4DX3A

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
400
structure length
360
Chain Sequence
MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 126
structure length 360
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dx3A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dx3A01
2OKTA 3TCSA 2PTWA 2PS2A 3UGVA 3EEZA 2AL2B 1EC9A 2GGJA 1YEYA 2AL1A 3UJEA 2OG9A 1EC8A 2OZTA 4GYPC 1ONEA 2PMQA 1R6WA 3SJNA 3SSZA 4F4RA 3NFUA 2PSNA 1P43A 3IJIA 4HCDA 3QTPA 4A6GA 2ZADA 5IDZA 3T4WA 2QDEA 3TWAA 1JDFA 3IJQA 3I6EA 4IZGA 3IK4A 3ZVIA 3Q4DA 4HNLA 3D46A 2PP0A 3NXLA 4E5TA 1NU5A 2NQLA 2OZ8A 3VCNA 3R0UA 3CAWA 4GFIA 3I6TA 4KWSA 1IYXA 2GGGA 1MDRA 3DG6A 1E9IA 4K2SA 3P0WA 1MRAA 3TJIA 1FHUA 3R25A 2P3ZA 5J04A 1MDLA 1R0MA 4K1WA 3TWBA 3UCDA 1JPDX 3PK7A 4HNCA 4ENLA 2GGIA 1KKRA 2MNRA 1SJBA 3N4EA 1XS2A 4GGBA 3H8AA 3BSMA 2GL5A 3JW7A 4Z1YA 3OTRA 1RVKA 3U9IA 3ENLA 3SN1A 4DHGA 2DW7A 3OP2A 1BQGA 6ENLA 2PP3A 4HYRA 4J1OA 4E8GA 3SQSA 2QJNA 3DGBA 4DN1A 2FKPA 1DTNA 3STPA 4DX3A 4JN8A 2OO6A 1PDYA 4GISA 4J3ZA 1P48A 3MZNA 3N6JA 5FJRA 3BOXA 4JHMA 1JPMA 4MGGA 2PU1A 2QVHA 3GY1A 2ONEA 3ZVHA 3TOYA 3T8QA 1F9CA 3OZYA 3S47A 4KT2A 3DERA 5ENLA 4IHCA 4DYEA 3TQPA 3P93A 2AKZA 3DDMA 3DFHA 1OEPA 1PDZA 1TE6A 3SBFA 3HPFA 2OVLA 3FV9A 3CXOA 1NELA 1EBGA 3R1ZA 4EWJA 3FCPA 3JVAA 4A3RA 3RGTA 3V4BA 3RRAA 4MMWA 3ES8A 3PWIA 4H19A 3TW9A 1BKHA 1EBHA 5BOFA 3UJRA 3MY9A 3U4FA 4DXKA 3DFYA 2OZ3A 4A35A 3SN0A 2FYMA 2HZGA 3QKEA 1TZZA 3ZLFA 2O56A 2PCEA 1FHVA 2ZC8A 3IJLA 5FJOA 3VC6A 2XH4A 1ECQA 2QGYA 2OFJA 4GMEA 3UJSA 3NO1A 3FJ4A 1MNSA 3Q45A 4GYPA 4KPLA 2AL2A 2PP1A 1W6TA 2PTXA 2POZA 4DWDA 2MUCA 4HCHA 4H1ZA 3UJFA 3VC5A 3DEQA 3OPSA 3RCYA 3D47A 2RDXA 3OW1A 2PTZA 1WUFA 1KD0A 2OX4A 3FVDA 2HNEA 3S5SA 4M0XA 3T9PA 3DESA 3N6HA 3VCCA 3CT2A 2XSXA 3UXKA 2PTYA 3ES7A 4KEMA 4HCLA 2P0IA 5EU9A 3V3WA 2XH2A 4G8TA 4MKSA 5FJUA 3FXGA 2HXUA 2P8CA 3ZLHA 2GGHA 3UXLA 3UJ2A 2PGEA 2CHRA 3H70A 2QJJA 3R10A 4E4FA 3R11A 3EKGA 3DG7A 1SJAA 1XPYA 1MUCA 4ROPA 4IP4A 4GGHA 3PWGA 3CYJA 3ZLGA 3QLDA 4E4UA 1TKKA 3OZMA 5FJTA 3TTEA 2OPJA 1JCTA 2QJMA 3SN4A 4X2PA 3T6CA 4HPNA 2P88A 5FJPA 3MSYA 3PFRA 3QPEA 1EC7A 3CK5A 2PGWA 4YWSA 3TJ4A 2DW6A 4E6MA 3H7VA 3NZGA 3MQTA 4FI4A 2QDDA 4ZCWA 1SJDA 4H2HA 3RR1A 3ZVHB 3P3BA 3B97A 3I4KA 4ZA0A 