4DX3A

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
400
structure length
360
Chain Sequence
b'MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 126
structure length 360
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dx3A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dx3A01
2AKMA 3UGVA 2PU1A 5FJTA 4GMEA 4DXKA 2XGZA 4GGBA 4GISA 3NZGA 3H12A 3OZMA 1WUFA 4HNLA 4DX3A 3ZLHA 2FYMA 1JDFA 1R6WA 2OFJA 2MNRA 5ENLA 3UXLA 4M6UA 4HPNA 2OKTA 3GD6A 1PDYA 3ENLA 4H1ZA 2AKZA 5FJPA 4IT1A 2AL2A 3UCDA 3N6HA 3TOYA 2PTYA 3Q45A 3I6EA 3D46A 4J3ZA 1NELA 2OX4A 5FJUA 1L8PA 1IYXA 4IP4A 4HYRA 4E6MA 1NU5A 2OVLA 3PK7A 1XPYA 3QPEA 3JZUA 2OQHA 1EC8A 3B97A 4JN7A 4DYEA 3ZLGA 3QN3A 3IJLA 3OW1A 3CK5A 3STPA 2OLAA 2QQ6A 1KKRA 2GGHA 3OTRA 3SN4A 1TE6A 4GYPA 4K2SA 2XH0A 2PCEA 5EU9A 3TW9A 1SJBA 2XH7A 3QLDA 2PTXA 3T6CA 1WUEA 3VFCA 2HXUA 3IK4A 2DW6A 4IZGA 4G7FA 2AL1A 1JPMA 4HCDA 3RRAA 4KEMA 1DTNA 4Z17A 2CHRA 2QJJA 1SJAA 3VA8A 3MUCA 1E9IA 2P3ZA 3SQSA 3P3BA 3ES8A 3R10A 5IDZA 1BKHA 4YWSA 3IJIA 4M0XA 1F9CA 4K1WA 3R1ZA 3DIPA 3FJ4A 4GIRA 2QVHA 3RITA 3N4EA 3K1GA 1MUCA 3CB3A 1EC7A 3DESA 3OPSA 3RCYA 2MUCA 4J1OA 2GDQA 4E4UA 3GY1A 1MRAA 3VDGA 4A6GA 4E5TA 3T4WA 4IL2A 3TJIA 4GFIA 2OQYA 2AL2B 3MY9A 2XH4A 3T9PA 1MDRA 1EC9A 3CT2A 3R0UA 1EBGA 2GGJA 1ONEA 2PP1A 3I4KA 3NXLA 3S47A 4DN1A 2ZC8A 3TWBA 3VCNA 4H2HA 4GGHA 1RVKA 1KCZA 2PGWA 1EBHA 4FI4A 3MSYA 3SJNA 2OZTA 4X2PA 4MGGA 4H83A 3H7VA 4MKSA 1ECQA 1P48A 3UJ2A 4HNCA 2I5QA 3D47A 3S5SA 3KUMA 3TWAA 1SJDA 2PSNA 3Q4DA 4A35A 5FJRA 4HCLA 2HXTA 1YEYA 4HN8A 1XS2A 3PWGA 1R0MA 4FP1A 3RO6A 4Z1YA 2POZA 3P0WA 3ZVHB 2XSXA 3FV9A 3FXGA 3SSZA 3OZYA 3RR1A 4IP5A 3VC6A 3V3WA 4EWJA 2QDDA 4JN8A 2QGYA 3GO2A 4ENLA 1KD0A 2OPJA 3NFUA 2PP3A 3MWCA 1KKOA 3MQTA 3FVDA 3MZNA 3DG7A 1JCTA 3QTPA 3V4BA 3DEQA 4KT2A 3DERA 6ENLA 3UJFA 2FKPA 5BOFA 3DG3A 2ZADA 2OO6A 3JW7A 4E4FA 3U4FA 2P0IA 3H8AA 4K8GA 2GL5A 4F4RA 3R25A 1P43A 3SN1A 2PP0A 3IJQA 4G8TA 4KWSA 2QDEA 2NQLA 3BJSA 2P8BA 1ELSA 3UCCA 3VCCA 3DFHA 4JHMA 4ROPA 2DW7A 1OEPA 3CAWA 2HZGA 3P93A 2O56A 3TTEA 3VC5A 3U9IA 3QKEA 1BQGA 3UJEA 2PGEA 3SN0A 2PS2A 3V5CA 1SJCA 3V5FA 3DGBA 3ES7A 3R0KA 3BSMA 1FHUA 5FJOA 4E8GA 2PMQA 2RDXA 3BOXA 2XH2A 3TCSA 3H70A 3JVAA 3N4FA 3RGTA 3PFRA 3ZLFA 3HPFA 2P8CA 4DHGA 1PDZA 5J04A 3OP2A 3GC2A 4HCHA 3CXOA 3TQPA 3FCPA 2PTZA 3R11A 3THUA 4GYPC 3NO1A 3UXKA 3CYJA 3N6JA 5BOEA 2QJMA 3DG6A 2PU0A 2OZ3A 4IL0A 2GSHA 1MDLA 3FYYA 1TKKA 2PODA 1MNSA 2GGEA 2GGGA 4H19A 2GGIA 7ENLA 1W6TA 4A3RA 1FHVA 2OG9A 2OZ8A 2P88A 3T8QA 1TZZA 3DDMA 3MKCA 4KPLA 3ZVIA 3ZVHA 2ONEA 2PPGA 4ZA0A 3EEZA 2HNEA 1JPDX 4IHCA 3PWIA 3UJSA 3EKGA 2PTWA 3DFYA 4MMWA 4ZCWA 2QJNA 2PA6A 3UJRA 3TJ4A 3I6TA 4DWDA 3SBFA
chains in the Genus database with same CATH superfamily
4IIDA 3NQDA 4QDMA 4UQAA 4DJFD 4CNPA 3CIWA 3NZGA 1BWCA 3KW3A 2VNCA 2X1RA 2EGZA 3ZLHA 3WBWA 3BMXA 3Q2DA 3KAOA 1AK5A 1UUOA 5AVHA 4AFYA 3KCOA 1GEUA 3BV7A 4O53A 9XIAA 3W1PA 1MVYA 4XZWA 1P7TB 3PUGA 2C19A 3P81A 3GIQA 1B30A 4NUWA 3SURA 4FNUA 4HNUA 1M53A 1CZ1A 3S1WA 5DMLA 5FJIA 1WXJA 3WLNA 3Q45A 3Q37A 4XZBA 1ONWA 5HA7A 4TV6A 1XP3A 4ACZB 4OHQA 4Z1AA 1SSGA 1NPXA 3THAA 6REQA 1K1DA 3ITLA 4WSHA 3ZLGA 4Q4MA 1X98A 1FWFC 3LMZA 3SRKA 2WVSA 4OBTA 2ISDA 5HDRA 3EOUA 1FH9A 3G1HA 4F0LA 5K2ZA 3N73A 1ZP4A 3MSDA 3TEVA 2WVUA 4CEUC 4H01A 5BW6A 1UR0A 2J6VA 3ABSA 1UPPA 4AYSA 4QAIA 2I9EA 1GRTA 3TA6A 3AHXA 1F6YA 2C8NA 2BGNE 4IZGA 5G2WA 2AL1A 3EWCA 2IKIA 1XLBA 3TAKA 4H4IA 3MS8A 2ZXDA 2NSXA 2TMDA 2E8ZA 1H63A 4OBSA 1KR0A 1XYCA 3STEA 4O10A 1Y7VA 3BANA 2DZUA 1E4LA 3UZ5A 3WLMA 1QRQA 1HKKA 5AY7A 1SR0A 4WDXA 2CCRA 2XN2A 3S2LA 4E4UA 2QT3A 1QATA 2VRQA 2HK0A 1M7PA 4GNKB 2AL2B 1WKFA 1KLYA 2PWFA 1G6CA 5CBBA 2EF9A 1WDRA 3PPHA 1XSJA 4M1RA 4JNYA 2TPRA 4NX0A 3S5NA 5IOBA 3CL6A 2C3ZA 4OWGA 2V30A 4MHBA 2QZRA 4Z0JA 4XV0A 5FF2A 4BV6A 4XX6A 1LLOA 1UC5A 2G37A 4B2DA 3C2OA 3LUTA 5FS9A 2ATSA 3LTSA 4XBJA 3V0TA 4ZENA 5DEZA 3IJDA 4JNZA 2V67A 3M07A 4D72A 1UIOA 1JNDA 3LGDA 5D2TA 3VMPA 4V1XA 4ZFCA 2QEZA 4N9EA 1EIXA 3KLJA 3ABQA 1XS2A 3TTQA 2PDCA 5EGRA 2EHHA 2YXOA 1UZDA 4DO7A 4M80A 4RNHA 4P7RA 4LUIA 3GNOA 3KVMA 3E2SA 3DH7A 3ZJKA 3QFWA 3G1RA 2HK1A 4YMZA 3VC6A 4HU4A 4ZB0A 1PIGA 1TA3A 1XDLA 3VGGA 5F2MA 5FAGA 4ENLA 3C3UA 1ISXA 1TRIA 3EWYA 1GKPA 1DWAM 1G0CA 4C6QA 3EX6A 3NVDA 1D8CA 3FA5A 4I9JA 1F6PA 4HZ6A 4TU1A 1X2GA 3LHWA 1X1NA 3W0KA 2G50A 3DERA 2Z4GA 4IOTA 2FDMA 1KFLA 4M19A 4JN6A 5A3HA 4A21A 4TMBA 1WDDA 2VHLA 2GL5A 2QIWA 3U2CA 3N2TA 1W91A 3CMFA 2F61A 1HIZA 3STFA 4CD5A 4HNVA 3P84A 1LPFA 1S2TA 4H4VA 1EEPA 4GI6A 3V36A 1KGXA 5DBUA 2ZE0A 4MNKA 5D9NA 2ON3A 3LXDA 2NV2A 1Z9AA 3W1QA 3WIJA 5D32A 3ONCA 5AYIA 1EOMA 4HT3A 1UR3M 2XWDA 1ZQ5A 2FHBA 2VXNA 2ABBA 4Y9OA 2PGEA 2PS2A 3WBAA 4UTHA 2HDJA 2AOSA 1XHGA 2BXVA 3BSMA 3CWNA 2WP5A 3EA3A 1OJXA 3GDLA 4LB4A 1XKJA 3NO5A 4BQ3A 3RGTA 1TV2A 2WBGA 4B5UA 4HU0A 4DAIA 3H4WA 1K9TA 4LTSA 1FFQA 4PMYA 1TTPA 3CXOA 3TQPA 2GQAA 3VDBA 3U8GA 5LYRA 2XGBA 4R3UA 3LERA 3VE7A 1HL9A 2VFIA 4H8UA 3ZZ1A 1MQPA 3K2GA 3KBVA 3DFTA 3EOSA 5C70A 1GW1A 3S1UA 2UY4A 3DKLA 4G7EB 5K9CA 3AU6A 1BZLA 2YCLB 1TV5A 2BY3A 