1KKRA 1EC9A 3H70A 3TWAA 2GL5A 2GGJA 1KCZA 4E8GA 5EU9A 5FJTA 1TKKA 3SN1A 1TE6A 4DXKA 4EWJA 2AKZA 2GDQA 2PS2A 3STPA 3ZLHA 3CYJA 1RVKA 3B97A
chains in the Genus database with same CATH superfamily
4BI6A 2VGFA 2ISSA 1MRAA 1ICPA 1KRCC 4K38A 2PDIA 3B03A 4EP8C 4DO5A 3V0TA 2BDQA 1UPMB 3TYZA 5JXQA 2Y62A 4Y8FA 4AIEA 3KWXA 4GO8A 3C3NA 3TZFA 4LPCA 3OW1A 3UZZA 3PBMA 3ANYA 3L4TA 3G1HA 1AQ0A 4H50A 3UCDA 4LAKA 2VEFA 1MQPA 1AZ1A 1CGVA 1TELA 3CV1A 1REQA 1DIDA 3KBVA 4LAMA 2F5ZA 2R1NA 1GHSA 4AD3A 4IQLA 3ZXWA 4JFWA 4W87A 3EEZA 5T9CE 4MUPA 2XVNA 5DRCA 4MZYA 2H8ZA 1TRDA 4YU1A 3VX0A 1V7YA 1X6LA 3GVGA 1X97A 5EMKA 3OVQA 5LNRA 5ABFA 3GZ3A 4JPGA 2DH3A 4WSJA 4AC7C 4ZXLA 3DUGA 4E3TA 4PMVA 1N2VA 3TR9A 3G1RA 2R8WA 5DLCA 4RL3A 3HGJA 3CGEA 1EFZA 3S1XA 3GDMA 3GM8A 3HG2A 4L64A 3NQ7A 2CDUA 1AD1A 3KVKA 2E3ZA 3RU6A 2EQDA 2HVNA 4IGNA 3MVIA 3I3EA 1TA3A 1OFDA 2GOKA 4MNLA 3SQSA 1VYRA 2RFGA 3DEQA 4JZ5A 3ITLA 1QBBA 1POKA 2YPIA 3H4XA 3ZR6A 3DGZA 3CZKA 4X22A 3H53A 4MDPA 4Q4PA 4W8LA 2YW3A 2PDWA 2HQMA 1FWEC 4IOTA 3QY7A 2WM0A 2QR6A 4O16A 4JDBA 4CU7A 4LVDA 3P0XA 3LGGA 2W5FA 1W9VA 3EA2A 3URQA 3OZPA 4K8HA 5I3IA 2PDNA 3B8SA 1F3EA 5AY7A 3SY8A 4FP1A 2EJAA 4A8RA 5BU6A 4AU0A 3C56A 2DJLA 5GJMA 1OQFA 2VZVA 1W1ZA 5HXMA 3ME3A 2NW0A 4CQDA 2HXUA 3W2NA 3L4VA 4GLEA 4NNCA 1PCKA 1NFGA 1OFAA 4IMCA 3TLQA 3AXXA 3TU9A 3QZAA 1FRBA 1YHTA 3SUUA 3VINA 3OTRA 1KCXA 4OBTA 2C8NA 3R5EA 1FHVA 3TNOA 4MWAA 5I5RA 3V35A 4I5RA 4H9YA 4CKQA 2DT3A 3FYPA 2VVNA 3N4FA 2GSHA 2QCDB 1SFSA 4L1GA 2W3ZA 4AY1A 2VFEA 3K8LA 3B04A 4ZODA 5H6HA 3UVAA 4PB5A 2EF9A 5JQ9A 7ENLA 4MWAD 4OKDA 3MUAA 4ZENA 4J2PA 1ZUAX 5LIKX 3T55A 3TW7A 3QLLA 3TSDA 3EOOA 4DWSA 5DMMA 4J3XA 4AIOA 3R94A 1JZ3A 3S46A 4JTHA 1ITQA 1FOBA 3APGA 4PMJA 4HB7A 2WHLA 3V7PA 1GVYA 1EJ7L 5CH9A 4KWWA 1XLBA 1GESA 4QIUA 5HULA 3M0ZA 1VDVA 3NPXA 3MA8A 4TU1A 5I0DA 3B3DA 5GJNA 1IEIA 4B5TA 3NWRA 4WDUA 3OQEA 3PPFA 1L6GA 1G94A 4DZAA 1OJXA 1H0GA 4INFA 1VPXA 4FSAA 5CGMA 4KERA 3E3HA 1UBPC 3WH6A 3Q58A 2C71A 3A12A 2BXZA 4H6RA 3TTEA 4C6FA 2OEMA 1XIGA 3ZLFA 1FQ0A 5DXXA 3RMEA 4YTQA 2P88A 5HR7A 2YAUA 1SW7A 3VE7A 4G7FA 1Q8AA 3R79A 2YCLB 1DJYA 2PWUA 1PTAA 3CV6A 5HR6A 4H8UA 1R8LA 2JKPA 4PFMA 3EPNA 2IW0A 3GRSA 3PBGA 4Y90A 2AAAA 4L4MA 3THUA 1UCWA 3ZR5A 4DUOA 2OO6A 4QCFA 4RLIA 1OC7A 2IQ0A 3VVGA 2GQ8A 4HK7A 4Q8VA 3SSZA 3KP1A 2Y6ZA 2ZWYA 2X7WA 5AB3A 3PAJA 1V3IA 5D9NA 3P61A 4L4LA 1V0MA 4P8VA 2OODA 3L65A 1FEAA 3AJ7A 2B7PA 3LCFA 4U2YA 4N9DA 5CZTA 5E9XA 1ZCCA 1CGTA 2YZRA 3TEVA 1KM2A 4FNSA 1ME8A 1MW0A 4GVFA 3EOSA 4NQ1A 2V5DA 1GEQA 1NFPA 3MU7A 4IG2B 3WQCA 3WLLA 1GJUA 4CD4A 3I65A 3W38A 1RQEA 3WJXA 1I45A 1QDSA 2NWSA 4F9DA 1J93A 5DEZA 1W1YA 3KRBA 4D6EA 2QT3A 4IF2A 5D4YA 3GWQA 4PCTA 2HXTA 4UNIA 4B16A 4HA0A 2OYLA 5C2CA 5EMMA 4HNCA 2YR1A 2PU0A 1KXHA 4GFSA 3BLFA 3S42A 2ZDSA 4LANA 1HKKA 2NLIA 3B8WA 4XVEA 3NFUA 4JL2A 4K8DA 1QI2A 1CCWB 5KTLA 4LAOA 2CFFA 3W7HA 1TO3A 5JRBA 4GIYA 3NZRA 4G9PA 3CWNA 1W31A 3TSBA 4J1OA 1EC9A 4Z1DA 5FEWA 3CHFA 1TE1A 3H7RA 1Q6QA 3LCWA 3UG5A 4XAFA 5U1OA 4UTWA 1F3TA 1HJVA 3EB3A 1TKKA 4B3KA 1EIXA 5JBFA 1TPFA 3W28A 1OCBA 2ZXBA 1TFVA 3TTYA 3BPWA 3LBCA 4NYUA 4YN5A 2Z2AA 3VM5A 4LT9A 3WNMA 4CEUC 4DAIA 4MLJA 3H2FA 2CWXA 4P7LA 2QV4A 3RN6A 5C70A 2AOSA 2FGLA 4JXCA 3W1PA 3P6LA 2Y7GA 4M7TA 4H8VA 4J9JA 4HU3A 3EPMA 4Y9AA 5BXPA 4ZOAA 3MO7A 3N2XA 2WZEA 4KCVA 4W93A 1L9WA 3GO2A 2A3HA 2J7CA 2GGEA 2YIHA 4HOZA 3GW0A 4XISA 4TX9A 4EM4A 1HX0A 3ZJ6A 4UNLA 1VLWA 5AHEA 1MEWA 2V67A 4XZBA 1UWTA 4AHQA 3PJXA 4GH3A 1D3CA 4OWGA 2FPYA 1GVEA 2G96A 2VM8A 1A3HA 1GQKA 1EUNA 5KEZA 4G1NA 1M1BA 2UBPC 3O2LA 2Z1BA 3PUEA 4MVAA 3W53A 4Q3MA 5A8GA 3R13A 1HXJA 3WLSA 5C8BB 1G7VA 2PRMA 2DT1A 3NPUA 1VIWA 2FDSA 3QGVA 3VX1A 2WMIB 6REQB 1B90A 3TVAA 1VS1A 1GJPA 4O28A 3TUUA 2FZ9A 4LA1A 3EXRA 3KCOA 3TKFA 3QEZA 3WQOA 3F4NA 1F74A 4XAZA 3IJLA 1W37A 5CC7A 2JIWA 4RNFA 2EPLX 2BG5A 3VOCA 3XISA 3N4EA 3G77A 3NVWB 4R3UA 1TG7A 4R53A 1UYQA 1XIMA 3W7RA 1WZKA 4M8UA 2PDBA 3PBVA 3M4HA 3WLOA 2X8CA 4IL2A 3SECA 1UP2A 2ZWZA 3MSDA 3QH2A 1Y0EA 4ZQCA 1HGYA 4KT2A 5CPMA 3WQ5A 1ECQA 3DHPA 2XYLA 4YVPA 3EWUA 3W25A 3QY8A 3G0XA 5FESA 4M51A 3NZ1A 1K03A 4H2CA 3SGGA 3IUHA 3DFSA 2V68A 3M5ZA 4DI9A 2XSXA 4APNA 4YHEA 1H61A 2GGIA 4XZNX 3AHZA 3MHGA 2AQVA 2ZCGA 3MUY1 5H1WA 7A3HA 1M7OA 4LAZA 2FFIA 4MKNA 1O60A 2OB3A 3RK8A 5T26A 3W07A 1Z32X 1KKOA 4LUSA 1J79A 3ENLA 5F4XA 3V0UA 5CPTA 4YS1A 4DPPA 1ISVA 3UWWA 4K39A 3TYDA 2WV8A 1KFBA 1O6IA 3W00A 1QW9A 2V3DA 3WQ6A 1GK8A 1JPDX 2UY5A 3RGTA 1QHPA 3DERA 2OSWA 2CBIA 3WLKX 2WOWA 2JF6A 5DX7A 5XINA 3A4JA 1DIKA 5IRPA 1VP5A 1LWJA 4MFEA 4J3VA 1UPPA 1OX4A 1UWIA 3DK8A 2YCKX 1JDCA 2WWCA 1TZZA 3DG3A 2F8QA 1VFHA 4Q7NA 5AYYA 5A6SA 2A7NA 4D6JA 1K77A 1PL9A 3AMDA 2BOEX 3DK4A 3DDMA 1GG0A 2Q02A 5XIMA 2GYIA 5AKQA 2QXWA 5BMWA 2E68A 1O68A 