3DH9A

Crystal structure of drosophila thioredoxin reductase, wild-type
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
482
structure length
482
Chain Sequence
QGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 1
publication title Crystal Structure of Drosophila Thioredoxin Reductase, wild-type
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 153
structure length 482
sequence length 482
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3dh9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dh9A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dh9A02
1YQZA 4X9NA 4H7UA 3EAOA 1TYPA 1K0JA 1H84A 2C76A 1FOHA 3KKJA 3GRSA 1B8SA 3CGEA 2X3NA 4BK3A 3UKLA 4Z2UA 3JSKA 2JBVA 1NHRA 3QVPA 2B9XA 2J3NA 1B5QA 1GOSA 3T37A 2R4JA 5EOWA 1OJAA 1S3EA 4BJYA 1GREA 2V6OA 2V61A 3RHAA 4CBQA 1LQUA 3D8XA 2WU2A 1ZOVA 4OPDA 1ELIA 3KD9A 2YVGA 1YQ4A 3BNUA 3RP7A 3VRBA 2XVJA 4TM4A 1P2EA 2RGOA 1S2YA 1NG4A 3PVCA 5KOXA 5HXIA 1F8SA 2ZZCA 1EL8A 2BK5A 4NTCA 1LPFA 1PS9A 3GDNA 3UKKA 4U2TA 4AOXA 3ALLA 4B67A 3L8KA 3UOZA 5CKUA 3PO7A 2VVLG 4U8NA 1Y56B 1KNRA 2XLTA 3NK0X 2C67A 2RGJA 3NYFA 4B66A 4Z2RA 4CNJA 2CFYA 1YKJA 3OC4A 1D7YA 1F8RA 2YG3A 3GWDA 1COYA 4U8KA 3LXDA 1ZX9A 3AE2A 3NH3X 2Q7VA 2C66A 3C4NA 2YG4A 1D7LA 4CCQA 2VQBA 2C73A 3UTGA 3CNSA 3CGCA 2X8CA 4YSHA 3II4A 3AEEA 1GEUA 1VRQB 3F8PA 4XWRA 3SFEA 4TLZA 4Z25A 1CJ3A 1EL5A 1L9EA 3DJEA 4A6NB 1E7PA 4H4SA 1DOEA 5FS9A 3S5WA 4B65A 3URHA 2AR8A 4KPRA 1IUUA 3LOVA 1S2QA 4ZN0A 2BXSA 2JKCA 2QA1A 2YLWA 4H4PA 1OJCA 3V3OA 2JB1A 2WETA 4CCRA 4A79A 1FECA 2C7GA 4J2WA 4A9WA 1OJ9A 3F8DA 4CY8A 5TR3A 1TDNA 4K8DA 2XLSA 3AXBA 4O5UA 4ICYA 2E1MA 2YG7A 1X31B 1CC4A 2ARDA 1H7XA 4EQWA 3LADA 1KF6A 1CHUA 3AYLA 3ATQA 2R0GA 3AE5A 3NGCX 4GF7A 2UZZA 2GVCA 4NEVA 1MOKA 3B3RA 4K5RA 4YXDA 1S3BA 2B7RA 4U8PA 1CJCA 4K5SA 1D5TA 3AE6A 2B9WA 1TDOA 1GERA 4NEWA 4K2XA 1LQTA 4MJWA 5KVIA 4ZCCA 4TLXA 3Q9TA 1PJ5A 4C74A 1RYIA 3AECA 5JCNA 4P9SA 3C96A 3AB1A 3UOXA 1Q1RA 3K30A 2CULA 2GQFA 4B68A 4JNAA 4B69A 5LV9A 3AE3A 4UDRA 1DJQA 1JNRA 3AEDA 2OALA 4AT0A 4H50A 3GYJA 4WX1A 3CNPA 1YY5A 1ZOYA 1JRXA 3UKFA 2NPXA 1RP0A 1BKWA 2BCPA 1E6EA 3M12A 2B9YA 2QCUA 3UKAA 2VQ7A 2E4GA 1GRFA 1PBFA 3DGHA 2YVJA 1CBOA 1EBDA 2A8XA 2FJEA 5ER0A 4GUVA 4EQXA 4U8IA 4IVMB 4YKGA 3QJ4A 1YQ3A 5KXJA 1BGJA 5C2TA 1O5WA 4H4VA 1PBEA 1Q1WA 4JN9A 1H81A 2X99A 3DA1A 3LZXA 4EM3A 4JQ9A 3CNDA 5KVHA 4N9XA 4XWZA 4H4RA 1LJ1A 1QJDA 2WPCA 1NDAA 2AQJA 2C65A 4U2LA 1JEHA 3KPFA 1JNZA 3SM8A 1CJ2A 2A89A 3FPZA 4D04A 1OJDA 1B4VA 4Z26A 1H83A 4JY3A 4OPIA 1NEKA 2GQWA 4EQRA 3LB8A 1IUSA 4U8OA 5KRQA 4OPTA 3GSIA 2OLNA 3EPTA 2O9ZA 4H4YA 4J31A 2WPFA 1VDCA 2WQYA 4IV9A 5HYMA 4LU6A 3UOVA 1GRHA 2QA2A 2V60A 3AYJA 1PJ7A 4IVOB 4TM1A 1IUVA 2GMJA 3NNEA 4B63A 4H4QA 3RP8A 4E0VA 1M64A 4DGKA 2YLSA 4YTPA 1H86A 5L46A 3DJJA 3QSSA 2BC0A 4H2NA 4B64A 3CNTA 1GT8A 3BI4A 1VQWA 3C4AA 5U63A 1VG9A 4XXGA 3SFDA 4H4ZA 1SEZA 2FJAA 3NHOX 2VRMA 1UKVG 3ATRA 1PXCA 5C3JA 2BS4A 4U8LA 4FK1C 1ZMCA 2C3CA 3NK1X 3DK4A 5GSNA 4Z24A 3CPHG 4AT2A 1DOCA 4H2RA 4UP3A 2IVEA 4ZCDA 3CPJG 4J33A 2C72A 1BGNA 5HY5A 1JU2A 3P4SA 5GRTA 2EQ8A 5EBKA 1O95A 4D03A 1NHSA 3Q6JA 2TPRA 1PN0A 2JB3A 3CIRA 2RABA 3AEBA 3IHGA 5FS7A 4GR1A 2XVHA 4REKA 3AD9B 2XFNA 4YSYA 1ZY8A 2XLUA 3NK2X 4H4WA 5J7XA 3AE4A 2B7SA 3M0OA 1NHQA 4GRTA 2WBAA 5U25A 1N1PA 2YLTA 1GESA 1CL0A 3P4RA 2ZBWA 3RP6A 2Z5XA 2EQ7A 4CY6A 1IUWA 3AD8B 2EQ6A 4CRTA 1Q9IA 2BS3A 3IC9A 2VVLA 1GRAA 3NN0X 2CVJA 3BNMA 5U1OA 3CTYA 1ZKQA 2WOVA 4GCMA 2V3BA 1B37A 4HB9A 1L0VA 3KLJA 5EB5A 4YT0A 5BRTA 1FCDA 4OCGA 2R0PA 3QFBA 3IWAA 1PJ6A 4JNQA 2QAEA 2Q0KA 1GXFA 1GETA 4GDPA 2YVFA 4RG3A 1MXTA 3AE7A 4LA1A 2YQUA 1TYTA 4AP1A 2YG6A 3BI2A 3UP5A 3VRAA 2WESA 2WDQA 3GDPA 3ISHA 1NPXA 1CC6A 3NG7X 1ZMDA 4EIQA 3UTFA 1BZLA 1L9CA 2JB2A 1GTEA 1EL7A 1PXBA 1RSGA 5FMHA 4NTDA 2OLOA 4YTMA 2VZ2A 4UDPA 4YTNA 3I3LA 3S61A 3NIXA 5JCKA 1L9DA 4IA5A 1GSNA 4BURA 1KSUA 3NT6A 2R46A 3UKQA 3K7TA 2ZZ0A 1CC2A 2R4EA 4Y4MA 3EF6A 2WOIA 3ABVA 3UKPA 3GWFA 3P9UA 4U2SA 5JCLA 3GMCA 2AAQA 1DOBA 1N4VA 1TDKA 1HYUA 3G5RA 1D4CA 2EQ9A 3I6DA 5IPYA 4ADWA 4NTEA 1K4QA 1E1LA 2WP6A 3CN8A 1QLBA 3IF9A 2BXRA 3FBSA 4JY2A 4ECHA 2Q0LA 3CNJA 2Y6RA 2C75A 5J60A 1K0IA 4B1BA 2BABA 1LTXR 4APNA 4M52A 3D1CA 4NZHA 2V5ZA 1MO9A 3PS9A 2FJBA 2XVEA 1GRGA 3OZ2A 2BC1A 4JDRA 3P4QA 4TM0A 1F3PA 2BA9A 2OA1A 3ALMA 4OPLA 2WDRA 3M13A 5JCMA 1E1MA 3KVEA 4USRA 3LJPA 1PBDA 1GRBA 2HQMA 1DXLA 1KNPA 2XFOA 4J57A 2GR2A 2GEWA 1PDHA 3SQPA 3NTDA 1N4WA 4H4UA 3NKSA 4C5OA 2YG5A 1ZK7A 1DODA 4PAAA 4OPGA 3P1WA 2XCGA 3GMBA 4FX9A 4EMWA 2JK6A 5M10A 4X9MA 1GRTA 1JRYA 3AEAA 2XLPA 2BK3A 3LZWA 3QSMA 1E1NA 3H8IA 2VRLA 4RSLA 2DKIA 4YSZA 2CDUA 1KDGA 2XFUA 2XVFA 1FEBA 2WPEA 3AE8A 2X8HA 4C3XA 4Z44A 1JRZA 1GPEA 2BS2A 2GV8A 3QFAA 2GF3A 4YWOA 3ZYXA 2WOWA 2I0ZA 1IJHA 2YWLA 1JOAA 1CJ4A 1D4EA 4X4JA 5BULA 4H4TA 1XPQA 2PHHA 2ZZBA 4BK2A 2C3DA 3NTAA 2GAHB 3DK9A 4K7ZA 1W4XA 2GB0A 5BUKA 3AWIA 4H2QA 3NYEA 1BF3A 3ZDNA 2YR5A 1GALA 1PBCA 3K7MX 4A99A 3NRNA 4RG4A 5KOWA 4DNAA 3BHKA 1XHCA 2XFPA 3QSEA 2OAMA 4KX6A 2BK4A 2R9ZA 3WE0A 4A65A 2B76A 3FMWA 1BWCA 4U8JA 3V76A 1KFYA 3G5QA 3GYIA 3NYCA 2JAEA 4U8MA 3VR8A 4J56A 4O5QA 4A7AA 1H82A 4Z2TA 1E1KA 3GD3A 3K7QX 4OVIA 2GMHA 1CF3A 2WDVA 2F5ZA 2IVDA 4A5LA 1AOGA 1DNCA 1ZP0A 3G5SA 2W0HA 2YLXA 4J36A 3GD4A 3R9UA 4EMJA 1PHHA 3ICTA 4UDQA 4C3YA 3DH9A 2VOUA 3SGLA 3DGZA 4BK1A 1N4UA 3FG2P 3ICSA 2A87A 1O94A 3HZLA 3EANA 3ITJA 2V3AA 1GV4A 5IQ4A 5JCIA 2WEUA 2YLZA 1V59A 3DMEA 2GR1A 4I58A 5FS8A 3KU9A 2R45A 3AEFA 5KWFA 3AYIA 2WU5A 3BI5A 2GRTA 4IA6A 3VQRA 3UCLA 3O0HA 1NHPA 1OJTA 3QVRA 4J34A 2XFQA 3B6DA 3IHMA 4BJZA 4I59A 1GTHA 4AOSA 3V3NA 2GH5A 3UP4A 1Y0PA 4FK1A 2BCGG 2PYXA 2X50A 2X8GA 1Z6LA 2WP5A 2FJDA 1LV0A 2E5VA 1IUXA 1QO8A 3P4PA 3CGDA 2WHDA 4H4XA 2R0CA 4GDEA 4EM4A 1REOA 2Y6QA 1TDEA 3ALJA 4OPUA 1VG0A 2YAUA 2BYBA 1F8WA 3NLCA 5M0ZA 4C77A 1XANA 1XDIA 2GR3A 2ACZA 1LVLA 4FDCB 1D4DA 2VVMA 1TDFA 1KSSA 3AE9A 2BACA 3ICRA 2XDOA 3KA7A 4YKFA 3VR9A 4Y4LA 4DSGA 2Z5YA 3NN6X 2YM2A 3H4KA 2GAGB 1Y56A 2IIDA 4Z43A 3AEGA 3GRTA 5HHFA 4LIIA 2RGHA 3CGBA 1H6VA 1K0LA 4WCTA 3L1RA 1GNDA 1FL2A 1ZDLA 2XLRA 1NAAA 4H2PA 5EB4A 5CQFA 2FBWA 3F8RA 4HA6A 1PXAA 2YLRA 1E39A 2C70A 4EQSA 2Q6UA 1PBBA 2YR6A 2WP9A 2YM1A 4EIPA 4Y4NA 2TMDA 3UKHA 1ONFA 1F6MA 5DBJA 3REDA 3UOYA 1H7WA 3UTEA 4A6NA 4AP3A 4BV6A 2H88A 1P2HA 1M6IA 2C64A 2NVKX 3RNMA 2XVIA 4TM3A 3VRDB 5FS6A 4DSHA 4YSXA 2DKHA 4EMIA 3UTHA 5BVAA 1TRBA 3DJGX 3E1TA 4OPCA 4CNKA 5IQ1A 2APGA 2XYOA 3AE1A 1DJNA 1EL9A 4USQA 1IUTA 3AD7B 3CPIG 2WS3A 4PABA 1NG3A 3FIMB 2H89A 4K22A 3DK8A 1FEAA 1NENA 3DJDA 2GR0A 3BHFA 3ADAB 3COXA 2YR4A 3H8LA
chains in the Genus database with same CATH superfamily