4MB5A 1E15A 4L1WA 2WKJA 1R3TA 1QWGA 1VLWA 3FVMA 2P0OA 4PMNA 2Z6IA 1O5RA 1L6GA 5FF4A 1V3HA 1TR1A 1UD8A 3GYEA 2GK1B 4EXQA 3KLKA 2A3AA 5A8QA 4YWOA 3LDVA 1XD1A 3PWIA 4EXBA 1XLDA 3O16A 3A4XA 4OT7A 4H7CA 4IFRA 2XU2A 4RNIA 2PA6A 3EDJA 4ZO9A 1FKWA 1K3UA 3QFAA 1Z32X 1FO4A 3TX9A 3FNDA 2D1ZA 3VGBA 5GNYA 2PWUA 5CPOA 4GISA 5CGMA 1KWKA 2YVGA 1I4NA 4AYGA 4JOMA 1H3GA 4LAKA 2XSAA 3GTIA 4GVIA 1G4TA 2SFPA 3ALFA 4HPNA 4JGDA 2NQZA 1J9YA 3ENLA 2EXOA 1U5JA 1KB3A 2QLYA 4H3DA 1NFGA 3N6HA 3SI9A 3TOYA 3SGUA 1AZ1A 2CLPA 2Y88A 3FS2A 1H1YA 3D46A 4UZSA 2E25A 1XBXA 4GIYA 3AUOA 3FLUA 1XKYA 2DSWA 1BVNP 2FPTA 2OR2A 4H6RA 2XN1A 3MVTA 3IWPA 3NQMA 2WZMA 3TDFA 1F73A 4LC6A 4D6EA 2X50A 2GUBA 2EBNA 4GY1A 4JTUA 3NVVB 1DJHA 3ABRA 2PEVA 4KEVA 3OVPA 2QF7A 4C6FA 3TMQA 1FH7A 3NURA 2F38A 5EU9A 3PVFA 4CNTA 4PN2A 1XDIA 3AHTA 5I03A 3AHVA 3KDOA 4H8HA 3NGJA 3EWXA 1FVPA 1U5HA 4YLWA 4FO4A 2E8YA 1GPFA 4U33A 1ME8A 5HATA 1CX9A 1MXSA 2V3DA 3NM1A 1JCXA 4KERA 1VBJA 2WCAA 1XSKA 5T9BG 3WJXA 2AAAA 3VOJA 2VZTA 1XBVA 3TR9A 4GY0A 1G94A 2E6DA 2YDQA 1IIGA 3NDOA 3EWWA 3OZPA 1J2BA 5CSYA 1EC7A 3BQ6A 1VJZA 3W3OA 5TIMA 2I5IA 3NM3A 2V2CA 5LIYX 4A6GA 1VF8A 2CZEA 4WVXA 1QXLA 4X9YA 3VM7A 2VP8A 2CHNA 3CM4A 3WK3A 4JFUA 4AEFA 4PCSA 3MY9A 3C2VA 3BW3A 4DXVA 1S46A 1GJUA 4JQ4A 3BC9A 2GGJA 3NXLA 4RZ5A 3BGJA 1HQTA 3C4UA 4L9ZA 3DFOA 3W75A 3HGSA 3LGEA 1BKSA 1P7TA 1W3IA 4LBRA 3NYDA 3MO4A 4NVTA 4CN1A 4Y90A 3BV4A 1HVXA 1MNZA 2NUXA 3NZ1A 3MKVA 4UTIA 1GUVA 4P7NA 5AHEA 4EE9A 1HGYA 2Y62A 4TOQA 4GY7A 2NXGA 1WQ5A 2GQ9A 5FEXA 3UA3A 4ACZA 1E9ZB 4XIMA 2VQTA 1OZQA 3KX6A 3GIYA 3E2RA 4S3GA 4EQSA 5EMMA 4LCRA 1F4HA 4H4WA 3O9NA 3OOQA 3DHUA 4B16A 1EX5A 4LUSB 3IJ6A 1DJYA 2POZA 3GIPA 3GVQA 3TUUA 3FV9A 3EF6A 3FXGA 5U25A 2AGTA 4LH8A 1Q7MA 1E70M 3OZYA 3C2FA 1UP0A 4BURA 3AAMA 3OHMB 4AHOA 3GZ3A 1L8NA 1PO9A 4DUWA 5AC5A 4MAZA 3QC3A 4NX5A 3MUXA 3TN5A 5D4YA 4AZHA 4M6PA 3P14A 2FDSA 1D9EA 2J9XA 3BW2A 3HA1A 4B5VA 1XIEA 2X1TA 1H41A 3CV7A 4MDPA 3EOEA 2MANA 3V4BA 4NAEB 1S2VA 1Q4WA 2Y6ZA 4C1NA 1EA9C 5FF0A 2CXGA 4IGNA 1PTAA 1CW2A 1HJUA 2OO6A 1EF2A 1QPKA 3MMWA 5FD0A 2Y8VA 4PBFA 4AWSA 3HW2A 1V6VA 2ZDSA 1EJ7L 3RO8A 3WLIA 4V2XA 1EP2A 5HNRA 4HU8A 2VEGA 2QCDB 5A2BA 2CBUA 1TMHA 3O2LA 4X0VA 4MY1A 1WXZA 3HU7A 3GR7A 4OOUA 3ARRA 2WOVA 4C6DA 3MWAA 2BC1A 1SYTA 2O56A 2VL4A 1AJ2A 3CZGA 4OOZA 4NP7A 1M41A 1QW9A 3JU2A 4C6NA 1A3HA 3DXIA 8CGTA 1BQGA 4HSNA 5AC7A 2EQ6A 2O9RA 3V5FA 2WHJA 4L5ZA 2YX0A 3ITTA 2PMQA 5HWMA 1DWFM 1WBHA 1D2KA 1JYXA 1BQCA 5FKYA 1TPEA 2R1LA 4BQ5A 3KOYA 4L61A 3MA8A 3GXFA 4UOJA 1UBSA 3FA4A 2H3DA 1EO5A 3F5KA 1B3VA 1I2NA 1Z41A 4UCFA 3ZJ6A 3FCPA 3DI0A 1PE1A 3C61A 3WMBA 4O0ZA 3S1GA 2CWXA 1GVOA 1JXKA 2OZ3A 1JCYA 5CBJA 1KTBA 3AZTA 3WDHA 5D2VA 5I78A 4PMOA 3SCTA 1VGAA 4H4ZA 3APTA 1UIPA 3USZA 1H0GA 1R2RA 4ALDA 1ME7A 1TTQA 2A2IA 4K39A 5DLCA 4LUJA 4S3FA 4QFUA 4GHRA 4GXMA 8RUCA 4B4FA 2WHMA 1XH1A 2VX7A 1QNOA 2DUZA 2A79A 2GVGA 2WK2A 1CECA 1FFRA 1XC4A 3SUUA 3UJSA 1IGWA 4O1AA 3DUGA 1Q5MA 3FHAA 2PC8A 1W3HA 1IXPA 3PJWA 4H9UA 3CJPA 2RUSA 3B40A 4KFNA 1U2YA 4DXKA 3UPWA 4W87A 4BWLC 1EB3A 4YYFA 3USBA 3GDMA 4C1LA 1SM9A 1LRNA 4E8CA 2ZZ1A 5CCZA 4CNUA 4KKXA 4PSRA 3W7IA 4UFMA 1NDVA 4TXEA 1QI3A 5ENLA 1FFUC 4IGSA 2VZOA 3N19B 1T0OA 1EO7A 1AQHA 3W83A 3UR7A 4FX7A 3OA5A 3GXNA 1TV8A 4L64A 3SADA 4XD4A 4GYKA 3LLDA 4BFAA 5U1OA 2W55A 4YS1A 4AEEA 1S5MA 2R1PA 2B81A 4HYRA 2UWFA 3SZ8A 1XPYA 4QE5A 3IC9A 4WIWA 2CKRA 4MOZA 1PWLA 5BOOA 4F2BA 1BWLA 3K4WA 1HJWA 3WKZA 1GRBA 4G56A 1RD5A 3IJLA 5KTLA 3AJ7A 2VKZG 4WKAA 3GR4A 1V5XA 2ACSA 3PTKA 4YVVA 1UMYA 2NX9A 2Y7GA 4LVAA 4XZNX 3L4VA 1HKWA 4US5D 2PCEA 4WKFA 4A3QA 1W9UA 1E0UA 2E77A 5EFDA 3OZOA 4RPQA 1A5SA 4JCLA 1S3HA 3A4JA 3HB9A 3O05A 1NQ6A 2QPSA 1SFLA 2FPYA 3M5ZA 3LLXA 1OG6A 5T8GA 3ETRB 2QJHA 3R0DA 4G7EA 5BXTA 2VZSA 2YCLA 2OQLA 1S1PA 3MUCA 4JX5A 1YYAA 4AX7A 3STCA 3PUEA 3W84A 1LRQA 1BRLB 3CHEA 4HK6A 3RPDA 4D6FA 1DE6A 4GIRA 3L5AA 3SQMA 2GK1A 5HXMA 2FZ9A 4EMIA 3BLFA 4N0RA 4JYEA 4U2ZA 2UZ9A 3KL5A 4JKLA 1M03A 4CNOA 3P61A 3W71A 3GD3A 3F4NA 4AC7C 1NP2A 1MRAA 4IIHA 2XIBA 4RJEA 3RRXA 3TJIA 2ISFA 4UTFA 1GOOA 4H9XA 3VMOA 3VZZA 3G2GA 1YTKA 1Q1RA 1Y5WA 3W27A 1RVGA 1W8SA 1EBGA 3KRUA 1M5WA 1LBMA 2OKOA 3WNPA 5T26A 4P7OA 2QCCA 1ZY8A 4K36A 4AQLA 2G3IA 1EGZA 1TSIA 3RX2A 2Y5SA 3VD3A 5IHSA 1MEIA 1GQIA 3C2YA 1UCWA 4FB7A 4DZHA 3MCNA 4DJFA 1JZ6A 1PCKA 1ECQA 3B4UA 3UJ2A 1CTNA 2JFEX 1PPIA 4Y8EA 4C5ZA 1VPXA 3CLMA 5G1YA 1J12A 4ZFMA 2WC7A 3N2CA 2BX7A 3UY7A 4E2OA 3LD5A 4AIBA 4TIMA 1IT0A 4XAFA 3FAWA 1W9PA 2A6LA 3E02A 3H24A 1YBQB 3NDZA 3OVRA 3HMJG 3LHYA 4UR7A 1QJWA 2C6QA 3GWQA 4D2JA 3R07C 4EQXA 1T8XA 2IXUA 4MB4A 4Z1BA 1X96A 1XCWA 3EX4A 1E1CB 1JEHA 1GYNA 3BAYA 2HS8A 2X40A 2IKHA 1B9BA 5HR6A 2ZTKA 1XX1A 2QGYA 2X1SA 4NZFA 1ISYA 3G22A 2HBVA 4LAUA 4PCFA 1RBAA 3DH9A 1IEQA 5IXEA 3EB4A 1W1B1 3FVDA 1H7NA 4LAMA 4BI5A 5C9WA 4JTGA 1FP9A 2E1DA 4KQNA 2YZ5A 3K30A 3W6MA 3F4VA 4QISA 3AI0A 3N18A 4OUEA 3WLTA 3QHMA 1E6NA 3ZXWA 1YPFA 1H50A 5ABHA 1TPB1 4O4WA 2PDLA 2DJXA 3BLKA 2QDEA 3DFPA 2VGGA 1FECA 4IMEA 1UKPA 1V77A 1WBJA 1TVPA 1R46A 1XL9A 2OT1A 1ZRQA 2VWTA 2VX4A 1ADSA 3G1SA 