1F9CA

Crystal structure of mle d178n variant
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
370
structure length
360
Chain Sequence
SALIERIDAIIVDLPTIQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDALAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQNLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEARLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE I)
publication title Buried charged surface in proteins.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 133
structure length 360
sequence length 370
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1f9cA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1f9cA01
3ZVIA 2PA6A 3ZVHA 4HNCA 3S47A 3ES8A 5ENLA 5FJTA 3TTEA 4K8GA 3SN1A 2OKTA 2MUCA 3SBFA 3UJSA 4G8TA 3CXOA 4J3ZA 4H19A 3QLDA 2I5QA 1WUFA 3P93A 1EBHA 2PGEA 1XPYA 3DIPA 2XGZA 3VC6A 3IJLA 3U9IA 4Z17A 3NXLA 3UJRA 4IT1A 4DN1A 3OW1A 5BOFA 1FHVA 4KWSA 2PP0A 3ZLFA 4E6MA 3P0WA 3EKGA 2GL5A 3SSZA 2PGWA 3TJIA 1PDZA 4G7FA 1KD0A 3VCNA 1TKKA 4HNLA 2GGHA 2XSXA 4FI4A 2QJJA 1EC7A 3HPFA 5EU9A 1SJAA 2AL2A 2GGIA 2CHRA 2XH2A 3BOXA 3FVDA 1L8PA 3MSYA 3H8AA 4HCLA 3TOYA 3DDMA 1FHUA 4Z1YA 1P48A 1P43A 3RR1A 3UCDA 3NFUA 2AL1A 3V5FA 3IJQA 3RCYA 2OZTA 2OG9A 2XH7A 3I6EA 4HCHA 3TJ4A 1ONEA 3VCCA 3EEZA 4JN8A 2P0IA 2GGJA 2O56A 3I6TA 3GO2A 3TW9A 4JHMA 3H70A 4DX3A 2ZADA 4IHCA 1JPDX 3QN3A 2NQLA 3TQPA 1KKOA 4J1OA 3TCSA 3CB3A 2OQHA 1MNSA 2QGYA 1NELA 4H2HA 2PP3A 2XH4A 3FJ4A 3B97A 2HXTA 2MNRA 4KT2A 3N4FA 1BQGA 3DFHA 1JDFA 2RDXA 4K2SA 4GIRA 2PP1A 1NU5A 1MDRA 2PMQA 3MQTA 1KCZA 3DGBA 3R10A 2P8BA 4JN7A 5FJRA 1R6WA 2PSNA 4EWJA 1KKRA 2XH0A 3KUMA 4HYRA 3RRAA 2ZC8A 1BKHA 2OZ8A 3V3WA 3GY1A 2OVLA 3UXKA 3GD6A 4GMEA 4H83A 4ZA0A 1R0MA 3MWCA 3UGVA 3DERA 3PWGA 1E9IA 3P3BA 3ES7A 3R0KA 3QTPA 3TWAA 3VDGA 4MMWA 3T6CA 4GISA 1MUCA 3JVAA 2QDEA 2PCEA 4H1ZA 4E4UA 1PDYA 3IJIA 2PU0A 3SN0A 3NO1A 1W6TA 2PS2A 4IZGA 1SJBA 2P88A 4KPLA 3CK5A 3UCCA 3V4BA 3QKEA 3VA8A 3Q4DA 2P3ZA 4YWSA 3RO6A 2OZ3A 2PU1A 1SJDA 1XS2A 4E8GA 4M6UA 1TZZA 6ENLA 3ZLHA 3DG6A 4A6GA 2PODA 2HNEA 2QDDA 4IL0A 3T8QA 2GDQA 3T4WA 2PTZA 2QVHA 2OQYA 4HCDA 3SQSA 4MGGA 3DG3A 3R1ZA 1WUEA 3I4KA 2OFJA 3MY9A 3SN4A 3VFCA 3MUCA 4F4RA 2PPGA 3THUA 2FYMA 4FP1A 5IDZA 2DW6A 1MDLA 3FYYA 3T9PA 3H7VA 4K1WA 3CT2A 3NZGA 1F9CA 3PWIA 3SJNA 1ECQA 4DWDA 3VC5A 4GGBA 3Q45A 1JCTA 4IP4A 4GYPC 3V5CA 1MRAA 3TWBA 5FJOA 1RVKA 2QJMA 1SJCA 3UJEA 1TE6A 4X2PA 3N6JA 3JW7A 4A3RA 3R11A 5FJPA 4E4FA 1OEPA 3IK4A 2ONEA 3FXGA 3R25A 3UJFA 2OX4A 4IP5A 2FKPA 3JZUA 3UJ2A 3OTRA 3PK7A 4GYPA 3FV9A 3ZVHB 2OLAA 4DHGA 5BOEA 2PTWA 4GFIA 7ENLA 5J04A 2DW7A 5FJUA 2GSHA 3QPEA 3N6HA 4ZCWA 4DXKA 3D46A 3RGTA 1EC9A 4ROPA 2POZA 1IYXA 3N4EA 2GGEA 4E5TA 3ENLA 4GGHA 3RITA 3ZLGA 2P8CA 2HZGA 4MKSA 2OPJA 3BJSA 1EBGA 4IL2A 3H12A 4A35A 3BSMA 1JPMA 3MKCA 3MZNA 3OPSA 3OZYA 3GC2A 2PTYA 4ENLA 1DTNA 2HXUA 2QJNA 4HN8A 1ELSA 3D47A 3K1GA 3DESA 3UXLA 2QQ6A 2OO6A 2PTXA 3CYJA 3S5SA 4KEMA 4M0XA 3STPA 2AKZA 3FCPA 2GGGA 3DFYA 3U4FA 1EC8A 3CAWA 3OP2A 3PFRA 2AKMA 2AL2B 4HPNA 4DYEA 3OZMA 3DG7A 3R0UA 1YEYA 3DEQA
chains in the Genus database with same CATH superfamily
4D8AA 4I90A 3T1GA 1UBSA 2OT0A 1S5TA 2E6YA 1F05A 3AZSA 4L6DA 4NZ4A 1JFXA 1OJXA 5F2GA 2W5FA 4J3TA 4A2SA 1SB3B 2BP1A 4FLQA 1THFD 2PDUA 4C6IA 3ATYA 2Q8ZA 4X9YA 5CPMA 2FMOA 3N3MA 1K6AA 2Y63A 3A24A 1FFVC 1MUWA 2I1OA 5KVHA 1VBJA 3EPMA 3ISIX 3LPGA 4S1FA 4DUOA 3NXLA 4GJIA 3RIKA 4MY1A 4FZIA 2CEQA 1SVDA 1UPPA 3I7QA 1YBQB 2ZXQA 2DZBA 3MMWA 4HOWA 5DANA 5L6UA 1XR2A 4YCOA 1MW1A 3VKCA 1QO2A 1HT6A 3IV8A 4GR1A 1C3FA 5ECVA 4P7RA 1I6NA 3F5LA 4NAFA 5IHSA 4DEFA 1IR2A 1VLWA 1A49A 4E0CA 1EC7A 2V2CA 1KXTA 2YCIX 4MIMA 3WQEA 7PTDA 2VC7A 4IOTA 2RKXA 3PBUA 4PB5A 1LQAA 5ABGA 2AAAA 2YL8A 3NQCA 2XSAA 4HMDA 5B80A 4MNMA 5FEXA 4CN6A 4NZJA 5LGZA 3TOYA 3UG5A 3HG2A 4FNUA 3IUIA 3ANUA 1NWUA 4Z1YA 2R9ZA 4L1WA 1US0A 2AL1A 1DE6A 2XFYA 4C1KA 2VUNA 4K68A 4R9XA 1HJUA 2GGJA 2HTMA 4IQLA 4KGLA 3AJ7A 1VR6A 3R13A 3W7OA 4Q6JA 3ARXA 2YXGA 3A21A 3B8WA 2BSLA 2RGMA 4JCMA 2QUMA 3TQPA 4QCEA 5EL1A 4MVAA 4RV8A 1NHPA 4D6EA 4CNUA 6XIAA 3TZNA 5I02A 1EZ2A 4H2HA 4FXJA 2Y5JA 4JQAA 3PBMA 2Q6ZA 3UVAA 2CHOA 1JDDA 1FWEC 1E15A 3M9YA 4KWVA 2H6RA 3ZO9A 4KT2A 4ACYA 1J79A 1GSNA 2WBGA 2OX1A 2R14A 2GVYA 2VNCA 1RSCA 3AXKA 2V5LA 2D3LA 3ZZ1A 1JPHA 3NDOA 4NZ3A 3NQGA 1GZ1A 3MQTA 4AX7A 1NFPA 1E6XM 3GKAA 4YMZA 2Z26A 2QCMA 3FEMA 2E8YA 1A3XA 3M16A 1PCKA 3BSGA 1QNSA 1JUBA 3QY8A 1OD0A 1LOLA 2Y88A 5C5YA 2GQ3A 3TSBA 3RXZA 2P3EA 4NAEA 3HPAA 3OODA 2WJDA 2BVYA 3KRZA 1HP4A 2VCCA 2WSKA 3SAZA 5AYZA 3R0KA 3QTPA 2NXIA 1UWSA 4MMWA 3SR7A 4MLRA 4QJ5B 5MKGB 1QATA 1S2AA 3GVGA 4H4ZA 3KOXA 2IPWA 4GLEA 3SN0A 4DZHA 2VKZG 4KWUA 2OQLA 3B9DA 1R46A 2HWGA 5CZSA 5C2GA 2DQWA 2PLJA 1GKQA 5HPCA 1H41A 4B4HA 1SW3A 1GRAA 1A5LC 3UETA 4LA1A 5HUOA 1XH2A 2X30A 3PZGA 4CU7A 3PC0A 1UD4A 4R5EA 3PUGA 3N9SA 4LU0A 4E8GA 1YQZA 4V1YA 4C6LA 3VNDA 1MFVA 5FF2A 3M5VA 4GNJA 3D9XA 5DRCA 3SY8A 3E74A 2GDQA 3T4WA 5BXTA 1QI5A 2WNQA 3GD3A 3LMZA 2WHKA 2ZX8A 1LP6A 1QI0A 1DORA 1FOBA 3I4KA 3WUGA 3NOEA 1FWTA 1PKNA 1Z7AA 4PBFA 4KKXA 3CUFA 2IPJA 4S3JA 2R94A 4FA3A 4NF7A 3TXVA 