1YQZA 3EAOA 4TVWA 3KKJA 4FP1A 1EC9A 3JSKA 2J3NA 1B5QA 3T37A 4CBQA 4K8GA 1ELIA 2YVGA 3VC6A 1JROA 5KOXA 2ZZCA 2BK5A 4G7FA 4U2TA 3ALLA 3UJ2A 1SJDA 3L8KA 3PO7A 4U8NA 2W3SA 4CNJA 3QN3A 1D7YA 1KKOA 3LXDA 3BOXA 3V5FA 3C4NA 2YG4A 3STPA 2C73A 3UTGA 2HXUA 3RRAA 4XWRA 3SFEA 4Z25A 1CJ3A 2AL2A 4MMWA 3S5WA 1S2QA 2BXSA 1TZZA 2YLWA 4E4FA 1OJCA 2JB1A 2ZC8A 2WETA 4A79A 4CCRA 3PWGA 4CY8A 1TDNA 2BRAA 3DDMA 3TQPA 3VCCA 1CC4A 1SJBA 1KF6A 1CHUA 3OZYA 3OPSA 4HPNA 2PSNA 4YXDA 1R0MA 1CJCA 4TVYA 1D5TA 4H19A 2B9WA 4G74A 3SR6B 3NVWB 3A7UA 4P9SA 3TJ4A 3AB1A 3NVYB 1T3QC 4JNAA 3SBFA 3T4WA 3R0KA 3TTEA 1YY5A 1ZOYA 2PGWA 2ZADA 2B9YA 2QCUA 2VQ7A 3A7AA 1GRFA 3DGHA 1FHUA 1CBOA 2A8XA 1IYXA 3SN0A 3V3WA 3GC2A 1PBEA 3UXKA 4JQ9A 4XWZA 3QLDA 2QJJA 1QJDA 2C65A 1JNZA 2P8BA 2A89A 4D04A 1JPDX 2GQWA 5KRQA 3GSIA 3OW1A 2O9ZA 4IV9A 1GRHA 3PG6A 3NNEA 3B9JB 3QSSA 2BC0A 4B64A 3CNTA 3NVVB 4H4ZA 3NHOX 2BRYA 2OQYA 4U8LA 4FK1C 2IVEA 3CPJG 1JU2A 3P4SA 3SZWA 3U9IA 3CXBA 2RABA 3AEBA 5FS7A 4GR1A 4YSYA 2XLUA 3NZGA 2QGYA 1XS2A 3M0OA 1S7MA 4GRTA 3SYIA 4GGBA 3ZVIA 5U25A 2YLTA 1GESA 2Z5XA 2EQ7A 3UJEA 2E5AA 3AD8B 1VQZA 4CRTA 3BNMA 1ZKQA 2WOVA 3KLJA 4YT0A 2R0PA 4M6UA 2PP3A 3SZFA 4RG3A 1GETA 4LA1A 2YQUA 3UP5A 3OZMA 3GDPA 1JPMA 4II3A 4GIRA 1PXBA 1RSGA 1MNSA 2OLOA 4YTMA 3S61A 4K1WA 3NT6A 3UKQA 3K7TA 1CC2A 4U2SA 3GMCA 3ETRB 3G5RA 1D4CA 3H12A 3RITA 4NTEA 3CN8A 3IF9A 3FBSA 2Q0LA 3I4KA 4G8TA 4NZHA 2FJBA 2XVEA 4HNCA 3D47A 2GGIA 4OPLA 3HRDC 5JCMA 3ZVHB 1E1MA 3KVEA 3LJPA 1PBDA 2HQMA 4JN7A 2GR2A 2GEWA 1PDHA 3SQPA 4H4UA 1ZXIC 2XCGA 4FX9A 2JK6A 2BK3A 1N62C 1E1NA 3DG6A 3AE8A 2XVFA 4C3XA 1GPEA 2GV8A 4YWOA 3AMZA 1IJHA 1RVKA 4BK2A 2C3DA 1EC7A 3NTAA 3DK9A 2GB0A 5BUKA 3NYEA 1GALA 3JW7A 3NRNA 3ZLHA 4DWDA 4IP4A 1BWCA 2JAEA 4U8MA 3A7RA 2NQLA 3GD3A 3K7QX 4A5LA 2F5ZA 1AOGA 1ZP0A 4J36A 1PHHA 2GGGA 4UDQA 4C3YA 2MNRA 3SZ0A 3DH9A 3DGZA 3HPFA 3P3BA 3FG2P 3QKEA 3ITJA 2WEUA 2YLZA 2P88A 5FS8A 3AEFA 4IA6A 3O0HA 2OPJA 4K2SA 3QVRA 4J34A 2XFQA 4AOSA 2BCGG 2WP5A 1LV0A 2E5VA 1QO8A 4II2A 2Y6QA 3MQTA 1F9CA 5M0ZA 4C77A 1D4DA 3ICRA 3KA7A 2PP1A 3ENLA 3ES8A 4GGHA 2GAGB 2XH2A 1K0LA 1NAAA 4IP5A 3F8RA 2YLRA 1E39A 2XH4A 1N60C 2YR6A 2C4CA 3REDA 3UOYA 3UTEA 4A6NA 1KN0A 1P2HA 2QDDA 2OZTA 3R10A 4JHMA 2C64A 2NVKX 4YSXA 1PDZA 4OPCA 2APGA 2XYOA 3BSMA 4PABA 3FIMB 2H89A 3SQSA 3BHFA 3I6EA 3R11A 3MUCA 4G9KA 3QTPA 1K0JA 2C76A 2X3NA 4BK3A 1SJAA 3FXGA 1NELA 3RR1A 1GOSA 1GREA 2V6OA 3D8XA 2WU2A 5BOEA 3BNUA 3RP7A 1P2EA 2RGOA 1NG4A 3PWIA 4NTCA 2AKZA 3UOZA 5CKUA 1Y56B 1KNRA 3NK0X 1F8RA 3AM9A 4U8KA 1ZX9A 3AE2A 2OO6A 4FI4A 2C66A 1D7LA 2VQBA 2X8CA 1VRQB 3D46A 3R0UA 3DJEA 4HN8A 1E7PA 4B65A 2AR8A 3DG7A 7ENLA 2OFJA 2W55A 4J2WA 3F8DA 1P48A 2XLSA 2E1MA 1X31B 3LADA 1V97A 3P93A 1EC8A 4IL2A 4K5SA 3AE6A 4MJWA 1GERA 4NEWA 4K2XA 3V5CA 1PJ5A 4C74A 5JCNA 3C96A 1Q1RA 3K30A 2CULA 3RCYA 4B69A 1MDLA 4DXKA 1RP0A 1BKWA 2BCPA 3IK4A 1E6EA 2YVJA 5ER0A 1YQ3A 1BGJA 1O5WA 1Q1WA 4H83A 4N9XA 3R25A 3BJSA 4J3ZA 2AQJA 3KPFA 3K1GA 3SM8A 3FPZA 1OJDA 1B4VA 4Z26A 1H83A 1NEKA 4EQRA 2OQHA 3CAWA 3EPTA 4H4YA 2WPFA 3DGBA 4DN1A 4LU6A 5HYMA 2QA2A 3DFHA 1PJ7A 1IUVA 4E0VA 4YTPA 4DGKA 3N4EA 1GT8A 5U63A 1VG9A 3VA8A 4XXGA 4GMEA 1SEZA 2VRMA 1UKVG 2OLAA 5C3JA 2BS4A 2C3CA 3UJRA 5GSNA 1DOCA 4H2RA 4ZCDA 4J33A 2C72A 2GGHA 5GRTA 3Q45A 3DERA 2EQ8A 5EBKA 3FCPA 2TPRA 2JB3A 4REKA 4DX3A 1ZY8A 3NK2X 4HCLA 1NHQA 2WBAA 3P4RA 5FJRA 1GRAA 1FHVA 3CTYA 4HB9A 2QAEA 2Q0KA 1GXFA 2QVHA 3V4BA 2YG6A 3VRAA 1X2GA 3U4FA 2WESA 3NG7X 3UTFA 2VZ2A 4UDPA 4YTNA 5JCKA 1SJCA 4BURA 2ZZ0A 3EF6A 2WOIA 3GWFA 3P9UA 6ENLA 5JCLA 4IT1A 3I6DA 1K4QA 2WP6A 1QLBA 4ECHA 2BXRA 3Q4DA 3CNJA 1K0IA 4B1BA 1ELSA 3B97A 1GRGA 2BC1A 1F3PA 3MZNA 3TOYA 1DTNA 3R1ZA 1KNPA 4C5OA 4PAAA 3P1WA 1FFVC 2PODA 5M10A 3JZUA 3AEAA 2XLPA 3SJNA 4ENLA 3QSMA 4YSZA 5FJTA 4Z44A 2I0ZA 4X4JA 4H4TA 3AWIA 4H2QA 3ZDNA 1BF3A 3K7MX 4A99A 4DNAA 1XHCA 2XFPA 4KX6A 2B76A 4U8JA 4HCHA 3DESA 1H82A 4KPLA 4OVIA 4DYEA 3GD4A 3GO2A 3CXOA 4EMJA 2PGEA 2QQ6A 3ICSA 3HZLA 1GV4A 5IQ4A 2GR1A 3KU9A 2R45A 5KWFA 2WU5A 3VQRA 1MUCA 3CT2A 1GTHA 4H2HA 3UP4A 2PYXA 2X50A 2X8GA 3P4PA 1BKHA 4H4XA 2R0CA 4GDEA 5KMQA 1XANA 1ONEA 2VVMA 4E5TA 1TDFA 2XDOA 3VR9A 2YM2A 4X2PA 4Z43A 3GRTA 1H6VA 1H2IA 2E3TA 1FL2A 3L1RA 2OX4A 5CQFA 3KUMA 1PXAA 4EQSA 3T6CA 2WP9A 4EIPA 4Y4NA 3VDGA 3THUA 1ONFA 1F6MA 1H7WA 2W3RA 3GD6A 1N5XA 2XVIA 5FS6A 2DKHA 3UTHA 2XGZA 1TRBA 3CPIG 1STZA 1NENA 4G6GA 3GYXA 4H7UA 4H1ZA 1FOHA 3CGEA 3UKLA 4Z2UA 2JBVA 1S3EA 4BJYA 3VRBA 3CB3A 2FKPA 2XVJA 1PDYA 4M0XA 4TM4A 3NXLA 3S5SA 3PVCA 3T14A 5HXIA 1F8SA 5G5GB 1EL8A 2PS2A 4JN8A 1LPFA 1KKRA 3UKKA 4AOXA 4Z2RA 1N63C 3DFYA 2RGJA 1YKJA 3OC4A 2YG3A 1COYA 3EUB3 3NH3X 3ZLFA 1X2HA 3T0KA 3N6HA 3CNSA 4YSHA 3II4A 2GGEA 4TLZA 1EL5A 1WUEA 1L9EA 3CK5A 4H4SA 3URHA 3LOVA 1R6WA 2JKCA 2QA1A 3I6TA 4A9WA 1OJ9A 4O5UA 1H7XA 2FYMA 3MSYA 3ATQA 2GVCA 4NEVA 1MOKA 3B3RA 1EBGA 1S3BA 3SY4A 2B7RA 1TDOA 2QDEA 1LQTA 4ZCCA 5KVIA 1RYIA 3AECA 3T31A 1OEPA 1WUFA 4B68A 4UDRA 3UCDA 1DJQA 3AEDA 2OALA 3D9XA 3GYJA 4WX1A 3CNPA 1JRXA 3UKFA 2OKTA 4GYPA 3M12A 2XSXA 2E4GA 1VDVA 1PBFA 3MY9A 2QJMA 1EBDA 3CYJA 4GUVA 4U8IA 3VCNA 4YKGA 3QJ4A 4KWSA 1JCTA 4JN9A 2AL2B 1YEYA 3FYYA 4EM3A 5KVHA 3L5OA 1NDAA 4U2LA 1JEHA 1CJ2A 3VFCA 4JY3A 4OPIA 1IUSA 4U8OA 3LB8A 4OPTA 3UOVA 4IVOB 4TM1A 2XH0A 3H70A 4H4QA 3RP8A 4B63A 2GSHA 2YLSA 1H86A 2OZ8A 3FJ4A 3TWBA 3SFDA 2FJAA 4GFIA 3ATRA 4ZCWA 1PXCA 1ZMCA 4Z24A 3DK4A 2PU0A 3UJSA 3CPHG 1BGNA 4D03A 1NHSA 1PN0A 3ZVHA 3AD9B 5J7XA 1BQGA 2OG9A 3RP6A 1MRAA 2XH7A 4CY6A 1IUWA 4E4UA 2EQ6A 1Q9IA 1ECQA 3DIPA 3HYXA 2VVLA 3NN0X 5U1OA 3FV9A 5EU9A 4GCMA 3CMMA 5EB5A 3QFBA 4GDPA 2YVFA 2HNEA 3AE7A 3SN1A 4GYPC 4AP1A 4ZA0A 1L9CA 1GTEA 1EL7A 4KEMA 4NTDA 3P0WA 3I3LA 3NIXA 1L9DA 4IA5A 1GSNA 2R46A 2PP0A 1E9IA 2AAQA 1TDKA 1N4VA 1HYUA 4HNLA 2EQ9A 5IPYA 4ADWA 2AL1A 1E1LA 4JY2A 2Y6RA 4G6HA 5J60A 3D1CA 1MO9A 3PS9A 2P3ZA 3OZ2A 3TWAA 4JDRA 3P4QA 2WDRA 3M13A 4USRA 1DXLA 2RDXA 4MKSA 4J57A 3NTDA 3N4FA 1N4WA 3NKSA 1EBHA 1ZK7A 4A35A 4OPGA 4X9MA 1JRYA 4A3RA 3OTRA 2DKIA 4Z17A 4E8GA 2XFUA 1JRZA 5G5HB 2BS2A 2GF3A 3ZYXA 1JOAA 5BULA 2PHHA 1XPQA 4E6MA 2ZZBA 1PBCA 2O56A 4KT2A 5KOWA 3BHKA 3IJIA 3DEQA 3T9PA 2BK4A 2R9ZA 3FMWA 2PTXA 3G5QA 1XPYA 3GYIA 4J56A 4O5QA 2GMHA 2WDVA 2IVDA 4HYRA 2W0HA 2YLXA 3T2ZA 2PPGA 3SGLA 1N4UA 3R07C 3EANA 2V3AA 5JCIA 4I58A 1V59A 3IJQA 3AYIA 3BI5A 1NHPA 3TJIA 3UJFA 3B6DA 3IHMA 2GGJA 4BJZA 1Y0PA 4FK1A 1Z6LA 3CGDA 2WHDA 5KNLA 4EM4A 3NVZB 2PA6A 1TDEA 3ALJA 1F8WA 3NLCA 2GR3A 2ACZA 5IDZA 5KMSA 4A6GA 2BACA 4Y4LA 4DSGA 3H4KA 1RM6B 3OP2A 1Y56A 2IIDA 3AEGA 5HHFA 2RGHA 4WCTA 1GNDA 5EB4A 4HA6A 2Q6UA 1JRPA 3UKHA 4IZGA 4BV6A 1M6IA 4TM3A 4EMIA 4CNKA 1W6TA 1DJNA 4K22A 2GR0A 3ADAB 3COXA 2YR4A 3H8LA 4X9NA 1TYPA 1H84A 3GRSA 1B8SA 3EKGA 3QVPA 1NHRA 2B9XA 2R4JA 3TCSA 5EOWA 1OJAA 4Z1YA 2V61A 3RHAA 1LQUA 3HYWA 1ZOVA 4OPDA 3KD9A 1YQ4A 1S2YA 1TE6A 3ZLGA 1PS9A 3GDNA 3TW9A 