4A3YA 3L4XA 4WUIA 4HZ8A 1IT0A 1WDWA 4IQJA 2AGKA 2WSQA 4GQRA 3GQYA 1P0KA 4PUDA 5BW6A 3CXOA 3RG6A 4MAZA 2O9RA 3N9KA 2X0YA 5E93A 1B2YA 3QMRA 4X0VA 4FIRA 3W72A 4BF9A 2PGEA 2J7DA 4W86A 3C3UA 3UPMA 1I2NA 1UHVA 4DO7A 2WB5A 5IBXA 4I6KA 3GDTA 2NSOA 1T41A 4YTRA 5HNRA 2WW5A 4LB3A 1LBFA 2POZA 2QCMA 3S9YA 3FFSA 1VCVA 2WZTA 1SJDA 1CGXA 4P5UA 4UR8A 1PVNA 1E1EA 4A21A 4CD5A 3M47A 4IPPA 1VJIA 4H9ZA 3H21A 4GK8A 3T4CA 3UXLA 5G5IA 4ATDA 5FJJA 2R24A 2OZ3A 4H8NA 4FX7A 1KRMA 3TN6A 3B40A 1TX0A 1PYMA 2GWGA 4RE2A 5CSRA 3A9IA 3V1PA 5AZ0A 3AIQA 3NCOA 2PDKA 1NDYA 2Z00A 1F4HA 4PRTA 2GDUA 4H7ZA 4S3FA 3WUEA 2NQZA 3DENA 2KX9A 3AUOA 4Y8EA 3TJXA 4DJFC 1W1IE 2O56A 1GZJA 1TWIA 3NYDA 1VAHA 3W1TA 1O5KA 1J10A 4UOZA 1PIIA 3THAA 3PB0A 1UR0A 1NAL1 2GQ9A 4QJ3B 4H4RA 2D2JA 3EF6A 1LBLA 1GOWA 1WX0A 3EWBX 3NSMA 1MZHA 1LT8A 5I23A 2EHHA 2POTA 3NDOA 1R86A 1QW8A 2BLEA 3H6OA 1RQHA 2FJUB 3M41A 4EMJA 1UROA 3A4WA 1PSCA 2Q6ZA 4R7WA 1FXPA 4ZA0A 2OEJA 1Y7VA 4ERGA 4JN8A 3N19B 1CX9A 4WGHA 2J8TA 3WL1A 3LBMA 1UD2A 2Y2WA 1HNYA 3G3DA 2VC5A 4NNBA 1WKEA 2GJLA 2W61A 2QYGA 1MXGA 2CYGA 4JY8A 2EQ9A 2ZX6A 1GXFA 4IXXA 4M6PA 1PX4A 1I60A 5I7GA 2QGHA 1ZBCA 2NT0A 4R88A 1FKXA 4C6PA 5G5GB 4PULA 1LCOA 4ADUA 1M9HA 3NGFA 1SO5A 1A47A 1TE6A 3O7UA 3KM8A 4FXSA 3N13A 3RPMA 3GH4A 3TN4A 1EX5A 4PA8A 4H4XA 3W2LA 3DECA 1M6IA 4D6GA 4ZE5A 1ZQ5A 4LV9A 3WQGA 3TQKA 4Q8QA 5I3DA 1OC5A 4FIQA 4CCDA 3ANVA 5EKYA 1QI0A 2H9AA 3WUGA 2J7HA 1MEIA 4EX4A 2X42A 4C6EA 1D2KA 4KPLA 4RUBA 1C8XA 1W9DM 1OIMA 2Z0IA 4GFIA 2VRKA 1Q6FA 1NWSA 4UFMA 2HNEA 3EANA 1FWBC 3AS1A 4AIUA 4JQ2A 2G95A 1CLXA 1W3NA 3OJGA 3PZUA 4AZCA 1AQMA 3THDA 1GREA 4KWSA 5AYBA 2EPMX 3CH9A 4K7ZA 5BMXA 1QPRA 2QKFA 1R3YA 2QIWA 3P67A 4DQWA 1GQIA 2ESCA 2WK2A 3G5EA 1SYTA 2Y7EA 4ES4A 4FB7A 3NQ8A 3VFCA 2QUMA 8XIMA 3W0KA 1FUYA 5LIYX 3M5XA 3NDZA 5IDZA 1OEPA 1DXIA 5FOOA 3CIXA 3IGSA 3WUBA 4AZCB 1Q63A 3TZNA 3IIXA 4JHMA 4CD6A 2CW6A 3EDDA 4IPLA 2GR2A 3RPDA 4RZ6A 2WPGA 4U28A 4I9TA 4S3DA 1E9ZB 2YVJA 3T09A 2ZUMA 4UTMA 3WO8A 3O16A 4PMYA 1AL7A 3KOXA 4WY0F 1RXOB 4JTTA 1RJRA 2NXGA 2J79A 4F2UA 3E6EA 4HJWA 7TIMA 4FF5A 3ZT5A 4I3GA 4LC6A 1TPDA 2JK2A 2ONEA 4B5VA 1OGBA 3AMKA 2VZSA 1UASA 3AALA 4YYCA 5A8MA 3DYPA 2PDUA 3DAQA 2YLAA 1ESWA 3N6JA 4FZIA 1L8NA 3HIJA 3A7AA 3HRDC 5BWFA 2R6OA 1TJPA 1E1CB 1BVNP 1OX4B 2HWGA 4ATLA 3EEGA 1UOZA 5XIAA 1L6SA 4HMEA 1E9YB 2VX7A 2GLKA 4OECA 3WQ8A 3WH7A 1T6MA 3OU8A 2ZX5A 4LUTB 3C0QA 3II1A 1AH4A 2VQTA 3TOPA 3RO6A 3AUJA 4D6DA 3I4KA 3SCTA 1V02A 2INEA 1HJSA 1W5MA 3PN8A 2CETA 3GDBA 1XYMA 3PJTA 3T78A 4LUSB 3NQEA 3SFWA 2WLZA 3EX1A 3AC0A 2P50A 2NX9A 3N18A 3E5BA 2XWDA 3GD6A 1G9HA 1DXFA 4AVFA 2IPWA 3FS2A 1V0NA 4NXSA 1S7MA 3O0HA 2C15A 4V27A 1Q2SA 1UJQA 1KLZA 4KGJA 3DGHA 2PDJA 2PWVA 3CL6A 3LI1A 4LTSA 3GU2A 3EDKA 5KZ6A 3S5NA 3I6RA 2WPCA 6TIMA 4Z17A 2QVNA 2WANA 1Q85A 4PMDA 3QV7A 3A24A 5AYXA 1N62C 4WDWA 1HL8A 1JCYA 1NPXA 1LDCA 3TW6A 2ZA1A 5ABEA 1J0ZA 4GD0A 1TJ0A 4C5ZA 1EP3A 1E43A 4Z2JA 1MEHA 3URNA 4Q8PA 3RM8A 1IV8A 4O1DA 1XBVA 1FBAA 4HA1A 1PPIA 3PZMA 5FD0A 3CH0A 2F61A 3KOZA 2NVAA 4OBRA 1DYSA 3TDFA 2WKJA 1W9XA 5ECUA 3LSCA 4NZ1A 3H23A 3O9NA 4HP5A 1ADOA 1R7AA 2EPKX 3TOYA 1E6XM 4ZMGA 1UIOA 2X0HA 1UR3M 4US5A 4JX6A 1DWGM 2CLOA 3AYTA 3UW6A 4G6CA 2W91A 2XDFA 4F2TA 2AAQA 3DOPA 2GQWA 2PF0A 1A5AA 1VEMA 3RRAA 4UTFA 4OT7A 3C2FA 1PHQA 3VDBA 4KEZA 1Y5WA 4HJFA 5FF2A 4QDWA 2XZ7A 2CERA 4WF7A 4MGGA 2Q09A 5LYRA 2R1KA 3STGA 3VGFA 3ZJ7A 4X3ZA 4NZ5A 4C6MA 1PXGA 2RJGA 2C19A 4AG0A 1CLKA 3M0VA 3QR0A 1KFWA 3GTHA 4B91A 3VDCA 1ZP4A 3CT2A 3G18A 3BMVA 2Z6JA 3KHJA 2FQIA 4HU0A 1QVBA 2YL8A 4O0QA 4ONVA 4WK9A 2CZEA 2BHYA 3NXLA 1SO4A 4S3KA 3ZWTA 1ZFJA 3MV11 2YBTA 4A8IA 3V36A 2C6QA 3K8MA 2QV5A 2QCGA 4RZ5A 3E0IA 1YEYA 3LPGA 9XIMA 5TNVA 3SIZA 1UKTA 3T42A 3RX4A 3KX6A 5HBFA 1EB3A 2P1FA 1B3WA 3BV4A 3GC5A 2YDAA 4ACYA 3ABXA 2HPMA 4BURA 1E1CA 4PRWA 3ZLHA 2WHJA 1LPFA 4GX9A 2PLMA 1EF3A 5G4WA 4QS5A 2DIJA 3OVGA 1TWZA 5LIXX 1E6RA 4KIEA 2V2CA 5DO8A 4GYPC 2ZXAA 2EKGA 2DQWA 4AXNA 3UG3A 4EOUA 4O52A 3SCRA 4C6DA 4I7UA 2WP5A 1AMYA 2CCRA 5KSWA 1RVGA 5I78A 4X9SA 1EWDA 3ID7A 3W7KA 1S2VA 3VA8A 4HSOA 4BJHA 3A4AA 4NJJA 3PZ9A 1IEWA 1VBJA 1J8VA 2WBKA 1O5XA 4H7VA 5F2IA 4MZ8A 1RLDA 4RZBA 2D22A 2ZC1A 5HATA 3GS6A 1XM3A 3MW7A 4EXBA 1QI5A 2LLEA 3BOXA 4I7VA 3LPFA 1XCFA 3ALFA 5IOBA 1JCTA 4XWUA 4H8HA 1OD0A 3M0JA 2WJEA 1AH3A 3EX3A 1YRRA 2DH2A 4NNAA 1NF0A 3DC8A 3UESA 2WM1A 1UD4A 3DN5A 2J47A 1X1NA 4IPIA 1O94A 4UCFA 1H3GA 3WH9A 1JEZA 4O8RA 4GI8A 1IXOA 4OU1A 2VO5A 3RCNA 5G2IA 3HPSA 4S3BA 1QI3A 3VOHA 1FKWA 5CBJA 3SURA 1Q6RA 2Z26A 4A29A 3L7RA 3AU6A 1Z69A 3FK4A 4UWMA 4JTEA 4ECLA 3CWOX 3CV2A 1S5MA 4JYDA 5HWMA 3BAKA 4QBXA 4WSHA 5E70A 5AFDA 1JVNA 3G1FA 2GR1A 1H60A 4GZIA 3OZYA 1L6FA 4HPHA 4IJBA 1EUAA 3AQUA 3UPBA 1SMDA 1U83A 4JTRA 6CGTA 3C2VA 2OJPA 