4CQBA 3W73A 1Z8AA 4LY4A 3W7NA 4ZODA 1W1YA 4B5WA 1TV5A 1V6VA 4NZ1A 1VLIA 3EWXA 5FIPA 3NZGA 4AD5A 2E5DA 4IX0A 4APNA 2XUCA 4NUWA 1G4TA 2J8TA 2E6AA 3R2GA 4XZIA 5H8PA 4PUJA 4GGBA 1PSCA 1GRFA 2EHHA 4IP4A 1V6TA 4NZ5A 1YYAA 3K8KA 4RNHA 3MWAA 2WKJA 3N04A 2E5BA 4AEFA 2QJMA 2OMAA 5FAJA 1X1NA 1TE6A 2HJPA 2INEA 4MB1A 4HPXA 3GW3A 1GOXA 1H61A 4CNNA 3GH4A 3CIWA 3LBOA 4M56A 3GFYA 4JTUA 3RDKA 4Q4QA 5TIMA 4WOQA 4C7DA 4NEVA 1PYFA 1H5VA 3OLIA 5F4SA 3GH5A 5FCZA 2OLAA 3QV9A 1O5KA 3S5NA 2X1SA 3H2FA 2D0GA 3Q67A 3ARWA 3HN3A 2YR1A 2PDQA 4ROPA 5AC4A 2VR2A 5H2ZA 3QKZA 1KW1A 1W5MA 1XIHA 1E5JA 2RH9A 3ENLA 4XIMA 5JRBA 3N25A 2ATMA 1GOIA 2A3HA 4UUIA 3KWXA 1NFBA 3AMKA 3MBDA 2BC0A 3MZNA 3BZJA 3L2LA 2GJNA 5JCLA 4N2YA 2VI0A 1S38A 1YNQA 1LL7A 1A0EA 4GNVA 3GFXA 3TXZA 4W7WA 4ZEPA 3R5EA 5AVHA 3VM5A 4BURA 3T40A 3GQYA 1TR9A 2YLLA 3OVQA 1DNCA 4EX4A 4Y9PA 2WPFA 1G5AA 1RM6B 4E3VA 2AKMA 3GG8A 1ONRA 1KR1A 4WSHA 4MB5A 4JPGA 1JFHA 1ODZA 4H7VA 1F7BA 5A6BD 1U5JA 3DEQA 2XDFA 2VWTA 1EYWA 2JEQA 1OABA 4GVGA 3SN1A 3DYPA 1EOMA 2ZTJA 3RM9A 3MW7A 2AGTA 4PR4A 2WVVB 2NV1A 4U3AA 4AMCA 5T9BG 2VM8A 1T8QA 3A12A 4YWOA 1O66A 1ZJHA 1P0NA 1HJSA 4DO7A 3KP1A 3GVRA 4CCDA 1DBTA 3M5YA 1UWTA 1BGAA 2P76A 1J0ZA 4FXRA 5FF4A 2E68A 1OBAA 4Z17A 1C29A 1YE4A 2PDMA 2NSXA 4HMNA 4BF5A 1K1DA 3OW1A 4DLFA 4PCSA 1CGUA 1C90A 1NSJA 1ZGDA 2VEPA 1TX2A 3QMRA 4D8LA 4UFLA 3A7UA 5IM51 2V3FA 1MQRA 3W86A 3DKLA 4P8WA 3WH8A 1R9XA 2DT3A 3KVKA 4JEQA 4B4FA 1XBYA 3G8RA 3RR4A 1E6NA 5FEPA 3TP4A 2I17A 1XQKA 3MSYA 1N62C 2DUXA 2X41A 4HJWA 1Z69A 2HPMA 2OYKA 3W81A 3QFBA 3UNDA 2J8FA 3WJWA 1GPFA 3BW2A 4OFCA 5KZDA 4NEWA 2Y62A 1FX6A 3W70A 4HGXA 3W25A 2Y85A 1RQBA 4E2OA 2CLIA 4WX2A 4M7SA 2Y4SA 4IIHA 1ISZA 3QSTA 4WUIA 4UTTC 2ISVA 3WK1A 2WHMA 4MB3A 1R2SA 4FMVA 3L8KA 2Z6JA 2VGIA 3KTSA 3L5MA 4LCSA 4GJ1A 3I4EA 4LYPA 2OTDA 5DCEA 3AXXA 1X7IA 4PRRA 1U5HA 4MB4A 3UF9A 5DCDA 3B97A 4H4SA 3EGJA 1E56A 3LCHA 4UC5A 1TUXA 1R9ZA 3O0HA 4Y96A 4Q6XA 1QOQA 5KINA 5FS6A 2DUZA 4NNBA 1AG1O 1PZ1A 1WBJA 1JIBA 3E9AA 5LA2A 5FJRA 1AJ2A 1Q2SA 1I75A 1R6WA 3OA3A 3VNMA 3MV11 4H8UA 2XH0A 4JTSA 1HKMA 3F1QA 5D4YA 3RRAA 4B92A 2PCQA 2PI6A 3IAPA 4IMAA 1I2OA 3WK2A 1P0BA 1VHNA 3NQ8A 2H8XA 3IJ6A 1DWFM 4K8HA 2PDFA 4PEKA 1B31A 4B5SA 3GB6A 3FJNA 1YDYA 3P3BA 3ARYA 5LIUX 4LUSB 4H8HA 3CH9A 1YE6A 2WC4A 3WLSA 2NQJA 2J7GA 1SFTA 4RXGA 2VRJA 1UWQA 4GY0A 6PTDA 3U7VA 3WSUA 3GG0A 5J5RA 1UQYA 3ABRA 3ZT7A 2OJPA 2OSYA 4PTVA 1E5NA 1FH7A 4WSKA 3KFTA 5XIAA 1W1TA 2PZNA 3UWQA 1QAPA 2D0HA 2WP6A 5FI8A 2BZNA 1H49A 3KCJA 2BB0A 4LW7A 1SJDA 1JVNA 4XAFA 1C8XA 3PBVA 4S3BA 4AWEA 1IXPA 3W83A 1YTKA 1MFUA 2HNEA 4LCQA 5HQMA 4BV6A 3RG6A 3LXCA 4YYCA 1BF6A 3S1GA 2YYUA 4JXCA 4QSHA 3N9KA 3DGHA 1GOQA 1MI3A 1NOFA 4X0VA 1VENA 3VIMA 1Q63A 1Z42A 4MWAD 4N7QA 1OVDA 1OZQA 5IDZA 3HO8A 3H54A 1NOUA 3SEPA 5CKSA 1VRDA 1OFEA 4C6NA 1IF2A 3INPA 4MG4A 2WMKA 2JGYA 4GZ7A 3A5FA 1POJA 3W1RA 8CGTA 4H4TA 2XSBA 2F84A 3OQ8A 3PPHA 5B7ZA 2J7HA 2C71A 2Y5SA 5HJLA 4DXVA 2GUBA 3R6IA 1NOWA 3AIRA 2B81A 4UZUA 7XIMA 1EIXA 4O14A 3WD1A 5FJJA 2NWRA 3PK7A 4BI7A 4LC8A 1ISVA 1JQVA 1ZFJA 3H55A 3UZXA 4O18A 2WWCA 3GNRA 4GFIA 1DJWA 2ZDSA 3NPUA 2VDGA 4EMIA 3IVTA 5FD0A 2NUWA 3MUZ1 3RGTA 3DCPA 3LHVA 5FJIA 1B4EA 3TJXA 4ECLA 4LAKA 3VUPA 4MADA 3SCNA 4KRUA 1CZ1A 3VIHA 4WKHA 3BJSA 2A2IA 3SECA 3VDAA 3NO3A 3AIQA 4YTQA 1JPMA 2TPRA 4W86A 4WEVX 4H4VA 3GC2A 3PZMA 3VD3A 2E1DA 2W3ZA 1B90A 1JCMP 3D47A 1OG0A 4ICMA 2J9ZA 2WPCA 3TIMA 4GO9A 2PTXA 5BXSA 3S5SA 1O7AA 3B9JB 4US5D 2NX3A 1PX8A 3FCPA 3U4FA 4PSPA 2W6RA 3VPLA 3BGJA 3URHA 1NF0A 3UWEA 1OHLA 1XCXA 4WLCA 3FFSA 3UXDA 2QAEA 3GC4A 4HPNA 5I3KA 4Q7BA 3NZRA 3DG7A 3K4DA 3ZVHA 3M0IA 1KM3A 3DYOA 1B3WA 3UP8A 3MVTA 1DIKA 4C7GA 4HP5A 3R43A 1LF1A 4IMFA 4K8EA 4ZXLA 4H19A 2GJXA 3TN4A 3DI0A 5JXQA 3CGDA 1LOQA 3D3AA 1FRBA 2J88A 3MMDA 1LWHA 3M7WA 1O94A 3CQJA 3LHTA 3LZ3A 1CGTA 3DFQA 1XD1A 1KWGA 3CUGA 5C2XA 1HVXA 4PMVA 2WVSA 3UERA 2GL5A 2RFGA 3HGSA 1KD0A 3OBAA 1UJQA 4UOZA 4HNLA 5I77A 1ZK7A 3LHYA 3PANA 2V30A 4JTCA 1GQIA 3CGCA 3L4YA 4MNKA 2O55A 2BC1A 3PF3A 2Y5EA 4C6OA 2HCVA 3BW3A 5F2MA 4E2DA 4CN4A 3BICA 5CPLA 2EPHA 4HCLA 1V6YA 2F6UA 3BDKA 2DSUA 2ZZ0A 2TYSA 1GGOA 3BVJA 1Q8AA 1JZ8A 3FXYA 4Y9OA 2VX6A 1E4IA 4DF2A 5AFDA 3IRDA 2CERA 3GHUA 3B9OA 4LSBA 3EYPA 5KVIA 4HU8A 1FWCC 3LU2A 1UKTA 3VK5A 4RUBA 2QXWA 2YVGA 2V2HA 1D7KA 1XYBA 2GK1B 3TW9A 1G0CA 2QAFA 4B2DA 1Q1WA 2W9MA 4IF2A 2C1GA 3BLPX 2BHYA 5D32A 4XD3A 4BQ4A 5BXPA 2E5CA 4WKFA 1EUAA 1TPUA 2QCDA 4GABA 3KS5A 3PVFA 2C15A 3NQMA 4AY7A 1GUVA 3TV8A 3E12A 4Z08A 4KCVA 4J56A 1C93A 1W5QA 3EXSA 1RHCA 3QPYA 3H21A 3CZ8A 3SGUA 3VD9A 1I45A 1ZZMA 3N13A 3ZJ7A 9RUBA 1LOSA 5I3DA 5JBDA 1H5YA 3NM1A 2O4QA 5HA7A 3REQA 2WLYA 1X2GA 4M6VA 3SFKA 2DQXA 2DU2A 2P8BA 4ZSTA 4H4YA 5I03A 4GC4A 4B5NA 4EF9A 4GRSA 4R27A 4FXFA 3NUKA 1PAMA 3WKZA 2YIHA 3G6LA 3MMUA 1XI3A 1MWOA 3T2OA 1LRQA 2XIQA 5JCMA 1N55A 1IEIA 3EMZA 1I1XA 2OZ8A 3C0JA 4IGSA 1W3JA 2QMJA 3GD6A 2EO7A 4H83A 3CZLA 1HL8A 1XD0A 5EYWA 2ZQ0A 1TTQA 1QW7A 3PWGA 4CNTA 3EWCA 3FKKA 5JQ9A 4HSOA 1G9HA 2D73A 3N17A 4W85A 2PC4A 2RAGA 4IQDA 3S5OA 5BOOA 3E38A 2WO5A 1MUCA 2ZRXA 1EOKA 4N4QA 4O1CA 2ZOXA 1RD5A 2QDEA 3PNZA 1E0UA 