3MUCA 2PU0A 3V5CA 4K8GA 3DIPA 4HN8A 2XH7A 3THUA 3MWCA 2XGZA 3VDGA 3GO2A 7ENLA 3DG3A 3H12A 4IT1A 2PPGA 2PODA 3K1GA 2OQYA 4FP1A 2QQ6A 3BJSA 2P8BA 4M6UA 3N4FA 4GIRA 4H83A 1KKOA 2GSHA 2GDQA 3FYYA 4JN7A 2I5QA 2OLAA 1SJCA 3V5FA 2XH0A 4IL0A 1L8PA 1ELSA 3JZUA 3VFCA 1KCZA 3RO6A 4IL2A 4G7FA 4IP5A 3GD6A 4Z17A 3UCCA 3QN3A 3MKCA 3KUMA 2AKMA 3GC2A 2GGEA 3VA8A 2OQHA 3RITA 2PA6A 3CB3A 1WUEA 5BOEA 3R0KA 2HXTA
chains in the Genus database with same CATH superfamily
4RJEA 3F2CA 4AVOA 1T5AA 1B57A 2HRWA 4EM4A 3AXXA 4XD4A 1EZ2A 3EDKA 4HNUA 4XBSA 2NW0A 2ZUUA 2B0MA 1EO5A 4S2CA 3SQLA 4CQCA 2A3CA 2POTA 4Q7BA 2OG9A 2IXVA 1B54A 2JKEA 1UP0A 4L1WA 3QC0A 4QLKA 4B16A 4JCMA 1U83A 2W3ZA 2V3BA 3DHUA 5G1YA 4OGZA 1DP0A 1QUMA 3GVVA 3CMGA 2CERA 4EMWA 5J5DA 1OX4B 3A5FA 3WDHA 2PDUA 4FLRA 1NFBA 1R3TA 1EH9A 4YN5A 4YL2A 5G5HB 3IAPA 1HIZA 1GVFA 1KC7A 1QPQA 1Q1RA 2NT0A 1VKFA 4A05A 2UV8G 2VHLA 4JTGA 1SMDA 3WLKX 1UR2A 3U8GA 3O0FA 1U5JA 4Q4RA 1SSDA 3DG6A 1TO3A 2IPFA 2I9EA 1IGSA 2ZRZA 2QNEA 4YCPA 3F7JA 3Q65A 3BH4A 3V7PA 3AIUA 1JD7A 2CFFA 3NURA 1PCWA 3P82A 3OLDA 2ZKMX 3TXVA 1WYGA 3CLWA 4K7YA 3W7EA 3ETRB 3AXIA 4JQ9A 1UH4A 5GRTA 5LNSA 3WJXA 1NF7A 3GKFA 3NZRA 2J9YA 4JDBA 5DX7A 1H63A 2CITA 4B5WA 1A5OC 3QV7A 4ZL1A 3QTGA 2XINA 3IARA 2HQAA 5A8PA 1D7YA 1TPFA 4DHGA 5AC5A 3GU2A 3E74A 3OVQA 5A69A 1GVSA 1Z3NA 3P61A 2QJNA 1DTNA 4CVWA 3QFBA 1LL6A 2GFTA 3U7VA 5REQA 3GNXA 4S3EA 3POCA 1GVYA 4GC4A 2GK1A 3W1LA 1E1CA 4H7ZA 1KA9F 4C7DA 3FFSA 2QVNA 4UOQA 1JFXA 1ZDLA 2J7BA 1HO1A 2BOGX 4JYFA 2CZDA 3QY6A 1S39A 4J57A 2JGQA 2ANUA 2FPVA 4LNCA 4IGNA 4DYEA 3P93A 1SYTA 3V35A 2W92A 1XDIA 1WYIA 3BUVA 4ECLA 1XBVA 3HPFA 4CQ8A 1S2VA 3AO0A 2FLIA 4A3RA 3N4AA 3R43A 2F38A 4WJXA 4DVOA 2QUVA 5T9CE 4D6JA 3FHAA 4LNYA 2Y7DA 1V93A 2YJQA 3HM7A 3N2XA 1GVIA 4JIHA 2X99A 4IG2A 4XG1A 1V02A 4CN6A 2FYMA 2QXWA 1O1HA 1E6RA 3UZXA 4IFOA 1TPH1 3PUEA 4S39A 5HQMA 1KBLA 4QGCA 3RG6A 4S38A 3QR0A 3GC5A 3QMTA 5I6SA 1F6PA 1VEMA 3UJSA 2BOEX 5AC4A 1J12A 3MMDA 1NHSA 1L6SA 1TZ7A 3UWQA 3GXIA 4IQDA 2WNWA 3DFNA 2V3FA 1DPMA 4W8BA 3RAOA 2PDCA 7XIMA 6ALDA 2W4XA 1ODUA 1J5TA 1ITXA 1EBDA 1UQZA 3M0YA 5E70A 2ZX7A 3T42A 1V6WA 4NQ1A 2FPYA 3TCEA 3RF9A 1TPEA 1FWDC 2OWWA 3DESA 3W7DA 2DZWA 1P6BA 4QEEA 1P1XA 1H2JA 4P8VA 3AS0A 1O66A 3BW2A 4PMUA 3WJSA 