4FLQA 1OFPA 4JQ1A 2ZRXA 3NA8A 2HZGA 3S2JA 1QW8A 2ZXQA 3H55A 1XHCA 1ZY9A 4AU0A 1DYSA 4J28A 4L6OA 1UQYA 3S3GA 1PX3A 3AQUA 2ZZ0A 3E6EA 1JI2A 3DHDA 3QRHA 2OEJA 5HMFA 5I3DA 1DEDA 1OCJA 3QZAA 3VKAA 3T08A 3HZ3A 1Z48A 4UR8A 3O15A 4Q8NA 1JCNA 2RDWA 1VENA 3MZ2A 4KH2A 2E3TA 1B90A 3B06A 1RBOB 3S8HA 2CFFA 2WBAA 3W7JA 1U30A 5G2IA 2NXHA 3GXPA 3TV8A 1BFNA 4P8VA 3VD5A 2QUUA 4ZSTA 3IAQA 3S0CA 1Q4NX 4KWOA 3L4XA 2C0HA 4UNLA 4B5XA 3W1LA 4UOZA 1TPWA 3GG8A 4MY8A 4UFKA 1P0EA 3BCDA 1VC4A 4UMBA 3VUSA 1CBGA 1ISVA 2P10A 2NUYA 1DIKA 3VUPA 4O12A 3W22A 4H2CA 3U5UA 4XZHA 3MT1A 1KFEA 1SR9A 2FVMA 1UMLA 4C60A 3AXKA 3BCJA 2XG9A 3QV7A 1ZJBA 3IARA 3TMLA 3NYZA 1WV2A 1JPDX 1XANA 3K4DA 5D8ZA 4UCGA 3O6CA 2NVCA 3UYIA 3E74A 3R8GA 3LCHA 4DYJA 1ZSXA 2Z28A 2AKMA 1TYTA 2C18A 2WSQA 2J7GA 2OO0A 4LANA 3B0PA 2H8ZA 3B8IA 4AMCA 2JF7A 2PDFA 3WNNA 5K4ZA 4HD5A 5A2AA 1GOMA 3RN6A 3MANA 1XD0A 4F0MA 1W56A 1IEWA 1B3WA 1JAKA 2GVEA 1TVLA 2V68A 4AWUA 4JTHA 7TIMA 4K8DA 3LHZA 1OX4B 3A3XA 3KL0A 3EYPA 2QCDA 1QR7A 1FCUA 2O4MA 1WDWA 2QDGA 2EG8A 4L56A 3OQ8A 4JY8A 1UKOA 3OEXA 4DJFC 5FESA 3GC4A 3CPRA 1A5BA 1WYGA 4LJ3A 5KZDA 1NF7A 4O13A 2ZX8A 2O0TA 1TE1A 2CBIA 3JZUA 3MP3A 1ZENA 4W8BA 1FWIC 4GC3A 1R85A 4MJ4A 3FXYA 1Q6DA 2WM0A 3UWWA 1JR1A 5D02A 3AIUA 3OW1A 1JGIA 1V51A 4R7WA 3TTYA 1SPQA 1OFDA 1HJQA 1ISZA 1DJIA 3G6LA 2RJHA 5DF0A 4AEOA 2NVKX 3WF3A 1K6WA 3AFBA 1RH9A 4H9TA 4HPGA 5JCNA 3NQ2A 4RX0A 4UTLA 1CWYA 3BH4A 1GORA 3VFCA 2YFNA 3PHAA 3W1MA 1TWDA 5GJNA 4BEQA 1FWHC 2XFWA 4O54A 2C1GA 4HCDA 2DSVA 3A23A 3PBMA 1LQ0A 1AQFA 4MNJA 1R3SA 2NUWA 4YWSA 4HVXA 3P60A 3SGZA 1W31A 3PY2A 4UB9A 4K37A 3DIPA 3I3DA 2Y85A 4OIFA 2QVHA 1LVLA 1E1EA 2PFHA 3SECA 2Z29A 3B05A 1TJ0A 4P5UA 3GG0A 1V0KA 4ZTXA 3UERA 3SM0A 1GPWA 4J1OA 5LNWA 4IISA 3WLHA 1ECEA 2X8CA 3A9BA 4LX4A 3FKKA 1EJUC 4GNVA 3KBSA 4DF1A 4R88A 4H8NA 3CZKA 4JKMA 1ONXA 5H8UA 3DGZA 1GQLA 2VELA 5I02A 1TFVA 3ZT6A 1M1BA 4E38A 3B9NA 3P62A 3NQ8A 1T5AA 4R27A 1SMAA 2NVAA 3BLIA 2OYLA 1X6UA 5D37A 3NCOA 1HJSA 2PLCA 1K8CA 1XIHA 2VVSA 3S9YA 5BRPA 2W54A 1T7LA 1RM6B 4F0SA 4QJ1A 1X39A 1CXLA 5DN1A 5HR7A 1N55A 3T55A 2B4GA 3A3HA 1TVNA 3BLPX 2C7FA 1O1ZA 2IKGA 3IIXA 1KM6A 3EA2A 2CC0A 3EMCA 3THDA 5H1WA 3WH8A 1G4SA 4NZ1A 2QJIA 5K3VA 1WAWA 3SQLA 4FMVA 4P7LA 5JMUA 1OCBA 1R0MA 5CGTA 1BHGA 2QCMA 4CLMA 3N2XA 5G1TA 1K8YA 3H4KA 3SCQA 4JX4A 2YW3A 3NNTA 4NSBA 3NWRA 4WDWA 5EY5A 1KCKA 2QKFA 3FIGA 1EWEA 2BS9A 3UZXA 3TYZA 4WQ6A 1LL7A 1B3ZA 3GUGA 3NQAA 2D22A 4PZVA 5BYWA 2VFEA 2PDWA 3S5OA 1JNEA 2E6YA 3DX5A 4NT0A 1GOXA 3WQOA 3MW7A 5C9ZA 1TPFA 4YCPA 3PG6A 5F4WA 4K3ZA 1QI5A 4AD3A 3G0SA 3WLKX 1B5TA 1HKMA 3UP8A 1RV8A 1VKFA 2WZIA 3M0ZA 2ZADA 4YTUA 1CXKA 5DT7A 3HQ1A 1BRLA 1Z42A 2YDSA 3W6LA 2V6OA 4R85A 1DWIM 3URHA 1VP5A 4EPKA 1W3TA 4MYXA 3DBPA 4HPJA 4K6AA 1MMFA 1DPMA 1MFVA 1BF2A 2CBJA 4JFWA 3F1QA 3F2DA 5H2ZA 1J93A 1SO3A 4GO8A 3IACA 4LSBA 3QKEA 3NQEA 4AWEA 3WH7A 3BICA 2NW0A 3VD4A 3LM7A 4LUTB 2PDXA 3RG6A 4HSOA 1UZ4A 1C8QA 3WDRA 2O55A 2YDAA 1XF0A 3H2MA 5CG0A 2BHUA 2BC0A 1XIIA 1OBAA 1JF5A 2BVWA 4BA0A 3PF3A 5CJ5A 3GD4A 3OP2A 5CAKA 1C92A 3EOOA 1Q6OA 1JDAA 1TIWA 2WMJA 3HURA 3QZ6A 2Q8XA 1EBDA 3CO4A 5AFDA 2DZWA 4I90A 1KRBC 5EMUA 3EMQA 1KC7A 2XWEA 5A6LA 2ESCA 1IEVA 1PUDA 4G1KA 3REQB 4GZEA 1BLIA 2BDQA 5EBUA 1TV3A 5C6MA 1KQZA 4V15A 4S3CA 1W37A 1IXQA 1L6SA 4UR9A 4QG9A 1DP0A 4XSLA 1AQ0A 4I7WA 4EK7A 3WEOA 3W7QA 4J35A 1A5AA 2QVNA 3TYUA 3ANYA 1E1CA 1S2CA 2VRJA 1V3LA 1LOSA 1UHVA 1S2AA 1US0A 1NHSA 3VOIA 2PTWA 4AZBA 3DFYA 1LWHA 4GUHA 5A95A 5HANA 4UWMA 1OY0A 3DHPA 3I7QA 2FMOA 3WSUA 4Q8VA 3E9AA 4GGBA 3LB0A 3GRSA 4DNAA 1FDZA 5EBAA 3OLEA 4KETA 3V16A 5AC6A 1Q6FA 1T40A 2IPWA 1OFBA 4CQDA 3S42A 3CO8A 1GYLA 1KFBA 2YCIX 1A3XA 4RE0A 1W54A 5I5RA 2W3ZA 2OEKA 3TNOA 4ZOBA 1TYPA 1FP8A 2G96A 4HMNA 1YDOA 3WBYA 3NOEA 3K5XA 2AKZA 2R6OA 3MHUA 1ZFJA 1NWUA 4MY9A 4PFMA 2G4FA 2X2YA 1RPXA 1PZ1A 1L2UA 3OLGA 4I9AA 1OYAA 4Y9AA 1NELA 4Y2WA 1XFCA 4XB3A 3SCSA 2R1NA 1I0BA 4IMCA 4IP4A 1AH3A 1GOKA 4E6MA 3ZSSA 4WY0B 4DPQA 3CZ8A 2C1HA 3M0VA 3GXMA 2HBXA 4JL2A 1D3GA 1Q1WA 3P8IA 4DIAA 1LM1A 1UKSA 2WJDA 4RKAA 1GTHA 3CU2A 4L9YA 3WNOA 5DMNA 1KBBA 4W8LA 3PAJA 2JEQA 4I9TA 4M5PA 4PUUA 1JPHA 1NDZA 4JDBA 1G1YA 4K38A 3O0HA 4QDPA 4QLKA 4O1BA 2WC3A 3GG7A 3QLDA 5TAOA 3BW4A 1U33A 2DZVA 4BF5A 1S3TC 3VDAA 5ECUA 2WXDM 3JRKA 1GEQA 4G7FA 4NI3A 3M4HA 2QXWA 2VCCA 3EXTA 4XUYA 3BAXA 3L7RA 2JIWA 5TNVA 4QNEA 5IDZA 3S6DA 4HMCA 3IUDA 4EVZA 1QCWA 2FGZA 4PBEA 4A8IA 3SUTA 3R1ZA 2IQ0A 1W3LA 1UH2A 2PBGA 3EPMA 4QIUA 2VURA 4WR3A 3OVGA 4XWUA 3L5LA 4AH7A 1TR9A 5GPRA 1JZ7A 3BDKA 3T1GA 2MUCA 1E1FA 2ACRA 2GPTA 2YXXA 1FWEC 3BXWA 3PPFA 2BWGA 4BCEA 1A0EA 4MNLA 4P8WA 2XVGA 3UZYA 4JS3A 1Q7QA 4GVFA 3N9KA 2ZC1A 1PV8A 1ZALA 4HU3A 1V3JA 3AS3A 1MDRA 1YMYA 3BVJA 4IWWA 1XFBA 2J74A 4U5IA 1OVDA 3AMGA 1RJQA 3VCNA 2TSYA 4ZB2A 3EUB3 3WF4A 4S1FA 3AIRA 1Q7ZA 2YA0A 4AG0A 3LI1A 3UETA 2Z6JA 1M7OA 2P50A 2TODA 2F2KA 2WMIB 2J77A 4CCZA 3AOFA 1OFEA 3PZTA 3T0CA 3CUXA 3N11A 5D9MA 5ECVA 1RHCA 4BKNA 1E0TA 4UTTA 3M6DA 1KO0A 3HQOA 5JIPA 1GVSA 1EDQA 4JQ9A 3Q4DA 1XGEA 4LBSA 2X42A 1UJQA 1OC6A 5E9AA 1S1RA 2I57A 3S5ZA 1M68A 