3DH9A

Crystal structure of drosophila thioredoxin reductase, wild-type
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
482
structure length
482
Chain Sequence
QGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 1
publication title Crystal Structure of Drosophila Thioredoxin Reductase, wild-type
rcsb
source organism Drosophila melanogaster
total genus 153
structure length 482
sequence length 482
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3dh9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dh9A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dh9A02
2JB3A 1VQWA 4OPIA 2R4EA 2VRLA 2C67A 3RNMA 4I59A 5L46A 4YXDA 2GH5A 1DODA 4BURA 3F8PA 4U8MA 3GMBA 1DOBA 2E5VA 5EB4A 3CIRA 3GDPA 3DGZA 3ZDNA 3QFBA 3OZ2A 2BXRA 3QSEA 1O94A 3IHGA 1Y0PA 5IQ4A 3M13A 2E1MA 1KNPA 3CTYA 4XWZA 1TDFA 3UCLA 4A9WA 3NG7X 1FCDA 3GD3A 2WQYA 2YG7A 4RG4A 2Q0KA 2VRMA 3UKAA 2WOWA 1LQUA 2WPEA 4C3YA 1H6VA 4EM4A 2PYXA 4H4VA 2WDRA 3CNPA 3GWFA 4K22A 1E1NA 5DBJA 3DK4A 2C75A 5M0ZA 4ZCCA 3UOYA 3NN6X 1TDNA 2C65A 3CGEA 2GQFA 3LJPA 4YTMA 2YWLA 2NVKX 3VR9A 1CJ4A 4Z2RA 4H4RA 4Y4NA 2JBVA 2H89A 3AEBA 1NDAA 3KPFA 2RGJA 4J36A 2XFOA 3PS9A 1H86A 4B67A 2R4JA 5EBKA 2JB1A 2WDVA 2VOUA 2XVHA 3V3NA 3FBSA 1GV4A 1K0JA 1REOA 4ECHA 3L1RA 4AOXA 3EF6A 1PJ5A 2A8XA 1NHRA 2V61A 3CNTA 3NYCA 4AT0A 2FJAA 1IUSA 1S3EA 3NRNA 2QA1A 3KLJA 4TM1A 2WU5A 5CKUA 3CN8A 3ALJA 3GYIA 4PAAA 1E39A 2OAMA 3NKSA 1NHPA 5J7XA 4KPRA 1BWCA 3LXDA 4C3XA 2YM2A 4YSZA 1RSGA 3COXA 3LZWA 4A99A 3LADA 4H4XA 1YKJA 3NK1X 3AEDA 1TYTA 1F3PA 3K7TA 3NYFA 4U8KA 3S5WA 4APNA 2C66A 2WS3A 1FEAA 1F6MA 4OPCA 4J56A 3VRBA 3SFDA 2XLUA 2XFQA 4K5SA 4IVMB 1CL0A 3NTAA 2XVJA 1M6IA 3UP4A 4M52A 4Z26A 4O5QA 4J57A 4YWOA 2OALA 1PXAA 2TPRA 3GWDA 2AAQA 2XVIA 4CRTA 4DSHA 3BI5A 4B69A 2Y6RA 4TM3A 2ZZCA 3DMEA 2R9ZA 3UOZA 3HZLA 2CULA 2GVCA 2YQUA 1PS9A 1GRGA 1ZDLA 3CGCA 3P4QA 2Q0LA 2YM1A 4HA6A 3UOVA 3QFAA 3P4RA 4FK1A 1B8SA 1S3BA 4J33A 1JRYA 2A87A 1O5WA 1L9EA 4K2XA 5U63A 1GALA 1TDEA 1V59A 2BK4A 3E1TA 4YTNA 5JCLA 1ZY8A 4MJWA 3UKPA 1E7PA 4AT2A 2EQ7A 4NZHA 4H2QA 5BUKA 2YG4A 5GRTA 3S61A 2J3NA 1IUVA 2GF3A 1N4WA 1PHHA 2QA2A 3IF9A 3PO7A 1DNCA 4JY3A 2AQJA 1MO9A 5TR3A 5BVAA 1B4VA 2APGA 4NTDA 1CF3A 3CPHG 3GRTA 4H4SA 3AE1A 4NTCA 4X4JA 2B76A 4GUVA 3QJ4A 3DJGX 1GESA 3H4KA 4U8NA 4UP3A 2B7RA 4LA1A 3Q9TA 4XWRA 3VRDB 1TDKA 4K8DA 4REKA 1KF6A 2WETA 3B6DA 1E1LA 1ZOYA 4YTPA 2XLTA 2XLPA 4H50A 1JEHA 2EQ9A 1PBDA 1YQ4A 2R0PA 4IA6A 4TLXA 4A6NA 4U8JA 5KWFA 4N9XA 1VG0A 3GD4A 1DXLA 5JCKA 2Y6QA 3IHMA 3UTEA 4B65A 4UDPA 2YLRA 4EMIA 2GMJA 2V6OA 2BCPA 4A5LA 1S2QA 2OLOA 4B68A 4H4ZA 2JAEA 2OA1A 3K7QX 4YKFA 1DJNA 1S2YA 2B9XA 1K0LA 5JCIA 1ZP0A 2C3CA 4D04A 2WDQA 2JB2A 4HB9A 3SFEA 5J60A 2CVJA 1FEBA 1N4VA 3RP8A 1PXBA 3GSIA 2XFNA 3B3RA 3ISHA 1O95A 4H4TA 3SM8A 4B66A 1GREA 2WP6A 3DA1A 1UKVG 1YQZA 1EL7A 3AD7B 3BHKA 3KKJA 3G5QA 1FL2A 3NTDA 1YY5A 2BS4A 4EQSA 1FECA 2C3DA 4YKGA 2GB0A 3G5RA 1EBDA 4USRA 3UKKA 2WOIA 1MOKA 1PJ6A 2V5ZA 1Y56B 4CY8A 1Y56A 1P2EA 2XVFA 1ZK7A 1L9CA 2Q6UA 3AEFA 3ICSA 4WCTA 3SGLA 4BK2A 4NEVA 2IVEA 3LB8A 2RGOA 4K5RA 1ZOVA 2WOVA 3AE5A 2WP9A 4EMWA 4WX1A 1CHUA 4CY6A 3GYJA 3EANA 3BHFA 3AEGA 3EPTA 1TRBA 1PJ7A 3AEEA 2XFUA 1BGNA 4A7AA 4CNJA 3AE3A 2X50A 4TLZA 4Z25A 1D4DA 3EAOA 3LZXA 2CDUA 4OPGA 1JRXA 4EIPA 4C77A 1D5TA 4IVOB 3CNJA 4J34A 5HXIA 4D03A 3K7MX 2FJEA 2GR3A 1LQTA 2BC0A 2WPCA 1RP0A 1QO8A 2XLRA 4EIQA 2QCUA 4CBQA 4Z2TA 3QVPA 2ARDA 3BNMA 4J2WA 2X8GA 3Q6JA 4EM3A 1MXTA 3RP7A 1NAAA 2B9WA 3D1CA 1NENA 3H8IA 1L0VA 5KVHA 3ICTA 3KVEA 3WE0A 3RP6A 1GT8A 1FOHA 3URHA 2F5ZA 4J31A 2BK3A 4CCRA 4OPDA 1D4CA 4U2SA 1YQ3A 3UKLA 1W4XA 3VRAA 4B63A 4I58A 5LV9A 2GMHA 1M64A 4FK1C 3VQRA 5EB5A 1H81A 2E4GA 4YSXA 3V3OA 4C74A 1GTHA 4IA5A 2BABA 3AE7A 3QSSA 3UTGA 5BULA 4JDRA 2H88A 1OJTA 3REDA 1E1MA 3M12A 1EL8A 4GCMA 3R9UA 4E0VA 1ZKQA 2BS3A 4JNAA 4USQA 5HY5A 1GRTA 3AE4A 1KNRA 4BV6A 4TM0A 1KDGA 5JCNA 2YR5A 3I3LA 4H2NA 2R45A 3FMWA 1GETA 3UTHA 3QSMA 1D7LA 3QVRA 4OPUA 2ZZ0A 2IIDA 3DJDA 1CJ3A 3RHAA 1BKWA 4O5UA 5HYMA 3CGDA 2BXSA 1IUXA 2UZZA 1XANA 2YAUA 1HYUA 1JNRA 3ATRA 1GEUA 2GRTA 1PN0A 1CBOA 1NEKA 2FJDA 3GDNA 1QLBA 4Z24A 4U8LA 2BA9A 2GR0A 1F8WA 4GDEA 4OPTA 3V76A 3CGBA 2C64A 4ICYA 3AWIA 2V3BA 3NH3X 4DGKA 2WEUA 5HHFA 1H83A 3BI4A 5GSNA 1GTEA 4EQWA 1NHSA 1LPFA 4Y4MA 4P9SA 4DSGA 4EQRA 3ADAB 3BI2A 2DKHA 3KA7A 2YG5A 4CCQA 3G5SA 3FIMB 2XDOA 4H7UA 4JN9A 3CNSA 2YVJA 2X99A 1E6EA 3NN0X 1BF3A 5KOXA 3ITJA 1ELIA 1JOAA 1E1KA 1BZLA 2GQWA 3DGHA 3ATQA 3P9UA 2YLXA 4X9NA 2AR8A 2R0GA 3FG2P 4U8OA 4ZCDA 4JY2A 2GAGB 5EOWA 2YVGA 1CC4A 2R0CA 3IWAA 3DK8A 4UDRA 1ZMDA 1JRZA 5ER0A 4B1BA 2YG6A 4H4PA 4NTEA 1NG4A 2FJBA 3NLCA 5IPYA 2Z5YA 1IUTA 1CC2A 1XHCA 3UTFA 1GRHA 2ZBWA 3AECA 3NK0X 3KU9A 4Z2UA 2EQ6A 4U8PA 4AP1A 2JK6A 3H8LA 1OJDA 4ZN0A 2C7GA 1GPEA 3P1WA 3C96A 4GF7A 1GXFA 1DOCA 1PDHA 4GRTA 2X8CA 2VZ2A 1GNDA 4C5OA 1NHQA 3AXBA 3DJEA 3P4PA 2GV8A 2ZZBA 1NPXA 3KD9A 1B37A 5IQ1A 2BCGG 2C70A 2RABA 4OCGA 4Y4LA 2DKIA 1B5QA 4U8IA 2YLWA 3UP5A 1QJDA 1PBFA 4LU6A 2B9YA 4YSYA 1ZX9A 2IVDA 2YLSA 1XDIA 5FS8A 2ACZA 1OJ9A 2VVLG 5FS6A 3UOXA 2YR4A 4EMJA 3CPIG 4A65A 2WPFA 2Q7VA 2WU2A 1K0IA 3AD8B 3AE9A 4OPLA 5FS7A 2V60A 2VQBA 2YLTA 1RYIA 1GRAA 2QAEA 3UKHA 4H2RA 5C3JA 2VVLA 2BYBA 4BJYA 1F8RA 3DK9A 1XPQA 5U1OA 1KSSA 4JQ9A 4H2PA 4H4UA 2WESA 2GR1A 3ZYXA 4KX6A 2B7SA 3T37A 2XLSA 2GAHB 2WP5A 1N4UA 2YR6A 3NGCX 3F8DA 2I0ZA 1Z6LA 1OJAA 2CFYA 1GERA 2Z5XA 2A89A 2JKCA 1LVLA 1SEZA 3NIXA 5FS9A 3AB1A 3I6DA 2XCGA 3F8RA 4K7ZA 1CJCA 2XVEA 4PABA 3GMCA 2YVFA 3FPZA 1ONFA 3IC9A 3NK2X 4IV9A 4EQXA 1IUWA 3II4A 4FDCB 3JSKA 5BRTA 1NG3A 5KOWA 1ZMCA 1D4EA 2XYOA 3PVCA 2TMDA 4TM4A 2BK5A 3UKQA 3VR8A 1GOSA 4AOSA 4BK1A 2BC1A 1EL5A 3ALLA 1Q1RA 2BS2A 3AE8A 3AYJA 3AEAA 4AP3A 3CPJG 1N1PA 1EL9A 4YSHA 5KXJA 1TDOA 1VRQB 1IUUA 4DNAA 3NHOX 4Z44A 1H7WA 1PBBA 3NYEA 1X31B 2YG3A 4B64A 3ICRA 2GR2A 1PBEA 2FBWA 4CNKA 2X8HA 1JU2A 2VQ7A 4JNQA 3CNDA 3BNUA 4BK3A 3P4SA 5CQFA 4ADWA 4RG3A 4OVIA 3GRSA 1KSUA 4GDPA 1PXCA 4UDQA 3ABVA 3C4AA 4BJZA 3AE6A 4A79A 2HQMA 2RGHA 5JCMA 2X3NA 3NNEA 1LJ1A 1GRBA 1CJ2A 1K4QA 2R46A 3O0HA 4GR1A 1Q1WA 5M10A 2OLNA 3LOVA 3L8KA 2PHHA 1IJHA 4H4YA 1H7XA 5FMHA 1D7YA 1LTXR 2WBAA 3DJJA 2BACA 3SQPA 5KVIA 1Q9IA 2VVMA 3AYIA 4YT0A 3OC4A 1GSNA 5KRQA 1H84A 2C76A 3ALMA 3C4NA 1TYPA 2V3AA 4Z43A 3NT6A 1PBCA 1LV0A 3AE2A 1VG9A 3AD9B 1CC6A 2O9ZA 3DH9A 4U2TA 4RSLA 1COYA 1JNZA 2EQ8A 2GEWA 1OJCA 2XFPA 1F8SA 1DOEA 4H4QA 2C72A 5C2TA 1GRFA 4X9MA 4LIIA 4FX9A 4U2LA 4H4WA 1KFYA 3M0OA 5U25A 2WHDA 2W0HA 1AOGA 3D8XA 3K30A 4NEWA 1DJQA 1H82A 2NPXA 4XXGA 1VDCA 1BGJA 3AYLA 2YLZA 1L9DA 1P2HA 3UKFA 4A6NB 2C73A
chains in the Genus database with same CATH superfamily
