3DH9A

Crystal structure of drosophila thioredoxin reductase, wild-type
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
482
structure length
482
Chain Sequence
QGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Drosophila Thioredoxin Reductase, wild-type
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 1
total genus 153
structure length 482
sequence length 482
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3dh9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dh9A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dh9A02
1LTXR 2C75A 3EANA 1TDOA 2QA1A 4DNAA 2BC1A 3KU9A 1S3BA 2X8GA 1GRGA 4N9XA 1GRAA 2YLTA 3UKHA 1FEAA 1GT8A 3WE0A 4UDQA 4HA6A 2R45A 3UKPA 2FJEA 1PJ5A 1S2YA 2H89A 3NYFA 3UCLA 4AT0A 2DKHA 4Z2TA 1EL5A 1TDFA 4H7UA 4OPCA 2FJBA 4YSYA 2RGJA 4OPDA 2WHDA 5GSNA 2YLXA 1PXBA 2PHHA 4B68A 3IF9A 2UZZA 2VRLA 5JCMA 2RABA 2B7SA 2OA1A 1KSSA 3AEDA 3UOVA 4YWOA 4AOSA 1NG3A 4B67A 4GCMA 2QAEA 3QSEA 2ZBWA 4LU6A 4K7ZA 4YKGA 2XVJA 1DOEA 3NK2X 1ZKQA 4NTDA 2BS3A 3F8DA 4J31A 2B9YA 2XLPA 3C4NA 4TM4A 2BA9A 3FG2P 3D8XA 1JRYA 1Y56B 1VQWA 2B76A 2XVEA 4GR1A 3NYEA 3GSIA 3IHGA 3AEEA 1DXLA 3ICTA 1FCDA 1GTHA 2WETA 4Y4NA 1ZMCA 3DGHA 1NHRA 2VQ7A 4FX9A 1BGJA 5BVAA 1S3EA 4NEVA 4K22A 2YG4A 3RP8A 1DJQA 2AR8A 4GF7A 4YKFA 3UOZA 2XCGA 1LQTA 4YSXA 4U2LA 1F8RA 2ZZ0A 1PBDA 2WESA 3L1RA 1E6EA 4K5RA 2WOVA 4Z24A 3OC4A 1PBFA 3NK0X 4EM3A 2R0PA 2GAHB 3ICRA 4ICYA 3IWAA 3AE7A 3JSKA 2YR5A 4Z2RA 1DJNA 1XDIA 3C4AA 4EQRA 1DOBA 1D7LA 3UTGA 1PXCA 1H6VA 3QSSA 2CFYA 2BABA 4OVIA 3NGCX 3BI4A 4TM0A 2VVLG 1K4QA 2GRTA 4A9WA 3LXDA 4D03A 2XFUA 3Q9TA 3AE3A 5JCIA 4C3YA 2EQ6A 1KFYA 2BXSA 3CGDA 4IV9A 2YG3A 2V3BA 1MOKA 3M13A 3CPJG 5KOXA 2X99A 3SQPA 5CKUA 4H4UA 4EMJA 1GRFA 3CGCA 4ECHA 3G5QA 1GREA 2GVCA 4LIIA 3DMEA 2YLWA 3AE1A 3BNMA 5M10A 4JNQA 3GDPA 3AEAA 1JNRA 1F6MA 4EMWA 2HQMA 1NENA 1S2QA 2FBWA 4H2PA 3OZ2A 4B66A 1QLBA 2B9XA 3EF6A 2GQFA 4Z26A 3BI5A 2GQWA 1IUUA 4KX6A 1TDKA 1N4WA 3SGLA 4A6NB 3RP6A 2GAGB 3UTHA 3AD7B 2GR3A 5TR3A 1EBDA 2ZZBA 1CC6A 3K7QX 4JY2A 4U8IA 4NTEA 5J60A 1B5QA 2I0ZA 3KLJA 4NZHA 4YSHA 1NAAA 3AE9A 3BNUA 3UTFA 3VRAA 3G5SA 2ZZCA 1GRTA 2BK3A 2OLOA 4O5UA 1PXAA 1VRQB 3AEGA 3LOVA 4GRTA 1E1KA 4GUVA 1IUTA 2XVHA 1H86A 1GESA 2R4EA 2C7GA 4U8KA 3NTAA 2YG7A 3CN8A 5IQ1A 3GRSA 3UKQA 3BI2A 5C2TA 1ZX9A 3AXBA 2XFQA 1TDNA 3NN0X 1VG9A 2PYXA 4IVOB 4BV6A 4H4WA 1CJ4A 2XDOA 2WDVA 2WP6A 3L8KA 4USQA 3FIMB 4XWZA 2YQUA 1LV0A 4H4PA 4RG3A 2XLUA 4AP1A 2X50A 4CRTA 3LZWA 4H4QA 2XFPA 4A65A 2A87A 4H4ZA 2V61A 1L9CA 1MXTA 2GEWA 1NDAA 1CJ3A 2C67A 3CIRA 2Z5XA 2Q6UA 2ARDA 3S5WA 2YR4A 4Z44A 2YM1A 1GRHA 2WEUA 3KD9A 4EQSA 1KSUA 3VR9A 3CTYA 2YM2A 1YKJA 3B6DA 4BJYA 2JAEA 2YG6A 3CNDA 3EPTA 4H4VA 1N4UA 1Z6LA 2WS3A 3VR8A 2C70A 4X9MA 5LV9A 3NHOX 2BCPA 1YQ3A 2R4JA 3KVEA 3PO7A 3S61A 3GWFA 3P4RA 4CNKA 2YLSA 1GNDA 4YTMA 4PAAA 1EL8A 2BYBA 2Q7VA 3SFEA 3VQRA 1NHPA 1YY5A 2BK5A 2VOUA 2JB2A 4U8NA 1F8SA 2E4GA 2YVJA 3ABVA 1CL0A 1JRXA 4GDPA 1L9DA 1GV4A 2Q0KA 3AEFA 4U2TA 4LA1A 1O5WA 5KVHA 3P4QA 1H84A 1M64A 1HYUA 2X8CA 2BS4A 2VZ2A 2X3NA 4H2RA 3V76A 4CBQA 4DSHA 5FS7A 3BHKA 3P1WA 5JCNA 2WPCA 3CNJA 3URHA 1K0IA 1D4DA 3NLCA 4X4JA 1KDGA 5KWFA 5KRQA 2WOWA 4K5SA 1K0LA 1RP0A 3CPIG 5BULA 4H2NA 5EB4A 2B7RA 4I58A 2CULA 4TLZA 4U8PA 5CQFA 4J34A 1XANA 2IVDA 1BWCA 1TYTA 3NK1X 4IA5A 4UDPA 1ZP0A 1K0JA 2AQJA 3SM8A 3UKLA 2C73A 1OJ9A 2WQYA 2XFOA 5DBJA 2VVLA 4JY3A 1F8WA 3FMWA 1H7XA 3ISHA 5L46A 2ACZA 3ATRA 4A5LA 2XLTA 1Q9IA 2BK4A 3AD9B 1VG0A 2E5VA 2BS2A 3SFDA 4MJWA 3DK8A 3QVPA 1V59A 1EL7A 1BKWA 1IUWA 3AD8B 1OJTA 2W0HA 1SEZA 2WDQA 3NN6X 3NRNA 3ATQA 1JRZA 1D4CA 3K7TA 4AOXA 4BK2A 3ALLA 4K8DA 4ADWA 2X8HA 1ZMDA 4B65A 1GTEA 2FJDA 1GRBA 3GMBA 1KF6A 3QSMA 3AWIA 3RP7A 4ZN0A 4FDCB 4DGKA 1TRBA 3V3NA 2RGOA 3GRTA 3II4A 4CNJA 4GDEA 2WP5A 3DK9A 4DSGA 3B3RA 3GWDA 4M52A 1PBCA 3HZLA 3UOYA 4Y4MA 1H7WA 2RGHA 3KKJA 1RYIA 2OAMA 2QCUA 3NIXA 1H81A 2JKCA 4B69A 4EIQA 5HY5A 3GD4A 3AYJA 3DA1A 1E39A 4UP3A 3LADA 1PBEA 1P2EA 1Y56A 2WDRA 1QO8A 1P2HA 1ONFA 2NVKX 2WPEA 5FMHA 4C74A 2WP9A 3PS9A 4APNA 2YR6A 3LJPA 1NEKA 1H83A 2OLNA 3UOXA 2A89A 2WU5A 1BF3A 3AE8A 5EB5A 1GSNA 3NH3X 4D04A 3ALMA 1FEBA 5JCKA 4Z2UA 4FK1A 4EQWA 2YVFA 1PJ6A 3UP4A 1M6IA 1IJHA 5EOWA 2XLRA 3KA7A 3LB8A 3NTDA 4OPTA 2EQ8A 2JK6A 2GH5A 4CY8A 4CY6A 2XFNA 2CDUA 4H4TA 4EQXA 2YG5A 3ADAB 3K30A 4USRA 3AE5A 2XYOA 3IHMA 4U8MA 3NYCA 3D1CA 3BHFA 4JQ9A 1ELIA 3VRBA 4H4YA 4O5QA 4C3XA 1IUVA 4CCRA 4FK1C 1COYA 4B64A 5FS6A 3DK4A 2OALA 3GMCA 3PVCA 2C3CA 3GYJA 1CJCA 4OCGA 2A8XA 2V3AA 3I3LA 3M12A 4Z43A 4PABA 3O0HA 2YLRA 4B1BA 1LVLA 4J36A 1MO9A 1XHCA 2XVIA 3AE6A 3COXA 2EQ9A 2R0CA 4H50A 4JN9A 3FPZA 3LZXA 1F3PA 2VVMA 1D5TA 1EL9A 2C64A 1B37A 1PHHA 3Q6JA 1FOHA 4CCQA 4RSLA 3CPHG 5FS9A 3E1TA 4A7AA 1H82A 1L9EA 1CJ2A 2GF3A 2O9ZA 1CBOA 3UP5A 4J2WA 1E1LA 2GR1A 4EIPA 1N4VA 1FECA 1GXFA 3DH9A 1E1NA 1ZY8A 4H2QA 2XVFA 2E1MA 4A6NA 5U25A 3AYLA 4YT0A 2VQBA 1JOAA 3CGEA 4J57A 4EM4A 4A79A 1L0VA 1XPQA 4UDRA 5JCLA 1JEHA 5IQ4A 5BRTA 4HB9A 4U8LA 4BK1A 1OJAA 1GALA 4AT2A 1OJCA 5HYMA 5U1OA 5ER0A 4YSZA 1OJDA 4YTPA 1TYPA 1BGNA 1NPXA 4BJZA 1B4VA 1Q1RA 1B8SA 1D4EA 1NG4A 2WBAA 1LQUA 2C76A 3GDNA 3VRDB 2Z5YA 4U8JA 1LJ1A 2JBVA 1RSGA 2TPRA 1UKVG 2R46A 3UTEA 3ZYXA 5GRTA 3UKKA 4I59A 1ZK7A 1IUSA 1PBBA 1TDEA 4EMIA 4K2XA 4OPUA 2NPXA 3CNTA 4NTCA 3UKFA 2GMJA 4JDRA 1YQZA 2EQ7A 3CNPA 3ICSA 1LPFA 5M0ZA 2GMHA 1FL2A 1PDHA 2AAQA 1E7PA 1D7YA 1E1MA 3R9UA 2CVJA 2V6OA 1NHQA 2GB0A 4E0VA 4U2SA 2GR2A 4YXDA 5EBKA 3AB1A 3EAOA 4H4XA 2V60A 2V5ZA 2YVGA 2GR0A 5HXIA 4J33A 2YWLA 4H4RA 2BXRA 1KNPA 3KPFA 2BC0A 2WU2A 1Q1WA 3AEBA 3C96A 3DJJA 4OPGA 3QFBA 4TM1A 1X31B 1PN0A 4WCTA 1BZLA 2VRMA 4YTNA 3DGZA 1CC2A 2FJAA 2C65A 3NKSA 3H4KA 2J3NA 2APGA 2TMDA 3F8RA 3DJDA 2C72A 2IVEA 5IPYA 4Y4LA 4KPRA 3AE2A 3T37A 2F5ZA 4REKA 3ZDNA 5KXJA 1DODA 1O95A 4P9SA 2C66A 2B9WA 4TLXA 2BACA 4H4SA 4OPLA 5KVIA 1DOCA 2Y6RA 4RG4A 4TM3A 4IVMB 2QA2A 3M0OA 5HHFA 1VDCA 4XXGA 4ZCDA 1ZOVA 2WPFA 2R0GA 3ITJA 2WOIA 3RNMA 4C5OA 1PS9A 3H8LA 3NNEA 3QVRA 1CC4A 3DJEA 4JNAA 4XWRA 4IA6A 1GETA 3F8PA 2Q0LA 3P9UA 3UKAA 3GYIA 2YLZA 3V3OA 4B63A 3REDA 1ZOYA 5FS8A 2BCGG 1GOSA 1JNZA 1ZDLA 1DNCA 3AE4A 3QFAA 3NT6A 4X9NA 1NHSA 3IC9A 3G5RA 3K7MX 2H88A 1N1PA 1GERA 2JB3A 4BK3A 4ZCCA 3H8IA 1AOGA 2IIDA 5C3JA 3QJ4A 1JU2A 1CF3A 3AECA 3RHAA 3GD3A 4BURA 2R9ZA 2JB1A 2Y6QA 5J7XA 4OPIA 1IUXA 2C3DA 1KNRA 2XLSA 3ALJA 1GEUA 3P4PA 1W4XA 4C77A 1O94A 2DKIA 5U63A 4Z25A 3DJGX 1YQ4A 4J56A 1REOA 4U8OA 2YAUA 1GPEA 1QJDA 1PJ7A 3P4SA 3I6DA 3FBSA 5KOWA 1CHUA 4WX1A 4AP3A 5BUKA 3AYIA 3NG7X 3CGBA 1Y0PA 3CNSA 4NEWA 4A99A 2GV8A
chains in the Genus database with same CATH superfamily