2E9MA 3I68A 4H4VA 1E0UA 1H2IA 1KM1A 1XC6A 5EU9A 4A8IA 3QHNA 3NVZB 2GWGA 1XL9A 1BXBA 3CV1A 3AXHA 5CSUA 2PDLA 2PWVA 5D9PA 2QJJA 3P5ZA 2EQ8A 2WJZA 1Q6CA 1TA3A 2E25A 1P6CA 1IWAA 3ZFHA 3D9XA 4PCPA 1BYDA 1K7EA 4GZ7A 1X2HA 3MPGA 1FWJC 4U2ZA 4BY3A 1JROA 2WB5A 5GNYA 3BQ5A 1O94A 1LZOA 1OWQA 3AYRA 2F2KA 4DEFA 1LLZA 1ZY9A 3WNNA 3EYPA 4AIOA 4HYVA 1AZ2A 3NYZA 4IXHA 1UZHA 4JTLA 3R6IA 4F9DA 1GQNA 4IICA 1AL7A 3TYAA 2OELA 3DGRA 5K9XA 4LS1A 3N2TA 4LCRA 2NV1A 2VFFA 2GQAA 1XSJA 3QOMA 2E6FA 2BS9A 3UWVA 4AZHA 4NZ4A 4FI4A 1N2VA 2C1HA 2R1PA 3Q58A 4V2XA 5I00A 1SZEA 1S5NA 8XIMA 5FAJA 1J4EA 1HJSA 4FMVA 3ZVHB 4QG9A 1K7XA 3PHAA 2DSZA 3FGCA 3DIPA 1IR1A 1PHWA 1T96A 4K7ZA 1MXSA 4BJHA 3FDKA 3TK7A 1ZMDA 1VFHA 4IIGA 2X30A 3DG3A 4XV0A 4GZEA 2G4FA 2OQYA 3EX2A 2YFOA 3SR7A 3STCA 3GR4A 3CH0A 1I0DA 3GR8A 4AEEA 1OB0A 2D0FA 2WSRA 5HMEA 1YMYA 2GDQA 4LUYA 2ZZ6A 1BVWA 1E4NA 3IUDA 2YDQA 1GW1A 4JQ2A 2Y2WA 3BGGA 3SCWA 1PTDA 1KM3A 1FKWA 2QJHA 5JBFA 1PKYA 1K7FA 1CX9A 3GXDA 5HJLA 4R33A 1UR9A 4DBDA 4DAIA 3WD1A 4K8HA 3KLLA 3LRLA 4AZCA 3AMZA 1KTCA 3M44A 4K3ZA 2B4GA 2YCIX 1V79A 3AUJA 3S46A 1G4SA 4J3SA 2AL1A 1OGGA 4NY2A 1EC8A 4HU4A 4JTUA 4ACZB 1ZFJA 1JNEA 3CWOX 2AGKA 3HG4A 3EPOA 4ERIA 2IKGA 1OC5A 4H50A 2GVYA 1WKYA 3E0IA 3IJQA 3H21A 3ZVIA 2VR4A 1HO4A 1RBOB 3SO7A 3AFBA 3BMVA 1BZLA 3E2VA 2V63A 3EMCA 3MJYA 5ER0A 5TQLA 3SCNA 3B9OA 4H7VA 3NS1B 5CKSA 3ITLA 3QMSA 4A3QA 4QJ3B 4NG3A 2CNCA 1K03A 2GRTA 1C90A 4R7OA 3NZPA 3PNZA 1QO2A 3CXBA 4WDWA 3G1HA 3TEVA 1T41A 4B2DD 1VPYA 2W3SA 3FYPA 4Y90A 1H61A 4DF1A 1TMHA 1RHCA 4JX4A 3FNDA 2XVKA 4Z1YA 3QXBA 3TZNA 3UWZA 3UW6A 5U1OA 3IVTA 4AHPA 1S5TA 1NOFA 3C8NA 4Q8OA 1A3HA 4C1NA 4JTSA 3USZA 4AX6A 4AY1A 3MMUA 3MO4A 4YYCA 3MB9A 3QY8A 4QTGA 1EJUC 4QR6A 2ABBA 3OO2A 3IRDA 2JE8A 2PDHA 3VDCA 3LMYA 3F4WA 5C2GA 3BLPX 1IXNA 3AU6A 1ZAJA 4L9XA 3RUBL 1PDYA 1W5MA 3HB9A 4PTXA 2HTMA 1DXLA 3U6WA 4XD5A 1P7TB 3PPGA 1PWLA 5LA2A 1JPMA 3B3DA 1GVRA 1EA9C 4PSRA 1FFVC 2VD8A 1WA3A 3LTSA 3IANA 2GQ3A 1CYGA 1V0NA 3T8QA 1JDDA 4WQ6A 4DWSA 1KXVA 1A0CA 3SCTA 4EPBC 4KT2A 3EOSA 1L6YA 2EO7A 1AD1A 3SUTA 1UH3A 3KZPA 3RU6A 2ZRXA 3H53A 2FMOA 4O1CA 1B90A 2Z7GA 1X39A 3ABSA 4RPPA 3SCUA 2IXUA 1OEPA 2WOVA 3MUIA 5AC7A 4HHLA 3VKJA 3UXAA 3SM0A 3W2LA 2YL5A 3T05A 4N6FA 4C7GA 1KFLA 1MI3A 4GACA 