4OPIA 1VQWA 2R4EA 4I59A 5L46A 4YXDA 1DODA 4U8MA 3GMBA 2E5VA 3OZ2A 3UXKA 2PGWA 1H2IA 4XWZA 4A9WA 2PP0A 3RO6A 4RG4A 2WOWA 2WPEA 2PYXA 5M0ZA 4ZCCA 2GQFA 3LJPA 4Z2RA 1KKRA 4Z1YA 3AEBA 3DFYA 2P0IA 2XVHA 4E8GA 4ECHA 1S7MA 1MNSA 3SR6B 4AOXA 3QKEA 4M0XA 2XH0A 2WU5A 3ALJA 1SJAA 2MUCA 3COXA 3NK1X 4U8KA 1F3PA 4J56A 2XLUA 1MDLA 2XVJA 2O56A 4Z26A 4O5QA 4YWOA 2NQLA 3DG3A 4CRTA 4B69A 1FFUC 2ZZCA 2CULA 4GAVA 1PS9A 3P4QA 3CGCA 2Q0LA 3VCNA 3QFAA 3P4RA 2PMQA 5IDZA 4YTNA 2BK4A 3E1TA 1ZY8A 1E7PA 3SXIA 2EQ7A 5BUKA 2GF3A 1PHHA 4JY3A 4ENLA 5TR3A 5BVAA 2OZ3A 1CF3A 3CPHG 3EEZA 4NTCA 3DJGX 2QVHA 3H4KA 4LA1A 1KF6A 2QJMA 2AL2A 1JEHA 4TLXA 4U8JA 2OZTA 1DXLA 4EMIA 3FYYA 2GMJA 2BCPA 4A5LA 4NWZA 2OLOA 2OA1A 4YKFA 5JCIA 1ZP0A 3OW1A 2WDQA 2CVJA 2QDDA 3STPA 1PXBA 3ISHA 2XFNA 4H4TA 1GREA 2WP6A 3DA1A 1UKVG 1YQZA 3R25A 3T0KA 3NRZB 2FYMA 2BS4A 2XH4A 3NFUA 4HN8A 2GL5A 2XVFA 1L9CA 4WCTA 4NEVA 2WOVA 3AE5A 3HYXA 3MWCA 4CY6A 3EANA 3AEGA 3UCDA 2XFUA 3AE3A 2OQYA 3CNJA 3K7MX 2BC0A 3U4FA 2QCUA 4CBQA 4Z2TA 3QVPA 2ARDA 3BNMA 4HPNA 1NAAA 2B9WA 3D1CA 3FJ4A 4MKSA 3H8IA 3AMZA 3DG6A 4J31A 2BK3A 6ENLA 4I58A 2GMHA 5EB5A 2DW6A 1GTHA 4IA5A 3UTGA 4JDRA 2H88A 1OJTA 3R9UA 4GCMA 3AE4A 1KNRA 4BV6A 3H8AA 3I3LA 3N6JA 1F9CA 2IIDA 3TWBA 1IUXA 2UZZA 1JNRA 1GEUA 1CBOA 1NEKA 2BRAA 2FJDA 1QLBA 4Z24A 4U8LA 3ZLFA 1F8WA 4GDEA 3CGBA 4IP5A 4ICYA 3I4KA 5HHFA 3V5FA 4EQWA 1LPFA 3SYIA 3KA7A 4JN9A 2QDEA 1ELIA 2R0GA 3FG2P 4JY2A 2GAGB 5EOWA 3IWAA 5ER0A 4NTEA 2OPJA 2Z5YA 1IUTA 3UGVA 1JRPA 1E9IA 3AECA 4Z2UA 4U8PA 2C7GA 1ECQA 4GRTA 1NHQA 2ZZBA 2FKPA 3AM9A 3Q45A 3CK5A 3RITA 4Y4LA 1B5QA 4U8IA 4EWJA 2YLWA 1PBFA 2YLSA 2VVLG 2ACZA 3UOXA 3V3WA 4J1OA 4EMJA 2Q7VA 3DGBA 3SN0A 2YLTA 2AKZA 2VVLA 1IYXA 3CAWA 1XPQA 1KSSA 4H2PA 4KX6A 1P43A 4E4UA 4GMEA 2YR6A 3F8DA 3GD6A 5FJRA 1GERA 4A6GA 2P8BA 1CJCA 4X2PA 4PABA 2YVFA 3R07C 3NK2X 2ZADA 4IV9A 2OVLA 3JSKA 3VR8A 2TMDA 2BK5A 2AKMA 3ALLA 2OZ8A 4GGHA 3QTPA 3MSYA 3FVDA 1VRQB 5KMRA 3R0UA 3VC5A 3OZMA 1WUEA 1SJCA 3BNUA 4UDQA 3U9IA 2HQMA 3T2YA 2RGHA 3SSZA 3NNEA 1LJ1A 4JN8A 3L8KA 3S61A 1D7YA 4YT0A 1GSNA 3NVWB 2C76A 1LV0A 2XSXA 4IT1A 4U2TA 2E3TA 3TWAA 1GRFA 4X9MA 4FX9A 4H4WA 4NNJA 1KFYA 5U25A 2W0HA 1AOGA 1ZXIC 4HNCA 2NPXA 2YLZA 1DTNA 4A6NB 2JB3A 2GH5A 4G9KA 5EB4A 3CIRA 3ZDNA 3QFBA 5FJUA 2BXRA 2GGJA 1O94A 3IHGA 5IQ4A 2E1MA 1FCDA 3S5SA 2Q0KA 2VRMA 3UKAA 4C3YA 1H6VA 4E5TA 2GGGA 3NN6X 1P48A 4YTMA 2YWLA 3VR9A 1CJ4A 2H89A 1NDAA 3GO2A 4E4FA 5EBKA 1TE6A 2OG9A 3V3NA 1JROA 1K0JA 1SJBA 3NYCA 1PDYA 3KLJA 4TM1A 1SB3B 3CN8A 3GYIA 4PAAA 4KPRA 1BWCA 1R0MA 4YSZA 3CXOA 3LADA 1KKOA 3AEDA 1TYTA 3K7TA 2PTYA 2PTZA 4APNA 2C66A 4OPCA 3VFCA 5KMQA 2OALA 4DSHA 3P0WA 4YWSA 2GVCA 1GRGA 5G5HB 4FK1A 1B8SA 1FO4A 3T4WA 2A87A 4K2XA 4A35A 1GALA 5JCLA 2HXUA 4MJWA 3UKPA 4AT2A 1ONEA 1IUVA 1N4WA 1KCZA 4IP4A 2APGA 3P3BA 1GESA 4U8NA 2PS2A 3K1GA 2BRYA 1E1LA 1ZOYA 2XLPA 1YQ4A 2EQ9A 4A6NA 5KWFA 4N9XA 1VG0A 3CB3A 2PTWA 4UDPA 2V6OA 2PA6A 3K7QX 1KD0A 1DJNA 2RDXA 1K0LA 2GGEA 1JPDX 2PODA 5J60A 4G73A 3RP8A 3GSIA 3B3RA 4B66A 4GAPA 4G8TA 1EL7A 3KKJA 3G5QA 1FL2A 1VDVA 3NTDA 3HPFA 5ENLA 3V5CA 2C3DA 2GB0A 1EBDA 1MOKA 1PJ6A 1Y56A 2Q6UA 3T31A 2RGOA 3PG6A 1ZOVA 4EMWA 4WX1A 3EPTA 1TRBA 3AEEA 4CNJA 4TLZA 3ZLHA 3EAOA 3LZXA 4OPGA 3SZ0A 1D5TA 4Z17A 4J34A 3N4FA 4D03A 1L8PA 2GR3A 2WPCA 1LQTA 1RP0A 2XLRA 4MMWA 3NVVB 4GIRA 3SQSA 3Q6JA 1MXTA 3RRAA 1L0VA 3KVEA 3WE0A 3RP6A 2W55A 3URHA 2F5ZA 4U2SA 5FJTA 3UKLA 5LV9A 1M64A 4KT2A 3V3OA 4C74A 3HW2A 3QSSA 4MGGA 1OEPA 3REDA 3NXLA 1EL8A 3HYWA 5HY5A 1N5XA 3UJEA 4TM0A 3FMWA 3QSMA 1N5WC 4OPUA 2OLAA 2PU0A 4HCHA 4O5UA 3V76A 3GC2A 3AWIA 4DGKA 3S47A 5GSNA 3PFRA 3CT2A 5EU9A 3R11A 1FFVC 1NU5A 2YG5A 3G5SA 5J04A 1E6EA 5KOXA 3ITJA 3P9UA 1E1KA 1BZLA 2GDQA 2YLXA 4X9NA 2AR8A 3MZNA 4ZCDA 4UDRA 3DK8A 1ZMDA 4B1BA 2YG6A 4H4PA 1NG4A 5IPYA 1GRHA 3KU9A 2JK6A 1OJDA 4ZN0A 2HZGA 3C96A 3EUB3 1GNDA 3AXBA 3DJEA 3P4PA 2GV8A 3D47A 5IQ1A 2BCGG 2RABA 2GSHA 3UP5A 3NZGA 5KMPA 4A65A 2WU2A 1K0IA 3NVZB 4G74A 1JDFA 2PCEA 5KNLA 1XS2A 3ZYXA 2B7SA 3VDGA 3NGCX 2I0ZA 3ES8A 2Z5XA 4TVWA 2A89A 2P8CA 4GYPC 1SEZA 5FS9A 3AB1A 3ZLGA 3CYJA 4K7ZA 2XVEA 3GMCA 1JCTA 4KPLA 1ONFA 4EQXA 1IUWA 4FDCB 5JRBA 2XYOA 1GOSA 2BC1A 1EL5A 1Q1RA 5G5GB 3H12A 3CPJG 1N1PA 2XH2A 3NHOX 1BKHA 1X31B 2OFJA 4DX3A 2OX4A 1MDRA 2X8HA 2VQ7A 4JNQA 4G7FA 4DWDA 4RG3A 1KSUA 1PXCA 1V97A 3SN4A 5JCMA 3QN3A 2OLNA 3LOVA 3V4BA 1TZZA 5FMHA 2WBAA 3SQPA 3SBFA 3H7VA 3OC4A 3IJQA 1H84A 2E5AA 3AE2A 3AD9B 1CC6A 2O9ZA 3UCCA 1JNZA 3QLDA 4H4QA 3TCSA 2P88A 3MQTA 1MUCA 1WYGA 1DJQA 3I6EA 1H82A 3UKFA 2VRLA 2C67A 3T6CA 4BURA 3F8PA 4II3A 1DOBA 3GDPA 3QSEA 4K1WA 2GGHA 1KNPA 3UCLA 3NG7X 3HRDC 2WQYA 1LQUA 3OZYA 2PSNA 4IHCA 4EM4A 4H4VA 2WDRA 3CNPA 1E1NA 2C75A 3UOYA 2C65A 3CGEA 3TJ4A 2JBVA 3KPFA 1JPMA 2XFOA 3PS9A 1H86A 3N6HA 2WDVA 2VOUA 1GV4A 3VC6A 2PPGA 1REOA 3EF6A 1PJ5A 4H2HA 1NHRA 3CNTA 3JW7A 3FV9A 1IUSA 1S3EA 3NRNA 5CKUA 1E39A 2OAMA 1NHPA 3UJRA 4DHGA 3LXDA 5FJOA 4GFIA 3SY4A 3TJIA 1X2HA 1YKJA 3NYFA 4H83A 3S5WA 2WS3A 4ZOHB 1FEAA 1F6MA 3SFDA 3PK7A 4IVMB 1TKKA 1MRAA 1RM6B 3GWDA 4G6HA 3BI5A 2PGEA 2XH7A 3UOVA 1S3BA 4J33A 1JRYA 1L9EA 1TDEA 2YG4A 5GRTA 2QA2A 3PO7A 3SZCA 1FHUA 2AQJA 1MO9A 4NTDA 4X4JA 3UXLA 4UP3A 3FCPA 4XWRA 1TDKA 4REKA 4YTPA 4IA6A 2R0PA 1PBDA 1WUFA 3BJSA 2Y6QA 3UTEA 2I5QA 1YEYA 3DERA 1S2QA 4B68A 4H4ZA 2B9XA 4ROPA 2C3CA 4D04A 1BQGA 4HB9A 3SM8A 1O95A 3AD7B 1YY5A 4YKGA 3G5RA 4USRA 3UKKA 1Y56B 1N62C 3A7AA 4CY8A 1ZK7A 3T8QA 3ICSA 3SGLA 3P93A 4K5RA 2WP9A 2QGYA 1CHUA 1PJ7A 4A7AA 4HNLA 4Z25A 1D4DA 3A7UA 4C77A 2MNRA 4IVOB 5HXIA 2FJEA 3B9JB 3H70A 4TVYA 4J2WA 2X8GA 3RP7A 1GT8A 4CCRA 4OPDA 1YQ3A 1SJDA 1W4XA 3VRAA 4B63A 3SZFA 3VQRA 1H81A 2E4GA 4YSXA 3AE7A 5BULA 3T9PA 3M12A 4E0VA 1X2GA 1EBHA 2BS3A 4USQA 1GRTA 2P3ZA 1KDGA 2YR5A 4H2NA 2R45A 3UTHA 3DIPA 2ZZ0A 3NO1A 2PTXA 3JZUA 2YAUA 1HYUA 3ATRA 2GRTA 1PN0A 3TW9A 4OPTA 2GR0A 2C64A 1EBGA 2V3BA 4F4RA 3NH3X 2WEUA 1GTEA 4Y4MA 4EQRA 4CCQA 3CNSA 2YVJA 2QJNA 2X99A 4H1ZA 3NN0X 3ATQA 2GQWA 1N63C 3IK4A 4U8OA 2YVGA 4HCLA 1CC2A 3UTFA 2ZBWA 2C4CA 4AP1A 3H8LA 3OTRA 1GPEA 1RVKA 1GXFA 1PDHA 3D46A 2POZA 4G6GA 4IZGA 4OCGA 1N61C 2DKIA 1QJDA 3ETRB 4LU6A 2B9YA 1OJ9A 5FS6A 2YR4A 3CPIG 3OPSA 3BSMA 2ONEA 3AE9A 1RYIA 1GRAA 2QAEA 4H2RA 3DK9A 5U1OA 4JQ9A 2GAHB 2WP5A 1OJAA 4GGBA 2JKCA 3NIXA 3I6DA 2XCGA 3ES7A 3F8RA 3FPZA 5FJPA 3PWGA 3DEQA 3II4A 5BRTA 1NG3A 5KOWA 1D4EA 4TM4A 3PVCA 3UKQA 3RCYA 3TTEA 4AOSA 4BK1A 2BS2A 3AE8A 3AEAA 5KXJA 1TDOA 1IUUA 2PU1A 4E6MA 3NYEA 4B64A 2GR2A 2FBWA 4CNKA 1EC8A 1VQZA 4BK3A 4ADWA 3GRSA 3ABVA 4BJZA 3AE6A 4A79A 3ZVIA 3R10A 3L5OA 1GRBA 4GR1A 1Q1WA 2PHHA 1IJHA 3KD9A 1H7XA 2BACA 2VVMA 3AN1A 5KVIA 4K2SA 3ALMA 1TYPA 2V3AA 3NT6A 4HCDA 3DH9A 4H19A 1COYA 2EQ8A 2GEWA 1OJCA 3SN1A 1DOEA 2C72A 4LIIA 4U2LA 4II2A 3D8XA 4NEWA 1VDCA 1BGJA 1FIQB 3AYLA 3MUCA 3RNMA 1XPYA 3DDMA 3KUMA 3UJFA 3GY1A 3DGZA 2GGIA 1Y0PA 3M13A 3CTYA 