1V93A 1GTEA 4D1IA 4YPJA 1H1YA 2C0AA 4ZB0A 4DJDA 2P3EA 1LM1A 1V6UA 2YVFA 1ADDA 1JGIA 1TV3A 5BROA 1IZKA 4I8YA 1D7KA 1UR4A 4L6HA 1JCXA 4WQ6A 3C52A 5FSEC 3LGDA 2Y85A 4MWAB 4JTDA 3AS3A 1C7TA 2WVVA 3CV7A 2VEPA 2VT0A 4C90A 4DX3A 1AG1O 3MVTA 4XZLX 4JGDA 3CL8A 3FA5A 4IHCA 2PODA 2CHOA 3TJIA 1JQVA 4PYSA 4PMOA 3N6HA 3E5PA 4RX0A 4PEKA 4URIA 3M44A 2ZZ2A 4M6UA 3JW7A 3P0WA 4GYKA 3W37A 4NZ4A 3AAMA 3VZYA 5CJMA 3W02A 1QK2A 1UMLA 4IPJA 2A5HA 1FCBA 1O66A 4IT1A 2CESA 1UR2A 1X2GA 1I0DA 2A1YA 3WF4A 3KOFA 1R0MA 1RA0A 2XUCA 1J9YA 4GIAA 1KV8A 4G2DA 2CC0A 3U2ZA 2W3RA 3EXTA 2ZQ0A 4ZOHB 3AZTA 1GRGA 1FWHC 1WDSA 3VKCA 4O54A 1SGJA 1JCNA 4ORMA 3KL3A 3OA5A 2XIMA 1Z89A 3UJRA 2WZMA 1PS9A 2UWFA 3P82A 4P7NA 2FZBA 3OGSA 3AN1A 3KOWA 3IAPA 4JDRA 1A50A 1ONXA 4HHHA 1XIHA 3N29A 4ZB5A 3LTYA 1ZJBA 1E0TA 3S8HA 4JNZA 3F5LA 1WNOA 4UTHA 3A64A 3S2CA 2X1UA 3D46A 1PV8A 4EQXA 3WJYA 4K7YA 1GWJA 4RXGA 4XV0A 1NDVA 3HV9A 4ZTYA 2HZGA 2NZLA 5KZDA 5BRBA 2FVKA 4DEFA 3RXZA 3BAJA 1B0IA 3F2CA 1OABA 4C6QA 3QKEA 2V63A 3WK0A 1ZRQA 3E49A 1TPVA 1FA2A 1VEPA 3T6CA 5DBTA 2E67A 3SY1A 4FNTA 4MJ2A 3T08A 1W0MA 4RJEA 1TMHA 3A5VA 3U5UA 1UR1A 5B7YA 2J74A 3PBWA 2DSKA 1UZ1A 3NQGA 3LM3A 3LTSA 4U3CA 1F8IA 1RP9A 1M03A 3MUXA 1BVWA 3OGVA 1S2AA 1ADSA 3VM7A 3WD3A 1QNRA 4L6DA 5H8UA 1BYDA 3I6EA 3IJ7A 3HJEA 4V1XA 2G37A 1M7PA 3E0LA 1RBAA 1U2YA 2XM2A 2J78A 4O13A 4L4PA 2ISFA 1XDMA 2V69A 3H24A 3BXWA 3FOKA 3RR1A 2XH4A 2QMJA 6A3HA 3NVYB 2WWDA 3TJ4A 1Z7AA 1KCKA 4GGBA 3S0CA 1HN1A 1W5QA 3WLHA 2YA0A 2CEQA 1CXFA 2VWTA 1H6VA 3RNDA 2CFYA 3ZVHA 3GAYA 2W92A 4MYAA 2GZXA 1V03A 3EBVA 4HMNA 3PZOA 1QW7A 1A5BA 4HK5A 4BHYA 1C92A 2DIKA 3L2LA 1WQ5A 2Y7DA 4RE4A 3OHIA 4AYSA 4S3EA 1W32A 3BOFA 5HA7A 4M52A 5ER0A 4TVYA 3WQEA 2WNWA 3R12A 1B57A 1XLLA 2DZVA 1HW6A 2D23A 3W7GA 3NVZB 1FIQB 3WLPA 3L0GA 3GKFA 1KQYA 4ZO8A 3R8RA 3WD1A 4ADSA 4EF9A 3EGJA 1UWSA 1QNSA 2OT1A 3HPXA 1Q6GA 4B4HA 1R9YA 1PZ0A 1YYAA 3CWHA 3JS3A 3WNLA 3MYOA 3APTA 2ZKMX 4M6VA 4AIBA 3N15A 3N12A 3L5AA 4GVIA 4IX2A 4LVFA 1FWGC 5M2FX 3ZT6A 1VF8A 1TJ1A 3NIYA 5A6JA 3ARXA 2PFHA 1QPQA 4GNJA 1B3OA 3KL5A 2NT1A 3QMTA 3CZ8A 3MJYA 1LORA 5HJLA 2ABAA 2YDSA 3VIMA 1AVAA 1WUEA 2ZA2A 2FTWA 1C3FA 2XZ9A 4H1ZA 3A3WA 2IKJA 3IARA 3WD4A 1WAUA 3WMSA 3NL3A 4EAMA 1W9BM 4PMNA 2QCHA 5HMSA 3GZAA 4QG9A 1XS2A 2GUBA 5JIPA 3AMCA 4IM4A 4WKAA 3S47A 2RDWA 2YLLA 3W2MA 1K8CA 1HTIA 3SUWA 5HDRA 2ALRA 1EA9C 2A3CA 3MI3A 3GRTA 1AJ0A 4EPEC 1OINA 2YA2A 3WLNA 1SSGA 3WF2A 1E5NA 2CBUA 3W71A 3ZSTA 3PNZA 3W1NA 5JBEA 3MQTA 4O53A 3CO4A 5FAJA 4ZQNA 1MUWA 4TTUA 4NI8A 2CLMA 3WL0A 4PRRA 4NJHA 4L4OA 1V3LA 2I57A 1LLOA 2E9BA 3IVUA 5HQMA 3NO3A 1K7EA 2RKXA 4IMFA 1DJIA 3LHZA 4HK6A 4MADA 3CGTA 1BKSA 3SQMA 2ZZ5A 2QS8A 1E5JA 3IJ6A 1NOWA 3SN4A 1Z41A 3F2BA 4ERAA 1PWMA 4Y7EA 3WBEA 3TJLA 5I79A 1WKYA 2QVHA 3GXMA 1PE1A 4NT0A 1FH8A 1VCFA 1W1PA 1TIMA 3P8IA 1OF6A 4HNUA 1HUVA 4FXRA 1AZ2A 1TX2A 1YNQA 2A7PA 3DG7A 4DJDD 3GTXA 5HPCA 4QITA 1CLVA 1XLAA 2OMAA 4CNSA 4E3VA 3LM7A 3CUJA 5DN1A 2BY0A 4JX5A 4OE7A 3GG1A 1E4LA 3T0BA 3HMJG 3TWBA 3DKJA 1PKMA 3ANUA 4R9OA 2OG9A 1V6VA 4GPNA 1R3WA 4HPXA 1XSJA 3EA3A 1BTCA 3UR2A 3B06A 1TV2A 1UKPA 3IANA 1TTIA 1WV2A 4JQ1A 2BMBA 4W8BA 2QUTA 2JQXA 3AISA 1FY6A 1S5WA 4S3JA 3L8KA 1JCJA 1TJRA 1ONRA 2RUSA 1ZMCA 3VIHA 3UZYA 1B3XA 1TPWA 3LCLA 1JYNA 1IWAA 2Y63A 4Z1AA 3SR7A 2QAEA 2I7GA 1TV4A 4RNHA 2JIEA 1TPH1 1XXXA 3WJSA 1H1ZA 2ZC8A 4WD0A 3TK7A 1PX3A 1K4QA 2C7FA 2QEZA 3WQ4A 1Q1RA 1XSIA 3LDVA 1WBHA 4DN1A 2R82A 5REQA 3Q65A 2PMQA 3I3BA 5A94A 1SR0A 3SRKA 4WKHA 4W5UA 4WEVX 3BSGA 4DHGA 2V3BA 4D6IA 3P74A 3REQB 3SRFA 2ZICA 2WNZA 3T8QA 3GE7A 1YXYA 4MJMA 4HYWA 1QNVA 1RH9A 3WDRA 1O1ZA 3LLFA 1FP9A 3EAOA 3R10A 4CVUA 2FZNA 5CSYA 1R87A 2E8ZA 3K5XA 1DXEA 3NTYA 1XGEA 2VCBA 4TOQA 1ZS2A 2REQB 4W7UA 1UWRA 3EDEA 5FS7A 1L0PA 4S3GA 3CU2A 1HIZA 3I4EA 3UT0A 2NX3A 2G3JA 3BAIA 4LVAA 3U9IA 1ZK7A 5C9WA 2ZRZA 1Z8AA 1Q7ZA 2VEGA 3HO8A 4KRZA 4DBUA 3DBPA 4EKJA 1GRBA 1KGXA 3D5HA 4AEOA 3LHWA 4HNLA 2GVLA 4GZEA 3CAQA 2BY2A 2NVCA 1X7IA 3NPVA 1SZEA 1VFMA 3WQFA 2NPXA 3WBXA 3E74A 2QPUA 1SVDA 5A6TC 3W7PA 1TRIA 4HYVA 2G4JA 1WZLA 3VZXA 2PTYA 1GSNA 3SUVA 3TYUA 3IWPA 4IFOA 4A6GA 2XJ7A 5CC6A 3F4CA 5FJUA 1ZY9A 1KV5A 2XIIA 3LU2A 2P3ZA 3CUGA 3THQA 5BWAA 3C86A 1GW1A 4J3TA 1JUEA 2E1DA 2G41A 2YFOA 4P8XA 2DZXA 3HURA 1EHNA 1HO4A 4IIFA 1A5LC 4PTWA 3SZ8A 3A5FA 1KFCA 2XSBA 2BBFA 3M0HA 3HPZA 5EY5A 1F3PA 4M81A 5FL1A 4Q8WA 2DSWA 3EXSA 3W70A 4GXMA 4F3HA 2X1RA 2YX0A 5F7UA 2IKIA 5C0QA 1YLVA 4UTJA 3U2OA 3H70A 3TWAA 4N4PA 1X6UA 3DGRA 3S5ZA 4F0KA 2BV9A 2OWCA 2A3EA 4YTUA 2CLIA 4C7FA 4IISA 2J77A 2QJIA 1SM9A 3MBDA 1NWTA 5F1VA 1XYLA 5TF0A 1YPXA 2JEQA 1CGWA 1K02A 3KTSA 4FDCB 5D2TA 4LC8A 1OGGA 2QCNA 3ZS4A 4GVGA 3THCA 4PUJA 1FWWA 1Q13A 1T8QA 2W62A 4PL2A 5I07A 3WQVA 1OK4A 1XRSA 4W89A 1J0JA 2GJRA 