1UWAA 3GDRA 2QCHA 4Z1YA 3VNZA 1MEHA 2WYSA 1O5XA 2A85A 2C3CA 2Y89A 1FCQA 4AD0A 2VFHA 4DQWA 1CNVA 4NZ3A 2WOWA 4NJHA 1Q66A 2ISVA 3SCOA 3MSRA 3WD3A 1R7AA 4KRTA 3IVTA 4ZQOA 2BY2A 2GVLA 3PBWA 1R2TA 1FTXA 4GH1A 5JVLA 3QLLA 2ZX6A 1KKOA 4PMDA 1UA7A 3EX1A 3DG7A 3LHTA 4GQ0A 4W86A 3W7RA 2PD5A 2YBUA 1GCYA 1Y0EA 3AC0A 2WZHA 3C0JA 1K9DA 4US5A 4Q4RA 5MKGB 4GO9A 4PMUA 2PRHA 1E6ZA 3JW7A 1BVZA 2OB3A 4Z2JA 2V3AA 3QMRA 3EXSA 4H6QA 2JEPA 4UFJA 2VCAA 1QDSA 4QSHA 3D6NA 2IMRA 3W7LA 2HS6A 4QEEA 3TW6A 3D3AA 5HJLA 4F2UA 4Q7IA 1J0KA 1IXNA 1S5VA 1EH9A 2BFGA 4FLRA 2ACQA 3M1ZA 1TIMA 4AZCB 1VEPA 3E0IA 5JRBA 5A8PA 4YHEA 3TA9A 3AWNA 1J0JA 4B15A 3O63A 4RW3A 4EMJA 3S2MA 3WK2A 2EG6A 4CCEA 3EPNA 1UJPA 1BPLB 4PFHA 4O1CA 1EZWA 3DYOA 2D20A 1TPDA 4ICCX 4DBWA 2NQ5A 3BMWA 5EMKA 5C9UA 2WV8A 3TCSA 3B9OA 2DQXA 3KBNA 3JVAA 4GZIA 3A4WA 3WNKA 5I3FA 3UYCA 2VC7A 3QOKA 2QW5A 3DI1A 2XTKA 1EA0A 3BL3A 3BOFA 3FYPA 2JK2A 2D69A 3RDKA 1FWDC 1EIBA 1F8IA 2PU0A 5AC4A 3KVKA 4O15A 1P0BA 1POJA 3H7UA 5JH2A 5BXSA 1GVRA 2Y7EA 4F40A 3V7PA 2PDUA 3G6MA 3IV3A 4JX6A 3RM4A 3EAUA 1C3FA 2PB1A 4DWSD 3PB0A 4U10A 2DGAA 3SY8A 5HQMA 3CL8A 1GQNA 4QSFA 5A94A 4C91A 1NEYA 1REQB 2UY2A 2X2GA 4O16A 1EYEA 3TVAA 4FOUA 4S23A 3W28A 3OVQA 1XV8A 2OSXA 4QRNA 2EPKX 2QCLA 3CL7A 1G01A 4MB3A 3L4ZA 2Z25A 3HO8A 4LYKA 1P1XA 1ZB5A 3T40A 3KBJA 1N2VA 3EX3A 3H21A 9RUBA 4DBUA 1GHRA 4HHPA 1SW3A 3WL0A 3ARYA 1QVBA 3TQVA 3UF9A 4U4MA 2FYMA 2WPCA 1NF0A 1DBTA 3CZJA 3VOHA 1JD7A 1V3KA 3WD0A 3RM9A 2CXEA 1C8YA 3Q65A 4DVOA 1WXYA 1ZLPA 4B90A 4IUOA 2EPMX 3GG1A 3URNA 2Z1SA 2VFGA 1GHSA 3PJTA 1JCMP 1XGZA 2PZ0A 4ZOEA 3G0UA 3UCDA 1XR2A 4YVPA 5A6TC 1XBYA 2VFFA 3LCWA 3WX7A 2JGYA 4DYKA 5FJUA 4JYDA 3SCVA 1L8PA 1DIOA 4POCA 4AD5A 3WDQA 4Y7EA 2XIMA 4HK7A 4UTTC 2D2OA 4HB7A 2NQ9A 2D23A 3UZWA 1H0IA 3P5ZA 5KETA 4FALA 1VQZA 1N7KA 1W1VA 3RXZA 4V27A 4DI9A 5CXPA 1OB0A 1IT8A 4LUTA 4PCTA 2JKEA 3QOMA 5FEPA 3KCJA 1XYAA 1FA2A 1Z69A 3J7HA 1R3YA 4ZR8A 1QI0A 1P5BA 4EANA 5HMEA 3WENA 4ZSUA 3WLRA 2EQDA 3EA1A 4CVUA 3ARSA 3OODA 4MWAC 2DW6A 1WCGA 3V1HA 4WRHA 3QR1A 2GUUA 3FDGA 4K8HA 3W1AA 3WLPA 3REQA 2INFA 2DT3A 2O7QA 2ZDRA 1LDCA 4GH3A 4B91A 3NQFA 4IGMA 4DBDA 2W6RA 1E9IA 3E3HA 1L2QA 1H7OA 4GRTA 1O94A 3ES8A 3S6OA 1C29A 3WH9A 4ADSA 1GZGA 1QHPA 3TFXA 4X2RA 4F9JA 3GU9A 4CKQA 2HE5A 4CGTA 5U4NA 1FXQA 3T7VA 4KF1A 4CQ9A 4AZ6A 4BEUA 1TWZA 3TU9A 1XH2A 3W7EA 3C0SA 4AD2A 1TJRA 1OK6A 1MUCA 1VFFA 4JTTA 4IIBA 2VGBA 5TQLA 2X99A 2A7RA 4IMDA 2GR1A 3OC4A 3O6AA 3H6OA 4GBDA 5AN7A 2BGSA 3SQPA 4GCAA 4JTAA 2R1MA 1XINA 5M2FX 2QV5A 2C3DA 3LENA 3T0TA 1B3OA 3S2CA 1Q6QA 3XINA 1DWJM 3RX3A 1XIFA 3E0WA 1V6XA 3ZSTA 1KN0A 1W0MA 2OGJA 2VT0A 1K03A 2TRSA 4QAWA 2PDQA 4GJ1A 4O11A 2DIKA 4LS2A 3NZPA 4MGGA 1W2PA 3VZXA 1VBRA 3P0XA 4FNPA 4LOCA 3QHOA 4A29A 4X3ZA 3R58A 3WDJA 1B57A 3ARVA 1NP0A 5I2UA 2EKGA 3KUMA 5C9RA 3M0YA 3VYLA 1GG0A 2W5FA 1NWRA 1OD8A 4WY0A 4MKVA 3LADA 2XZ7A 1RLDA 3S2NA 1TWSA 6TIMA 2YVJA 4EKJA 4L4PA 3LOTA 1JFXA 2VRKA 3L2MA 1LZOA 1Q13A 1CXEA 3ZOAA 4XAZA 1XYMA 4M7SA 3DK9A 4B3KA 4FXFA 1BG9A 2O9OA 2OPJA 4IPNB 1CXIA 1CI1A 1JXJA 2F6KA 3MWCA 1KRMA 2PGRA 1GVEA 4PTMA 1XLHA 1XQLA 4ONVA 4NXKA 3C2RA 3ITYA 2OLHA 4FNRA 1KFKA 1PTDA 1W5NA 3F2BA 4DO4A 4LALA 4DBEA 1O60A 4RDWA 2AQVA 3AS2A 4AY7A 3LS9A 4K8GA 1IWAA 2JQXA 4MSSA 4OECA 1HJXA 3NR0A 3C0QA 3IEBA 2J78A 2VR2A 5TR3A 3W72A 5I3GA 1FY6A 4PMZA 4UQBA 3CUJA 4IMFA 3A4AA 4AF0B 4C6MA 4JHZA 5KZ6A 2C14A 4GI4A 1VFLA 3CWHA 3B4YA 5DRCA 1A5MC 3TTSA 2ZICA 2PRLA 4WCJA 1D7KA 3CGBA 3B8SA 2IPJA 2QCNA 2GWGA 3LZ5A 4JTJA 1QWKA 3PG9A 1Q6GA 3T4CA 2HJPA 1G5AA 1QT1A 3VD7A 1S5WA 1XYFA 3GH4A 5C2CA 4Q8WA 1B3XA 4OE7A 3GXDA 3VTRA 2V9DA 2WMIA 2INZA 3ATYA 2X41A 3KTXA 3LYEA 1V02E 3DHFA 3MUY1 2ZUUA 3IJ9A 5FCZA 3AALA 2B7NA 1THFD 2B7PA 3L2IA 1WYIA 1TMLA 4FDCB 1TA3B 4KGJA 1JULA 3DDMA 1PZ3A 4JBRA 3ELFA 2FTYA 3NQVA 2I56A 2E6AA 4NRRA 1GNXA 4A2SA 5HBFA 3O0KA 2WVTA 3NZRA 1FIQB 4KESA 1E51A 3BLDA 5F4XA 3BG3A 4DI8A 1F3WA 1BYDA 4IHCA 4LNYA 2ZXAA 4XZMX 4DWSB 3DK8A 2E40A 2HTMA 1GZJA 2OYKA 3UVIA 4LV9A 3ZFHA 1R38A 2WB5A 1A50A 1MUMA 3WLJA 3A64A 1A5NC 3HPZA 4KWWA 2Z1XA 2RHGA 5HUPA 3W87A 3ORWA 2PF0A 4CD7A 4UFIA 3IGHX 1BYAA 2G41A 5M3WA 2R91A 4EQWA 2YOCA 5MF5A 4PB5A 1UOZA 5FSDC 4QS6A 5MKGA 5D33A 1W3NA 1QMLA 2E9BA 3AHZA 1ZK7A 1QOXA 3GD6A 1R9YA 3UXIA 2WOIA 1O95A 4IT1A 5G1MA 3A24A 3P6LA 2J75A 5F4SA 1OCQA 1OFAA 3P67A 3L21A 3I6EA 1H2JA 1XYBA 5I7GA 4AZCA 4CUCA 2PLKA 3A21A 1J6OA 2X8HA 4R9OA 1UWQA 3N2BA 1D3HA 3QPEA 1UG6A 3FX4A 2AMXA 4X22A 2WSKA 4C5YA 2OQHA 2GJXB 2DVUA 1NAL1 1W1A1 2E0PA 3Q94A 4HIBA 3EWDA 4DEFA 1HO1A 2AQWA 4O17A 3STPA 2RKXA 3EEGA 3UQNA 1V8EA 3CLWA 1A4LA 2PDJA 1BF6A 2JF6A 3C0LA 1E4IA 2BVYA 2HXUA 1R30A 1A5LC 3AU2A 1OX6A 4IIGA 5I3JA 4PUKA 1H7WA 4B5NA 1TX0A 3GE7A 2PAJA 2V2HA 1Z89A 2FJUB 4LFYA 5CZJA 3OGSA 2AMGA 3GFZA 1DTNA 1CENA 1GK8A 2QV4A 3AUJA 1RA0A 3R10A 1F3EA 2WNNA 3KDNA 5CZTA 1E9LA 5G5GB 1QOPA 5G2HA 5BXPA 1REQA 2C1IA 1W32A 1VRDA 4D1IA 1XDJA 4U2YA 3IANA 4KMQA 1OCNA 3VVGA 4KBXA 4MADA 1C8XA 1GYMA 1QOQA 3IS4A 4GUJA 4QX4A 1AW5A 4PEEA 1GVYA 2YLLA 3OPSA 4J3WA 5A6SA 3VGEA 1AVAA 3M16A 9XIMA 3ABXA 