1TDFA 3GD3A 2YG7A 3IJIA 3A7RA 3GWFA 4K22A 5DBJA 3DK4A 4IL0A 3GYXA 1TDNA 2NVKX 2HXTA 4H4RA 4Y4NA 2RGJA 4J36A 4B67A 2R4JA 2JB1A 3NS1B 3FBSA 5BOFA 3L1RA 3R1ZA 2A8XA 2V61A 4AT0A 3D9XA 2FJAA 2QA1A 3NKSA 5J7XA 4C3XA 2YM2A 3Q4DA 1RSGA 3LZWA 4A99A 4H4XA 2OKTA 3VRBA 2XFQA 4K5SA 1CL0A 3NTAA 1EC7A 7ENLA 1M6IA 3UP4A 4KWSA 4M52A 4J57A 1PXAA 2TPRA 2AAQA 2XVIA 2Y6RA 4TM3A 3DMEA 2W3RA 2QJJA 2R9ZA 3VCCA 3UOZA 3HZLA 2CHRA 2YQUA 1ZDLA 4HA6A 2YM1A 3UJ2A 1O5WA 5U63A 1V59A 4NZHA 4H2QA 2J3NA 3IF9A 3QPEA 4FP1A 3TQPA 1DNCA 4ZA0A 1B4VA 5KMSA 3GRTA 4H4SA 3SJNA 3AE1A 2B76A 4GUVA 3QJ4A 2B7RA 3Q9TA 3VRDB 4K8DA 2WETA 3B6DA 3R0KA 2XLTA 4H50A 2W54A 3GD4A 5JCKA 3IHMA 4B65A 2YLRA 4A3RA 2JAEA 2AL1A 1S2YA 2JB2A 3SFEA 1FEBA 1N4VA 1STZA 3BHKA 4EQSA 1FECA 2WOIA 2V5ZA 1P2EA 3AEFA 4BK2A 1N60C 4JHMA 2IVEA 3LB8A 3DESA 4DYEA 1W6TA 4DN1A 3CXBA 3GYJA 3BHFA 3DG7A 1BGNA 2X50A 2CDUA 1JRXA 4EIPA 2QQ6A 1QO8A 4EIQA 4EM3A 1KN0A 1NENA 5KVHA 3ICTA 1FOHA 1D4CA 3ZVHB 4FK1C 3RGTA 3B97A 2BABA 1E1MA 1ZKQA 4JNAA 3KPKA 2PP1A 3PWIA 5JCNA 4GYPA 4DXKA 3BOXA 1GETA 3T2ZA 1D7LA 3QVRA 2DW7A 2OQHA 3DJDA 3RHAA 1CJ3A 1BKWA 5HYMA 3CGDA 2BXSA 1XANA 3GDNA 3MY9A 2BA9A 1R6WA 1H83A 3BI4A 4JN7A 1NHSA 4P9SA 4DSGA 3ADAB 3BI2A 2DKHA 3NVYB 3FIMB 5BOEA 2XDOA 4H7UA 1BF3A 1EC9A 1JOAA 1T3QC 3DGHA 3HYVA 2HNEA 1CC4A 2R0CA 1JRZA 2FJBA 3NLCA 3SZWA 1XHCA 3NK0X 2EQ6A 3P1WA 4GF7A 4KEMA 1DOCA 3T14A 2X8CA 2VZ2A 4C5OA 1FHVA 1NPXA 1B37A 2C70A 3SX6A 4YSYA 1ZX9A 4GISA 2IVDA 1XDIA 5FS8A 4M6UA 3EKGA 2OO6A 3CMMA 3N4EA 2WPFA 3AD8B 4OPLA 5FS7A 3ENLA 2V60A 2VQBA 3UKHA 5C3JA 2BYBA 4BJYA 1F8RA 4H4UA 2WESA 2GR1A 3RR1A 3T37A 3DFHA 2XLSA 1N4UA 1Z6LA 2CFYA 1LVLA 3IJLA 3ZVHA 1PDZA 3IC9A 3TOYA 4ZCWA 1ZMCA 3MKCA 3THUA 2PP3A 3JVAA 3AYJA 4AP3A 3OP2A 1EL9A 4YSHA 4IL2A 4DNAA 4Z44A 1H7WA 1PBBA 2YG3A 3FXGA 3ICRA 4FI4A 1PBEA 1JU2A 3CNDA 3P4SA 5CQFA 4OVIA 4GDPA 3T2KA 3C4AA 2W3SA 2XGZA 2X3NA 2ZC8A 1CJ2A 1K4QA 2R46A 3O0HA 5M10A 3UJSA 3VA8A 4H4YA 1LTXR 3DJJA 1Q9IA 3AYIA 5KRQA 3C4NA 4Z43A 1PBCA 4HYRA 1VG9A 4RSLA 2XFPA 1F8SA 5C2TA 1NELA 4J3ZA 3M0OA 2WHDA 1ELSA 4K8GA 3K30A 3I6TA 4XXGA 2AL2B 1L9DA 1P2HA 2C73A
chains in the Genus database with same CATH topology
2JB3A 1VQWA 4OPIA 2R4EA 2VRLA 2C67A 3RNMA 4I59A 5L46A 4YXDA 2GH5A 1DODA 4BURA 3F8PA 4G9KA 4II3A 4U8MA 3GMBA 1DOBA 2E5VA 5EB4A 3CIRA 3GDPA 3DGZA 3ZDNA 3QFBA 3OZ2A 2BXRA 3QSEA 1O94A 3IHGA 1Y0PA 5IQ4A 3M13A 2E1MA 1H2IA 1KNPA 3CTYA 4XWZA 1TDFA 3UCLA 4A9WA 3NG7X 1FCDA 3GD3A 2WQYA 2YG7A 4RG4A 2Q0KA 2VRMA 3UKAA 2WOWA 1LQUA 2WPEA 4C3YA 1H6VA 4EM4A 2PYXA 4H4VA 2WDRA 3CNPA 3GWFA 4K22A 1E1NA 5DBJA 3DK4A 2C75A 5M0ZA 4ZCCA 3UOYA 3GYXA 3NN6X 1TDNA 2C65A 3CGEA 2GQFA 3LJPA 4YTMA 2YWLA 2NVKX 3VR9A 1CJ4A 4Z2RA 4H4RA 4Y4NA 2JBVA 2H89A 3AEBA 1NDAA 3KPFA 2RGJA 4J36A 2XFOA 3PS9A 1H86A 4B67A 2R4JA 5EBKA 2JB1A 2WDVA 2VOUA 2XVHA 3V3NA 3FBSA 1GV4A 1K0JA 1REOA 1S7MA 4ECHA 3L1RA 4AOXA 3EF6A 1PJ5A 2A8XA 1NHRA 2V61A 3CNTA 3NYCA 4AT0A 3D9XA 2FJAA 1IUSA 1S3EA 3NRNA 2QA1A 3KLJA 4TM1A 2WU5A 5CKUA 3CN8A 3ALJA 3GYIA 4PAAA 1E39A 2OAMA 3NKSA 1NHPA 5J7XA 4KPRA 1BWCA 3LXDA 4C3XA 3SY4A 2YM2A 4YSZA 1RSGA 3COXA 3LZWA 4A99A 3LADA 4H4XA 1YKJA 3NK1X 3AEDA 1TYTA 1F3PA 3K7TA 3NYFA 4U8KA 3S5WA 4APNA 2C66A 2WS3A 1FEAA 1F6MA 4OPCA 4J56A 3VRBA 3SFDA 2XLUA 2XFQA 4K5SA 4IVMB 1CL0A 3NTAA 2XVJA 1M6IA 5KMQA 3UP4A 4M52A 4Z26A 4O5QA 4J57A 4YWOA 2OALA 1PXAA 2TPRA 3GWDA 4G6HA 2AAQA 2XVIA 4CRTA 4DSHA 3BI5A 4B69A 2Y6RA 4TM3A 2ZZCA 3DMEA 2R9ZA 3UOZA 3HZLA 2CULA 4GAVA 2GVCA 2YQUA 1PS9A 1GRGA 1ZDLA 3CGCA 3P4QA 2Q0LA 2YM1A 4HA6A 3UOVA 3QFAA 3P4RA 4FK1A 1B8SA 1S3BA 4J33A 1JRYA 2A87A 1O5WA 1L9EA 4K2XA 5U63A 1GALA 1TDEA 1V59A 2BK4A 3E1TA 4YTNA 5JCLA 1ZY8A 4MJWA 3UKPA 1E7PA 4AT2A 3SXIA 2EQ7A 4NZHA 4H2QA 5BUKA 2YG4A 5GRTA 3S61A 2J3NA 1IUVA 2GF3A 1N4WA 1PHHA 2QA2A 3IF9A 3PO7A 3SZCA 1DNCA 4JY3A 2AQJA 1MO9A 5TR3A 5BVAA 1B4VA 2APGA 4NTDA 5KMSA 1CF3A 3CPHG 5KOWA 3GRTA 4H4SA 3AE1A 4NTCA 4X4JA 2B76A 4GUVA 3QJ4A 3DJGX 1GESA 3H4KA 4U8NA 4UP3A 2B7RA 4LA1A 3Q9TA 4XWRA 3VRDB 1TDKA 4K8DA 4REKA 1KF6A 2BRYA 2WETA 3B6DA 1E1LA 1ZOYA 4YTPA 2XLTA 2XLPA 4H50A 1JEHA 2EQ9A 1PBDA 1YQ4A 2R0PA 4IA6A 4TLXA 4A6NA 4U8JA 5KWFA 4N9XA 1VG0A 3GD4A 1DXLA 5JCKA 2Y6QA 3IHMA 3UTEA 4B65A 4UDPA 2YLRA 4EMIA 2GMJA 2V6OA 2BCPA 4A5LA 1S2QA 4NWZA 2OLOA 4B68A 4H4ZA 2JAEA 2OA1A 3K7QX 4YKFA 1DJNA 1S2YA 2B9XA 1K0LA 5JCIA 1ZP0A 2C3CA 4D04A 2WDQA 2JB2A 4HB9A 3SFEA 5J60A 2CVJA 1FEBA 1N4VA 4G73A 3RP8A 1PXBA 3GSIA 2XFNA 3B3RA 3ISHA 1O95A 4H4TA 3SM8A 4B66A 1GREA 4GAPA 2WP6A 3DA1A 1UKVG 1YQZA 1EL7A 3AD7B 3BHKA 3KKJA 3G5QA 1FL2A 3T0KA 3NTDA 1YY5A 2BS4A 4EQSA 1FECA 2C3DA 4YKGA 2GB0A 3G5RA 1EBDA 4USRA 3UKKA 2WOIA 1MOKA 1PJ6A 2V5ZA 1Y56B 4CY8A 1Y56A 1P2EA 2XVFA 1ZK7A 1L9CA 2Q6UA 3AEFA 3ICSA 4WCTA 3SGLA 4BK2A 4NEVA 3T31A 2IVEA 3LB8A 2RGOA 3PG6A 4K5RA 1ZOVA 2WOVA 3AE5A 3HYXA 2WP9A 4EMWA 4WX1A 1CHUA 4CY6A 3GYJA 3EANA 3BHFA 3AEGA 3EPTA 1TRBA 1PJ7A 3AEEA 2XFUA 1BGNA 4A7AA 4CNJA 3AE3A 2X50A 4TLZA 4Z25A 1D4DA 3EAOA 3LZXA 2CDUA 4OPGA 1JRXA 4EIPA 3SZ0A 4C77A 1D5TA 4IVOB 3CNJA 4J34A 5HXIA 4D03A 3K7MX 2FJEA 2GR3A 1LQTA 2BC0A 2WPCA 1RP0A 1QO8A 2XLRA 4EIQA 2QCUA 4CBQA 4Z2TA 3QVPA 2ARDA 3BNMA 4J2WA 2X8GA 3Q6JA 4EM3A 1KN0A 1MXTA 3RP7A 1NAAA 2B9WA 3D1CA 1NENA 3H8IA 1L0VA 5KVHA 3ICTA 3KVEA 3WE0A 3RP6A 1GT8A 1FOHA 3URHA 2F5ZA 4J31A 2BK3A 4CCRA 4OPDA 1D4CA 4U2SA 1YQ3A 3UKLA 1W4XA 3VRAA 4B63A 4I58A 5LV9A 2GMHA 1M64A 4FK1C 3SZFA 5EB5A 3VQRA 1H81A 2E4GA 4YSXA 3V3OA 4C74A 1GTHA 4IA5A 2BABA 3AE7A 3QSSA 3UTGA 5BULA 4JDRA 2H88A 1OJTA 3REDA 1E1MA 3M12A 1EL8A 3HYWA 4GCMA 3R9UA 4E0VA 1ZKQA 2BS3A 4JNAA 4USQA 5HY5A 1GRTA 3AE4A 3KPKA 1KNRA 4BV6A 4TM0A 1KDGA 5JCNA 2YR5A 3I3LA 4H2NA 2R45A 3FMWA 1GETA 3T2ZA 3UTHA 3QSMA 1D7LA 3QVRA 4OPUA 2ZZ0A 2IIDA 3DJDA 1CJ3A 3RHAA 1BKWA 4O5UA 5HYMA 3CGDA 2BXSA 1IUXA 2UZZA 1XANA 2YAUA 1HYUA 1JNRA 3ATRA 1GEUA 2GRTA 1PN0A 1CBOA 1NEKA 2BRAA 2FJDA 3GDNA 1QLBA 4Z24A 4U8LA 2BA9A 2GR0A 1F8WA 4GDEA 4OPTA 3V76A 3CGBA 2C64A 4ICYA 3AWIA 2V3BA 3NH3X 4DGKA 2WEUA 5HHFA 1H83A 3BI4A 5GSNA 1GTEA 4EQWA 1NHSA 1LPFA 4Y4MA 4P9SA 3SYIA 4DSGA 4EQRA 3ADAB 3BI2A 2DKHA 3KA7A 2YG5A 4CCQA 3G5SA 3FIMB 2XDOA 4H7UA 4JN9A 3CNSA 2YVJA 2X99A 1E6EA 3NN0X 1BF3A 5KOXA 3ITJA 1ELIA 1JOAA 1E1KA 1BZLA 2GQWA 3DGHA 3ATQA 3P9UA 3HYVA 2YLXA 4X9NA 2AR8A 2R0GA 3FG2P 4U8OA 4ZCDA 4JY2A 2GAGB 5EOWA 2YVGA 1CC4A 2R0CA 3IWAA 3DK8A 4UDRA 1ZMDA 1JRZA 5ER0A 4B1BA 2YG6A 4H4PA 4NTEA 1NG4A 2FJBA 3NLCA 5IPYA 2Z5YA 1IUTA 1CC2A 3SZWA 1XHCA 3UTFA 1GRHA 2ZBWA 3AECA 3NK0X 2C4CA 3KU9A 4Z2UA 2EQ6A 4U8PA 4AP1A 2JK6A 3H8LA 1OJDA 4ZN0A 2C7GA 1GPEA 3P1WA 3C96A 4GF7A 1GXFA 1DOCA 1PDHA 4GRTA 3T14A 2X8CA 2VZ2A 1GNDA 4C5OA 1NHQA 3AXBA 3DJEA 3P4PA 2GV8A 2ZZBA 1NPXA 3KD9A 1B37A 4G6GA 5IQ1A 2BCGG 2C70A 2RABA 4OCGA 3SX6A 4Y4LA 