3W76A 4LJ3A 3WELA 5C54A 1JZ2A 2IXUA 1XHGA 3QPZA 4C5YA 2DVTA 2XN0A 2EPOA 3B9AA 1UZ4A 3M9YA 3AMLA 5I00A 1W3KA 5IXEA 1NARA 3M5YA 1UR8A 2EG7A 3B8IA 2RDTA 1UQYA 3FN9A 4QXIA 4A3QA 2X8GA 4ZVJA 3VGGA 4C65A 2IS7A 2EKCA 2ANUA 3LENA 2X16A 3C5QA 3H2CA 2C16A 3WH5A 2GGGA 4WXZA 2PB1A 3NJ3A 4CU8A 4MZ1A 3EKZA 1ICQA 1NU5A 1NEYA 2FVLA 1BYBA 2PGRA 2PDGA 1W6TA 5LKYA 2VEMA 4M1RA 1F6YA 3H54A 1O4UA 3Q45A 3WMLA 4DELA 3M5VA 3HMCA 3RLVA 1WKDA 5CBIA 1MNSA 1XC6A 1QOXA 1YQ2A 3PWGA 1BG4A 4AB4A 3CUIA 2P8BA 4DBEA 3M1ZA 4JFSA 3N3TA 2V0TA 1FHDA 4DI8A 2BVWA 4R7JA 5C7VA 1G6CA 1BQCA 5EMLA 4HPJA 1XIEA 3D6NA 1AODA 4MDOA 2PWDA 1MW3A 3TCSA 3VDHA 1H50A 1DJZA 4XUGA 4IGHA 4FX9A 1JQXA 4AISA 4DWSB 1P0DA 3PTMA 2F9RA 2XVGA 2BGSA 4H7CA 1OF8A 1YTDA 4NZCA 3PFMA 4G5DA 1NDZA 3RM9A 4JIEA 4AD0A 5HMDA 3S2NA 3H4GA 4REQB 9RUBA 2D2HA 5TBOA 1V6WA 2BS9A 1JL8A 5CZSA 3WX7A 3IIVA 2ZZ1A 2GGHA 1ME7A 1BTMA 2X30A 4XTIA 3VO0A 3JU2A 2D20A 4YTSA 2ALDA 4IP5A 1EJRC 5AHLA 2QCDA 1JXJA 1XRFA 2I9EA 1P1MA 7REQA 1ZENA 2XIOA 4J7RA 3RLGA 3P7YA 2CZVA 1JDEA 1T0OA 4NX5A 3F5JA 3MHUA 4GC3A 1U1JA 4MWAE 5TQLA 4UR7A 2AMGA 3JR2A 1HQTA 3DYOA 3BC9A 2ZRVA 3LCXA 3MB9A 1ZMDA 2PPGA 1VFSA 4EANA 1GRAA 4RW5A 1OD8A 3SEPA 1JAKA 4L9YA 5D03A 5KVHA 3IGXA 2WCAA 3T4WA 3BARA 1PYFA 1TPUA 1BG9A 4RNIA 3WBWA 3FX4A 3CUHA 3AI0A 1FWFC 4PUKA 2DPEA 4I5XA 5JUVA 3S9IA 4GY1A 3VKBA 2V3AA 3LI0A 4O57A 5A6KA 1GPWA 4HBKA 1NTHA 4AW7A 4N7QA 2VX4A 4LVBA 4WRHA 1GW9A 1OFRA 4IUOA 5C7HA 3VNJA 3UWEA 1NM9A 1IT8A 1F3WA 3T05A 2JGQA 5HUPA 2BVTA 2DU2A 3MDWA 1VD6A 1J96A 1ZTVA 4E4PA 1M53A 4QCEA 5FS9A 1XLMA 4RR4A 1TA3B 3GVVA 3MUCA 2BXYA 3DKLA 4O17A 2YJQA 3EOLA 1RBOB 1LUCB 3EA1A 2E25A 2PP1A 1UD3A 1TMLA 3OLIA 4M7SA 4O10A 6ENLA 2YFNA 3FHAA 3WJZA 1K8XA 3VABA 2X09A 3GUWA 2YL5A 3WK2A 3RDKA 3MP4A 3T7VA 3NVDA 4H01A 1X1ZA 3TSMA 3SCQA 4EAYA 3A13A 4XD3A 1S2UA 5LXXA 4PSPA 2QJHA 5RUBA 3WDHA 4LYKA 1F9CA 2FHBA 2C91A 2HNHA 3G8RA 5E6YA 3LHYA 5I77A 3OVPA 4O15A 2XH2A 3K2GA 4WJ8A 2BZNA 1FDYA 4AZGA 5CC5A 1SMAA 4XAGA 5FI8A 1I4NA 3BG5A 1GONA 4HD5A 4LUJA 4OGZA 1Q6DA 2BXVA 2OSYA 3QQ0A 3IRDA 3KTCA 3LK6A 1WDQA 1I1WA 1XPYA 3VCNA 2E6YA 5HQEA 2E6AA 1IZCA 1JGMA 1JYXA 3GDLA 4PCFA 4Q22A 1K9EA 3GW3A 2WMGA 2Y1HA 1A0DA 1K4HA 3BZGA 2DDXA 1ZALA 2BASA 3FNDA 1JI2A 3B9OA 1W17A 1FP8A 3CB8A 2Y5SA 4HT3A 3WBAA 4TV5A 4AF0B 1JG9A 1G7UA 3KBMA 5JH1A 1RCOB 2ZXDA 3C0JA 4DLFA 1BEUA 4HCLA 3R25A 1HL9A 5EYWA 4J56A 5A1AA 3OVRA 2Q3RA 3R89A 3K30A 4FO4A 1GQJA 1IYXA 2H8XA 1V4YA 1J2BA 1UUMA 4GBUA 2Y89A 4GI9A 3CUXA 2DT2A 4DWDA 3ZSSA 2Y70A 3M6YA 1P7TB 4JEJA 3GSMA 4X60A 3O15A 4HMCA 1BF6A 1V77A 1W1B1 1MFUA 3CZJA 2E09A 4W88A 2Y4SA 1LOSA 4WDXA 4N9EA 2RABA 2W3SA 3W26A 1W5PA 5FJTA 1JAEA 3N2BA 2X50A 3KE0A 4XSMA 4DXKA 4PTMA 3O0FA 1JZ5A 3W1RA 4PGLA 3B97A 3W7QA 1KM3A 1JZ7A 1DIEA 3BQ5A 3RLHA 2WVVB 2VELA 3OODA 3NVVB 1ELSA 1M65A 4KW2A 3BCDA 3TLLA 4QQ3A 1H7RA 3A9BA 4UQDA 5A2CA 1PKNA 3CC1A 4C1NA 1QPOA 2G5WA 1UC4A 1VQTA 1F2JA 3NL2A 3TW9A 1OBAA 2I9UA 4JIPA 3W1MA 5K4ZA 2YZ5A 3CL7A 3T40A 3PSWA 1DQXA 4JIIX 5AYZA 1OB0A 3LB0A 3LZ3A 3EWWA 5FKYA 1YQZA 1A5SA 4C6CA 3TQ0A 1J5TA 1KB3A 1S38A 2J27A 3U2EA 4LBUA 4UXDA 3EX4A 3H2MA 1ZCOA 1KWGA 3RLUA 5HNNA 1BXBA 1TSIA 3H12A 4ZBCA 4JTQA 2TRSA 3SUTA 3UYCA 2VOTA 3V3WA 3UXKA 2J7FA 2INZA 4XSLA 4JN6A 2ZUTA 4ZB2A 2PDYA 1GPFA 2PE4A 3WCZA 2D1ZA 1XRVA 3G1AA 3Q67A 4LS2A 1V08A 4N6FA 2ZZBA 2NV2A 4NX0A 4M29A 4C6BA 3EMZA 4YMZA 5A95A 3N2MA 4QE4A 1D7YA 4ZQRA 4XAYA 4WIWA 3MHFA 3VNZA 1GVOA 1QAPA 3LLDA 5AHNA 3UR7A 4IIHA 4LCQA 2ISDA 5DMLA 3QYSA 3AHYA 2VZOA 3GYEA 3SBFA 2JBMA 1K7XA 3GX9A 3HGOA 3GH7A 3VNYA 5CPLA 1GJWA 4AX6A 4GCAA 4D6CA 1OY0A 3FGCA 2Z29A 1VBUA 1I1XA 1I2RA 1XLEA 4HZ6A 4ORIA 3KRUA 5EBUA 3UWYA 3TQPA 2PWEA 4GRTA 3V4BA 1VCGA 1EJTC 5CPNA 3UA4A 1Q65A 2OQYA 2YOCA 3ARPA 4ZE4A 3LRKA 1ZPTA 2V2DA 3LA4A 4R5EA 3OQ8A 1E56A 6REQA 3KLLA 4H4PA 1E3ZA 3H2EA 4QX4A 1DVJA 2PEVA 3PJWA 4DUWA 1GYMA 1U5JA 4CD8A 3CB3A 1U1UA 3AYRA 3G2GA 3QOKA 2BHZA 4JAWA 3BWWA 1A4MA 1A5UA 2VC7A 4WSKA 1TQXA 1QWKA 3QR3A 4JTLA 4IIDA 6XIAA 5ABTA 2FLIA 3MV01 4NAFB 3W87A 1VFFA 1OGSA 3QC3A 1XFCA 4U31A 1FO4A 1R5YA 4UTIA 3UCCA 3SJ3A 5DMYA 3QYQA 2GVEA 2GUYA 4QP0A 1GVQA 3GYCA 3ES8A 3WUFA 1F76A 4RK8A 4LH8A 3SQLA 3PP7A 1IZJA 4QSHA 4FPSA 2CXEA 4PCNA 2V6AA 2IQTA 4DWSD 1OK6A 3VNKA 2FIQA 2E6DA 1GZGA 2W4XA 4HOWA 3OOQA 4UQEA 3E38A 4ATWA 3KUMA 4EWND 3KZPA 3QHMA 3QSRA 4ZO6A 3H8AA 4HNTA 3GH5A 1UD5A 2D2OA 2EGZA 3WY1A 1KBBA 1OVDA 2JGYA 3SUSA 3W88A 5CSUA 2O7QA 1YIXA 4O0ZA 4ZOBA 3FHQA 3PUOA 3PG6A 5LHEA 3GNNA 3CO8A 3R07C 3UETA 5FEPA 1WXZA 3S6DA 3MWCA 1XR2A 1VYSX 3BLKA 3G1XA 1KRBC 4GACA 2C1GA 1UKSA 1QCWA 4AD5A 1Y5VA 4KIRA 3W2KA 2J6VA 4MTVA 3RAOA 2J25A 3DESA 3GD3A 2NQHA 3AWOA 1JPMA 1UBSA 2Y8KA 4JIHA 1U22A 1OZMA 3CPGA 5KZMA 1BWKA 1CIUA 2ISWA 1ONEA 3FKRA 3UGVA 