4R7WA 5DBTA 3SR6B 3KCOA 1LORA 4EAYA 1KFEA 3HW2A 4R88A 8RUCA 1NHRA 2CHNA 2CZFA 4DZ5A 3OVRA 2XZ9A 3W02A 2FZBA 1EA0A 2DT0A 3VA8A 2CZEA 4L56A 4HA1A 2PRLA 2GOKA 3Q58A 1PIIA 3QXBA 2R1LA 3J7HA 3UG8A 5M3WA 3WBXA 4WXYA 1TZZA 1HZYA 1KCLA 1FO4A 1TX0A 4M3PA 3SQSA 4PGLA 3HZ3A 5DCBA 4AD0A 1QK2A 2VDHA 4NL1A 1EHNA 1RALA 3RF9A 2PDYA 2EKGA 1UKSA 2WHLA 2OFJA 4B16A 1SZEA 4MUPA 3WDHA 2VHLA 5AC7A 4FOKA 1U2YA 5GPRA 3CMGA 4BHYA 3TYAA 2Z28A 4CLMA 3QRHA 1OD8A 1DXIA 2HNHA 4H01A 4TO8A 4POCA 3IANA 3AHYA 4LVGA 2HRWA 3W74A 3VNYA 3U3HA 4WXZA 3BAKA 2EQDA 1UUOA 3AIVA 3GHRA 4WKAA 4QAIA 1JQXA 3V5CA 3TWBA 2ZX7A 3EAOA 1B2YA 4A4AA 1JDEA 4DYKA 2J9XA 1LTDA 3STGA 1NFGA 4S2CA 3G0SA 2GYIA 4DUWA 2MANA 1QVBA 4HA4A 2PUZA 2ZUWA 3N2CA 2J24A 5BU9A 3KXQA 4EM4A 3W1PA 5AYYA 4GOAA 1LT8A 3GG1A 3WJXA 2YDSA 2IUZA 1NP2A 4DRSA 1C8YA 1M65A 2GSHA 2ZUSA 4C6FA 1E0WA 1G67A 1B1YA 5K2ZA 1XIMA 2ZDRA 2FZDA 4F2BA 3GWQA 2ZRVA 1GETA 3GXDA 4LWWA 5JIPA 3N4EA 3LCGA 2E67A 4XKMA 3A7RA 1TV4A 1ZJIA 3K13A 2YQUA 1IEXA 1TJ0A 3WX7A 2WKGA 5K3VA 4IL2A 4PB4A 3H12A 3FOKA 2QJIA 4RE3A 3AI0A 4FF7A 3UA4A 4CVWA 4EPDC 1LCOA 1W5PA 4WDTA 2TPSA 4TOQA 1NP0A 3NL3A 2I7GA 4NAFB 3EWUA 1NPXA 2GQWA 1WV2A 2XVKA 3PFRA 3DXIA 3WF4A 3M0YA 1EJRC 4FX6M 2QDGA 1V79A 2WZMA 4JIIX 3WQPA 8TIMA 1KLZA 1Q7QA 1RJQA 1VJZA 1GEUA 2C0HA 4HNCA 1H2IA 3TU9A 4K8GA 2ZRWA 1PPIA 3CUJA 4LEQA 1RQEA 1V77A 3KAOA 2MUCA 2VTFA 4J40A 2A3CA 4CCZA 4AY1A 4BK9A 1V3MA 2XGBA 1W1PA 4DUVA 4PUMA 2J79A 1XPYA 1PEZA 1BVZA 3RRXA 3AIEA 1M7XA 5A6TC 4M52A 1JAEA 4JTLA 3IUHA 1FP8A 2XM1A 1PJ9A 3EDFA 2HV5A 3OZOA 4E6MA 3DAQA 2H9AA 3VX1A 1H11A 1W1IE 4MWAC 3AXHA 1DWAM 1EDQA 1H63A 2V8ZA 1EXBA 5CPTA 3D5HA 1EYEA 1LQ2A 3LUTA 1A5UA 2ZUTA 1XHCA 2PDPA 1SO6A 4JTDA 1EDGA 3S42A 1YTDA 1TMHA 3LGDA 5A6AA 3IJ9A 4GFSA 2JKAA 4LBUA 1N61C 3KVJA 4GE8A 4ATDA 1XLJA 4EXBA 1O4UA 3NURA 1XYCA 1SQ7A 3GVVA 3N4AA 1SFJA 3A3HA 4H3DA 3APGA 2PLKA 3SCTA 1TVNA 2FTPA 4JN8A 4EIVA 2YL6A 3GYEA 2NVAA 3RN6A 5BXRA 2YZRA 3R58A 3CHCA 1AH3A 2Z1VA 3CV2A 1MW0A 4A8IA 4FR1A 3WNNA 5JCIA 2B7PA 4NAEB 3ARSA 4QG8A 3CB3A 4JOMA 1GNXA 4J5NA 3QHMA 1BVWA 3P84A 4D6JA 3SCUA 1A4LA 3AO0A 3FJ4A 4KFNA 3C61A 1XX1A 4IXHA 4UOQA 1OGGA 3VTRA 3QY6A 1RCQA 1FWHC 3GZ3A 1J6PA 3PZVA 2YXXA 1EIBA 3VM7A 1KM6A 2Y2WA 1MDRA 3O6YX 4EOUA 4YLWA 1S46A 1CLXA 3M64A 3IS4A 4DQWA 1K4QA 3S83A 3U8GA 4W8BA 1BKHA 2WPEA 3CASA 4ZGYA 2VCBA 1TSIA 3M47A 4NJJA 1AL8A 2FLIA 4PEEA 2NXHA 3BMVA 1IT8A 2DIJA 2CBUA 1HJWA 5IXEA 1MW3A 2VZSA 3W1NA 2CC0A 5AKQA 3LRLA 1PZ3A 1NWSA 4Q3MA 1S5MA 1M7PA 3EKZA 1ALDA 4UTWA 3VDGA 3T6CA 4GISA 1ICPA 2J62A 4LH8A 4ZO6A 2W67A 3VOJA 3SUTA 3EEGA 4MLJA 2WZTA 1SO4A 1EX1A 5MF5A 3TAKA 3LHWA 2DT1A 2P5NA 4E38A 4KPLA 1GXFA 3AISA 3V4BA 2DUAA 3CYVA 3R0DA 3EA1A 1FEAA 3XIMA 3HQOA 3ZT5A 5DT5A 5I23A 3IJDA 4M6UA 1TPDA 3PHAA 1XANA 3BGAA 2QDDA 4OT7A 4CEXC 1A50A 1T96A 3ARVA 4HNUA 2DZSA 1BYDA 3MO4A 4L61A 4WDWA 2Y61A 3H2EA 3RPTA 3KE0A 4Q8QA 2EF9A 1QNOA 3UWVA 3T0DA 3B0VC 4GI6A 2QKFA 5KZEA 1LVLA 3C4UA 1VGAA 3MUXA 3UZYA 1Q4WA 1H7WA 5LNVA 4FP1A 3QGVA 4RKAA 2ICSA 2CLLA 2YXOA 2UBPC 3HF3A 2DSVA 3SQPA 3PWIA 3WNMA 3LRKA 4V1XA 3OG3A 1UR1A 3VC5A 1YW1A 5HK4A 4AG0A 1WQ5A 1TVPA 1R3TA 3FGCA 4XD6A 1UROA 2E25A 2ZZ3A 2A7NA 2UY4A 4GUHA 1IIHA 1R47A 1KC7A 1KBKA 4C6MA 4QIUA 3MHFA 5CJ5A 3HJZA 1O5QA 1F73A 4X2PA 3M1ZA 2BVWA 4KCWA 3NO5A 4QS6A 2CZ5A 5CZ0A 4N6EA 2C16A 4JTIA 2E9BA 3Q2DA 2A0NA 1GQLA 3HQNA 3CV6A 1E1CA 4WDXA 4XZLX 3TLQA 3N2OA 4O13A 2Z2UA 3ZMRA 1RJRA 3B4YA 2WMHA 4DAIA 4X9SA 4KW2A 3WQFA 2CZDA 4NZCA 1VBUA 1O5RA 2PTWA 2D1ZA 2R82A 1J96A 3SUSA 3F2BA 1XUUA 4I3GA 3UWUA 1N5WC 3M4HA 1US3A 2BBFA 3HV9A 3VMOA 4OOZA 3GRTA 2QMKA 1MMFA 1W5NA 3U2ZA 1JEHA 3EA3A 2F38A 1PX4A 2VFHA 3POCA 1EBGA 3LGEA 6TIMA 4Q4SA 3DOPA 2PAJA 1G7VA 1PVNA 1YADA 4J3WA 4AZCA 5CC5A 4GVIA 5D8ZA 4UFKA 2FHCA 3UXLA 4JFTA 3CLWA 4JFSA 3KDOA 3QHOA 3CWOX 4BWLC 2JIWA 1T7LA 1ZMDA 1RXOB 2FFCA 5LXXA 9CGTA 4PMYA 5E5CA 3DFYA 3UR2A 2GJPA 3CAKA 2HSAA 4M6PA 1Q85A 4ZZ9A 1EDTA 1TRIA 4XAYA 3LENA 1J0HA 2J74A 1D3CA 3C5QA 3UG3A 5ABFA 3OLDA 3VFLA 1CI1A 2R8WA 3TTEA 1HL2A 1LWJA 3UR5A 3TNBA 2GJLA 5FS7A 5AYIA 4MAVA 1N8IA 2OCZA 8XIMA 4G8TA 3QLDA 2INFA 2HK1A 4CCEA 3C0SA 5I3JA 3F4NA 2HEJA 2XGZA 3VZXA 3RYSA 4NJKA 4ZXOA 1EXPA 1EJVC 3LBMA 1QCWA 3B4UA 1GKPA 5E0KA 3STCA 1CCWB 2G8ZA 2EBNA 3SGGA 1TKKA 4XZMX 3VXGA 1WKDA 3WZ0E 2XSXA 4GY7A 3SCPA 1M41A 1Q6CA 5BMWA 2AL2A 2GGIA 1H1NA 2Z29A 4LC6A 4HNVA 1DOSA 5FKYA 3P74A 3WNKA 4Q4KA 3BOXA 3MA8A 1H7PA 3NR0A 3TA6A 4AD3A 2V3EA 3T81A 4JL1A 5JH1A 3K8MA 2J47A 4K38A 2D2OA 3GFZA 1TREA 4NKCA 2V38A 4XIAA 4R53A 3GNNA 2NWSA 1F5ZA 1V6WA 1ZAJA 3PULA 3Q37A 4BR1A 3O6DA 3ZSSA 1MQQA 2BODX 3B05A 3I6TA 3W7RA 1VB9A 5F4WA 4UOJA 1DKWA 5AZ0A 3L21A 1UASA 2HE8A 3STEA 4ZO7A 1ZL1A 5I7GA 1SW0A 4JTKA 1JPDX 2D24A 1JOAA 1VFMA 4Z2GA 3FAXA 3T78A 1KLYA 3URNA 1BD0A 4X60A 2WYSA 4Q4PA 1DQWA 3VOGA 3VAVA 5D2YA 1A5CA 3WH7A 4FHAA 2WSRA 3TYDA 2FVKA 1A53A 3USZA 2D20A 4ZO8A 4CUCA 2QUVA 9XIAA 3WLIA 3UPMA 4QQUA 1DJQA 4G56A 4W7VA 3OC4A 2PLCA 2XIMA 2X99A 1E73M 3G1HA 6XIMA 3BLFA 1XC6A 3GXIA 5HATA 3CL7A 4WSJA 2DZUA 4PCFA 2X1RA 3G1DA 3S2MA 4E8CA 2X8HA 2WWDA 2DVTA 5JCNA 1ME9A 1MUMA 1TJ1A 3SDOA 