2DKIA 1B5QA 4U8IA 2YLWA 3UP5A 1QJDA 1PBFA 4LU6A 2B9YA 4YSYA 1ZX9A 2IVDA 2YLSA 1XDIA 5FS8A 2ACZA 1OJ9A 2VVLG 5FS6A 3UOXA 3CMMA 2YR4A 4EMJA 5KMPA 3CPIG 4A65A 2WPFA 2Q7VA 2WU2A 1K0IA 3AD8B 3AE9A 4OPLA 5FS7A 2V60A 2VQBA 2YLTA 1RYIA 1GRAA 2QAEA 3UKHA 4H2RA 4G74A 5C3JA 2VVLA 2BYBA 4BJYA 1F8RA 3DK9A 1XPQA 5U1OA 1KSSA 5KNLA 4JQ9A 4H2PA 4H4UA 2WESA 2GR1A 3ZYXA 4KX6A 2B7SA 3T37A 2XLSA 2GAHB 2WP5A 1N4UA 2YR6A 3NGCX 3F8DA 2I0ZA 1Z6LA 1OJAA 2CFYA 1GERA 2Z5XA 2A89A 2JKCA 1LVLA 1SEZA 3NIXA 5FS9A 3AB1A 3I6DA 2XCGA 3F8RA 4K7ZA 1CJCA 2XVEA 4PABA 3GMCA 2YVFA 3FPZA 1ONFA 3IC9A 3NK2X 4IV9A 4EQXA 1IUWA 3II4A 4FDCB 5JRBA 3JSKA 1NG3A 5BRTA 1ZMCA 1D4EA 2XYOA 3PVCA 2TMDA 4TM4A 2BK5A 3UKQA 3VR8A 1GOSA 4AOSA 4BK1A 2BC1A 1EL5A 3ALLA 1Q1RA 2BS2A 3AE8A 3AYJA 3AEAA 4AP3A 3CPJG 1N1PA 1EL9A 4YSHA 5KXJA 1TDOA 1VRQB 1IUUA 4DNAA 3NHOX 4Z44A 1H7WA 1PBBA 3NYEA 1X31B 5KMRA 2YG3A 4B64A 3ICRA 2GR2A 1PBEA 2FBWA 4CNKA 2X8HA 1JU2A 2VQ7A 4JNQA 3CNDA 3BNUA 4BK3A 3P4SA 5CQFA 4ADWA 4RG3A 4OVIA 3GRSA 1KSUA 4GDPA 1PXCA 4UDQA 3T2KA 3ABVA 3C4AA 4BJZA 3AE6A 4A79A 2HQMA 3T2YA 2RGHA 5JCMA 2X3NA 3NNEA 1LJ1A 3L5OA 1GRBA 1CJ2A 1K4QA 2R46A 3O0HA 4GR1A 1Q1WA 5M10A 2OLNA 3LOVA 3L8KA 2PHHA 1IJHA 4H4YA 1H7XA 5FMHA 1D7YA 1LTXR 2WBAA 3DJJA 2BACA 3SQPA 5KVIA 1Q9IA 2VVMA 3AYIA 4YT0A 3OC4A 1GSNA 5KRQA 1H84A 2C76A 3ALMA 3C4NA 1TYPA 2V3AA 4Z43A 3NT6A 1PBCA 1LV0A 3AE2A 1VG9A 3AD9B 1CC6A 2O9ZA 3DH9A 4U2TA 4RSLA 1COYA 1JNZA 2EQ8A 2GEWA 1OJCA 2XFPA 1F8SA 1DOEA 4H4QA 2C72A 5C2TA 1GRFA 4X9MA 4LIIA 4FX9A 4U2LA 4H4WA 4NNJA 1KFYA 3M0OA 4II2A 5U25A 2WHDA 2W0HA 1AOGA 3D8XA 3K30A 4NEWA 1DJQA 1H82A 2NPXA 4XXGA 1VDCA 1BGJA 3AYLA 2YLZA 1L9DA 1P2HA 3UKFA 4A6NB 2C73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JB3 A;  1VQW A;  4OPI A;  2R4E A;  2VRL A;  2C67 A;  3RNM A;  4I59 A;  5L46 A;  4YXD A;  2GH5 A;  1DOD A;  4BUR A;  3F8P A;  4U8M A;  3GMB A;  1DOB A;  2E5V A;  5EB4 A;  3CIR A;  3GDP A;  3DGZ A;  3ZDN A;  3QFB A;  3OZ2 A;  2BXR A;  3QSE A;  1O94 A;  3IHG A;  1Y0P A;  5IQ4 A;  3M13 A;  2E1M A;  1KNP A;  3CTY A;  4XWZ A;  1TDF A;  3UCL A;  4A9W A;  3NG7 X;  1FCD A;  3GD3 A;  2WQY A;  2YG7 A;  4RG4 A;  2Q0K A;  2VRM A;  3UKA A;  2WOW A;  1LQU A;  2WPE A;  4C3Y A;  1H6V A;  4EM4 A;  2PYX A;  4H4V A;  2WDR A;  3CNP A;  3GWF A;  4K22 A;  1E1N A;  5DBJ A;  3DK4 A;  2C75 A;  5M0Z A;  4ZCC A;  3UOY A;  3NN6 X;  1TDN A;  2C65 A;  3CGE A;  2GQF A;  3LJP A;  4YTM A;  2YWL A;  2NVK X;  3VR9 A;  1CJ4 A;  4Z2R A;  4H4R A;  4Y4N A;  2JBV A;  2H89 A;  3AEB A;  1NDA A;  3KPF A;  2RGJ A;  4J36 A;  2XFO A;  3PS9 A;  1H86 A;  4B67 A;  2R4J A;  5EBK A;  2JB1 A;  2WDV A;  2VOU A;  2XVH A;  3V3N A;  3FBS A;  1GV4 A;  1K0J A;  1REO A;  4ECH A;  3L1R A;  4AOX A;  3EF6 A;  1PJ5 A;  2A8X A;  1NHR A;  2V61 A;  3CNT A;  3NYC A;  4AT0 A;  2FJA A;  1IUS A;  1S3E A;  3NRN A;  2QA1 A;  3KLJ A;  4TM1 A;  2WU5 A;  5CKU A;  3CN8 A;  3ALJ A;  3GYI A;  4PAA A;  1E39 A;  2OAM A;  3NKS A;  1NHP A;  5J7X A;  4KPR A;  1BWC A;  3LXD A;  4C3X A;  2YM2 A;  4YSZ A;  1RSG A;  3COX A;  3LZW A;  4A99 A;  3LAD A;  4H4X A;  1YKJ A;  3NK1 X;  3AED A;  1TYT A;  1F3P A;  3K7T A;  3NYF A;  4U8K A;  3S5W A;  4APN A;  2C66 A;  2WS3 A;  1FEA A;  1F6M A;  4OPC A;  4J56 A;  3VRB A;  3SFD A;  2XLU A;  2XFQ A;  4K5S A;  4IVM B;  1CL0 A;  3NTA A;  2XVJ A;  1M6I A;  3UP4 A;  4M52 A;  4Z26 A;  4O5Q A;  4J57 A;  4YWO A;  2OAL A;  1PXA A;  2TPR A;  3GWD A;  2AAQ A;  2XVI A;  4CRT A;  4DSH A;  3BI5 A;  4B69 A;  2Y6R A;  4TM3 A;  2ZZC A;  3DME A;  2R9Z A;  3UOZ A;  3HZL A;  2CUL A;  2GVC A;  2YQU A;  1PS9 A;  1GRG A;  1ZDL A;  3CGC A;  3P4Q A;  2Q0L A;  2YM1 A;  4HA6 A;  3UOV A;  3QFA A;  3P4R A;  4FK1 A;  1B8S A;  1S3B A;  4J33 A;  1JRY A;  2A87 A;  1O5W A;  1L9E A;  4K2X A;  5U63 A;  1GAL A;  1TDE A;  1V59 A;  2BK4 A;  3E1T A;  4YTN A;  5JCL A;  1ZY8 A;  4MJW A;  3UKP A;  1E7P A;  4AT2 A;  2EQ7 A;  4NZH A;  4H2Q A;  5BUK A;  2YG4 A;  5GRT A;  3S61 A;  2J3N A;  1IUV A;  2GF3 A;  1N4W A;  1PHH A;  2QA2 A;  3IF9 A;  3PO7 A;  1DNC A;  4JY3 A;  2AQJ A;  1MO9 A;  5TR3 A;  5BVA A;  1B4V A;  2APG A;  4NTD A;  1CF3 A;  3CPH G;  3GRT A;  4H4S A;  3AE1 A;  4NTC A;  4X4J A;  2B76 A;  4GUV A;  3QJ4 A;  3DJG X;  1GES A;  3H4K A;  4U8N A;  4UP3 A;  2B7R A;  4LA1 A;  3Q9T A;  4XWR A;  3VRD B;  1TDK A;  4K8D A;  4REK A;  1KF6 A;  2WET A;  3B6D A;  1E1L A;  1ZOY A;  4YTP A;  2XLT A;  2XLP A;  4H50 A;  1JEH A;  2EQ9 A;  1PBD A;  1YQ4 A;  2R0P A;  4IA6 A;  4TLX A;  4A6N A;  4U8J A;  5KWF A;  4N9X A;  1VG0 A;  3GD4 A;  1DXL A;  5JCK A;  2Y6Q A;  3IHM A;  3UTE A;  4B65 A;  4UDP A;  2YLR A;  4EMI A;  2GMJ A;  2V6O A;  2BCP A;  4A5L A;  1S2Q A;  2OLO A;  4B68 A;  4H4Z A;  2JAE A;  2OA1 A;  3K7Q X;  4YKF A;  1DJN A;  1S2Y A;  2B9X A;  1K0L A;  5JCI A;  1ZP0 A;  2C3C A;  4D04 A;  2WDQ A;  2JB2 A;  4HB9 A;  3SFE A;  5J60 A;  2CVJ A;  1FEB A;  1N4V A;  3RP8 A;  1PXB A;  3GSI A;  2XFN A;  3B3R A;  3ISH A;  1O95 A;  4H4T A;  3SM8 A;  4B66 A;  1GRE A;  2WP6 A;  3DA1 A;  1UKV G;  1YQZ A;  1EL7 A;  3AD7 B;  3BHK A;  3KKJ A;  3G5Q A;  1FL2 A;  3NTD A;  1YY5 A;  2BS4 A;  4EQS A;  1FEC A;  2C3D A;  4YKG A;  2GB0 A;  3G5R A;  1EBD A;  4USR A;  3UKK A;  2WOI A;  1MOK A;  1PJ6 A;  2V5Z A;  1Y56 B;  4CY8 A;  1Y56 A;  1P2E A;  2XVF A;  1ZK7 A;  1L9C A;  2Q6U A;  3AEF A;  3ICS A;  4WCT A;  3SGL A;  4BK2 A;  4NEV A;  2IVE A;  3LB8 A;  2RGO A;  4K5R A;  1ZOV A;  2WOV A;  3AE5 A;  2WP9 A;  4EMW A;  4WX1 A;  1CHU A;  4CY6 A;  3GYJ A;  3EAN A;  3BHF A;  3AEG A;  3EPT A;  1TRB A;  1PJ7 A;  3AEE A;  2XFU A;  1BGN A;  4A7A A;  4CNJ A;  3AE3 A;  2X50 A;  4TLZ A;  4Z25 A;  1D4D A;  3EAO A;  3LZX A;  2CDU A;  4OPG A;  1JRX A;  4EIP A;  4C77 A;  1D5T A;  4IVO B;  3CNJ A;  4J34 A;  5HXI A;  4D03 A;  3K7M X;  2FJE A;  2GR3 A;  1LQT A;  2BC0 A;  2WPC A;  1RP0 A;  1QO8 A;  2XLR A;  4EIQ A;  2QCU A;  4CBQ A;  4Z2T A;  3QVP A;  2ARD A;  3BNM A;  4J2W A;  2X8G A;  3Q6J A;  4EM3 A;  1MXT A;  3RP7 A;  1NAA A;  2B9W A;  3D1C A;  1NEN A;  3H8I A;  1L0V A;  5KVH A;  3ICT A;  3KVE A;  3WE0 A;  3RP6 A;  1GT8 A;  1FOH A;  3URH A;  2F5Z A;  4J31 A;  2BK3 A;  4CCR A;  4OPD A;  1D4C A;  4U2S A;  1YQ3 A;  3UKL A;  1W4X A;  3VRA A;  4B63 A;  4I58 A;  5LV9 A;  2GMH A;  1M64 A;  4FK1 C;  3VQR A;  5EB5 A;  1H81 A;  2E4G A;  4YSX A;  3V3O A;  4C74 A;  1GTH A;  4IA5 A;  2BAB A;  3AE7 A;  3QSS A;  3UTG A;  5BUL A;  4JDR A;  2H88 A;  1OJT A;  3RED A;  1E1M A;  3M12 A;  1EL8 A;  4GCM A;  3R9U A;  4E0V A;  1ZKQ A;  2BS3 A;  4JNA A;  4USQ A;  5HY5 A;  1GRT A;  3AE4 A;  1KNR A;  4BV6 A;  4TM0 A;  1KDG A;  5JCN A;  2YR5 A;  3I3L A;  4H2N A;  2R45 A;  3FMW A;  1GET A;  3UTH A;  