1F9CA

Crystal structure of mle d178n variant
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
360
Chain Sequence
b'SALIERIDAIIVDLPTIQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDALAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQNLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEARLARFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE I)
molecule tags Isomerase
source organism Pseudomonas putida
publication title Buried charged surface in proteins.
pubmed doi rcsb
total genus 133
structure length 360
sequence length 370
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1f9cA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1f9cA01
3FCPA 3TOYA 3CAWA 3R0KA 3NXLA 4ENLA 3SN4A 1JPMA 3DGBA 3KUMA 2OFJA 4H83A 2P8BA 4JN8A 2OPJA 2QJJA 1TE6A 3R25A 4MGGA 3GD6A 2XSXA 3S5SA 1ECQA 3T4WA 3I6EA 4HN8A 3PFRA 1WUFA 3BJSA 3GY1A 3PWIA 2GGEA 4IP5A 3TCSA 3Q4DA 3CB3A 3D47A 3H7VA 4GFIA 3S47A 2XGZA 2OX4A 3NFUA 2OZTA 3VA8A 3JZUA 2P0IA 1PDZA 5FJUA 2PCEA 3CYJA 2OG9A 2HZGA 3ZVHB 2XH2A 3GO2A 2PTZA 4IP4A 4IT1A 3IJIA 1MUCA 3GC2A 1P48A 2PP0A 3PWGA 3P3BA 1MNSA 3ZLGA 2QDEA 4JHMA 3FVDA 1EC8A 3MZNA 2PP1A 3DFYA 1BQGA 3UJFA 4H2HA 1FHVA 4E6MA 3DFHA 3DG6A 3JW7A 2O56A 3VCCA 3CK5A 2PS2A 2OQYA 3UXLA 2AKZA 2P88A 2QVHA 1KCZA 2PU1A 4J1OA 3MY9A 3U9IA 5FJTA 3RITA 4A6GA 1IYXA 3UGVA 2AKMA 3FXGA 3RRAA 3TJIA 4DYEA 1JPDX 1SJCA 4E8GA 1KKRA 2GL5A 3V3WA 3ZVIA 3EKGA 3UJRA 2PPGA 1P43A 3R10A 4M6UA 3SJNA 4DWDA 3OP2A 1KKOA 3I4KA 3P0WA 2OLAA 4KWSA 2MNRA 4KT2A 4E4FA 2FKPA 4J3ZA 2OZ8A 2PP3A 1R6WA 4IHCA 2AL2A 1MDRA 3FJ4A 1ONEA 4DX3A 2AL1A 2QDDA 4H1ZA 2MUCA 4ZCWA 2OVLA 2RDXA 3SQSA 3ES7A 3FYYA 3QN3A 4HPNA 3JVAA 4Z1YA 2OZ3A 3TWAA 2P3ZA 1DTNA 4GYPC 4M0XA 3TWBA 2QJNA 3ZVHA 5BOEA 3ZLHA 4Z17A 1W6TA 1E9IA 1R0MA 3DERA 3STPA 1MDLA 3SN1A 3VC6A 4E5TA 3VFCA 1L8PA 4G8TA 3TJ4A 3SSZA 3I6TA 2GGGA 3ES8A 4F4RA 2QGYA 3ENLA 2DW7A 2ONEA 3BSMA 4H19A 3OZYA 3TW9A 4KPLA 4HNLA 1MRAA 1OEPA 3K1GA 5EU9A 1NELA 2PODA 3UCDA 1RVKA 3N4FA 2PGEA 4DHGA 4DXKA 2OKTA 3P93A 4GYPA 3EEZA 1XS2A 4GGHA 2FYMA 3DIPA 1FHUA 3NZGA 2ZADA 3N6HA 2PMQA 2P8CA 4FP1A 3RO6A 3DDMA 1EC7A 1BKHA 3OTRA 3CXOA 3N6JA 1YEYA 2XH4A 2PTXA 2CHRA 2PSNA 3VC5A 5IDZA 1F9CA 1EBHA 3B97A 4K2SA 3FV9A 5FJRA 3H70A 3T8QA 3V5CA 3HPFA 5FJOA 1JDFA 2HXTA 3CT2A 3DEQA 1TZZA 3H8AA 3DG7A 3SN0A 3NO1A 3MQTA 4GIRA 1SJAA 3VCNA 1EC9A 6ENLA 3QKEA 4HCHA 3OW1A 3MUCA 4IZGA 3TTEA 3UJEA 1XPYA 4GISA 3R0UA 2PA6A 3QLDA 4FI4A 5ENLA 4DN1A 3N4EA 3THUA 3T6CA 4JN7A 3U4FA 3QPEA 4ZA0A 3IK4A 4IL0A 4K8GA 1KD0A 3TQPA 2GGIA 3VDGA 4HCDA 3UJSA 3UCCA 2POZA 5BOFA 4E4UA 3RCYA 3OPSA 3ZLFA 3DG3A 1SJBA 2OO6A 4K1WA 3OZMA 3UXKA 4IL2A 1SJDA 2QJMA 3UJ2A 2PGWA 3V4BA 5FJPA 2HNEA 3IJQA 2PU0A 3MSYA 2ZC8A 3D46A 4ROPA 4GGBA 2I5QA 2NQLA 4A35A 4HCLA 4X2PA 3RGTA 3MWCA 2AL2B 4MKSA 4G7FA 1EBGA 2GSHA 2GGJA 1ELSA 3R1ZA 4KEMA 3Q45A 1PDYA 3V5FA 2HXUA 3MKCA 2GGHA 3BOXA 3H12A 7ENLA 2QQ6A 2OQHA 3DESA 1WUEA 1TKKA 3IJLA 4YWSA 3RR1A 3SBFA 1NU5A 4HYRA 3QTPA 4EWJA 2GDQA 1JCTA 4GMEA 2XH0A 2PTYA 4A3RA 4HNCA 3T9PA 2XH7A 2DW6A 3R11A 3PK7A 5J04A 2PTWA 4MMWA
chains in the Genus database with same CATH superfamily
3WK3A 4BS0A 4B4HA 2ZUVA 3RPDA 2VMFA 1C9DA 2HE8A 4LW7A 1WDDA 1BRLA 1V6UA 2BP1A 3OB8A 5HANA 6ALDA 2OFJA 4XKYA 5EFFA 5CPTA 3ZJKA 2GWGA 3ICJA 4GIEA 3W1LA 4NG3A 2YPIA 1KWGA 2WSQA 3W1PA 2WKJA 3PFRA 2QPSA 2V5BA 1X8FA 3BJSA 1QNPA 4K7YA 2VYOA 4LYPA 1TPB1 1VCGA 3Q4DA 5KZDA 1PIGA 1PTDA 2VI0A 1JZ6A 4J4KA 4TTUA 4GFIA 1LVLA 3LX9A 1N7KA 4L61A 1BGGA 4P7RA 5HQLA 5E0CA 3BLDA 2FTYA 3OIXA 3CM4A 5C54A 3I7QA 3OA3A 2PCEA 3F4CA 1S2WA 4W8LA 3DYMA 3EDKA 4M8UA 5C55A 4IUOA 4D1JA 2NQ5A 2GQ8A 2WSPA 1E15A 4L65A 3QKZA 1RPXA 5CZ0A 3RF9A 4P7QA 4PFMA 3H4GA 3PR2A 2V5LA 1QRQA 4ZTYA 1RCOB 3T8LA 4C7FA 3ARTA 4E6MA 1OFDA 3DFHA 1A3WA 3W27A 3ZO9A 5G2IA 2Q02A 2VP8A 2WV8A 4RXFA 1UD4A 3F4VA 4D9PA 4O0QA 1EJRC 4N4PA 3H4XA 1KCXA 3IUIA 1AA1B 4GH3A 2GDVA 4LTSA 4C6LA 4QEHA 1VQTA 3BMVA 3CZGA 3HGSA 3PHAA 2CEQA 5CSYA 1RZMA 5AHLA 2PF8A 3QHOA 3R5EA 3E0WA 3TFXA 1W56A 3SJNA 2KAUC 2DVUA 2YZ5A 3M1ZA 5DX7A 3E12A 3A3WA 4AHOA 1NFBA 1XIHA 4QJ1A 4QG8A 3RM4A 5K9DA 2YB1A 1TA3B 3AIEA 2ISVA 2OZ8A 3T4CA 3TONA 1JI2A 4ZXLA 1W1IE 2VCCA 1X6NA 3QSTA 1VFTA 3W70A 4DX3A 2E77A 2AL1A 1EGVA 5D30A 4IH3A 2GVJA 3ATZA 5AYIA 5KEZA 1VDVA 1GCYA 3A7RA 1C3FA 1ZQ5A 4GCAA 4Q7NA 1E4MM 3URQA 5C9WA 4HZMA 1Z69A 3NIYA 2OR2A 1AMYA 1VFLA 4TVUA 1KA9F 4POCA 5CZJA 1IT7A 2D2JA 1NARA 3BVJA 2DVTA 4M5PA 3O1NA 4GNKB 3C4UA 5CAHA 2OODA 4GR1A 2OEJA 3GHUA 1TMHA 3M46A 1UIPA 2ZTKA 3M0ZA 3SN1A 2XVKA 4CQ8A 4LNYA 1W5NA 5AHEA 3LHTA 2HDJA 3KVJA 4CN6A 3ES8A 1HGYA 2E9BA 3TYDA 1OGGA 2ONEA 2EQ6A 2PTDA 4O8AA 4U3CA 2PDYA 2WPBA 2NT0A 4DBDA 1Q6GA 1KTNA 2YW4A 1L6YA 5CZTA 3KTXA 3RYSA 3WK2A 2VX7A 3GU9A 2ACRA 1H60A 3SFWA 3LGEA 3W24A 3L9CA 3VINA 3KFTA 3LRMA 2P8CA 7XIMA 3CL7A 1ONXA 4GY1A 3RCNA 1BYAA 4IMCA 4I90A 3CH0A 1CI1A 1F7BA 1D7FA 4AZ7A 5IDZA 3GHTA 1XIGA 2BHZA 1ZNNA 1TA3A 3VABA 4ZQOA 4XX6A 3EDEA 3W3OA 4JTCA 1JUBA 1VBJA 1YBQB 5BU6A 1VBUA 1JDFA 8CGTA 1TR9A 2HXTA 4HNNA 4I5RA 3C2RA 3TQVA 4LFYA 2QULA 1KFBA 4DJDA 1R9XA 3VD9A 1JCLA 2EG7A 4K8EA 4DYJA 