2NXHA 4S3AA 2QHAA 1T0OA 3APTA 1XDJA 3M1ZA 2EPNA 2I14A 1X2GA 1PZ0A 4G7EB 3RCNA 1DXIA 3AU2A 1A47A 2V38A 1R8LA 2FQIA 1X6NA 4IPIA 3CNYA 4OFCA 4DI9A 2YBVA 3KHJA 3TFCA 2CXEA 2QKFA 3UYIA 1DHKA 1ICPA 1X98A 3M43A 3T1GA 3CGBA 1B3OA 3M7SA 1MO9A 4HPGA 4FAMA 1Y65A 3HURA 1H7PA 2C3CA 4FF7A 2GQ8A 4PUEA 3QPYA 1OFQA 5FS9A 1WZAA 3LLDA 2VFEA 5AHLA 1TPDA 1ITUA 2VVSA 3TW7A 4NNCA 2PWGA 3OBAA 2IS7A 2CLMA 5IHRA 2GSJA 2Y5JA 3TMQA 3WUBA 2FGBA 3LLXA 1Q6GA 4J9JA 3URAA 1PE1A 3LCFA 4PRRA 2ZRWA 1OX4A 1W9DM 1NH6A 2D2GA 1KRCC 2V5LA 3JU2A 4GO8A 1TR1A 2R14A 3IS4A 2VFHA 1NF0A 1AQMA 2VDHA 2Q8LA 3PR2A 5DMNA 5KSWA 1EDTA 1XFBA 1XH2A 1OVDA 3G1SA 3WNMA 3ZJ7A 3LXBA 1GTHA 1TVPA 4OUIA 1PVNA 1RUSA 4C91A 1DV7A 2RDWA 3TIMA 3U2OA 2D22A 3O0KA 3H4WA 3LNPA 4OOZA 4UQDA 3VAVA 2VURA 3LXAA 1UPMB 1R2RA 2J8GA 2QV4A 1XGZA 3WSUA 2Z2UA 5EMJA 4WZHA 2GR1A 4EE9A 1PV8A 4ZEPA 4GXMA 1UIOA 1JFHA 3ARVA 4DF0A 3UPWA 3GRIA 3CYJA 2C15A 2TYSA 2BFGA 2YCJA 4KGLA 3TYCA 1FX6A 3LPGA 2EKCA 4KFNA 1E5NA 2FVKA 4CU6A 1XYLA 4IIDA 3HTWA 1P0DA 3LHYA 2VMFA 5CSYA 3OLGA 5I07A 3OHMB 4AXKA 2V3DA 5EGRA 2QDDA 3TW6A 2HWGA 2VX6A 4LWWA 3KBNA 4ONVA 4JTFA 2ACSA 4CCCA 1HVQA 3PZOA 3U2ZA 1RAKA 4KFOA 1H5YA 2PU0A 3U2EA 3WELA 2P1FA 3QGAC 3AXKA 3UYCA 4LT9A 1TMQA 1LBFA 2QCEA 4XWUA 5JIPA 1ZL1A 3QM3A 5C9RA 4HNTA 3THUA 2EQ7A 4J3VA 2YDSA 7ENLA 1S5VA 1VLWA 3RJXA 1US3A 3VKAA 3ZYZA 1TTQA 2AQOA 4PMVA 3KWXA 4R9XA 2X05A 3VUSA 1SFTA 3LCWA 1E43A 2D1ZA 1R3RA 5BU9A 4FR1A 4MTVA 3GM8A 1HKIA 1EUAA 4H9TA 4UBPC 1E1EA 4R7JA 1RP9A 3GXNA 3MA8A 1NDAA 2OLAA 3H2OA 1UR8A 1UR3M 4M6QA 1A5LC 3DC8A 4P7NA 4MY9A 2VTFA 3N2CA 1IIHA 4JHZA 4W5ZA 4E3VA 4Q8NA 1YTDA 3CB3A 5XIMA 6XIMA 1RP8A 2ALDA 3R0KA 3TTQA 1SVDA 3I4EA 3KCJA 1J93A 3FN9A 2PC8A 1TJRA 2GSEA 5I3JA 4MZ1A 4MIMA 1H11A 2XIQA 3CO4A 1EPVA 4A8RA 4APNA 1WDWA 4C65A 2PLJA 3TDFA 5K4ZA 2V8ZA 3WQWA 2YVFA 5ABFA 1R30A 5BZAA 4PCTA 1PZ3A 2YDAA 2J13A 4TX9A 1GT8A 2HMCA 2ZADA 1EFZA 2ASHA 5IDZA 5BXSA 1TTPA 3BAXA 3N73A 1PCKA 4I6VA 2QGHA 2WNQA 3CZLA 4HNLA 3UU0A 1N8WA 4LSBA 3VNKA 1WQ5A 1OBAA 3G3MA 1ZBWA 1T3QC 2J75A 3PTQA 1QBBA 1KXTA 1MW2A 4XIMA 3SGUA 1E70M 4AZ7A 4DNMA 1MRAA 3VZYA 3PBWA 1AOGA 4XO7A 4GD0A 1LF1A 4F66A 2PDKA 1CXLA 3K2GA 4C6CA 3CZGA 4IMDA 3IPWA 5EA9A 1GOXA 1NP0A 3SY1A 2WKJA 2NUXA 2V69A 4QSHA 4IWWA 4GX9A 4JTCA 