4GKLA 3CJPA 5AC8A 3GG7A 1M7JA 4UR8A 5DY3A 2WOVA 3CMFA 3ABSA 3U2CA 3WH9A 1JF6A 4QS5A 3KEHA 3HPZA 1ENUA 2G0WA 1H7NA 5EGRA 1HJVA 3UU0A 3B9AA 1ESWA 3TH6A 5AHEA 1E51A 3VGDA 3FG2P 4AF0A 1QW8A 4GQ0A 4LV4A 5FOOA 3WENA 3M0MA 1XYZA 3B8UA 4EPBC 1GYNA 1BHGA 4EQXA 5BNKA 3HMJG 1W9DM 3JVAA 3AUOA 1LQ0A 1X6LA 1VBRA 1X38A 4BY3A 1REQA 2LLEA 3G1SA 1ZUAX 4KRZA 3WD3A 1ITQA 3BOFA 4M81A 2B7NA 4K39A 1QOXA 3UCCA 2Y8KA 4RE0A 1MOKA 1O68A 3BOLA 1RP9A 2WM1A 2ZZ2A 3AAMA 1OZMA 3ZR6A 3S3GA 1QHPA 4KGJA 2D2GA 4NILA 6ENLA 4Q7IA 4AH7A 3IIPA 3WIJA 2CW6A 1JCNA 2IMRA 3W2KA 3BMWA 1O6IA 1OF8A 4Q8VA 1WXYA 2CETA 3C86A 5HJXA 2GPTA 2J25A 4J7RA 4HKPA 3FN9A 3E0VA 3R8HA 2G3MA 1HL9A 2WZHA 2IKIA 4JKMA 1Z44A 4TVUA 1E71M 4M5PA 3T8LA 3WDPP 3OGRA 1ODUA 1TQXA 2W0HA 4NRSA 3F03K 2Z7GA 2ACQA 3QHNA 1DL3A 1TMLA 1XIEA 4UTJA 3RILA 4CQAA 1BXNA 1A5BA 1F07A 4N6FA 3AS1A 2TODA 3EUB3 1KA9F 2C13A 3IRSA 1I0DA 3W24A 2TAAA 4GZIA 1A0CA 1XLHA 2DSWA 2IKGA 3P80A 4G7EA 4PMOA 1GHRA 1RVKA 4L5ZA 1JUEA 3EBVA 4ZOEA 3L4TA 2AQWA 4LCRA 3L0KA 3VIGA 3VINA 4CNSA 1F3WA 3G6MA 3R11A 3NPWA 4JQ3A 5BRQA 5A8OA 3QGAC 2EKCA 1M9HA 1B3ZA 3W9ZA 2BCPA 5CQ1A 1Q7MA 1SR9A 3B8SA 1WKEA 1OK4A 3A4WA 3UPWA 3ZVHB 1EL3A 2OLHA 1IWBA 1XQLA 4JD4A 5C8BB 3H4KA 3B04A 3LM3A 1LDCA 2D2JA 3BH4A 4B91A 4V28A 3EXRA 4N02A 4DXKA 3A47A 2JFEX 1K9TA 1SGJA 1EC9A 5E0CA 2GJXB 1F4HA 2DJLA 2PWGA 3H2AA 1XBZA 5LKYA 4L1XA 2BG5A 1AH0A 4DI8A 2PRMA 2YW3A 1O5XA 1SSDA 3MKCA 1O12A 4ERGA 1GVIA 4KRTA 3CTTA 4ROQA 4M24A 5C71A 5D37A 4JYEA 1XUZA 1RQHA 4JQ9A 4H4UA 5BU6A 3TZFA 4H4IA 4LVBA 4LY8A 2ZUVA 1ZSXA 1EKOA 1XXXA 4DYJA 1XLMA 3FDKA 3BTNA 4Q8OA 4TUFA 4YHEA 2FDSA 4ONVA 4TV6A 3H53A 3ABZA 1KXVA 2IQDA 5D05A 4OUIA 5F7UA 3TK7A 7TIMA 1LBLA 4NJIA 3FYOA 4LQ1A 3IJLA 3VOHA 4WDUA 3HOJA 3LPPA 1BTMA 2CZVA 1WE5A 3CGBA 5AB3A 1I2PA 5AYBA 4TVDA 2VD9A 3G1AA 1UR9A 3U48A 3PTDA 2QCDB 1QUMA 2JF6A 3APTA 4HZ7A 1EH9A 3DHFA 2OSWA 2O9OA 1Z48A 2RGLA 1ZLPA 3NQFA 3DH9A 4NP7A 1FVPA 1I2NA 2XH2A 3MI6A 3CS2A 1CIUA 3FA5A 3KS6A 3VD4A 3W6YA 2WCSA 1GRGA 1BKSA 3MB9A 3M6DA 3GDTA 3REQB 4IQEA 4RLIA 3NFUA 1OADA 2ZWYA 5D9OA 4NJGA 3T4CA 3E2VA 4AMAA 3OHIA 1YLVA 4LVAA 3C8FA 4S3GA 4OGZA 1X7FA 4AIUA 5KMYA 4IFKA 5C54A 2NQ5A 1C91A 4G1KA 3DHUA 4ZB0A 3ORWA 3ZOAA 4JHMA 1AQHA 1U5VA 4PL1A 3SUWA 2Z6IA 3WLNA 1XJBA 4LPCA 2XFRA 4J1OA 4AXKA 2QS8A 5K4XA 3BUVA 3MTWA 3B9NA 2RDUA 3B8TA 3QR3A 5D04C 4RX0A 3O1NA 4P7NA 4DJFD 1JCJA 3C2EA 4LUTA 3A4XA 1QBAA 3CB8A 3PG9A 2VGBA 3PUDA 1YXCA 2WANA 3N4FA 1LJYA 3W7CA 2P10A 1ZENA 2UV8G 3VGHA 5KZMA 2DPEA 4O1BA 1JD9A 3E0FA 3N3TA 4N9BA 1XRSA 4L7ZA 1IT7A 2YB4A 4LS1A 5DLCA 1GOMA 1H50A 1XCWA 4UXDA 1Q6FA 4QROA 3OG2A 3IARA 4DJDD 4UTWC 3GIQA 5AYXA 3F4CA 3G5EA 1Q4NX 2CLPA 3K5XA 2J7DA 3KZPA 5A8MA 1RPXA 2KAUC 4ADTA 2V69A 2NZLA 3G24A 4BCEA 1OIMA 3ATZA 4PCTA 7A3HA 1E55A 4AZIA 1BG9A 4NNAA 4FLOA 1CTNA 3TROA 1OB0A 2PC8A 5K9DA 3WNLA 4J3SA 5JBEA 3YPIA 3TC7A 3OBKA 1M3UA 3DC8A 4UCGA 1F8IA 2VZTA 2PS2A 2G41A 3H4XA 4YJ5A 2OEKA 3AN1A 3LADA 2ESCA 4QAWA 2FVLA 3F4WA 1EX5A 4A8RA 4GRTA 3W1TA 2IQTA 4EQSA 3WMBA 4JN6A 2VGGA 3M0JA 3W2JA 4I8YA 3G18A 4XBKA 3KX6A 4GIAA 1VQZA 2I16A 4S3FA 4QITA 4ZO9A 1T40A 5LNRA 1KV8A 4JTRA 3R89A 1EJ7L 1B57A 4W8LA 3RLUA 4IMEA 4JS3A 5GNXA 1W9BM 2P53A 4A21A 2NQHA 1H4PA 3OO2A 4DO4A 1JROA 3NQAA 2XIBA 4ZOCA 4Q8TA 4QNWA 4P8UA 2NVDA 2YBUA 4JTHA 4DBEA 2A8XA 2Z7KA 3F2DA 3LCIA 2UY3A 5HQEA 2BHZA 2EJAA 2V81A 4LEFA 4GCXA 3SQLA 3GR4A 5TAOA 4IPIA 4REQA 5I78A 2RDWA 4A05A 2WNNA 1H1YA 5G5IA 1FWJC 1DXFA 3DGZA 5IHRA 1I4NA 3VILA 2ZUUA 3VGGA 2CBJA 2ISWA 3K2GA 3H7UA 2G4FA 3I3DA 1RCOB 2IW0A 4TTGA 4A3RA 3NVVB 2YJQA 3VNZA 1UA3A 4Y7EA 1JDCA 1OEPA 3HM7A 5I3GA 3MMTA 1EPXA 4QFUA 4UTKA 5F1VA 1F3TA 3PZNA 3MKVA 3ANVA 1FWDC 4FALA 4QG9A 2OODA 3IGSA 3ITLA 2XINA 1UKOA 3QFWA 2VL4A 3TYBA 3GXFA 3WL1A 7ENLA 2WK2A 3HJEA 3DFPA 3KW3A 1GVOA 3L5LA 3D46A 1Q5MA 5FF7A 3TAOA 4M6QA 3W7JA 4GHRA 4JX5A 3URBA 1W91A 3V75A 1FP9A 2HZGA 4MKSA 3NJ3A 1P5BA 3KLKA 1S5NA 4XSLA 2WSPA 1L6GA 5HPOA 3VMPA 2G37A 2XJ7A 4YVVA 2BTMA 1XC4A 2NV9A 5DMNA 2QJNA 2H9AB 4S3KA 1TV3A 1FCUA 5U25A 3LGGA 2YCLA 3HFYA 1HN1A 1WZLA 4C6EA 1FWAC 1CXFA 1XIDA 2QHAA 1UP2A 4OV9A 3CMJA 3COTA 1O1ZA 4ZB5A 4AVNA 3OZMA 3UD6A 3ITGA 1H7RA 3TQ0A 4NYUA 5I5RA 1JEZA 1GW1A 1L9WA 3L65A 3BAYA 1XLIA 3U5UA 3HGRA 4ACZA 4NIRA 5BROA 2W55A 2X8GA 5M5DA 1WAUA 2VRKA 4PH6A 5LZLA 4P7QA 3WLRA 3M7SA 1TPEA 3SBFA 4AVOA 3RMEA 3ZSTA 1NWRA 4J3ZA 5AHNA 1E72M 4HK6A 4A3YA 4HU3A 4LV9A 1NY1A 5BWAA 4AQLA 3W7KA 2CDUA 4GACA 4KWSA 2XFFA 1UZHA 3WQ6A 2PDGA 4JGDA 1EQPA 1WDQA 3GR7A 4A29A 1IZKA 1WZKA 4D6CA 4IPLA 3OGSA 1PTAA 1XBVA 5HXMA 1Q13A 1GRHA 2BGSA 4G7FA 3LBCA 3UEQA 1O60A 4XKYA 3LSBA 1VFHA 1LLWA 5EU9A 1T99A 4TVCA 2Y7FA 4HTYA 1W3NA 2QULA 2G3FA 3Q6JA 1DPMA 2Z27A 1QWKA 5FACA 1GOOA 2YA1A 2JK2A 5HR6A 2V3DA 3PWAA 4TTUA 3LXAA 4LYQA 4HA3A 1K8YA 1PXGA 2GVLA 3LN3A 3BLIA 4W89A 1XLAA 3W85A 4F0HA 1TR1A 2VFFA 2X0SA 3SCOA 2PFHA 1Z41A 4K3ZA 1OM0A 2VYOA 3GNXA 3O8AA 3G77A 4ORMA 3PJWA 2XN0A 3MC5A 3NXFA 3WD4A 3GXPA 4NU7A 1YMYA 4PB3A 4LTSA 1R7OA 1VFLA 1OX6A 3HV8A 1UH2A 1V8EA 1H1ZA 1IV8A 3TCSA 2W66A 4BA0A 5E70A 4HQVA 1Q2RA 2QEZA 4FDCB 4PYSA 1EP2A 3HG3A 2TRSA 3HQPA 2HDJA 