1VBHA 3W1UA 4DBDA 5G5HB 1XUZA 3RU8X 3J7HA 4EM3A 4D8ZA 3RPTA 3H7VA 5C2GA 1ZY8A 3SADA 4BQ2A 4HSNA 5FF0A 5AHIA 3PPGA 4IJCA 3W82A 3M7WA 4Z08A 2YB4A 1J12A 2IPJA 3R4IA 4Z0SA 4LB4A 4CCZA 3RF9A 4Q4KA 3O07A 1CEOA 2Q71A 1J18A 3VNMA 4LALA 3AO0A 3GR4A 4YCPA 4C7DA 1ZAIA 1GZ1A 1ZP3A 3USZA 1R7OA 2ZXQA 5FF7A 3IUIA 2DZPA 3FSTA 4CU6A 2PWGA 1DWIM 3UPWA 5A8OA 2Y5JA 1TJ2A 4XG1A 1X2HA 3BUVA 4WHBA 2XVKA 3L68A 1JF6A 2G0WA 1EZ2A 3MDUA 2GJPA 3DH7A 5C9UA 1FCQA 3TTQA 4AZ7A 5L9FA 4QLJA 3E2SA 2BY3A 3U57A 1JEHA 4JCLA 4E4FA 1DJXA 3PBUA 1GVSA 5CKSA 3FYYA 3S6OA 1B4KA 1QU4A 1MNZA 1GT8A 3PZTA 4ASTA 5LZLA 2CIPA 1JCMP 1UZDA 3R0DA 3BLLA 3OYXA 4JQ3A 3N2TA 4O1EA 1FCUA 1PDYA 5K2ZA 3L21A 3E0VA 1KQZA 1LRNA 1B31A 3MUZ1 5AZ1A 3HOJA 2NXIA 3P8JA 4UMAA 2WJZA 1IGSA 4CN1A 1ZB5A 2YXOA 3R8HA 4UFJA 4MB4A 1RY0A 4DUVA 3MY9A 2WJDA 1XH2A 1PIFA 3CIVA 3TTSA 3M0IA 5DCEA 1OHLA 2X41A 1XDIA 1KFEA 3EKLA 3GNDA 3O05A 1KCZA 2J24A 5E0FA 1SZNA 3A22A 5LSMA 1S2WA 1FVPA 4HA3A 4DY1A 1EQPA 5LGXA 2CLKA 5DT5A 4FX6M 1KC7A 4DXVA 2PS2A 3KWSA 3STPA 1UOKA 2WVUA 4WY0B 2PRLA 3L66A 2GK1A 5I3FA 2E1WA 3FA3A 3WF3A 4BQ5A 1Q1WA 1QUMA 1KTNA 4WZHA 4KEMA 4GRSA 3SRHA 1BSIA 5U4NA 1SUXA 3OBAA 5HUOA 3ZOAA 3PK7A 5AOUA 4H4QA 5LNUA 5FEXA 1WA3A 3MMWA 3POHA 4L80A 1TVNA 5A3HA 3NL6A 1BLIA 1O1HA 1E6QM 3BQ6A 1H1NA 3IVSA 1XLGA 3N3MA 4OBSA 1FFQA 5HOSA 1OX5A 2F2HA 3AHTA 3AMZA 2BVDA 1QK0A 4W7VA 3LXCA 4K2SA 2R1LA 4L1XA 5HNTA 5F2LA 4K37A 4ICMA 2VGBA 1AW2A 1I9CB 5E0CA 2IKHA 4QISA 4EQRA 3GHSA 5LA2A 2WMJA 3TN3A 1G69A 1TV7A 3AS0A 2HCVA 1XLHA 1QNQA 4S1FA 4GY7A 5T91A 1J4EA 3FJLA 4HGXA 3G1DA 5I06A 3CHVA 2XGZA 3DI1A 5BCAA 2YDRA 2ZZ4A 4Q6XA 3CZEA 1G5AA 1L8PA 5H91A 2HMCA 2RAGA 3DJGX 4RDVA 2YVGA 3UG4A 4KF1A 4U3AA 4AWUA 5BRPA 3SGZA 2DFAA 2EXOA 3WD0A 1EIBA 4KCWA 2VURA 3VTRA 1GQLA 1DWFM 3W4RA 4UQBA 4DPQA 5CJNA 1AOGA 3VYLA 1LWIA 4S3AA 3XINA 1FH7A 4EACA 4RDZA 1HT6A 4JBRA 4MNKA 2QCEA 4FLQA 2KZHA 4WGXA 4ZQMA 1UUQA 2JK6A 2EO7A 4K8GA 2ZE0A 1SPQA 4L61A 3KP0A 1H49A 4DM1A 1A3WA 4JTIA 2XG9A 2Z27A 4K6AA 1BXCA 1GUVA 5M03A 2FDMA 3AYSA 1VFUA 4PMUA 3ZT7A 1XIFA 3WFZA 5JCMA 2J8GA 2XM1A 4O19A 3UJEA 4JTGA 3KCJA 1KNWA 1DWJM 4FS9A 4LEQA 2GSJA 4M1BA 4NG3A 3HV8A 1E6PA 3UD6A 4UUIA 2OLHA 3T2QA 1ZBWA 4QG6A 4PTDA 5U25A 4HTYA 1NIUA 2X1SA 3A21A 3T9PA 1X39A 1EYEA 3AIWA 4L1WA 4A22A 4JD4A 1GKPA 3CMFA 3GVWA 3HBLA 3DCPA 3H2NA 1KBJA 1RALA 3MP5A 1GHRA 1V79A 4KEUA 3GXDA 3CYVA 3NO5A 1LUCA 2Q8ZA 1KR1A 2OU4A 2DEPA 2OLAA 1LP6A 3H55A 3V5FA 5CC3A 4R9XA 1VLIA 2X0SA 3NURA 3FV9A 4FX8A 1RJPA 1AFSA 5FJRA 2DVXA 3IS4A 5HQLA 3WQPA 1M6JA 1R9ZA 4HIBA 4R27A 2ZE3A 1XV8A 3MI6A 3P93A 7PTDA 4HHPA 1H4PA 3WF1A 3HQ1A 4YIWA 1T96A 3UZWA 4PMXA 2PI6A 3B9NA 4O0KA 5JCIA 2I14A 2TSYA 3W7MA 4Q4RA 2FKPA 2J75A 4C6LA 4ZSUA 1KXTA 1GEUA 3BO9A 1P6CA 4BR1A 4HNOA 3KBNA 2V3GA 3OYZA 3PUDA 3GU1A 1T5AA 1YE6A 3W83A 2XN2A 3U3HA 3QKZA 3V5CA 5AVHA 3ORWA 5DQPA 1OSEA 3CPUA 2V81A 3K4WA 3BLEA 3SCOA 3TR2A 1IEXA 4A3UA 1Z48A 5CBBA 3CJPA 1TUFA 3LNMA 4DZHA 5AVNA 3PPHA 2OWXA 3TE9A 4BQ3A 4CQ9A 1KBLA 2ODOA 1E4MM 5A8QA 4B5NA 3VMOA 1TZ9A 4EF8A 3KS5A 3S6TA 2O7SA 3PFRA 2AMXA 2V8ZA 1YPIA 3AHVA 5BYWA 3S1GA 4US5D 3LPOA 1VHCA 4OUEA 3H2AA 1NJJA 5HPOA 4D1JA 3WJWA 3GXPA 2CZFA 4F4RA 4N9CA 4LRSA 1OC6A 2OTDA 4NJIA 1Q3NA 3QF0A 4REQA 3IRSA 4XQ6A 1JPIA 3N2CA 3TA9A 5GQBA 1EGZA 1ZAHA 3B4YA 1SZRA 7ODCA 4UTUA 3ZO9A 3QLDA 3VZZA 1EA0A 3C0SA 2DIEA 2C1HA 4I90A 3NO1A 5AC5A 2GDVA 4C1LA 2XTKA 1B4EA 3FYOA 2V5KA 3I6TA 5A6BA 5BZAA 1KLYA 5BU9A 3WLMA 5F2MA 3HFYA 1CECA 2GRTA 1OFQA 3TAOA 1OCJA 5G4EA 2VTFA 1S3HA 3DHFA 3R43A 1DKWA 2R91A 4UCGA 3W9ZA 5I3KA 2PDFA 4LFYA 4H4VA 4HYRA 4KFOA 4ZGYA 2J9XA 2PBOA 1QT1A 4UZUA 1CI1A 3UJ2A 1VZWA 2V2HA 5JMUA 1B3ZA 4DZ5A 2OSXA 4A35A 4XBSA 3AIUA 4TMBA 3GD4A 4CN6A 1WB0A 4J3WA 1W1TA 2VNCA 5CPOA 1DNCA 4AAJA 3IJ9A 1ZLPA 2DUZA 1PBGA 4PMRA 2WP6A 3G0SA 3IVTA 2VD9A 4LOCA 2BCPA 1YMYA 2REQA 5DELA 1KKRA 3DJJA 4MNJA 3FDGA 1K9TA 4LW7A 1G4TA 4J27A 4NAEB 4JTJA 1W2VA 1K7FA 2ZDRA 2WOIA 4IUGA 4GXWA 4W9TA 2TODA 2NV9A 4J57A 2HK1A 1FCVA 1DHPA 3REQA 3ITTA 4YWSA 2QPSA 4KS0A 2HE8A 1EJVC 4XX6A 1EYWA 3ARZA 3W7OA 3QW4B 5J5DA 3WLQA 2RDUA 1VFTA 3KCLA 4E5TA 3VGEA 1J0KA 3N4AA 4QJ5B 4R34A 4D9PA 1EZWA 1OADA 3RILA 5EFDA 3HG4A 1N8FA 3CPRA 4G8TA 1JRCA 3WENA 4GBDA 4M80A 4E2BA 4OV4A 4AY7A 3A47A 3WK3A 2MUCA 1ISZA 3EX6A 1NWRA 3NSNA 2VKZG 3K4DA 3AXKA 1VFOA 3EDFA 3LHUA 4CEXC 2WMFA 3T8LA 1A5OC 2I5GA 1E4NA 3AROA 5I2UA 4IGMA 3ITCA 1DTNA 3WYZA 2VRQA 3TC6A 3KDNA 1EGMA 1RA5A 3POCA 4QJ4B 4H4ZA 4F40A 5JIWA 3R2GA 4MM1A 4HNNA 4GJIA 2ZOXA 3LXBA 1WOAA 1I6NA 2QQ6A 3PTQA 4B9ZA 4CNUA 3OC4A 2XGBA 3QVQA 3DIPA 2QAFA 1XCWA 4TVCA 1V0KA 4CQ8A 4HN4A 1QOQA 2D0HA 4OIFA 5DT7A 4NYYA 2ZZ3A 1BD0A 3QFAA 2CU0A 1JULA 4GABA 1Z9AA 3BGAA 4JQ4A 1CZ1A 3EMCA 3S5YA 4NASA 4U10A 3NGJA 4Z1BA 2PRHA 2PP3A 