2PDXA 3OTRA 3NQVA 1XH0A 2OSWA 5IBXC 4IQJA 1CNVA 2XVPA 3HJEA 4KESA 3REQB 4GA8A 3SCRA 1P1MA 1OCNA 1EJTC 2J27A 2GYIA 3W26A 1BHGA 1Q63A 3PUOA 3EKLA 3WDQA 3NIYA 3CYVA 1GEUA 1LQ0A 1Q7MA 4MVAA 2J7CA 1JZ4A 1G7VA 1FOBA 3LQGA 2WKLA 5DELA 4Q8TA 4K68A 5HNNA 4H6QA 2A7RA 4MYXA 3A7AA 3GTNA 4JQAA 4WUIA 4C6OA 4PC8A 2WJFA 2HK1A 2PU1A 1OG0A 2QVHA 3M16A 3ZVHA 3AIVA 3C86A 1F5ZA 5AHFA 3CLMA 1HJWA 2J6XA 1A53A 1ZBVA 1ZP3A 3W1NA 2BMBA 1Y8BA 4PUMA 1M9HA 3CL8A 1X8FA 3B8WA 4F0RA 3ZSSA 2C14A 2L5HA 3SBFA 1LTDA 1NQKA 3OYXA 1MUMA 1TFVA 2XZ7A 3NO5A 1FWTA 4P8WA 4OBRA 3TV8A 3VOHA 1CDGA 4PMXA 4NYYA 1H50A 4CCZA 4IPNB 1J18A 1BKHA 4UTLA 1HP4A 4LC6A 3L4WA 3GHUA 1HUVA 3W85A 5C5YA 3W29A 3HF3A 4HSOA 1NHRA 4H9ZA 1W9XA 1E0WA 1GREA 2DQWA 3WQ5A 1O4UA 3THQA 4OBTA 2O4QA 5CLTA 1XR2A 4ICMA 1MRQA 2FIQA 3ZR4A 2GR0A 3AMDA 3W88A 4D6CA 2BXYA 3ZWTA 1S2WA 1A4LA 5HK4A 5A2BA 4KCUA 4E3TA 1SB3B 5GPRA 4Z1DA 3MMWA 1K9TA 3B05A 4PFHA 4YTQA 3UY8A 2YCKX 2WJDA 1F6KA 2RABA 4WKHA 1CGUA 5I23A 4D1JA 4I5XA 3CU2A 2YA1A 3QZ6A 1JF6A 1OF6A 3RR4A 3NQCA 5CC6A 2ZTJA 1R87A 1VJSA 2INEA 3HPAA 3M0MA 3OHIA 3G1FA 1AL8A 3P8IA 2D20A 3ABZA 1EP2A 3WMBA 1ZPTA 1REQB 5CAKA 2D0HA 1SR0A 1OHLA 1K6WA 3FXGA 2PDJA 2V6AA 5M17A 3ZLHA 2GGHA 4IIFA 3VTRA 5DEZA 4DLMA 3VPLA 1RCXB 4QEHA 1EGZA 1UKTA 5I2UA 3K8KA 1V59A 4PRTA 3KM8A 3SGZA 1GKQA 1X7FA 3ZWSA 1EOMA 3EWBX 4WKAA 5D9NA 4I7UA 1XQKA 4LTSA 4PMDA 1V0KA 5KZDA 3LTPA 1GHSA 3WH8A 5PTDA 1E6XM 3F03K 3ZLGA 3KDNA 1FVPA 4AWUA 5FJTA 1V6YA 2ACUA 4AZBA 3VNDA 1JCTA 3VNZA 3UZYA 3SN4A 1G01A 3TH6A 4J35A 2A3AA 3M0JA 4AIUA 2I17A 4W7WA 5H8PA 2OYKA 5C9XA 4UXDA 2XWEA 4L56A 2A7NA 4RW3A 1SJDA 5C7HA 4WDXA 4ZE5A 1K77A 3ZO9A 1Y5XA 2C19A 3O6YX 2FGZA 3IJ7A 5KETA 4O13A 1F3EA 4H9XA 2C8NA 5K3VA 1SZNA 1OIFA 1KFCA 2ISSA 1R3WA 3GFZA 1S7MA 3A7RA 2Y8UA 2PODA 3EWDA 3VGBA 1AA1B 5T91A 4O8AA 3L67A 4TR9A 1M7JA 2VC7A 4S23A 4AD2A 4IJBA 3D5HA 3GVGA 2Y85A 3GYEA 1HL2A 1B30A 1R3QA 2A6NA 3FYYA 3WZ0E 4UQBA 2OO0A 2Y8KA 1C8XA 4IL0A 1OFAA 3A4XA 3CUZA 3GDMA 4JTRA 2PDGA 4WF7A 1BKSA 1HKJA 3GD6A 3W07A 1H60A 3B8IA 1E0XA 3N18A 5J8LA 3VD3A 1XXXA 2OEJA 4L5ZA 4DZHA 2G5WA 4G7EA 4L1XA 4B3ZA 2FZNA 3W7HA 1PPIA 4KS0A 2DZXA 3TLQA 1AD4A 2X0HA 2VENA 3UR2A 4HJFA 2Q3OA 3UGVA 3HO8A 1US2A 1W0MA 3EEZA 3A13A 4LGXA 3PAJA 4B4HA 3LG3A 1TUFA 