4B67A 2VVLG 2XLTA 2C67A 3NYFA 4B66A 2CFYA 3GWDA 4GISA 5FJOA 1FFUC 5JRBA 3NO1A 2Q7VA 4CCQA 1JDFA 3CGCA 3AEEA 1GEUA 3F8PA 2DW7A 4MGGA 4A6NB 1DOEA 5FS9A 2CHRA 4KPRA 1IUUA 4ZN0A 1P43A 3JVAA 4H4PA 3V3OA 2ONEA 1FECA 1N61C 2C7GA 4F4RA 5TR3A 3SXIA 4K8DA 3AXBA 3VC5A 4ICYA 2YG7A 2ARDA 4EQWA 3AYLA 3NGCX 2R0GA 3AE5A 4GF7A 5ENLA 2UZZA 4K5RA 3NS1B 3RO6A 4U8PA 3IJLA 5FJUA 4TLXA 3Q9TA 2DW6A 4YWSA 3UOXA 2GQFA 3N6JA 5LV9A 3AE3A 1JNRA 4AT0A 4H50A 2NPXA 3UKAA 2FJEA 4EQXA 4IVMB 3HW2A 5KXJA 5C2TA 4H4VA 1H81A 2X99A 3DA1A 3LZXA 3CNDA 4H4RA 1LJ1A 2WPCA 2P0IA 2HXTA 2OLNA 4J31A 1VDCA 2WQYA 2V60A 3AYJA 3NRZB 2GMJA 3NFUA 1M64A 4G73A 5L46A 3UCCA 3DJJA 4H2NA 3BI4A 1VQWA 3C4AA 3S47A 5KMRA 3NK1X 4AT2A 4UP3A 3ES7A 5HY5A 1O95A 3Q6JA 1MDRA 3CIRA 3IHGA 2XVHA 1N5WC 2XFNA 4H4WA 3AE4A 2B7SA 3PK7A 1N1PA 3T2KA 1CL0A 2ZBWA 4NNJA 2BS3A 1FO4A 3IC9A 2CVJA 2HZGA 4GAPA 5BOFA 2V3BA 1B37A 1L0VA 3FVDA 5BRTA 1FCDA 4OCGA 3IWAA 1PJ6A 4JNQA 3EEZA 1FIQB 1MXTA 3SSZA 1TYTA 3BI2A 3DG3A 2WDQA 3ISHA 1NPXA 1CC6A 2GDQA 1ZMDA 4EIQA 3MWCA 1BZLA 3RGTA 2JB2A 2GL5A 5FMHA 3SZCA 1KSUA 3KPKA 2R4EA 4Y4MA 3ABVA 3UKPA 3GY1A 1L8PA 1DOBA 3H7VA 2PCEA 1KCZA 3T8QA 2POZA 2C75A 2BABA 1LTXR 4APNA 4M52A 2V5ZA 5FJPA 4TM0A 2BA9A 2OA1A 3ALMA 1SB3B 1GRBA 2XFOA 3UXLA 4IHCA 2YG5A 5J04A 1DODA 2I5QA 1NU5A 3GMBA 4EMWA 1GRTA 4ROPA 3SX6A 2PMQA 3LZWA 4HCDA 3H8IA 2VRLA 4RSLA 2OVLA 2CDUA 1KDGA 1FEBA 2WPEA 2X8HA 1WYGA 3QFAA 2WOWA 2YWLA 2QJNA 1CJ4A 1D4EA 2GAHB 4K7ZA 1W4XA 2YR5A 2PTWA 4RG4A 2W54A 4A65A 3QSEA 3WE0A 2OAMA 2MUCA 1KFYA 3V76A 4J1OA 3NYCA 1TKKA 3VR8A 4A7AA 4ZOHB 4NWZA 4Z2TA 1E1KA 1CF3A 1DNCA 3G5SA 3R9UA 3ICTA 2VOUA 4BK1A 2AKMA 2A87A 1O94A 3DMEA 2GRTA 3UCLA 2P8CA 3SN4A 1OJTA 4GAVA 4DHGA 4I59A 3V3NA 2GH5A 2FJDA 1IUXA 4EWJA 3HYVA 1REOA 4OPUA 1VG0A 2YAUA 2BYBA 2PTYA 1XDIA 1LVLA 4FDCB 1KSSA 2OZ3A 3AE9A 4YKFA 2Z5YA 3NN6X 3UGVA 4LIIA 3CGBA 1ZDLA 2XLRA 2PU1A 4H2PA 2FBWA 2C70A 2PTZA 1PBBA 2YM1A 3T2YA 2TMDA 5DBJA 3PFRA 3QPEA 4AP3A 2H88A 5KMPA 3RNMA 3H8AA 3AN1A 3VRDB 4DSHA 5BVAA 1KD0A 3DJGX 3E1TA 4IL0A 5IQ1A 3AE1A 1EL9A 4USQA 1IUTA 3AD7B 2WS3A 1NG3A 3DK8A 1FEAA 3DJDA 3MKCA
chains in the Genus database with same CATH topology
1YQZA 4X9NA 4H7UA 4G9KA 3EAOA 1TYPA 1K0JA 1H84A 2C76A 1FOHA 3KKJA 3GRSA 1B8SA 3CGEA 2X3NA 4BK3A 3UKLA 4Z2UA 3JSKA 2JBVA 1NHRA 3QVPA 2B9XA 2J3NA 1B5QA 1GOSA 3T37A 2R4JA 5EOWA 1OJAA 1S3EA 4BJYA 1GREA 2V6OA 2V61A 3RHAA 4CBQA 1LQUA 3D8XA 2WU2A 3HYWA 1ZOVA 4OPDA 1ELIA 3KD9A 2YVGA 1YQ4A 3BNUA 3RP7A 3VRBA 2XVJA 4TM4A 1P2EA 2RGOA 1S2YA 1NG4A 3PVCA 3T14A 5KOXA 5HXIA 1F8SA 2ZZCA 1EL8A 2BK5A 4NTCA 1LPFA 1PS9A 3GDNA 3UKKA 4U2TA 4AOXA 3ALLA 4B67A 3L8KA 3UOZA 5CKUA 3PO7A 2VVLG 4U8NA 1Y56B 1KNRA 2XLTA 3NK0X 2C67A 2RGJA 3NYFA 4B66A 4Z2RA 4CNJA 2CFYA 1YKJA 3OC4A 1D7YA 1F8RA 2YG3A 3GWDA 1COYA 4U8KA 3LXDA 1ZX9A 5JRBA 3AE2A 3NH3X 2Q7VA 2C66A 3C4NA 2YG4A 1D7LA 4CCQA 2VQBA 3T0KA 2C73A 3UTGA 3CNSA 3CGCA 2X8CA 4YSHA 3II4A 3AEEA 1GEUA 1VRQB 3F8PA 4XWRA 3SFEA 4TLZA 4Z25A 1CJ3A 1EL5A 1L9EA 3DJEA 4A6NB 1E7PA 4H4SA 1DOEA 5FS9A 3S5WA 4B65A 3URHA 2AR8A 4KPRA 1IUUA 3LOVA 1S2QA 4ZN0A 2BXSA 2JKCA 2QA1A 2YLWA 4H4PA 1OJCA 3V3OA 2JB1A 2WETA 4CCRA 4A79A 1FECA 2C7GA 4J2WA 4A9WA 1OJ9A 3F8DA 4CY8A 5TR3A 1TDNA 4K8DA 2BRAA 2XLSA 3AXBA 4O5UA 3SXIA 4ICYA 2E1MA 2YG7A 1X31B 1CC4A 2ARDA 1H7XA 4EQWA 3LADA 1KF6A 1CHUA 3AYLA 3ATQA 2R0GA 3AE5A 3NGCX 4GF7A 2UZZA 2GVCA 4NEVA 1MOKA 3B3RA 4K5RA 4YXDA 1S3BA 3SY4A 2B7RA 4U8PA 1CJCA 4K5SA 1D5TA 3AE6A 2B9WA 1TDOA 1GERA 4NEWA 4G74A 1LQTA 4K2XA 5KVIA 4MJWA 4ZCCA 4TLXA 3Q9TA 1PJ5A 4C74A 1RYIA 3AECA 3T31A 5JCNA 4P9SA 3C96A 3AB1A 3UOXA 1Q1RA 3K30A 2CULA 2GQFA 4B68A 4JNAA 4B69A 5LV9A 3AE3A 4UDRA 1DJQA 1JNRA 3AEDA 2OALA 4AT0A 4H50A 3D9XA 3GYJA 4WX1A 3CNPA 1YY5A 1ZOYA 1JRXA 3UKFA 2NPXA 1RP0A 1BKWA 2BCPA 1E6EA 3M12A 2B9YA 2QCUA 3UKAA 2VQ7A 2E4GA 1GRFA 1PBFA 3DGHA 2YVJA 1CBOA 1EBDA 2A8XA 2FJEA 5ER0A 4GUVA 4EQXA 4U8IA 4IVMB 4YKGA 3QJ4A 1YQ3A 5KXJA 1BGJA 5C2TA 1O5WA 4H4VA 1PBEA 1Q1WA 4JN9A 1H81A 2X99A 3DA1A 3LZXA 4EM3A 4JQ9A 3CNDA 5KVHA 4N9XA 4XWZA 4H4RA 1LJ1A 1QJDA 2WPCA 3L5OA 1NDAA 2AQJA 2C65A 4U2LA 1JEHA 3KPFA 1JNZA 3SM8A 1CJ2A 2A89A 3FPZA 4D04A 1OJDA 1B4VA 4Z26A 1H83A 4JY3A 4OPIA 1NEKA 2GQWA 4EQRA 3LB8A 1IUSA 4U8OA 5KRQA 4OPTA 3GSIA 2OLNA 3EPTA 2O9ZA 4H4YA 4J31A 2WPFA 1VDCA 2WQYA 4IV9A 5HYMA 4LU6A 3UOVA 1GRHA 2QA2A 2V60A 3AYJA 3PG6A 1PJ7A 4IVOB 4TM1A 1IUVA 2GMJA 3NNEA 4B63A 4H4QA 3RP8A 4E0VA 1M64A 4DGKA 2YLSA 4YTPA 1H86A 4G73A 5L46A 3DJJA 3QSSA 2BC0A 4H2NA 4B64A 3CNTA 1GT8A 3BI4A 1VQWA 3C4AA 5U63A 1VG9A 5KMRA 4XXGA 3SFDA 4H4ZA 1SEZA 2FJAA 3NHOX 2VRMA 1UKVG 2BRYA 3ATRA 1PXCA 5C3JA 2BS4A 4U8LA 4FK1C 1ZMCA 2C3CA 3NK1X 3DK4A 5GSNA 4Z24A 3CPHG 4AT2A 1DOCA 4H2RA 4UP3A 2IVEA 4ZCDA 3CPJG 4J33A 2C72A 1BGNA 5HY5A 1JU2A 3P4SA 3SZWA 5GRTA 2EQ8A 5EBKA 1O95A 4D03A 1NHSA 3Q6JA 2TPRA 1PN0A 2JB3A 3CIRA 2RABA 3AEBA 3IHGA 5FS7A 4GR1A 2XVHA 4REKA 3AD9B 2XFNA 4YSYA 1ZY8A 2XLUA 3NK2X 4H4WA 5J7XA 3AE4A 2B7SA 3M0OA 1NHQA 1S7MA 4GRTA 3SYIA 2WBAA 5U25A 1N1PA 2YLTA 3T2KA 1GESA 1CL0A 3P4RA 2ZBWA 3RP6A 2Z5XA 2EQ7A 4CY6A 1IUWA 3AD8B 4NNJA 2EQ6A 4CRTA 1Q9IA 2BS3A 3HYXA 3IC9A 2VVLA 1GRAA 3NN0X 2CVJA 3BNMA 5U1OA 3CTYA 1ZKQA 2WOVA 4GCMA 4GAPA 2V3BA 1B37A 4HB9A 3CMMA 1L0VA 3KLJA 5EB5A 4YT0A 5BRTA 1FCDA 4OCGA 2R0PA 3QFBA 3IWAA 1PJ6A 4JNQA 2QAEA 2Q0KA 3SZFA 1GXFA 1GETA 4GDPA 2YVFA 4RG3A 1MXTA 3AE7A 4LA1A 2YQUA 1TYTA 4AP1A 2YG6A 3BI2A 3UP5A 3VRAA 2WESA 2WDQA 3GDPA 3ISHA 1NPXA 1CC6A 3NG7X 4II3A 1ZMDA 4EIQA 3UTFA 1BZLA 1L9CA 2JB2A 1GTEA 1EL7A 1PXBA 1RSGA 5FMHA 4NTDA 2OLOA 4YTMA 2VZ2A 4UDPA 3SZCA 3I3LA 3S61A 4YTNA 3NIXA 5JCKA 1L9DA 4IA5A 1GSNA 4BURA 1KSUA 3NT6A 2R46A 3UKQA 3KPKA 3K7TA 2ZZ0A 1CC2A 2R4EA 4Y4MA 3EF6A 2WOIA 3ABVA 3UKPA 3GWFA 3P9UA 4U2SA 5JCLA 3GMCA 2AAQA 1DOBA 1N4VA 1TDKA 1HYUA 3G5RA 1D4CA 2EQ9A 3I6DA 5IPYA 4ADWA 4NTEA 1K4QA 1E1LA 2WP6A 3CN8A 1QLBA 3IF9A 2BXRA 3FBSA 4JY2A 4ECHA 2Q0LA 3CNJA 2Y6RA 2C75A 4G6HA 5J60A 1K0IA 4B1BA 2BABA 1LTXR 4APNA 4M52A 3D1CA 4NZHA 2V5ZA 1MO9A 3PS9A 2FJBA 2XVEA 1GRGA 3OZ2A 2BC1A 4JDRA 3P4QA 4TM0A 1F3PA 2BA9A 2OA1A 3ALMA 4OPLA 2WDRA 3M13A 5JCMA 1E1MA 3KVEA 4USRA 3LJPA 1PBDA 1GRBA 2HQMA 1DXLA 1KNPA 2XFOA 4J57A 2GR2A 2GEWA 1PDHA 3SQPA 3NTDA 1N4WA 4H4UA 3NKSA 4C5OA 2YG5A 1ZK7A 1DODA 4PAAA 4OPGA 3P1WA 2XCGA 3GMBA 4FX9A 4EMWA 2JK6A 5M10A 4X9MA 1GRTA 1JRYA 3AEAA 2XLPA 3SX6A 2BK3A 3LZWA 3QSMA 1E1NA 3H8IA 2VRLA 4RSLA 2DKIA 4YSZA 2CDUA 1KDGA 2XFUA 2XVFA 1FEBA 2WPEA 3AE8A 2X8HA 4C3XA 4Z44A 1JRZA 1GPEA 2BS2A 2GV8A 3QFAA 2GF3A 4YWOA 3ZYXA 2WOWA 2I0ZA 1IJHA 2YWLA 1JOAA 1CJ4A 1D4EA 4X4JA 5BULA 4H4TA 1XPQA 2PHHA 2ZZBA 4BK2A 2C3DA 3NTAA 2GAHB 3DK9A 4K7ZA 1W4XA 2GB0A 5BUKA 3AWIA 4H2QA 3NYEA 1BF3A 3ZDNA 2YR5A 1GALA 1PBCA 3K7MX 4A99A 3NRNA 4RG4A 5KOWA 4DNAA 3BHKA 