5EMJA 4DAFA 1I2OA 3UY8A 3KLKA 1ENUA 1E70M 2IPFA 1GCYA 4GUIA 3QPYA 3VE9A 1FH9A 5CCZA 4MOZA 3O6AA 2HTMA 2PTWA 5I02A 1KGUA 1ISYA 3QV8A 1F4AA 4PMQA 2QNEA 1YDOA 1KR0A 2QCCA 3ZJKA 1IEQA 1SW0A 4IIGA 4R33A 3UZ5A 5HWJA 3W01A 1UQZA 3DFHA 4Z1CA 4GJ1A 2VQUA 1DTUA 5EPDA 4NZJA 5E1QA 3I7RA 5MKGA 4U33A 2Y0FA 4HA4A 4GIRA 4P8WA 1ZXIC 3NQ6A 1JIBA 3PY2A 2QMKA 1V02E 1MZRA 3WBYA 1OT2A 2Q3OA 1RLCL 4JFUA 1F05A 2CLPA 3WFAA 1UC5A 3R7MA 1JXKA 2F6XA 1P0BA 3ATYA 3FDKA 1RR2A 3LMZA 3ZQ9A 3RUBL 4EMWA 4GISA 1V0LA 3HTWA 3MT1A 2FMNA 5CZKA 3KBJA 4DJED 7XIMA 3RJXA 4ML9A 1FWDC 3SR6B 4EVZA 4H9VA 1B9ZA 3ATZA 1A4LA 1Q6CA 4HCDA 1KFLA 3UR8A 1E15A 2OO0A 4OVXA 1JYWA 3QQWA 2V38A 1CT5A 4UQAA 1BRLA 4PEEA 3SCWA 2UY4A 3O3RA 2QUUA 1BXNA 3EUB3 1SJCA 4NL1A 4P7QA 2WMKA 4DJEA 4DBSA 2PWHA 1IQ8A 4N0RA 4AD1A 4ADTA 3TIMA 1B3YA 3UZJA 2MNRA 2GVGA 1EC8A 3T1GA 1K9DA 5CZJA 2XFWA 4Z0JA 2E6FA 1K8YA 3VDAA 1KCLA 2FZ8A 3QGAC 2B7QA 5D2YA 4NI3A 2OOFA 2CKSA 4KFPA 2OWWA 2O9OA 4H6KA 3ARUA 2QDEA 3UBPC 2JEPA 2XISA 4J4KA 3VD4A 2E77A 3SQPA 4CNPA 3TMQA 2O92A 4IG2A 5HINA 4ZOEA 2EPNA 3HZ3A 1V3KA 3VOIA 1NF7A 4IFKA 4PUMA 2FTYA 2GPTA 4PL1A 3K4AA 4ERIA 3IPWA 5D2WA 4GUGA 3QRHA 2BX7A 1B30A 4H19A 3ZVHB 4C7GA 5G1MA 1F6KA 4ZL1A 3QFWA 3W2JA 4L6OA 2D24A 1UA7A 3UA3A 5D9PA 4JN7A 5FACA 4ZTXA 1AH0A 4JHZA 1EDTA 3CMGA 3C8FA 4MJZA 3WNOA 3RJYA 3R58A 5D9OA 5K7JA 4K1WA 5CEWA 1WYGA 2DGAA 4NAEA 4FNUA 1HJUA 1V3HA 1LWHA 3VUPA 1NP2A 1DOSA 4XIMA 3VMPA 1HF6A 2PDMA 3TFXA 4H04A 3TXVA 3T2PA 3KRZA 2V3FA 1JJKA 2YCLA 4DF0A 3FLUA 1YW1A 3OO2A 4KGLA 3COTA 2WSKA 3AM9A 1OFPA 4XKMA 1YXCA 2VR5A 1JDAA 1WDRA 3EPOA 2TPSA 1X8FA 2ON3A 5D9MA 3NL5A 2NWRA 1H7PA 3UJFA 3H7UA 2HROA 4N42A 4FR1A 3GTIA 5CG7A 3AZRA 3GFZA 1A5CA 1KN0A 3PM6A 3UXDA 3IJ8A 1XQLA 3TC3A 2GQ3A 3ARQA 1W2PA 3WH8A 3C2OA 4S38A 1QPKA 2QULA 3LV5A 4ICNA 4NY2A 1FWSA 2B7NA 5A6MA 4JICA 4HKPA 3FVMA 2BTMA 4YCOA 3STFA 1IT7A 1DJNA 3SB0A 2W9MA 2WVTA 3AYVA 5FIPA 4F66A 3WNNA 2FZDA 2E5BA 3C2RA 2PTDA 2ACUA 3ARTA 1OG6A 3F2DA 3VKKA 7CGTA 4J3ZA 4KRUA 4AZ5A 1YDNA 3A6OA 1WE5A 3M46A 3QJAA 5JBDA 3ZLGA 1D3GA 3LHTA 3UQNA 3GNOA 3HB9A 4WJEA 1QNPA 2WNNA 1IR2A 4LY4A 1TREA 5D02A 1KFJA 1BGGA 1DJHA 1CTNA 1XIIA 4U5IA 3EWZA 3VOFA 1XLKA 4BZYA 3B8DA 4MB5A 4TUFA 4ACZA 1RBLA 2OX1A 1NSJA 1W1VA 3NZQA 3GUGA 2ZUWA 1BWVA 1WUFA 2AQWA 2DZUA 1VPQA 1W3HA 1VJZA 4F0RA 2D73A 1AL8A 1ONFA 2VRJA 4MY8A 4QAWA 1A0CA 4O4VA 1XP3A 4XAPA 3MS8A 3S4TA 3AXHA 3U2CA 1E55A 4UQCA 2D0GA 3STCA 4MPKA 4FR6A 1US2A 2R9ZA 1W3IA 4D2JA 4Q33A 4ACZB 2VDGA 4GXPA 3TP4A 4KPRA 1HKMA 1GRTA 3ZMRA 3IEBA 2HS8A 5A8PA 3VPLA 5F2GA 3R0KA 3SJNA 2RHGA 4IP7A 3G24A 1DEDA 4NIRA 1SJBA 2UY3A 2YCEA 1RZMA 4B5XA 3VIOA 4BV6A 4MB3A 2C13A 4GO9A 4IQDA 2CBJA 3UJSA 1GKRA 4UTWC 4JTKA 3Q2DA 3QGKC 3VIGA 1RV8A 2EQ8A 2ZZ7A 5AC6A 3PWAA 1VEOA 3AICA 1XYFA 4I9AA 3G6MA 4MKSA 1J0YA 4J28A 3CLMA 3UWUA 4H9XA 4HU8A 2NXHA 3GIYA 5A6LA 3QBUA 1AQHA 5FJIA 3MCOA 2WPEA 4UC5A 4YL2A 5ABFB 3AIBA 3BLIA 4B2DA 2PTZA 5FEZA 1O5QA 4O8AA 2C3ZA 1MYRA 3H2OA 2Y88A 4S39A 7REQB 4UR9A 2WO5A 2AL2B 3B0YA 3ZZ1A 1H11A 4LEFA 1B5TA 1H2JA 3L5MA 3BK0A 4BI7A 3QC0A 3T0AA 1GVRA 1AW5A 3BMXA 3UNTA 1EP2A 1XH0A 3VKJA 4ZFCA 5IFPA 3M43A 2EPHA 5K9XA 2IKGA 5CZ0A 1TV5A 1RK6A 3IUDA 3ZFHA 5DFAA 1N8WA 3W75A 4BA0A 2PLKA 3ZJ8A 2GJNA 2XU2A 3UXAA 4LS1A 1R47A 3OIXA 1QO2A 2PD5A 1Q6OA 5I3HA 2P0IA 2X1IA 1VFLA 4FHAA 1HGWA 3URBA 1ZHAA 3NPWA 3ALGA 3CLWA 3PS7A 3EB4A 2VUNA 3IV8A 4JQAA 1VGAA 3H26A 2Z28A 3VD7A 2Z1VA 2PURA 3GG0A 4KRTA 2F6KA 2Z2BA 2CBVA 1R3QA 3RCYA 1C8YA 3PC0A 1MWOA 5IFTA 3FJ4A 1UMYA 1U5HA 1STZA 3BV7A 3O6CA 5JH2A 3WDJA 1O95A 3WKZA 5MHBA 4MYXA 4BY3A 3ISIX 3PF3A 4S3CA 1UUOA 1POJA 3M64A 3UERA 5I09A 5K9CA 1Q7MA 4E8DA 1XW8A 3LY0A 1OX6A 1XI3A 3NOYA 1RQBA 4QFUA 4E0CA 4DYKA 3CTTA 4Z42C 3W1AA 4HPNA 3WQWA 3V75A 3URAA 1TVLA 2OGYA 4PSRA 4N6EA 1XBZA 4H4SA 2HVMA 2VVSA 1MW1A 1CGUA 4HPGA 4KFNA 2NQ5A 4E2VA 1THFD 1BRLB 4DWSC 2NQJA 2IMRA 3BAXA 1P43A 4UMBA 3FIGA 3BJFA 1Q45A 3SCVA 1KXVA 3GG8A 1SW3A 1SFLA 3EWDA 3ITGA 1QNOA 3BH4A 1DP0A 4YJ5A 1EO5A 4XTDA 4BF5A 3GBDA 4JS3A 4Q8TA 4QAIA 1C8VA 5E09A 1PHWA 5DCBA 5D04C 2BOGX 4GI4A 1TYGA 2WMHA 1Q66A 3HQPA 4WXYA 1V6YA 5CLTA 2VR2A 4GIEA 2A3BA 3BDKA 3P3BA 2W67A 1H5YA 5D2VA 3BMWA 3RHGA 4LF1A 1W3JA 2OQLA 1EJXC 1ITUA 4C60A 1FWCC 2V3EA 4NVTA 1AK5A 3S1WA 1WBJA 3LTPA 1WZAA 5MKGB 4HU4A 1NELA 4PTNA 5CXPA 4GKLA 1X7FA 2QPXA 3R11A 4A8NA 3VOGA 4ALDA 1K6WA 1V3MA 2YYTA 1TTJA 3QZ6A 1PWLA 4YWIA 3YPIA 4FLRA 1YBQA 5LXEA 3WSUA 4PBEA 3KLJA 1HL2A 5EA9A 3PZIA 1ITCA 1TZ7A 1JRBA 1E9LA 1VENA 2NVDA 3LCGA 2WMIA 1R38A 3FKKA 3LG3A 5EL1A 5GNYA 3SDOA 3B05A 4QRNA 2WPBA 3LEPA 1CXEA 1G1YA 5JCNA 2ZZCA 4WKFA 3PZGA 3N1AA 2NV1A 1CXIA 3PHAA 3GAKA 4KBXA 1RPXA 1LRQA 1XHCA 1L2UA 1SZFA 4QDPA 2XPKA 2ZUNA 1RVKA 3CYJA 4Q8MA 3RIKA 4QSFA 1EOKA 4E2DA 3VGHA 