2E3TA 1UR4A 4IFKB 3L0KA 4DPQA 1XYFA 3UJEA 2HISA 4U5KA 1KXHA 5AY7A 1RJRA 4CEXC 1G6CA 4LAKA 3VDAA 2VEIA 1V3MA 3EMQA 4LUJA 3DI1A 1VRXA 4HA1A 1AW2A 3RO8A 3LYEA 4PMRA 4UTMA 4QDPA 1TX0A 3RNMA 6XIAA 4O8RA 2H9AB 2F6UA 1FWAC 1WDSA 2Z1WA 4DY1A 3IK4A 3L5AA 2Y0FA 3Q4DA 5BROA 3R89A 4E8DA 4JKKA 2OZ8A 3KEHA 4HHMA 3E38A 4H7CA 3I6TA 1V0MA 3LY0A 5CJ5A 3MZ2A 3T4CA 2GGGA 4D2JA 1O6IA 4HOXA 3NXFA 5A8OA 2HE8A 1ISZA 3G77A 4L4OA 4F0MA 3VX1A 5AYBA 1GG1A 3OVRA 4O28A 2YCLA 4AC1X 3PJWA 2UBPC 1E3XA 2XVLA 1EJXC 2BY1A 3EWWA 1W2PA 1RQBA 1ZK7A 5JU6A 4HNCA 2VO5A 2MNRA 1W1A1 1XS2A 2QCFA 3DBPA 3UR7A 2C3DA 2VZOA 4JL2A 3WFZA 2VGIA 5E0FA 3M0IA 3DZ1A 3ZSTA 1A5NC 1Q4NX 2W54A 2Y1HA 3GTXA 1JUBA 5LGXA 1V08A 3PBGA 4KCTA 3UG4A 3NPWA 5A95A 1TR9A 2CLOA 3T0BA 1CXEA 1ML1A 3KS6A 3A9IA 1UJPA 4GABA 3VU2A 4DYKA 4AZIA 4H04A 3T7VA 1TV7A 5GVJA 4E8GA 3WNLA 1VQTA 2Z7KA 3KL5A 4FNTA 2WSPA 4ML4A 2G97A 5TNVA 5LIYX 4HA4A 2HDJA 4MB1A 4HMNA 4YMZA 2XSBA 4D6IA 3PNUA 4TX8A 4YVXA 4ZZ9A 4H9MA 4PODA 2QAPA 1LRQA 1G69A 1TJPA 3CHVA 9RUBA 2R9RA 2YOCA 5D32A 4JHMA 5TR3A 1DWJM 3SRFA 4MGGA 3IV8A 2E9BA 2A79A 4PBEA 4O57A 5AZ0A 4Q8UA 2AQWA 2XVNA 4YYFA 3L2MA 1GGOA 1DIDA 1FP9A 1M04A 4MLRA 1C7SA 5FCZA 1Z69A 2RFGA 2P5NA 2QMJA 2AKZA 3GTIA 2UY3A 4OV4A 3B8VA 2HV5A 3B40A 4G6CA 1FP8A 1Q4WA 2DZUA 2R1MA 2R94A 3CUIA 4F0SA 3UESA 3AIQA 1ZZMA 3LSCA 2EQ6A 4YWIA 4O4VA 5DN1A 4R9OA 4AD5A 3FY1A 3VIJA 1BG4A 4BI7A 3WIJA 2ISFA 2WPEA 3MY9A 3UCQA 2CBUA 5HWMA 4ZFCA 1A5CA 2C0HA 4DLFA 1RV8A 1F6YA 4HJWA 4C6LA 3GIYA 4WJEA 1SFLA 2XIJA 3CUFA 4I5RA 1KQZA 5E0KA 1UA7A 2P53A 3RX4A 1OFEA 1N8FA 3IIXA 2QCLA 1H1ZA 2EPKX 2IPWA 3E2QA 4XZLX 4GRTA 4LBRA 5KINA 4M81A 1EO7A 3HFTA 5C70A 3A6OA 1W1IE 1IT7A 3BLOA 2VC6A 1J0HA 1MW1A 3LPPA 3B06A 5FL0A 1ZJBA 1DQWA 3UJFA 4DO4A 1GG0A 3DEQA 3OPSA 2VI0A 5AZ1A 2RDXA 4LBSA 1CBGA 4FIRA 3BPWA 3V16A 3L65A 2O9OA 2ALRA 4UTUA 2VWTA 1ISXA 1WZMA 3TU9A 1UW9A 4PN2A 3VCCA 4O4WA 1GK8A 2WSKA 4IX0A 4KH2A 4ZSUA 1DYSA 4AD0A 2PDNA 3MDUA 4HHPA 2VCAA 1EJ7L 3WUEA 2Q02A 4I3GA 3RK8A 2NVDA 4F48A 1QR7A 4LCSA 1QU4A 4PFMA 4TVUA 4NASA 3NSMA 4EANA 3VOCA 3DJGX 3BLFA 2X8HA 1MUCA 3MVTA 2GJXB 3QMRA 4PGLA 2A0NA 2DIEA 4IP4A 2BV9A 3W81A 3H26A 1OY0A 4E4UA 5A8MA 2ESCA 2B81A 4MUZA 3TVAA 2WO5A 4C6JA 3FKKA 2VX7A 3S8HA 1W37A 4XZWA 2O7QA 2A21A 