3QSM A;  1D7L A;  3QVR A;  4OPU A;  2ZZ0 A;  2IID A;  3DJD A;  1CJ3 A;  3RHA A;  1BKW A;  4O5U A;  5HYM A;  3CGD A;  2BXS A;  1IUX A;  2UZZ A;  1XAN A;  2YAU A;  1HYU A;  1JNR A;  3ATR A;  1GEU A;  2GRT A;  1PN0 A;  1CBO A;  1NEK A;  2FJD A;  3GDN A;  1QLB A;  4Z24 A;  4U8L A;  2BA9 A;  2GR0 A;  1F8W A;  4GDE A;  4OPT A;  3V76 A;  3CGB A;  2C64 A;  4ICY A;  3AWI A;  2V3B A;  3NH3 X;  4DGK A;  2WEU A;  5HHF A;  1H83 A;  3BI4 A;  5GSN A;  1GTE A;  4EQW A;  1NHS A;  1LPF A;  4Y4M A;  4P9S A;  4DSG A;  4EQR A;  3ADA B;  3BI2 A;  2DKH A;  3KA7 A;  2YG5 A;  4CCQ A;  3G5S A;  3FIM B;  2XDO A;  4H7U A;  4JN9 A;  3CNS A;  2YVJ A;  2X99 A;  1E6E A;  3NN0 X;  1BF3 A;  5KOX A;  3ITJ A;  1ELI A;  1JOA A;  1E1K A;  1BZL A;  2GQW A;  3DGH A;  3ATQ A;  3P9U A;  2YLX A;  4X9N A;  2AR8 A;  2R0G A;  3FG2 P;  4U8O A;  4ZCD A;  4JY2 A;  2GAG B;  5EOW A;  2YVG A;  1CC4 A;  2R0C A;  3IWA A;  3DK8 A;  4UDR A;  1ZMD A;  1JRZ A;  5ER0 A;  4B1B A;  2YG6 A;  4H4P A;  4NTE A;  1NG4 A;  2FJB A;  3NLC A;  5IPY A;  2Z5Y A;  1IUT A;  1CC2 A;  1XHC A;  3UTF A;  1GRH A;  2ZBW A;  3AEC A;  3NK0 X;  3KU9 A;  4Z2U A;  2EQ6 A;  4U8P A;  4AP1 A;  2JK6 A;  3H8L A;  1OJD A;  4ZN0 A;  2C7G A;  1GPE A;  3P1W A;  3C96 A;  4GF7 A;  1GXF A;  1DOC A;  1PDH A;  4GRT A;  2X8C A;  2VZ2 A;  1GND A;  4C5O A;  1NHQ A;  3AXB A;  3DJE A;  3P4P A;  2GV8 A;  2ZZB A;  1NPX A;  3KD9 A;  1B37 A;  5IQ1 A;  2BCG G;  2C70 A;  2RAB A;  4OCG A;  4Y4L A;  2DKI A;  1B5Q A;  4U8I A;  2YLW A;  3UP5 A;  1QJD A;  1PBF A;  4LU6 A;  2B9Y A;  4YSY A;  1ZX9 A;  2IVD A;  2YLS A;  1XDI A;  5FS8 A;  2ACZ A;  1OJ9 A;  2VVL G;  5FS6 A;  3UOX A;  2YR4 A;  4EMJ A;  3CPI G;  4A65 A;  2WPF A;  2Q7V A;  2WU2 A;  1K0I A;  3AD8 B;  3AE9 A;  4OPL A;  5FS7 A;  2V60 A;  2VQB A;  2YLT A;  1RYI A;  1GRA A;  2QAE A;  3UKH A;  4H2R A;  5C3J A;  2VVL A;  2BYB A;  4BJY A;  1F8R A;  3DK9 A;  1XPQ A;  5U1O A;  1KSS A;  4JQ9 A;  4H2P A;  4H4U A;  2WES A;  2GR1 A;  3ZYX A;  4KX6 A;  2B7S A;  3T37 A;  2XLS A;  2GAH B;  2WP5 A;  1N4U A;  2YR6 A;  3NGC X;  3F8D A;  2I0Z A;  1Z6L A;  1OJA A;  2CFY A;  1GER A;  2Z5X A;  2A89 A;  2JKC A;  1LVL A;  1SEZ A;  3NIX A;  5FS9 A;  3AB1 A;  3I6D A;  2XCG A;  3F8R A;  4K7Z A;  1CJC A;  2XVE A;  4PAB A;  3GMC A;  2YVF A;  3FPZ A;  1ONF A;  3IC9 A;  3NK2 X;  4IV9 A;  4EQX A;  1IUW A;  3II4 A;  4FDC B;  3JSK A;  5BRT A;  1NG3 A;  5KOW A;  1ZMC A;  1D4E A;  2XYO A;  3PVC A;  2TMD A;  4TM4 A;  2BK5 A;  3UKQ A;  3VR8 A;  1GOS A;  4AOS A;  4BK1 A;  2BC1 A;  1EL5 A;  3ALL A;  1Q1R A;  2BS2 A;  3AE8 A;  3AYJ A;  3AEA A;  4AP3 A;  3CPJ G;  1N1P A;  1EL9 A;  4YSH A;  5KXJ A;  1TDO A;  1VRQ B;  1IUU A;  4DNA A;  3NHO X;  4Z44 A;  1H7W A;  1PBB A;  3NYE A;  1X31 B;  2YG3 A;  4B64 A;  3ICR A;  2GR2 A;  1PBE A;  2FBW A;  4CNK A;  2X8H A;  1JU2 A;  2VQ7 A;  4JNQ A;  3CND A;  3BNU A;  4BK3 A;  3P4S A;  5CQF A;  4ADW A;  4RG3 A;  4OVI A;  3GRS A;  1KSU A;  4GDP A;  1PXC A;  4UDQ A;  3ABV A;  3C4A A;  4BJZ A;  3AE6 A;  4A79 A;  2HQM A;  2RGH A;  5JCM A;  2X3N A;  3NNE A;  1LJ1 A;  1GRB A;  1CJ2 A;  1K4Q A;  2R46 A;  3O0H A;  4GR1 A;  1Q1W A;  5M10 A;  2OLN A;  3LOV A;  3L8K A;  2PHH A;  1IJH A;  4H4Y A;  1H7X A;  5FMH A;  1D7Y A;  1LTX R;  2WBA A;  3DJJ A;  2BAC A;  3SQP A;  5KVI A;  1Q9I A;  2VVM A;  3AYI A;  4YT0 A;  3OC4 A;  1GSN A;  5KRQ A;  1H84 A;  2C76 A;  3ALM A;  3C4N A;  1TYP A;  2V3A A;  4Z43 A;  3NT6 A;  1PBC A;  1LV0 A;  3AE2 A;  1VG9 A;  3AD9 B;  1CC6 A;  2O9Z A;  3DH9 A;  4U2T A;  4RSL A;  1COY A;  1JNZ A;  2EQ8 A;  2GEW A;  1OJC A;  2XFP A;  1F8S A;  1DOE A;  4H4Q A;  2C72 A;  5C2T A;  1GRF A;  4X9M A;  4LII A;  4FX9 A;  4U2L A;  4H4W A;  1KFY A;  3M0O A;  5U25 A;  2WHD A;  2W0H A;  1AOG A;  3D8X A;  3K30 A;  4NEW A;  1DJQ A;  1H82 A;  2NPX A;  4XXG A;  1VDC A;  1BGJ A;  3AYL A;  2YLZ A;  1L9D A;  1P2H A;  3UKF A;  4A6N B;  2C73 A; 
#chains in the Genus database with same CATH topology
 4OPI A;  1VQW A;  2R4E A;  4I59 A;  5L46 A;  4YXD A;  1DOD A;  4U8M A;  3GMB A;  2E5V A;  3OZ2 A;  3UXK A;  2PGW A;  1H2I A;  4XWZ A;  4A9W A;  2PP0 A;  3RO6 A;  4RG4 A;  2WOW A;  2WPE A;  2PYX A;  5M0Z A;  4ZCC A;  2GQF A;  3LJP A;  4Z2R A;  1KKR A;  4Z1Y A;  3AEB A;  3DFY A;  2P0I A;  2XVH A;  4E8G A;  4ECH A;  1S7M A;  1MNS A;  3SR6 B;  4AOX A;  3QKE A;  4M0X A;  2XH0 A;  2WU5 A;  3ALJ A;  1SJA A;  2MUC A;  3COX A;  3NK1 X;  4U8K A;  1F3P A;  4J56 A;  2XLU A;  1MDL A;  2XVJ A;  2O56 A;  4Z26 A;  4O5Q A;  4YWO A;  2NQL A;  3DG3 A;  4CRT A;  4B69 A;  1FFU C;  2ZZC A;  2CUL A;  4GAV A;  1PS9 A;  3P4Q A;  3CGC A;  2Q0L A;  3VCN A;  3QFA A;  3P4R A;  2PMQ A;  5IDZ A;  4YTN A;  2BK4 A;  3E1T A;  1ZY8 A;  1E7P A;  3SXI A;  2EQ7 A;  5BUK A;  2GF3 A;  1PHH A;  4JY3 A;  4ENL A;  5TR3 A;  5BVA A;  2OZ3 A;  1CF3 A;  3CPH G;  3EEZ A;  4NTC A;  3DJG X;  2QVH A;  3H4K A;  4LA1 A;  1KF6 A;  2QJM A;  2AL2 A;  1JEH A;  4TLX A;  4U8J A;  2OZT A;  1DXL A;  4EMI A;  3FYY A;  2GMJ A;  2BCP A;  4A5L A;  4NWZ A;  2OLO A;  2OA1 A;  4YKF A;  5JCI A;  1ZP0 A;  3OW1 A;  2WDQ A;  2CVJ A;  2QDD A;  3STP A;  1PXB A;  3ISH A;  2XFN A;  4H4T A;  1GRE A;  2WP6 A;  3DA1 A;  1UKV G;  1YQZ A;  3R25 A;  3T0K A;  3NRZ B;  2FYM A;  2BS4 A;  2XH4 A;  3NFU A;  4HN8 A;  2GL5 A;  2XVF A;  1L9C A;  4WCT A;  4NEV A;  2WOV A;  3AE5 A;  3HYX A;  3MWC A;  4CY6 A;  3EAN A;  3AEG A;  3UCD A;  2XFU A;  3AE3 A;  2OQY A;  3CNJ A;  3K7M X;  2BC0 A;  3U4F A;  2QCU A;  4CBQ A;  4Z2T A;  3QVP A;  2ARD A;  3BNM A;  4HPN A;  1NAA A;  2B9W A;  3D1C A;  3FJ4 A;  4MKS A;  3H8I A;  3AMZ A;  3DG6 A;  4J31 A;  2BK3 A;  6ENL A;  4I58 A;  2GMH A;  5EB5 A;  2DW6 A;  1GTH A;  4IA5 A;  3UTG A;  4JDR A;  2H88 A;  1OJT A;  3R9U A;  4GCM A;  3AE4 A;  1KNR A;  4BV6 A;  3H8A A;  3I3L A;  3N6J A;  1F9C A;  2IID A;  3TWB A;  1IUX A;  2UZZ A;  1JNR A;  1GEU A;  1CBO A;  1NEK A;  2BRA A;  2FJD A;  1QLB A;  4Z24 A;  4U8L A;  3ZLF A;  1F8W A;  4GDE A;  3CGB A;  4IP5 A;  4ICY A;  3I4K A;  5HHF A;  3V5F A;  4EQW A;  1LPF A;  3SYI A;  3KA7 A;  4JN9 A;  2QDE A;  1ELI A;  2R0G A;  3FG2 P;  4JY2 A;  2GAG B;  5EOW A;  3IWA A;  5ER0 A;  4NTE A;  2OPJ A;  2Z5Y A;  1IUT A;  3UGV A;  1JRP A;  1E9I A;  3AEC A;  4Z2U A;  4U8P A;  2C7G A;  1ECQ A;  4GRT A;  1NHQ A;  2ZZB A;  2FKP A;  3AM9 A;  3Q45 A;  3CK5 A;  3RIT A;  4Y4L A;  1B5Q A;  4U8I A;  4EWJ A;  2YLW A;  1PBF A;  2YLS A;  2VVL G;  2ACZ A;  3UOX A;  3V3W A;  4J1O A;  4EMJ A;  2Q7V A;  3DGB A;  3SN0 A;  2YLT A;  2AKZ A;  2VVL A;  1IYX A;  3CAW A;  1XPQ A;  1KSS A;  4H2P A;  4KX6 A;  1P43 A;  4E4U A;  4GME A;  2YR6 A;  3F8D A;  3GD6 A;  5FJR A;  1GER A;  4A6G A;  2P8B A;  