1LTXR 3BSMA 1TDOA 2BC1A 1GRAA 3S47A 3WE0A 2PPGA 4KEMA 2R45A 1S2YA 4Z2TA 4AT0A 3CAWA 1EL5A 2XH7A 1TDFA 4YSYA 2RGJA 2WHDA 2YLXA 1JDFA 2GGIA 2VRLA 2RABA 3AEDA 1KSSA 4AOSA 4B67A 3QSEA 1DOEA 4NTDA 3IJLA 2XLPA 3C4NA 4TM4A 3FG2P 3D8XA 1VQWA 2B76A 4GR1A 3IHGA 3AEEA 1FCDA 1GTHA 4Y4NA 3DGHA 4K22A 3RP8A 1DJQA 4IP5A 4YSXA 2ZZ0A 3QTPA 1S7MA 1E6EA 3N6HA 1N60C 4EM3A 4ICYA 5G5HB 2YR5A 4Z2RA 1DOBA 4HYRA 3UTGA 1PXCA 1K4QA 2GRTA 4DX3A 2BXSA 1KFYA 2YG3A 5FJPA 3CGCA 3D9XA 1GREA 3QPEA 2GVCA 3PWIA 3D46A 3OW1A 3AE1A 1R6WA 1F6MA 2XH2A 2HQMA 4B66A 3OZ2A 4Z26A 1NELA 3BI5A 2GQWA 1TDKA 2RDXA 3SGLA 3AD7B 1L8PA 1CC6A 3I4KA 4NZHA 3AE9A 3UTFA 2ZZCA 1GRTA 2BK3A 3OZYA 1PXAA 2R4EA 3CN8A 3GRSA 2XFQA 4IVOB 4BV6A 3UJEA 4H4WA 2WDVA 2WP6A 4USQA 2XFPA 4A65A 4GFIA 1MXTA 3CIRA 2Z5XA 2ARDA 3S5WA 2YR4A 4Z44A 1GRHA 3KD9A 4EQSA 1KSUA 3CTYA 1YKJA 3B6DA 2YG6A 4H4VA 3VDGA 3NHOX 1FHVA 2YLSA 3UJ2A 1YY5A 2YVJA 4H2HA 2Q0KA 3AEFA 3P4QA 2PTWA 1H84A 2X3NA 3ZVHA 4GAPA 4DSHA 3P1WA 3EEZA 3CNJA 1D4DA 3NLCA 4II3A 1XS2A 2QJNA 3V5CA 4JHMA 3MUCA 3RGTA 3PG6A 1BWCA 3TJ4A 1ZP0A 2AQJA 3SM8A 5KMRA 1OJ9A 2WQYA 5DBJA 3FMWA 1H7XA 3KUMA 4II2A 2PU0A 1KN0A 1Q9IA 1VG0A 2BS2A 4H83A 2AKMA 1IUWA 1OJTA 1WUFA 2PTYA 1D4CA 3K7TA 3DFYA 2E5AA 3VCNA 2X8HA 2FJDA 4ZN0A 1GRBA 2PSNA 1TRBA 3SZCA 3QLDA 3FYYA 3II4A 3MQTA 2XSXA 3DK9A 3D47A 1PBCA 3UOYA 1H7WA 3CT2A 2RGHA 2OAMA 3NIXA 3NFUA 2WDRA 2NVKX 3T9PA 5FMHA 2OLNA 1BF3A 2FYMA 2YVFA 3UP4A 3Q45A 4E6MA 3KA7A 3LB8A 4OPTA 1BQGA 2XFNA 2OQYA 1N61C 1COYA 4B64A 2OALA 3GMCA 3PVCA 2A8XA 2V3AA 4Z43A 1EBGA 1KD0A 5JRBA 2R0CA 3FPZA 2VVMA 2XGZA 3NO1A 1B37A 5BOEA 3A7AA 5FS9A 3E1TA 1L9EA 1CBOA 3R07C 1E1LA 3JZUA 1FECA 4H2QA 5BOFA 4A6NA 5J04A 3ZLGA 3U4FA 1XPQA 5BRTA 4G74A 1OJAA 4YSZA 3UXKA 1OJDA 1D4EA 2WBAA 1LQUA 3DEQA 1LJ1A 3TW9A 4I59A 1IUSA 4KPLA 2PGWA 3EUB3 2NPXA 4NTCA 1YQZA 3CNPA 4A35A 5ENLA 3VCCA 2GMHA 3A7RA 2AAQA 1NHQA 4E0VA 2GR2A 3AB1A 2V5ZA 2XH4A 2GDQA 2PP0A 2WU2A 4TM1A 1MNSA 3UJRA 5KMPA 2C65A 1MDRA 5IPYA 4REKA 3ZDNA 1DODA 2OLAA 4TLXA 2W55A 2R0GA 4C5OA 4XWRA 3N6JA 3T4WA 2Q0LA 3P9UA 3GYIA 4B63A 3SYIA 3HYXA 3AM9A 1FHUA 3QFAA 3NT6A 3MWCA 2IIDA 3ZLFA 4E5TA 4K2SA 2GSHA 1CF3A 3AECA 4DWDA 1YQ4A 4J56A 1REOA 3VA8A 3UCDA 3I6DA 3FBSA 1CHUA 4WX1A 3OPSA 4A99A 4J3ZA 3EANA 2QA1A 3KU9A 2X8GA 1GRGA 4Z1YA 2YLTA 3UKHA 4UDQA 4HA6A 2ONEA 2I5QA 3UKPA 3OTRA 3NYFA 4H7UA 4OPDA 3NVWB 5GSNA 4B68A 2UZZA 2OA1A 3UOVA 3H7VA 4Z17A 1NG3A 2QAEA 4YKGA 4K7ZA 3NK2X 2BA9A 1JRPA 2QQ6A 3ICTA 3I6TA 1NHRA 3ZVIA 4FX9A 1S3EA 4NEVA 2YG4A 3UCCA 2AR8A 4GF7A 4YKFA 2POZA 1PBDA 4Z24A 3OC4A 1PBFA 3NK0X 3ICRA 3R10A 2BABA 3PWGA 4D03A 4A9WA 3LXDA 4C3YA 1WYGA 2EQ6A 1KKRA 3CGDA 4IV9A 2GL5A 3M13A 2V3BA 4ECHA 3G5QA 1H2IA 4LIIA 3DMEA 4JNQA 4H2PA 2O56A 3SZ0A 1IUUA 3RP6A 2P8CA 2GAGB 3DG3A 1ZXIC 4YSHA 3VRAA 4X2PA 3V5FA 4ZOHB 2PTZA 4GRTA 4GUVA 1IUTA 3VC6A 4U8KA 2PP3A 1VQZA 4H1ZA 3NTAA 2YG7A 5C2TA 3AXBA 1TDNA 1SB3B 3FIMB 5FJUA 2YQUA 4H4PA 2OZ8A 4RG3A 2X50A 2A87A 4KT2A 1L9CA 2C67A 1N63C 2QJJA 2YM1A 2P8BA 2YM2A 2JAEA 1N4UA 2WS3A 4X9MA 1PDYA 4CNKA 3DG6A 3SFEA 4PAAA 1EL8A 2Q7VA 3VQRA 1NHPA 2JB2A 4U8NA 2E4GA 3ABVA 1CL0A 4GDPA 4U2TA 1O5WA 5KVHA 2BS4A 2VZ2A 3V76A 5FS7A 3SX6A 2WPCA 5KWFA 1RP0A 2PP1A 3A7UA 3CPIG 1MDLA 2IVDA 4A6GA 1TYTA 3NK1X 1K0JA 1EC8A 2VVLA 2ACZA 2P3ZA 3IJIA 2BK4A 2E5VA 4DN1A 3DK8A 1EL7A 1BKWA 3AD8B 3KPKA 1JPDX 2WDQA 3NN6X 4MMWA 1MUCA 4AOXA 4BK2A 3ALLA 4B65A 3HYVA 1GTEA 1KF6A 3RP7A 3AWIA 4FDCB 4DGKA 3HYWA 5KMSA 3GRTA 2OO6A 3GD6A 3B3RA 3GWDA 4Y4MA 1SJCA 3RITA 1RYIA 3KKJA 2JKCA 1E39A 1P2EA 1P2HA 1ONFA 3P93A 5EB5A 4G73A 1GSNA 1FEBA 5JCKA 1PJ6A 2XLRA 4CY8A 2JK6A 4CY6A 2YG5A 3AE5A 5FJRA 4JQ9A 4H4YA 3T2YA 5FS6A 3GYJA 1CJCA 4PABA 1LVLA 2AL1A 4J36A 1MO9A 3CB3A 2XVIA 3AE6A 3COXA 1D5TA 1PHHA 3Q6JA 1P48A 4RSLA 3RRAA 1CJ2A 3UP5A 2GGGA 4IHCA 1N4VA 2CHRA 1ZY8A 2NQLA 4G6HA 4IP4A 3AYLA 4YT0A 2VQBA 1JOAA 3CGEA 4A79A 1L0VA 4UDRA 5IQ4A 3T31A 4A3RA 1GALA 1OJCA 5U1OA 4YTPA 1NPXA 3GDNA 3VRDB 3UTEA 2TPRA 3MSYA 4K2XA 4JDRA 3ICSA 5M0ZA 1FL2A 1PDHA 1E1MA 4HCLA 2V6OA 2GB0A 4U2SA 4YXDA 5HXIA 2PODA 1KNPA 3KPFA 3DJJA 3H8AA 1X31B 1PN0A 1RM6B 2FJAA 3NKSA 3H4KA 1MRAA 3NVZB 4NWZA 2F5ZA 3TWAA 4ZA0A 3BJSA 1O95A 4P9SA 2C66A 5KVIA 1DOCA 2Y6RA 4TM3A 5HHFA 3M0OA 2P0IA 4ZCDA 2WPFA 2ZADA 3CK5A 1PS9A 1CC4A 4JNAA 4IA6A 1GETA 1T3QC 3REDA 1N5XA 2PA6A 1JNZA 3NVYB 1R0MA 1SJBA 2H88A 2PTXA 4ZCCA 4HNLA 4BURA 2JB1A 5J7XA 4OPIA 3BOXA 2C3DA 2XLSA 3ALJA 3SJNA 1W4XA 1O94A 2DKIA 5U63A 1NU5A 4GMEA 1GPEA 4AP3A 5BUKA 5KMQA 3CGBA 1Y0PA 4NEWA 2ZC8A 1N62C 3ES8A 1VDVA 3GO2A 3ETRB 1S3BA 1FEAA 1GT8A 2OZTA 3SR6B 4J1OA 3IK4A 4G6GA 2FJEA 2FJBA 3Q4DA 1PXBA 2PHHA 3IF9A 5JCMA 4YWOA 4GCMA 3T6CA 2ZBWA 4LU6A 2BS3A 4J31A 2B9YA 4G8TA 1Y56B 3GSIA 1DXLA 4K8GA 1ZMCA 2OQHA 3FV9A 3UOZA 1LQTA 4U2LA 2R0PA 2GAHB 3SBFA 3MKCA 3JSKA 3C4AA 3QSSA 2CFYA 4E4UA 3NGCX 2OPJA 3BI4A 4TM0A 2XFUA 3Q9TA 2MNRA 3RR1A 4HCHA 3CXBA 1EC7A 5KOXA 2X99A 3SQPA 5CKUA 4H4UA 4EMJA 1GRFA 1FO4A 3BNMA 5M10A 3AEAA 3VFCA 1JNRA 4EMWA 1NENA 1S2QA 2B9XA 2QDDA 1N4WA 2OVLA 4E4FA 2GR3A 5TR3A 4JY2A 3K7QX 4U8IA 5J60A 4NTEA 2PGEA 1B5QA 2I0ZA 3KLJA 3NRZB 1NAAA 3BNUA 3G5SA 2OLOA 4O5UA 1VRQB 3AEGA 3LOVA 2PU1A 1H86A 1GESA 3NN0X 2PYXA 1CJ4A 3AN1A 2GGJA 1LV0A 3TQPA 4EWJA 4AP1A 2XLUA 4CRTA 4H4QA 4GIRA 4IL2A 1NDAA 4GAVA 3NZGA 2Q6UA 4BJYA 2PCEA 3VR8A 5LV9A 3PO7A 1YQ3A 1EC9A 2R4JA 3P4RA 1GNDA 2BYBA 3JVAA 2GGEA 4GISA 2VOUA 1FFUC 1JRXA 4FP1A 1L9DA 2QVHA 1HYUA 2X8CA 4H2RA 4CBQA 3THUA 5KNLA 3BHKA 5JCNA 1K0IA 1KDGA 3OZMA 5KRQA 4DYEA 4K5SA 1K0LA 5BULA 3SN1A 2B7RA 1YEYA 4I58A 4U8PA 4DXKA 3SY4A 3UKLA 4UDPA 4JY3A 1F8WA 3ISHA 1V97A 5L46A 2XLTA 3NVVB 4MJWA 4GGBA 3QVPA 2W0HA 1SEZA 3ATQA 1JRZA 1N5WC 3R25A 4K8DA 1ZMDA 1JCTA 3QSMA 3CYJA 2QGYA 3DGBA 4CNJA 7ENLA 2AL2A 3S5SA 5IDZA 4M52A 3B9JB 3I6EA 3N4EA 4B69A 3L5OA 4EIQA 1H81A 4UP3A 3LADA 2FKPA 1PBEA 2DW6A 2WP9A 3PS9A 4APNA 2AKZA 2WU5A 3AE8A 3ALMA 4Z2UA 4FK1A 1M6IA 1IJHA 3NTDA 2GH5A 2CDUA 4H4TA 4EQXA 4HNCA 3K30A 4U8MA 3VRBA 4O5QA 3DG7A 2P88A 1IUVA 4C3XA 3DK4A 1JROA 2C3CA 2BRAA 3M12A 3O0HA 4GYPA 2YLRA 4B1BA 1XHCA 3B97A 4M6UA 4H50A 4JN9A 2OX4A 3LZXA 1STZA 3MY9A 3P0WA 1FOHA 4ENLA 4A7AA 1H82A 2GR1A 3DH9A 1E1NA 2E1MA 4EM4A 5JCLA 1JEHA 4BK1A 4AT2A 5HYMA 2E3TA 1TYPA 1BGNA 3QN3A 1NG4A 3SSZA 4H19A 2Z5YA 3ZYXA 2JBVA 1RSGA 2R46A 3H12A 5GRTA 1PBBA 1TDEA 1WUEA 4EMIA 3UKFA 1SJDA 1D7YA 3AMZA 3EAOA 3MZNA 4H4XA 2V60A 2YVGA 4J33A 4H4RA 1ONEA 2BXRA 3AEBA 3QFBA 3DIPA 2GGHA 5FJTA 4WCTA 2VRMA 3DGZA 2APGA 2J3NA 2TMDA 3F8RA 3DJDA 2IVEA 4Y4LA 3AE2A 3T37A 3CMMA 2BRYA 1X2GA 4OPLA 4RG4A 1W6TA 2QA2A 4XXGA 1ZOVA 3K1GA 4IZGA 3H8LA 3QVRA 2PMQA 1BKHA 3UKAA 2YLZA 3V3OA 1OEPA 5FS8A 1GOSA 1DNCA 3AE4A 4GYPC 3SXIA 4X9NA 1NHSA 3IC9A 4HN8A 3G5RA 3K7MX 1N1PA 1GERA 1KKOA 3H8IA 5C3JA 3QJ4A 3GD3A 2R9ZA 1P43A 1GEUA 3P4PA 4Z25A 2YAUA 1QJDA 3IJQA 3NG7X 3CNSA 2OKTA 1FFVC 4F4RA 4GGHA 2C75A 4DNAA 4N9XA 3R11A 1ELSA 2HXTA 1PJ5A 