1XHCA 2XFPA 3QSEA 2OAMA 4KX6A 2BK4A 2R9ZA 3WE0A 4A65A 2B76A 3FMWA 1BWCA 4U8JA 3V76A 1KFYA 3G5QA 3GYIA 3NYCA 2JAEA 4U8MA 3VR8A 4J56A 4O5QA 4A7AA 4NWZA 1H82A 4Z2TA 1E1KA 3GD3A 3K7QX 4OVIA 2GMHA 1CF3A 2WDVA 2F5ZA 2IVDA 4A5LA 1AOGA 1DNCA 1ZP0A 3G5SA 2W0HA 2YLXA 4J36A 3GD4A 3R9UA 4EMJA 1PHHA 3ICTA 4UDQA 3T2ZA 4C3YA 3SZ0A 3DH9A 2VOUA 3SGLA 3DGZA 4BK1A 1N4UA 3FG2P 3ICSA 2A87A 1O94A 3HZLA 3EANA 3ITJA 2V3AA 1GV4A 5IQ4A 5JCIA 2WEUA 2YLZA 1V59A 3DMEA 2GR1A 4I58A 5FS8A 3KU9A 2R45A 3AEFA 5KWFA 3AYIA 2WU5A 3BI5A 2GRTA 4IA6A 3VQRA 3UCLA 3O0HA 1NHPA 1OJTA 3QVRA 4GAVA 4J34A 2XFQA 3B6DA 3IHMA 4BJZA 4I59A 1GTHA 4AOSA 3V3NA 2GH5A 3UP4A 1Y0PA 4FK1A 2BCGG 2PYXA 2X50A 2X8GA 1Z6LA 2WP5A 2FJDA 1LV0A 2E5VA 1IUXA 1QO8A 3P4PA 4II2A 3CGDA 2WHDA 4H4XA 2R0CA 3HYVA 4GDEA 5KNLA 5KMQA 4EM4A 1REOA 2Y6QA 1TDEA 3ALJA 4OPUA 1VG0A 2YAUA 2BYBA 1F8WA 3NLCA 5M0ZA 4C77A 1XANA 1XDIA 2GR3A 2ACZA 1LVLA 4FDCB 1D4DA 2VVMA 1TDFA 1KSSA 3AE9A 2BACA 3ICRA 5KMSA 2XDOA 3KA7A 4YKFA 3VR9A 4Y4LA 4DSGA 2Z5YA 3NN6X 2YM2A 3H4KA 2GAGB 1Y56A 2IIDA 4Z43A 3AEGA 3GRTA 5HHFA 4LIIA 2RGHA 3CGBA 1H6VA 1K0LA 4WCTA 1H2IA 1GNDA 1FL2A 3L1RA 1ZDLA 2XLRA 1NAAA 4H2PA 5EB4A 5CQFA 2FBWA 3F8RA 4HA6A 1PXAA 2YLRA 1E39A 2C70A 4EQSA 2Q6UA 1PBBA 2YR6A 2WP9A 2YM1A 3T2YA 4EIPA 4Y4NA 2C4CA 2TMDA 3UKHA 1ONFA 1F6MA 5DBJA 3REDA 3UOYA 1H7WA 3UTEA 4A6NA 4AP3A 4BV6A 2H88A 1KN0A 1P2HA 5KMPA 1M6IA 2C64A 2NVKX 3RNMA 2XVIA 4TM3A 3VRDB 5FS6A 4DSHA 4YSXA 2DKHA 4EMIA 3UTHA 5BVAA 1TRBA 3DJGX 3E1TA 4OPCA 4CNKA 5IQ1A 2APGA 2XYOA 3AE1A 1DJNA 1EL9A 4USQA 1IUTA 3AD7B 3CPIG 2WS3A 4PABA 1NG3A 3FIMB 2H89A 4K22A 3DK8A 1FEAA 1NENA 3DJDA 4G6GA 2GR0A 3BHFA 3ADAB 3COXA 2YR4A 3H8LA 3GYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQZ A;  4X9N A;  4H7U A;  3EAO A;  1TYP A;  1K0J A;  1H84 A;  2C76 A;  1FOH A;  3KKJ A;  3GRS A;  1B8S A;  3CGE A;  2X3N A;  4BK3 A;  3UKL A;  4Z2U A;  3JSK A;  2JBV A;  1NHR A;  3QVP A;  2B9X A;  2J3N A;  1B5Q A;  1GOS A;  3T37 A;  2R4J A;  5EOW A;  1OJA A;  1S3E A;  4BJY A;  1GRE A;  2V6O A;  2V61 A;  3RHA A;  4CBQ A;  1LQU A;  3D8X A;  2WU2 A;  1ZOV A;  4OPD A;  1ELI A;  3KD9 A;  2YVG A;  1YQ4 A;  3BNU A;  3RP7 A;  3VRB A;  2XVJ A;  4TM4 A;  1P2E A;  2RGO A;  1S2Y A;  1NG4 A;  3PVC A;  5KOX A;  5HXI A;  1F8S A;  2ZZC A;  1EL8 A;  2BK5 A;  4NTC A;  1LPF A;  1PS9 A;  3GDN A;  3UKK A;  4U2T A;  4AOX A;  3ALL A;  4B67 A;  3L8K A;  3UOZ A;  5CKU A;  3PO7 A;  2VVL G;  4U8N A;  1Y56 B;  1KNR A;  2XLT A;  3NK0 X;  2C67 A;  2RGJ A;  3NYF A;  4B66 A;  4Z2R A;  4CNJ A;  2CFY A;  1YKJ A;  3OC4 A;  1D7Y A;  1F8R A;  2YG3 A;  3GWD A;  1COY A;  4U8K A;  3LXD A;  1ZX9 A;  3AE2 A;  3NH3 X;  2Q7V A;  2C66 A;  3C4N A;  2YG4 A;  1D7L A;  4CCQ A;  2VQB A;  2C73 A;  3UTG A;  3CNS A;  3CGC A;  2X8C A;  4YSH A;  3II4 A;  3AEE A;  1GEU A;  1VRQ B;  3F8P A;  4XWR A;  3SFE A;  4TLZ A;  4Z25 A;  1CJ3 A;  1EL5 A;  1L9E A;  3DJE A;  4A6N B;  1E7P A;  4H4S A;  1DOE A;  5FS9 A;  3S5W A;  4B65 A;  3URH A;  2AR8 A;  4KPR A;  1IUU A;  3LOV A;  1S2Q A;  4ZN0 A;  2BXS A;  2JKC A;  2QA1 A;  2YLW A;  4H4P A;  1OJC A;  3V3O A;  2JB1 A;  2WET A;  4CCR A;  4A79 A;  1FEC A;  2C7G A;  4J2W A;  4A9W A;  1OJ9 A;  3F8D A;  4CY8 A;  5TR3 A;  1TDN A;  4K8D A;  2XLS A;  3AXB A;  4O5U A;  4ICY A;  2E1M A;  2YG7 A;  1X31 B;  1CC4 A;  2ARD A;  1H7X A;  4EQW A;  3LAD A;  1KF6 A;  1CHU A;  3AYL A;  3ATQ A;  2R0G A;  3AE5 A;  3NGC X;  4GF7 A;  2UZZ A;  2GVC A;  4NEV A;  1MOK A;  3B3R A;  4K5R A;  4YXD A;  1S3B A;  2B7R A;  4U8P A;  1CJC A;  4K5S A;  1D5T A;  3AE6 A;  2B9W A;  1TDO A;  1GER A;  4NEW A;  4K2X A;  1LQT A;  4MJW A;  5KVI A;  4ZCC A;  4TLX A;  3Q9T A;  1PJ5 A;  4C74 A;  1RYI A;  3AEC A;  5JCN A;  4P9S A;  3C96 A;  3AB1 A;  3UOX A;  1Q1R A;  3K30 A;  2CUL A;  2GQF A;  4B68 A;  4JNA A;  4B69 A;  5LV9 A;  3AE3 A;  4UDR A;  1DJQ A;  1JNR A;  3AED A;  2OAL A;  4AT0 A;  4H50 A;  3GYJ A;  4WX1 A;  3CNP A;  1YY5 A;  1ZOY A;  1JRX A;  3UKF A;  2NPX A;  1RP0 A;  1BKW A;  2BCP A;  1E6E A;  3M12 A;  2B9Y A;  2QCU A;  3UKA A;  2VQ7 A;  2E4G A;  1GRF A;  1PBF A;  3DGH A;  2YVJ A;  1CBO A;  1EBD A;  2A8X A;  2FJE A;  5ER0 A;  4GUV A;  4EQX A;  4U8I A;  4IVM B;  4YKG A;  3QJ4 A;  1YQ3 A;  5KXJ A;  1BGJ A;  5C2T A;  1O5W A;  4H4V A;  1PBE A;  1Q1W A;  4JN9 A;  1H81 A;  2X99 A;  3DA1 A;  3LZX A;  4EM3 A;  4JQ9 A;  3CND A;  5KVH A;  4N9X A;  4XWZ A;  4H4R A;  1LJ1 A;  1QJD A;  2WPC A;  1NDA A;  2AQJ A;  2C65 A;  4U2L A;  1JEH A;  3KPF A;  1JNZ A;  3SM8 A;  1CJ2 A;  2A89 A;  3FPZ A;  4D04 A;  1OJD A;  1B4V A;  4Z26 A;  1H83 A;  4JY3 A;  4OPI A;  1NEK A;  2GQW A;  4EQR A;  3LB8 A;  1IUS A;  4U8O A;  5KRQ A;  4OPT A;  3GSI A;  2OLN A;  3EPT A;  2O9Z A;  4H4Y A;  4J31 A;  2WPF A;  1VDC A;  2WQY A;  4IV9 A;  5HYM A;  4LU6 A;  3UOV A;  1GRH A;  2QA2 A;  2V60 A;  3AYJ A;  1PJ7 A;  4IVO B;  4TM1 A;  1IUV A;  2GMJ A;  3NNE A;  4B63 A;  4H4Q A;  3RP8 A;  4E0V A;  1M64 A;  4DGK A;  2YLS A;  4YTP A;  1H86 A;  5L46 A;  3DJJ A;  3QSS A;  2BC0 A;  4H2N A;  4B64 A;  3CNT A;  1GT8 A;  3BI4 A;  1VQW A;  3C4A A;  5U63 A;  1VG9 A;  4XXG A;  3SFD A;  4H4Z A;  1SEZ A;  2FJA A;  3NHO X;  2VRM A;  1UKV G;  3ATR A;  1PXC A;  5C3J A;  2BS4 A;  4U8L A;  4FK1 C;  1ZMC A;  2C3C A;  3NK1 X;  3DK4 A;  5GSN A;  4Z24 A;  3CPH G;  4AT2 A;  1DOC A;  4H2R A;  4UP3 A;  2IVE A;  4ZCD A;  3CPJ G;  4J33 A;  2C72 A;  1BGN A;  5HY5 A;  1JU2 A;  3P4S A;  5GRT A;  2EQ8 A;  5EBK A;  1O95 A;  4D03 A;  1NHS A;  3Q6J A;  2TPR A;  1PN0 A;  2JB3 A;  3CIR A;  2RAB A;  3AEB A;  3IHG A;  5FS7 A;  4GR1 A;  2XVH A;  4REK A;  3AD9 B;  2XFN A;  4YSY A;  1ZY8 A;  2XLU A;  3NK2 X;  4H4W A;  5J7X A;  3AE4 A;  2B7S A;  3M0O A;  1NHQ A;  4GRT A;  2WBA A;  5U25 A;  1N1P A;  2YLT A;  1GES A;  1CL0 A;  3P4R A;  2ZBW A;  3RP6 A;  2Z5X A;  2EQ7 A;  4CY6 A;  1IUW A;  3AD8 B;  2EQ6 A;  4CRT A;  1Q9I A;  2BS3 A;  3IC9 A;  2VVL A;  1GRA A;  3NN0 X;  2CVJ A;  3BNM A;  5U1O A;  3CTY A;  1ZKQ A;  2WOV A;  4GCM A;  2V3B A;  1B37 A;  4HB9 A;  1L0V A;  3KLJ A;  5EB5 A;  4YT0 A;  5BRT A;  1FCD A;  4OCG A;  2R0P A;  3QFB A;  3IWA A;  1PJ6 A;  4JNQ A;  2QAE A;  2Q0K A;  1GXF A;  1GET A;  4GDP A;  2YVF A;  4RG3 A;  1MXT A;  3AE7 A;  4LA1 A;  2YQU A;  1TYT A;  4AP1 A;  2YG6 A;  3BI2 A;  3UP5 A;  3VRA A;  2WES A;  2WDQ A;  3GDP A;  3ISH A;  1NPX A;  1CC6 A;  3NG7 X;  1ZMD A;  4EIQ A;  3UTF A;  1BZL A;  1L9C A;  2JB2 A;  1GTE A;  1EL7 A;  1PXB A;  1RSG A;  5FMH A;  4NTD A;  2OLO A;  4YTM A;  2VZ2 A;  4UDP A;  4YTN A;  3I3L A;  3S61 A;  3NIX A;  5JCK A;  1L9D A;  4IA5 A;  1GSN A;  4BUR A;  1KSU A;  3NT6 A;  2R46 A;  3UKQ A;  3K7T A;  2ZZ0 A;  1CC2 A;  2R4E A;  4Y4M A;  