1CJC A;  4X2P A;  4PAB A;  2YVF A;  3R07 C;  3NK2 X;  2ZAD A;  4IV9 A;  2OVL A;  3JSK A;  3VR8 A;  2TMD A;  2BK5 A;  2AKM A;  3ALL A;  2OZ8 A;  4GGH A;  3QTP A;  3MSY A;  3FVD A;  1VRQ B;  5KMR A;  3R0U A;  3VC5 A;  3OZM A;  1WUE A;  1SJC A;  3BNU A;  4UDQ A;  3U9I A;  2HQM A;  3T2Y A;  2RGH A;  3SSZ A;  3NNE A;  1LJ1 A;  4JN8 A;  3L8K A;  3S61 A;  1D7Y A;  4YT0 A;  1GSN A;  3NVW B;  2C76 A;  1LV0 A;  2XSX A;  4IT1 A;  4U2T A;  2E3T A;  3TWA A;  1GRF A;  4X9M A;  4FX9 A;  4H4W A;  4NNJ A;  1KFY A;  5U25 A;  2W0H A;  1AOG A;  1ZXI C;  4HNC A;  2NPX A;  2YLZ A;  1DTN A;  4A6N B;  2JB3 A;  2GH5 A;  4G9K A;  5EB4 A;  3CIR A;  3ZDN A;  3QFB A;  5FJU A;  2BXR A;  2GGJ A;  1O94 A;  3IHG A;  5IQ4 A;  2E1M A;  1FCD A;  3S5S A;  2Q0K A;  2VRM A;  3UKA A;  4C3Y A;  1H6V A;  4E5T A;  2GGG A;  3NN6 X;  1P48 A;  4YTM A;  2YWL A;  3VR9 A;  1CJ4 A;  2H89 A;  1NDA A;  3GO2 A;  4E4F A;  5EBK A;  1TE6 A;  2OG9 A;  3V3N A;  1JRO A;  1K0J A;  1SJB A;  3NYC A;  1PDY A;  3KLJ A;  4TM1 A;  1SB3 B;  3CN8 A;  3GYI A;  4PAA A;  4KPR A;  1BWC A;  1R0M A;  4YSZ A;  3CXO A;  3LAD A;  1KKO A;  3AED A;  1TYT A;  3K7T A;  2PTY A;  2PTZ A;  4APN A;  2C66 A;  4OPC A;  3VFC A;  5KMQ A;  2OAL A;  4DSH A;  3P0W A;  4YWS A;  2GVC A;  1GRG A;  5G5H B;  4FK1 A;  1B8S A;  1FO4 A;  3T4W A;  2A87 A;  4K2X A;  4A35 A;  1GAL A;  5JCL A;  2HXU A;  4MJW A;  3UKP A;  4AT2 A;  1ONE A;  1IUV A;  1N4W A;  1KCZ A;  4IP4 A;  2APG A;  3P3B A;  1GES A;  4U8N A;  2PS2 A;  3K1G A;  2BRY A;  1E1L A;  1ZOY A;  2XLP A;  1YQ4 A;  2EQ9 A;  4A6N A;  5KWF A;  4N9X A;  1VG0 A;  3CB3 A;  2PTW A;  4UDP A;  2V6O A;  2PA6 A;  3K7Q X;  1KD0 A;  1DJN A;  2RDX A;  1K0L A;  2GGE A;  1JPD X;  2POD A;  5J60 A;  4G73 A;  3RP8 A;  3GSI A;  3B3R A;  4B66 A;  4GAP A;  4G8T A;  1EL7 A;  3KKJ A;  3G5Q A;  1FL2 A;  1VDV A;  3NTD A;  3HPF A;  5ENL A;  3V5C A;  2C3D A;  2GB0 A;  1EBD A;  1MOK A;  1PJ6 A;  1Y56 A;  2Q6U A;  3T31 A;  2RGO A;  3PG6 A;  1ZOV A;  4EMW A;  4WX1 A;  3EPT A;  1TRB A;  3AEE A;  4CNJ A;  4TLZ A;  3ZLH A;  3EAO A;  3LZX A;  4OPG A;  3SZ0 A;  1D5T A;  4Z17 A;  4J34 A;  3N4F A;  4D03 A;  1L8P A;  2GR3 A;  2WPC A;  1LQT A;  1RP0 A;  2XLR A;  4MMW A;  3NVV B;  4GIR A;  3SQS A;  3Q6J A;  1MXT A;  3RRA A;  1L0V A;  3KVE A;  3WE0 A;  3RP6 A;  2W55 A;  3URH A;  2F5Z A;  4U2S A;  5FJT A;  3UKL A;  5LV9 A;  1M64 A;  4KT2 A;  3V3O A;  4C74 A;  3HW2 A;  3QSS A;  4MGG A;  1OEP A;  3RED A;  3NXL A;  1EL8 A;  3HYW A;  5HY5 A;  1N5X A;  3UJE A;  4TM0 A;  3FMW A;  3QSM A;  1N5W C;  4OPU A;  2OLA A;  2PU0 A;  4HCH A;  4O5U A;  3V76 A;  3GC2 A;  3AWI A;  4DGK A;  3S47 A;  5GSN A;  3PFR A;  3CT2 A;  5EU9 A;  3R11 A;  1FFV C;  1NU5 A;  2YG5 A;  3G5S A;  5J04 A;  1E6E A;  5KOX A;  3ITJ A;  3P9U A;  1E1K A;  1BZL A;  2GDQ A;  2YLX A;  4X9N A;  2AR8 A;  3MZN A;  4ZCD A;  4UDR A;  3DK8 A;  1ZMD A;  4B1B A;  2YG6 A;  4H4P A;  1NG4 A;  5IPY A;  1GRH A;  3KU9 A;  2JK6 A;  1OJD A;  4ZN0 A;  2HZG A;  3C96 A;  3EUB 3;  1GND A;  3AXB A;  3DJE A;  3P4P A;  2GV8 A;  3D47 A;  5IQ1 A;  2BCG G;  2RAB A;  2GSH A;  3UP5 A;  3NZG A;  5KMP A;  4A65 A;  2WU2 A;  1K0I A;  3NVZ B;  4G74 A;  1JDF A;  2PCE A;  5KNL A;  1XS2 A;  3ZYX A;  2B7S A;  3VDG A;  3NGC X;  2I0Z A;  3ES8 A;  2Z5X A;  4TVW A;  2A89 A;  2P8C A;  4GYP C;  1SEZ A;  5FS9 A;  3AB1 A;  3ZLG A;  3CYJ A;  4K7Z A;  2XVE A;  3GMC A;  1JCT A;  4KPL A;  1ONF A;  4EQX A;  1IUW A;  4FDC B;  5JRB A;  2XYO A;  1GOS A;  2BC1 A;  1EL5 A;  1Q1R A;  5G5G B;  3H12 A;  3CPJ G;  1N1P A;  2XH2 A;  3NHO X;  1BKH A;  1X31 B;  2OFJ A;  4DX3 A;  2OX4 A;  1MDR A;  2X8H A;  2VQ7 A;  4JNQ A;  4G7F A;  4DWD A;  4RG3 A;  1KSU A;  1PXC A;  1V97 A;  3SN4 A;  5JCM A;  3QN3 A;  2OLN A;  3LOV A;  3V4B A;  1TZZ A;  5FMH A;  2WBA A;  3SQP A;  3SBF A;  3H7V A;  3OC4 A;  3IJQ A;  1H84 A;  2E5A A;  3AE2 A;  3AD9 B;  1CC6 A;  2O9Z A;  3UCC A;  1JNZ A;  3QLD A;  4H4Q A;  3TCS A;  2P88 A;  3MQT A;  1MUC A;  1WYG A;  1DJQ A;  3I6E A;  1H82 A;  3UKF A;  2VRL A;  2C67 A;  3T6C A;  4BUR A;  3F8P A;  4II3 A;  1DOB A;  3GDP A;  3QSE A;  4K1W A;  2GGH A;  1KNP A;  3UCL A;  3NG7 X;  3HRD C;  2WQY A;  1LQU A;  3OZY A;  2PSN A;  4IHC A;  4EM4 A;  4H4V A;  2WDR A;  3CNP A;  1E1N A;  2C75 A;  3UOY A;  2C65 A;  3CGE A;  3TJ4 A;  2JBV A;  3KPF A;  1JPM A;  2XFO A;  3PS9 A;  1H86 A;  3N6H A;  2WDV A;  2VOU A;  1GV4 A;  3VC6 A;  2PPG A;  1REO A;  3EF6 A;  1PJ5 A;  4H2H A;  1NHR A;  3CNT A;  3JW7 A;  3FV9 A;  1IUS A;  1S3E A;  3NRN A;  5CKU A;  1E39 A;  2OAM A;  1NHP A;  3UJR A;  4DHG A;  3LXD A;  5FJO A;  4GFI A;  3SY4 A;  3TJI A;  1X2H A;  1YKJ A;  3NYF A;  4H83 A;  3S5W A;  2WS3 A;  4ZOH B;  1FEA A;  1F6M A;  3SFD A;  3PK7 A;  4IVM B;  1TKK A;  1MRA A;  1RM6 B;  3GWD A;  4G6H A;  3BI5 A;  2PGE A;  2XH7 A;  3UOV A;  1S3B A;  4J33 A;  1JRY A;  1L9E A;  1TDE A;  2YG4 A;  5GRT A;  2QA2 A;  3PO7 A;  3SZC A;  1FHU A;  2AQJ A;  1MO9 A;  4NTD A;  4X4J A;  3UXL A;  4UP3 A;  3FCP A;  4XWR A;  1TDK A;  4REK A;  4YTP A;  4IA6 A;  2R0P A;  1PBD A;  1WUF A;  3BJS A;  2Y6Q A;  3UTE A;  2I5Q A;  1YEY A;  3DER A;  1S2Q A;  4B68 A;  4H4Z A;  2B9X A;  4ROP A;  2C3C A;  4D04 A;  1BQG A;  4HB9 A;  3SM8 A;  1O95 A;  3AD7 B;  1YY5 A;  4YKG A;  3G5R A;  4USR A;  3UKK A;  1Y56 B;  1N62 C;  3A7A A;  4CY8 A;  1ZK7 A;  3T8Q A;  3ICS A;  3SGL A;  3P93 A;  4K5R A;  2WP9 A;  2QGY A;  1CHU A;  1PJ7 A;  4A7A A;  4HNL A;  4Z25 A;  1D4D A;  3A7U A;  4C77 A;  2MNR A;  4IVO B;  5HXI A;  2FJE A;  3B9J B;  3H70 A;  4TVY A;  4J2W A;  2X8G A;  3RP7 A;  1GT8 A;  4CCR A;  4OPD A;  1YQ3 A;  1SJD A;  1W4X A;  3VRA A;  4B63 A;  3SZF A;  3VQR A;  1H81 A;  2E4G A;  4YSX A;  3AE7 A;  5BUL A;  3T9P A;  3M12 A;  4E0V A;  1X2G A;  1EBH A;  2BS3 A;  4USQ A;  1GRT A;  2P3Z A;  1KDG A;  2YR5 A;  4H2N A;  2R45 A;  3UTH A;  3DIP A;  2ZZ0 A;  3NO1 A;  2PTX A;  3JZU A;  2YAU A;  1HYU A;  3ATR A;  2GRT A;  1PN0 A;  3TW9 A;  4OPT A;  2GR0 A;  2C64 A;  1EBG A;  2V3B A;  4F4R A;  3NH3 X;  2WEU A;  1GTE A;  4Y4M A;  4EQR A;  4CCQ A;  3CNS A;  2YVJ A;  2QJN A;  2X99 A;  4H1Z A;  3NN0 X;  3ATQ A;  2GQW A;  1N63 C;  3IK4 A;  4U8O A;  2YVG A;  4HCL A;  1CC2 A;  3UTF A;  2ZBW A;  2C4C A;  4AP1 A;  3H8L A;  3OTR A;  1GPE A;  1RVK A;  1GXF A;  1PDH A;  3D46 A;  2POZ A;  4G6G A;  4IZG A;  4OCG A;  1N61 C;  2DKI A;  1QJD A;  3ETR B;  4LU6 A;  2B9Y A;  1OJ9 A;  5FS6 A;  2YR4 A;  3CPI G;  3OPS A;  3BSM A;  2ONE A;  3AE9 A;  1RYI A;  1GRA A;  2QAE A;  4H2R A;  3DK9 A;  5U1O A;  4JQ9 A;  2GAH B;  2WP5 A;  1OJA A;  4GGB A;  2JKC A;  3NIX A;  3I6D A;  2XCG A;  3ES7 A;  3F8R A;  3FPZ A;  5FJP A;  3PWG A;  3DEQ A;  3II4 A;  