2H89A 3UCLA 2DKHA 4MGGA 4OPCA 5FJOA 2W3RA 2OFJA 2B7SA 2XVJA 1ZKQA 3F8DA 1JRYA 3NYEA 2XVEA 2WETA 2VQ7A 1BGJA 5BVAA 3DERA 1ECQA 4JN8A 3DFHA 2XCGA 1F8RA 3DESA 2WESA 3L1RA 3TCSA 4K5RA 2WOVA 3IWAA 3AE7A 1DJNA 1XDIA 3GYXA 4EQRA 1D7LA 1H6VA 3VC5A 4OVIA 2VVLG 1PDZA 3AE3A 5JCIA 4YWSA 4HPNA 1MOKA 3CPJG 3TTEA 3T2KA 3T0KA 3UJSA 2YLWA 3ZVHB 3GDPA 2HXUA 2FBWA 1QLBA 3FXGA 3EF6A 2GQFA 4KX6A 2PS2A 3HW2A 4TVWA 4DHGA 4A6NB 3SZFA 3UTHA 3FVDA 1EBDA 2ZZBA 3GY1A 1E1KA 4E8GA 2XVHA 1FIQB 3R0UA 2C7GA 5IQ1A 3UKQA 3BI2A 1ZX9A 3HPFA 1VG9A 2W3SA 3H70A 3SQSA 2XDOA 3L8KA 4XWZA 4HCDA 3EKGA 3P3BA 3LZWA 4H4ZA 2V61A 2GEWA 1CJ3A 3R0KA 1EBHA 2WEUA 3VR9A 3EPTA 3CNDA 1Z6LA 4K1WA 2C70A 3GC2A 2BCPA 3KVEA 3S61A 3GWFA 3PK7A 4YTMA 3FJ4A 2BK5A 1F8SA 1GV4A 1TE6A 1TZZA 4LA1A 1M64A 2QJMA 3URHA 4X4JA 3N4FA 2WOWA 3TJIA 2XH0A 4H2NA 5EB4A 2CULA 4TLZA 3UJFA 5CQFA 4J34A 1XANA 3T14A 4IA5A 2C73A 2XFOA 2C4CA 4NNJA 2HNEA 3ATRA 4A5LA 3AD9B 4MKSA 3SFDA 1V59A 5EU9A 3V4BA 3NRNA 3FCPA 3ES7A 4IL0A 4ADWA 3GMBA 3V3NA 2RGOA 3UGVA 2MUCA 4GDEA 2WP5A 3T2ZA 2DW7A 4DSGA 3HZLA 5G5GB 2QCUA 5HY5A 3GD4A 3AYJA 3DA1A 1Y56A 1QO8A 2WPEA 4C74A 4FI4A 2YR6A 3LJPA 1NEKA 1H83A 3UOXA 2A89A 3NH3X 1E9IA 4D04A 3HRDC 1SJAA 4EQWA 5EOWA 4TVYA 1TKKA 2EQ8A 3ADAB 4USRA 2XYOA 3V3WA 3IHMA 3NYCA 3D1CA 3BHFA 1ELIA 2HZGA 4CCRA 4FK1C 2OZ3A 4ROPA 4IT1A 4KWSA 4OCGA 3I3LA 3NXLA 2EQ9A 1F3PA 1EL9A 2C64A 4CCQA 3CPHG 2GF3A 2O9ZA 2AL2B 4J2WA 4EIPA 1GXFA 1DTNA 2XVFA 5U25A 1RVKA 3PFRA 2QDEA 3TWBA 4J57A 3JW7A 4HB9A 4U8LA 5ER0A 1JPMA 4BJZA 1X2HA 1Q1RA 1B4VA 1B8SA 2C76A 4U8JA 4ZCWA 1UKVG 3CXOA 3SZWA 2OG9A 3UKKA 1ZK7A 4OPUA 3CNTA 2W54A 2GMJA 3TOYA 2EQ7A 1LPFA 1F9CA 3ZLHA 1E7PA 3R9UA 2CVJA 5EBKA 2GR0A 2YWLA 3SN4A 3ENLA 2BC0A 3C96A 1Q1WA 4OPGA 3STPA 1BZLA 4YTNA 1CC2A 3QKEA 2C72A 4KPRA 4JN7A 5KXJA 2B9WA 2BACA 4H4SA 3RHAA 4IVMB 1VDCA 4M0XA 3NS1B 1XPYA 3ITJA 2WOIA 3RNMA 4G7FA 3NNEA 3SN0A 3DJEA 4G9KA 3F8PA 1ZOYA 2BCGG 3T8QA 3OP2A 1ZDLA 3RCYA 1IYXA 2JB3A 4BK3A 1AOGA 3RO6A 1JU2A 3UXLA 2Y6QA 3R1ZA 6ENLA 1IUXA 3U9IA 1KNRA 3DDMA 1KCZA 4C77A 3DJGX 4U8OA 1PJ7A 3P4SA 5KOWA 3AYIA 2GV8A
chains in the Genus database with same CATH topology
1LTXR 2C75A 3EANA 1TDOA 2QA1A 4DNAA 2BC1A 3KU9A 1S3BA 2X8GA 1GRGA 4N9XA 1GRAA 2YLTA 3UKHA 1FEAA 1GT8A 3WE0A 4UDQA 4HA6A 4G6GA 2R45A 3UKPA 2FJEA 1PJ5A 1S2YA 2H89A 3NYFA 3UCLA 4AT0A 2DKHA 4Z2TA 1EL5A 1TDFA 4H7UA 4OPCA 2FJBA 4YSYA 2RGJA 4OPDA 2WHDA 5GSNA 2YLXA 1PXBA 2PHHA 4B68A 3IF9A 2UZZA 2VRLA 5JCMA 2RABA 2B7SA 2OA1A 1KSSA 3AEDA 3UOVA 4YWOA 4AOSA 1NG3A 4B67A 4GCMA 2QAEA 3QSEA 2ZBWA 4LU6A 4K7ZA 4YKGA 2XVJA 1DOEA 3NK2X 1ZKQA 4NTDA 2BS3A 3F8DA 4J31A 2B9YA 2XLPA 3C4NA 4TM4A 2BA9A 3FG2P 3D8XA 1JRYA 1Y56B 1VQWA 2B76A 2XVEA 4GR1A 3NYEA 3GSIA 3IHGA 3AEEA 1DXLA 3ICTA 1FCDA 1GTHA 2WETA 4Y4NA 1ZMCA 3DGHA 1NHRA 2VQ7A 4FX9A 1BGJA 5BVAA 1S3EA 4NEVA 4K22A 2YG4A 3RP8A 1DJQA 2AR8A 4GF7A 4YKFA 3UOZA 2XCGA 1LQTA 4YSXA 4U2LA 1F8RA 2ZZ0A 1PBDA 2WESA 3L1RA 1S7MA 1E6EA 4K5RA 2WOVA 4Z24A 3OC4A 1PBFA 3NK0X 4EM3A 2R0PA 2GAHB 3ICRA 4ICYA 3IWAA 3AE7A 3JSKA 2YR5A 4Z2RA 1DJNA 1XDIA 3GYXA 3C4AA 4EQRA 1DOBA 1D7LA 3UTGA 1PXCA 1H6VA 3QSSA 2CFYA 2BABA 4OVIA 3NGCX 3BI4A 4TM0A 2VVLG 1K4QA 2GRTA 4A9WA 3LXDA 4D03A 2XFUA 3Q9TA 3AE3A 5JCIA 4C3YA 2EQ6A 1KFYA 2BXSA 3CGDA 4IV9A 2YG3A 2V3BA 1MOKA 3M13A 3CPJG 5KOXA 2X99A 3SQPA 5CKUA 4H4UA 4EMJA 1GRFA 3CGCA 4ECHA 3G5QA 3D9XA 1GREA 1H2IA 4LIIA 2GVCA 3T0KA 3T2KA 3DMEA 2YLWA 3AE1A 3BNMA 5M10A 4JNQA 3GDPA 3AEAA 1JNRA 1F6MA 4EMWA 2HQMA 1NENA 1S2QA 2FBWA 4H2PA 3OZ2A 4B66A 1QLBA 2B9XA 3EF6A 2GQFA 4Z26A 3BI5A 2GQWA 3SZ0A 1IUUA 4KX6A 1TDKA 1N4WA 3SGLA 4A6NB 3RP6A 2GAGB 3SZFA 3UTHA 3AD7B 2GR3A 5TR3A 1EBDA 2ZZBA 1CC6A 3K7QX 4JY2A 4U8IA 4NTEA 5J60A 1B5QA 2I0ZA 3KLJA 4NZHA 4YSHA 1NAAA 3AE9A 3BNUA 3UTFA 3VRAA 3G5SA 2ZZCA 1GRTA 2BK3A 2OLOA 4O5UA 1PXAA 1VRQB 3AEGA 3LOVA 4GRTA 1E1KA 4GUVA 1IUTA 2XVHA 1H86A 1GESA 2R4EA 2C7GA 4U8KA 3NTAA 2YG7A 3CN8A 5IQ1A 3GRSA 3UKQA 3BI2A 5C2TA 1ZX9A 3AXBA 2XFQA 1TDNA 3NN0X 1VG9A 2PYXA 4IVOB 4BV6A 4H4WA 1CJ4A 2XDOA 2WDVA 2WP6A 3L8KA 4USQA 3FIMB 4XWZA 2YQUA 1LV0A 4H4PA 4RG3A 2XLUA 4AP1A 2X50A 4CRTA 3LZWA 4H4QA 2XFPA 4A65A 2A87A 4H4ZA 2V61A 1L9CA 1MXTA 2GEWA 1NDAA 1CJ3A 2C67A 3CIRA 2Z5XA 4GAVA 2Q6UA 2ARDA 3S5WA 2YR4A 4Z44A 2YM1A 1GRHA 2WEUA 3KD9A 4EQSA 1KSUA 3VR9A 3CTYA 2YM2A 1YKJA 3B6DA 4BJYA 2JAEA 2YG6A 3CNDA 3EPTA 4H4VA 1N4UA 1Z6LA 2WS3A 3VR8A 2C70A 4X9MA 5LV9A 3NHOX 2BCPA 1YQ3A 2R4JA 3KVEA 3PO7A 3S61A 3GWFA 3P4RA 4CNKA 2YLSA 1GNDA 4YTMA 4PAAA 1EL8A 2BYBA 2Q7VA 3SFEA 3VQRA 1NHPA 1YY5A 2BK5A 2VOUA 2JB2A 4U8NA 1F8SA 2E4GA 2YVJA 3ABVA 1CL0A 1JRXA 4GDPA 1L9DA 1GV4A 2Q0KA 3AEFA 4U2TA 4LA1A 1O5WA 5KVHA 3P4QA 1H84A 1M64A 1HYUA 2X8CA 2BS4A 2VZ2A 2X3NA 4GAPA 4H2RA 3V76A 4CBQA 4DSHA 5KNLA 5FS7A 3BHKA 3P1WA 3SX6A 5JCNA 2WPCA 3CNJA 1K0IA 3URHA 1D4DA 3NLCA 4X4JA 4II3A 1KDGA 5KWFA 5KRQA 2WOWA 4K5SA 1K0LA 1RP0A 3CPIG 5BULA 4H2NA 5EB4A 2B7RA 4I58A 2CULA 4TLZA 4U8PA 5CQFA 4J34A 3PG6A 1XANA 2IVDA 3T14A 1BWCA 3SY4A 1TYTA 3NK1X 4IA5A 4UDPA 1ZP0A 1K0JA 2AQJA 3SM8A 3UKLA 2C73A 5KMRA 1OJ9A 2WQYA 2C4CA 2XFOA 5DBJA 4NNJA 2VVLA 4JY3A 1F8WA 3FMWA 1H7XA 3ISHA 5L46A 2ACZA 3ATRA 4II2A 4A5LA 2XLTA 1Q9IA 1KN0A 2BK4A 3AD9B 1VG0A 2E5VA 2BS2A 3SFDA 4MJWA 3DK8A 3QVPA 1V59A 1EL7A 1BKWA 1IUWA 3AD8B 3KPKA 1OJTA 2W0HA 1SEZA 2WDQA 3NN6X 3NRNA 3ATQA 1JRZA 1D4CA 3K7TA 4AOXA 4BK2A 3ALLA 4K8DA 4ADWA 2X8HA 1ZMDA 3HYVA 1GTEA 2FJDA 1GRBA 3GMBA 1KF6A 3QSMA 3AWIA 3RP7A 4B65A 4FDCB 4ZN0A 4DGKA 3HYWA 5KMSA 1TRBA 3V3NA 2RGOA 3GRTA 3SZCA 3II4A 4CNJA 4GDEA 2WP5A 3DK9A 3T2ZA 4DSGA 3B3RA 3GWDA 4M52A 1PBCA 3HZLA 3UOYA 4Y4MA 1H7WA 2RGHA 3L5OA 1RYIA 2OAMA 2QCUA 3KKJA 1H81A 2JKCA 3NIXA 4B69A 4EIQA 5HY5A 3GD4A 3AYJA 3DA1A 1E39A 4UP3A 3LADA 1PBEA 1P2EA 1Y56A 2WDRA 1QO8A 1P2HA 1ONFA 2NVKX 2WPEA 5FMHA 4C74A 2WP9A 3PS9A 4APNA 2YR6A 3LJPA 1NEKA 1H83A 2OLNA 3UOXA 2A89A 2WU5A 1BF3A 3AE8A 4G73A 5EB5A 1GSNA 3NH3X 4D04A 3ALMA 1FEBA 5JCKA 4Z2UA 4FK1A 4EQWA 2YVFA 1PJ6A 3UP4A 1M6IA 1IJHA 5EOWA 2XLRA 3KA7A 3LB8A 3NTDA 4OPTA 2EQ8A 2JK6A 2GH5A 4CY8A 4CY6A 2XFNA 2CDUA 4H4TA 4EQXA 2YG5A 3ADAB 3K30A 4USRA 3AE5A 2XYOA 3IHMA 4U8MA 3NYCA 3D1CA 3BHFA 4JQ9A 1ELIA 3VRBA 4H4YA 4O5QA 3T2YA 4C3XA 1IUVA 4CCRA 4FK1C 1COYA 4B64A 5FS6A 3DK4A 2OALA 3GMCA 3PVCA 2C3CA 2BRAA 3GYJA 1CJCA 4OCGA 2A8XA 2V3AA 3I3LA 3M12A 4Z43A 4PABA 3O0HA 2YLRA 4B1BA 1LVLA 4J36A 1MO9A 5JRBA 1XHCA 2XVIA 3AE6A 3COXA 2EQ9A 2R0CA 4H50A 4JN9A 3FPZA 3LZXA 1F3PA 2VVMA 1D5TA 1EL9A 2C64A 1B37A 1PHHA 3Q6JA 1FOHA 4CCQA 4RSLA 3CPHG 5FS9A 3E1TA 4A7AA 1H82A 1L9EA 1CJ2A 2GF3A 2O9ZA 1CBOA 3UP5A 4J2WA 1E1LA 2GR1A 4EIPA 1N4VA 1FECA 1GXFA 3DH9A 1E1NA 1ZY8A 4H2QA 2XVFA 2E1MA 4G6HA 4A6NA 5U25A 3AYLA 4YT0A 2VQBA 1JOAA 3CGEA 4J57A 4EM4A 4A79A 1L0VA 1XPQA 4UDRA 5JCLA 