3MMWA 2ZVIA 1POKA 2OX1A 3HQPA 3CHEA 2Y61A 1PZ2A 3VI2A 4EANA 3PZTA 4MFEA 5TR3A 2JGQA 4M56A 3NZPA 2RJHA 3S6DA 3TTEA 1UJQA 3P84A 3W7IA 1UYQA 2CXGA 4IPPA 2X2YA 4PRWA 3CHCA 4RE0A 2QV5A 1BD0A 4NRRA 2VQUA 3N4EA 1CB2A 4NXKA 3U4FA 5FS7A 3EOUA 3V7PA 3G5EA 4UQCA 3LBOA 2F38A 2G8ZA 3AS3A 4BY3A 4GXWA 1E55A 3VPLA 1BTCA 1PL9A 5BOFA 1ZAJA 3RCYA 3ZLFA 4IJBA 5I07A 3PBGA 4XVDA 3E2VA 5CJ5A 2XHYA 4MHBA 4S3JA 1ISYA 3VFLA 1V77A 4AU0A 4LIIA 4FNQA 1EDTA 3VUSA 4H4TA 3AS1A 1XBXA 5FJPA 1UR8A 5REQB 4GQGA 3NL2A 5A95A 1MFUA 5CSSA 4XBKA 5DXXA 4JIPA 1MYRA 1KM5A 4NRSA 3ZT6A 4TR9A 3G1SA 3H2OA 1C29A 2WPFA 2I5QA 3WMSA 2DPEA 4J9JA 3CUZA 3TH6A 2PWVA 3MSDA 1IIHA 4GK8A 2BVWA 3LOTA 3BL3A 4JCLA 3BK0A 3SZ8A 4U2ZA 2QVNA 3WY1A 2YSWA 1VEMA 1QPNA 3N4AA 1XSIA 3TN3A 5DBTA 4UTHA 1LOSA 1ZJHA 3C8NA 1UWUA 1TPWA 5LIXX 1TMQA 1RY0A 1SB3B 4S23A 1OX4A 2RKXA 5JIWA 2E1WA 4JQ1A 1ZS2A 3VU2A 3W76A 1R3YA 3UETA 3SIZA 3N25A 2VHLA 4MMWA 2E68A 4BF9A 4QS6A 3RM9A 5LNRA 3MWAA 5IOBA 1Z44A 4IP7A 3ONBA 5CPQA 1CEOA 4BF5A 1YXYA 3G6LA 1XHCA 4MGGA 2BZNA 4GWEA 4EIVA 4BWLA 4HN8A 1JFHA 4APNA 4Z2IA 5JBDA 1XD1A 3WJSA 3ABSA 3QOKA 1Q7ZA 1EDGA 4HU3A 2O7SA 4AEFA 2C13A 1VYRA 1I2RA 2EGZA 1H7OA 3LSBA 3JZEA 3LI1A 2WOIA 1GQLA 3VUPA 2OZTA 2NXIA 1KFJA 3LLDA 4K7VA 4LWWA 5T8GA 4US5D 1EFZA 3LHVA 4Z42C 2VVNA 3U7BA 5BNKA 3PNZA 1EWDA 1DQWA 4UWMA 2D0HA 1HL9A 2WC4A 3IJIA 3R58A 4Q33A 3CEPA 3Q37A 4N9BA 5FOOA 4QJ4B 1R7AA 3GXIA 3Q2DA 4JOMA 3G8EA 1GKPA 2QDEA 2CLHA 3LN3A 4OKDA 3B0XA 1UH4A 3ORWA 2VRKA 4QX4A 4N9DA 4IG2A 3IPWA 4HOXA 1BGAA 3FVMA 1KRAC 1NP2A 1X8CA 3JW7A 3T05A 4HBKA 3GHRA 2O56A 2V8ZA 3BG3A 2B7OA 2OQYA 1NSJA 2C18A 3B9OA 4PCPA 4D8ZA 1QO5A 2X41A 4H3DA 4FX9A 3SGUA 4UTWC 3A6OA 4XIAA 1VRXA 4CD4A 5XIAA 2IS7A 1E9ZB 1LL6A 4O52A 3OVGA 3I65A 1M53A 1HL2A 5LHEA 3U2EA 3V75A 5D9PA 1Q1RA 4J27A 1CXLA 4HKPA 2H90A 2V3AA 3JR2A 4C5YA 1T41A 2OO0A 3FNDA 3GH5A 5PTDA 4DWDA 4AYSA 2NQHA 3TTYA 4LU0A 5ABTA 2WZHA 3SQPA 1KRMA 1Q6LA 1RHCA 4XSMA 1TTQA 3UG5A 2XIIA 3IIPA 3OG3A 5HUPA 3QY6A 4G1NA 3FJ6A 2NUXA 1XHGA 2J25A 2WZTA 5C71A 3L21A 1WBJA 4JFUA 3W74A 3F2BA 3CAVA 1WAWA 4M3PA 5I00A 5DXYA 3PULA 4GA8A 4TTGA 5HPCA 2VGFA 4MNLA 3TN6A 4JR5A 2J7GA 2PZ0A 3EPOA 3WLPA 3C2EA 4NZ5A 4S3FA 2VGGA 3FXYA 3AQUA 2VO5A 3OODA 4J40A 2X0SA 3M0LA 2C79A 2YA1A 2QJNA 4YTQA 4ATDA 3KBVA 1JROA 4IXHA 2REQB 4Q8WA 1GVOA 1AOGA 1JF5A 2VD8A 4WVXA 1MQRA 3RG6A 2PWGA 3T44A 3BMWA 1FP8A 1GORA 1XCFA 2G3MA 4L9ZA 4QSFA 3OHMB 3QR0A 4HNLA 3S42A 4FPSA 4AF0A 4AZCA 1Y8BA 2XGIA 3W84A 5A69A 4GVIA 4MDOA 1NDZA 3PZGA 2E1DA 4NZ3A 3RX4A 2PGEA 3CGTA 1NF7A 1B0IA 1OX4B 2YLLA 3W7NA 1CX9A 3WH6A 4KRZA 4AG0A 1XRFA 1FFUC 3ANYA 3UT0A 3S9IA 1Z48A 1V3IA 1XKJA 1FEBA 2VFHA 3STFA 2VC7A 5FEWA 5I3FA 4CEXC 2Y8UA 2CESA 5KTLA 2WP6A 5AC8A 5M2FX 1EBHA 1UG6A 3KL3A 1DOSA 2PDIA 4QJ5B 2DZBA 2YXOA 4GXPA 1KBKA 3B03A 4PRRA 4D6FA 1ZENA 1BYDA 1ZP3A 5AKQA 3FA3A 2YCEA 4RXGA 6A3HA 1YDNA 3AHYA 2DQXA 5I3HA 1NM9A 1X2HA 1XLHA 3WD3A 3C2VA 1N62C 4LRSA 3IANA 3CUJA 2XIJA 2OSWA 5EMJA 4G7EA 1XKYA 4ZO9A 1PX8A 4O10A 2WNQA 4BKNA 4PYSA 5LIUX 1JDEA 2O0TA 5CLWA 5BXPA 5A2AA 2ZZCA 3W2UA 3W2MA 1LP6A 4S3GA 1K4QA 4XUGA 1UBSA 4LANA 4K8GA 1HP4A 4H41A 1VEOA 1BRLB 1XRSA 2VR4A 4R3UA 4L80A 5E9AA 1PKLA 3H54A 1D2KA 4LBRA 2J8TA 4D6GA 5D8ZA 1G5AA 4NQ1A 3EA3A 4YU1A 4PMXA 1GVIA 1EEXA 4K36A 3S1GA 1H7NA 5M1TA 3AZRA 1QPOA 8XIAA 1CENA 5SWUA 1UZ4A 4EKJA 1LJYA 3OBAA 1X1ZA 5EGRA 2UY3A 5FEPA 1Q65A 1DWIM 3THAA 2VURA 4PBGA 4QNWA 1E9LA 3XISA 1JG9A 5FS6A 1W3KA 1NHPA 3HW2A 2HVMA 5JCNA 3AYVA 3L5MA 1TPVA 1YYAA 3O0FA 3N1AA 1J93A 2OLSA 3RGTA 2A7NA 3LG3A 1ZY9A 2A3CA 3ARRA 2CPUA 5HUOA 4Y6GA 1K3UA 1HL8A 1G01A 3WFLA 1BAGA 4KEMA 2OGJA 5G1YA 1OFBA 2FPVA 3GG8A 5C6MA 3GVGA 2YCKX 4MWAC 2AAMA 2ZZ3A 1Y5WA 3PAJA 5CC7A 1IWAA 5E6ZA 2XSBA 3DFTA 1B3YA 4UBPC 3GNPA 4WDXA 3CQHA 3G2GA 2OSXA 1N5XA 2WQDA 1S3TC 3VGFA 3K13A 1J8VA 3UQNA 3BCFA 5AVHA 4KESA 2PAJA 5F2IA 1FEAA 2Z4GA 1F4AA 1XLFA 1UZHA 1ZZMA 4MNJA 1P0EA 3AM9A 4H01A 2XVNA 4HK7A 3SRKA 4ERAA 4JY9A 3DGBA 1DV7A 4Q8UA 2QUTA 5DRCA 1B3WA 4L4MA 4IGNA 4JN8A 4IM4A 3W2JA 2J78A 2ZCGA 3BICA 1TVPA 1C8YA 1TYGA 1UWAA 1B9BA 1K8XA 2WPEA 1IZKA 3T4WA 4EPEC 2TAAA 1J5SA 3W53A 4MG4A 1OK6A 3E2SA 1TV3A 1GJWA 2QYGA 1V0NA 3UU0A 4GI4A 4KEVA 5K3VA 3NSMA 4HPXA 4PUWA 2RGMA 1NHRA 3WELA 4BURA 1BZLA 3LPFA 3T7VA 3L0NA 3PG9A 3VNLA 1M41A 1W1B1 8A3HA 4K1GA 4J3TA 3QMRA 1V3KA 4ADUA 3EXRA 3B8DA 5H8MA 2V30A 3M9YA 2EKCA 5FJUA 4DB7A 2DZXA 3QC0A 2QAFA 4N0RA 4YCPA 2O7QA 3GO2A 3LSCA 3VNIA 1F3EA 3TYEA 2AAQA 2X0YA 3URNA 3PWGA 3T0CA 3QMSA 1Q5MA 1U1UA 1X6UA 1VFHA 1AODA 3T1GA 2D2OA 1VLIA 2BDQA 1KC7A 2PP1A 2EPNA 1E6XM 3KOFA 2X40A 4O1DA 2GYIA 4OBSA 5CBJA 5LNSA 3URAA 4GG9A 3T0BA 1RPKA 1GVEA 2P88A 2W55A 2EXOA 1IEQA 2D20A 3MSGA 4G2DA 4Q6JA 4MAVA 4WCJA 3WLMA 3DH7A 3ANUA 4PBEA 5A6KA 2WO5A 1RM6B 3HF3A 2Y63A 4ICMA 2C15A 3LUTA 4N7QA 3LCLA 1XGZA 3AN1A 2PUZA 4LJ3A 3NA8A 2CLMA 4LAMA 3PZQA 3MMUA 4AHPA 4JDBA 4JNMA 1QTWA 4UCGA 3EWCA 1PWLA 4A05A 1KLZA 3CO4A 3WD4A 3W1RA 1PCWA 1R9ZA 1I2PA 3H2AA 1O5RA 1H0GA 3SEPA 4LC6A 2E9LA 4S39A 4IHCA 3S6TA 4A3HA 2VWSA 4QQ3A 1J6OA 3S1WA 3H2CA 3GVRA 1H7WA 2CZVA 1M7JA 3WLJA 4XBSA 4UR8A 4YS1A 4MF4A 4F9DA 3MTWA 