4F0HA 4UNKA 4CN4A 1BSIA 1A80A 3REQA 4F79A 1VBUA 4MADA 4YWSA 4O0QA 1IZJA 2UY5A 3O8AA 3FHQA 1KNWA 3RILA 4JIQA 1GWJA 4D9PA 5HJXA 4WSJA 4HU8A 4QFUA 3UG5A 2QJGA 4PTMA 3P3BA 4CKQA 4ZA0A 2BWGA 3VO0A 3KX6A 4UNIA 4LB4A 4X2RA 2Y88A 3LADA 2QCDB 5I3FA 2O9RA 1TG7A 2RDUA 1W3JA 3QPZA 1OGBA 5IFTA 1IT0A 4Y9OA 4GINA 3AIWA 1IR2A 5LZLA 2G95A 1MVYA 3IVSA 3P14A 4E8CA 1YYAA 1XSIA 2V0TA 1CGWA 1CGYA 4HMCA 2J7HA 4HA0A 1KW1A 4FOKA 2W3RA 1UZ4A 4G2DA 1Q6DA 5HINA 1VCFA 3URQA 3V5FA 1CECA 3W71A 1TV2A 2ACQA 1XGDA 4O1EA 1CENA 4XAGA 4IH3A 2WC7A 2AKMA 4J2PA 3WBWA 2NPXA 4J40A 2AAMA 5CG7A 3M9YA 5K4XA 3A3XA 1ZLPA 3QQWA 2C1GA 1V6TA 2DIKA 1IGWA 2Y5SA 1D9EA 5AB3A 3SW6A 4GYPC 5G4HC 1ONEA 3PP7A 3NL5A 4UFIA 2PMQA 5H91A 2YB1A 4K8EA 5A5WA 3XIMA 3GVWA 3SSZA 3IJIA 4CQ9A 1MMFA 2C16A 3FK4A 4S1FA 3N19B 2V81A 3WLNA 3DXIA 4C6IA 2PDPA 5AYIA 3O0HA 1NARA 3T4WA 1F3WA 2C71A 5TBOA 3A4WA 1XCXA 2OWXA 3A3HA 1D3GA 3GG7A 1N60C 3QFEA 3APYA 5HOSA 4RDVA 1DJWA 2JGYA 4E5TA 4IGHA 1VYPX 3VCNA 3T07A 3CAWA 3MS8A 2XU2A 3NQMA 1WKEA 3WQFA 2XIBA 1SW7A 4W86A 5EB8A 1PUDA 1KGWA 3BG9A 4U2YA 4ZB2A 2FVLA 3GSMA 5LHEA 3VILA 4DBUA 2ATMA 2WK2A 1E73M 2V5CA 3E12A 4MNKA 2ZZ3A 3ITVA 1REQA 1WKDA 5JCIA 1B0IA 4WKFA 4RLIA 1LOLA 1QOPA 1I75A 4CN1A 3VOGA 3DBNA 5FAGA 1T99A 3JW7A 3LD5A 1PB0A 2G3IA 4ZQPA 4HZ6A 3SAZA 5DBTA 4LUSB 2WOWA 2XFYA 1SUXA 1B4KA 1JXKA 4IMFA 3BC9A 1XLGA 4L6HA 4DIAA 5CH9A 2Z29A 4G1NA 1FFRA 4TOQA 1H7RA 1TPWA 3EXTA 4K6AA 3UY7A 4JNMA 1GYNA 2QULA 4DUOA 4YLWA 1UWQA 3HQ1A 2XWDA 4S3FA 5JCKA 2ZZCA 4W8LA 1ZJAA 1MZHA 3R58A 4PUWA 3BAKA 1G67A 1F73A 5I24A 3HGJA 3HJZA 5LIWX 3CL6A 3G24A 4N02A 4QCEA 5CZTA 1NAL1 4AMAA 2OQLA 1M6JA 3ECQA 3UWWA 3GY1A 4V1YA 1W1YA 3TOYA 4GXPA 2DSUA 4M82A 1VR6A 1PZ2A 1JUEA 3M0ZA 4DJFC 4IHCA 3CM4A 1QXLA 1H4PA 3CO8A 3GRTA 1BFNA 3IJ6A 2PLCA 2EF9A 3L2LA 2ZVRA 4AMCA 2X0YA 4LVFA 4RV3A 2VX4A 1VAHA 1XQLA 1DEDA 1W3KA 4WOQA 4YU1A 3PAOA 1VJZA 4KBXA 1E6ZA 3S83A 3QVQA 4ILSA 2BHYA 1UKQA 3JVAA 3G8RA 3NOEA 5E93A 4AWSA 3SURA 5D2XA 5JXQA 4JPGA 3O6CA 2VQUA 2C6QA 3KOYA 2F61A 5AYYA 5C2XA 4HOZA 1XLBA 4BI5A 4UTIA 4NAFB 5IRPA 2ZTKA 1SFSA 1G4EA 2QT3A 2Q71A 4ZVJA 1FA2A 1PYFA 4PYSA 1EXPA 1ZGDA 1QPRA 4FX9A 3MUXA 4Q4PA 3WLHA 3KP1A 3NO1A 2G0WA 4O12A 2QCCA 2VZUA 2KAUC 1EWEA 3LERA 1A0DA 2ZZ0A 4IFKA 3E5PA 5LA1A 3AJXA 