1JEHA 5IQ4A 5BRTA 4HB9A 4G74A 4U8LA 3T31A 4BK1A 1OJAA 1GALA 4AT2A 1OJCA 5HYMA 5U1OA 5ER0A 4YSZA 1OJDA 4YTPA 1TYPA 1BGNA 1NPXA 4BJZA 1B4VA 1Q1RA 1B8SA 1D4EA 1NG4A 2WBAA 1LQUA 2C76A 3GDNA 3VRDB 2Z5YA 4U8JA 1LJ1A 2JBVA 1RSGA 2TPRA 1UKVG 2R46A 3UTEA 3ZYXA 3SZWA 5GRTA 3UKKA 4I59A 1ZK7A 1IUSA 1PBBA 1TDEA 4EMIA 4K2XA 4OPUA 2NPXA 3CNTA 4NTCA 3UKFA 2GMJA 4JDRA 1YQZA 2EQ7A 3CNPA 3ICSA 1LPFA 5M0ZA 2GMHA 1FL2A 1PDHA 2AAQA 1E7PA 1D7YA 1E1MA 3R9UA 2CVJA 2V6OA 1NHQA 2GB0A 4E0VA 4U2SA 2GR2A 4YXDA 5EBKA 3AB1A 3EAOA 4H4XA 2V60A 2V5ZA 2YVGA 2GR0A 5HXIA 4J33A 2YWLA 4H4RA 2BXRA 1KNPA 3KPFA 2BC0A 2WU2A 1Q1WA 3AEBA 3C96A 3DJJA 4OPGA 3QFBA 4TM1A 1X31B 1PN0A 4WCTA 1BZLA 2VRMA 4YTNA 3DGZA 1CC2A 5KMPA 2FJAA 2C65A 3NKSA 3H4KA 2J3NA 2APGA 2TMDA 3F8RA 3DJDA 2C72A 2IVEA 5IPYA 4Y4LA 4KPRA 3AE2A 4NWZA 2F5ZA 3T37A 4REKA 3ZDNA 3CMMA 2BRYA 5KXJA 1DODA 1O95A 4P9SA 2C66A 2B9WA 4TLXA 2BACA 4H4SA 4OPLA 5KVIA 1DOCA 2Y6RA 4RG4A 4TM3A 4IVMB 2QA2A 3M0OA 5HHFA 1VDCA 4XXGA 4ZCDA 1ZOVA 2WPFA 2R0GA 3ITJA 2WOIA 3RNMA 4C5OA 1PS9A 3H8LA 3NNEA 3QVRA 1CC4A 3DJEA 4JNAA 4XWRA 4IA6A 4G9KA 1GETA 3F8PA 2Q0LA 3P9UA 3UKAA 3GYIA 2YLZA 3V3OA 4B63A 3REDA 1ZOYA 5FS8A 3SYIA 2BCGG 3HYXA 1GOSA 1JNZA 1ZDLA 1DNCA 3AE4A 3QFAA 3NT6A 3SXIA 4X9NA 1NHSA 3IC9A 3G5RA 3K7MX 2H88A 1N1PA 1GERA 2JB3A 4BK3A 4ZCCA 3H8IA 1AOGA 2IIDA 5C3JA 3QJ4A 1JU2A 1CF3A 3AECA 3RHAA 3GD3A 4BURA 2R9ZA 2JB1A 2Y6QA 5J7XA 4OPIA 1IUXA 2C3DA 1KNRA 2XLSA 3ALJA 1GEUA 3P4PA 1W4XA 4C77A 1O94A 2DKIA 5U63A 4Z25A 3DJGX 1YQ4A 4J56A 1REOA 4U8OA 2YAUA 1GPEA 1QJDA 1PJ7A 3P4SA 3I6DA 3FBSA 5KOWA 1CHUA 4WX1A 4AP3A 5BUKA 3AYIA 3NG7X 3CGBA 1Y0PA 3CNSA 5KMQA 4NEWA 4A99A 2GV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTX R;  2C75 A;  3EAN A;  1TDO A;  2QA1 A;  4DNA A;  2BC1 A;  3KU9 A;  1S3B A;  2X8G A;  1GRG A;  4N9X A;  1GRA A;  2YLT A;  3UKH A;  1FEA A;  1GT8 A;  3WE0 A;  4UDQ A;  4HA6 A;  2R45 A;  3UKP A;  2FJE A;  1PJ5 A;  1S2Y A;  2H89 A;  3NYF A;  3UCL A;  4AT0 A;  2DKH A;  4Z2T A;  1EL5 A;  1TDF A;  4H7U A;  4OPC A;  2FJB A;  4YSY A;  2RGJ A;  4OPD A;  2WHD A;  5GSN A;  2YLX A;  1PXB A;  2PHH A;  4B68 A;  3IF9 A;  2UZZ A;  2VRL A;  5JCM A;  2RAB A;  2B7S A;  2OA1 A;  1KSS A;  3AED A;  3UOV A;  4YWO A;  4AOS A;  1NG3 A;  4B67 A;  4GCM A;  2QAE A;  3QSE A;  2ZBW A;  4LU6 A;  4K7Z A;  4YKG A;  2XVJ A;  1DOE A;  3NK2 X;  1ZKQ A;  4NTD A;  2BS3 A;  3F8D A;  4J31 A;  2B9Y A;  2XLP A;  3C4N A;  4TM4 A;  2BA9 A;  3FG2 P;  3D8X A;  1JRY A;  1Y56 B;  1VQW A;  2B76 A;  2XVE A;  4GR1 A;  3NYE A;  3GSI A;  3IHG A;  3AEE A;  1DXL A;  3ICT A;  1FCD A;  1GTH A;  2WET A;  4Y4N A;  1ZMC A;  3DGH A;  1NHR A;  2VQ7 A;  4FX9 A;  1BGJ A;  5BVA A;  1S3E A;  4NEV A;  4K22 A;  2YG4 A;  3RP8 A;  1DJQ A;  2AR8 A;  4GF7 A;  4YKF A;  3UOZ A;  2XCG A;  1LQT A;  4YSX A;  4U2L A;  1F8R A;  2ZZ0 A;  1PBD A;  2WES A;  3L1R A;  1E6E A;  4K5R A;  2WOV A;  4Z24 A;  3OC4 A;  1PBF A;  3NK0 X;  4EM3 A;  2R0P A;  2GAH B;  3ICR A;  4ICY A;  3IWA A;  3AE7 A;  3JSK A;  2YR5 A;  4Z2R A;  1DJN A;  1XDI A;  3C4A A;  4EQR A;  1DOB A;  1D7L A;  3UTG A;  1PXC A;  1H6V A;  3QSS A;  2CFY A;  2BAB A;  4OVI A;  3NGC X;  3BI4 A;  4TM0 A;  2VVL G;  1K4Q A;  2GRT A;  4A9W A;  3LXD A;  4D03 A;  2XFU A;  3Q9T A;  3AE3 A;  5JCI A;  4C3Y A;  2EQ6 A;  1KFY A;  2BXS A;  3CGD A;  4IV9 A;  2YG3 A;  2V3B A;  1MOK A;  3M13 A;  3CPJ G;  5KOX A;  2X99 A;  3SQP A;  5CKU A;  4H4U A;  4EMJ A;  1GRF A;  3CGC A;  4ECH A;  3G5Q A;  1GRE A;  2GVC A;  4LII A;  3DME A;  2YLW A;  3AE1 A;  3BNM A;  5M10 A;  4JNQ A;  3GDP A;  3AEA A;  1JNR A;  1F6M A;  4EMW A;  2HQM A;  1NEN A;  1S2Q A;  2FBW A;  4H2P A;  3OZ2 A;  4B66 A;  1QLB A;  2B9X A;  3EF6 A;  2GQF A;  4Z26 A;  3BI5 A;  2GQW A;  1IUU A;  4KX6 A;  1TDK A;  1N4W A;  3SGL A;  4A6N B;  3RP6 A;  2GAG B;  3UTH A;  3AD7 B;  2GR3 A;  5TR3 A;  1EBD A;  2ZZB A;  1CC6 A;  3K7Q X;  4JY2 A;  4U8I A;  4NTE A;  5J60 A;  1B5Q A;  2I0Z A;  3KLJ A;  4NZH A;  4YSH A;  1NAA A;  3AE9 A;  3BNU A;  3UTF A;  3VRA A;  3G5S A;  2ZZC A;  1GRT A;  2BK3 A;  2OLO A;  4O5U A;  1PXA A;  1VRQ B;  3AEG A;  3LOV A;  4GRT A;  1E1K A;  4GUV A;  1IUT A;  2XVH A;  1H86 A;  1GES A;  2R4E A;  2C7G A;  4U8K A;  3NTA A;  2YG7 A;  3CN8 A;  5IQ1 A;  3GRS A;  3UKQ A;  3BI2 A;  5C2T A;  1ZX9 A;  3AXB A;  2XFQ A;  1TDN A;  3NN0 X;  1VG9 A;  2PYX A;  4IVO B;  4BV6 A;  4H4W A;  1CJ4 A;  2XDO A;  2WDV A;  2WP6 A;  3L8K A;  4USQ A;  3FIM B;  4XWZ A;  2YQU A;  1LV0 A;  4H4P A;  4RG3 A;  2XLU A;  4AP1 A;  2X50 A;  4CRT A;  3LZW A;  4H4Q A;  2XFP A;  4A65 A;  2A87 A;  4H4Z A;  2V61 A;  1L9C A;  1MXT A;  2GEW A;  1NDA A;  1CJ3 A;  2C67 A;  3CIR A;  2Z5X A;  2Q6U A;  2ARD A;  3S5W A;  2YR4 A;  4Z44 A;  2YM1 A;  1GRH A;  2WEU A;  3KD9 A;  4EQS A;  1KSU A;  3VR9 A;  3CTY A;  2YM2 A;  1YKJ A;  3B6D A;  4BJY A;  2JAE A;  2YG6 A;  3CND A;  3EPT A;  4H4V A;  1N4U A;  1Z6L A;  2WS3 A;  3VR8 A;  2C70 A;  4X9M A;  5LV9 A;  3NHO X;  2BCP A;  1YQ3 A;  2R4J A;  3KVE A;  3PO7 A;  3S61 A;  3GWF A;  3P4R A;  4CNK A;  2YLS A;  1GND A;  4YTM A;  4PAA A;  1EL8 A;  2BYB A;  2Q7V A;  3SFE A;  3VQR A;  1NHP A;  1YY5 A;  2BK5 A;  2VOU A;  2JB2 A;  4U8N A;  1F8S A;  2E4G A;  2YVJ A;  3ABV A;  1CL0 A;  1JRX A;  4GDP A;  1L9D A;  1GV4 A;  2Q0K A;  3AEF A;  4U2T A;  4LA1 A;  1O5W A;  5KVH A;  3P4Q A;  1H84 A;  1M64 A;  1HYU A;  2X8C A;  2BS4 A;  2VZ2 A;  2X3N A;  4H2R A;  3V76 A;  4CBQ A;  4DSH A;  5FS7 A;  3BHK A;  3P1W A;  5JCN A;  2WPC A;  3CNJ A;  3URH A;  1K0I A;  1D4D A;  3NLC A;  4X4J A;  1KDG A;  5KWF A;  5KRQ A;  2WOW A;  4K5S A;  1K0L A;  1RP0 A;  3CPI G;  5BUL A;  4H2N A;  5EB4 A;  2B7R A;  4I58 A;  2CUL A;  4TLZ A;  4U8P A;  5CQF A;  4J34 A;  1XAN A;  2IVD A;  1BWC A;  1TYT A;  3NK1 X;  4IA5 A;  4UDP A;  1ZP0 A;  1K0J A;  2AQJ A;  3SM8 A;  3UKL A;  2C73 A;  1OJ9 A;  2WQY A;  2XFO A;  5DBJ A;  2VVL A;  4JY3 A;  1F8W A;  3FMW A;  1H7X A;  3ISH A;  5L46 A;  2ACZ A;  3ATR A;  4A5L A;  2XLT A;  1Q9I A;  2BK4 A;  3AD9 B;  1VG0 A;  2E5V A;  2BS2 A;  3SFD A;  4MJW A;  3DK8 A;  3QVP A;  1V59 A;  1EL7 A;  1BKW A;  1IUW A;  3AD8 B;  1OJT A;  2W0H A;  1SEZ A;  2WDQ A;  3NN6 X;  3NRN A;  3ATQ A;  1JRZ A;  1D4C A;  3K7T A;  4AOX A;  4BK2 A;  3ALL A;  4K8D A;  4ADW A;  2X8H A;  1ZMD A;  4B65 A;  1GTE A;  2FJD A;  1GRB A;  3GMB A;  1KF6 A;  3QSM A;  3AWI A;  3RP7 A;  4ZN0 A;  4FDC B;  4DGK A;  1TRB A;  3V3N A;  2RGO A;  3GRT A;  3II4 A;  4CNJ A;  4GDE A;  2WP5 A;  3DK9 A;  4DSG A;  3B3R A;  3GWD A;  4M52 A;  1PBC A;  3HZL A;  3UOY A;  4Y4M A;  1H7W A;  2RGH A;  3KKJ A;  1RYI A;  2OAM A;  2QCU A;  3NIX A;  1H81 A;  2JKC A;  4B69 A;  4EIQ A;  5HY5 A;  3GD4 A;  