1TQXA 2J8FA 3B0PA 2VDIA 3WF2A 1T5AA 4R27A 3DH9A 3SGGA 4JYEA 1KR0A 3PZ9A 4R5EA 1KRBC 3QGAC 4QISA 2BC1A 5E9XA 1DTNA 3WK0A 4GJ1A 2IXVA 5I7GA 2BMBA 3DAQA 1V6XA 3VGDA 3OLEA 1R0MA 1UKPA 4W8AA 4WSHA 1YLVA 1KO0A 2WLYA 5A8NA 1K7FA 3VXGA 3SSZA 5FJJA 3DBPA 4NJIA 3HJEA 2DW7A 4PTXA 3LEPA 4GZ7A 1KCKA 1C93A 2XU2A 3TNOA 3DI0A 2X7WA 3EANA 1JXJA 1IXNA 1HKVA 5KZMA 2ON3A 3BE7A 1S38A 2OYLA 2VDGA 4Z2KA 5KVIA 3SCPA 5IHSA 5JBEA 2UY4A 1WKDA 5CPNA 3NXFA 4P2VA 4UQ9A 1KQZA 2QUVA 3NZGA 4R7OA 4D6DA 4GYJA 5FF0A 3VGBA 1XYBA 1BSLA 1TV8A 2OZ0A 1DJGA 2CC0A 2INZA 1PTAA 3RIKA 4JAWA 3IEBA 4B5TA 1EOKA 4ZL1A 1IXOA 4H7VA 3NZ1A 3CXOA 1FWHC 1YEYA 1KGWA 4DPQA 2GQ3A 2VZSA 2OSYA 3G22A 3R13A 4DLFA 2VZVA 4K2SA 2ZA3A 4N2YA 3WDRA 4X9YA 3W01A 5A8OA 1BXNA 3FA5A 2PDXA 4X3ZA 4FF7A 3DEQA 2OXNA 3UG3A 2P3EA 3L5AA 3HB9A 2H9AA 2NWSA 4JKKA 2ZA2A 3PTQA 4RZBA 4EM3A 3AMLA 2VDHA 6ENLA 4H9YA 2CLKA 2ABBA 4CQAA 1YXCA 3M5ZA 3CBWA 1I2OA 5FF4A 3R0UA 3JRKA 1HJSA 1W9PA 2JKPA 4FI4A 3PBYA 5JH1A 3GLCA 3HMJG 2D23A 4LUTA 4YTUA 8RUCA 3KCJA 2IQ0A 4KCVA 2E6DA 3BZGA 4JICA 1K70A 4LB4A 1W5OA 3SCSA 3HRDC 4GYKA 1R7OA 3ZMRA 3CIXA 2BS9A 4JHOA 1EZWA 4DUWA 3QQWA 1UKQA 4I7WA 1ML1A 2VOTA 3NS1B 1SW7A 3WUBA 4YNGA 4B90A 3BLFA 2V6AA 5LIYX 4NX0A 1E72M 3E0VA 4RJEA 2PDHA 3CJPA 4RDWA 4REQB 3GD4A 3TX9A 3GNXA 1TJ2A 3PM6A 4N9CA 2PWFA 2QIIA 4C6PA 3AMDA 4EAYA 3PUOA 1EBGA 2CLEA 3UZ5A 1RA0A 1EHNA 2HXUA 2ZIDA 3EWXA 5IFPA 2RGLA 1IGWA 1RXOB 3BAWA 3WEOA 1YKWA 1LRQA 3IJLA 2HVOA 5FL0A 4TVWA 5H91A 2Y4SA 3I68A 4EWJA 4PUUA 2A3AA 4I7VA 1J0HA 3NPWA 4KRUA 1SM9A 4LV9A 1Q1WA 4LYKA 3LYEA 1HNYA 3EPMA 2DUAA 2R8WA 1OZQA 1OIMA 4LS1A 1VFFA 3TCEA 1XINA 3O16A 4DZIA 4HYVA 3PF3A 3NXLA 1MSSA 4LUIA 2VOMA 1S2UA 4QSHA 1OJXA 1EA9C 2OPJA 5H8UA 1ONWA 1LBLA 4TXEA 3W75A 2CYGA 4NZCA 2WHLA 2NX3A 2Y7DA 1TRIA 4K68A 4F0RA 3WBAA 4PSPA 3MB9A 5CSRA 1EGMA 1EJVC 2W6RA 1GTHA 3GNRA 2INEA 3CB3A 3PBVA 5CGQA 5F1UA 2J13A 2XPKA 4Q8NA 1V5XA 4LS2A 3VNZA 3CT7A 4UR7A 1WO2A 4FX6M 1GZ1A 3U4AA 4DF2A 1O5QA 4P61A 1CZ1A 3MJMA 3W1XA 1E3ZA 1NVMA 1VJSA 3D6NA 1WA3A 4GNJA 4DBSA 5CAKA 3B8WA 3AXXA 3M43A 4J7RA 4Q4SA 5DQPA 4JQAA 3KLLA 4NL1A 3BAJA 3O05A 1VHCA 2QF7A 4UIOA 3WEMA 3ARXA 4KRTA 1FCUA 1H4PA 1F2JA 2I14A 1GOXA 4P8UA 4QDWA 4GLEA 2YYUA 4HD5A 3KVKA 2H8XA 3DFSA 4PUNA 1E1FA 1K7EA 3GW3A 3BCDA 4HZ6A 1V3JA 5BW6A 3REQA 2B81A 4C6BA 4PTDA 1T3QC 2IUZA 3NVYB 2ZE0A 4XTDA 1YPXA 4GFSA 1UR9A 4P8XA 2PZNA 5AFDA 3ZFHA 3N2XA 4NNCA 2QPXA 2FZBA 1GK8A 1XWYA 4XQ6A 1UZ1A 3BAXA 1JNDA 3AFBA 4H8HA 1BSIA 2X16A 2FDMA 2FTWA 1AQMA 4ACZB 1GPFA 4I3GA 4DYEA 4PR4A 3M47A 1ZMCA 4QNEA 3PY2A 1QW7A 1OYBA 1W91A 2GRTA 1K9DA 3GR8A 1PB0A 3WQEA 2GOUA 3RPMA 3IGSA 2NX1A 3B8TA 4LVGA 3RLUA 1KM1A 3LTPA 2CBJA 4KT2A 1CW2A 4WGHA 3CEUA 2QKFA 4UTFA 4PMYA 4IQEA 3FN9A 5A6AA 3WL0A 1KBBA 4IG2B 2MUCA 4LALA 1CXFA 4ZCWA 4NHVA 2V2CA 2YL5A 3UXDA 2I57A 3AHVA 4IFKA 4LUSB 4MWAE 3G1HA 3EOSA 1CXIA 3AS2A 4LEFA 4H8UA 3EB3A 4H9ZA 4X0NA 1QCWA 3DBNA 1M68A 5C9UA 1HIZA 3PZVA 1KFLA 3L2MA 1J12A 1E4IA 2ADAA 5AYXA 3W6MA 1YHTA 2INFA 1BPLB 5I06A 1FFVC 4DJEC 4CQBA 1MDLA 4HQVA 3BGAA 3APYA 4XG1A 4HK6A 1V3HA 2CBUA 2PF0A 1BG4A 1QHPA 4O28A 3G3MA 3PJUA 1TJPA 2BVYA 4B92A 1GERA 2GK1B 1D7KA 3OZYA 2FZMA 4KPLA 3U2ZA 4FLOA 3CO8A 4FLQA 4V2XA 1Y0EA 2WVTA 4RDZA 3GR7A 4GIYA 4F0HA 4GVGA 4NNAA 3EWZA 5D2VA 3VYLA 1KGXA 3ZJ6A 3U0HA 3W82A 2BY3A 3DGRA 2BGNE 5AC5A 5E0FA 2HROA 3L4XA 1DJHA 2FYMA 4MADA 1SSDA 4JTRA 2Z6JA 1O95A 5G1TA 2PMQA 1ICPA 3UYIA 3RO6A 3DDMA 5G5GB 4ZBCA 4Z1CA 4Y7EA 1O6IA 2BVTA 5TF0A 2OYKA 1TYPA 2FZ9A 4PRTA 5I09A 5KITA 2QCDA 2WCSA 2XH4A 2J8GA 2CHRA 3SADA 1LORA 3GIYA 4Z2GA 4N42A 5F4SA 2EG6A 3PB2A 3VNDA 1QPRA 3MT1A 3H70A 3N12A 4IPJA 1R46A 2ZXQA 1A3HA 4WY0F 4Y9NA 5C7VA 4AISA 2VM8A 1HX0A 4Q3MA 1BWVA 4IIEA 3WZ0E 1M01A 2BGSA 1GW1A 2WMIB 4GE8A 4XKMA 1YDOA 1FWNA 1I0BA 1OGBA 2GLKA 3MHFA 3CNYA 4RE4A 2JGYA 2NSXA 3S2JA 2VEGA 5E1QA 2G0WA 2OMAA 3HN3A 1XQLA 4FEZA 1ISVA 5FMHA 1L2QA 1F6PA 4I5XA 5AECA 4UTWA 3IJDA 1DP0A 1TWZA 3LLXA 3IK4A 2PDUA 2X0HA 1FDZA 3I3BA 2X8HA 1TO3A 3UCCA 2POZA 4F9JA 4J2PA 3M41A 5MF5A 1AVAA 1IZJA 1IWPA 4NEWA 1Z89A 1GVFA 4V1YA 4GHRA 2OO6A 3NQMA 4M6QA 3IJ7A 1JCXA 3V0SA 4UTKA 3L12A 2F61A 4C6NA 1NOWA 3P81A 3WJZA 1GESA 4YTTA 1E0WA 1VS1A 3UA3A 1JGMA 1L9WA 4RV8A 1UOKA 3A3XA 3C2YA 5C0QA 1E1CA 1TQJA 3LCFA 3NQ6A 1AH0A 3WLLA 1IE7C 2F7FA 4GKTA 1SR0A 3VIIA 2OB3A 5U7SA 4LT9A 4UMAA 3TXVA 3H21A 1UC5A 3U3HA 1EIXA 3CMJA 3KAOA 3GIPA 1XQKA 3R0DA 3ITGA 2GJXB 3WQFA 4JIHA 2J7CA 3EWDA 4GQRA 1PZ3A 3KDNA 2AQOA 2FTPA 2VTFA 5EMLA 1VF8A 2DY3A 2GDQA 4DQWA 2FB2A 2L5HA 2PTYA 1HUVA 1LG1A 1PCKA 1JUEA 3MP3A 1FA2A 4HA1A 4IPIA 1YE4A 1O12A 4WK9A 4KW2A 2WBKA 1VRDA 3W1AA 4CLMA 5BXTA 4Z2JA 5HMFA 2IPGA 3AUJA 1GOWA 3S9ZA 3H24A 3WENA 1LG2A 2J7HA 4Q8PA 3WCZA 1E6RA 4YWIA 5H8PA 4O19A 4CVUA 4UTUA 2WNNA 2HV5A 1W1YA 2Z00A 1TIWA 2CLIA 3P2VA 2R1MA 3SIMA 1DEDA 1H62A 3QTGA 3IC9A 3S0CA 2FGBA 4GUGA 1GRBA 1OD0A 5IRPA 1T6MA 3OLDA 2FFCA 2ZKMX 2JF7A 3WYZA 5C8BB 3KW3A 1XV8A 5D9OA 3H22A 3FFSA 5D03A 2CXEA 4A4AA 4DLMA 5JIPA 2ZUMA 3VA8A 3TYBA 4AAJA 1JAEA 2V5KA 3NM1A 1LBFA 1EP1A 4KKXA 1FWBC 3B9AA 2GK1A 4MYXA 1ENUA 1E1CB 2CKSA 3S1UA 3LY0A 3WUFA 1I2NA 