3EF6 A;  2WOI A;  3ABV A;  3UKP A;  3GWF A;  3P9U A;  4U2S A;  5JCL A;  3GMC A;  2AAQ A;  1DOB A;  1N4V A;  1TDK A;  1HYU A;  3G5R A;  1D4C A;  2EQ9 A;  3I6D A;  5IPY A;  4ADW A;  4NTE A;  1K4Q A;  1E1L A;  2WP6 A;  3CN8 A;  1QLB A;  3IF9 A;  2BXR A;  3FBS A;  4JY2 A;  4ECH A;  2Q0L A;  3CNJ A;  2Y6R A;  2C75 A;  5J60 A;  1K0I A;  4B1B A;  2BAB A;  1LTX R;  4APN A;  4M52 A;  3D1C A;  4NZH A;  2V5Z A;  1MO9 A;  3PS9 A;  2FJB A;  2XVE A;  1GRG A;  3OZ2 A;  2BC1 A;  4JDR A;  3P4Q A;  4TM0 A;  1F3P A;  2BA9 A;  2OA1 A;  3ALM A;  4OPL A;  2WDR A;  3M13 A;  5JCM A;  1E1M A;  3KVE A;  4USR A;  3LJP A;  1PBD A;  1GRB A;  2HQM A;  1DXL A;  1KNP A;  2XFO A;  4J57 A;  2GR2 A;  2GEW A;  1PDH A;  3SQP A;  3NTD A;  1N4W A;  4H4U A;  3NKS A;  4C5O A;  2YG5 A;  1ZK7 A;  1DOD A;  4PAA A;  4OPG A;  3P1W A;  2XCG A;  3GMB A;  4FX9 A;  4EMW A;  2JK6 A;  5M10 A;  4X9M A;  1GRT A;  1JRY A;  3AEA A;  2XLP A;  2BK3 A;  3LZW A;  3QSM A;  1E1N A;  3H8I A;  2VRL A;  4RSL A;  2DKI A;  4YSZ A;  2CDU A;  1KDG A;  2XFU A;  2XVF A;  1FEB A;  2WPE A;  3AE8 A;  2X8H A;  4C3X A;  4Z44 A;  1JRZ A;  1GPE A;  2BS2 A;  2GV8 A;  3QFA A;  2GF3 A;  4YWO A;  3ZYX A;  2WOW A;  2I0Z A;  1IJH A;  2YWL A;  1JOA A;  1CJ4 A;  1D4E A;  4X4J A;  5BUL A;  4H4T A;  1XPQ A;  2PHH A;  2ZZB A;  4BK2 A;  2C3D A;  3NTA A;  2GAH B;  3DK9 A;  4K7Z A;  1W4X A;  2GB0 A;  5BUK A;  3AWI A;  4H2Q A;  3NYE A;  1BF3 A;  3ZDN A;  2YR5 A;  1GAL A;  1PBC A;  3K7M X;  4A99 A;  3NRN A;  4RG4 A;  5KOW A;  4DNA A;  3BHK A;  1XHC A;  2XFP A;  3QSE A;  2OAM A;  4KX6 A;  2BK4 A;  2R9Z A;  3WE0 A;  4A65 A;  2B76 A;  3FMW A;  1BWC A;  4U8J A;  3V76 A;  1KFY A;  3G5Q A;  3GYI A;  3NYC A;  2JAE A;  4U8M A;  3VR8 A;  4J56 A;  4O5Q A;  4A7A A;  1H82 A;  4Z2T A;  1E1K A;  3GD3 A;  3K7Q X;  4OVI A;  2GMH A;  1CF3 A;  2WDV A;  2F5Z A;  2IVD A;  4A5L A;  1AOG A;  1DNC A;  1ZP0 A;  3G5S A;  2W0H A;  2YLX A;  4J36 A;  3GD4 A;  3R9U A;  4EMJ A;  1PHH A;  3ICT A;  4UDQ A;  4C3Y A;  3DH9 A;  2VOU A;  3SGL A;  3DGZ A;  4BK1 A;  1N4U A;  3FG2 P;  3ICS A;  2A87 A;  1O94 A;  3HZL A;  3EAN A;  3ITJ A;  2V3A A;  1GV4 A;  5IQ4 A;  5JCI A;  2WEU A;  2YLZ A;  1V59 A;  3DME A;  2GR1 A;  4I58 A;  5FS8 A;  3KU9 A;  2R45 A;  3AEF A;  5KWF A;  3AYI A;  2WU5 A;  3BI5 A;  2GRT A;  4IA6 A;  3VQR A;  3UCL A;  3O0H A;  1NHP A;  1OJT A;  3QVR A;  4J34 A;  2XFQ A;  3B6D A;  3IHM A;  4BJZ A;  4I59 A;  1GTH A;  4AOS A;  3V3N A;  2GH5 A;  3UP4 A;  1Y0P A;  4FK1 A;  2BCG G;  2PYX A;  2X50 A;  2X8G A;  1Z6L A;  2WP5 A;  2FJD A;  1LV0 A;  2E5V A;  1IUX A;  1QO8 A;  3P4P A;  3CGD A;  2WHD A;  4H4X A;  2R0C A;  4GDE A;  4EM4 A;  1REO A;  2Y6Q A;  1TDE A;  3ALJ A;  4OPU A;  1VG0 A;  2YAU A;  2BYB A;  1F8W A;  3NLC A;  5M0Z A;  4C77 A;  1XAN A;  1XDI A;  2GR3 A;  2ACZ A;  1LVL A;  4FDC B;  1D4D A;  2VVM A;  1TDF A;  1KSS A;  3AE9 A;  2BAC A;  3ICR A;  2XDO A;  3KA7 A;  4YKF A;  3VR9 A;  4Y4L A;  4DSG A;  2Z5Y A;  3NN6 X;  2YM2 A;  3H4K A;  2GAG B;  1Y56 A;  2IID A;  4Z43 A;  3AEG A;  3GRT A;  5HHF A;  4LII A;  2RGH A;  3CGB A;  1H6V A;  1K0L A;  4WCT A;  3L1R A;  1GND A;  1FL2 A;  1ZDL A;  2XLR A;  1NAA A;  4H2P A;  5EB4 A;  5CQF A;  2FBW A;  3F8R A;  4HA6 A;  1PXA A;  2YLR A;  1E39 A;  2C70 A;  4EQS A;  2Q6U A;  1PBB A;  2YR6 A;  2WP9 A;  2YM1 A;  4EIP A;  4Y4N A;  2TMD A;  3UKH A;  1ONF A;  1F6M A;  5DBJ A;  3RED A;  3UOY A;  1H7W A;  3UTE A;  4A6N A;  4AP3 A;  4BV6 A;  2H88 A;  1P2H A;  1M6I A;  2C64 A;  2NVK X;  3RNM A;  2XVI A;  4TM3 A;  3VRD B;  5FS6 A;  4DSH A;  4YSX A;  2DKH A;  4EMI A;  3UTH A;  5BVA A;  1TRB A;  3DJG X;  3E1T A;  4OPC A;  4CNK A;  5IQ1 A;  2APG A;  2XYO A;  3AE1 A;  1DJN A;  1EL9 A;  4USQ A;  1IUT A;  3AD7 B;  3CPI G;  2WS3 A;  4PAB A;  1NG3 A;  3FIM B;  2H89 A;  4K22 A;  3DK8 A;  1FEA A;  1NEN A;  3DJD A;  2GR0 A;  3BHF A;  3ADA B;  3COX A;  2YR4 A;  3H8L A; 
#chains in the Genus database with same CATH topology
 1YQZ A;  3EAO A;  4TVW A;  3KKJ A;  4FP1 A;  1EC9 A;  3JSK A;  2J3N A;  1B5Q A;  3T37 A;  4CBQ A;  4K8G A;  1ELI A;  2YVG A;  3VC6 A;  1JRO A;  5KOX A;  2ZZC A;  2BK5 A;  4G7F A;  4U2T A;  3ALL A;  3UJ2 A;  1SJD A;  3L8K A;  3PO7 A;  4U8N A;  2W3S A;  4CNJ A;  3QN3 A;  1D7Y A;  1KKO A;  3LXD A;  3BOX A;  3V5F A;  3C4N A;  2YG4 A;  3STP A;  2C73 A;  3UTG A;  2HXU A;  3RRA A;  4XWR A;  3SFE A;  4Z25 A;  1CJ3 A;  2AL2 A;  4MMW A;  3S5W A;  1S2Q A;  2BXS A;  1TZZ A;  2YLW A;  4E4F A;  1OJC A;  2JB1 A;  2ZC8 A;  2WET A;  4A79 A;  4CCR A;  3PWG A;  4CY8 A;  1TDN A;  2BRA A;  3DDM A;  3TQP A;  3VCC A;  1CC4 A;  1SJB A;  1KF6 A;  1CHU A;  3OZY A;  3OPS A;  4HPN A;  2PSN A;  4YXD A;  1R0M A;  1CJC A;  4TVY A;  1D5T A;  4H19 A;  2B9W A;  4G74 A;  3SR6 B;  3NVW B;  3A7U A;  4P9S A;  3TJ4 A;  3AB1 A;  3NVY B;  1T3Q C;  4JNA A;  3SBF A;  3T4W A;  3R0K A;  3TTE A;  1YY5 A;  1ZOY A;  2PGW A;  2ZAD A;  2B9Y A;  2QCU A;  2VQ7 A;  3A7A A;  1GRF A;  3DGH A;  1FHU A;  1CBO A;  2A8X A;  1IYX A;  3SN0 A;  3V3W A;  3GC2 A;  1PBE A;  3UXK A;  4JQ9 A;  4XWZ A;  3QLD A;  2QJJ A;  1QJD A;  2C65 A;  1JNZ A;  2P8B A;  2A89 A;  4D04 A;  1JPD X;  2GQW A;  5KRQ A;  3GSI A;  3OW1 A;  2O9Z A;  4IV9 A;  1GRH A;  3PG6 A;  3NNE A;  3B9J B;  3QSS A;  2BC0 A;  4B64 A;  3CNT A;  3NVV B;  4H4Z A;  3NHO X;  2BRY A;  2OQY A;  4U8L A;  4FK1 C;  2IVE A;  3CPJ G;  1JU2 A;  3P4S A;  3SZW A;  3U9I A;  3CXB A;  2RAB A;  3AEB A;  5FS7 A;  4GR1 A;  4YSY A;  2XLU A;  3NZG A;  2QGY A;  1XS2 A;  3M0O A;  1S7M A;  4GRT A;  3SYI A;  4GGB A;  3ZVI A;  5U25 A;  2YLT A;  1GES A;  2Z5X A;  2EQ7 A;  3UJE A;  2E5A A;  3AD8 B;  1VQZ A;  4CRT A;  3BNM A;  1ZKQ A;  2WOV A;  3KLJ A;  4YT0 A;  2R0P A;  4M6U A;  2PP3 A;  3SZF A;  4RG3 A;  1GET A;  4LA1 A;  2YQU A;  3UP5 A;  3OZM A;  3GDP A;  1JPM A;  4II3 A;  4GIR A;  1PXB A;  1RSG A;  1MNS A;  2OLO A;  4YTM A;  3S61 A;  4K1W A;  3NT6 A;  3UKQ A;  3K7T A;  1CC2 A;  4U2S A;  3GMC A;  3ETR B;  3G5R A;  1D4C A;  3H12 A;  3RIT A;  4NTE A;  3CN8 A;  3IF9 A;  3FBS A;  2Q0L A;  3I4K A;  4G8T A;  4NZH A;  2FJB A;  2XVE A;  4HNC A;  3D47 A;  2GGI A;  4OPL A;  3HRD C;  5JCM A;  3ZVH B;  1E1M A;  3KVE A;  3LJP A;  1PBD A;  2HQM A;  4JN7 A;  2GR2 A;  2GEW A;  1PDH A;  3SQP A;  4H4U A;  1ZXI C;  2XCG A;  4FX9 A;  2JK6 A;  2BK3 A;  1N62 C;  1E1N A;  3DG6 A;  3AE8 A;  2XVF A;  4C3X A;  1GPE A;  2GV8 A;  4YWO A;  3AMZ A;  1IJH A;  1RVK A;  4BK2 A;  2C3D A;  1EC7 A;  3NTA A;  3DK9 A;  2GB0 A;  5BUK A;  3NYE A;  1GAL A;  3JW7 A;  3NRN A;  3ZLH A;  4DWD A;  4IP4 A;  1BWC A;  2JAE A;  4U8M A;  3A7R A;  2NQL A;  3GD3 A;  3K7Q X;  4A5L A;  2F5Z A;  1AOG A;  1ZP0 A;  4J36 A;  