3AYJ A;  3DA1 A;  1E39 A;  4UP3 A;  3LAD A;  1PBE A;  1P2E A;  1Y56 A;  2WDR A;  1QO8 A;  1P2H A;  1ONF A;  2NVK X;  2WPE A;  5FMH A;  4C74 A;  2WP9 A;  3PS9 A;  4APN A;  2YR6 A;  3LJP A;  1NEK A;  1H83 A;  2OLN A;  3UOX A;  2A89 A;  2WU5 A;  1BF3 A;  3AE8 A;  5EB5 A;  1GSN A;  3NH3 X;  4D04 A;  3ALM A;  1FEB A;  5JCK A;  4Z2U A;  4FK1 A;  4EQW A;  2YVF A;  1PJ6 A;  3UP4 A;  1M6I A;  1IJH A;  5EOW A;  2XLR A;  3KA7 A;  3LB8 A;  3NTD A;  4OPT A;  2EQ8 A;  2JK6 A;  2GH5 A;  4CY8 A;  4CY6 A;  2XFN A;  2CDU A;  4H4T A;  4EQX A;  2YG5 A;  3ADA B;  3K30 A;  4USR A;  3AE5 A;  2XYO A;  3IHM A;  4U8M A;  3NYC A;  3D1C A;  3BHF A;  4JQ9 A;  1ELI A;  3VRB A;  4H4Y A;  4O5Q A;  4C3X A;  1IUV A;  4CCR A;  4FK1 C;  1COY A;  4B64 A;  5FS6 A;  3DK4 A;  2OAL A;  3GMC A;  3PVC A;  2C3C A;  3GYJ A;  1CJC A;  4OCG A;  2A8X A;  2V3A A;  3I3L A;  3M12 A;  4Z43 A;  4PAB A;  3O0H A;  2YLR A;  4B1B A;  1LVL A;  4J36 A;  1MO9 A;  1XHC A;  2XVI A;  3AE6 A;  3COX A;  2EQ9 A;  2R0C A;  4H50 A;  4JN9 A;  3FPZ A;  3LZX A;  1F3P A;  2VVM A;  1D5T A;  1EL9 A;  2C64 A;  1B37 A;  1PHH A;  3Q6J A;  1FOH A;  4CCQ A;  4RSL A;  3CPH G;  5FS9 A;  3E1T A;  4A7A A;  1H82 A;  1L9E A;  1CJ2 A;  2GF3 A;  2O9Z A;  1CBO A;  3UP5 A;  4J2W A;  1E1L A;  2GR1 A;  4EIP A;  1N4V A;  1FEC A;  1GXF A;  3DH9 A;  1E1N A;  1ZY8 A;  4H2Q A;  2XVF A;  2E1M A;  4A6N A;  5U25 A;  3AYL A;  4YT0 A;  2VQB A;  1JOA A;  3CGE A;  4J57 A;  4EM4 A;  4A79 A;  1L0V A;  1XPQ A;  4UDR A;  5JCL A;  1JEH A;  5IQ4 A;  5BRT A;  4HB9 A;  4U8L A;  4BK1 A;  1OJA A;  1GAL A;  4AT2 A;  1OJC A;  5HYM A;  5U1O A;  5ER0 A;  4YSZ A;  1OJD A;  4YTP A;  1TYP A;  1BGN A;  1NPX A;  4BJZ A;  1B4V A;  1Q1R A;  1B8S A;  1D4E A;  1NG4 A;  2WBA A;  1LQU A;  2C76 A;  3GDN A;  3VRD B;  2Z5Y A;  4U8J A;  1LJ1 A;  2JBV A;  1RSG A;  2TPR A;  1UKV G;  2R46 A;  3UTE A;  3ZYX A;  5GRT A;  3UKK A;  4I59 A;  1ZK7 A;  1IUS A;  1PBB A;  1TDE A;  4EMI A;  4K2X A;  4OPU A;  2NPX A;  3CNT A;  4NTC A;  3UKF A;  2GMJ A;  4JDR A;  1YQZ A;  2EQ7 A;  3CNP A;  3ICS A;  1LPF A;  5M0Z A;  2GMH A;  1FL2 A;  1PDH A;  2AAQ A;  1E7P A;  1D7Y A;  1E1M A;  3R9U A;  2CVJ A;  2V6O A;  1NHQ A;  2GB0 A;  4E0V A;  4U2S A;  2GR2 A;  4YXD A;  5EBK A;  3AB1 A;  3EAO A;  4H4X A;  2V60 A;  2V5Z A;  2YVG A;  2GR0 A;  5HXI A;  4J33 A;  2YWL A;  4H4R A;  2BXR A;  1KNP A;  3KPF A;  2BC0 A;  2WU2 A;  1Q1W A;  3AEB A;  3C96 A;  3DJJ A;  4OPG A;  3QFB A;  4TM1 A;  1X31 B;  1PN0 A;  4WCT A;  1BZL A;  2VRM A;  4YTN A;  3DGZ A;  1CC2 A;  2FJA A;  2C65 A;  3NKS A;  3H4K A;  2J3N A;  2APG A;  2TMD A;  3F8R A;  3DJD A;  2C72 A;  2IVE A;  5IPY A;  4Y4L A;  4KPR A;  3AE2 A;  3T37 A;  2F5Z A;  4REK A;  3ZDN A;  5KXJ A;  1DOD A;  1O95 A;  4P9S A;  2C66 A;  2B9W A;  4TLX A;  2BAC A;  4H4S A;  4OPL A;  5KVI A;  1DOC A;  2Y6R A;  4RG4 A;  4TM3 A;  4IVM B;  2QA2 A;  3M0O A;  5HHF A;  1VDC A;  4XXG A;  4ZCD A;  1ZOV A;  2WPF A;  2R0G A;  3ITJ A;  2WOI A;  3RNM A;  4C5O A;  1PS9 A;  3H8L A;  3NNE A;  3QVR A;  1CC4 A;  3DJE A;  4JNA A;  4XWR A;  4IA6 A;  1GET A;  3F8P A;  2Q0L A;  3P9U A;  3UKA A;  3GYI A;  2YLZ A;  3V3O A;  4B63 A;  3RED A;  1ZOY A;  5FS8 A;  2BCG G;  1GOS A;  1JNZ A;  1ZDL A;  1DNC A;  3AE4 A;  3QFA A;  3NT6 A;  4X9N A;  1NHS A;  3IC9 A;  3G5R A;  3K7M X;  2H88 A;  1N1P A;  1GER A;  2JB3 A;  4BK3 A;  4ZCC A;  3H8I A;  1AOG A;  2IID A;  5C3J A;  3QJ4 A;  1JU2 A;  1CF3 A;  3AEC A;  3RHA A;  3GD3 A;  4BUR A;  2R9Z A;  2JB1 A;  2Y6Q A;  5J7X A;  4OPI A;  1IUX A;  2C3D A;  1KNR A;  2XLS A;  3ALJ A;  1GEU A;  3P4P A;  1W4X A;  4C77 A;  1O94 A;  2DKI A;  5U63 A;  4Z25 A;  3DJG X;  1YQ4 A;  4J56 A;  1REO A;  4U8O A;  2YAU A;  1GPE A;  1QJD A;  1PJ7 A;  3P4S A;  3I6D A;  3FBS A;  5KOW A;  1CHU A;  4WX1 A;  4AP3 A;  5BUK A;  3AYI A;  3NG7 X;  3CGB A;  1Y0P A;  3CNS A;  4NEW A;  4A99 A;  2GV8 A; 
#chains in the Genus database with same CATH topology
 1LTX R;  3BSM A;  1TDO A;  2BC1 A;  1GRA A;  3S47 A;  3WE0 A;  2PPG A;  4KEM A;  2R45 A;  1S2Y A;  4Z2T A;  4AT0 A;  3CAW A;  1EL5 A;  2XH7 A;  1TDF A;  4YSY A;  2RGJ A;  2WHD A;  2YLX A;  1JDF A;  2GGI A;  2VRL A;  2RAB A;  3AED A;  1KSS A;  4AOS A;  4B67 A;  3QSE A;  1DOE A;  4NTD A;  3IJL A;  2XLP A;  3C4N A;  4TM4 A;  3FG2 P;  3D8X A;  1VQW A;  2B76 A;  4GR1 A;  3IHG A;  3AEE A;  1FCD A;  1GTH A;  4Y4N A;  3DGH A;  4K22 A;  3RP8 A;  1DJQ A;  4IP5 A;  4YSX A;  2ZZ0 A;  3QTP A;  1S7M A;  1E6E A;  3N6H A;  1N60 C;  4EM3 A;  4ICY A;  5G5H B;  2YR5 A;  4Z2R A;  1DOB A;  4HYR A;  3UTG A;  1PXC A;  1K4Q A;  2GRT A;  4DX3 A;  2BXS A;  1KFY A;  2YG3 A;  5FJP A;  3CGC A;  3D9X A;  1GRE A;  3QPE A;  2GVC A;  3PWI A;  3D46 A;  3OW1 A;  3AE1 A;  1R6W A;  1F6M A;  2XH2 A;  2HQM A;  4B66 A;  3OZ2 A;  4Z26 A;  1NEL A;  3BI5 A;  2GQW A;  1TDK A;  2RDX A;  3SGL A;  3AD7 B;  1L8P A;  1CC6 A;  3I4K A;  4NZH A;  3AE9 A;  3UTF A;  2ZZC A;  1GRT A;  2BK3 A;  3OZY A;  1PXA A;  2R4E A;  3CN8 A;  3GRS A;  2XFQ A;  4IVO B;  4BV6 A;  3UJE A;  4H4W A;  2WDV A;  2WP6 A;  4USQ A;  2XFP A;  4A65 A;  4GFI A;  1MXT A;  3CIR A;  2Z5X A;  2ARD A;  3S5W A;  2YR4 A;  4Z44 A;  1GRH A;  3KD9 A;  4EQS A;  1KSU A;  3CTY A;  1YKJ A;  3B6D A;  2YG6 A;  4H4V A;  3VDG A;  3NHO X;  1FHV A;  2YLS A;  3UJ2 A;  1YY5 A;  2YVJ A;  4H2H A;  2Q0K A;  3AEF A;  3P4Q A;  2PTW A;  1H84 A;  2X3N A;  3ZVH A;  4GAP A;  4DSH A;  3P1W A;  3EEZ A;  3CNJ A;  1D4D A;  3NLC A;  4II3 A;  1XS2 A;  2QJN A;  3V5C A;  4JHM A;  3MUC A;  3RGT A;  3PG6 A;  1BWC A;  3TJ4 A;  1ZP0 A;  2AQJ A;  3SM8 A;  5KMR A;  1OJ9 A;  2WQY A;  5DBJ A;  3FMW A;  1H7X A;  3KUM A;  4II2 A;  2PU0 A;  1KN0 A;  1Q9I A;  1VG0 A;  2BS2 A;  4H83 A;  2AKM A;  1IUW A;  1OJT A;  1WUF A;  2PTY A;  1D4C A;  3K7T A;  3DFY A;  2E5A A;  3VCN A;  2X8H A;  2FJD A;  4ZN0 A;  1GRB A;  2PSN A;  1TRB A;  3SZC A;  3QLD A;  3FYY A;  3II4 A;  3MQT A;  2XSX A;  3DK9 A;  3D47 A;  1PBC A;  3UOY A;  1H7W A;  3CT2 A;  2RGH A;  2OAM A;  3NIX A;  3NFU A;  2WDR A;  2NVK X;  3T9P A;  5FMH A;  2OLN A;  1BF3 A;  2FYM A;  2YVF A;  3UP4 A;  3Q45 A;  4E6M A;  3KA7 A;  3LB8 A;  4OPT A;  1BQG A;  2XFN A;  2OQY A;  1N61 C;  1COY A;  4B64 A;  2OAL A;  3GMC A;  3PVC A;  2A8X A;  2V3A A;  4Z43 A;  1EBG A;  1KD0 A;  5JRB A;  2R0C A;  3FPZ A;  2VVM A;  2XGZ A;  3NO1 A;  1B37 A;  5BOE A;  3A7A A;  5FS9 A;  3E1T A;  1L9E A;  1CBO A;  3R07 C;  1E1L A;  3JZU A;  1FEC A;  4H2Q A;  5BOF A;  4A6N A;  5J04 A;  3ZLG A;  3U4F A;  1XPQ A;  5BRT A;  4G74 A;  1OJA A;  4YSZ A;  3UXK A;  1OJD A;  1D4E A;  2WBA A;  1LQU A;  3DEQ A;  1LJ1 A;  3TW9 A;  4I59 A;  1IUS A;  4KPL A;  2PGW A;  3EUB 3;  