4TMCA 3PANA 5A8NA 2BOFX 1D3HA 1E0XA 4CQBA 4K7VA 4FOKA 2J3NA 5G4HC 2W54A 3VCRA 1XL9A 3BLDA 5D33A 3NR0A 3T2OA 1M7JA 3A23A 2OLSA 1S5VA 1J01A 3GDRA 3T44A 2OGJA 4KETA 3DFPA 4TR9A 3O6YX 5D37A 4Q7IA 1OG0A 2V5JA 3UXIA 1J5SA 4BEUA 2V82A 1TVPA 4JOMA 1W54A 3SRDA 3UY7A 4AHOA 3LX9A 1EJWC 3ITOA 2BC1A 1P1XA 4MPQA 1QHZA 2GH5A 1PIGA 1HFBA 1CBGA 1ODZA 3IV3A 3FY1A 1WDPA 4MG4A 1UJPA 1WXYA 4ZFMA 4AVNA 4E6MA 1C91A 4JTUA 4X0NA 1IEVA 1WKFA 2WSYA 1EO7A 1Y65A 3OP2A 3E9AA 4HVXA 4LAUA 1JYVA 1TPC1 3I68A 3LHVA 2PSNA 4MUZA 3MZ2A 1R30A 2C18A 2INFA 4PN2A 1ZJAA 1U5VA 3PTKA 4AUBA 4WOZA 4YVXA 4A3RA 2QCLA 2ZRUA 1EP1A 4D72A 1GERA 1E0VA 3ZR4A 3C4UA 3N14A 2FGBA 3W84A 3MSGA 3Q94A 1MDRA 3RO8A 1J6OA 1TTPA 4FOJA 4A2RA 3LUTA 1IXPA 4EK7A 1HJQA 3T0TA 5HJYA 3E02A 3N9RA 4QE1A 2Y5EA 3MKKA 2X2GA 4PBFA 2J7GA 4DB7A 3QN3A 5I03A 4HTBA 4MHBA 3WEMA 5BXSA 4Q7BA 3DFQA 1GEHA 3AIEA 2W0HA 2DZTA 3DK9A 1S39A 3LRLA 4DZIA 2P0OA 1OWQA 3M0YA 4F0MA 2OKOA 1JR1A 4DNAA 4GYJA 5MF5A 3JZEA 3SCPA 2J4GA 2RDXA 3CEUA 2WC7A 2ATSA 4GH1A 4ROPA 4NJKA 1T7LA 3LADA 2XH7A 1LOLA 2GQAA 1T40A 2DUXA 3H4KA 2PWFA 5E5CA 5ENLA 3UGRA 3NEVA 2YA1A 4X2RA 3W7CA 3WEOA 2WOVA 1PTDA 4KWVA 1OFEA 1UB3A 1TPEA 1RK5A 4UTKA 5D05A 1W56A 3HM7A 3LRMA 1FDJA 3LD5A 1JFHA 4OJYA 2F7FA 2HVOA 3BVJA 2ZRYA 3OZMA 3OA3A 1QPNA 3JRKA 1HKWA 3P2VA 4I6VA 4GI6A 4C6JA 3B9JB 2QJJA 2JF7A 1IE7C 2C3DA 4JFTA 1S5TA 3WK1A 3CZLA 3ELFA 3TAKA 1R46A 3LS9A 5DY3A 3AFBA 5EBKA 3W29A 3HN3A 1JZ4A 4FLOA 1WCGA 3FSUA 1XYZA 4H4UA 1B54A 4NEWA 3NDYA 2YYUA 3F4WA 4ZOCA 3UNDA 1L2QA 3BL3A 2WKGA 2A4AA 4Y9OA 1EHAA 1YNPA 4CGTA 4FNQA 3E2VA 2F6UA 4DJEC 2QF7A 3HGSA 3FXGA 1KXQA 3L4YA 1V6TA 1FWJC 1QWGA 1XISA 3SAZA 1HJXA 3ONCA 3TV8A 3PG8A 1TMQA 1DJQA 4Q8OA 4TVDA 2BC0A 4AWEA 3QY6A 5TR3A 3A3HA 1YTKA 4IICA 2Q8XA 1QXLA 4WVXA 1XC4A 1MDLA 2RGMA 4P7RA 2ZRWA 4JDYA 4QROA 1PO9A 1A5KC 1WAWA 2W6RA 3LBOA 5AYIA 2MANA 2XGIA 2J7BA 2G3FA 2P76A 2VFDA 5U7SA 4KMQA 1LLZA 4W85A 1NHPA 4W7WA 1FXQA 2O9TA 3AZSA 5FJPA 4FALA 4YXGA 1UIPA 2HEJA 4TVWA 3B0UX 1Z3NA 1J6PA 1KFKA 1F6PA 3CAKA 1BZLA 4AWTA 3EWCA 2J7EA 5K9DA 2PLCA 3BCJA 1H63A 1PX8A 3M0MA 2G97A 3G0UA 2C0HA 1GRHA 5E0KA 1FEBA 1UW9A 4IMEA 1VIZA 2BP1A 3VNLA 1E4IA 3LMYA 4M24A 1Q7QA 1CPUA 5CAKA 3HF3A 5LA0A 4CCCA 4MAVA 4QDMA 3O8AA 1HVXA 3NVTA 1RHCA 4IL0A 4K3ZA 3MMTA 2R9RA 1XJBA 3G8EA 1DHKA 3PTDA 3LLXA 4HCHA 2EG6A 4ROQA 1JCLA 4DM2A 4L9ZA 3CZGA 1R6WA 4LNCA 3NQDA 3USBA 3P60A 3PUGA 1QASA 1FFUC 2ACSA 3IK2A 1QFEA 2AL1A 1RP8A 3ABSA 2ACRA 1X96A 4QEHA 5FSDC 1E1FA 3IJDA 1EDGA 1V6XA 2QHAA 1H41A 1T99A 4AF0A 2H3BA 4P2VA 2X2YA 4B5SA 1ZGDA 3UFYA 1S1RA 3MC5A 1RD6A 4RW3A 4EQWA 2XH0A 3I7SA 4MJ4A 2PAJA 1LBMA 2EBNA 3TONA 4U5KA 2GGJA 1EX1A 4HZ7A 4E8GA 5EU9A 1QMLA 2VDIA 1EWEA 1B9BA 1E6SM 4DO4A 1KM0A 3SN1A 1M01A 1VYPX 1N7KA 2CLFA 2H3DA 2OXNA 3U7VA 3BCFA 4H9MA 1AJZA 4ZR8A 3MO4A 2XHYA 3DXIA 4FLSA 2BGQA 4GY0A 1ZL1A 5JU6A 4IMAA 3W7EA 3QPEA 2JALA 1HP5A 1S5NA 3VIIA 1REQB 5HWNA 1OCNA 4GC4A 1O12A 4CUCA 3D3AA 2VYOA 4GKTA 4O1AA 3NYZA 4GMEA 3DG6A 3RX3A 5G2WA 1BPLB 4LWWA 1OYCA 4GYFA 1V51A 3DFYA 1Q4NX 3OLDA 3F4VA 1GOXA 1NFBA 3NQMA 2FB3A 2QLYA 2HK0A 3ARWA 1ECEA 2XSAA 3IIOA 4RDYA 4C6NA 1I2PA 4X63A 4NEVA 4LS0A 2I56A 3H4WA 1XCXA 4XZMX 2YB1A 6ALDA 3L23A 3BJSA 4CNOA 3CT7A 3W1XA 3C8NA 3IGHX 5GPRA 1K6AA 2XIQA 3E2RA 2G3NA 3L9CA 4JIQA 3PR2A 4IJRA 2A21A 1XQKA 1UKOA 3OBKA 5G2HA 4H3DA 4NHVA 2WCGA 1DV7A 2O4MA 3NXFA 1GVIA 1ODUA 1TCDA 2CZDA 5KINA 3M07A 1JPKA 2HBXA 5CGTA 5EMYA 4NZ3A 2PCEA 1NH6A 1CYGA 2NSXA 3S1UA 2C79A 2I5QA 5C2XA 4AZBA 1XX1A 4JL1A 3KTXA 4XBJA 2YL6A 1UD6A 2Z4GA 5M3WA 4PH6A 2OZ8A 4KCUA 2FFCA 2FJKA 3S2JA 1US3A 4FEZA 5KZEA 3QHNA 2Z25A 4JY9A 4XZHA 3TYBA 2DT0A 3E0WA 3CGDA 1VBRA 2VCAA 4NRRA 4QNWA 5AC7A 1M5WA 1GQNA 2OPJA 1M04A 3VDGA 3UVIA 3CNYA 1DPMA 4PUUA 3C2EA 4CNTA 2FHCA 2VUYA 2XN1A 1XRTA 2JE8A 3OBEA 4JR5A 1LL4A 2PDCA 4IMGA 2A6NA 5BOFA 4RCXA 2VX6A 4GQBA 4ZQOA 2HV5A 2Z7GA 2VHLA 4JKMA 3UG8A 4OHQA 2WXDM 3QXBA 1N5WC 1G4PA 1Q8JA 3EOUA 4QM1A 2G8ZA 3WD2A 3W1QA 1PKLA 3DZ1A 1F8WA 1YTEA 3C0LA 2VFHA 4DJFA 4BCEA 4HHLA 4MF4A 1XH1A 4F0LA 1RCXB 1LJYA 3VMNA 3R6IA 4H9TA 2CLLA 2ZRXA 4PTXA 3SCUA 1E0WA 2JKAA 3F1QA 1R3SA 3PBYA 2E40A 2EG8A 3VFLA 1DIOA 4NSBA 4QLKA 5TD4A 3KW3A 1KM5A 5A2BA 2RH9A 3KXQA 3ABRA 4WDTA 4WLCA 1N8IA 3OGRA 2ZFAA 1GOQA 3O63A 1GKQA 9CGTA 4AMAA 3SCSA 2DV0A 2I1OA 1MI3A 4DNHA 2HBVA 4QS6A 1VBGA 4GZJA 4AZHA 2VGIA 1CB2A 2D3NA 3HW2A 2WZIA 1JZ8A 1E3XA 3PPCA 1HJWA 3W3OA 1JUBA 2O4QA 1W5OA 1FHUA 4KCTA 4GX8A 3E1F1 3D0CA 1F3XA 4DLMA 1UWQA 2PC4A 1M3UA 1SJAA 3T0DA 1QJWA 4XIAA 3CQ0A 5SWUA 5M17A 2FPVA 1I0BA 3VGDA 1XFBA 1MUCA 3MKVA 3UEQA 1GNXA 5IHRA 4LYQA 2HDJA 2YGYA 4LNYA 3N2OA 3STEA 4G7EA 1Q6EA 3E12A 2RGLA 3W1LA 3AXMA 1P48A 1JPHA 1D8WA 2WKLA 4MB1A 3TYEA 2CKRA 4ILSA 1DWHM 4B92A 1O7AA 1UH4A 1W3LA 