5BRT A;  1NG3 A;  5KOW A;  1D4E A;  4TM4 A;  3PVC A;  3UKQ A;  3RCY A;  3TTE A;  4AOS A;  4BK1 A;  2BS2 A;  3AE8 A;  3AEA A;  5KXJ A;  1TDO A;  1IUU A;  2PU1 A;  4E6M A;  3NYE A;  4B64 A;  2GR2 A;  2FBW A;  4CNK A;  1EC8 A;  1VQZ A;  4BK3 A;  4ADW A;  3GRS A;  3ABV A;  4BJZ A;  3AE6 A;  4A79 A;  3ZVI A;  3R10 A;  3L5O A;  1GRB A;  4GR1 A;  1Q1W A;  2PHH A;  1IJH A;  3KD9 A;  1H7X A;  2BAC A;  2VVM A;  3AN1 A;  5KVI A;  4K2S A;  3ALM A;  1TYP A;  2V3A A;  3NT6 A;  4HCD A;  3DH9 A;  4H19 A;  1COY A;  2EQ8 A;  2GEW A;  1OJC A;  3SN1 A;  1DOE A;  2C72 A;  4LII A;  4U2L A;  4II2 A;  3D8X A;  4NEW A;  1VDC A;  1BGJ A;  1FIQ B;  3AYL A;  3MUC A;  3RNM A;  1XPY A;  3DDM A;  3KUM A;  3UJF A;  3GY1 A;  3DGZ A;  2GGI A;  1Y0P A;  3M13 A;  3CTY A;  1TDF A;  3GD3 A;  2YG7 A;  3IJI A;  3A7R A;  3GWF A;  4K22 A;  5DBJ A;  3DK4 A;  4IL0 A;  3GYX A;  1TDN A;  2NVK X;  2HXT A;  4H4R A;  4Y4N A;  2RGJ A;  4J36 A;  4B67 A;  2R4J A;  2JB1 A;  3NS1 B;  3FBS A;  5BOF A;  3L1R A;  3R1Z A;  2A8X A;  2V61 A;  4AT0 A;  3D9X A;  2FJA A;  2QA1 A;  3NKS A;  5J7X A;  4C3X A;  2YM2 A;  3Q4D A;  1RSG A;  3LZW A;  4A99 A;  4H4X A;  2OKT A;  3VRB A;  2XFQ A;  4K5S A;  1CL0 A;  3NTA A;  1EC7 A;  7ENL A;  1M6I A;  3UP4 A;  4KWS A;  4M52 A;  4J57 A;  1PXA A;  2TPR A;  2AAQ A;  2XVI A;  2Y6R A;  4TM3 A;  3DME A;  2W3R A;  2QJJ A;  2R9Z A;  3VCC A;  3UOZ A;  3HZL A;  2CHR A;  2YQU A;  1ZDL A;  4HA6 A;  2YM1 A;  3UJ2 A;  1O5W A;  5U63 A;  1V59 A;  4NZH A;  4H2Q A;  2J3N A;  3IF9 A;  3QPE A;  4FP1 A;  3TQP A;  1DNC A;  4ZA0 A;  1B4V A;  5KMS A;  3GRT A;  4H4S A;  3SJN A;  3AE1 A;  2B76 A;  4GUV A;  3QJ4 A;  2B7R A;  3Q9T A;  3VRD B;  4K8D A;  2WET A;  3B6D A;  3R0K A;  2XLT A;  4H50 A;  2W54 A;  3GD4 A;  5JCK A;  3IHM A;  4B65 A;  2YLR A;  4A3R A;  2JAE A;  2AL1 A;  1S2Y A;  2JB2 A;  3SFE A;  1FEB A;  1N4V A;  1STZ A;  3BHK A;  4EQS A;  1FEC A;  2WOI A;  2V5Z A;  1P2E A;  3AEF A;  4BK2 A;  1N60 C;  4JHM A;  2IVE A;  3LB8 A;  3DES A;  4DYE A;  1W6T A;  4DN1 A;  3CXB A;  3GYJ A;  3BHF A;  3DG7 A;  1BGN A;  2X50 A;  2CDU A;  1JRX A;  4EIP A;  2QQ6 A;  1QO8 A;  4EIQ A;  4EM3 A;  1KN0 A;  1NEN A;  5KVH A;  3ICT A;  1FOH A;  1D4C A;  3ZVH B;  4FK1 C;  3RGT A;  3B97 A;  2BAB A;  1E1M A;  1ZKQ A;  4JNA A;  3KPK A;  2PP1 A;  3PWI A;  5JCN A;  4GYP A;  4DXK A;  3BOX A;  1GET A;  3T2Z A;  1D7L A;  3QVR A;  2DW7 A;  2OQH A;  3DJD A;  3RHA A;  1CJ3 A;  1BKW A;  5HYM A;  3CGD A;  2BXS A;  1XAN A;  3GDN A;  3MY9 A;  2BA9 A;  1R6W A;  1H83 A;  3BI4 A;  4JN7 A;  1NHS A;  4P9S A;  4DSG A;  3ADA B;  3BI2 A;  2DKH A;  3NVY B;  3FIM B;  5BOE A;  2XDO A;  4H7U A;  1BF3 A;  1EC9 A;  1JOA A;  1T3Q C;  3DGH A;  3HYV A;  2HNE A;  1CC4 A;  2R0C A;  1JRZ A;  2FJB A;  3NLC A;  3SZW A;  1XHC A;  3NK0 X;  2EQ6 A;  3P1W A;  4GF7 A;  4KEM A;  1DOC A;  3T14 A;  2X8C A;  2VZ2 A;  4C5O A;  1FHV A;  1NPX A;  1B37 A;  2C70 A;  3SX6 A;  4YSY A;  1ZX9 A;  4GIS A;  2IVD A;  1XDI A;  5FS8 A;  4M6U A;  3EKG A;  2OO6 A;  3CMM A;  3N4E A;  2WPF A;  3AD8 B;  4OPL A;  5FS7 A;  3ENL A;  2V60 A;  2VQB A;  3UKH A;  5C3J A;  2BYB A;  4BJY A;  1F8R A;  4H4U A;  2WES A;  2GR1 A;  3RR1 A;  3T37 A;  3DFH A;  2XLS A;  1N4U A;  1Z6L A;  2CFY A;  1LVL A;  3IJL A;  3ZVH A;  1PDZ A;  3IC9 A;  3TOY A;  4ZCW A;  1ZMC A;  3MKC A;  3THU A;  2PP3 A;  3JVA A;  3AYJ A;  4AP3 A;  3OP2 A;  1EL9 A;  4YSH A;  4IL2 A;  4DNA A;  4Z44 A;  1H7W A;  1PBB A;  2YG3 A;  3FXG A;  3ICR A;  4FI4 A;  1PBE A;  1JU2 A;  3CND A;  3P4S A;  5CQF A;  4OVI A;  4GDP A;  3T2K A;  3C4A A;  2W3S A;  2XGZ A;  2X3N A;  2ZC8 A;  1CJ2 A;  1K4Q A;  2R46 A;  3O0H A;  5M10 A;  3UJS A;  3VA8 A;  4H4Y A;  1LTX R;  3DJJ A;  1Q9I A;  3AYI A;  5KRQ A;  3C4N A;  4Z43 A;  1PBC A;  4HYR A;  1VG9 A;  4RSL A;  2XFP A;  1F8S A;  5C2T A;  1NEL A;  4J3Z A;  3M0O A;  2WHD A;  1ELS A;  4K8G A;  3K30 A;  3I6T A;  4XXG A;  2AL2 B;  1L9D A;  1P2H A;  2C73 A; 
#chains in the Genus database with same CATH homology
 2JB3 A;  1VQW A;  4OPI A;  2R4E A;  2VRL A;  2C67 A;  3RNM A;  4I59 A;  5L46 A;  4YXD A;  2GH5 A;  1DOD A;  4BUR A;  3F8P A;  4G9K A;  4II3 A;  4U8M A;  3GMB A;  1DOB A;  2E5V A;  5EB4 A;  3CIR A;  3GDP A;  3DGZ A;  3ZDN A;  3QFB A;  3OZ2 A;  2BXR A;  3QSE A;  1O94 A;  3IHG A;  1Y0P A;  5IQ4 A;  3M13 A;  2E1M A;  1H2I A;  1KNP A;  3CTY A;  4XWZ A;  1TDF A;  3UCL A;  4A9W A;  3NG7 X;  1FCD A;  3GD3 A;  2WQY A;  2YG7 A;  4RG4 A;  2Q0K A;  2VRM A;  3UKA A;  2WOW A;  1LQU A;  2WPE A;  4C3Y A;  1H6V A;  4EM4 A;  2PYX A;  4H4V A;  2WDR A;  3CNP A;  3GWF A;  4K22 A;  1E1N A;  5DBJ A;  3DK4 A;  2C75 A;  5M0Z A;  4ZCC A;  3UOY A;  3GYX A;  3NN6 X;  1TDN A;  2C65 A;  3CGE A;  2GQF A;  3LJP A;  4YTM A;  2YWL A;  2NVK X;  3VR9 A;  1CJ4 A;  4Z2R A;  4H4R A;  4Y4N A;  2JBV A;  2H89 A;  3AEB A;  1NDA A;  3KPF A;  2RGJ A;  4J36 A;  2XFO A;  3PS9 A;  1H86 A;  4B67 A;  2R4J A;  5EBK A;  2JB1 A;  2WDV A;  2VOU A;  2XVH A;  3V3N A;  3FBS A;  1GV4 A;  1K0J A;  1REO A;  1S7M A;  4ECH A;  3L1R A;  4AOX A;  3EF6 A;  1PJ5 A;  2A8X A;  1NHR A;  2V61 A;  3CNT A;  3NYC A;  4AT0 A;  3D9X A;  2FJA A;  1IUS A;  1S3E A;  3NRN A;  2QA1 A;  3KLJ A;  4TM1 A;  2WU5 A;  5CKU A;  3CN8 A;  3ALJ A;  3GYI A;  4PAA A;  1E39 A;  2OAM A;  3NKS A;  1NHP A;  5J7X A;  4KPR A;  1BWC A;  3LXD A;  4C3X A;  3SY4 A;  2YM2 A;  4YSZ A;  1RSG A;  3COX A;  3LZW A;  4A99 A;  3LAD A;  4H4X A;  1YKJ A;  3NK1 X;  3AED A;  1TYT A;  1F3P A;  3K7T A;  3NYF A;  4U8K A;  3S5W A;  4APN A;  2C66 A;  2WS3 A;  1FEA A;  1F6M A;  4OPC A;  4J56 A;  3VRB A;  3SFD A;  2XLU A;  2XFQ A;  4K5S A;  4IVM B;  1CL0 A;  3NTA A;  2XVJ A;  1M6I A;  5KMQ A;  3UP4 A;  4M52 A;  4Z26 A;  4O5Q A;  4J57 A;  4YWO A;  2OAL A;  1PXA A;  2TPR A;  3GWD A;  4G6H A;  2AAQ A;  2XVI A;  4CRT A;  4DSH A;  3BI5 A;  4B69 A;  2Y6R A;  4TM3 A;  2ZZC A;  3DME A;  2R9Z A;  3UOZ A;  3HZL A;  2CUL A;  4GAV A;  2GVC A;  2YQU A;  1PS9 A;  1GRG A;  1ZDL A;  3CGC A;  3P4Q A;  2Q0L A;  2YM1 A;  4HA6 A;  3UOV A;  3QFA A;  3P4R A;  4FK1 A;  1B8S A;  1S3B A;  4J33 A;  1JRY A;  2A87 A;  1O5W A;  1L9E A;  4K2X A;  5U63 A;  1GAL A;  1TDE A;  1V59 A;  2BK4 A;  3E1T A;  4YTN A;  5JCL A;  1ZY8 A;  4MJW A;  3UKP A;  1E7P A;  4AT2 A;  3SXI A;  2EQ7 A;  4NZH A;  4H2Q A;  5BUK A;  2YG4 A;  5GRT A;  3S61 A;  2J3N A;  1IUV A;  2GF3 A;  1N4W A;  1PHH A;  2QA2 A;  3IF9 A;  3PO7 A;  3SZC A;  1DNC A;  4JY3 A;  2AQJ A;  1MO9 A;  5TR3 A;  5BVA A;  1B4V A;  2APG A;  4NTD A;  5KMS A;  1CF3 A;  3CPH G;  5KOW A;  3GRT A;  4H4S A;  3AE1 A;  4NTC A;  4X4J A;  2B76 A;  4GUV A;  3QJ4 A;  3DJG X;  1GES A;  3H4K A;  4U8N A;  4UP3 A;  2B7R