2NPX A;  4NTC A;  1YQZ A;  3CNP A;  4A35 A;  5ENL A;  3VCC A;  2GMH A;  3A7R A;  2AAQ A;  1NHQ A;  4E0V A;  2GR2 A;  3AB1 A;  2V5Z A;  2XH4 A;  2GDQ A;  2PP0 A;  2WU2 A;  4TM1 A;  1MNS A;  3UJR A;  5KMP A;  2C65 A;  1MDR A;  5IPY A;  4REK A;  3ZDN A;  1DOD A;  2OLA A;  4TLX A;  2W55 A;  2R0G A;  4C5O A;  4XWR A;  3N6J A;  3T4W A;  2Q0L A;  3P9U A;  3GYI A;  4B63 A;  3SYI A;  3HYX A;  3AM9 A;  1FHU A;  3QFA A;  3NT6 A;  3MWC A;  2IID A;  3ZLF A;  4E5T A;  4K2S A;  2GSH A;  1CF3 A;  3AEC A;  4DWD A;  1YQ4 A;  4J56 A;  1REO A;  3VA8 A;  3UCD A;  3I6D A;  3FBS A;  1CHU A;  4WX1 A;  3OPS A;  4A99 A;  4J3Z A;  3EAN A;  2QA1 A;  3KU9 A;  2X8G A;  1GRG A;  4Z1Y A;  2YLT A;  3UKH A;  4UDQ A;  4HA6 A;  2ONE A;  2I5Q A;  3UKP A;  3OTR A;  3NYF A;  4H7U A;  4OPD A;  3NVW B;  5GSN A;  4B68 A;  2UZZ A;  2OA1 A;  3UOV A;  3H7V A;  4Z17 A;  1NG3 A;  2QAE A;  4YKG A;  4K7Z A;  3NK2 X;  2BA9 A;  1JRP A;  2QQ6 A;  3ICT A;  3I6T A;  1NHR A;  3ZVI A;  4FX9 A;  1S3E A;  4NEV A;  2YG4 A;  3UCC A;  2AR8 A;  4GF7 A;  4YKF A;  2POZ A;  1PBD A;  4Z24 A;  3OC4 A;  1PBF A;  3NK0 X;  3ICR A;  3R10 A;  2BAB A;  3PWG A;  4D03 A;  4A9W A;  3LXD A;  4C3Y A;  1WYG A;  2EQ6 A;  1KKR A;  3CGD A;  4IV9 A;  2GL5 A;  3M13 A;  2V3B A;  4ECH A;  3G5Q A;  1H2I A;  4LII A;  3DME A;  4JNQ A;  4H2P A;  2O56 A;  3SZ0 A;  1IUU A;  3RP6 A;  2P8C A;  2GAG B;  3DG3 A;  1ZXI C;  4YSH A;  3VRA A;  4X2P A;  3V5F A;  4ZOH B;  2PTZ A;  4GRT A;  4GUV A;  1IUT A;  3VC6 A;  4U8K A;  2PP3 A;  1VQZ A;  4H1Z A;  3NTA A;  2YG7 A;  5C2T A;  3AXB A;  1TDN A;  1SB3 B;  3FIM B;  5FJU A;  2YQU A;  4H4P A;  2OZ8 A;  4RG3 A;  2X50 A;  2A87 A;  4KT2 A;  1L9C A;  2C67 A;  1N63 C;  2QJJ A;  2YM1 A;  2P8B A;  2YM2 A;  2JAE A;  1N4U A;  2WS3 A;  4X9M A;  1PDY A;  4CNK A;  3DG6 A;  3SFE A;  4PAA A;  1EL8 A;  2Q7V A;  3VQR A;  1NHP A;  2JB2 A;  4U8N A;  2E4G A;  3ABV A;  1CL0 A;  4GDP A;  4U2T A;  1O5W A;  5KVH A;  2BS4 A;  2VZ2 A;  3V76 A;  5FS7 A;  3SX6 A;  2WPC A;  5KWF A;  1RP0 A;  2PP1 A;  3A7U A;  3CPI G;  1MDL A;  2IVD A;  4A6G A;  1TYT A;  3NK1 X;  1K0J A;  1EC8 A;  2VVL A;  2ACZ A;  2P3Z A;  3IJI A;  2BK4 A;  2E5V A;  4DN1 A;  3DK8 A;  1EL7 A;  1BKW A;  3AD8 B;  3KPK A;  1JPD X;  2WDQ A;  3NN6 X;  4MMW A;  1MUC A;  4AOX A;  4BK2 A;  3ALL A;  4B65 A;  3HYV A;  1GTE A;  1KF6 A;  3RP7 A;  3AWI A;  4FDC B;  4DGK A;  3HYW A;  5KMS A;  3GRT A;  2OO6 A;  3GD6 A;  3B3R A;  3GWD A;  4Y4M A;  1SJC A;  3RIT A;  1RYI A;  3KKJ A;  2JKC A;  1E39 A;  1P2E A;  1P2H A;  1ONF A;  3P93 A;  5EB5 A;  4G73 A;  1GSN A;  1FEB A;  5JCK A;  1PJ6 A;  2XLR A;  4CY8 A;  2JK6 A;  4CY6 A;  2YG5 A;  3AE5 A;  5FJR A;  4JQ9 A;  4H4Y A;  3T2Y A;  5FS6 A;  3GYJ A;  1CJC A;  4PAB A;  1LVL A;  2AL1 A;  4J36 A;  1MO9 A;  3CB3 A;  2XVI A;  3AE6 A;  3COX A;  1D5T A;  1PHH A;  3Q6J A;  1P48 A;  4RSL A;  3RRA A;  1CJ2 A;  3UP5 A;  2GGG A;  4IHC A;  1N4V A;  2CHR A;  1ZY8 A;  2NQL A;  4G6H A;  4IP4 A;  3AYL A;  4YT0 A;  2VQB A;  1JOA A;  3CGE A;  4A79 A;  1L0V A;  4UDR A;  5IQ4 A;  3T31 A;  4A3R A;  1GAL A;  1OJC A;  5U1O A;  4YTP A;  1NPX A;  3GDN A;  3VRD B;  3UTE A;  2TPR A;  3MSY A;  4K2X A;  4JDR A;  3ICS A;  5M0Z A;  1FL2 A;  1PDH A;  1E1M A;  4HCL A;  2V6O A;  2GB0 A;  4U2S A;  4YXD A;  5HXI A;  2POD A;  1KNP A;  3KPF A;  3DJJ A;  3H8A A;  1X31 B;  1PN0 A;  1RM6 B;  2FJA A;  3NKS A;  3H4K A;  1MRA A;  3NVZ B;  4NWZ A;  2F5Z A;  3TWA A;  4ZA0 A;  3BJS A;  1O95 A;  4P9S A;  2C66 A;  5KVI A;  1DOC A;  2Y6R A;  4TM3 A;  5HHF A;  3M0O A;  2P0I A;  4ZCD A;  2WPF A;  2ZAD A;  3CK5 A;  1PS9 A;  1CC4 A;  4JNA A;  4IA6 A;  1GET A;  1T3Q C;  3RED A;  1N5X A;  2PA6 A;  1JNZ A;  3NVY B;  1R0M A;  1SJB A;  2H88 A;  2PTX A;  4ZCC A;  4HNL A;  4BUR A;  2JB1 A;  5J7X A;  4OPI A;  3BOX A;  2C3D A;  2XLS A;  3ALJ A;  3SJN A;  1W4X A;  1O94 A;  2DKI A;  5U63 A;  1NU5 A;  4GME A;  1GPE A;  4AP3 A;  5BUK A;  5KMQ A;  3CGB A;  1Y0P A;  4NEW A;  2ZC8 A;  1N62 C;  3ES8 A;  1VDV A;  3GO2 A;  3ETR B;  1S3B A;  1FEA A;  1GT8 A;  2OZT A;  3SR6 B;  4J1O A;  3IK4 A;  4G6G A;  2FJE A;  2FJB A;  3Q4D A;  1PXB A;  2PHH A;  3IF9 A;  5JCM A;  4YWO A;  4GCM A;  3T6C A;  2ZBW A;  4LU6 A;  2BS3 A;  4J31 A;  2B9Y A;  4G8T A;  1Y56 B;  3GSI A;  1DXL A;  4K8G A;  1ZMC A;  2OQH A;  3FV9 A;  3UOZ A;  1LQT A;  4U2L A;  2R0P A;  2GAH B;  3SBF A;  3MKC A;  3JSK A;  3C4A A;  3QSS A;  2CFY A;  4E4U A;  3NGC X;  2OPJ A;  3BI4 A;  4TM0 A;  2XFU A;  3Q9T A;  2MNR A;  3RR1 A;  4HCH A;  3CXB A;  1EC7 A;  5KOX A;  2X99 A;  3SQP A;  5CKU A;  4H4U A;  4EMJ A;  1GRF A;  1FO4 A;  3BNM A;  5M10 A;  3AEA A;  3VFC A;  1JNR A;  4EMW A;  1NEN A;  1S2Q A;  2B9X A;  2QDD A;  1N4W A;  2OVL A;  4E4F A;  2GR3 A;  5TR3 A;  4JY2 A;  3K7Q X;  4U8I A;  5J60 A;  4NTE A;  2PGE A;  1B5Q A;  2I0Z A;  3KLJ A;  3NRZ B;  1NAA A;  3BNU A;  3G5S A;  2OLO A;  4O5U A;  1VRQ B;  3AEG A;  3LOV A;  2PU1 A;  1H86 A;  1GES A;  3NN0 X;  2PYX A;  1CJ4 A;  3AN1 A;  2GGJ A;  1LV0 A;  3TQP A;  4EWJ A;  4AP1 A;  2XLU A;  4CRT A;  4H4Q A;  4GIR A;  4IL2 A;  1NDA A;  4GAV A;  3NZG A;  2Q6U A;  4BJY A;  2PCE A;  3VR8 A;  5LV9 A;  3PO7 A;  1YQ3 A;  1EC9 A;  2R4J A;  3P4R A;  1GND A;  2BYB A;  3JVA A;  2GGE A;  4GIS A;  2VOU A;  1FFU C;  1JRX A;  4FP1 A;  1L9D A;  2QVH A;  1HYU A;  2X8C A;  4H2R A;  4CBQ A;  3THU A;  5KNL A;  3BHK A;  5JCN A;  1K0I A;  1KDG A;  3OZM A;  5KRQ A;  4DYE A;  4K5S A;  1K0L A;  5BUL A;  3SN1 A;  2B7R A;  1YEY A;  4I58 A;  4U8P A;  4DXK A;  3SY4 A;  3UKL A;  4UDP A;  4JY3 A;  1F8W A;  3ISH A;  1V97 A;  5L46 A;  2XLT A;  3NVV B;  4MJW A;  4GGB A;  3QVP A;  2W0H A;  1SEZ A;  3ATQ A;  1JRZ A;  1N5W C;  3R25 A;  4K8D A;  1ZMD A;  1JCT A;  3QSM A;  3CYJ A;  2QGY A;  3DGB A;  4CNJ A;  7ENL A;  2AL2 A;  3S5S A;  5IDZ A;  4M52 A;  3B9J B;  3I6E A;  3N4E A;  4B69 A;  3L5O A;  4EIQ A;  1H81 A;  4UP3 A;  3LAD A;  2FKP A;  1PBE A;  2DW6 A;  2WP9 A;  3PS9 A;  4APN A;  2AKZ A;  2WU5 A;  3AE8 A;  3ALM A;  4Z2U A;  4FK1 A;  1M6I A;  1IJH A;  3NTD A;  2GH5 A;  2CDU A;  4H4T A;  4EQX A;  4HNC A;  3K30 A;  4U8M A;  3VRB A;  4O5Q A;  3DG7 A;  2P88 A;  1IUV A;  4C3X A;  3DK4 A;  1JRO A;  2C3C A;  2BRA A;  3M12 A;  3O0H A;  4GYP A;  2YLR A;  4B1B A;  1XHC A;  3B97 A;  4M6U A;  4H50 A;  4JN9 A;  2OX4 A;  3LZX A;  1STZ A;  3MY9 A;  3P0W A;  1FOH A;  4ENL A;  4A7A A;  1H82 A;  2GR1 A;  3DH9 A;  1E1N A;  2E1M A;  4EM4 A;  5JCL A;  1JEH A;  4BK1 A;  4AT2 A;  5HYM A;  2E3T A;  1TYP A;  1BGN A;  3QN3 A;  1NG4 A;  3SSZ A;  4H19 A;  2Z5Y A;  3ZYX A;  2JBV A;  1RSG A;  2R46 A;  3H12 A;  5GRT A;  1PBB A;  1TDE A;  1WUE A;  4EMI A;  3UKF A;  1SJD A;  1D7Y