4S3BA 5CC3A 2CHOA 2G5WA 1YTDA 2F6XA 4C1KA 2YYUA 1UC4A 3W7HA 3BCFA 1OABA 1K7FA 3LM3A 1JRPA 5LNSA 1ONRA 1O5KA 3LCXA 5L9FA 4E8DA 4HA0A 4QJ3B 1F4AA 2ZQ0A 4MZ1A 1C93A 3C86A 4TO8A 4ASTA 2ZZ6A 3G3MA 3OHIA 3TN4A 4H4TA 1FCVA 3SJNA 1E73M 1QU4A 1JCLA 3WUEA 1IZKA 2GQ3A 1WP6A 1TV7A 1FWAC 1QO2A 2J24A 5B7ZA 1H5VA 3L67A 4O0QA 3NQ7A 3W6YA 1LTDA 4GI8A 3S5SA 1W1YA 2CLFA 3G18A 3I65A 3U57A 3M46A 4LY8A 2VENA 4QP0A 5F1VA 4I3GA 2C0AA 4DAFA 3Q6JA 4IFKB 1BWKA 2R82A 1YEYA 2AAMA 4E2DA 3AICA 1PWMA 4N4QA 4FP1A 3RO6A 1I1XA 2XSXA 3SJ3A 3SRFA 1U83A 4PMXA 4M8UA 3PJUA 4XAPA 3GAYA 3RILA 3RR1A 1KM1A 5JCMA 2Z2AA 3WEMA 3MMUA 2IKJA 3TH6A 1OIMA 1LG2A 3N04A 3ZJ8A 3GO2A 1VIWA 1A0DA 1QBAA 2BHYA 3A12A 4RCXA 4C6PA 2PLMA 1HT6A 4MWAE 1VJIA 4LPCA 2J8TA 3DAQA 1VBHA 4GRSA 1TX2A 1ZBWA 5EA9A 3DEQA 2VZVA 3P5YA 5AYBA 1ZBKA 2WQPA 1VIZA 1EXBA 1H5YA 3R25A 3H54A 4JY9A 3WBEA 1YRRA 1VEOA 2NQLA 2VM8A 3E12A 3UWEA 1WKYA 2LLEA 1F6KA 4TVDA 1WE5A 1WZMA 2QNEA 4O4VA 4JFSA 1D7FA 1OEPA 1VDVA 5DY2A 1EHAA 1FEAA 1N63C 4CNNA 4HNTA 4RV8A 3WQEA 5B80A 1UOKA 1F3TA 1A3WA 2A3CA 3ZWSA 2EEXA 4AMAA 3PNZA 3FJNA 4J3XA 1KNWA 2HQAA 3PZQA 4UTUA 4E8GA 1EQCA 4QBXA 1E6PA 4UMAA 1GG1A 4ADUA 3H53A 1L6WA 1LUCB 1VAHA 3KHDA 1V0MA 3POHA 3ZLFA 3TYDA 3L8KA 1YW1A 1XJBA 3PPCA 1FUYA 3FOKA 2GFTA 3A7UA 4X9SA 4ORMA 3VK5A 1AZ2A 2D3LA 3CTTA 3UXKA 3CZLA 2DT0A 1WKDA 4PEKA 3W7KA 2J79A 4UMCA 1H61A 2XZ9A 4RNJA 5I79A 3R8HA 2F84A 1IGSA 1NOFA 3BAWA 1TKKA 1DWHM 1W9XA 3ARZA 4FA3A 3GTFA 5CG7A 2GGIA 3ONBA 1FHVA 2CEQA 3B04A 4IPPA 4AIOA 1H51A 4M1BA 3GM8A 1TPUA 1BVWA 4CU6A 1GW9A 2X1IA 3TSBA 2ONEA 1D7YA 1DQXA 3KTSA 6PTDA 1E4MM 4HTBA 4L80A 1KCXA 2DSUA 4D8LA 3UBPC 2VDGA 4C1NB 3VKJA 2CNCA 1VCVA 1K9EA 3ME3A 3RPTA 2VD9A 3RJYA 4W9TA 5BMXA 3TN6A 4Y9NA 3EDEA 2F6UA 3A7AA 2PDHA 2QJNA 4JDRA 1WDSA 2TAAA 1V08A 4L1GA 3UY8A 2BVTA 1AMKA 3KM8A 4QE4A 4W7VA 4C6OA 4PMVA 3GRIA 3LZ3A 4TMCA 3F4WA 1XIBA 3H12A 4DX3A 4GG9A 4O19A 1T8QA 1PKYA 5C54A 3F03K 1OF8A 1B1YA 3GUWA 4LWWA 3TR2A 4PUEA 3WQ5A 3LRLA 3BAJA 4Y9PA 3QY8A 4U31A 5BMWA 1OC7A 3HTWA 1LT7A 4C7GA 2EQ7A 2Y63A 1O1HA 4AF0A 4UQDA 4M3PA 4J3ZA 4HA4A 2Y4SA 3Q67A 4GQQA 3T78A 1Q6CA 4K68A 1ZNNA 4LYPA 3PSWA 3M7WA 3WDPP 4DYEA 6XIAA 5LHFA 4PMJA 3MYOA 1TJ2A 4I9MA 3W24A 3F4CA 2HQMA 2VUYA 3QYQA 3TTOA 2V5LA 3T2QA 4HA3A 3SN4A 1LOLA 1FFVC 1Q2RA 1H09A 4JXCA 4L6HA 4XO6A 4CD6A 2YQUA 1XRTA 2RGMA 3RAOA 3UNDA 4PH6A 3BSHA 2DT2A 2GQ8A 2PTXA 4RK8A 3RJXA 3C56A 1EYWA 3DENA 1NDAA 4Q7BA 1GWJA 1N8FA 1JG9A 4YN5A 3WJYA 4C6CA 1JPMA 2CLEA 3DU0A 3MB9A 4GC4A 3HBLA 4R7JA 1I60A 3H23A 1LRTA 3VA8A 3G1YA 1PVNA 3AXIA 4DJDD 3I68A 3CZEA 1F9CA 4QLLA 4YNGA 4EPDC 4IUGA 5REQA 3CQIA 5CAHA 2WLZA 3FJ4A 1N82A 1ZAJA 1XRSA 1NWTA 4RXGA 1ADOA 3U6WA 1ML1A 3TFCA 1EDGA 3I4EA 3ITCA 4PGLA 4DWSA 3SSJA 1RP8A 3RK8A 1NJJA 2Z2BA 2PRMA 4QCFA 3TIMA 1I2QA 1MZHA 1WB0A 1OJTA 5LNVA 4GFIA 1RD6A 2OQYA 3GR8A 4AUBA 4ECLA 4NKCA 5IFTA 5CBIA 5FJJA 3LQGA 2HMCA 2VOTA 2VEKA 2ZC8A 1NHRA 2J8GA 3UPMA 3NEHA 1OZMA 4O50A 2E5AA 1EOKA 2YL6A 4J3VA 2YKKA 3EDDA 1BAGA 1VS1A 2TPSA 4GGHA 2V6AA 1EBHA 1O6IA 4FI4A 3MSYA 3RPMA 4B3LA 2H6RA 3G77A 2H8XA 5AYZA 4QG6A 2YGYA 2B7QA 1AW1A 4M6QA 4KCUA 2CBVA 3IJ7A 2Y2WA 1US3A 1UROA 2BV9A 1XG4A 3ZR4A 4HZMA 2Z7GA 3GFXA 1DKWA 1ZJAA 2WMKA 1HP5A 1DHKA 2GJXA 2P3EA 2OJPA 2AQOA 1BSIA 3P0WA 2FFCA 4MTVA 3LPOA 1FWRA 3EOLA 1FWNA 1NHQA 5A5WA 2KAUC 2YLAA 4LVBA 4DJED 2V69A 4YTTA 2NPXA 1XIGA 3K46A 3NJ3A 1TWIA 5TD4A 4ZEPA 4MLRA 4AIUA 1WA3A 4QROA 3VIPA 2DH2A 4B4HA 2R1KA 3K1DA 2E9MA 4FEZA 2PP3A 1NSJA 3TE9A 3BARA 3PULA 2W66A 3DGRA 4PE8A 3I6RA 1XLKA 4L4OA 2NT1A 1YQZA 3TOPA 3KVJA 3U48A 3T0DA 3BLEA 5CPNA 1QPOA 4EP8C 3CV2A 1V79A 1DWGM 4F4RA 1AJZA 1F2JA 1K70A 3SN1A 4KWSA 4G8TA 4IGHA 1W1IE 1XIDA 3UZZA 4GXPA 1FKXA 4GUFA 3E38A 5CPSA 3NXFA 1YNYA 3E49A 1GESA 4NASA 4D6CA 3MU7A 1AFSA 3MSGA 7TAAA 3HM7A 4CD4A 4UC5A 3QQWA 3O8AA 4BF7A 2TYSA 4N9BA 3VIHA 2WOQA 4M52A 3UWVA 1JGMA 2XIIA 1IR2A 1EZ2A 1FHUA 2ZRZA 4WD0A 1KV5A 1GTEA 5CPLA 4JNMA 4PC8A 3SR7A 2XH2A 4FS9A 3H70A 2WNWA 3ISIX 1JJKA 4GQGA 4RUBA 1Z7AA 2Q8ZA 1FOBA 4PL2A 3B8DA 4S2CA 1I2OA 4GINA 3WUBA 3ARWA 4MZYA 4GBUA 1B31A 1XWYA 1SO5A 4IMAA 5D2YA 1DQWA 1TJ1A 1FDYA 1LF1A 1EFZA 4LYQA 1MRQA 3JR2A 3EGJA 3LXCA 4NF7A 2GR3A 4PTVA 4IFKA 2OELA 2NSOA 2DJLA 3T8QA 1ZJHA 1EXPA 4DLMA 1UWUA 3IUHA 4KFPA 4KPLA 1KXVA 2D3NA 4J27A 3CUHA 4URIA 1FHLA 3GYCA 1KFJA 2DT1A 3PZGA 1GVIA 1Q85A 2NQJA 3R7MA 3VAVA 3E5BA 4EF9A 2Z00A 1GV4A 1ZUAX 4MDOA 3AIWA 3AO0A 2IQDA 3SDOA 3E1F1 3BGAA 4HPXA 4QGCA 3R12A 4JICA 3WQ8A 4YTRA 3ZMRA 4IPIA 1VHCA 3GX9A 5G4HC 3FA3A 4DWSC 1AMYA 1V0NA 3I6TA 4ZOAA 3WF2A 3LCLA 3PFMA 1F74A 1YLVA 5FI8A 4QG8A 1Q65A 3RFAA 4FSAA 3GH7A 3VI2A 4JKKA 4RNFA 5I77A 1W5OA 3N15A 3S5YA 1BGAA 3ZT5A 1EPVA 1R6WA 2MNRA 3UXLA 1GRFA 1JEZA 1OFQA 3AMKA 4BWLA 2FIQA 1M3UA 2DP3A 1H7PA 3W7DA 4H1ZA 2PC4A 3UXAA 3O1NA 3VNKA 5D9PA 3HV8A 2A3LA 3MPGA 4X60A 3TW7A 2PTYA 2I5GA 2UY5A 2QMJA 4WOQA 2VX5A 3T44A 2ANUA 5A6AA 5C71A 4JEJA 3UG5A 5LZLA 1GJPA 5D30A 5LKYA 4OZOA 3BGGA 1IZJA 4FXRA 3W82A 3W73A 2X8GA 4RXFA 3L5MA 1LUCA 3R94A 2FJKA 4WY0F 2E4TA 1Q63A 3M43A 3CK5A 5HAOA 1EGMA 3LB8A 2FMNA 4NNAA 