1NQ6A 1EJUC 3QYSA 2BOEX 1CXEA 2Z1KA 4OWGA 1HX0A 2MNRA 3M0LA 4ZOBA 3EWWA 1S2CA 4UTMA 4LRSA 1VYPX 3S6DA 3BV4A 1JDFA 3G1FA 1S5VA 2Z24A 3DYMA 2PP1A 5FF0A 5HWJA 4S3AA 2X0HA 4DBSA 3PPFA 3TVAA 4GUJA 2BY3A 1KWKA 1VFFA 1DXLA 3TR9A 2E9LA 1XLGA 4OECA 3HMCA 4IH3A 3ELFA 1YPXA 4BS0A 1ADSA 3SCWA 4RZ4A 2OVLA 3EANA 4GMEA 1PKLA 5CZKA 3H24A 1NM9A 4DO5A 4D9PA 2DZWA 4NASA 2ZA3A 3CL6A 1E9IA 4HHLA 3AC0A 3TN6A 1HJQA 4QE5A 2XIOA 1TPWA 1CEOA 2VQTA 5KEZA 3OHMB 2ZCGA 3BQ5A 4FR6A 1PYMA 1JRCA 4L1GA 3QZAA 4AY8A 4PODA 2DH2A 3VIJA 1LLZA 4OVXA 2BV9A 4UIOA 1TCMA 4GCAA 3WBYA 4CU6A 3PUEA 3MJYA 4AZ6A 4CN1A 4RDWA 1SMAA 3FGCB 1U22A 1EEXA 3VCRA 4YU1A 4CQ8A 4AD4A 3W37A 3OB8A 4QSFA 3K1DA 3WJSA 2ZIDA 3WUEA 4PN2A 3T07A 2NUXA 3BJTA 3AZTA 3DG6A 3WEZA 5A95A 5A2AA 4ZL1A 2OQYA 4RR4A 1E1CB 1UD3A 3GU9A 4MGGA 3NQ6A 2CWXA 4EVZA 2OYMA 1MXGA 4R7OA 3N2BA 3R8RA 1OC7A 1L0PA 5A1AA 3KLLA 3ARTA 3FAWA 3LI1A 2E0PA 3IGUA 3VD5A 5IDIA 4GPNA 4GVHA 3MBFA 4Z1CA 2A1YA 1GJPA 3THCA 4ZQRA 1QHOA 4ADSA 4AIBA 1R8LA 1K03A 3A22A 3VIOA 3UZZA 4K1WA 3UR7A 4S3DA 3UYCA 2IKJA 3VOIA 4WK9A 1F9CA 3II1A 4B9ZA 1EWEA 5HMDA 4S3EA 1XGZA 2WMFA 4AEEA 3U4AA 1EEPA 3AROA 3WEOA 3T2PA 3UT0A 2X40A 4AZCB 3LLFA 2DSKA 5A8PA 3VKBA 1KV5A 1GWJA 4MYXA 1E1EA 3GR8A 3TJLA 2YAUA 3VZZA 1R3YA 2A6NA 3WDQA 3FHAA 4DF0A 1TA3A 4LS0A 1YDOA 3OA5A 4DJFC 5I6SA 2OX4A 3RNMA 1GVSA 4IP5A 5EFDA 4FAMA 2O9RA 3W28A 1T0OA 1R3RA 1LL4A 5AZ1A 3KRBA 3SI9A 4JTFA 4HOZA 3M44A 5ABFB 2P1FA 3R94A 4OKDA 4C1LA 2VQUA 4R7JA 4NHVA 4XVDA 3HRDC 1ZCCA 2VFIA 1X6UA 1QPNA 5J04A 2BHUA 5FF3A 2CKRA 4ZCWA 3W0KA 1IGSA 1P1MA 1YPIA 2E9MA 4N4PA 4IMDA 5D9MA 3O0FA 3N14A 2QUUA 4HHMA 1F6YA 2OEMA 4DJDC 2P8CA 1YX1A 1XDLA 3C2VA 2NLYA 2OPJA 3WLKX 3NQEA 4X3ZA 3AMLA 3F5JA 4XWUA 4O1EA 3VIPA 1VBHA 2R6OA 1H62A 1K7EA 1P6WA 4DAFA 2PDHA 4MKNA 3OYXA 1IHIA 2C79A 1VCVA 3MV01 1ELSA 5LA1A 1B3VA 2O7QA 3AYVA 2GR2A 1LT7A 5I09A 3RHGA 2GGGA 3CAWA 4H7ZA 4U3CA 3TTYA 3G0UA 1HVQA 1GQJA 3D0CA 2AL2B 2Q01A 4HB7A 3W2LA 1UC5A 2ZXDA 3LK6A 4O10A 4W4QA 1HF6A 1N2VA 4NI8A 3TX9A 2Q02A 1FCBA 1U1UA 3GAYA 1UUMA 4D6DA 2OU4A 1W8GA 3S1UA 4JIRA 1IE7C 3THDA 2RJHA 1SMDA 4K7YA 1PTGA 2J6XA 3NVYB 2Z0IA 2ABBA 5C70A 2HPIA 2J7EA 5CAHA 3DFTA 1GEQA 2BX7A 1RK6A 2EG6A 4JNYA 5XIMA 3SCRA 4L4OA 4F48A 1UMLA 3ZJKA 4UMBA 4H04A 2ZZ7A 4F79A 5BOFA 1FHVA 3W7DA 3P60A 4OTKA 2XGIA 3TFCA 2PGWA 5HNTA 4H9XA 3TJIA 2VT0A 3W7EA 1IZCA 3VCNA 2UZ9A 2V5DA 3MYPA 1EJSC 4QLJA 4U2YA 4FOUA 4AHOA 1N63C 2ZX6A 1BG4A 3IWPA 4YXGA 3GNDA 3OVPA 3W00A 2Y1HA 2CBVA 1TCDA 4OBRA 4DWSA 6A3HA 1JZ6A 2EQ7A 1QPOA 3GHTA 3LOTA 5I3FA 3BV7A 2GR1A 1GG0A 4AUBA 4PFHA 1D7FA 3APYA 2QCLA 3MSGA 1GVFA 1J18A 3DK8A 3V5FA 2OZTA 2OG9A 3KM8A 1AZ1A 4O52A 1FFUC 1TYPA 3ZM8A 3DUGA 4BF9A 3CZEA 1KCXA 1CGWA 1C8VA 2PB1A 4MWAE 1Z3NA 3W7HA 1WBHA 4FPSA 1L2UA 2HBXA 3CU2A 1YKWA 2IXUA 1AJ0A 1WDWA 4JDBA 5FESA 1KQYA 3ARUA 1TV2A 4AF0B 2BLEA 2WQPA 3L4XA 5FEZA 4AIEA 5DMYA 1UD6A 3ARZA 1A3HA 3EF6A 5IBXC 2QGYA 4O15A 3QSRA 1OSEA 4C6CA 1ZB5A 3S5YA 3FJ6A 5M1TA 3W87A 2XH4A 1G4SA 4Q4RA 1REQB 1R7AA 3BAIA 4A8LA 2Z2BA 2WSYA 2AAQA 3FDGA 3S1WA 5CXPA 4PBGA 1KXQA 4EWND 3VKAA 3LPOA 4XSMA 2PDNA 5AHIA 3QPZA 1AH4A 4FO4A 1SU5A 1TG7A 3UQNA 4HU0A 1UR3M 2GVEA 2YA2A 1T8XA 3G8EA 3SCVA 4YCPA 3KUMA 1EGMA 2W4XA 4W8AA 3W7MA 1FY6A 1IXOA 3MANA 4U33A 1A4MA 2W3RA 2NSOA 1GRTA 2EGZA 1SFSA 1KBLA 2BGQA 4ML9A 3G1XA 4QP0A 4M82A 2J9YA 2C1IA 4HHHA 4PRWA 3DJGX 1ZHAA 3DBNA 2RJGA 3CGEA 3PR2A 3BLEA 2QV5A 5IOBA 3FEQA 2YBVA 4V2XA 5A69A 1S5WA 2DP3A 4H1ZA 4AYGA 4N9CA 4BF7A 2YVFA 5HNUA 4RZBA 2BY0A 1W0MA 4PTWA 4AVFA 3LQGA 4HSNA 3WBAA 1SJBA 4I7WA 5G4HC 1Q65A 4KS0A 4CU8A 4G7EB 4QJ1A 1QI3A 2UY2A 3BAWA 5TNVA 4NY2A 4F0MA 1AJZA 2QV4A 1G4EA 1SZNA 1YDVA 2ZUMA 5LIWX 1A0DA 3QV6A 4J3XA 2OYLA 5G1YA 4DIAA 1ZJAA 3NYZA 4UTIA 3IUDA 3EPNA 3TCEA 4L4MA 3R79A 4GZEA 4DWSD 5DO8A 4HTBA 1GZGA 4DELA 3LNMA 2YPIA 4IIGA 1EO5A 2ZYFA 3T08A 2FYMA 2ZRZA 2J4GA 3H7VA 2R24A 2WCGA 4QM1A 2GSJA 1NQKA 1R3WA 3B3DA 1NH6A 1CXKA 5G2WA 2YBTA 4PBEA 1PCWA 2BVDA 4S23A 3P62A 3WLJA 3AQUA 1TYGA 2DFAA 1IXNA 3CEUA 5D30A 4JIEA 3LV6A 4JNMA 1XIBA 2PF0A 3KHJA 3C2YA 2Y6ZA 3QW4B 3B06A 5ECUA 4C6BA 1HKVA 1W3TA 1W3KA 1SYTA 1V3JA 3SZ8A 3N11A 5C7HA 4DPPA 5T8GA 1K8CA 3DI1A 5E9XA 4QCFA 4F2TA 4UQDA 3L67A 3B03A 5HULA 2Z00A 2G97A 3FV9A 3PB0A 4CQCA 4P8VA 2ZA2A 1GHSA 1SO3A 4FX8A 3QYQA 5AHFA 3WCZA 2WMIA 3LERA 1JXJA 1R9YA 2G4JA 1DTUA 1IYXA 3FJLA 1WZAA 2QPSA 3WLHA 2AGKA 4O8RA 3KL5A 2DEPA 1ZP4A 3N18A 3AYRA 1WP6A 4GI9A 3AALA 3ZJ6A 3CO4A 3Q94A 3GXMA 1KFBA 3SY1A 4O0KA 4DF1A 3L5OA 3P81A 2HE5A 2PDKA 3K1GA 5EMJA 5CSRA 1POKA 3IV3A 4W7UA 3PAOA 3N29A 2AKZA 2J7FA 5BRPA 2ZKMX 4DBWA 3PZ9A 3S9ZA 3AM9A 1A5NC 4AYSA 4AZHA 5FMHA 4W5ZA 5E6ZA 3A4JA 3HURA 2QW5A 2WSQA 5C0QA 1UYQA 3CUHA 1JF5A 4PUUA 4F0SA 4M1RA 3GYCA 3KTXA 1LL6A 1LRTA 1F3XA 1JUKA 1B30A 1EQCA 1IR1A 4QX4A 1A5AA 4QGCA 1W3HA 1CECA 4JTAA 1TPVA 3P93A 5JCKA 4HZ8A 1EBHA 1I2RA 2YFOA 2IPGA 3B8IA 1EHAA 2BS9A 3LPFA 1Y5WA 2FHBA 4IFKB 3UJRA 1E40A 4WF7A 2QYGA 2E6DA 3UXAA 1RBLA 3P82A 4GO8A 3GAKA 3UZJA 4LAOA 4PFMA 3KBMA 4JEJA 3PZIA 3KRUA 7CGTA 1QI4A 1VJIA 5D9NA 1U30A 2JBMA 4DPQA 4E4PA 4U10A 3BO9A 3ARPA 3CHEA 4AW7A 2NUYA 4LUTB 3A7AA 