A;  3AMZ A;  3EAO A;  3MZN A;  4H4X A;  2V60 A;  2YVG A;  4J33 A;  4H4R A;  1ONE A;  2BXR A;  3AEB A;  3QFB A;  3DIP A;  2GGH A;  5FJT A;  4WCT A;  2VRM A;  3DGZ A;  2APG A;  2J3N A;  2TMD A;  3F8R A;  3DJD A;  2IVE A;  4Y4L A;  3AE2 A;  3T37 A;  3CMM A;  2BRY A;  1X2G A;  4OPL A;  4RG4 A;  1W6T A;  2QA2 A;  4XXG A;  1ZOV A;  3K1G A;  4IZG A;  3H8L A;  3QVR A;  2PMQ A;  1BKH A;  3UKA A;  2YLZ A;  3V3O A;  1OEP A;  5FS8 A;  1GOS A;  1DNC A;  3AE4 A;  4GYP C;  3SXI A;  4X9N A;  1NHS A;  3IC9 A;  4HN8 A;  3G5R A;  3K7M X;  1N1P A;  1GER A;  1KKO A;  3H8I A;  5C3J A;  3QJ4 A;  3GD3 A;  2R9Z A;  1P43 A;  1GEU A;  3P4P A;  4Z25 A;  2YAU A;  1QJD A;  3IJQ A;  3NG7 X;  3CNS A;  2OKT A;  1FFV C;  4F4R A;  4GGH A;  2C75 A;  4DNA A;  4N9X A;  3R11 A;  1ELS A;  2HXT A;  1PJ5 A;  2H89 A;  3UCL A;  2DKH A;  4MGG A;  4OPC A;  5FJO A;  2W3R A;  2OFJ A;  2B7S A;  2XVJ A;  1ZKQ A;  3F8D A;  1JRY A;  3NYE A;  2XVE A;  2WET A;  2VQ7 A;  1BGJ A;  5BVA A;  3DER A;  1ECQ A;  4JN8 A;  3DFH A;  2XCG A;  1F8R A;  3DES A;  2WES A;  3L1R A;  3TCS A;  4K5R A;  2WOV A;  3IWA A;  3AE7 A;  1DJN A;  1XDI A;  3GYX A;  4EQR A;  1D7L A;  1H6V A;  3VC5 A;  4OVI A;  2VVL G;  1PDZ A;  3AE3 A;  5JCI A;  4YWS A;  4HPN A;  1MOK A;  3CPJ G;  3TTE A;  3T2K A;  3T0K A;  3UJS A;  2YLW A;  3ZVH B;  3GDP A;  2HXU A;  2FBW A;  1QLB A;  3FXG A;  3EF6 A;  2GQF A;  4KX6 A;  2PS2 A;  3HW2 A;  4TVW A;  4DHG A;  4A6N B;  3SZF A;  3UTH A;  3FVD A;  1EBD A;  2ZZB A;  3GY1 A;  1E1K A;  4E8G A;  2XVH A;  1FIQ B;  3R0U A;  2C7G A;  5IQ1 A;  3UKQ A;  3BI2 A;  1ZX9 A;  3HPF A;  1VG9 A;  2W3S A;  3H70 A;  3SQS A;  2XDO A;  3L8K A;  4XWZ A;  4HCD A;  3EKG A;  3P3B A;  3LZW A;  4H4Z A;  2V61 A;  2GEW A;  1CJ3 A;  3R0K A;  1EBH A;  2WEU A;  3VR9 A;  3EPT A;  3CND A;  1Z6L A;  4K1W A;  2C70 A;  3GC2 A;  2BCP A;  3KVE A;  3S61 A;  3GWF A;  3PK7 A;  4YTM A;  3FJ4 A;  2BK5 A;  1F8S A;  1GV4 A;  1TE6 A;  1TZZ A;  4LA1 A;  1M64 A;  2QJM A;  3URH A;  4X4J A;  3N4F A;  2WOW A;  3TJI A;  2XH0 A;  4H2N A;  5EB4 A;  2CUL A;  4TLZ A;  3UJF A;  5CQF A;  4J34 A;  1XAN A;  3T14 A;  4IA5 A;  2C73 A;  2XFO A;  2C4C A;  4NNJ A;  2HNE A;  3ATR A;  4A5L A;  3AD9 B;  4MKS A;  3SFD A;  1V59 A;  5EU9 A;  3V4B A;  3NRN A;  3FCP A;  3ES7 A;  4IL0 A;  4ADW A;  3GMB A;  3V3N A;  2RGO A;  3UGV A;  2MUC A;  4GDE A;  2WP5 A;  3T2Z A;  2DW7 A;  4DSG A;  3HZL A;  5G5G B;  2QCU A;  5HY5 A;  3GD4 A;  3AYJ A;  3DA1 A;  1Y56 A;  1QO8 A;  2WPE A;  4C74 A;  4FI4 A;  2YR6 A;  3LJP A;  1NEK A;  1H83 A;  3UOX A;  2A89 A;  3NH3 X;  1E9I A;  4D04 A;  3HRD C;  1SJA A;  4EQW A;  5EOW A;  4TVY A;  1TKK A;  2EQ8 A;  3ADA B;  4USR A;  2XYO A;  3V3W A;  3IHM A;  3NYC A;  3D1C A;  3BHF A;  1ELI A;  2HZG A;  4CCR A;  4FK1 C;  2OZ3 A;  4ROP A;  4IT1 A;  4KWS A;  4OCG A;  3I3L A;  3NXL A;  2EQ9 A;  1F3P A;  1EL9 A;  2C64 A;  4CCQ A;  3CPH G;  2GF3 A;  2O9Z A;  2AL2 B;  4J2W A;  4EIP A;  1GXF A;  1DTN A;  2XVF A;  5U25 A;  1RVK A;  3PFR A;  2QDE A;  3TWB A;  4J57 A;  3JW7 A;  4HB9 A;  4U8L A;  5ER0 A;  1JPM A;  4BJZ A;  1X2H A;  1Q1R A;  1B4V A;  1B8S A;  2C76 A;  4U8J A;  4ZCW A;  1UKV G;  3CXO A;  3SZW A;  2OG9 A;  3UKK A;  1ZK7 A;  4OPU A;  3CNT A;  2W54 A;  2GMJ A;  3TOY A;  2EQ7 A;  1LPF A;  1F9C A;  3ZLH A;  1E7P A;  3R9U A;  2CVJ A;  5EBK A;  2GR0 A;  2YWL A;  3SN4 A;  3ENL A;  2BC0 A;  3C96 A;  1Q1W A;  4OPG A;  3STP A;  1BZL A;  4YTN A;  1CC2 A;  3QKE A;  2C72 A;  4KPR A;  4JN7 A;  5KXJ A;  2B9W A;  2BAC A;  4H4S A;  3RHA A;  4IVM B;  1VDC A;  4M0X A;  3NS1 B;  1XPY A;  3ITJ A;  2WOI A;  3RNM A;  4G7F A;  3NNE A;  3SN0 A;  3DJE A;  4G9K A;  3F8P A;  1ZOY A;  2BCG G;  3T8Q A;  3OP2 A;  1ZDL A;  3RCY A;  1IYX A;  2JB3 A;  4BK3 A;  1AOG A;  3RO6 A;  1JU2 A;  3UXL A;  2Y6Q A;  3R1Z A;  6ENL A;  1IUX A;  3U9I A;  1KNR A;  3DDM A;  1KCZ A;  4C77 A;  3DJG X;  4U8O A;  1PJ7 A;  3P4S A;  5KOW A;  3AYI A;  2GV8 A; 
#chains in the Genus database with same CATH homology
 1LTX R;  2C75 A;  3EAN A;  1TDO A;  2QA1 A;  4DNA A;  2BC1 A;  3KU9 A;  1S3B A;  2X8G A;  1GRG A;  4N9X A;  1GRA A;  2YLT A;  3UKH A;  1FEA A;  1GT8 A;  3WE0 A;  4UDQ A;  4HA6 A;  4G6G A;  2R45 A;  3UKP A;  2FJE A;  1PJ5 A;  1S2Y A;  2H89 A;  3NYF A;  3UCL A;  4AT0 A;  2DKH A;  4Z2T A;  1EL5 A;  1TDF A;  4H7U A;  4OPC A;  2FJB A;  4YSY A;  2RGJ A;  4OPD A;  2WHD A;  5GSN A;  2YLX A;  1PXB A;  2PHH A;  4B68 A;  3IF9 A;  2UZZ A;  2VRL A;  5JCM A;  2RAB A;  2B7S A;  2OA1 A;  1KSS A;  3AED A;  3UOV A;  4YWO A;  4AOS A;  1NG3 A;  4B67 A;  4GCM A;  2QAE A;  3QSE A;  2ZBW A;  4LU6 A;  4K7Z A;  4YKG A;  2XVJ A;  1DOE A;  3NK2 X;  1ZKQ A;  4NTD A;  2BS3 A;  3F8D A;  4J31 A;  2B9Y A;  2XLP A;  3C4N A;  4TM4 A;  2BA9 A;  3FG2 P;  3D8X A;  1JRY A;  1Y56 B;  1VQW A;  2B76 A;  2XVE A;  4GR1 A;  3NYE A;  3GSI A;  3IHG A;  3AEE A;  1DXL A;  3ICT A;  1FCD A;  1GTH A;  2WET A;  4Y4N A;  1ZMC A;  3DGH A;  1NHR A;  2VQ7 A;  4FX9 A;  1BGJ A;  5BVA A;  1S3E A;  4NEV A;  4K22 A;  2YG4 A;  3RP8 A;  1DJQ A;  2AR8 A;  4GF7 A;  4YKF A;  3UOZ A;  2XCG A;  1LQT A;  4YSX A;  4U2L A;  1F8R A;  2ZZ0 A;  1PBD A;  2WES A;  3L1R A;  1S7M A;  1E6E A;  4K5R A;  2WOV A;  4Z24 A;  3OC4 A;  1PBF A;  3NK0 X;  4EM3 A;  2R0P A;  2GAH B;  3ICR A;  4ICY A;  3IWA A;  3AE7 A;  3JSK A;  2YR5 A;  4Z2R A;  1DJN A;  1XDI A;  3GYX A;  3C4A A;  4EQR A;  1DOB A;  1D7L A;  3UTG A;  1PXC A;  1H6V A;  3QSS A;  2CFY A;  2BAB A;  4OVI A;  3NGC X;  3BI4 A;  4TM0 A;  2VVL G;  1K4Q A;  2GRT A;  4A9W A;  3LXD A;  4D03 A;  2XFU A;  3Q9T A;  3AE3 A;  5JCI A;  4C3Y A;  2EQ6 A;  1KFY A;  2BXS A;  3CGD A;  4IV9 A;  2YG3 A;  2V3B A;  1MOK A;  3M13 A;  3CPJ G;  5KOX A;  2X99 A;  3SQP A;  5CKU A;  4H4U A;  4EMJ A;  1GRF A;  3CGC A;  4ECH A;  3G5Q A;  3D9X A;  1GRE A;  1H2I A;  4LII A;  2GVC A;  3T0K A;  3T2K A;  3DME A;  2YLW A;  3AE1 A;  3BNM A;  5M10 A;  4JNQ A;  3GDP A;  3AEA A;  1JNR A;  1F6M A;  4EMW A;  2HQM A;  1NEN A;  1S2Q A;  2FBW A;  4H2P A;  3OZ2 A;  4B66 A;  1QLB A;  2B9X A;  3EF6 A;  2GQF A;  4Z26 A;  3BI5 A;  2GQW A;  3SZ0 A;  1IUU A;  4KX6 A;  1TDK A;  1N4W A;  3SGL A;  4A6N B;  3RP6 A;  2GAG B;  3SZF A;  3UTH A;  3AD7 B;  2GR3 A;  5TR3 A;  1EBD A;  2ZZB A;  1CC6 A;  3K7Q X;  4JY2 A;  4U8I A;  4NTE A;  5J60 A;  1B5Q A;  2I0Z A;  3KLJ A;  4NZH A;  4YSH A;  1NAA A;  3AE9 A;  3BNU A;  3UTF A;  3VRA A;  3G5S A;  2ZZC A;  1GRT A;  2BK3 A;  2OLO A;  4O5U A;  1PXA A;  1VRQ B;  3AEG A;  3LOV A;  4GRT A;  1E1K A;  4GUV A;  1IUT A;  2XVH A;  1H86 A;  1GES A;  2R4E A;  2C7G A;  4U8K A;  3NTA A;  2YG7 A;  3CN8 A;  5IQ1 A;  3GRS A;  3UKQ A;  3BI2 A;  5C2T A;  1ZX9 A;  