1PHH A;  2GGG A;  4UDQ A;  4C3Y A;  2MNR A;  3SZ0 A;  3DH9 A;  3DGZ A;  3HPF A;  3P3B A;  3FG2 P;  3QKE A;  3ITJ A;  2WEU A;  2YLZ A;  2P88 A;  5FS8 A;  3AEF A;  4IA6 A;  3O0H A;  2OPJ A;  4K2S A;  3QVR A;  4J34 A;  2XFQ A;  4AOS A;  2BCG G;  2WP5 A;  1LV0 A;  2E5V A;  1QO8 A;  4II2 A;  2Y6Q A;  3MQT A;  1F9C A;  5M0Z A;  4C77 A;  1D4D A;  3ICR A;  3KA7 A;  2PP1 A;  3ENL A;  3ES8 A;  4GGH A;  2GAG B;  2XH2 A;  1K0L A;  1NAA A;  4IP5 A;  3F8R A;  2YLR A;  1E39 A;  2XH4 A;  1N60 C;  2YR6 A;  2C4C A;  3RED A;  3UOY A;  3UTE A;  4A6N A;  1KN0 A;  1P2H A;  2QDD A;  2OZT A;  3R10 A;  4JHM A;  2C64 A;  2NVK X;  4YSX A;  1PDZ A;  4OPC A;  2APG A;  2XYO A;  3BSM A;  4PAB A;  3FIM B;  2H89 A;  3SQS A;  3BHF A;  3I6E A;  3R11 A;  3MUC A;  4G9K A;  3QTP A;  1K0J A;  2C76 A;  2X3N A;  4BK3 A;  1SJA A;  3FXG A;  1NEL A;  3RR1 A;  1GOS A;  1GRE A;  2V6O A;  3D8X A;  2WU2 A;  5BOE A;  3BNU A;  3RP7 A;  1P2E A;  2RGO A;  1NG4 A;  3PWI A;  4NTC A;  2AKZ A;  3UOZ A;  5CKU A;  1Y56 B;  1KNR A;  3NK0 X;  1F8R A;  3AM9 A;  4U8K A;  1ZX9 A;  3AE2 A;  2OO6 A;  4FI4 A;  2C66 A;  1D7L A;  2VQB A;  2X8C A;  1VRQ B;  3D46 A;  3R0U A;  3DJE A;  4HN8 A;  1E7P A;  4B65 A;  2AR8 A;  3DG7 A;  7ENL A;  2OFJ A;  2W55 A;  4J2W A;  3F8D A;  1P48 A;  2XLS A;  2E1M A;  1X31 B;  3LAD A;  1V97 A;  3P93 A;  1EC8 A;  4IL2 A;  4K5S A;  3AE6 A;  4MJW A;  1GER A;  4NEW A;  4K2X A;  3V5C A;  1PJ5 A;  4C74 A;  5JCN A;  3C96 A;  1Q1R A;  3K30 A;  2CUL A;  3RCY A;  4B69 A;  1MDL A;  4DXK A;  1RP0 A;  1BKW A;  2BCP A;  3IK4 A;  1E6E A;  2YVJ A;  5ER0 A;  1YQ3 A;  1BGJ A;  1O5W A;  1Q1W A;  4H83 A;  4N9X A;  3R25 A;  3BJS A;  4J3Z A;  2AQJ A;  3KPF A;  3K1G A;  3SM8 A;  3FPZ A;  1OJD A;  1B4V A;  4Z26 A;  1H83 A;  1NEK A;  4EQR A;  2OQH A;  3CAW A;  3EPT A;  4H4Y A;  2WPF A;  3DGB A;  4DN1 A;  4LU6 A;  5HYM A;  2QA2 A;  3DFH A;  1PJ7 A;  1IUV A;  4E0V A;  4YTP A;  4DGK A;  3N4E A;  1GT8 A;  5U63 A;  1VG9 A;  3VA8 A;  4XXG A;  4GME A;  1SEZ A;  2VRM A;  1UKV G;  2OLA A;  5C3J A;  2BS4 A;  2C3C A;  3UJR A;  5GSN A;  1DOC A;  4H2R A;  4ZCD A;  4J33 A;  2C72 A;  2GGH A;  5GRT A;  3Q45 A;  3DER A;  2EQ8 A;  5EBK A;  3FCP A;  2TPR A;  2JB3 A;  4REK A;  4DX3 A;  1ZY8 A;  3NK2 X;  4HCL A;  1NHQ A;  2WBA A;  3P4R A;  5FJR A;  1GRA A;  1FHV A;  3CTY A;  4HB9 A;  2QAE A;  2Q0K A;  1GXF A;  2QVH A;  3V4B A;  2YG6 A;  3VRA A;  1X2G A;  3U4F A;  2WES A;  3NG7 X;  3UTF A;  2VZ2 A;  4UDP A;  4YTN A;  5JCK A;  1SJC A;  4BUR A;  2ZZ0 A;  3EF6 A;  2WOI A;  3GWF A;  3P9U A;  6ENL A;  5JCL A;  4IT1 A;  3I6D A;  1K4Q A;  2WP6 A;  1QLB A;  4ECH A;  2BXR A;  3Q4D A;  3CNJ A;  1K0I A;  4B1B A;  1ELS A;  3B97 A;  1GRG A;  2BC1 A;  1F3P A;  3MZN A;  3TOY A;  1DTN A;  3R1Z A;  1KNP A;  4C5O A;  4PAA A;  3P1W A;  1FFV C;  2POD A;  5M10 A;  3JZU A;  3AEA A;  2XLP A;  3SJN A;  4ENL A;  3QSM A;  4YSZ A;  5FJT A;  4Z44 A;  2I0Z A;  4X4J A;  4H4T A;  3AWI A;  4H2Q A;  3ZDN A;  1BF3 A;  3K7M X;  4A99 A;  4DNA A;  1XHC A;  2XFP A;  4KX6 A;  2B76 A;  4U8J A;  4HCH A;  3DES A;  1H82 A;  4KPL A;  4OVI A;  4DYE A;  3GD4 A;  3GO2 A;  3CXO A;  4EMJ A;  2PGE A;  2QQ6 A;  3ICS A;  3HZL A;  1GV4 A;  5IQ4 A;  2GR1 A;  3KU9 A;  2R45 A;  5KWF A;  2WU5 A;  3VQR A;  1MUC A;  3CT2 A;  1GTH A;  4H2H A;  3UP4 A;  2PYX A;  2X50 A;  2X8G A;  3P4P A;  1BKH A;  4H4X A;  2R0C A;  4GDE A;  5KMQ A;  1XAN A;  1ONE A;  2VVM A;  4E5T A;  1TDF A;  2XDO A;  3VR9 A;  2YM2 A;  4X2P A;  4Z43 A;  3GRT A;  1H6V A;  1H2I A;  2E3T A;  1FL2 A;  3L1R A;  2OX4 A;  5CQF A;  3KUM A;  1PXA A;  4EQS A;  3T6C A;  2WP9 A;  4EIP A;  4Y4N A;  3VDG A;  3THU A;  1ONF A;  1F6M A;  1H7W A;  2W3R A;  3GD6 A;  1N5X A;  2XVI A;  5FS6 A;  2DKH A;  3UTH A;  2XGZ A;  1TRB A;  3CPI G;  1STZ A;  1NEN A;  4G6G A;  3GYX A;  4H7U A;  4H1Z A;  1FOH A;  3CGE A;  3UKL A;  4Z2U A;  2JBV A;  1S3E A;  4BJY A;  3VRB A;  3CB3 A;  2FKP A;  2XVJ A;  1PDY A;  4M0X A;  4TM4 A;  3NXL A;  3S5S A;  3PVC A;  3T14 A;  5HXI A;  1F8S A;  5G5G B;  1EL8 A;  2PS2 A;  4JN8 A;  1LPF A;  1KKR A;  3UKK A;  4AOX A;  4Z2R A;  1N63 C;  3DFY A;  2RGJ A;  1YKJ A;  3OC4 A;  2YG3 A;  1COY A;  3EUB 3;  3NH3 X;  3ZLF A;  1X2H A;  3T0K A;  3N6H A;  3CNS A;  4YSH A;  3II4 A;  2GGE A;  4TLZ A;  1EL5 A;  1WUE A;  1L9E A;  3CK5 A;  4H4S A;  3URH A;  3LOV A;  1R6W A;  2JKC A;  2QA1 A;  3I6T A;  4A9W A;  1OJ9 A;  4O5U A;  1H7X A;  2FYM A;  3MSY A;  3ATQ A;  2GVC A;  4NEV A;  1MOK A;  3B3R A;  1EBG A;  1S3B A;  3SY4 A;  2B7R A;  1TDO A;  2QDE A;  1LQT A;  4ZCC A;  5KVI A;  1RYI A;  3AEC A;  3T31 A;  1OEP A;  1WUF A;  4B68 A;  4UDR A;  3UCD A;  1DJQ A;  3AED A;  2OAL A;  3D9X A;  3GYJ A;  4WX1 A;  3CNP A;  1JRX A;  3UKF A;  2OKT A;  4GYP A;  3M12 A;  2XSX A;  2E4G A;  1VDV A;  1PBF A;  3MY9 A;  2QJM A;  1EBD A;  3CYJ A;  4GUV A;  4U8I A;  3VCN A;  4YKG A;  3QJ4 A;  4KWS A;  1JCT A;  4JN9 A;  2AL2 B;  1YEY A;  3FYY A;  4EM3 A;  5KVH A;  3L5O A;  1NDA A;  4U2L A;  1JEH A;  1CJ2 A;  3VFC A;  4JY3 A;  4OPI A;  1IUS A;  4U8O A;  3LB8 A;  4OPT A;  3UOV A;  4IVO B;  4TM1 A;  2XH0 A;  3H70 A;  4H4Q A;  3RP8 A;  4B63 A;  2GSH A;  2YLS A;  1H86 A;  2OZ8 A;  3FJ4 A;  3TWB A;  3SFD A;  2FJA A;  4GFI A;  3ATR A;  4ZCW A;  1PXC A;  1ZMC A;  4Z24 A;  3DK4 A;  2PU0 A;  3UJS A;  3CPH G;  1BGN A;  4D03 A;  1NHS A;  1PN0 A;  3ZVH A;  3AD9 B;  5J7X A;  1BQG A;  2OG9 A;  3RP6 A;  1MRA A;  2XH7 A;  4CY6 A;  1IUW A;  4E4U A;  2EQ6 A;  1Q9I A;  1ECQ A;  3DIP A;  3HYX A;  2VVL A;  3NN0 X;  5U1O A;  3FV9 A;  5EU9 A;  4GCM A;  3CMM A;  5EB5 A;  3QFB A;  4GDP A;  2YVF A;  2HNE A;  3AE7 A;  3SN1 A;  4GYP C;  4AP1 A;  4ZA0 A;  1L9C A;  1GTE A;  1EL7 A;  4KEM A;  4NTD A;  3P0W A;  3I3L A;  3NIX A;  1L9D A;  4IA5 A;  1GSN A;  2R46 A;  2PP0 A;  1E9I A;  2AAQ A;  1TDK A;  1N4V A;  1HYU A;  4HNL A;  2EQ9 A;  5IPY A;  4ADW A;  2AL1 A;  1E1L A;  4JY2 A;  2Y6R A;  4G6H A;  5J60 A;  3D1C A;  1MO9 A;  3PS9 A;  2P3Z A;  3OZ2 A;  3TWA A;  4JDR A;  3P4Q A;  2WDR A;  3M13 A;  4USR A;  1DXL A;  2RDX A;  4MKS A;  4J57 A;  3NTD A;  3N4F A;  1N4W A;  3NKS A;  1EBH A;  1ZK7 A;  4A35 A;  4OPG A;  4X9M A;  1JRY A;  4A3R A;  3OTR A;  2DKI A;  4Z17 A;  4E8G A;  2XFU A;  1JRZ A;  5G5H B;  2BS2 A;  2GF3 A;  3ZYX A;  1JOA A;  5BUL A;  2PHH A;  1XPQ A;  4E6M A;  2ZZB A;  1PBC A;  2O56 A;  4KT2 A;  5KOW A;  3BHK A;  3IJI A;  3DEQ A;  3T9P A;  2BK4 A;  2R9Z A;  3FMW A;  2PTX A;  3G5Q A;  1XPY A;  3GYI A;  4J56 A;  4O5Q A;  2GMH A;  2WDV A;  2IVD A;  4HYR A;  2W0H A;  2YLX A;  3T2Z A;  2PPG A;  3SGL A;  1N4U A;  3R07 C;  3EAN A;  2V3A A;  5JCI A;  4I58 A;  1V59 A;  3IJQ A;  3AYI A;  3BI5 A;  1NHP A;  