2JEQA 3BXWA 3GD3A 1X39A 4H9MA 1R3VA 2FHCA 2BTMA 3DUGA 3VZXA 1X2GA 4ZFCA 3SGZA 3RX2A 1HW6A 1HN1A 4JY8A 3J7HA 3S4TA 1YTKA 5F4XA 5HJYA 2G3NA 4ML9A 2Y62A 5BXRA 1T99A 3MZNA 1XXXA 3KBNA 3KRSA 2QLYA 4C5ZA 1TIMA 3AU6A 3G3DA 4F3HA 3C0QA 3CTLA 3DG6A 2DP3A 2XFWA 3UA4A 1XW8A 1MRQA 1TYTA 3HM7A 5EBAA 4UB9A 4D72A 3GU1A 4DBWA 2NZLA 2AKZA 5A8PA 4ZOBA 1MQPA 1GQNA 4J1OA 3MY9A 3MP4A 3F5LA 2YX0A 8TIMA 5CG7A 1XP3A 2WM1A 3FXGA 3IWPA 1H49A 3VD3A 2ZRYA 3IAQA 3SSJA 4JX4A 4IFRA 2H6RA 1VD6A 1XYAA 1Q3NA 3SY5A 3TJIA 3W85A 3O63A 4NUWA 4JIIX 1SJCA 4E8GA 4YYFA 4BEQA 1JZ4A 2PPGA 4IPNB 2P5NA 3R10A 4P7NA 3LD5A 4HMNA 3ID7A 3MANA 1XRTA 4JHZA 3FAWA 3HPSA 3Q58A 3R79A 3EX1A 3UWQA 5HMDA 3VOFA 3E2QA 4OOZA 4J3ZA 4CCCA 3D0CA 2B7PA 3UERA 3DJJA 1TRDA 1S5NA 1TJ1A 4ZOCA 5K9CA 1JZ3A 1FH7A 3ARYA 2XINA 4WHBA 5G4HC 1J18A 2WHKA 3WDPP 4O11A 1DWGM 4C1LA 3A22A 3L4UA 3G0UA 1HVQA 1S46A 1GQKA 2QMJA 3OBKA 3MUAA 2NQZA 4Z1YA 3G77A 5GNXA 3TW6A 2NLYA 4GI6A 3FOKA 5BOEA 3ALGA 1RVGA 1UA3A 1FWIC 3NO5A 3UG8A 3AWNA 9CGTA 4E0CA 2I5GA 3LB0A 5FKYA 2CWXA 1L8PA 5D2WA 4MNMA 5DANA 3G1DA 1SZRA 3ZR5A 5IXEA 5HWJA 3L0GA 4EX4A 5A1AA 3W0KA 3WNNA 2C16A 3LBMA 2Z25A 1OFPA 4H19A 3HA1A 2A5HA 2C0AA 1POJA 5ER0A 1A5LC 1R85A 4TIMA 2IKHA 2J66A 3MW7A 2HNHA 1VIZA 4AFYA 1ITXA 1LWIA 4B5VA 3EDFA 2NX9A 4QP0A 5JCMA 4MLRA 1L6SA 5C9ZA 1THFD 4IQLA 1GRHA 1SFJA 2QMKA 1W9XA 4F0LA 1CCWB 4GZJA 1BKHA 4W89A 4E2OA 5B80A 1JZ7A 2YFOA 4JTJA 3WNKA 2R14A 3KL5A 5A2BA 3AI0A 1R3TA 2RDTA 1UBPC 4REQA 3HFYA 1G4TA 3WL1A 3B8SA 4PSRA 4ADTA 2ALRA 2ZX8A 4UUIA 3CV6A 5EMYA 4KIEA 2C3DA 3DHPA 2A4AA 4KFPA 4C7DA 4EK7A 3R8GA 3WH7A 2G95A 4HYWA 3RU8X 3IIOA 3H8AA 3R94A 5LNVA 4LQ1A 3NO1A 5AVNA 1AL8A 3N14A 1XFBA 1KR1A 1YNQA 2VCBA 3UR2A 1QW9A 1S5MA 4KCWA 4W7UA 2DJLA 4HNTA 5EBKA 4AWTA 3C0LA 1WZLA 2WVVB 4HCHA 1R3QA 1ZAIA 2Z28A 3SCWA 2G3FA 3ABQA 4GOAA 3MPGA 2WW5A 2R91A 1PJ9A 4OQVA 3OQ8A 2ZX5A 4EPDC 2AQWA 4XD4A 4LGXA 5DLCA 3CS2A 3WQ8A 1G9HA 5J5DA 3W87A 1VB9A 1IR2A 1QOPA 5CBIA 4C1NB 5TIMA 4KCUA 4E4UA 3VMNA 4CQDA 4I7UA 2BSLA 2NV2A 3GSMA 4Y90A 5AHFA 3RJXA 3DENA 2TODA 1SZFA 4CU7A 3B06A 3UXKA 2R1PA 3QHMA 2FQIA 1XIIA 4XAYA 4LXFA 4K8HA 3V1PA 1JXKA 3TZNA 2XJ7A 4MKVA 5F2LA 1U1JA 3MSYA 1ADDA 3TN4A 1NHSA 5E09A 1ME8A 2XZ9A 3IIXA 2V63A 4GGBA 1A5SA 3FEMA 5IBXC 4JFTA 1W0MA 3PBMA 4YVXA 4P8WA 3VD4A 5C9XA 5D9NA 3DFPA 3CZLA 4EM4A 5HR7A 2GVGA 3Q45A 2GDUA 4WF7A 2PD9A 1FWCC 3DJGX 1DJXA 1D9EA 3APTA 1JYNA 3T55A 4KFOA 1LQ0A 1JVNA 1V08A 3NOEA 4JD4A 2UY5A 3DESA 1XG4A 2ATMA 4O13A 1TKKA 3V36A 3ZSSA 3SURA 1JR1A 3MMDA 3QTPA 1WQ5A 2D22A 3W1TA 1JCTA 2XH0A 2Y88A 3DECA 4JEQA 3F4NA 4HNCA 4AC7C 1TTPA 4DELA 4UQBA 1A5UA 4B5UA 1LOLA 3IK2A 3POHA 3TAOA 1U33A 3TROA 4DJED 4ENLA 2QNEA 1A47A 3ITXA 3FG2P 4DAFA 5HATA 2D2GA 4NJJA 5CJNA 3SB0A 4I9AA 2Y5JA 2DSUA 4JNZA 2CDUA 1K1DA 3A23A 4NT0A 1CT5A 3HBLA 3U8GA 1N2VA 3FK4A 2VUNA 2YDAA 2EPOA 1IEVA 3MVIA 4O14A 4UFIA 5HMSA 3LCHA 5D33A 3UEQA 2CW6A 4M6VA 4HSOA 3M4HA 1I6NA 4BEUA 2WVSA 1XM3A 3N2CA 3H7VA 1DQXA 1TUFA 2ANUA 1O1ZA 1A53A 1A5OC 1WE5A 1Y7VA 2W79A 5BXSA 4B5WA 2Z7GA 3EWUA 5EB8A 1TCMA 3GTFA 4Q4PA 1I1XA 1MWOA 2VXNA 1XSKA 4IP4A 2BX7A 1KRCC 1QXLA 3GQYA 1QJWA 1K77A 4BK9A 1F5ZA 2R1LA 4ZSUA 5K4ZA 4F2UA 4WOZA 3TYUA 2CCRA 1ZFJA 4O1AA 4RL3A 4FNTA 1OCBA 2IW0A 3M7SA 3W7KA 4F2BA 3WD0A 3BLOA 3PUDA 1X7IA 4HNOA 1N5WC 3N18A 3KP1A 3TYAA 2Y8KA 4L4OA 1W3IA 3C2OA 4ZQPA 2DZTA 3GTXA 5JRBA 2WJDA 1ZP4A 3RHGA 1OFEA 3TW7A 1QNRA 2P0OA 1ITCA 2PU1A 2V2HA 5TAOA 3TFCA 1OHLA 1VPQA 3WQPA 4HMDA 1NDVA 2FJUB 3UGVA 3NVTA 3AC0A 1MUWA 3PJWA 3NQAA 2VNCA 2I9UA 3ZVIA 4EMJA 4WXYA 1L8NA 4Y8FA 3L2IA 2DT2A 1E0VA 1HVXA 3MVTA 3U48A 3HQOA 4DJDC 2XTKA 2EO7A 4QCEA 3RMEA 3BG9A 3WH9A 3MUXA 1WXZA 1HGWA 4B16A 1JGIA 3GK0A 4MOZA 4Q4RA 2EQ7A 1TG7A 2ZBTA 1UP3A 2PB1A 4E2BA 4Q4KA 1S2AA 1R3RA 2FDSA 2WYSA 1AFSA 1LYXA 1ODZA 4MVAA 2VFEA 1F3TA 4GNVA 4LVAA 3T81A 2A7PA 2AOSA 4H7CA 3TAKA 1TZ9A 4IX2A 1KCLA 2BWGA 2ZZ4A 1UPPA 1P0NA 2VENA 4Z0SA 1OK4A 4MJMA 4GKLA 3DHFA 3F2CA 3RO8A 3VDHA 3GXMA 4MLJA 3WUGA 3STPA 1LCOA 4FAMA 1EO5A 2WOVA 3A5VA 3SRHA 4BV6A 3AYRA 2Z1XA 4WSJA 2E3ZA 2X8RA 3GR4A 3H55A 3KRBA 3SQLA 1FP9A 2Z1WA 3BSMA 4XKYB 3MA8A 3U2OA 5DT7A 3GKFA 3INPA 3CMFA 4HJWA 1QATA 1EJTC 5HNRA 4DF1A 5A6LA 2W5FA 1FOBA 1HP5A 4YTRA 3E3HA 4UTTC 3W6LA 3SDOA 5F4WA 1B4KA 2ZADA 3A9BA 3UPMA 3B4UA 3WF1A 2PE4A 4JIEA 2PDKA 1ITQA 1W54A 1US0A 4DI9A 2PDFA 4B5XA 1W31A 2H3DA 1E6NA 4RW3A 1LWJA 2PSNA 3XINA 5CLTA 3SUWA 2R82A 5F1VA 3Q94A 5HQEA 4XO7A 4GY0A 5KVHA 4OZOA 3O0HA 3LM7A 4DI8A 3W7RA 3DG7A 3WLKX 3HJZA 1V02E 4TMCA 3KE0A 1QPQA 4CCDA 3MQTA 1K9FA 1DIKA 4EPKA 2VELA 3OHIA 1HF6A 1QOQA 4HZ8A 1EEPA 4LVDA 2W27A 3B9JB 1OF6A 3GXDA 1SMDA 5ENLA 4B3KA 4DN1A 5FI8A 3UZXA 2OKOA 2BODX 3NEHA 4AH7A 3UNDA 3WDQA 4DUXA 3HPAA 1H6VA 5AC4A 4L56A 3M0YA 4YMZA 3WBXA 3IGUA 4KH2A 1ZY8A 1R2TA 1ZB5A 2V2DA 3LNMA 2DZUA 1V0KA 2PRMA 4B91A 2KX9A 4ZO6A 2YKKA 1X7FA 1VBRA 3Q65A 1LZOA 4C6EA 4UFJA 1JAKA 5LGZA 4H6KA 2V5JA 2TMDA 3G1AA 5HAOA 2ZX9A 5D2XA 4NI3A 4GY7A 1CGVA 4X2PA 1F3XA 3NOYA 3GVQA 4AWSA 1ZX9A 3W37A 3HIJA 4LEQA 2CLFA 1Z9AA 1UASA 4X0VA 3GS6A 1HG3A 4RDYA 1AQFA 2CITA 2J27A 3PZIA 3W25A 5F7UA 4ERGA 4ZQMA 4FNRA 1GOIA 