A;  4LA1 A;  3Q9T A;  4XWR A;  3VRD B;  1TDK A;  4K8D A;  4REK A;  1KF6 A;  2BRY A;  2WET A;  3B6D A;  1E1L A;  1ZOY A;  4YTP A;  2XLT A;  2XLP A;  4H50 A;  1JEH A;  2EQ9 A;  1PBD A;  1YQ4 A;  2R0P A;  4IA6 A;  4TLX A;  4A6N A;  4U8J A;  5KWF A;  4N9X A;  1VG0 A;  3GD4 A;  1DXL A;  5JCK A;  2Y6Q A;  3IHM A;  3UTE A;  4B65 A;  4UDP A;  2YLR A;  4EMI A;  2GMJ A;  2V6O A;  2BCP A;  4A5L A;  1S2Q A;  4NWZ A;  2OLO A;  4B68 A;  4H4Z A;  2JAE A;  2OA1 A;  3K7Q X;  4YKF A;  1DJN A;  1S2Y A;  2B9X A;  1K0L A;  5JCI A;  1ZP0 A;  2C3C A;  4D04 A;  2WDQ A;  2JB2 A;  4HB9 A;  3SFE A;  5J60 A;  2CVJ A;  1FEB A;  1N4V A;  4G73 A;  3RP8 A;  1PXB A;  3GSI A;  2XFN A;  3B3R A;  3ISH A;  1O95 A;  4H4T A;  3SM8 A;  4B66 A;  1GRE A;  4GAP A;  2WP6 A;  3DA1 A;  1UKV G;  1YQZ A;  1EL7 A;  3AD7 B;  3BHK A;  3KKJ A;  3G5Q A;  1FL2 A;  3T0K A;  3NTD A;  1YY5 A;  2BS4 A;  4EQS A;  1FEC A;  2C3D A;  4YKG A;  2GB0 A;  3G5R A;  1EBD A;  4USR A;  3UKK A;  2WOI A;  1MOK A;  1PJ6 A;  2V5Z A;  1Y56 B;  4CY8 A;  1Y56 A;  1P2E A;  2XVF A;  1ZK7 A;  1L9C A;  2Q6U A;  3AEF A;  3ICS A;  4WCT A;  3SGL A;  4BK2 A;  4NEV A;  3T31 A;  2IVE A;  3LB8 A;  2RGO A;  3PG6 A;  4K5R A;  1ZOV A;  2WOV A;  3AE5 A;  3HYX A;  2WP9 A;  4EMW A;  4WX1 A;  1CHU A;  4CY6 A;  3GYJ A;  3EAN A;  3BHF A;  3AEG A;  3EPT A;  1TRB A;  1PJ7 A;  3AEE A;  2XFU A;  1BGN A;  4A7A A;  4CNJ A;  3AE3 A;  2X50 A;  4TLZ A;  4Z25 A;  1D4D A;  3EAO A;  3LZX A;  2CDU A;  4OPG A;  1JRX A;  4EIP A;  3SZ0 A;  4C77 A;  1D5T A;  4IVO B;  3CNJ A;  4J34 A;  5HXI A;  4D03 A;  3K7M X;  2FJE A;  2GR3 A;  1LQT A;  2BC0 A;  2WPC A;  1RP0 A;  1QO8 A;  2XLR A;  4EIQ A;  2QCU A;  4CBQ A;  4Z2T A;  3QVP A;  2ARD A;  3BNM A;  4J2W A;  2X8G A;  3Q6J A;  4EM3 A;  1KN0 A;  1MXT A;  3RP7 A;  1NAA A;  2B9W A;  3D1C A;  1NEN A;  3H8I A;  1L0V A;  5KVH A;  3ICT A;  3KVE A;  3WE0 A;  3RP6 A;  1GT8 A;  1FOH A;  3URH A;  2F5Z A;  4J31 A;  2BK3 A;  4CCR A;  4OPD A;  1D4C A;  4U2S A;  1YQ3 A;  3UKL A;  1W4X A;  3VRA A;  4B63 A;  4I58 A;  5LV9 A;  2GMH A;  1M64 A;  4FK1 C;  3SZF A;  5EB5 A;  3VQR A;  1H81 A;  2E4G A;  4YSX A;  3V3O A;  4C74 A;  1GTH A;  4IA5 A;  2BAB A;  3AE7 A;  3QSS A;  3UTG A;  5BUL A;  4JDR A;  2H88 A;  1OJT A;  3RED A;  1E1M A;  3M12 A;  1EL8 A;  3HYW A;  4GCM A;  3R9U A;  4E0V A;  1ZKQ A;  2BS3 A;  4JNA A;  4USQ A;  5HY5 A;  1GRT A;  3AE4 A;  3KPK A;  1KNR A;  4BV6 A;  4TM0 A;  1KDG A;  5JCN A;  2YR5 A;  3I3L A;  4H2N A;  2R45 A;  3FMW A;  1GET A;  3T2Z A;  3UTH A;  3QSM A;  1D7L A;  3QVR A;  4OPU A;  2ZZ0 A;  2IID A;  3DJD A;  1CJ3 A;  3RHA A;  1BKW A;  4O5U A;  5HYM A;  3CGD A;  2BXS A;  1IUX A;  2UZZ A;  1XAN A;  2YAU A;  1HYU A;  1JNR A;  3ATR A;  1GEU A;  2GRT A;  1PN0 A;  1CBO A;  1NEK A;  2BRA A;  2FJD A;  3GDN A;  1QLB A;  4Z24 A;  4U8L A;  2BA9 A;  2GR0 A;  1F8W A;  4GDE A;  4OPT A;  3V76 A;  3CGB A;  2C64 A;  4ICY A;  3AWI A;  2V3B A;  3NH3 X;  4DGK A;  2WEU A;  5HHF A;  1H83 A;  3BI4 A;  5GSN A;  1GTE A;  4EQW A;  1NHS A;  1LPF A;  4Y4M A;  4P9S A;  3SYI A;  4DSG A;  4EQR A;  3ADA B;  3BI2 A;  2DKH A;  3KA7 A;  2YG5 A;  4CCQ A;  3G5S A;  3FIM B;  2XDO A;  4H7U A;  4JN9 A;  3CNS A;  2YVJ A;  2X99 A;  1E6E A;  3NN0 X;  1BF3 A;  5KOX A;  3ITJ A;  1ELI A;  1JOA A;  1E1K A;  1BZL A;  2GQW A;  3DGH A;  3ATQ A;  3P9U A;  3HYV A;  2YLX A;  4X9N A;  2AR8 A;  2R0G A;  3FG2 P;  4U8O A;  4ZCD A;  4JY2 A;  2GAG B;  5EOW A;  2YVG A;  1CC4 A;  2R0C A;  3IWA A;  3DK8 A;  4UDR A;  1ZMD A;  1JRZ A;  5ER0 A;  4B1B A;  2YG6 A;  4H4P A;  4NTE A;  1NG4 A;  2FJB A;  3NLC A;  5IPY A;  2Z5Y A;  1IUT A;  1CC2 A;  3SZW A;  1XHC A;  3UTF A;  1GRH A;  2ZBW A;  3AEC A;  3NK0 X;  2C4C A;  3KU9 A;  4Z2U A;  2EQ6 A;  4U8P A;  4AP1 A;  2JK6 A;  3H8L A;  1OJD A;  4ZN0 A;  2C7G A;  1GPE A;  3P1W A;  3C96 A;  4GF7 A;  1GXF A;  1DOC A;  1PDH A;  4GRT A;  3T14 A;  2X8C A;  2VZ2 A;  1GND A;  4C5O A;  1NHQ A;  3AXB A;  3DJE A;  3P4P A;  2GV8 A;  2ZZB A;  1NPX A;  3KD9 A;  1B37 A;  4G6G A;  5IQ1 A;  2BCG G;  2C70 A;  2RAB A;  4OCG A;  3SX6 A;  4Y4L A;  2DKI A;  1B5Q A;  4U8I A;  2YLW A;  3UP5 A;  1QJD A;  1PBF A;  4LU6 A;  2B9Y A;  4YSY A;  1ZX9 A;  2IVD A;  2YLS A;  1XDI A;  5FS8 A;  2ACZ A;  1OJ9 A;  2VVL G;  5FS6 A;  3UOX A;  3CMM A;  2YR4 A;  4EMJ A;  5KMP A;  3CPI G;  4A65 A;  2WPF A;  2Q7V A;  2WU2 A;  1K0I A;  3AD8 B;  3AE9 A;  4OPL A;  5FS7 A;  2V60 A;  2VQB A;  2YLT A;  1RYI A;  1GRA A;  2QAE A;  3UKH A;  4H2R A;  4G74 A;  5C3J A;  2VVL A;  2BYB A;  4BJY A;  1F8R A;  3DK9 A;  1XPQ A;  5U1O A;  1KSS A;  5KNL A;  4JQ9 A;  4H2P A;  4H4U A;  2WES A;  2GR1 A;  3ZYX A;  4KX6 A;  2B7S A;  3T37 A;  2XLS A;  2GAH B;  2WP5 A;  1N4U A;  2YR6 A;  3NGC X;  3F8D A;  2I0Z A;  1Z6L A;  1OJA A;  2CFY A;  1GER A;  2Z5X A;  2A89 A;  2JKC A;  1LVL A;  1SEZ A;  3NIX A;  5FS9 A;  3AB1 A;  3I6D A;  2XCG A;  3F8R A;  4K7Z A;  1CJC A;  2XVE A;  4PAB A;  3GMC A;  2YVF A;  3FPZ A;  1ONF A;  3IC9 A;  3NK2 X;  4IV9 A;  4EQX A;  1IUW A;  3II4 A;  4FDC B;  5JRB A;  3JSK A;  1NG3 A;  5BRT A;  1ZMC A;  1D4E A;  2XYO A;  3PVC A;  2TMD A;  4TM4 A;  2BK5 A;  3UKQ A;  3VR8 A;  1GOS A;  4AOS A;  4BK1 A;  2BC1 A;  1EL5 A;  3ALL A;  1Q1R A;  2BS2 A;  3AE8 A;  3AYJ A;  3AEA A;  4AP3 A;  3CPJ G;  1N1P A;  1EL9 A;  4YSH A;  5KXJ A;  1TDO A;  1VRQ B;  1IUU A;  4DNA A;  3NHO X;  4Z44 A;  1H7W A;  1PBB A;  3NYE A;  1X31 B;  5KMR A;  2YG3 A;  4B64 A;  3ICR A;  2GR2 A;  1PBE A;  2FBW A;  4CNK A;  2X8H A;  1JU2 A;  2VQ7 A;  4JNQ A;  3CND A;  3BNU A;  4BK3 A;  3P4S A;  5CQF A;  4ADW A;  4RG3 A;  4OVI A;  3GRS A;  1KSU A;  4GDP A;  1PXC A;  4UDQ A;  3T2K A;  3ABV A;  3C4A A;  4BJZ A;  3AE6 A;  4A79 A;  2HQM A;  3T2Y A;  2RGH A;  5JCM A;  2X3N A;  3NNE A;  1LJ1 A;  3L5O A;  1GRB A;  1CJ2 A;  1K4Q A;  2R46 A;  3O0H A;  4GR1 A;  1Q1W A;  5M10 A;  2OLN A;  3LOV A;  3L8K A;  2PHH A;  1IJH A;  4H4Y A;  1H7X A;  5FMH A;  1D7Y A;  1LTX R;  2WBA A;  3DJJ A;  2BAC A;  3SQP A;  5KVI A;  1Q9I A;  2VVM A;  3AYI A;  4YT0 A;  3OC4 A;  1GSN A;  5KRQ A;  1H84 A;  2C76 A;  3ALM A;  3C4N A;  1TYP A;  2V3A A;  4Z43 A;  3NT6 A;  1PBC A;  1LV0 A;  3AE2 A;  1VG9 A;  3AD9 B;  1CC6 A;  2O9Z A;  3DH9 A;  4U2T A;  4RSL A;  1COY A;  1JNZ A;  2EQ8 A;  2GEW A;  1OJC A;  2XFP A;  1F8S A;  1DOE A;  4H4Q A;  2C72 A;  5C2T A;  1GRF A;  4X9M A;  4LII A;  4FX9 A;  4U2L A;  4H4W A;  4NNJ A;  1KFY A;  3M0O A;  4II2 A;  5U25 A;  2WHD A;  2W0H A;  1AOG A;  3D8X A;  3K30 A;  4NEW A;  1DJQ A;  1H82 A;  2NPX A;  4XXG A;  1VDC A;  1BGJ A;  3AYL A;  2YLZ A;  1L9D A;  1P2H A;  3UKF A;  4A6N B;  2C73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...