2OTDA 3W2LA 3DGHA 1KLZA 4B5TA 5KITA 4CU7A 2GGHA 1QNRA 3IRSA 5IFPA 3KP0A 4GYPA 2ICSA 1HKIA 3M0JA 1MWOA 3WH5A 2C16A 3NL3A 2P5NA 4B9YA 4PB4A 3CGCA 7A3HA 3QBUA 1V6UA 3LPPA 3IK4A 1FDJA 4PUDA 1YDVA 3W70A 1A80A 3FFSA 3M0IA 3B0XA 4RV3A 3TJLA 3RMJA 3RRAA 3VX1A 3WQWA 5KINA 2EG7A 4YJ5A 1SZNA 3C6CA 1H2IA 1PKMA 1HTIA 1RJPA 5DFAA 3RLVA 4LEQA 4I5XA 8A3HA 2P1FA 4JPGA 4M0XA 4EM3A 1HXJA 2CERA 1I0DA 3HGJA 4H41A 3GFYA 4UTKA 2YXGA 3WD1A 2GOKA 5BU9A 2FPVA 3RCYA 3P80A 2E6FA 4MFDA 5LIWX 3W7PA 1GETA 1UR8A 3V0SA 1BG4A 1R87A 2GDQA 2VEIA 3GW3A 3N2MA 1CGUA 4JTEA 1OADA 1F8MA 2JGQA 3VNMA 1X7FA 4W84A 1G7VA 2VZUA 3QGKC 5C8BB 3QV6A 1FH8A 3T9PA 4JAWA 1EC9A 3WQGA 5BCAA 4PULA 2PP1A 3PUOA 1HUVA 3KHJA 3GKFA 3NUKA 3QEZA 4RDYA 3VIGA 3W2JA 1RVKA 4IIFA 4JTIA 1SZGA 3QH2A 2J62A 1AA1B 2BZNA 4US6A 1SVDA 2JKPA 3CEUA 5TBOA 3THQA 2ODOA 3D47A 4QCEA 2D24A 1HF6A 1SB3B 2V5CA 1KM0A 4EIVA 1SJDA 2E68A 1U1JA 2QR6A 5AECA 3EDKA 4H9YA 5DCBA 3TC3A 4B5WA 3RNMA 2HXTA 1A5CA 2GSJA 5D2XA 5AYXA 4F8XA 2Q71A 5LA0A 1AG1O 3VXGA 1T99A 1KRAC 3HMCA 2ZUTA 4IP5A 4WZHA 3WO8A 4YTQA 2OYMA 1EQPA 4Z1CA 2V8ZA 3D3FA 5I00A 2YA1A 2YPIA 3OIXA 1KD0A 2BODX 5DMYA 4LU0A 5LSMA 1LT8A 1POKA 4WEVX 1JCTA 4GJJA 3N25A 2XFYA 1XLLA 4M51A 1KRCC 2OODA 1YDNA 1KFCA 1TPH1 5KSWA 4UXDA 1ZMDA 2IQTA 3L0KA 2ZZCA 3U4FA 2P0IA 1M65A 4GVGA 3ZO9A 4MUPA 3VD9A 1XLGA 2BBFA 1YXDA 1VBGA 4Z08A 5EPDA 3ABZA 2DORA 3LY0A 3MBDA 4PSPA 1MYRA 3TC6A 3ARPA 1R3WA 5CJNA 1EUNA 3WLLA 1PKNA 2BB0A 3TQKA 3HG3A 4HGXA 3GB6A 1UBPC 2V5BA 4A05A 3MKKA 1JUKA 2J7FA 1I75A 3L9CA 1PHWA 4W5UA 4N4PA 4XZLX 3K8LA 2YBVA 3SN0A 1RSCA 3VNYA 2Y1HA 4FR6A 3ES7A 1NFBA 3R6IA 1IXOA 1ZKQA 5E6YA 2V5JA 3ARTA 3NTYA 1UWRA 3IIVA 3QR0A 3QKZA 2HWGA 4KEZA 4AISA 1YIXA 4XD6A 3R79A 3W76A 4MPQA 1PSCA 4DZIA 1UUMA 4DNHA 1YPXA 1F5ZA 3GHRA 4MWAD 4HCHA 2J6XA 4GYPC 4MLJA 3LU2A 3NSMA 3WQCA 1RK6A 4H7ZA 2G3NA 3SW6A 2XYLA 3DYMA 1K6AA 2HNHA 4JTFA 1PIFA 4H19A 1O4UA 3DK4A 2BY1A 3E0LA 4P2VA 1VR6A 4PYSA 1LQ2A 4KCTA 1D8WA 1OWQA 1NDYA 1TUXA 3FSTA 3OU8A 4ZQPA 3LXBA 4LVFA 3AXHA 2WWDA 5FACA 1UASA 3GBDA 4AD4A 2Z0IA 3FHQA 3U2OA 3UPBA 1R5YA 4CQAA 1RK5A 1VD6A 1GVQA 2IPGA 3MP5A 4MKNA 4O18A 3N9SA 1VH7A 1M9HA 4DM2A 5CSSA 4Q6XA 4AD1A 2E67A 1J18A 4ZXOA 4E0CA 1YADA 4IQDA 2GJRA 3UGVA 2ZZ3A 4Q4OA 1I6NA 4J56A 3KOZA 2C71A 1OK4A 1WDQA 1DE5A 3II4A 2DPEA 3PTQA 4LVDA 5K9DA 3HQPA 2VOMA 4I5UA 3OG3A 4ICMA 4XD3A 1VCFA 2BTMA 4WDUA 4CQCA 4QLJA 4M6UA 4OQVA 4WF7A 3R43A 2G8ZA 4NAFB 3GVVA 1JPKA 4WDTA 4UIOA 1KA9F 4CD8A 3RCMA 1QUMA 4QJ5B 3LCGA 3UR5A 3ICJA 3TAOA 1AH0A 1EP1A 1TO3A 1K8ZA 1LCOA 3OBKA 3N3TA 4ZO6A 4KCVA 2DU2A 1IYXA 5BNKA 3EKZA 2Y8KA 3LCFA 2PDNA 3VIFA 5ABGA 1V6WA 1A5OC 3PG8A 4TX6A 1EC8A 4Z2LA 1ZAHA 3T2PA 4H4XA 2I7GA 4ZE4A 1F05A 3B0VC 3T05A 3WD4A 4Z2KA 3AZSA 5FEZA 2QQ6A 3LV5A 4W85A 1KKRA 3WDIA 3IK2A 1TE6A 2GDUA 4IIEA 1YXYA 2BLEA 1L6YA 4MNMA 4N6FA 3RIKA 3CXBA 4GE8A 5AB3A 2CW6A 1SJBA 5IBXA 4E4PA 1WUEA 1EUAA 2REQB 3G1FA 3M5YA 1FHDA 1IF2A 2ALRA 4D6DA 2BOGX 4AXKA 2WKLA 3W00A 4Z17A 3R2GA 4Q8UA 1EJWC 2P3ZA 1OT2A 3P3BA 1DNCA 1MQRA 3PSVA 3M0MA 3GBEA 3T2OA 3CWOX 3ZT7A 3ITGA 3K1GA 1GKRA 2FH6A 3DKJA 2DQWA 2FZ8A 1VBUA 1PS9A 4ZQRA 4E3TA 3NRZB 2DY3A 3QSTA 3H2CA 3JS3A 1JZ8A 3VIMA 3VDHA 1OHLA 2ZUSA 4JQAA 4UNKA 4F0HA 1AOGA 3SIMA 2A3EA 4H7VA 2EJAA 3PZIA 4C7FA 3VIKA 3L4TA 4A3UA 1PBGA 5H91A 3U3HA 4EAYA 4WXYA 4P7QA 4ZO8A 3AM9A 2J7DA 4DN1A 1CIUA 2NT0A 1W9DM 3CT7A 3KE0A 3FEQA 4C90A 4PMRA 2YBTA 4Q32A 1A47A 4IG2B 4RDVA 2OGYA 4PB3A 5E0FA 2HEJA 1AD4A 5KZMA 2Z24A 3H7VA 4MKSA 3B3DA 1ZDLA 4O1EA 1KW1A 4B92A 1FWBC 2ZTJA 1UWTA 3TONA 3PJXA 5FS7A 1I2PA 3W7NA 4H9VA 5DO8A 4AB4A 3WJWA 2V0TA 1NOUA 3THCA 3PBVA 2W92A 4JTSA 3VGHA 2WZTA 4Z42C 2OOFA 5I3KA 3PANA 4JFVA 3DJJA 1RBLA 3WQDA 2FHCA 4ZGYA 1IWBA 1P4CA 1XC6A 1GSNA 2JK6A 4J57A 1E6XM 3ZVHB 4NEWA 3N9RA 2HISA 4GCXA 4H4PA 3SSZA 1J5TA 1EWDA 1K8XA 2YCKX 1J01A 1EKOA 3MYPA 1AW2A 3W26A 3KS6A 3WF1A 4EWJA 1YNQA 3SAZA 2FGLA 1OFRA 4HOXA 4I6VA 2ZVRA 4N6EA 3R8RA 5CPQA 2W62A 1XG3A 2X0SA 4S39A 3NFUA 1WPCA 1R47A 2G97A 4DPPA 2BOEX 1B9ZA 1MO0A 2Y5EA 2ZBTA 3G8RA 3WLOA 5DQPA 1HO4A 3WLQA 1TWWA 4ATLA 4PL1A 3BAKA 1CB2A 1TREA 2OX1A 2OOGA 3UJFA 4CVWA 2NZLA 3TN3A 3W4RA 5FSEC 3BQ5A 4JIPA 3IRDA 3CQJA 3GTXA 3B0UX 5LNUA 4NJJA 1CPUA 3CASA 2WPFA 3NVYB 4V33A 4PUMA 1JDDA 3BJSA 4D9PA 4BJHA 3LNMA 3GU1A 4MIMA 3W1UA 4H4UA 4X63A 3G0XA 1H1NA 2CITA 2YZRA 3IIOA 3HFTA 3LPGA 5M5DA 3VCCA 3GNDA 3WD2A 4H00A 4J3TA 4FIRA 3PZ9A 3ZIZA 3COTA 1KTCA 4DJDA 4CU8A 3U9IA 2L5HA 3P2VA 2PBOA 3EPOA 3OGRA 1PYMA 3WH6A 4GZJA 5DT5A 3WQ4A 4R33A 3LSBA 3EZ4A 1G4PA 1ODUA 3PFRA 2A21A 4LB3A 1ZCOA 2UBPC 3HPFA 3VX0A 3TYBA 2YB1A 3GC2A 1SO6A 1KM2A 4LA1A 1O5QA 3THUA 4WSJA 2PTDA 3NO1A 3VM5A 2ISSA 4KRZA 3B8WA 4GXWA 3CAQA 3W1TA 5C5YA 5IBXC 2PCQA 4WGHA 4Y8FA 2PGFA 3FG2P 4ZL1A 2PODA 4KS0A 2GGEA 2GOUA 1F07A 7REQB 3IVSA 4XD5A 5G4WA 7PTDA 4AX6A 3PZUA 4MWAB 1JIBA 2P88A 3C8FA 2WHLA 4S3EA 3BMVA 1DTUA 4FNSA 3AIEA 3MKCA 5HMSA 4O57A 3MUAA 2YL5A 2WKGA 4YVXA 4XIAA 2HNEA 2FZDA 1GONA 3ATZA 4HKPA 5DRIA 3N12A 1ESWA 1B0IA 3BJTA 1PX4A 1S2WA 4GKLA 1UD2A 1TTIA 3QMTA 1GRHA 2BASA 2WCSA 1V7AA 2V63A 