3OLIA 3B0VC 1WZAA 2HBVA 2WC3A 1QNQA 3AALA 4LPCA 4YVPA 3RM8A 4H9VA 4L9XA 3GX9A 3HV8A 4MY8A 4W8BA 4DM2A 4FMVA 4AZGA 1CXHA 1SZEA 3KLKA 4WSKA 5HNUA 2RABA 4AMCA 1WXYA 3LXAA 4ZQCA 4ADWA 4TUFA 3TOYA 1JPKA 4RV3A 5A2CA 2DT0A 2ZZ1A 4M81A 4JQ2A 2XVLA 1PAMA 3WD1A 4IIFA 1MO0A 3W2LA 1QPKA 2ZZ2A 1AJZA 4PA8A 1VAHA 1JYXA 3E5BA 5M5DA 3E0LA 2QDHA 4AZIA 4JTTA 1OJTA 3GY1A 2EBNA 4D2JA 3IVUA 5D02A 5HMEA 4LUYA 4FO4A 1EOMA 1H7XA 2BY0A 3ZWTA 3D47A 4AZBA 3A4AA 1JULA 3F7JA 3VIGA 4JBRA 4RW5A 1RP9A 5GRTA 2Z6IA 3W6YA 1BVWA 1UD8A 3NFUA 4S3CA 4ACYA 1UUMA 2ACQA 2Q8ZA 4WJ8A 3TR9A 3VOCA 1EPXA 1SPQA 1XLIA 4XO6A 4AQLA 1RBAA 2Y8VA 1XJBA 5LA0A 3HURA 3TJLA 3SR7A 5ABHA 1O1HA 1P48A 1M1BA 3AIVA 3Q67A 3WBEA 1WBHA 4TV5A 4WY0B 1R5YA 4QCFA 3PWAA 5GPRA 3N11A 1LF1A 3F5KA 3YPIA 3WH8A 3W23A 4LVBA 1YQ2A 1W9DM 1FDYA 2F2KA 2J24A 4TVYA 4CD5A 1W8SA 3MI3A 1ZBCA 3UWVA 3NYZA 1RP8A 3SCNA 1TB3A 5CXPA 4FXFA 2HTMA 1XLKA 2QVHA 3ABXA 1WDPA 3IARA 2EJ1A 1FHDA 4GRTA 2BGQA 3KVLA 3VOJA 1E0TA 1W1A1 2A3HA 2FB3A 1JYWA 1EYEA 4O8RA 2TYSA 1QHOA 3W71A 1RALA 1FUYA 3V3WA 4RNHA 1K6AA 3WQOA 3KP0A 5REQA 5LXEA 3UPBA 2TPRA 2DQWA 1VC4A 1X6LA 3IRDA 6CGTA 3BW2A 2ISSA 1V03A 1UWTA 2MNRA 3GG1A 3QFBA 1BWKA 1J0IA 2WSYA 4UTIA 5FF7A 1W3JA 3CUHA 4PUDA 2RAGA 5H1WA 2A85A 4NYUA 2OU4A 4C6MA 5FS8A 1RQHA 1TFVA 5I6SA 4X2RA 4PCTA 1DIDA 5GQBA 1ADOA 2Z1BA 3AAMA 2W3ZA 2Y24A 3NQFA 2V69A 4KQNA 4CCZA 2HISA 3NVWB 1XG3A 3W9ZA 3W7DA 2DDXA 1H1ZA 3ELFA 3HGJA 2XZ7A 3VKJA 4Y9PA 2HMCA 2A3LA 4BI7A 3B8IA 5M17A 1S7MA 3EX6A 4DJDD 3A12A 9RUBA 3KRUA 5BRBA 5G1MA 1DXLA 3DKLA 3VIMA 3QR3A 4TMBA 4GUIA 4O54A 2JK2A 3IV8A 4H4PA 3ARWA 3M0XA 4JX5A 2Y7EA 3T42A 4DJEA 1PIFA 5LNWA 4EMIA 1NELA 4LNCA 2A2IA 3AXHA 3QGKC 1H61A 3BMXA 4LAOA 3FJNA 5M3WA 1JJKA 5KZEA 4FR6A 1QNOA 1I60A 1Z7AA 3ECQA 4GGHA 1SFTA 4D6HA 4QHRA 1QFEA 3AZSA 3K5XA 4AVFA 2MANA 5T9CE 2PDGA 1RA5A 1V6YA 3PG6A 4L1WA 3GXNA 4Q8TA 4ZOHB 5CBBA 1GOMA 4BR1A 2E5DA 3L66A 3MYOA 3WMLA 3LCXA 1F9CA 2UV8G 4B3ZA 3W1MA 4NAEB 2QUMA 3RXZA 4L4PA 1N61C 5FIPA 4I9TA 1GWJA 3HG3A 3A64A 3II4A 5TBOA 3NVZB 1DJQA 2QCNA 3RILA 5FL1A 3BAYA 1SO6A 3O6YX 3TQ0A 1Y5VA 1K9EA 4EQSA 2XM1A 1GHRA 3NQCA 2PD5A 5J8LA 2C3ZA 1F73A 3IGXA 4PGLA 3BJTA 3KTSA 4WKAA 5JCLA 2QCCA 4QQUA 1FDJA 1OCJA 1GRTA 1FVPA 4PMZA 3IRSA 5CC6A 2G37A 4D71A 2QF8A 3FA4A 1RD6A 1QI3A 1KB3A 5D2TA 3WJYA 1OFAA 1GRFA 2DZAA 1TTIA 2GJXA 1PYFA 1RJPA 5CZSA 1PHQA 2X30A 3RX3A 1RCQA 3EZ4A 3A5FA 3D5HA 5KETA 4JL1A 3LBCA 1HJUA 1ZJAA 3OPSA 4EXBA 1E51A 3IVSA 3I7RA 3EXTA 4OIFA 4AIUA 4MB3A 3OZMA 1E70M 2YXGA 3UXIA 2YAUA 1GXFA 3RAOA 5BWFA 2OEMA 3V4BA 2JBMA 2VUYA 3D3FA 2FVLA 2BHUA 1OT1A 3R12A 2X42A 4E4PA 2R6OA 4R33A 2ZOXA 3ZIZA 3IJQA 4FLRA 2OLHA 2B4GA 3VOIA 3QQ1A 1I75A 4I6VA 2AL2B 3QYSA 3NQVA 2GSHA 3G1VA 5GVJA 4CCEA 1H50A 3GBEA 3LENA 1FKWA 4DPPA 1QWGA 2B7NA 3PJTA 1B4EA 1FRBA 2J75A 2NSOA 2TSYA 4QE5A 3BLLA 1SU5A 1J10A 1W2PA 3WLSA 4WJXA 2XFFA 2R9RA 2FZNA 1PO9A 4FXRA 2PDCA 3PSWA 4A3RA 2XFYA 3E38A 4AD1A 3N29A 4JZ5A 3SUVA 3FAXA 3TC7A 3UGRA 2YVGA 1JEZA 4B3LA 1SGJA 1EC8A 1JYVA 2JE8A 3TXZA 2C71A 3E2RA 1QI4A 5F2MA 3PB0A 3GYCA 4X60A 2YYTA 3GNDA 4Z1BA 2QJJA 1TE6A 4IMFA 3RCMA 3WLOA 3MBFA 3IUHA 1GJUA 3L2LA 1OVDA 2BOFX 3L8KA 4CD8A 4GJJA 3P6LA 4EAMA 5JCKA 1TV2A 4IP5A 1V6VA 2Z26A 2A3EA 4HK5A 2DJXA 5J5RA 1BHGA 1NF0A 3EAOA 1CLXA 1XLDA 1YX1A 3HQ1A 5A6BD 1NQKA 4RNJA 3CWOX 1HT6A 2PBOA 1V79A 4CD6A 1H09A 1Q6OA 4OFCA 4H2CA 4XZHA 4CN4A 1SFLA 4HT3A 3ZSTA 3G1YA 1E0XA 1PDZA 4INFA 1UP2A 2X2GA 2ZZ0A 1UR1A 3VX1A 1P4CA 3LHUA 2UWFA 5DO8A 4A3UA 4ROQA 3QH2A 4NJKA 4HU4A 5LA1A 4Y9MA 2WMHA 3IAPA 1S3HA 3COTA 5I78A 4K38A 4M24A 4URIA 3WIJA 3W7GA 4IPLA 1EKOA 1XFCA 2GQWA 4C65A 4WRHA 1MEIA 4CNUA 3LPPA 5LIWX 4M52A 4KGLA 4RK8A 1IXPA 1B31A 3NQEA 2XDFA 3B3DA 2OOFA 3B8UA 2NV9A 3HTWA 4NSBA 1A5KC 3SW6A 3RU6A 3GTHA 3NGFA 1XIFA 1XIEA 1XIJA 2UY2A 1MMFA 1XLEA 3OVPA 1IYXA 4GD0A 4PUMA 5EPDA 1N8FA 2POTA 2BOEX 1DE5A 1RQEA 4EE9A 1UJPA 2WMJA 6REQA 1A5BA 1BXBA 1KKOA 1B2YA 1KFWA 1OB0A 3QV9A 4ASTA 1NY1A 3GC5A 2GZXA 1OT2A 1LL4A 2V38A 4LY4A 4IMEA 2D69A 1QO2A 3V16A 5I3KA 1X96A 1DBTA 3C5QA 3DXIA 3UWEA 4FNPA 3FJ4A 6TAAA 3M0VA 1MI3A 3BLIA 3AIUA 5D37A 3FYOA 4XZLX 2OVLA 4CEUC 1KFCA 1U2YA 1OWQA 1FECA 1DJYA 4CNNA 2XN2A 2WOQA 1I45A 1ZKQA 2C14A 1J96A 1B9ZA 1K02A 3N13A 4RKAA 1C92A 3ARSA 4MUPA 3W7CA 4CNSA 3FX4A 3BGJA 1PKNA 2VL4A 1DIEA 3WBWA 1MW2A 3ZLHA 1XX1A 5BCAA 1ZAHA 3M64A 4D6IA 2Y0FA 3VE9A 4UNKA 4MWAA 4J3UA 1HJWA 5FF2A 4OV9A 2WPCA 4PTNA 3W00A 4KEUA 5EMUA 1BVNP 2VR2A 4EOUA 3VGGA 1E1EA 4PULA 3P14A 1W9BM 5LGXA 5EFDA 2D0GA 4M6PA 1WDQA 3EA1A 3OA5A 2C7FA 3RN6A 4XISA 2HSAA 1KM4A 4XD6A 3JUGA 3CIWA 2EQ8A 3MJYA 1DXEA 2NUYA 1VEPA 5G4EA 3TLLA 2PDNA 3HOJA 2A21A 3CGEA 2HPIA 1JDDA 2J4GA 1X97A 1IR1A 1WKYA 1D8WA 3NVVB 3WJWA 1N63C 3UG4A 3UPWA 2IQDA 2WQPA 9XIMA 3FEQA 1O7AA 1UP0A 3S5OA 5AYBA 1G4SA 4A29A 4MWAD 4WD0A 3L4YA 2CZFA 3W38A 1SR9A 2GVYA 2Z24A 3DYOA 3I3DA 3TA9A 2V82A 2ZRVA 2XISA 7REQB 2NQJA 1GZGA 1XLCA 2VGBA 4GINA 4JPGA 3P61A 2XYLA 2DH3A 1W1VA 4H4WA 1WCGA 5KMYA 3VDAA 1QOXA 3MMTA 4FIRA 4IIDA 3CPUA 5DF0A 1NQ6A 3NJ3A 1FH8A 2PWEA 3OZOA 3W4RA 2YCJA 3TSDA 4GO9A 2PA6A 4YHEA 4NI8A 1DVJA 5A8QA 3RNMA 1LDCA 