3AXB A;  2XFQ A;  1TDN A;  3NN0 X;  1VG9 A;  2PYX A;  4IVO B;  4BV6 A;  4H4W A;  1CJ4 A;  2XDO A;  2WDV A;  2WP6 A;  3L8K A;  4USQ A;  3FIM B;  4XWZ A;  2YQU A;  1LV0 A;  4H4P A;  4RG3 A;  2XLU A;  4AP1 A;  2X50 A;  4CRT A;  3LZW A;  4H4Q A;  2XFP A;  4A65 A;  2A87 A;  4H4Z A;  2V61 A;  1L9C A;  1MXT A;  2GEW A;  1NDA A;  1CJ3 A;  2C67 A;  3CIR A;  2Z5X A;  4GAV A;  2Q6U A;  2ARD A;  3S5W A;  2YR4 A;  4Z44 A;  2YM1 A;  1GRH A;  2WEU A;  3KD9 A;  4EQS A;  1KSU A;  3VR9 A;  3CTY A;  2YM2 A;  1YKJ A;  3B6D A;  4BJY A;  2JAE A;  2YG6 A;  3CND A;  3EPT A;  4H4V A;  1N4U A;  1Z6L A;  2WS3 A;  3VR8 A;  2C70 A;  4X9M A;  5LV9 A;  3NHO X;  2BCP A;  1YQ3 A;  2R4J A;  3KVE A;  3PO7 A;  3S61 A;  3GWF A;  3P4R A;  4CNK A;  2YLS A;  1GND A;  4YTM A;  4PAA A;  1EL8 A;  2BYB A;  2Q7V A;  3SFE A;  3VQR A;  1NHP A;  1YY5 A;  2BK5 A;  2VOU A;  2JB2 A;  4U8N A;  1F8S A;  2E4G A;  2YVJ A;  3ABV A;  1CL0 A;  1JRX A;  4GDP A;  1L9D A;  1GV4 A;  2Q0K A;  3AEF A;  4U2T A;  4LA1 A;  1O5W A;  5KVH A;  3P4Q A;  1H84 A;  1M64 A;  1HYU A;  2X8C A;  2BS4 A;  2VZ2 A;  2X3N A;  4GAP A;  4H2R A;  3V76 A;  4CBQ A;  4DSH A;  5KNL A;  5FS7 A;  3BHK A;  3P1W A;  3SX6 A;  5JCN A;  2WPC A;  3CNJ A;  1K0I A;  3URH A;  1D4D A;  3NLC A;  4X4J A;  4II3 A;  1KDG A;  5KWF A;  5KRQ A;  2WOW A;  4K5S A;  1K0L A;  1RP0 A;  3CPI G;  5BUL A;  4H2N A;  5EB4 A;  2B7R A;  4I58 A;  2CUL A;  4TLZ A;  4U8P A;  5CQF A;  4J34 A;  3PG6 A;  1XAN A;  2IVD A;  3T14 A;  1BWC A;  3SY4 A;  1TYT A;  3NK1 X;  4IA5 A;  4UDP A;  1ZP0 A;  1K0J A;  2AQJ A;  3SM8 A;  3UKL A;  2C73 A;  5KMR A;  1OJ9 A;  2WQY A;  2C4C A;  2XFO A;  5DBJ A;  4NNJ A;  2VVL A;  4JY3 A;  1F8W A;  3FMW A;  1H7X A;  3ISH A;  5L46 A;  2ACZ A;  3ATR A;  4II2 A;  4A5L A;  2XLT A;  1Q9I A;  1KN0 A;  2BK4 A;  3AD9 B;  1VG0 A;  2E5V A;  2BS2 A;  3SFD A;  4MJW A;  3DK8 A;  3QVP A;  1V59 A;  1EL7 A;  1BKW A;  1IUW A;  3AD8 B;  3KPK A;  1OJT A;  2W0H A;  1SEZ A;  2WDQ A;  3NN6 X;  3NRN A;  3ATQ A;  1JRZ A;  1D4C A;  3K7T A;  4AOX A;  4BK2 A;  3ALL A;  4K8D A;  4ADW A;  2X8H A;  1ZMD A;  3HYV A;  1GTE A;  2FJD A;  1GRB A;  3GMB A;  1KF6 A;  3QSM A;  3AWI A;  3RP7 A;  4B65 A;  4FDC B;  4ZN0 A;  4DGK A;  3HYW A;  5KMS A;  1TRB A;  3V3N A;  2RGO A;  3GRT A;  3SZC A;  3II4 A;  4CNJ A;  4GDE A;  2WP5 A;  3DK9 A;  3T2Z A;  4DSG A;  3B3R A;  3GWD A;  4M52 A;  1PBC A;  3HZL A;  3UOY A;  4Y4M A;  1H7W A;  2RGH A;  3L5O A;  1RYI A;  2OAM A;  2QCU A;  3KKJ A;  1H81 A;  2JKC A;  3NIX A;  4B69 A;  4EIQ A;  5HY5 A;  3GD4 A;  3AYJ A;  3DA1 A;  1E39 A;  4UP3 A;  3LAD A;  1PBE A;  1P2E A;  1Y56 A;  2WDR A;  1QO8 A;  1P2H A;  1ONF A;  2NVK X;  2WPE A;  5FMH A;  4C74 A;  2WP9 A;  3PS9 A;  4APN A;  2YR6 A;  3LJP A;  1NEK A;  1H83 A;  2OLN A;  3UOX A;  2A89 A;  2WU5 A;  1BF3 A;  3AE8 A;  4G73 A;  5EB5 A;  1GSN A;  3NH3 X;  4D04 A;  3ALM A;  1FEB A;  5JCK A;  4Z2U A;  4FK1 A;  4EQW A;  2YVF A;  1PJ6 A;  3UP4 A;  1M6I A;  1IJH A;  5EOW A;  2XLR A;  3KA7 A;  3LB8 A;  3NTD A;  4OPT A;  2EQ8 A;  2JK6 A;  2GH5 A;  4CY8 A;  4CY6 A;  2XFN A;  2CDU A;  4H4T A;  4EQX A;  2YG5 A;  3ADA B;  3K30 A;  4USR A;  3AE5 A;  2XYO A;  3IHM A;  4U8M A;  3NYC A;  3D1C A;  3BHF A;  4JQ9 A;  1ELI A;  3VRB A;  4H4Y A;  4O5Q A;  3T2Y A;  4C3X A;  1IUV A;  4CCR A;  4FK1 C;  1COY A;  4B64 A;  5FS6 A;  3DK4 A;  2OAL A;  3GMC A;  3PVC A;  2C3C A;  2BRA A;  3GYJ A;  1CJC A;  4OCG A;  2A8X A;  2V3A A;  3I3L A;  3M12 A;  4Z43 A;  4PAB A;  3O0H A;  2YLR A;  4B1B A;  1LVL A;  4J36 A;  1MO9 A;  5JRB A;  1XHC A;  2XVI A;  3AE6 A;  3COX A;  2EQ9 A;  2R0C A;  4H50 A;  4JN9 A;  3FPZ A;  3LZX A;  1F3P A;  2VVM A;  1D5T A;  1EL9 A;  2C64 A;  1B37 A;  1PHH A;  3Q6J A;  1FOH A;  4CCQ A;  4RSL A;  3CPH G;  5FS9 A;  3E1T A;  4A7A A;  1H82 A;  1L9E A;  1CJ2 A;  2GF3 A;  2O9Z A;  1CBO A;  3UP5 A;  4J2W A;  1E1L A;  2GR1 A;  4EIP A;  1N4V A;  1FEC A;  1GXF A;  3DH9 A;  1E1N A;  1ZY8 A;  4H2Q A;  2XVF A;  2E1M A;  4G6H A;  4A6N A;  5U25 A;  3AYL A;  4YT0 A;  2VQB A;  1JOA A;  3CGE A;  4J57 A;  4EM4 A;  4A79 A;  1L0V A;  1XPQ A;  4UDR A;  5JCL A;  1JEH A;  5IQ4 A;  5BRT A;  4HB9 A;  4G74 A;  4U8L A;  3T31 A;  4BK1 A;  1OJA A;  1GAL A;  4AT2 A;  1OJC A;  5HYM A;  5U1O A;  5ER0 A;  4YSZ A;  1OJD A;  4YTP A;  1TYP A;  1BGN A;  1NPX A;  4BJZ A;  1B4V A;  1Q1R A;  1B8S A;  1D4E A;  1NG4 A;  2WBA A;  1LQU A;  2C76 A;  3GDN A;  3VRD B;  2Z5Y A;  4U8J A;  1LJ1 A;  2JBV A;  1RSG A;  2TPR A;  1UKV G;  2R46 A;  3UTE A;  3ZYX A;  3SZW A;  5GRT A;  3UKK A;  4I59 A;  1ZK7 A;  1IUS A;  1PBB A;  1TDE A;  4EMI A;  4K2X A;  4OPU A;  2NPX A;  3CNT A;  4NTC A;  3UKF A;  2GMJ A;  4JDR A;  1YQZ A;  2EQ7 A;  3CNP A;  3ICS A;  1LPF A;  5M0Z A;  2GMH A;  1FL2 A;  1PDH A;  2AAQ A;  1E7P A;  1D7Y A;  1E1M A;  3R9U A;  2CVJ A;  2V6O A;  1NHQ A;  2GB0 A;  4E0V A;  4U2S A;  2GR2 A;  4YXD A;  5EBK A;  3AB1 A;  3EAO A;  4H4X A;  2V60 A;  2V5Z A;  2YVG A;  2GR0 A;  5HXI A;  4J33 A;  2YWL A;  4H4R A;  2BXR A;  1KNP A;  3KPF A;  2BC0 A;  2WU2 A;  1Q1W A;  3AEB A;  3C96 A;  3DJJ A;  4OPG A;  3QFB A;  4TM1 A;  1X31 B;  1PN0 A;  4WCT A;  1BZL A;  2VRM A;  4YTN A;  3DGZ A;  1CC2 A;  5KMP A;  2FJA A;  2C65 A;  3NKS A;  3H4K A;  2J3N A;  2APG A;  2TMD A;  3F8R A;  3DJD A;  2C72 A;  2IVE A;  5IPY A;  4Y4L A;  4KPR A;  3AE2 A;  4NWZ A;  2F5Z A;  3T37 A;  4REK A;  3ZDN A;  3CMM A;  2BRY A;  5KXJ A;  1DOD A;  1O95 A;  4P9S A;  2C66 A;  2B9W A;  4TLX A;  2BAC A;  4H4S A;  4OPL A;  5KVI A;  1DOC A;  2Y6R A;  4RG4 A;  4TM3 A;  4IVM B;  2QA2 A;  3M0O A;  5HHF A;  1VDC A;  4XXG A;  4ZCD A;  1ZOV A;  2WPF A;  2R0G A;  3ITJ A;  2WOI A;  3RNM A;  4C5O A;  1PS9 A;  3H8L A;  3NNE A;  3QVR A;  1CC4 A;  3DJE A;  4JNA A;  4XWR A;  4IA6 A;  4G9K A;  1GET A;  3F8P A;  2Q0L A;  3P9U A;  3UKA A;  3GYI A;  2YLZ A;  3V3O A;  4B63 A;  3RED A;  1ZOY A;  5FS8 A;  3SYI A;  2BCG G;  3HYX A;  1GOS A;  1JNZ A;  1ZDL A;  1DNC A;  3AE4 A;  3QFA A;  3NT6 A;  3SXI A;  4X9N A;  1NHS A;  3IC9 A;  3G5R A;  3K7M X;  2H88 A;  1N1P A;  1GER A;  2JB3 A;  4BK3 A;  4ZCC A;  3H8I A;  1AOG A;  2IID A;  5C3J A;  3QJ4 A;  1JU2 A;  1CF3 A;  3AEC A;  3RHA A;  3GD3 A;  4BUR A;  2R9Z A;  2JB1 A;  2Y6Q A;  5J7X A;  4OPI A;  1IUX A;  2C3D A;  1KNR A;  2XLS A;  3ALJ A;  1GEU A;  3P4P A;  1W4X A;  4C77 A;  1O94 A;  2DKI A;  5U63 A;  4Z25 A;  3DJG X;  1YQ4 A;  4J56 A;  1REO A;  4U8O A;  2YAU A;  1GPE A;  1QJD A;  1PJ7 A;  3P4S A;  3I6D A;  3FBS A;  5KOW A;  1CHU A;  4WX1 A;  4AP3 A;  5BUK A;  3AYI A;  3NG7 X;  3CGB A;  1Y0P A;  3CNS A;  5KMQ A;  4NEW A;  4A99 A;  2GV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...