3TJI A;  3UJF A;  3B6D A;  3IHM A;  2GGJ A;  4BJZ A;  1Y0P A;  4FK1 A;  1Z6L A;  3CGD A;  2WHD A;  5KNL A;  4EM4 A;  3NVZ B;  2PA6 A;  1TDE A;  3ALJ A;  1F8W A;  3NLC A;  2GR3 A;  2ACZ A;  5IDZ A;  5KMS A;  4A6G A;  2BAC A;  4Y4L A;  4DSG A;  3H4K A;  1RM6 B;  3OP2 A;  1Y56 A;  2IID A;  3AEG A;  5HHF A;  2RGH A;  4WCT A;  1GND A;  5EB4 A;  4HA6 A;  2Q6U A;  1JRP A;  3UKH A;  4IZG A;  4BV6 A;  1M6I A;  4TM3 A;  4EMI A;  4CNK A;  1W6T A;  1DJN A;  4K22 A;  2GR0 A;  3ADA B;  3COX A;  2YR4 A;  3H8L A;  4X9N A;  1TYP A;  1H84 A;  3GRS A;  1B8S A;  3EKG A;  3QVP A;  1NHR A;  2B9X A;  2R4J A;  3TCS A;  5EOW A;  1OJA A;  4Z1Y A;  2V61 A;  3RHA A;  1LQU A;  3HYW A;  1ZOV A;  4OPD A;  3KD9 A;  1YQ4 A;  1S2Y A;  1TE6 A;  3ZLG A;  1PS9 A;  3GDN A;  3TW9 A;  4B67 A;  2VVL G;  2XLT A;  2C67 A;  3NYF A;  4B66 A;  2CFY A;  3GWD A;  4GIS A;  5FJO A;  1FFU C;  5JRB A;  3NO1 A;  2Q7V A;  4CCQ A;  1JDF A;  3CGC A;  3AEE A;  1GEU A;  3F8P A;  2DW7 A;  4MGG A;  4A6N B;  1DOE A;  5FS9 A;  2CHR A;  4KPR A;  1IUU A;  4ZN0 A;  1P43 A;  3JVA A;  4H4P A;  3V3O A;  2ONE A;  1FEC A;  1N61 C;  2C7G A;  4F4R A;  5TR3 A;  3SXI A;  4K8D A;  3AXB A;  3VC5 A;  4ICY A;  2YG7 A;  2ARD A;  4EQW A;  3AYL A;  3NGC X;  2R0G A;  3AE5 A;  4GF7 A;  5ENL A;  2UZZ A;  4K5R A;  3NS1 B;  3RO6 A;  4U8P A;  3IJL A;  5FJU A;  4TLX A;  3Q9T A;  2DW6 A;  4YWS A;  3UOX A;  2GQF A;  3N6J A;  5LV9 A;  3AE3 A;  1JNR A;  4AT0 A;  4H50 A;  2NPX A;  3UKA A;  2FJE A;  4EQX A;  4IVM B;  3HW2 A;  5KXJ A;  5C2T A;  4H4V A;  1H81 A;  2X99 A;  3DA1 A;  3LZX A;  3CND A;  4H4R A;  1LJ1 A;  2WPC A;  2P0I A;  2HXT A;  2OLN A;  4J31 A;  1VDC A;  2WQY A;  2V60 A;  3AYJ A;  3NRZ B;  2GMJ A;  3NFU A;  1M64 A;  4G73 A;  5L46 A;  3UCC A;  3DJJ A;  4H2N A;  3BI4 A;  1VQW A;  3C4A A;  3S47 A;  5KMR A;  3NK1 X;  4AT2 A;  4UP3 A;  3ES7 A;  5HY5 A;  1O95 A;  3Q6J A;  1MDR A;  3CIR A;  3IHG A;  2XVH A;  1N5W C;  2XFN A;  4H4W A;  3AE4 A;  2B7S A;  3PK7 A;  1N1P A;  3T2K A;  1CL0 A;  2ZBW A;  4NNJ A;  2BS3 A;  1FO4 A;  3IC9 A;  2CVJ A;  2HZG A;  4GAP A;  5BOF A;  2V3B A;  1B37 A;  1L0V A;  3FVD A;  5BRT A;  1FCD A;  4OCG A;  3IWA A;  1PJ6 A;  4JNQ A;  3EEZ A;  1FIQ B;  1MXT A;  3SSZ A;  1TYT A;  3BI2 A;  3DG3 A;  2WDQ A;  3ISH A;  1NPX A;  1CC6 A;  2GDQ A;  1ZMD A;  4EIQ A;  3MWC A;  1BZL A;  3RGT A;  2JB2 A;  2GL5 A;  5FMH A;  3SZC A;  1KSU A;  3KPK A;  2R4E A;  4Y4M A;  3ABV A;  3UKP A;  3GY1 A;  1L8P A;  1DOB A;  3H7V A;  2PCE A;  1KCZ A;  3T8Q A;  2POZ A;  2C75 A;  2BAB A;  1LTX R;  4APN A;  4M52 A;  2V5Z A;  5FJP A;  4TM0 A;  2BA9 A;  2OA1 A;  3ALM A;  1SB3 B;  1GRB A;  2XFO A;  3UXL A;  4IHC A;  2YG5 A;  5J04 A;  1DOD A;  2I5Q A;  1NU5 A;  3GMB A;  4EMW A;  1GRT A;  4ROP A;  3SX6 A;  2PMQ A;  3LZW A;  4HCD A;  3H8I A;  2VRL A;  4RSL A;  2OVL A;  2CDU A;  1KDG A;  1FEB A;  2WPE A;  2X8H A;  1WYG A;  3QFA A;  2WOW A;  2YWL A;  2QJN A;  1CJ4 A;  1D4E A;  2GAH B;  4K7Z A;  1W4X A;  2YR5 A;  2PTW A;  4RG4 A;  2W54 A;  4A65 A;  3QSE A;  3WE0 A;  2OAM A;  2MUC A;  1KFY A;  3V76 A;  4J1O A;  3NYC A;  1TKK A;  3VR8 A;  4A7A A;  4ZOH B;  4NWZ A;  4Z2T A;  1E1K A;  1CF3 A;  1DNC A;  3G5S A;  3R9U A;  3ICT A;  2VOU A;  4BK1 A;  2AKM A;  2A87 A;  1O94 A;  3DME A;  2GRT A;  3UCL A;  2P8C A;  3SN4 A;  1OJT A;  4GAV A;  4DHG A;  4I59 A;  3V3N A;  2GH5 A;  2FJD A;  1IUX A;  4EWJ A;  3HYV A;  1REO A;  4OPU A;  1VG0 A;  2YAU A;  2BYB A;  2PTY A;  1XDI A;  1LVL A;  4FDC B;  1KSS A;  2OZ3 A;  3AE9 A;  4YKF A;  2Z5Y A;  3NN6 X;  3UGV A;  4LII A;  3CGB A;  1ZDL A;  2XLR A;  2PU1 A;  4H2P A;  2FBW A;  2C70 A;  2PTZ A;  1PBB A;  2YM1 A;  3T2Y A;  2TMD A;  5DBJ A;  3PFR A;  3QPE A;  4AP3 A;  2H88 A;  5KMP A;  3RNM A;  3H8A A;  3AN1 A;  3VRD B;  4DSH A;  5BVA A;  1KD0 A;  3DJG X;  3E1T A;  4IL0 A;  5IQ1 A;  3AE1 A;  1EL9 A;  4USQ A;  1IUT A;  3AD7 B;  2WS3 A;  1NG3 A;  3DK8 A;  1FEA A;  3DJD A;  3MKC A; 
#chains in the Genus database with same CATH homology
 1YQZ A;  4X9N A;  4H7U A;  4G9K A;  3EAO A;  1TYP A;  1K0J A;  1H84 A;  2C76 A;  1FOH A;  3KKJ A;  3GRS A;  1B8S A;  3CGE A;  2X3N A;  4BK3 A;  3UKL A;  4Z2U A;  3JSK A;  2JBV A;  1NHR A;  3QVP A;  2B9X A;  2J3N A;  1B5Q A;  1GOS A;  3T37 A;  2R4J A;  5EOW A;  1OJA A;  1S3E A;  4BJY A;  1GRE A;  2V6O A;  2V61 A;  3RHA A;  4CBQ A;  1LQU A;  3D8X A;  2WU2 A;  3HYW A;  1ZOV A;  4OPD A;  1ELI A;  3KD9 A;  2YVG A;  1YQ4 A;  3BNU A;  3RP7 A;  3VRB A;  2XVJ A;  4TM4 A;  1P2E A;  2RGO A;  1S2Y A;  1NG4 A;  3PVC A;  3T14 A;  5KOX A;  5HXI A;  1F8S A;  2ZZC A;  1EL8 A;  2BK5 A;  4NTC A;  1LPF A;  1PS9 A;  3GDN A;  3UKK A;  4U2T A;  4AOX A;  3ALL A;  4B67 A;  3L8K A;  3UOZ A;  5CKU A;  3PO7 A;  2VVL G;  4U8N A;  1Y56 B;  1KNR A;  2XLT A;  3NK0 X;  2C67 A;  2RGJ A;  3NYF A;  4B66 A;  4Z2R A;  4CNJ A;  2CFY A;  1YKJ A;  3OC4 A;  1D7Y A;  1F8R A;  2YG3 A;  3GWD A;  1COY A;  4U8K A;  3LXD A;  1ZX9 A;  5JRB A;  3AE2 A;  3NH3 X;  2Q7V A;  2C66 A;  3C4N A;  2YG4 A;  1D7L A;  4CCQ A;  2VQB A;  3T0K A;  2C73 A;  3UTG A;  3CNS A;  3CGC A;  2X8C A;  4YSH A;  3II4 A;  3AEE A;  1GEU A;  1VRQ B;  3F8P A;  4XWR A;  3SFE A;  4TLZ A;  4Z25 A;  1CJ3 A;  1EL5 A;  1L9E A;  3DJE A;  4A6N B;  1E7P A;  4H4S A;  1DOE A;  5FS9 A;  3S5W A;  4B65 A;  3URH A;  2AR8 A;  4KPR A;  1IUU A;  3LOV A;  1S2Q A;  4ZN0 A;  2BXS A;  2JKC A;  2QA1 A;  2YLW A;  4H4P A;  1OJC A;  3V3O A;  2JB1 A;  2WET A;  4CCR A;  4A79 A;  1FEC A;  2C7G A;  4J2W A;  4A9W A;  1OJ9 A;  3F8D A;  4CY8 A;  5TR3 A;  1TDN A;  4K8D A;  2BRA A;  2XLS A;  3AXB A;  4O5U A;  3SXI A;  4ICY A;  2E1M A;  2YG7 A;  1X31 B;  1CC4 A;  2ARD A;  1H7X A;  4EQW A;  3LAD A;  1KF6 A;  1CHU A;  3AYL A;  3ATQ A;  2R0G A;  3AE5 A;  3NGC X;  4GF7 A;  2UZZ A;  2GVC A;  4NEV A;  1MOK A;  3B3R A;  4K5R A;  4YXD A;  1S3B A;  3SY4 A;  2B7R A;  4U8P A;  1CJC A;  4K5S A;  1D5T A;  3AE6 A;  2B9W A;  1TDO A;  1GER A;  4NEW A;  4G74 A;  1LQT A;  4K2X A;  5KVI A;  4MJW A;  4ZCC A;  4TLX A;  3Q9T A;  1PJ5 A;  4C74 A;  1RYI A;  3AEC A;  3T31 A;  5JCN A;  4P9S A;  3C96 A;  3AB1 A;  3UOX A;  1Q1R A;  3K30 A;  2CUL A;  2GQF A;  4B68 A;  4JNA A;  4B69 A;  5LV9 A;  3AE3 A;  4UDR A;  1DJQ A;  1JNR A;  3AED A;  2OAL A;  4AT0 A;  4H50 A;  3D9X A;  3GYJ A;  4WX1 A;  3CNP A;  1YY5 A;  1ZOY A;  1JRX A;  3UKF A;  2NPX A;  1RP0 A;  1BKW A;  2BCP A;  1E6E A;  3M12 A;  2B9Y A;  2QCU A;  3UKA A;  2VQ7 A;  2E4G A;  1GRF A;  1PBF A;  3DGH A;  2YVJ A;  1CBO A;  1EBD A;  2A8X A;  2FJE A;  5ER0 A;  4GUV A;  4EQX A;  4U8I A;  4IVM B;  4YKG A;  3QJ4 A;  1YQ3 A;  5KXJ A;  1BGJ A;  5C2T A;  1O5W A;  4H4V A;  1PBE A;  1Q1W A;  4JN9 