2DZVA 1VLWA 3QPEA 2EPMX 4R9OA 4Y9AA 4S2BA 2UZ9A 4O1CA 4FR1A 4IL0A 2TRSA 4XAZA 1NFPA 3TQPA 1VPXA 3UJSA 3BURA 4QR6A 2A0NA 4A8NA 4JNYA 3M0KA 1MW0A 1GOKA 1YW1A 1YNPA 3VM5A 2VRJA 4H6QA 3G1RA 4AHQA 4IMAA 4PCFA 1OGSA 2NVAA 3MDWA 4CNPA 2ABAA 2X7VA 4IIGA 5HXMA 4ROPA 4XZIA 2E6FA 4PTWA 3AOFA 3PPFA 4IOTA 5BROA 1R2RA 2GGJA 1LBMA 4JTIA 5EY5A 3MKCA 1KNWA 2FHFA 5G2WA 1RY8A 4Q8QA 3LTYA 1OCNA 3H7RA 2D3NA 2NQ9A 1AH4A 3PUGA 1UWSA 4EP8C 1TWWA 2P50A 1CXKA 4C60A 2J9ZA 2J79A 4JTDA 3DGHA 4GBUA 1DWHM 5FSDC 2BFGA 5ECVA 3POCA 2H9AB 3VIKA 2PTWA 3ZJ8A 1LROA 2P76A 1KW1A 1MEWA 4YN5A 4EMWA 4TV6A 2YCLA 4B9YA 3EWYA 1QAPA 2Z1VA 4AY8A 2Y89A 2VCAA 1PX4A 3NQ2A 1PV8A 3T0DA 5I3GA 3SM0A 1E5NA 3VX0A 3WQDA 1UUOA 4NXSA 1QVBA 1WUFA 2G3IA 4RR4A 2G50A 3V0UA 1RSCA 3GYEA 2JK6A 3GVVA 1CGWA 2XGZA 1ONRA 1GRGA 5JVLA 3LPOA 3O6AA 4QS5A 4C1NA 3SRFA 1C91A 4S3AA 4MJ4A 5T91A 3IJ8A 3GDKA 3WEZA 2V3DA 2HS6A 2JALA 3GM8A 3G0SA 3NZQA 3RR4A 4TX6A 5A6BA 1B3ZA 2DZWA 2PLMA 3LV6A 3OJGA 4UFKA 2I5IA 3SCTA 4DVOA 4MZ1A 5HA7A 1UZDA 4HSHA 3AIQA 2ZZ5A 3TDFA 5A6MA 5DBUA 1KXHA 1SW0A 2W4XA 2VFGA 3CK5A 3MP5A 1D3GA 4U2YA 1FCVA 3CPRA 3BGGA 3EKLA 2BXVA 4EF9A 4HTBA 3CXBA 4R53A 1TCDA 3FIGA 1KCZA 3RPTA 4W87A 3W2NA 5FJTA 1K4HA 3TTOA 4A6GA 4OBTA 4YTSA 2CHNA 3H2MA 3ZQ9A 4O1BA 1FX6A 3LMYA 1DWFM 3S9YA 3EWBX 4JTKA 2GJRA 5FCZA 1MVYA 1DJIA 2W9MA 1IT0A 3GFYA 1S5VA 4XBJA 4MPQA 1VENA 2Z2BA 5HWNA 4A3YA 3VIPA 4NKCA 3SECA 5JCIA 4HSNA 3VIHA 3QY7A 3K4DA 1XYLA 1R38A 1OBAA 3P5ZA 3VILA 4FLSA 3QR1A 4GQ0A 2HCVA 3QRHA 4IISA 2OGYA 4A2SA 4CQCA 1YPFA 4V27A 4W4QA 4UTLA 5TQLA 4Y8EA 3K46A 3K2GA 1XLAA 2WLZA 4H1ZA 5A3HA 4LCRA 5FJIA 3EUB3 1F3WA 4U5IA 1B90A 2FIQA 1GYNA 3WX7A 3LNPA 3LTSA 1FFRA 5K4XA 5LNUA 4H4QA 3UZYA 4ZSTA 4LOCA 1ZSXA 4EQRA 1RJQA 1GOOA 2J7BA 3ITLA 5I3IA 2OZ3A 3WF4A 2P3ZA 1Q6DA 2DVXA 1NOUA 2DUZA 4XZWA 1OD8A 2VX4A 4H8NA 1FO4A 3KEHA 4QGCA 4LAKA 3QQ0A 3BPWA 3P82A 1ZL1A 5I24A 2IPWA 4OWGA 4N02A 2O4MA 3BJFA 1ZLPA 3ABOA 4H4IA 1XF0A 3EX4A 4KIRA 1OFOA 2F9RA 2PODA 1GQIA 3L65A 1VIWA 3UCDA 1OCQA 3QV8A 4M29A 3A24A 3MO4A 3I4EA 1X1OA 4GCXA 1F61A 2GFTA 3EEZA 1A5MC 1RV8A 3M44A 3O8AA 3VNYA 2CFYA 1E5JA 2YA0A 1EUNA 1H2JA 2DIKA 5I3JA 3AU2A 1EB3A 1Z8AA 2DSZA 1AD1A 1I0DA 3OTRA 5CSUA 3QXBA 3UESA 2XVPA 4P7OA 4C90A 4OECA 1KBJA 2YCLB 4FNSA 1MFVA 4AD2A 3R89A 1KV8A 3ZT5A 2WZMA 4M7TA 1T8XA 2WPGA 4AXKA 2H8ZA 3LQLA 1ZPTA 1UW9A 3VD7A 1AZ1A 2A3BA 3W7JA 2C1IA 1P6BA 2ZZ6A 3N73A 3TC3A 3OYZA 5KINA 1SO5A 4C6IA 3LCWA 2W3SA 3KWSA 3F4WA 2RH9A 4KEZA 1VYPX 2QZRA 3GG7A 3ITOA 4H6RA 4DNAA 1C9WA 1SJAA 3OVRA 2VEPA 4WXZA 1TUXA 3W7LA 4DNMA 1XPYA 5DCBA 1YIXA 1FQ0A 1FXQA 1MXDA 3S6OA 1UKOA 1IIGA 1PKYA 3T6CA 2P53A 2ZDSA 4CD7A 3VNJA 3LI0A 1NJJA 2WM0A 4C6KA 5HULA 2VKZG 5GJMA 1AQHA 2BVDA 1G67A 2D2HA 4ZXOA 3MKVA 2G96A 4QM1A 3RK8A 1EJXC 3K8MA 3MO7A 3W7OA 4PBFA 2C1GA 2GVEA 4UTMA 3H4KA 1M65A 1VQZA 3M0HA 3UP8A 3WN6A 3W7EA 4K7ZA 4IWWA 4Q32A 3EOOA 4JTAA 4OUIA 4P7LA 1KLYA 4UMBA 3DX5A 1XLMA 3CC1A 2F6UA 1XBZA 3PPGA 4UR9A 3LERA 4LY8A 3EBVA 4WIWA 3BAIA 2GSEA 3AYTA 4PH6A 3A47A 3P74A 1J6PA 4ADSA 4J3XA 1LUCB 2FZDA 4D6CA 5I03A 5A6JA 2WBGA 3DK4A 4FXSA 3BW4A 3JS3A 1ZK7A 4GI8A 3EDJA 2BBFA 3EOLA 1QK0A 2PDJA 4QE1A 7CGTA 2PLKA 3H12A 1Q13A 4JFSA 3TOPA 2AMXA 3THDA 3PP7A 2FVKA 4AD4A 2W0UA 1QNSA 4BJHA 4MY1A 2WOWA 1UIOA 2E0PA 2R1NA 3BDKA 3K4AA 1JF6A 1KBLA 1MNZA 2FLIA 3AYSA 1UD3A 4N6EA 5I23A 2O4QA 1XSJA 5J04A 3QFWA 4H9UA 1ISXA 2GR1A 2GOKA 3SN4A 2J7DA 1TE1A 4C91A 1XLBA 4DBUA 4LBUA 4M1RA 1TPH1 4JCMA 3VMOA 3KLJA 3NDYA 1LLWA 4BQ5A 4DYKA 1DE6A 4OTKA 3TIMA 4ZMGA 3HGRA 5CGTA 1UA7A 3SCRA 1G69A 1GONA 1V93A 4QAIA 3PPCA 1F8WA 3L5LA 3BOLA 1YDYA 4HZ7A 3UR5A 3RLGA 3BANA 3FKRA 5AC7A 2X1IA 5AOUA 2X8CA 4BI6A 4IQJA 1JUKA 3HGOA 1H63A 3BLEA 1WDRA 4R7JA 4FB7A 3BV4A 1XISA 3EDDA 3URHA 1R87A 1YPIA 4RUBA 2ICSA 3NO3A 3PAOA 4MM1A 1N60C 1JDCA 1NWSA 1KM0A 3QF0A 4RX0A 3KDOA 1UR2A 2W92A 3GVWA 3OVQA 1WPCA 1DPMA 1PUDA 3N34A 2OWWA 1ADSA 4WDTA 4W84A 1IV8A 3L4WA 4F0SA 2NLIA 5DMYA 3AIWA 1H1NA 1V7YA 3G6MA 3S5ZA 1J0YA 5BRPA 1A4MA 2WHMA 4W85A 2DORA 2PI6A 3K8KA 1BQGA 2DEPA 4F48A 1B3OA 3KS5A 2YL6A 4BFAA 5GNYA 3BLPX 4DUVA 1HJVA 3W73A 1V02A 3TLQA 2QJIA 1K9TA 3AMCA 1RLCL 3EX2A 3ETRB 3WMCA 3ITCA 3PC0A 1S5WA 3KOYA 4CKQA 1V6WA 3QC3A 3MUIA 2G3JA 5EBUA 4XZBA 3NAVA 3RRAA 4O17A 4ZENA 3UFYA 1OYAA 2IPFA 3WMBA 2Z27A 4DO7A 3EKGA 4PZVA 4B4FA 3UJRA 4PN2A 3GDMA 5KZ6A 4WOQA 2ZRUA 1M6IA 3H4WA 3OP2A 4DWSA 1QI2A 4HN4A 3UY7A 3CZKA 3N17A 4YJ5A 1P0DA 2WZIA 1FWEC 1Q8AA 5XINA 3NDZA 4AD0A 5JXQA 1H11A 2BV9A 2HK0A 4E4FA 2CERA 1E71M 4KPRA 5DRIA 3H6OA 1G6CA 1NFGA 3TJXA 3UVAA 4EVZA 1E4LA 4HPJA 3FJLA 1Z41A 3N9RA 3U2CA 3R7MA 4XZMX 3FSUA 2E6YA 4DNHA 2VFDA 5MKGB 3M5YA 1NWTA 4QAWA 3WFZA 4H6EA 1GVSA 1AW5A 3CV1A 4WGXA 3W1QA 3VTRA 1MZRA 3TWAA 5KSWA 1TV4A 1YDVA 5FF3A 4YXGA 2E40A 4HOZA 2WC7A 1H1YA 1E9IA 3O3RA 1XR2A 4KMQA 2Q09A 1BFNA 2JFEX 1EP2A 3ARPA 4E3TA 3URBA 5A5WA 1LWHA 2GR2A 1Q2SA 3CZ8A 1A50A 2EEXA 3I6TA 1LRTA 2QV4A 4S38A 3W72A 4GUFA 3AWOA 2WXDM 4ICCX 4AIOA 3M6DA 4U4MA 1F8IA 2OWCA 2REQA 1XC6A 4XK2A 3GAYA 1YNYA 1RVKA 2W54A 4DHGA 4C6FA 1BTMA 3A4XA 5IHRA 4B15A 1GNXA 5CPMA 4GZIA 3BCJA 1FHUA 2EPKX 3NL6A 