2BP1A 4YWIA 3BG5A 3ID7A 4E2BA 1LP6A 1G69A 3FY1A 4ZVJA 3VFLA 3U7BA 3RF9A 2XGZA 1Y5XA 1M6IA 4JTDA 3BZJA 3AMCA 3OZMA 4HNLA 4C65A 4DJEA 3NVZB 3N6QA 1G4EA 1JDFA 2FFIA 4LT9A 3I10A 3VGFA 1IQ8A 2OFJA 2VQUA 1ITXA 3MCOA 1PDYA 2NX1A 2ZUWA 1FWWA 3LTYA 5FJPA 2Q01A 3URBA 1B4EA 3I3EA 2GQWA 1JDEA 3IIZA 1IWPA 3U7VA 1L6FA 3G1XA 1J0HA 1ADDA 3IGSA 2HVMA 4MZ8A 2PWVA 3M47A 4IH3A 5D05A 4TTUA 2BNJA 4WXZA 3DYPA 4IP7A 1R9ZA 1E72M 1OQFA 1XI3A 2VD8A 3CGDA 2XGIA 2CZFA 1TCDA 1A5UA 1XQKA 4AW7A 3TROA 2BXZA 1N5XA 5C2XA 3VCRA 5CJMA 4GOAA 4R7OA 4GIEA 1O68A 3GTNA 1UWSA 1ENUA 4IQLA 1VYSX 4NYUA 1ZU8A 3V75A 2HVNA 1TQJA 4QHRA 3CMJA 3EWBX 3TW9A 1FCBA 2XH7A 3GDKA 3T6CA 4ZOHB 1P0DA 3NVTA 5E1QA 3WNLA 1EGVA 2Q6ZA 2JALA 4GKTA 3LEPA 5T91A 3MHFA 1XLMA 3O7UA 1SUXA 3TQ0A 3NPXA 2GYIA 1EEXA 1DIDA 2P53A 3EBVA 4Q6JA 3VNLA 2QJJA 1K7EA 5A1AA 2I16A 5HQEA 4G6CA 1OYBA 3WLSA 1R2SA 3KZSA 1UH3A 2NLYA 5A6KA 5GVJA 4TUFA 3SUVA 1EJTC 1ZZMA 3CHDA 5CGQA 1SZRA 5JBFA 3RITA 1YPIA 5G5HB 3GNRA 5XIMA 1ZL1A 1A53A 3INPA 4BK9A 2QIIA 3ARXA 1TG7A 2BXYA 5H6HA 1NFPA 1H49A 2QUTA 1Z44A 3CC1A 3OIHA 2JIEA 3PM6A 4DJDC 1UUQA 4HBKA 1VEMA 4FAMA 3B8VA 1SGJA 2V5KA 1ONEA 5BU6A 5JCLA 2EAWA 2OSWA 5JCIA 5FL1A 1QHOA 1FRBA 1EX1A 1QW7A 1OM0A 4J2MA 3QY6A 3I3BA 1UB3A 4NAFA 2GRTA 1XCFA 2W0HA 2Z1KA 1PXGA 2XVPA 5A2CA 2ZA3A 4OGZA 4YIWA 4KEUA 3NG3A 4WSKA 2YSWA 7CGTA 3UVAA 1E9YB 1UZHA 2HCVA 3KS5A 1JDCA 3DC8A 4IM4A 3RNDA 2I5QA 1GZ1A 2WPBA 2GJLA 4HA1A 3H4XA 3LNPA 4XAYA 1J2WA 5EFFA 4C6LA 4Q3MA 4L4LA 1Y8BA 2PSNA 3QR3A 1MW2A 3HPXA 4DLFA 1V02A 3MI3A 2EO7A 1NM9A 3AISA 3NQCA 4HN8A 2O4QA 1R3VA 5CEWA 4MUZA 4Q4PA 3CQHA 3DN5A 3PWAA 4MYAA 4YHGA 7ODCA 1QPQA 1CGWA 4D8ZA 4ZXLA 1N60C 3QJAA 1K7XA 3W25A 2QDDA 1X6NA 3OO2A 4Q8PA 2BHZA 2W79A 4QEHA 2OWCA 1OF6A 5AYYA 2QGHA 4IJCA 2NLIA 5HNUA 4D71A 3B9DA 3GHSA 4XO7A 1W17A 1IR1A 1YE6A 3UEQA 2XIOA 5A6MA 2REQA 2ZUVA 4DZAA 1ICSA 1VQTA 3QPYA 3M0XA 1KGUA 4LXFA 3KBWA 3YPIA 3QQ0A 4U3AA 4AZ5A 4JQ3A 4KT2A 2F8QA 1GGOA 3TXZA 1PL9A 1FEBA 1YXCA 1V93A 3DG3A 4DJEC 3CAVA 1IEIA 3HOJA 3ZR6A 3RX4A 4N02A 5BZAA 2Q8LA 4MF4A 4WX2A 2NX3A 2J9YA 4G5DA 1FWGC 1V03A 2QS8A 3MI6A 3GNPA 4FXSA 1CXHA 3ABOA 2P8BA 4LQ1A 3BZGA 5FOOA 5F2LA 4UTMA 1W3JA 4H9MA 2F9RA 4A22A 2NV1A 3NQBA 2QMKA 3W81A 4FF7A 2XUCA 3P93A 3W88A 4GA8A 3TNBA 3LHUA 1LWIA 2X1UA 1BD0A 3VIIA 4HJFA 2PDGA 3DGBA 4W88A 3PZMA 3K8KA 1C7SA 4PUJA 3R0KA 3C5QA 1MQQA 3KBMA 3RLGA 2WVVB 3UW6A 5C9XA 1OD0A 2RDXA 3NQ6A 2EJ1A 1JZ5A 2D2GA 3E2QA 3HG4A 4ACYA 4F9DA 3BUVA 3M0KA 2ZWZA 1LL6A 2FGBA 4RR4A 2PE4A 2QCGA 4UBPC 1V6YA 4IG2A 3MI2A 3PC0A 2XVKA 3TSDA 4XAGA 1DOSA 1XUZA 1XIJA 3DG6A 5CH9A 1AUSL 4FF5A 5ER0A 2CWNA 4U3CA 6ALDA 3CUZA 5H8MA 3GAKA 1H1ZA 3HRDC 4QTGA 3GQYA 2E5DA 1UR9A 1VB9A 1W6TA 5KVHA 4I8DA 3SIZA 3QW3A 2FHFA 2R24A 3PTMA 5I24A 4W89A 1FWCC 1QI2A 5AHIA 4KWUA 3ZVHA 2Y7FA 3P74A 3KLLA 1K77A 5M17A 1RCXB 3AWOA 4XTIA 1DJGA 3LTPA 3SFWA 1H6VA 4L9XA 3LXAA 4M7TA 2QCFA 3QY7A 2ZZBA 3H2OA 3SY5A 1HKJA 5J5DA 2ZUNA 3RHGA 2J66A 1QBBA 1PX8A 3A9IA 1UD6A 1H60A 2F5ZA 1TUFA 1ODZA 2J13A 1KBKA 2ZX5A 3CAKA 1ONFA 2OWWA 2YFOA 4AY8A 3VZYA 1M7JA 5A8MA 3B9EA 1STZA 4EAMA 2Y70A 2BCPA 3CGTA 5FS6A 3W2MA 3A3WA 4HMDA 2J4GA 3S1XA 4I6KA 1GQJA 1HG3A 1XSIA 1AD1A 2G3FA 2AL2A 4YTSA 3FJ6A 4FX8A 5I07A 4IXHA 4ZE5A 2EQ9A 4JR5A 3IIPA 1DJNA 2DIEA 3URQA 1NIUA 3V18A 5LA1A 2ASHA 4M6VA 2G3MA 3DFQA 4AVNA 1JPIA 3W29A 2A8XA 1XYZA 3EAOA 3EX2A 2CIPA 4M24A 3B97A 3AS0A 1LBFA 1UQZA 3FKRA 4RE4A 4DRSA 3T8LA 4NL1A 4HHHA 5FEWA 3VOFA 1SFTA 1E55A 2A0NA 3NOYA 2OLAA 2WPGA 1FBAA 1QI4A 4WKHA 1O12A 2ZKMX 5BROA 4K2SA 2ZRUA 2HROA 2Q3OA 1CGYA 3IGXA 3WF0A 3LRMA 4U28A 2W0UA 2PDKA 2IXVA 4EACA 1E3XA 3VILA 2WBKA 2OCZA 4Q22A 1KR1A 1TCMA 3HV9A 2YB4A 5KZEA 3DJGX 3TXVA 4XSMA 4HMEA 4LW7A 3OBAA 3VIJA 4HZ7A 5AZ0A 2X7VA 5HUOA 4R9XA 4TR9A 4ML9A 7REQA 4RW5A 1PZ2A 1RALA 4MWAA 1SJAA 4WGXA 4DBSA 1Z3NA 4R5EA 3MUIA 4N9CA 3GTHA 5JH1A 1UH4A 3G3DA 4K1WA 2C91A 1MXGA 3AROA 2D0HA 3GDBA 2PDMA 4H6EA 1W5MA 4GD0A 5IDIA 1QNQA 1UR2A 2J25A 3CB3A 4BQ4A 4CQBA 3K8MA 4EWND 4UFLA 2VYOA 4FX9A 1X8FA 2O9PA 3TYEA 3NO3A 3KP1A 1KCLA 1ZJIA 2WP6A 1UZ1A 4HN4A 1RQBA 1US2A 2JE8A 3B03A 4QM1A 2RAGA 5I23A 5GJMA 1DJXA 4F48A 3M7SA 1EJXC 5DCEA 2I1OA 4W7UA 5JBEA 1TB3A 3R0UA 1R3QA 1SW0A 3QFEA 3S47A 3PN8A 4UFHA 2VC6A 3TWBA 4GK8A 4S3JA 2H90A 5AC8A 2QUMA 5C2GA 3G8EA 4ZODA 3KOFA 3O3RA 1PKLA 2QAFA 4X2PA 3V1PA 2HE8A 1CLXA 4ZTYA 1P48A 2W91A 4E2VA 3PZVA 5J8LA 2PURA 4M56A 4Z2HA 3QPZA 3SEPA 2CPUA 2FVLA 3CV1A 1AODA 1MSSA 5C7HA 3E96A 3GHUA 3FSUA 5CC6A 4QS5A 1S5TA 3RR4A 4BI7A 3K13A 3DFSA 3GK0A 4ZB5A 2ZOXA 2V3GA 1VFOA 3SRDA 4DZ5A 2FTPA 3WK0A 1SSDA 4AHPA 4BF9A 2Z1VA 1H7RA 4GUGA 1X6LA 1BYCA 3G5EA 2GSEA 1UWIA 3UNTA 3UR8A 3HQNA 3W1XA 2GWNA 2F7FA 3F4DA 3PS7A 4NILA 3DECA 3MJYA 4GACA 3PZOA 4J4KA 3G24A 1RJRA 3NZQA 1SZFA 3AXXA 3JUGA 4AAJA 2ACUA 2PLJA 1W9VA 3OLDA 5M1TA 4RE2A 2NVDA 3QVQA 1KM3A 4GQBA 2IUZA 4GFSA 4Q8TA 5AVNA 1CDGA 2Z1WA 3L66A 3QSRA 3W7CA 3WMCA 3FDKA 4QITA 3VMNA 4H4QA 5DMMA 3EB2A 3ITXA 2V2DA 1XLIA 3L68A 4RZ6A 1G67A 3ZJ7A 3SUSA 4LS0A 2VGFA 4DNMA 3G1DA 4AZIA 1CGTA 2PP0A 4N2YA 3W1RA 6TAAA 3ARUA 1HL8A 