2CHRA 2A6LA 1MO0A 3NPVA 4KERA 4IIEA 1TRDA 3BSHA 2DJXA 3CIXA 1Q6OA 2OOGA 1TWDA 4XZ9A 1UG6A 1X1OA 2FPYA 2DGAA 4IPJA 3EA2A 1VAHA 2XH7A 4D71A 1NAL1 1L6SA 4A22A 2F7FA 5D2VA 1MQPA 4IUGA 4MFEA 1H09A 5BWFA 5TBOA 2VR4A 4LALA 1E4LA 3PUOA 1VPYA 2PF8A 2C14A 4AFYA 3AHZA 3LCLA 2ZX5A 1JJKA 1IEQA 3G1YA 3WLTA 5C9ZA 1R3VA 1NHQA 2BFGA 3PBWA 1KKOA 1ADOA 1J0KA 3GBDA 3OYZA 2ZZ4A 3BPWA 2QZRA 1TPH1 1XIFA 1RR2A 2X1UA 1P0KA 3FY1A 1JPKA 1Z89A 4B5XA 3CLMA 1W17A 1D3HA 1Z6KA 4C65A 4RZ5A 4URIA 1V6UA 1E3ZA 2WW5A 4L9XA 1QOPA 3CT7A 2VFDA 1K02A 4ZFMA 2VUYA 3PJUA 4ADUA 4GWEA 3RMJA 1WZMA 1GYLA 3LI0A 2YOCA 4H9TA 3VIIA 1DJGA 4GX9A 3MU7A 1OJTA 3LB8A 3L7RA 3QC3A 2Z2AA 5BW6A 2GR0A 3DK4A 4I7UA 2C19A 5T9CE 2XVLA 4XAPA 5LA0A 4GYKA 3ALFA 3A3WA 3W23A 4EXAA 3GS6A 1I60A 3DN5A 3VDCA 3T55A 1C7SA 3ITXA 3C3NA 5CPSA 3T0CA 1YXDA 1TYTA 1XYLA 1XIIA 1V3HA 2YFNA 4J2PA 2QIWA 4AWTA 1V02E 1MSSA 2RUSA 5EMLA 3S2CA 5I00A 1LBFA 1CWYA 4RL3A 5CGQA 4K36A 1N8FA 4ZE4A 3AXIA 2E3ZA 1KFKA 2NV2A 4REQB 4LB4A 3IJIA 4CQ9A 4NX5A 1EJTC 4Z2HA 2GFTA 4YTUA 3MUY1 3BGGA 2Q09A 1KRBC 1RP8A 3H22A 4DO6A 3CK5A 3NQDA 1J0YA 1I0BA 1TWWA 1ECEA 4H6KA 2FHFA 2OZ3A 2H90A 1IXQA 4GIYA 2X2GA 1UIPA 2Z4GA 1LROA 4B5TA 4LANA 3P7YA 1CDGA 2PODA 4B3KA 5JBFA 1HKKA 4ADWA 3RUBL 1A5KC 4RCXA 3PZQA 5IFPA 3VNJA 4Q8MA 3CPUA 5M17A 5U1OA 3OZPA 1J5TA 3EB2A 2D22A 4UTTA 4H41A 1TQJA 3EX2A 2X7VA 3AIWA 2A7PA 3HFTA 4UBPC 4Q8UA 1FH8A 1E1FA 5HINA 1KBBA 1LG1A 4IJRA 3PG6A 2ZBTA 4EF8A 4Q8WA 2PZ0A 3RK8A 4U28A 3TW7A 4QTGA 4P2VA 3HGJA 2A7RA 2BWGA 1DQXA 1QPKA 2PDLA 1EA9C 3W22A 3ABXA 1E6SM 1AODA 3V7PA 1AL7A 3EWDA 2DIEA 2FPVA 2WP5A 2E5AA 2WC3A 1OX4A 1B0IA 1J5SA 2YCLB 4UQAA 1FWGC 5EPDA 4WOZA 4P8XA 3W3OA 1ZMCA 1HKIA 5FJPA 1PS9A 7REQA 4HJFA 3GX9A 1NARA 2WZEA 4PSRA 3NVZB 3OTRA 3AYTA 3FS2A 2AMXA 4JTQA 1L6WA 3JR2A 1OFAA 3AS2A 4GYPA 5G1TA 1FEBA 1EBDA 4HMEA 4B3LA 5CGTA 4UTUA 2OOFA 1NIUA 1Y8BA 4ACZB 3MSDA 1HTIA 3MUIA 5D2WA 3GDKA 5FJUA 3V0TA 1F4AA 3N6HA 1JRBA 1VFSA 3TYZA 2EPLX 4EP8C 3HTWA 1U1HA 3RJYA 2V5CA 1LG2A 4K1GA 2REQA 4CEUC 3QEZA 5DF0A 4ATLA 1QNQA 4O53A 4QLLA 2OELA 5BRBA 2R1NA 3HIJA 3ITYA 1UOKA 4PMNA 1OGBA 1QFEA 4I6KA 1PKYA 4KPRA 4QNEA 2BY2A 3MT1A 3UW6A 1AW5A 3AZRA 3THQA 3ZXWA 1MXDA 4WVXA 2OO6A 1VIWA 3CYJA 4YYFA 4JKLA 3E5BA 2FIQA 1HFBA 2YZ5A 3QV7A 1TTPA 4XKYB 3DZ1A 3SRDA 2B31A 1N5XA 4GXPA 1XL9A 1BXBA 3N9RA 1Q6DA 3EMQA 3FK4A 3RLGA 4WJXA 3ZVIA 3IVSA 3LTSA 1XHGA 3AMCA 2Y0FA 3DHDA 6REQA 4PTDA 3S47A 1RZMA 3F4VA 2OXNA 3CPRA 4PCPA 3P61A 1RUSA 3M0XA 1V5XA 2XU2A 1X96A 4MJ2A 3TYCA 5E9AA 2ALRA 1TFVA 4EXQA 5D9PA 4H9MA 2PGEA 4UWMA 3KOFA 4Y6GA 3DIPA 1R2RA 2VZVA 3U9IA 3A4AA 1DJNA 1TIWA 1T41A 2FVMA 2JGQA 3CEPA 3EOLA 4H8VA 3CC1A 1CGXA 4DN1A 4H7CA 1TELA 6ALDA 5C9UA 1UC4A 2NW0A 4DWSC 1W3IA 4RW5A 4IIFA 1SM9A 1PHQA 2VRQA 1D9EA 1WAWA 2OT1A 2VX7A 3L0NA 1EF2A 1D2KA 4KWWA 3W76A 1W8SA 1JULA 2E6FA 5TF0A 1WKYA 5JH2A 2NVKX 3IACA 4OBTA 4HNOA 3OLGA 3AHVA 5BYWA 1I1WA 4HNNA 4J4KA 1IGWA 4PTNA 1FWFC 3AMZA 5C2CA 1F8MA 3LCFA 4M7TA 1NDYA 3GXNA 1KRAC 1MEIA 1P0DA 1J6OA 1XISA 1VYSX 2G96A 3FVDA 1MW2A 2QCCA 4J57A 3DFNA 2ZRYA 1M53A 3GTNA 4AZBA 4ZTXA 3PM6A 5CSUA 1GONA 3DJJA 4QE4A 2J66A 4LNCA 2RDTA 3RNDA 3I6EA 4CVUA 2D2HA 3VCCA 4WR3A 3NQBA 4P7LA 5G5HB 2C6QA 1YNPA 3SQMA 1STZA 1FA2A 4H4PA 4F0LA 3E6EA 4OU1A 2PDCA 4WRHA 5XINA 4L4PA 1VF8A 4MSSA 4NT0A 4GUIA 2PRHA 4XUYA 1WX0A 1W54A 4WGHA 1TZ7A 4Q8NA 1XYMA 5C9XA 3WF3A 4RDZA 1OFOA 4GX8A 5PTDA 3BW4A 3WNPA 2OGJA 3H7RA 2HQMA 3G0XA 3UY8A 2ACSA 5U7SA 3LA4A 3CXBA 1BQGA 3OIXA 5ABHA 1XICA 2A21A 3V1PA 1NU5A 4DNHA 3HG5A 1CLKA 1H51A 4AISA 3TR2A 4KBXA 4KEVA 1ZP3A 3DC0A 4JFUA 4O0ZA 3ICJA 1HG3A 4LUJA 3SW6A 4JTJA 4B2DD 3V3WA 5LIYX 1XKYA 1P4CA 1PV8A 1N82A 1JD7A 2PBOA 4C6QA 1JG9A 1E70M 3WF1A 5CSYA 5A6LA 2VEKA 5DRIA 3U2EA 2I5GA 4AWUA 4RK8A 3WLPA 4IMGA 5LNUA 1TTIA 4LS2A 4WJEA 4Y9NA 3E3HA 3TNOA 3ES7A 3KP0A 4JZ5A 1TZ9A 1OYBA 3NSNA 3WH5A 2FTYA 2FDMA 3BLDA 3BQ6A 1KM4A 5I0DA 4KCTA 4ALDA 2H8ZA 3TW6A 1RK5A 2HBVA 2DZTA 3PBGA 2J77A 1XDJA 2ZZ1A 5JVLA 2XFWA 2ALDA 3EOOA 5LNWA 4XG1A 2E4TA 3FVMA 4HT3A 4DLMA 4UQCA 5TD4A 1KNWA 2ZZBA 3E2RA 1PUDA 1XS2A 4BI5A 4PULA 3IGHX 1DJXA 3W7PA 5FS9A 2E8ZA 1EGZA 1TA3B 3ZLHA 4FLSA 2C3DA 3O2LA 1X2HA 4IL0A 3ID7A 1TJ2A 4JYFA 1M6IA 3FA4A 1VYRA 3NIYA 1GZJA 4IISA 3AS3A 5DN1A 2V5KA 5I3IA 4ORIA 4DNAA 5F2IA 1OYAA 3UG4A 2X7WA 3RJXA 1A47A 1FXPA 3WQ5A 3ITVA 4CD8A 5CC3A 3AHXA 1QNRA 1CXIA 3M6YA 4TVYA 1FWNA 3MY9A 2V6AA 2Z1WA 1OWQA 4GQRA 3C52A 1WDPA 1V7YA 3G2GA 1UW9A 2VMFA 2VDIA 1XM3A 4KEZA 3FYYA 4ZE5A 3RCNA 2Z1SA 1ZRQA 1S2UA 1MO9A 3VOFA 3N2MA 2XTKA 1JI2A 1TWSA 2VZUA 3O06A 5FS8A 2HISA 4JFVA 2CLMA 5K9XA 1MVYA 4YTTA 2DH3A 4FK9A 3KL0A 3NWRA 2FGLA 2YW4A 3UJEA 4JIHA 3TMLA 2QCFA 3E96A 5JU6A 1L2QA 1CGVA 3QOKA 3TE9A 2ONEA 1QU4A 3CV7A 4LNYA 4OJYA 1SR0A 4B90A 3LX9A 1A3WA 4D8ZA 1F6KA 4XB3A 2ZX9A 4QDPA 4G6CA 1M68A 2KX9A 1QPQA 4FF5A 3UCQA 1KN0A 2CU0A 5REQA 1YTEA 3RX4A 4G1NA 5A6BA 1WKFA 3LEPA 3GHSA 3VKDA 3CZJA 3VKJA 3TTOA 1FWWA 3AHTA 2VCAA 2PDJA 3MCOA 4MZ8A 4JDRA 5J5DA 4TX6A 4WHBA 4IGMA 2PURA 4E5TA 3H2CA 2R1PA 1UH4A 1Y7VA 4BJHA 3EOUA 1J0JA 2EJ1A 3LCXA 3LB0A 3VMNA 5CZJA 1CPUA 3OZYA 3WY1A 5ABEA 1MEWA 2Y89A 