2CLLA 4QJ3B 3LB8A 2PFHA 5FAGA 3SCUA 5AZ1A 1HQTA 3A9IA 1EH9A 4B2DD 3WQ5A 4ZTXA 1LRNA 1S39A 2OTDA 4EACA 3V35A 2OCZA 3P7YA 3VVGA 3KBMA 3OIHA 3FKKA 3V5CA 2YFNA 3T2PA 5BZAA 2FMOA 1XIDA 3MCOA 3R8HA 1TZZA 5DCDA 3EEGA 1UKTA 1ISZA 4H9XA 1EL3A 1BQCA 4EQWA 3SN0A 1V3MA 4Y9OA 3M16A 1DNCA 3DFQA 4Q7BA 1W5MA 1W9VA 5FA5A 4QEEA 1J0KA 3DC8A 2V3FA 2YVFA 1FWJC 4L9YA 3TTQA 2PURA 4IZGA 4ZODA 2DV0A 3NSNA 4AZHA 2QHAA 3CZEA 5HINA 1CYGA 4MJZA 2J74A 4K6AA 4PUKA 3E0FA 1PHWA 4US5A 1Y65A 3CH9A 2IPJA 1JD9A 3QMTA 4Y96A 2FZ8A 3NUKA 3OLGA 3QFEA 2W67A 3LHWA 4FOJA 4W7VA 1GV4A 4RCXA 3M5VA 4S3BA 4GH1A 2DSVA 5JBFA 3AUOA 4U5KA 2JIEA 2DUXA 4S1FA 3MV11 1XCWA 4DUOA 3PTMA 4DZ5A 3EKZA 3L4ZA 1XH2A 3P0XA 2I7GA 3WSUA 2CLOA 4PUJA 2J9YA 2X1TA 1HFBA 2Y70A 3MI6A 1PTGA 3AS0A 1BVZA 4A35A 4HCLA 1J0ZA 3FLUA 5EA9A 5IFTA 3RJYA 1ELSA 3UNTA 4EF8A 3DC0A 4H4ZA 4J3VA 3TTSA 4I6KA 3V5FA 4HHMA 2D24A 1H0IA 1J5TA 1BXCA 4NF7A 1Q4NX 4L64A 4AB4A 4WLCA 3ZJ7A 3SBFA 1VCVA 3G1XA 1GRAA 3SCOA 1KTBA 5GJNA 3KZSA 3MV01 1SZGA 4M82A 5DT5A 3R11A 1D7YA 1KXQA 2CBVA 3DCPA 4IXXA 4H4YA 3FW6A 4YPJA 3TVAA 1AG1O 3QW3A 2VR5A 4P5UA 1OINA 1RH9A 2GVLA 3I7SA 2A6LA 2NW0A 4DWSB 4H83A 4HMCA 2PGFA 3WDHA 3VDBA 3REQB 4ICNA 4XTIA 4CNTA 2FPTA 3PZUA 4GRSA 1VKFA 3RMJA 2PC8A 1X38A 1D8CA 4G9PA 3VIFA 3RFAA 3DYPA 4CVWA 5TD4A 2WNWA 3GAKA 2QCDB 1GEQA 3TCSA 3QLLA 2XSAA 3FSTA 1P7TB 4ACZA 3FS2A 3GG0A 1FHLA 4DO4A 4BZYA 3GZAA 2B31A 3WLIA 3UVIA 1JZ2A 4E8DA 4LC8A 4YL2A 3C56A 4AY1A 1ESWA 2HK1A 1QDSA 2FHBA 1SFSA 4MPKA 3ZZ1A 1DXFA 6TIMA 4OJYA 4JYDA 4BCEA 4DXXA 2XH2A 2BHYA 1V7AA 3BSGA 2AAAA 3U5UA 2FGZA 3H7UA 2PWHA 3GC2A 2PP0A 1Q45A 1R3WA 5CZKA 1JD7A 3KL0A 3VCRA 7A3HA 3EMZA 2Q6ZA 4JHMA 2QCLA 4L4LA 3CGBA 1RLDA 1B5TA 2ODOA 2GR3A 4DJFC 1XIBA 5CC5A 1KFEA 3DFNA 4U3AA 4WUIA 3IACA 2ZUNA 3L68A 1SYTA 2BY2A 3PSVA 4NZ1A 3W7HA 4AWEA 3AJ7A 4FX7A 2NUWA 4XB3A 3DHDA 2O9PA 2OT0A 4JN6A 3W26A 3NR0A 2DH2A 2VEMA 1FY6A 4Q4QA 3OBEA 3V5OA 3AMZA 1SMAA 3GW0A 4QG9A 3AXKA 2WK2A 3KX6A 1J01A 3T08A 1P1MA 3CAKA 2YW3A 3VKKA 3RLHA 4W5UA 1M03A 2IMRA 4PCNA 3TV8A 3CWHA 1TMLA 4XV0A 1FFQA 3ARVA 4ZO8A 4CN1A 2VC9A 3VIOA 5BWAA 6XIMA 2Y85A 4GVHA 3NL5A 3N2BA 1EX5A 5AY7A 2X50A 2PDWA 3W1NA 1ALDA 3HG2A 5DMMA 2JKAA 2QCFA 1ZXIC 2HBXA 4HPGA 1L6WA 1R8LA 1TPFA 1ZU8A 1UMYA 5MHBA 3G8RA 2WCGA 5ABEA 3SQSA 2Y7FA 3FYYA 3VOGA 1P0BA 3T40A 3KWXA 1EWEA 3AICA 3QN3A 3BAKA 2VT0A 4XZNX 1KV5A 3A3HA 3B40A 2PCQA 3GU2A 4CNOA 3PTKA 2EPHA 4HGXA 3WH5A 1E6PA 3VC6A 3VK5A 5E70A 4MFDA 4HB7A 1R86A 3CYVA 4MYAA 1VR6A 1VGAA 4DXVA 4I8DA 2ZUWA 3UR8A 3CHVA 4G5DA 1H41A 1C8VA 1M9HA 4UQDA 4GPNA 4JTLA 3OGVA 2QUNA 4UXDA 2A8XA 1PS9A 1V6TA 2CZ5A 5I3DA 1I2QA 3NQ7A 1TJ0A 2OKTA 3P93A 4ES4A 4E38A 2CKRA 4K3ZA 2LLEA 3VZYA 1V97A 1F05A 2F6KA 2YBTA 2ZUSA 4QIUA 1VFSA 2RUSA 1M7OA 3LZ3A 4Z1DA 2QT3A 4DM1A 5CPOA 2E8ZA 2PDQA 3TKFA 1TPUA 3GB6A 3S1VA 2W91A 1UR0A 2HVNA 3D9XA 2XIMA 5B7ZA 1PSCA 3GDLA 4HOWA 1UKSA 4I9JA 1ZTVA 6PTDA 1B1YA 3NZRA 2XWDA 1P7TA 4UOJA 1EA0A 1MO9A 4NX5A 4W9TA 1D3HA 2OQLA 4LS0A 4IIHA 1UOZA 1UH2A 4FNUA 2V5CA 3QLDA 1OG0A 4Z08A 3A4JA 3L0KA 1B3VA 4S2CA 4HNVA 1FCQA 3LXDA 4LYRA 2F8QA 3T09A 3DK8A 3ZWSA 3TSBA 4WEVX 1OIFA 1JZ8A 4LYQA 4CUCA 2V9DA 5C2CA 5CG0A 2TPSA 3K4WA 1SJBA 1I9CB 4UNIA 4YYCA 4EWND 4H4RA 1FWRA 2QPUA 2RJGA 4GIAA 2GH5A 3NWRA 4IL2A 1SJDA 2ZXBA 1FTXA 1Y5XA 1Q6RA 2WMGA 4DRSA 1XL9A 2NV1A 1ZMDA 2JQXA 2SFPA 4LCQA 5DMLA 4AX7A 2YXXA 1V59A 3CUXA 4C6OA 1FH9A 4D1IA 2NQLA 2E4TA 3CPGA 5CCZA 1CPUA 1KXVA 2XG9A 3GXTA 1GTEA 3LRLA 2R24A 1BF6A 2X1RA 4FOKA 4O18A 4S3EA 3M6YA 3L4VA 1WX0A 3LPGA 1NU5A 3HPZA 5DMNA 1HKIA 4N4QA 2GR0A 4DY1A 5ABFA 1WKEA 2GQ9A 1NDAA 4AEOA 1IT8A 1TPC1 3H53A 5CPSA 2E3TA 4QITA 4F40A 5XIMA 1Q2RA 2Y7GA 3UZJA 3RDKA 1IF2A 2VVSA 4J56A 2PLCA 2ZWYA 3PBWA 4H8VA 1GUVA 3Q6JA 1JPMA 4JKMA 3TNBA 1KFKA 3TQKA 4AD5A 3FHAA 4ZE4A 3KUMA 4US6A 1W8GA 3KBWA 3NNTA 3B9EA 3R25A 4UTJA 1L6GA 4A2RA 3MYPA 4WZHA 3U57A 2EHHA 1Q6CA 1A5AA 5HWMA 1XPGA 4RNIA 4H50A 1LUCA 3PWIA 5JU6A 3VKAA 3H23A 4AF0B 1TWSA 4XWUA 4FX8A 4ZGYA 1S1PA 2AGKA 3R43A 3QVQA 5BMXA 1WOBA 3S47A 3W86A 3VD5A 3CGDA 3EB4A 1IEXA 4UOZA 4DF0A 3N15A 4YCOA 3ERPA 5D38A 2XVGA 1FWFC 3EX3A 4Q4OA 2OG9A 3L67A 3S2NA 1US2A 2G4JA 3PS7A 4UZSA 3P8IA 1RBLA 2BB0A 5AYZA 3BOFA 4B9ZA 1UB3A 4ERIA 1MZHA 3NRZB 1MNSA 3EB2A 3QSRA 2JIWA 4MIMA 3NPUA 1OX5A 2FVMA 4C1KA 4RZ6A 1QI5A 3GHSA 4LRTA 5HJLA 2WSRA 4BA0A 1DL3A 3UR7A 2VEIA 4GX8A 5DN1A 5H6HA 1GGOA 4ZB5A 1TV5A 4JYFA 4E2VA 2W63A 1VJZA 2E6AA 2NT1A 2Q8XA 2CZEA 2R1KA 1KM6A 2C91A 3EOEA 2AKMA 3TA6A 1SW3A 4KFNA 1JPDX 1KKRA 1HKJA 5BMWA 3CWNA 2C8NA 3W88A 4G6CA 4AWUA 2FGLA 1U83A 1XI3A 2E5BA 4I9MA 3EAUA 4AEEA 4KWSA 4MB4A 1A80A 5C5YA 3BH4A 3WG6A 4RPQA 1Q4WA 5HQMA 1R6WA 3B9NA 2NPXA 3BTNA 1LOQA 1KM3A 2Y6ZA 3EMQA 2I56A 3VGEA 1HTIA 1TVNA 2ZZ7A 1W5PA 3SCVA 2PWUA 1P5BA 3U5YA 3QJAA 1XLJA 3BQ6A 4ATLA 3CQKA 3GNNA 4DO5A 4UZUA 1Q63A 3OU8A 4ZO7A 4AC1X 2DU2A 4HP5A 1GJPA 3STCA 1E6ZA 3C86A 2OT1A 2PLJA 1KTCA 3TWBA 3HMCA 4DIAA 3NQDA 2PDLA 4L6HA 1YE6A 3W83A 4D6JA 3AMKA 1FIQB 1A0CA 1ZCOA 1UROA 3DERA 3F1QA 5AHIA 3VDCA 4DAIA 3MU7A 2Y1HA 2F2HA 4NILA 2EF9A 3CL6A 4PCSA 3CASA 1NAL1 4JS3A 1B57A 3BO9A 4RE2A 3ZR6A 1GYMA 1MRAA 