2D3LA 3I7QA 6XIMA 1VC4A 2B4GA 1XYBA 1UWAA 2X99A 5TAOA 3UYIA 1ZU8A 3BANA 4XZ9A 5DBUA 3AU2A 2E4TA 5DMNA 4Y9MA 1ONWA 1NOFA 4PFHA 1DL3A 1DJWA 2Y8UA 5F1UA 3T81A 4JCMA 4FI4A 4RE0A 3S83A 5A6AA 1H62A 1DWAM 1VJSA 1HKVA 2VEIA 2WVSA 3KEHA 1IWBA 2ZVRA 4BFAA 3BTNA 2I5IA 4V2XA 5L6UA 4B9YA 1X98A 1H51A 4GYPA 1UP3A 3TFCA 2XFYA 3QR1A 4DVOA 3ZVIA 1IWPA 2GSEA 2GVJA 4FXFA 5H8PA 2XWEA 5J5RA 4XD6A 4AXKA 5HMEA 3P84A 3N73A 3HG5A 4RV3A 4C91A 4DUXA 2YCJA 2DZWA 4O11A 4DF2A 3HGRA 1TWSA 3V1HA 1OM0A 4HN8A 2ISVA 3D47A 4D8AA 1H0IA 3SFKA 1N55A 3GVRA 2QGYA 4S2CA 4C6IA 3OHMB 4S23A 4DXXA 5FA5A 1LYXA 3NQ2A 1JZ6A 2P8CA 3R8GA 2DW7A 1EEXA 3WEZA 3PZNA 3BAYA 4BQ4A 1B3VA 2NVKX 3H22A 4DIAA 1UP0A 2E5AA 1LG1A 1DQUA 4PE8A 2ZTJA 4EWJA 3GC4A 3VI2A 4A2SA 2A85A 1S1PA 3TA6A 2X7VA 1SFJA 1LG2A 4LUYA 1E9IA 4MMWA 1OJTA 1ZKQA 5M1TA 2PDXA 4RZ4A 4MY9A 4YVVA 1JROA 4NU7A 2FMOA 3HFTA 4UIOA 5HAOA 1KM6A 1G4EA 2FPTA 2VFIA 4UOJA 3GKAA 2IXVA 3SW6A 3S2MA 1D8CA 2P10A 1NHSA 1ISWA 3GVQA 1PDZA 1RY8A 3Q37A 2D0FA 1KTCA 1Z42A 2WZHA 2A0NA 1XYAA 2V5LA 3W86A 3WZ0E 1P0EA 3B4UA 3GBEA 2PUZA 4H4YA 4GGHA 4GOAA 1C9DA 4KEVA 4O4WA 4K8EA 3S5SA 3PULA 2UY2A 2NQ9A 1R2TA 3URHA 1S2CA 1UKQA 2PU1A 2V9DA 3ITXA 3AIRA 4AD2A 4W8AA 2R94A 6PTDA 2CLEA 2OZ0A 4LUTA 3LOTA 4C1NB 2Q8LA 4PMZA 3WG6A 5FMHA 2QCFA 1VB9A 4LCSA 1LL6A 4QGCA 3MPGA 1KO0A 1SU5A 4OFCA 3PNUA 3HA1A 1BKHA 2ZX9A 3TYCA 1WO2A 3CUFA 3LPPA 1PEZA 2OELA 2Z2UA 3GNRA 3O0KA 4JHOA 4V1YA 3IIPA 1CXLA 1RSCA 8RUCA 5K3VA 4B5WA 1ZDLA 4H9UA 5D8WA 5HJXA 2OFJA 2IQDA 2VC6A 1S46A 5EGRA 5H2ZA 3IC9A 2WJFA 3B0XA 1R3VA 1TIWA 2G4FA 3GLCA 3W6LA 2VC9A 1RUSA 3RFAA 3TH6A 4JTSA 1EC7A 2B0MA 1EH9A 4PCPA 3CXBA 1B1YA 3L4WA 4UFLA 1DXLA 5H8MA 4B15A 3VKAA 1H7OA 1A5NC 2VGGA 1ZNNA 3K46A 8TIMA 4XB3A 3FVDA 1V8EA 2WLYA 2BHUA 4PODA 4H41A 4XBKA 1A80A 2DZSA 5LNWA 4KWOA 1F07A 1R3RA 4NF7A 3GU9A 3IAQA 5DRIA 1YPFA 4L5ZA 3RCMA 3D9XA 1MW2A 1H7WA 1VPYA 2WNQA 3DU0A 4AH7A 4WR3A 3IK4A 3QTGA 1D9EA 1XINA 3DFNA 3E2QA 1GV4A 3W74A 4YHGA 1KM4A 5FF4A 3OEXA 4IFRA 1M7XA 4DJFD 1TPB1 3LV6A 1FFVC 3GK0A 2A79A 1MO9A 2Z6IA 4P7OA 1XWYA 1VH7A 3BG9A 5D8ZA 3CHCA 2VEKA 3IIZA 5FS8A 2QJGA 4KQNA 3AIVA 2ZBTA 1UH2A 4TV6A 2BSLA 1W8SA 2AL2A 4CCEA 3TX9A 2A6LA 4GA8A 2VZTA 3U0HA 1A49A 1ICSA 2C1IA 4Y9NA 3GXNA 1QR7A 5C6MA 1XG4A 1XD0A 4Z1YA 1WPCA 1LOQA 1KRAC 2X05A 4U2ZA 1DORA 1GORA 5D38A 3BW4A 2HS6A 1EKOA 2EJ1A 1V5XA 3QTPA 2KAUC 3PSVA 4GCXA 3HQNA 5A69A 1JUKA 1SO3A 5KMYA 5HMFA 5M5DA 3QMSA 1TCMA 3TROA 2DSZA 3DC0A 3W7LA 2J6XA 3KOYA 5ABGA 4P8UA 4LYRA 1N60C 1OIFA 2TPRA 2WBGA 4FF7A 3Q6JA 3AHXA 4MSSA 3GR7A 2OX4A 3NZGA 4H6EA 1V7AA 4BF7A 1G0CA 1IXNA 3KRSA 3R1ZA 4F2BA 1E72M 4YYFA 1HVQA 4ZO9A 2UZ9A 3PJUA 4NRSA 4J35A 4CNNA 4MNMA 4AHPA 3P81A 3AS2A 2IPGA 3LZ5A 3W2UA 4JKKA 1UWUA 4M5PA 5G1YA 5G1TA 2PF8A 4MFDA 3V5OA 4Q4MA 3VK5A 3RYSA 1WYIA 1JD9A 7TAAA 4AVOA 1JNDA 3VC6A 3LXAA 1FFRA 1PJ9A 1IHIA 2W27A 4J3SA 3CAWA 3QV6A 1XGDA 4FK9A 4JEQA 3JVAA 1GRFA 3LGEA 4B3LA 4Q6JA 1LF1A 1A0EA 1JRPA 3UR5A 3DFOA 3VNDA 3NS1B 1GTHA 2HE5A 4M19A 1OYAA 1AA1B 4EQSA 2SFPA 1MOKA 4I5UA 4UQ9A 4B5UA 4OZOA 4LSBA 5LA1A 3V16A 5HNUA 4MIMA 2DJXA 2PGWA 1W9PA 3VCCA 2E0PA 3PWIA 3BW2A 3KDOA 2VL4A 4GQ0A 1MRQA 4Q8UA 1ML1A 1X8CA 1OYBA 3M6DA 4LBSA 1QBAA 3NQFA 4DYEA 3M0LA 1R3TA 3D3FA 4LVGA 4GE8A 4OTKA 3RMJA 2O9PA 2QJMA 3ARYA 4JTCA 1GOMA 3II4A 4ZEPA 1YDVA 3CQKA 3V18A 3W22A 2R1MA 2Z1KA 4KWUA 3FAXA 3K13A 1P0NA 4NJGA 4BI5A 3BLOA 1NHQA 5C5YA 2W55A 1QHOA 1U33A 2YXGA 4ZQPA 4US6A 2DORA 1NDAA 3LNPA 1DJGA 3NG3A 3W7DA 1KGWA 1F8MA 1OT1A 3P14A 2X40A 2B81A 3MWAA 3VAVA 5AECA 2HQAA 1GGOA 1QI4A 1J0HA 3AXIA 1VR6A 3FA4A 3TCEA 1MSSA 3S9ZA 3KS6A 4IGSA 3N6QA 4MKVA 4NUWA 3MP3A 1TUXA 4I9JA 3MMDA 3VIPA 1CENA 2Y24A 4DBWA 1XYCA 1X1OA 4H2HA 1NOUA 1RPKA 1ZSXA 2CPUA 4TX6A 3WQDA 1BWCA 3GY1A 4H83A 4UBPC 3MUIA 1UA3A 2E7FA 1OFOA 1NHRA 1TQJA 1TV8A 3S1VA 2WSRA 3OZOA 3NA8A 3NQCA 4Z2KA 2WC4A 4LUIA 4F0HA 1HKJA 2BGNE 3IACA 3L67A 1AMKA 1FDZA 3OB8A 4JTFA 3MJMA 4QR6A 3ZYZA 2FVMA 2ASHA 3EWYA 2F38A 4AZ6A 2OOGA 1R2RA 1XLIA 2W0UA 5HK4A 1M41A 3HU7A 3NQBA 3TNBA 2OQHA 5EBAA 4XKYB 4ZZ9A 4G1KA 2VXNA 1LQAA 4HHMA 1XIBA 3WMBA 3NAVA 4GR1A 1XANA 1H7NA 3BOLA 4NXKA 4V15A 1YNYA 4DO6A 2G3IA 2AAMA 2OCZA 5JCKA 2O0TA 2GR0A 1HKIA 3WDIA 1MUMA 1UH3A 2JKEA 3GNPA 1SB3B 3QV9A 3MSRA 1F61A 4FAMA 5I3JA 2BNJA 4R85A 1XG3A 4DYJA 1DE6A 4Y6GA 3DBNA 2VP8A 1L6YA 1PZ3A 1US0A 3HPFA 1YADA 1XLJA 2QJNA 4O1BA 2F2KA 3IJQA 4B4FA 2PGFA 2QW5A 1VQZA 3B8UA 1RAKA 4LQ1A 3B8VA 2Z7KA 5BXRA 3W6YA 1QO5A 4O12A 4PR4A 4WX2A 3TC7A 1YKWA 2V6OA 4LRTA 4A3HA 3FAWA 5J04A 1UR9A 3FCPA 2ACQA 1ZAJA 4M56A 2CWNA 4LXFA 3CQIA 4K36A 1PKYA 2GK1B 3F5KA 4W5ZA 2V30A 3VIFA 2C3CA 1R85A 3DI0A 1SSDA 2FYMA 1EL3A 2DZAA 4U4MA 1E6NA 3ARRA 3JZUA 3N17A 1K4GA 4LU0A 3WLJA 1AUSL 1ZJIA 1JDFA 1ZZMA 3VUSA 1XBXA 4ML4A