3GNOA 1G1YA 4Q32A 3DESA 1DIDA 2QQ6A 3STPA 2E7FA 1FWSA 4TQTA 1EC8A 3M46A 4KFOA 4ZOHB 4JYDA 5CH9A 1NF7A 1K8XA 2PDBA 4DWSB 4XAGA 2C1HA 1LZOA 1XCFA 2SFPA 2XM2A 1GT8A 3CQIA 1B3YA 3CHVA 1QMLA 1CT5A 5ENLA 4UTLA 1R3SA 5CAKA 3L2MA 5HQLA 3GUWA 2WVTA 4OQVA 1ITCA 1Q8JA 4PUNA 1VIZA 4R3UA 4OHQA 1E9YB 1BSLA 3UWYA 1XRVA 2F8QA 1XGEA 4O1AA 4YNGA 3MDUA 1HKJA 2UWFA 3GZAA 3V5OA 4HPHA 1J0IA 1QXLA 1LPFA 2J8GA 5J8LA 1EWDA 4E3TA 1RBOB 5GVJA 4YS1A 1KXHA 3E49A 5EBKA 2WZIA 1ZDLA 4GIEA 4UQ9A 1P7TA 5CG0A 4Q7NA 4F40A 1IWAA 4LRTA 2X42A 1FBAA 2D69A 3R07C 2PD9A 2EPOA 3V0SA 3W29A 3PJXA 2V2DA 1XLKA 5FSDC 1NDAA 1ZTVA 2V67A 3OU8A 3WELA 4FNRA 4J28A 2ZVIA 3B8VA 1NVMA 4QBXA 4LVFA 2QJJA 3N19B 2VENA 4IGNA 4LF1A 3MI3A 4XZWA 3BWWA 1M01A 1KM5A 2YDRA 3KBJA 5AC5A 2ISDA 1Q6QA 4XTDA 1UKPA 4Y9AA 4JQ4A 4BFAA 3BZGA 3F2CA 3WQVA 4FXSA 1TJRA 3DDMA 5H8MA 4TX8A 4TV5A 3LSCA 1V97A 3WLLA 3I3BA 3WFLA 3IJQA 1AZ2A 4O1FA 3TJ4A 3W2UA 3TUUA 3NM3A 1JGMA 2QJHA 4KIRA 4IPPA 2CCRA 3EDEA 4O54A 2I9UA 4LBRA 1QK0A 1BEUA 1W2VA 1XF0A 3WBWA 3WUFA 5EBUA 1G7UA 2DZXA 3S1VA 4PCNA 3RLVA 2DV0A 3WMLA 2OQHA 4F9DA 3NDZA 1MNSA 4PUEA 2Q3OA 4TR9A 3DFOA 3G1RA 3W88A 4JX6A 4L6OA 1V6XA 3P2VA 4PRTA 3ABQA 1WO2A 3S2JA 1RLCL 5G1MA 1JPIA 1TMQA 5H8UA 1CX9A 5A6MA 4G9PA 4QLKA 4YVXA 2WNWA 1DHPA 1XLBA 2PEVA 5CC7A 1EJXC 4BEUA 4Q4MA 3VYLA 3W7QA 1X8CA 4RNJA 4UNLA 5HAOA 2GZXA 3A3XA 1JCYA 1UMYA 3QF0A 3VGEA 2W3SA 4EWJA 1EO7A 5E0FA 1KKRA 1BYAA 1AK5A 3LS9A 2XVPA 1JYNA 2CWNA 3LLDA 4XAZA 5EKYA 4JBRA 2PGFA 4JQ2A 1VEPA 2C7FA 2DT2A 2OKOA 3TYEA 5CPNA 3TKFA 2WBAA 3O6CA 7ODCA 3E0IA 2ABAA 4W88A 3GIYA 4YHGA 4MKVA 4AX6A 2VZOA 2ZZ5A 3EKLA 3IK2A 4I9MA 3WDJA 1AQMA 3QW3A 3MO7A 3E5PA 2CYGA 3NL5A 5F4XA 4MWAA 2G3JA 1I2QA 4OOUA 4EMWA 1X8FA 1AVAA 3L4UA 2ADAA 5A6JA 3FHQA 3UZ5A 1ZU8A 3W01A 3DX5A 1VPQA 4WCJA 2C0AA 3ZYZA 2PTDA 2R91A 2W79A 5G4WA 3GVWA 1XRTA 1TB3A 3N73A 4UQEA 2YL5A 4CGTA 1ZNNA 2YDQA 3N15A 1HGYA 4IG2A 4CD7A 4C90A 2NVCA 1FECA 3W1MA 3OJGA 3RPMA 1UD5A 4FNPA 2WMJA 4B15A 3WQCA 1JZ2A 2CXGA 1ISWA 3HU7A 2PTZA 2PWVA 3F4DA 3M0KA 2HQAA 1UCWA 4D72A 3KBVA 1ITXA 3NA8A 3GBEA 3EX3A 3SADA 1DHKA 3RX2A 4XVEA 1TV8A 4AWSA 4PMJA 1OIFA 4HK7A 3N1AA 4CD4A 4O4WA 5LHFA 4GH1A 4J27A 4QDMA 4YN5A 3OGVA 2WMIB 4GZJA 4IFOA 1PL9A 5I2UA 3EMCA 4GUFA 4EACA 4H9UA 2ZXBA 1KGWA 3WNOA 1MYRA 3C0LA 1FDZA 1JCTA 1UR2A 2NX1A 4E8DA 4GYPC 4UFHA 4K37A 1ADDA 1KFLA 5CBJA 1JYXA 2F6XA 2OWCA 1E4NA 4DM1A 1P1XA 1W9XA 3FNDA 5AY7A 1TWZA 2WJFA 5FAGA 3L12A 3NTYA 1WXZA 1WDRA 4E4FA 1S7MA 1C92A 5U4NA 1XBXA 3IK4A 4GD0A 3MVIA 3TC6A 3V36A 1OFPA 1E9LA 2FKPA 2CIPA 3ARQA 3JZUA 4US5A 3AMDA 5DXXA 3OIHA 4O17A 3SURA 4P5UA 1BTCA 3ANYA 3C3UA 4JY8A 2GH5A 2GVGA 4U5KA 4JNZA 3M41A 3EOEA 5IFTA 2Q8XA 3NZQA 4S39A 4DHGA 5LSMA 4C1NA 1K6WA 1S1PA 1PWMA 3PP7A 4AB4A 2I9EA 3M0HA 3G3MA 2NQ9A 3SUUA 4JR5A 1UWRA 4FLRA 2GSEA 4GI8A 2YCEA 2QCNA 4GGHA 4Q8PA 3EB4A 1HXJA 2JK6A 4DZIA 4YTSA 4WZHA 2PLMA 3CBWA 4YVPA 2DZAA 3BSMA 1OX5A 1Q6RA 1FDYA 3W1LA 1KQZA 4LFYA 3BK0A 1OK6A 1NTHA 3R8GA 1W1B1 1WXJA 1FHLA 4INFA 3RU8X 1V0MA 3SFWA 4Z2IA 1G94A 1UJPA 1VEOA 1BWLA 4NRRA 4AZ5A 4LBSA 4K6AA 3W2NA 3A23A 2GQ8A 2EQ9A 3TN3A 2CNCA 5EMYA 1F6PA 3JRKA 1HO1A 2CPUA 3N34A 2XHYA 4W93A 3RM8A 3ZT6A 2BASA 4NX0A 4X63A 4Y8EA 1Q6EA 2D0FA 3VKKA 4B5VA 4OUEA 1JRPA 3I3EA 3AYSA 1MRQA 2OKTA 5KETA 3P5YA 1A5MC 1M04A 4UNKA 5GNZA 4D2JA 4MAZA 4D6FA 2E09A 3EWBX 4XBJA 1GV4A 3WJYA 1PE1A 1XYAA 2VOMA 3ME3A 5FL0A 1DJHA 1OFDA 4A3UA 2VX4A 1KGUA 4C7FA 3BLKA 5E6YA 1CNVA 4GQGA 5G2HA 4XO7A 3FSTA 4JKKA 3CWHA 1BLIA 3SRKA 4ML4A 1G6CA 1KM2A 4EE9A 1GQKA 4XX6A 4GY1A 4DBDA 1K4HA 1X6NA 2V63A 2Z25A 1SJAA 3D6NA 4ILSA 1HKWA 1V08A 5I07A 4Z1AA 1TPFA 4X61A 3TDFA 4YL2A 1XIJA 3TA9A 1UR8A 1UP0A 2Y8UA 4NYYA 1FWBC 1VCGA 4LAUA 3RR1A 1SO5A 3MSRA 4HVXA 3RCYA 5I3HA 4XD5A 4Z1DA 2WOIA 2FH8A 2G3IA 1W32A 3EB3A 2F61A 3U7BA 1W5OA 1QO5A 4AHPA 4TMCA 3ITCA 3AIUA 5E1QA 2EXOA 2ZWZA 4UR9A 4Z0SA 3G3DA 3C2RA 3PZOA 4TX9A 3WK0A 3W7GA 3W26A 4NXKA 1J12A 3FX4A 1OQFA 4IHCA 1BWVA 1E6PA 1UWAA 2Y7GA 2ZICA 3PZTA 5CSSA 5GJPA 1I8JA 2OWXA 4RXFA 3WQOA 1J4EA 2WAGA 1JNEA 4O50A 4X2RA 4ZQOA 2QAPA 2W54A 1HQTA 3CL8A 3ECQA 4BWLA 1PWLA 4MDOA 3ZWSA 1F3EA 4LGXA 4WQ6A 2HXTA 2OLSA 2BXZA 2FJUB 4FSAA 4KETA 1OINA 4IIDA 3LQLA 1VC4A 2RDXA 5A3HA 3A9BA 5C55A 3CHDA 5HANA 4U5IA 3I68A 4LYRA 3ZR4A 1KCZA 3URQA 1S3HA 2ODOA 3PSWA 1XKJA 5D33A 2FZ8A 5C9RA 5CPOA 4GA8A 5CEWA 3SCQA 1LM1A 4KWOA 3UYIA 1GREA 3ARRA 5EMUA 3SSJA 4JHOA 3WO8A 1JZ4A 1JL8A 4IGHA 3MWCA 1TPB1 2ZUNA 2ANUA 1W56A 1FCQA 3PPCA 2FQIA 1VKFA 3WDIA 4MY9A 4KQNA 5FEWA 1UD8A 4P61A 1PDYA 5M03A 3UNTA 4AEOA 3M07A 3SM0A 1RY0A 3GTFA 2GQ9A 4IZGA 4EK7A 3QVQA 2VC5A 4QXIA 3WD0A 2OR2A 2JALA 2WC7A 3TEVA 1VDVA 1KO0A 5A8GA 3EDDA 4IWWA 3AJXA 4Q22A 2J78A 3RU6A 1Q45A 3S9YA 2XPKA 1WA3A 3N2TA 3R7MA 1OX4B 3GRIA 3IIOA 4EAMA 1XLLA 3BG9A 1P0EA 7REQB 4A6GA 3W72A 2GQAA 3BG5A 2QVHA 3LMYA 4HCDA 5JUVA 4PTMA 1H60A 3KWSA 1DEDA 4UCFA 3T05A 4ZB2A 1H2JA 5HUPA 3GM8A 1GOKA 3NZ1A 4EPKA 3ZWTA 2QCHA 3VFCA 4F4RA 1BRLA 2GWGA 1EUNA 3THUA 1ZPTA 2QJGA 1ZX9A 1UIOA 2QUNA 1MDLA 2E40A 1V0LA 3T42A 1TVLA 4ATWA 1FCVA 3KOYA 4IUOA 2REQB 1E3XA 3IEBA 2PBGA 5HR7A 1V93A 4IXXA 1WB0A 