4QDPA 1T0OA 5EU9A 1ZGDA 1J0JA 2C1HA 1TX0A 5FEXA 1WZKA 5C7HA 3OZPA 2FFIA 3WBYA 4JDYA 4GYPA 4OU1A 4H4UA 2O55A 3CUGA 4PMDA 5I79A 3FGCB 3I6RA 1CDGA 1X98A 1I8JA 2YVJA 4K8DA 1QK2A 5MKGA 3R8RA 3R07C 1SQ7A 3PG8A 2GJPA 3QPYA 1MXGA 1IEIA 2EPLX 3IJ6A 3P62A 4TVDA 1QMLA 3LXBA 5I0DA 3SUSA 1PIIA 4WX2A 2ZRZA 2J62A 3VOHA 4MJ2A 1JEHA 4U31A 5FJRA 4FDCB 2FH6A 1G7VA 3AJXA 3HPFA 1T7LA 4UQEA 1AJ2A 2OYMA 2ZWZA 3PZOA 3H2NA 2BOGX 1JNEA 1TX2A 1IZCA 3KOZA 3HPXA 4BI5A 4GXMA 3WUEA 5FESA 4WJEA 3ABZA 3SUUA 1UR4A 1ITUA 4JDRA 2Q3RA 3QKEA 5BYWA 1ZUAX 1Q6FA 2VRQA 3O7UA 1EXPA 4PMRA 1VH7A 4GISA 2O92A 1AW2A 3K8LA 3AHTA 1UQYA 4JN7A 4XAFA 3DFOA 1UR3M 5CJMA 1OADA 2IQTA 1MOKA 5EMMA 2GGIA 4AIEA 2V0TA 1ZRQA 4NIRA 2VWTA 3E5PA 4Y2WA 1XYFA 1H7PA 5L9FA 1O94A 5JUVA 5ECUA 3W02A 1ONFA 3SY8A 1N82A 4D8LA 4PE8A 2QJMA 1OG6A 2PGWA 4C6JA 3KHDA 1WNOA 1QR7A 2HNEA 3P60A 1ZALA 3R2GA 4AIBA 1E56A 1ZJBA 2C0HA 1NP0A 2PU0A 4I8YA 4Q8MA 3W81A 2ZC8A 3O6DA 1J2BA 4KERA 4ML4A 1WP6A 2Z1KA 3MWCA 1BLIA 3TU9A 4AVNA 1GKQA 3QY8A 1I4NA 3O15A 4H7ZA 2DGAA 3BOXA 3QGVA 1C7TA 2YL8A 3KCOA 4IGHA 3NQGA 3CAQA 1WUEA 1UD5A 3EA2A 4Q8VA 4NAEA 1KN0A 2QCMA 1C8QA 5D4YA 3HO8A 4GMEA 3NPXA 5DY2A 1EYWA 3TMQA 4ORIA 1BF2A 5LIKX 3JU2A 3M0JA 5FD0A 2ZE3A 4V28A 3GBDA 1QBBA 1XBVA 3GDBA 3SQMA 1XUZA 2YQUA 2W66A 1UWRA 2FPYA 5C2XA 1G4PA 4PEKA 4QLJA 5HR6A 4ZB0A 2CNCA 1LM1A 3C52A 3N2MA 1CLKA 4UFLA 3C2FA 3KM8A 3ME3A 2BY1A 2XSXA 1V3LA 3A7UA 1F76A 4HA4A 4LUJA 5I02A 2RDUA 1M5WA 1GHSA 7TIMA 1DHKA 4A8IA 4XVEA 1OQFA 3HU7A 2GGEA 4HA0A 1LTDA 1BWCA 2VX5A 4N6FA 5GJPA 3E9AA 1SVDA 3WQWA 3QHNA 2GUYA 1VBGA 1OYCA 3S8HA 2RFGA 2J6XA 4ATWA 5HBFA 3UZWA 2EJAA 2QR6A 1AJ0A 2QCEA 1PX3A 1K8YA 1RJRA 1A0DA 2YBUA 1IGSA 3GZ3A 2OJPA 3V0TA 1EIBA 4PB3A 1CB7B 3II1A 3ITVA 1TWDA 1GETA 5AZ0A 5HNTA 2ESCA 3LM3A 3ZLGA 4S3DA 3FVDA 4EXAA 2WP5A 4LF2A 3DFYA 1CGTA 1EDQA 4ZZ9A 5IM51 3AXIA 3D3AA 5CC3A 2R9ZA 1F3PA 2YA2A 2QJGA 3H2FA 4YVVA 1RK6A 3DHUA 1A5CA 1GEHA 4ZR8A 4IMGA 3SI9A 2E8YA 3NM3A 3CTTA 3ATYA 3DOPA 3NYDA 4Q7IA 3RITA 2C3CA 3RNDA 3GXFA 3UBPC 1DJZA 1BG9A 1E9YB 1FBAA 2Y5SA 1K8ZA 5T26A 2IKJA 4R9XA 1DWJM 3CU2A 3WQGA 1IWBA 4E8CA 1P43A 1QUMA 2HS8A 3MC5A 4G1KA 5DELA 2FH8A 3SRDA 3OQEA 1Z32X 1EF3A 4DEFA 3LHZA 5F2GA 1U5HA 1V0MA 2YB4A 4ORMA 1GKRA 2B7QA 3P0WA 5AYYA 1PE1A 3PANA 4BWLC 1IHIA 1EPVA 4XAPA 3GH7A 1F07A 1HO4A 4QDMA 3LMZA 1LQ2A 1NOFA 4GACA 4F0MA 2AL2A 2ISDA 1Z3NA 2NWRA 1MDRA 4H4VA 3V1HA 3P80A 5LHFA 4JQ3A 1PZ0A 2ZXAA 2Z29A 1V8EA 1DJNA 3WFAA 3B04A 2JKEA 4PL1A 1O5XA 1EGZA 3ES7A 3TP4A 3LCIA 5FS9A 1GZJA 3ARQA 2ZTJA 2H3BA 3MS8A 4OE7A 1WXJA 4M0XA 3ZVHA 3NL3A 4LBSA 5AB3A 2YGYA 3ZXWA 4NZFA 3UF9A 4J28A 1AZ2A 1DKWA 2XIBA 1WYIA 2O9RA 3WKZA 3TJ4A 2GGGA 4BQ4A 1R9YA 4NY2A 3AIRA 3ARUA 8XIMA 2FJKA 5G4WA 4O12A 4NEVA 1GW9A 1EZ2A 3FHQA 3GUWA 3OG2A 3BARA 4O0KA 1HO1A 1N8IA 3BV7A 3OYXA 2J7EA 4NP7A 5A6TC 4M80A 1XLLA 2V3EA 4RNFA 3STEA 3GRTA 4E3VA 3SFKA 4UMCA 3APGA 4O1EA 2R94A 1M7XA 1NDWA 5HK4A 1QT1A 3N6JA 1CXEA 3S83A 3GH4A 3O0KA 2NVDA 1F74A 2QW5A 4HHLA 3HG5A 2V3BA 2DIJA 1U30A 2XM2A 4EPBC 1ICSA 1GYLA 1JCNA 1P6WA 3CT2A 1AMKA 3CL8A 4UNLA 2BCPA 4NJHA 4DWSC 4OUEA 1LLZA 4OGZA 1WKFA 1F8MA 3FYPA 2E25A 1D3CA 1UHVA 1XUUA 2QAPA 1EC9A 3RRXA 4LA1A 2BG5A 1XH1A 1W3TA 3OW1A 3NURA 3H2EA 3UJEA 1RAKA 1HJXA 4KS0A 3MDUA 4U33A 3GRIA 2BC0A 1OC5A 3THCA 3W2KA 1KXTA 3C61A 4JKLA 1XYMA 2VC5A 3QW4B 4FS9A 3C6CA 4HCDA 4MSSA 3WNOA 2ZVRA 2E7FA 3E6EA 1CNVA 1PVNA 1WB0A 4JIRA 1P1XA 5HOSA 1GPWA 3GRSA 2IXUA 3DG3A 1E6QM 2GWNA 5G2HA 2J88A 4K1WA 5I77A 5G5IA 2V81A 1P6CA 4M19A 3CB8A 2J77A 4JTUA 2V68A 3CLWA 3SY1A 4O1FA 2NXGA 3H26A 4JGDA 3NCOA 1WYGA 1O68A 4OOUA 2RDWA 3CZJA 1VCFA 2D73A 2ASHA 3DI1A 4UQAA 1CTNA 3O07A 4FZIA 3ARZA 1E3XA 3K1DA 5EMKA 4G7FA 2WMIA 3WDIA 4B2DA 1VFUA 5E0KA 2WCAA 4RLIA 3OOQA 4O50A 1OSEA 4L6OA 2QQ6A 5FAJA 2OQHA 3NDOA 4YWSA 2Q3OA 2VC6A 4UC5A 4JFVA 4Z1AA 1X1NA 2WKGA 4QE4A 3DK9A 3T2QA 2HRWA 3UWUA 3V18A 3G0XA 3M07A 1UPMB 3SAZA 4H00A 4YLWA 1BYBA 1XDIA 1UC4A 1N8WA 3FCPA 3TK7A 3VAVA 3BZJA 4NYYA 3PTDA 3TSMA 4I5UA 4M7SA 3WF3A 2PRHA 5HJXA 4LVFA 1QASA 4B5NA 3P5YA 3KVMA 4W88A 3KBSA 4PUEA 3EPNA 3LGGA 3N6QA 4FA3A 4BF7A 4FALA 3OEXA 3MCMA 2PDBA 5D04C 3UW6A 2GUBA 5LA2A 3I6EA 1XIMA 1NIUA 3BWWA 2VZOA 1R3SA 1EQPA 1CECA 2WB5A 1JQVA 5I2UA 3RLVA 4KWWA 1L0PA 3KOXA 4WDWA 1DWAM 3B05A 1ZJIA 5D09A 1W37A 4DBEA 3BW3A 1L6FA 2ZC1A 1VYSX 4JIQA 3M0IA 3ZVHB 4C6DA 1DYSA 3MZ2A 5E93A 7TAAA 2C19A 3GC4A 4GZEA 1A3XA 2UBPC 3VKDA 1HKWA 1E73M 4HNUA 1M7PA 2WKLA 3P3BA 5D2YA 4MAZA 4F2TA 3DGZA 3QZ6A 3LADA 4LCSA 2QCGA 3W7QA 2X1UA 5K2ZA 1E0UA 1ZBVA 2DZPA 1LPFA 4A8RA 2ZRWA 7PTDA 1ECEA 4H2HA 1HKKA 2ALDA 3C0JA 1REQB 3VCCA 4PEEA 2I1OA 4AW7A 4QBXA 3UXLA 3WLTA 4LUTB 1JPIA 1PWMA 1SZNA 4TOQA 4IGMA 1EJUC 3E0IA 1XGEA 3B9DA 3DN5A 3TR2A 3U9IA 4GC3A 1AUSL 2PWDA 1JCJA 2X8GA 3N9SA 2P1FA 5DY3A 3LS9A 2YZRA 2ZDRA 2CETA 1F4HA 1N55A 4CU6A 2DZSA 1GG1A 3B0YA 1L2UA 3ABRA 5E6YA 4HU0A 2D1ZA 4QLLA 3I4KA 2OLAA 4DZHA 4MKNA 1HXJA 3S3GA 4J35A 3USZA 1GG0A 1AD4A 3C3NA 3PZNA 1W3LA 4H9TA 4EQXA 4KWUA 4W7WA 4KETA 2HQAA 3XIMA 4GUHA 5DEZA 4JX6A 3GKAA 3WO8A 4OHQA 2WWDA 1RR2A 3OGRA 3FGCA 3KRZA 4C6CA 5A8GA 3TC6A 1V51A 4HPNA 3JVAA