3F5LA 3UCCA 3WEZA 3VNDA 3AIQA 3S4TA 3M5VA 4W4QA 4NIRA 1T3QC 1I45A 1CCWB 5DCDA 3VOCA 1LQAA 2DVTA 4IMGA 3TTEA 1HX0A 2F2HA 1CT5A 4X61A 3MV01 4MG4A 1SW7A 3FJLA 2XHYA 2VEPA 1XRFA 1JYVA 4D6IA 1M7XA 2B7OA 4MJ2A 1DHPA 2BGQA 1H4PA 1OC5A 4F79A 1CLKA 3L12A 2W67A 4JZ5A 4UZUA 3L2LA 4UQEA 4JIQA 5ABFB 5CC5A 3LPFA 5AHNA 1KBJA 3N29A 1PDZA 5J04A 3CH0A 4NRSA 1GJWA 5HK4A 1LROA 4KGLA 7XIMA 3A13A 4X0NA 3CQKA 4B3ZA 2EPHA 4DUVA 3URAA 3FYYA 4RLIA 3W86A 4FNTA 2RGLA 2GGGA 3S9ZA 4V1YA 5EBKA 1FWTA 5FL0A 3WMSA 2OG9A 2J88A 2GH5A 3LK6A 3QV9A 3VU2A 3UWZA 2ZZ5A 3CUFA 1R8LA 4QQUA 5E0KA 1XLJA 3SCWA 2NV9A 3B9AA 4JTLA 4DO6A 2D73A 2DSKA 1AL7A 5GQBA 2GR0A 3DBNA 1ITCA 1A49A 3H2AA 3VPLA 3A5FA 4NI8A 3M6YA 4IPJA 2DZXA 2CDUA 4FK9A 3E0VA 3EKGA 3EWZA 4WLCA 2YCJA 4MMWA 3HFYA 4GX9A 4ZOCA 3GU2A 1WZAA 2FZMA 3T07A 5IM51 4TX9A 4ICNA 4AXNA 3KOWA 2X30A 2PU1A 2H9AB 5PTDA 2FQIA 2VC9A 2ZWYA 2EPNA 1R9XA 1V0LA 3WFLA 1OX5A 2PWDA 2RDTA 4LRTA 2HPIA 3WQPA 3C3NA 5FA5A 3TC7A 1Z8AA 2A3BA 3BLLA 3EANA 3ZM8A 3H2NA 5FMHA 3E2VA 5E6ZA 3QM3A 1FXPA 4HJWA 3U0HA 3NIYA 1EL3A 1TTJA 5G5IA 3F2CA 4JEQA 3SY1A 4MPKA 4EPEC 4J7RA 2OVLA 1TYGA 3PK7A 4DELA 3AIBA 3TLQA 1E4NA 1DXIA 2ADAA 3C52A 1SFSA 3CEPA 2Q3RA 1C9WA 2VJXA 4JN7A 2AAQA 2RDUA 4ZO7A 1GREA 1NDWA 2WJZA 4GVHA 4NYYA 4PRWA 2WVVA 3B8UA 4LAZA 4XZ9A 1EHNA 2XPKA 5EMLA 3ITOA 1ALDA 4KIRA 4A8RA 4Q4KA 1XDMA 1LG1A 3DOPA 2XH0A 3PBGA 1HW6A 4AZ7A 1ZS2A 3A6OA 3B0YA 3M64A 4DF2A 4CN4A 1QPRA 4LUSA 2VX6A 5EMYA 4JIEA 1DORA 1W1PA 5HNNA 4ZQMA 4OU1A 2RABA 3AYTA 3SCRA 4XVEA 1ZGDA 2PDBA 3N2OA 4Q7NA 4NU7A 4BI6A 4Z2GA 1U5VA 2OLSA 2V3BA 1HN1A 1BKHA 4TX8A 5RUBA 3WZ0E 3BLOA 2O7SA 1OIFA 4K8EA 4D1JA 4K7YA 3L5OA 4UNIA 2XFRA 1KBLA 4K1GA 1H62A 4NAEA 3STGA 3UD6A 3O0FA 3LLFA 4ATWA 3GY1A 3VGDA 5A69A 5CLTA 1TMQA 5I3IA 4GJIA 1WKEA 3W74A 3CPUA 4JDYA 4UTJA 1J96A 3CT2A 3RYSA 2VR4A 3UWYA 5L6UA 1SQ7A 3I4KA 3W02A 5CSRA 4H2HA 2W9MA 1JRCA 3NSNA 5LGZA 2PGWA 2HPMA 4MJZA 4AVOA 1JROA 3N1AA 4IX2A 1KM5A 4NNBA 3TZFA 1C7TA 1MZRA 1HL2A 1BWVA 3TSMA 2ATMA 4KCWA 1UKQA 4Q8MA 4J40A 3FW6A 3LCIA 1QK0A 2PWGA 4Q4QA 5HNTA 1JAEA 1QK2A 1VYRA 4QJ4B 3MMDA 4ADWA 4HNNA 2DVXA 3OLIA 4MAVA 3MO7A 1XXXA 3CQ0A 1X1OA 4D6GA 3L0NA 1B54A 2VDIA 1GT8A 1P6CA 1VFSA 4WJ8A 2J8FA 3MP4A 4LF2A 4AHQA 4C6EA 1N62C 1QNVA 5BRQA 1DXLA 4JQ2A 4XBKA 5DBTA 1MW1A 2ISWA 3H7RA 1X38A 4KRUA 1OG0A 2D0GA 2HV5A 1TELA 1JZ4A 5HWNA 5C7VA 5CZKA 5REQB 3MQTA 4HPHA 3SCNA 3P82A 2ZRWA 1Q6RA 2W3RA 1RPKA 1XBZA 2OWXA 4AWTA 2WMHA 5K9XA 2QF8A 4GNJA 3VOGA 1ZXIC 3IVUA 5A6BD 5DELA 1OINA 1GERA 3W2NA 3A22A 2FKPA 2GUYA 5FAJA 5E70A 3CNYA 5GNXA 3POCA 4E4FA 1XYLA 2EKCA 1C8VA 2OU4A 1OYCA 1JF6A 4G2DA 5HJYA 1JOAA 3F7JA 1GRGA 1GOIA 1NTHA 1LL4A 3MV11 3M0HA 2BY0A 5G4EA 4FNQA 1NY1A 2IW0A 3H2FA 3L4UA 1G7UA 4ZQCA 1WO2A 4ROPA 3VNJA 1K9FA 1LLWA 1H11A 2QCEA 1J6PA 3CAWA 3GW0A 2X16A 1XISA 5KVIA 1UR1A 3BOLA 4I5RA 3V5OA 2BMBA 3PPGA 5GNZA 2FH8A 3QC0A 3V5CA 1SJCA 4WK9A 3OA3A 1ZP3A 4PTXA 1OSEA 4GI9A 1V4YA 3BOXA 5I06A 3LN3A 3L0GA 2ZZ2A 2EQ8A 1IHIA 3N4FA 3PUDA 1QTWA 4LAOA 3ZQ9A 3CUIA 5D09A 2HRWA 4YU1A 2P8CA 1KGWA 3QV8A 1HZYA 2A3HA 2PTZA 3TYAA 1KXHA 4H50A 3BSGA 1XCXA 3HF3A 5FS8A 4I8YA 3Q58A 4B5SA 1PIIA 1WDPA 1DJZA 2DIJA 1F3XA 1O66A 1W3KA 3I7SA 2GSHA 2GR2A 4AZGA 1MXDA 4ERGA 5E0CA 3VKBA 2CLHA 4A3RA 1EDTA 1QNSA 3DC0A 1S39A 1GOWA 4UOQA 3CGEA 3O06A 3SCUA 1JUBA 1NARA 1C91A 1V7YA 3GC5A 1CXFA 3EEZA 3LBOA 1F61A 4IXXA 3TP4A 1VYPX 1DQUA 5CC7A 1UR4A 4D6JA 5JCKA 4TQTA 3AHYA 1EPXA 5M03A 3RCNA 4F0KA 4O8RA 1MFUA 5A6JA 3MMTA 3NEVA 4DWDA 4M81A 3SBFA 4BS0A 3VINA 4LBUA 2CZVA 3W7GA 4NXSA 4GMEA 4H04A 3S1VA 5JBDA 4CNSA 2RFGA 3MCMA 4KW2A 3MDWA 4LCQA 2WSPA 3BPWA 3UESA 2J7HA 2IPFA 5E93A 3UA4A 1VPYA 1PTGA 1J0YA 1VRXA 3KRBA 1R7OA 2VR5A 2BSLA 5MHBA 2DH3A 4W8AA 9CGTA 1X7IA 4O8AA 4L4MA 1F76A 2EPLX 4IPLA 4EXAA 5LGXA 4OJYA 2B0MA 2BG5A 1F8WA 1UD5A 1RY0A 3AMLA 4GPNA 4H4RA 2QPUA 2W4XA 3ZWTA 4CQ8A 3F5JA 5JIWA 4TTGA 4S3DA 3AXMA 3S9IA 1JRBA 1NU5A 2CLKA 2J9ZA 5D03A 1KM4A 4IX0A 4UQCA 1UP3A 3HJEA 4HTYA 3BG9A 1CEOA 2X0YA 1SFJA 1ZAIA 3APGA 2DDXA 2DZTA 2WCGA 1R3RA 1P1MA 1HNYA 3WL1A 4J5NA 3FYOA 2ZA1A 4OUIA 4J9JA 5ABFA 3SGGA 2WLYA 1JYWA 4QR6A 4HK5A 1LWJA 3S6TA 3MVIA 4DF0A 5TF0A 2E7FA 1YQ2A 4J2PA 3GNXA 4D6HA 1YBQA 2PWHA 2XFFA 4HOWA 2ZRVA 1CYGA 3HGRA 1XH0A 2BOFX 2V81A 4NZ4A 4FR1A 2OSYA 1E0XA 3OGVA 1W1TA 2WAGA 1XGDA 1BXBA 3BWWA 1ZX9A 4LRSA 2X0HA 2CHRA 2R9ZA 3ZS4A 1XLAA 3AMDA 4ADTA 3IJIA 3LG3A 3D9XA 4C6BA 2A6NA 4RDZA 3MBFA 2G3JA 5D8WA 2FLIA 1A4MA 4PCPA 3T42A 3DESA 1SU5A 3LA4A 4R53A 4JTQA 4YXGA 2YL9A 3UGRA 3T4WA 2G95A 1EJSC 5BWAA 1J4EA 3ZYZA 1CLVA 1O7AA 3KVLA 2P76A 4ES4A 4ZQNA 4JHOA 2H9AA 4FHAA 2E5BA 1E5NA 4HYWA 2PI6A 3VKKA 4QNWA 5F1UA 1KXQA 4Q4SA 4R34A 2QAEA 1VLIA 3AJXA 2V82A 4NJKA 1WX0A 2J3NA 1B3YA 5AHMA 1KCZA 3MDUA 2YR1A 4Y6GA 2VVNA 4C6KA 5J5RA 3TYCA 2OZTA 4XVDA 3W07A 5K4XA 1J0IA 1A0CA 1V3MA 2ALDA 3I7RA 3KRSA 1BTCA 1AH4A 3RLUA 4JIRA 3KTCA 2W63A 1MEWA 5EMJA 1N8WA 4OBRA 1HKVA 3GVWA 3FAXA 4H4SA 4J3UA 3SCPA 1WOAA 4GLEA 1Z6KA 4MFEA 4A35A 1NOWA 2J47A 4KWVA 1HP4A 5FJRA 3UFYA 4JD4A 3PBUA 5CZSA 1DVJA 4TVWA 4S38A 4HCLA 4ATDA 4OKDA 8TIMA