2OEJA 5T91A 5D8WA 4FS9A 1GJWA 3AMGA 2PDIA 2X05A 1NWTA 1V02A 3ZQ9A 1VHCA 1JZ7A 3CIVA 1Q6GA 4NG3A 3IJ8A 3OQEA 2ZRUA 1PB0A 3L9CA 3NS1B 1HJXA 1BYBA 3N6JA 4ZBCA 1JCLA 2RABA 1QDSA 3BC9A 3UGRA 1GRBA 4RJEA 1OT2A 2B7QA 4I9AA 2I56A 3CH0A 3WG6A 3FW6A 4R9OA 1L6YA 3VU2A 2DVUA 4NZFA 3GLCA 6REQB 3L23A 3GE7A 3PTQA 2PDXA 4PMUA 4CKQA 3NL6A 3S6TA 1MNZA 3W6MA 3W1UA 2WVUA 2VR5A 3KLJA 4XZBA 2XN2A 4FIRA 4US6A 1AFSA 3WK3A 4GH3A 2VEGA 2EEXA 1AMYA 4N9DA 4QG6A 3W75A 2CBIA 1EB3A 1Q6LA 4JHZA 3DKJA 1KFJA 3GU1A 4L65A 1DWJM 2WNZA 3BCFA 1DTNA 2HXUA 3BARA 2CLHA 2CLEA 4GJJA 3WUBA 3TTQA 2HVMA 1ZBKA 1VFOA 1D3GA 1ZS2A 2WKLA 5GQBA 4RPQA 2IXVA 1PZ2A 4MJZA 3CUZA 1ONWA 3VZYA 3LZ5A 2HVOA 2PA6A 4LAZA 5AOUA 3XINA 2JE8A 2F6KA 3QR0A 3NDYA 3GDBA 1EZWA 1W2PA 3MP5A 1KRCC 4C5YA 4YWIA 3WF0A 5A2BA 4IIBA 2L5HA 4DJEA 2QPUA 3VX0A 3BXWA 2FGBA 2XVNA 1OT1A 3KBWA 5DFAA 4RNFA 2BNJA 2V3GA 3WQWA 1XLCA 4XZNX 3L2IA 3IVUA 2BVTA 4ICCX 2Y7DA 2HROA 4MHBA 4PMQA 3SSZA 1TJPA 4W9TA 4AAJA 1Y5XA 1AQFA 2V6OA 2R1MA 1GK8A 3W53A 1SFLA 1CYGA 3GDLA 1V0NA 3CAQA 2VEIA 3CV1A 4Y2WA 4OZOA 5EBAA 3UVIA 4BZYA 1UP3A 2QCEA 4XBSA 1W9VA 3PSVA 2W27A 1RBAA 2G50A 3O16A 1WNOA 5HOSA 4AIOA 2A79A 1JYWA 3MHUA 5DMLA 1DXEA 3F7JA 3DHPA 3T2QA 4DY1A 4DXXA 1UBPC 2VOTA 2H3DA 2RHGA 3UCDA 1PIFA 1H6VA 1B3XA 3W6LA 2BDQA 3CPGA 4WJ8A 1S1RA 1FHDA 1SW7A 3DBPA 3PAJA 4MTVA 5EB8A 1V51A 1VFTA 4MDPA 2V3BA 4M29A 2O56A 4LXFA 1EGVA 3P0XA 5D2XA 3QLLA 4V27A 1QW9A 1ZBVA 3T7VA 1GG1A 3UWWA 1Q1RA 1FFQA 3GKFA 4U31A 5H1WA 2EQ8A 1AMKA 1JXKA 3QN3A 3E2SA 2YL9A 3FSUA 2X16A 5A6KA 4LOCA 3H2OA 1XYFA 4DVOA 1H3GA 2BMBA 3LRMA 4QJ4B 3JU2A 2NX9A 5SWUA 2O4MA 1K7FA 5A2CA 1E6RA 3VOCA 1R85A 5IRPA 4MNJA 3T0AA 1XPGA 3W1AA 1H0GA 3LDVA 1E0VA 2FZ9A 2QR6A 3PN8A 4ZVJA 4K2SA 3H4GA 4Y9MA 3NSMA 3TC3A 2PMQA 3DGBA 4JL2A 3WLMA 3VDBA 1Y65A 3EWYA 5I24A 2FB3A 2PSNA 4UFJA 2IS7A 4UR7A 2Y24A 4WY0A 3E0LA 1UH3A 1E0TA 3O63A 3M43A 3O0KA 1X39A 4O12A 4LYKA 4U2ZA 1QTWA 4H50A 1W37A 2X1TA 3UXKA 2YA0A 1M7OA 3E02A 3N12A 1VEMA 4ZA0A 5EMKA 2ACRA 1TUFA 5D09A 4LT9A 3S4TA 3DERA 3UGVA 4K7VA 2QNEA 1JDAA 1JNDA 4H4XA 4RDYA 4XQ6A 5K4ZA 1K9EA 4F0RA 3EDJA 1J10A 3TWAA 3DENA 1XLFA 5DT7A 1J01A 3SO7A 1T6MA 2PCEA 4LJ3A 1V3IA 2H3BA 1QJWA 5GRTA 3ONCA 4O16A 4E4UA 1VQTA 4DJED 4ZENA 1PKMA 1W6TA 5E93A 1ZJBA 2CKSA 4ASTA 3U6WA 3NNTA 3S6OA 1PBGA 1ZCOA 3N6QA 4LVDA 3C8NA 2O9PA 3AUJA 4L9ZA 1J8VA 3ZJ8A 3PNUA 4YWSA 3PG8A 1UOZA 3WLQA 2VEMA 4ERAA 4FX7A 1LUCA 3BURA 2FZMA 2A3BA 3PFMA 3W84A 1HUVA 3MP3A 2PE4A 1JGIA 1PO9A 1BSIA 3HQ1A 3L4WA 1AD1A 3QMSA 5C9WA 4DB7A 2CLOA 1XFBA 3DG3A 3RM4A 1LLOA 1JYVA 1T3QC 2Y70A 3AWOA 3KRSA 4AU0A 1WYGA 3OLEA 3I10A 4GXMA 3H4WA 2NT1A 5CZTA 5REQB 1TO3A 1BAGA 1ISXA 3C2OA 3PS7A 3URAA 3ABOA 2PPGA 1XDIA 4ZOAA 3LLXA 4RPPA 3T9PA 2HVNA 2CFYA 3PY2A 2NQZA 1W31A 5H6HA 1R2TA 3CT2A 3W7LA 4NNCA 2NXGA 5EFFA 4GC3A 3TTSA 3AFBA 1VJSA 4M19A 3AICA 4D1IA 3EOSA 4GQBA 3CWNA 3WBEA 1S3TC 1QPRA 1QNVA 5MHBA 2FGZA 1H7OA 4O0QA 3VI2A 1BWCA 2CLKA 2W91A 1VCFA 2WXDM 3I7SA 3MP4A 4D6IA 4Q33A 4LUIA 3CHFA 2DSZA 2J13A 1M6JA 3FXGA 3P14A 3WDRA 3R25A 1X97A 4Z2JA 3SGZA 4HMCA 3B0XA 3UJ2A 3TQKA 3GW0A 2PWHA 1UZ4A 4J3UA 3GTXA 1D7YA 3QBUA 4NXSA 4ZTYA 1KR0A 2YCKX 3LTYA 3A13A 2ZZCA 4MJMA 4NI3A 4LB3A 1G01A 1KM0A 2YYTA 2X09A 3O15A 4GKTA 5EA9A 3U5YA 3N2XA 1RJPA 3POHA 4H6EA 3V16A 1V03A 3EXTA 4FX9A 4UZSA 1G4PA 3WFAA 3QFAA 3MDWA 2B0MA 3IAQA 4HYVA 2POZA 3FKRA 4TU1A 2QDHA 5HWMA 1K9FA 1UWUA 3RITA 3MPGA 5TR3A 1GESA 6TAAA 2J7BA 1ZKQA 3WN6A 4Z1BA 4TMBA 3GRSA 1TWIA 4KMQA 4S3CA 3W82A 2PTYA 4MM1A 3SJ3A 1IT0A 3ALGA 5BMXA 1P7TB 2XN1A 4G2DA 4MPQA 4MJ4A 3NAVA 1UPMB 3OOQA 5F2LA 1Z9AA 1V4YA 2OSXA 3LYEA 5G2IA 3BE7A 4FNSA 1EJWC 1RD6A 3L5AA 1N60C 1R38A 3V35A 4PL2A 4KFPA 3QFEA 4DYEA 1B5TA 3MCNA 4NVTA 3G1VA 2QLYA 5DX7A 3WH6A 4ZFCA 3A6OA 3WQGA 2O7SA 1D8WA 3GNPA 3HBLA 3ZR5A 4RDVA 1K9DA 3NQ7A 3R12A 3KTCA 4PUDA 3CXOA 1ZY8A 1Q3NA 3RFAA 3RO8A 2V68A 1CGYA 1N8WA 4PMXA 3V18A 3U0HA 4RNIA 1RA5A 1H7XA 4JX4A 3CAVA 5LIKX 2ATSA 3NZPA 1GTEA 4DZAA 2O9TA 3I6RA 3H26A 4F0KA 3ZLFA 1ME7A 1ZQ5A 1FQ0A 4JCLA 3EAUA 1DIOA 5AECA 2J27A 2NPXA 1LWIA 1PZ0A 3CQKA 4MFDA 1W3LA 4KEUA 3P5ZA 2GGHA 3IGXA 4UMCA 1KCKA 1JR1A 3RCMA 3VUSA 1BZLA 3P6LA 3BL3A 1RH9A 1NDZA 3W71A 4IPNB 4PC8A 3L68A 1L8PA 3Q65A 4OIFA 1FHUA 1VP5A 3ZFHA 3LXDA 2ISFA 1P43A 4DM2A 3A9IA 3HGOA 5G5GB 2QUTA 1PHWA 1FTXA 2BXYA 1R87A 1NJJA 2QPXA 3H2MA 3NPXA 3TYUA 3HPSA 4A8NA 1V0KA 4RZ6A 3GO2A 5EY5A 1W9UA 2QVNA 3QTGA 1YBQA 3MYOA 3H70A 2ASHA 3KBNA 4MPKA 1PTDA 2GDVA 1JAKA 5K9CA 3USBA 3ZS4A 5HBFA 3T0TA 4KH2A 1KBIA 3O7UA 3CUXA 3LY0A 1K77A 1HW6A 2VJXA 4QISA 4AD1A 2EPMX 4MWAB 3UESA 4GK8A 4B5UA 1WPCA 3QR1A 3W1QA 2PP3A 3EDKA 1YNYA 1K8ZA 1LBMA 4HZMA 5D2TA 3BMXA 2DVXA 1GJUA 4A3HA 1W1A1 5ABTA 4UB9A 4QR6A 2OO0A 4FOJA 2JKPA 3B40A 1FKXA 4IG2B 2VEFA 1GW9A 2FZNA 1ITUA 1OCNA 1ZAHA 1TIMA 6CGTA 3QMTA 1ZALA 2JEPA 4HYRA 3T44A 4DUXA 5CBBA 4IP7A 2ZC8A 4NSBA 1SUXA 2OB3A 1B4KA 3FA3A 5AN7A 4HU4A 1FIQB 3QQ1A 1IQ8A 3JS3A 1R86A 4I5XA 4EANA 4JTEA 1ZAIA 3BG3A 4MYAA 4WIWA 3ITTA 4QE1A 4CNOA 3QQ0A 2WLZA 4M1BA 2VC6A 3QC0A 3FYPA 1KRMA 3R4IA 4H4QA 1M1BA 2ZTKA 2EQ6A 2WOWA 1US2A 1MZHA 4W87A 1OFBA 1CENA 4Z0JA 4M8UA