A;  1H81 A;  2X99 A;  3DA1 A;  3LZX A;  4EM3 A;  4JQ9 A;  3CND A;  5KVH A;  4N9X A;  4XWZ A;  4H4R A;  1LJ1 A;  1QJD A;  2WPC A;  3L5O A;  1NDA A;  2AQJ A;  2C65 A;  4U2L A;  1JEH A;  3KPF A;  1JNZ A;  3SM8 A;  1CJ2 A;  2A89 A;  3FPZ A;  4D04 A;  1OJD A;  1B4V A;  4Z26 A;  1H83 A;  4JY3 A;  4OPI A;  1NEK A;  2GQW A;  4EQR A;  3LB8 A;  1IUS A;  4U8O A;  5KRQ A;  4OPT A;  3GSI A;  2OLN A;  3EPT A;  2O9Z A;  4H4Y A;  4J31 A;  2WPF A;  1VDC A;  2WQY A;  4IV9 A;  5HYM A;  4LU6 A;  3UOV A;  1GRH A;  2QA2 A;  2V60 A;  3AYJ A;  3PG6 A;  1PJ7 A;  4IVO B;  4TM1 A;  1IUV A;  2GMJ A;  3NNE A;  4B63 A;  4H4Q A;  3RP8 A;  4E0V A;  1M64 A;  4DGK A;  2YLS A;  4YTP A;  1H86 A;  4G73 A;  5L46 A;  3DJJ A;  3QSS A;  2BC0 A;  4H2N A;  4B64 A;  3CNT A;  1GT8 A;  3BI4 A;  1VQW A;  3C4A A;  5U63 A;  1VG9 A;  5KMR A;  4XXG A;  3SFD A;  4H4Z A;  1SEZ A;  2FJA A;  3NHO X;  2VRM A;  1UKV G;  2BRY A;  3ATR A;  1PXC A;  5C3J A;  2BS4 A;  4U8L A;  4FK1 C;  1ZMC A;  2C3C A;  3NK1 X;  3DK4 A;  5GSN A;  4Z24 A;  3CPH G;  4AT2 A;  1DOC A;  4H2R A;  4UP3 A;  2IVE A;  4ZCD A;  3CPJ G;  4J33 A;  2C72 A;  1BGN A;  5HY5 A;  1JU2 A;  3P4S A;  3SZW A;  5GRT A;  2EQ8 A;  5EBK A;  1O95 A;  4D03 A;  1NHS A;  3Q6J A;  2TPR A;  1PN0 A;  2JB3 A;  3CIR A;  2RAB A;  3AEB A;  3IHG A;  5FS7 A;  4GR1 A;  2XVH A;  4REK A;  3AD9 B;  2XFN A;  4YSY A;  1ZY8 A;  2XLU A;  3NK2 X;  4H4W A;  5J7X A;  3AE4 A;  2B7S A;  3M0O A;  1NHQ A;  1S7M A;  4GRT A;  3SYI A;  2WBA A;  5U25 A;  1N1P A;  2YLT A;  3T2K A;  1GES A;  1CL0 A;  3P4R A;  2ZBW A;  3RP6 A;  2Z5X A;  2EQ7 A;  4CY6 A;  1IUW A;  3AD8 B;  4NNJ A;  2EQ6 A;  4CRT A;  1Q9I A;  2BS3 A;  3HYX A;  3IC9 A;  2VVL A;  1GRA A;  3NN0 X;  2CVJ A;  3BNM A;  5U1O A;  3CTY A;  1ZKQ A;  2WOV A;  4GCM A;  4GAP A;  2V3B A;  1B37 A;  4HB9 A;  3CMM A;  1L0V A;  3KLJ A;  5EB5 A;  4YT0 A;  5BRT A;  1FCD A;  4OCG A;  2R0P A;  3QFB A;  3IWA A;  1PJ6 A;  4JNQ A;  2QAE A;  2Q0K A;  3SZF A;  1GXF A;  1GET A;  4GDP A;  2YVF A;  4RG3 A;  1MXT A;  3AE7 A;  4LA1 A;  2YQU A;  1TYT A;  4AP1 A;  2YG6 A;  3BI2 A;  3UP5 A;  3VRA A;  2WES A;  2WDQ A;  3GDP A;  3ISH A;  1NPX A;  1CC6 A;  3NG7 X;  4II3 A;  1ZMD A;  4EIQ A;  3UTF A;  1BZL A;  1L9C A;  2JB2 A;  1GTE A;  1EL7 A;  1PXB A;  1RSG A;  5FMH A;  4NTD A;  2OLO A;  4YTM A;  2VZ2 A;  4UDP A;  3SZC A;  3I3L A;  3S61 A;  4YTN A;  3NIX A;  5JCK A;  1L9D A;  4IA5 A;  1GSN A;  4BUR A;  1KSU A;  3NT6 A;  2R46 A;  3UKQ A;  3KPK A;  3K7T A;  2ZZ0 A;  1CC2 A;  2R4E A;  4Y4M A;  3EF6 A;  2WOI A;  3ABV A;  3UKP A;  3GWF A;  3P9U A;  4U2S A;  5JCL A;  3GMC A;  2AAQ A;  1DOB A;  1N4V A;  1TDK A;  1HYU A;  3G5R A;  1D4C A;  2EQ9 A;  3I6D A;  5IPY A;  4ADW A;  4NTE A;  1K4Q A;  1E1L A;  2WP6 A;  3CN8 A;  1QLB A;  3IF9 A;  2BXR A;  3FBS A;  4JY2 A;  4ECH A;  2Q0L A;  3CNJ A;  2Y6R A;  2C75 A;  4G6H A;  5J60 A;  1K0I A;  4B1B A;  2BAB A;  1LTX R;  4APN A;  4M52 A;  3D1C A;  4NZH A;  2V5Z A;  1MO9 A;  3PS9 A;  2FJB A;  2XVE A;  1GRG A;  3OZ2 A;  2BC1 A;  4JDR A;  3P4Q A;  4TM0 A;  1F3P A;  2BA9 A;  2OA1 A;  3ALM A;  4OPL A;  2WDR A;  3M13 A;  5JCM A;  1E1M A;  3KVE A;  4USR A;  3LJP A;  1PBD A;  1GRB A;  2HQM A;  1DXL A;  1KNP A;  2XFO A;  4J57 A;  2GR2 A;  2GEW A;  1PDH A;  3SQP A;  3NTD A;  1N4W A;  4H4U A;  3NKS A;  4C5O A;  2YG5 A;  1ZK7 A;  1DOD A;  4PAA A;  4OPG A;  3P1W A;  2XCG A;  3GMB A;  4FX9 A;  4EMW A;  2JK6 A;  5M10 A;  4X9M A;  1GRT A;  1JRY A;  3AEA A;  2XLP A;  3SX6 A;  2BK3 A;  3LZW A;  3QSM A;  1E1N A;  3H8I A;  2VRL A;  4RSL A;  2DKI A;  4YSZ A;  2CDU A;  1KDG A;  2XFU A;  2XVF A;  1FEB A;  2WPE A;  3AE8 A;  2X8H A;  4C3X A;  4Z44 A;  1JRZ A;  1GPE A;  2BS2 A;  2GV8 A;  3QFA A;  2GF3 A;  4YWO A;  3ZYX A;  2WOW A;  2I0Z A;  1IJH A;  2YWL A;  1JOA A;  1CJ4 A;  1D4E A;  4X4J A;  5BUL A;  4H4T A;  1XPQ A;  2PHH A;  2ZZB A;  4BK2 A;  2C3D A;  3NTA A;  2GAH B;  3DK9 A;  4K7Z A;  1W4X A;  2GB0 A;  5BUK A;  3AWI A;  4H2Q A;  3NYE A;  1BF3 A;  3ZDN A;  2YR5 A;  1GAL A;  1PBC A;  3K7M X;  4A99 A;  3NRN A;  4RG4 A;  5KOW A;  4DNA A;  3BHK A;  1XHC A;  2XFP A;  3QSE A;  2OAM A;  4KX6 A;  2BK4 A;  2R9Z A;  3WE0 A;  4A65 A;  2B76 A;  3FMW A;  1BWC A;  4U8J A;  3V76 A;  1KFY A;  3G5Q A;  3GYI A;  3NYC A;  2JAE A;  4U8M A;  3VR8 A;  4J56 A;  4O5Q A;  4A7A A;  4NWZ A;  1H82 A;  4Z2T A;  1E1K A;  3GD3 A;  3K7Q X;  4OVI A;  2GMH A;  1CF3 A;  2WDV A;  2F5Z A;  2IVD A;  4A5L A;  1AOG A;  1DNC A;  1ZP0 A;  3G5S A;  2W0H A;  2YLX A;  4J36 A;  3GD4 A;  3R9U A;  4EMJ A;  1PHH A;  3ICT A;  4UDQ A;  3T2Z A;  4C3Y A;  3SZ0 A;  3DH9 A;  2VOU A;  3SGL A;  3DGZ A;  4BK1 A;  1N4U A;  3FG2 P;  3ICS A;  2A87 A;  1O94 A;  3HZL A;  3EAN A;  3ITJ A;  2V3A A;  1GV4 A;  5IQ4 A;  5JCI A;  2WEU A;  2YLZ A;  1V59 A;  3DME A;  2GR1 A;  4I58 A;  5FS8 A;  3KU9 A;  2R45 A;  3AEF A;  5KWF A;  3AYI A;  2WU5 A;  3BI5 A;  2GRT A;  4IA6 A;  3VQR A;  3UCL A;  3O0H A;  1NHP A;  1OJT A;  3QVR A;  4GAV A;  4J34 A;  2XFQ A;  3B6D A;  3IHM A;  4BJZ A;  4I59 A;  1GTH A;  4AOS A;  3V3N A;  2GH5 A;  3UP4 A;  1Y0P A;  4FK1 A;  2BCG G;  2PYX A;  2X50 A;  2X8G A;  1Z6L A;  2WP5 A;  2FJD A;  1LV0 A;  2E5V A;  1IUX A;  1QO8 A;  3P4P A;  4II2 A;  3CGD A;  2WHD A;  4H4X A;  2R0C A;  3HYV A;  4GDE A;  5KNL A;  5KMQ A;  4EM4 A;  1REO A;  2Y6Q A;  1TDE A;  3ALJ A;  4OPU A;  1VG0 A;  2YAU A;  2BYB A;  1F8W A;  3NLC A;  5M0Z A;  4C77 A;  1XAN A;  1XDI A;  2GR3 A;  2ACZ A;  1LVL A;  4FDC B;  1D4D A;  2VVM A;  1TDF A;  1KSS A;  3AE9 A;  2BAC A;  3ICR A;  5KMS A;  2XDO A;  3KA7 A;  4YKF A;  3VR9 A;  4Y4L A;  4DSG A;  2Z5Y A;  3NN6 X;  2YM2 A;  3H4K A;  2GAG B;  1Y56 A;  2IID A;  4Z43 A;  3AEG A;  3GRT A;  5HHF A;  4LII A;  2RGH A;  3CGB A;  1H6V A;  1K0L A;  4WCT A;  1H2I A;  1GND A;  1FL2 A;  3L1R A;  1ZDL A;  2XLR A;  1NAA A;  4H2P A;  5EB4 A;  5CQF A;  2FBW A;  3F8R A;  4HA6 A;  1PXA A;  2YLR A;  1E39 A;  2C70 A;  4EQS A;  2Q6U A;  1PBB A;  2YR6 A;  2WP9 A;  2YM1 A;  3T2Y A;  4EIP A;  4Y4N A;  2C4C A;  2TMD A;  3UKH A;  1ONF A;  1F6M A;  5DBJ A;  3RED A;  3UOY A;  1H7W A;  3UTE A;  4A6N A;  4AP3 A;  4BV6 A;  2H88 A;  1KN0 A;  1P2H A;  5KMP A;  1M6I A;  2C64 A;  2NVK X;  3RNM A;  2XVI A;  4TM3 A;  3VRD B;  5FS6 A;  4DSH A;  4YSX A;  2DKH A;  4EMI A;  3UTH A;  5BVA A;  1TRB A;  3DJG X;  3E1T A;  4OPC A;  4CNK A;  5IQ1 A;  2APG A;  2XYO A;  3AE1 A;  1DJN A;  1EL9 A;  4USQ A;  1IUT A;  3AD7 B;  3CPI G;  2WS3 A;  4PAB A;  1NG3 A;  3FIM B;  2H89 A;  4K22 A;  3DK8 A;  1FEA A;  1NEN A;  3DJD A;  4G6G A;  2GR0 A;  3BHF A;  3ADA B;  3COX A;  2YR4 A;  3H8L A;  3GYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...