4PTDA 4Z1BA 4KFPA 1NQ6A 2HK0A 3VIPA 2MUCA 2QS8A 3CZEA 3G1DA 4YTTA 4JZ5A 1OSEA 1KM6A 3MHUA 3CHEA 3E0LA 1CI1A 5B80A 4GH3A 1TUXA 2VC9A 4S2BA 4R88A 3OVPA 2HNEA 2J6VA 1UD3A 3WK3A 5CG0A 3MBFA 3VNJA 1XLHA 2H9AA 3A3WA 3AICA 5M2FX 3W1UA 1QPNA 7ODCA 1EX5A 1W5NA 3EDFA 1DJXA 2NXGA 4Y8FA 1N8IA 1T6MA 2A7PA 2PDMA 4BKNA 2P8CA 2YSWA 3WMCA 2FJKA 3ANUA 5IXEA 3CUGA 2BX7A 3NDOA 1OQFA 1VD6A 4GG9A 2J24A 2O4MA 4ADUA 5AFDA 4YVPA 3W70A 3DG7A 2E5CA 1WZLA 4LX4A 3HPZA 4OIFA 4M6VA 3CHFA 2X42A 3WQVA 4A3UA 1LYXA 4JTAA 1WOAA 3SADA 3LXDA 3M0VA 1JGMA 2YA2A 3ARRA 4Y6GA 5IBXA 1SO6A 1E4MM 2Z24A 4QIUA 1SZGA 1DNCA 3QZEA 5CZJA 2HS6A 5FJPA 4IM4A 3CZ8A 1W8GA 1XUZA 1ZU8A 1S2CA 4KW2A 4YTUA 1IXPA 1GZJA 3LN3A 5D2VA 1Q8AA 5TD4A 1M3UA 2H6RA 1N82A 3WK2A 2ZVIA 4QG6A 2R8WA 5D2TA 4ZOBA 4Z2KA 3WO8A 3VE7A 3EDJA 3R07C 3RR1A 3ARUA 3ZJ8A 3JS3A 1PIGA 4PUUA 3V5CA 2NSXA 3N13A 1G9HA 3A5VA 3KOWA 3DUGA 3AOFA 2YLLA 4AF0B 1YPIA 4ORMA 1RQHA 3VDGA 2EAWA 1BF2A 3W75A 3S9ZA 3G2GA 3ORWA 1ODZA 3TTOA 3QV8A 1GRTA 2EQ9A 3N4FA 1CIUA 4JFWA 2AGTA 3NM3A 3HV9A 4TVCA 1K4HA 3TOPA 5CZSA 4A8NA 1A5BA 1W3LA 2OJPA 4JTEA 3D0CA 3VIGA 4IX2A 2PDYA 1TMLA 2Y4SA 2E7FA 2VL4A 3KUMA 2PLKA 3L66A 4OV9A 1CCWB 3NA8A 3SUUA 3C0SA 2BASA 1WNOA 2QCMA 3KWSA 3OGSA 3BSGA 4FPSA 2DZTA 1JRPA 2W0HA 5MHBA 3EWCA 2QMKA 5FF0A 3AZSA 4GO9A 1BF6A 4ZTYA 1AQHA 2JF7A 1H1NA 2ISVA 2I7GA 1GPFA 1F4HA 3AZRA 3N3TA 4KCWA 4PSPA 4HCDA 2PSNA 1GESA 4RV8A 2V3EA 3BLDA 3WF3A 3EA3A 4GH1A 3C2YA 4ZQMA 3U57A 3W28A 4IZGA 3NM1A 2EJ1A 5BRBA 1J8VA 3FKRA 1LRTA 1D7KA 4FXJA 3QYQA 2UZ9A 1R5YA 4RDZA 3LPFA 4KWSA 1JCJA 2A3EA 1Q6QA 3L0GA 1I2OA 1SZRA 4K2SA 4GLEA 3BDKA 3UR8A 4Y96A 1CT5A 1XYCA 5F2IA 1CZ1A 4QE4A 1UA3A 3TJXA 2PE4A 3LV6A 2FVMA 3FDGA 3UCDA 4GI9A 2OTDA 4WY0F 1EIXA 3PZUA 2GGIA 4XKYB 4OJYA 4RUBA 5I7GA 5DMMA 1TSIA 2GL5A 5BXTA 4NU7A 5BMXA 1BRLB 3MVIA 3POHA 3NQBA 5KZ6A 2VZVA 4LVGA 2GJXA 4RW5A 3W1XA 1SW3A 4GUFA 5CQ1A 1A3XA 3E2SA 4W9TA 1WOBA 4H8NA 2NQ5A 5AHEA 3KS5A 1X1NA 4QAIA 5C55A 4L7ZA 4GIEA 2EPLX 2I1OA 4J3ZA 4FOUA 3IUHA 1F8WA 3KOFA 3W7CA 3LGDA 2I16A 4BQ4A 4LPCA 3NVTA 4NF7A 3I7QA 1O5RA 3PBMA 1UKPA 2BG5A 3CAVA 1ESWA 4Q7IA 2B7PA 4O17A 1UWIA 3PPCA 2NX3A 4C6NA 3UERA 4W7VA 3PULA 3AHTA 4ES4A 1NDWA 2FHBA 3WQOA 1B5TA 3DDMA 4C60A 2X8GA 3RFAA 4KMQA 4PZVA 1A4MA 1E40A 4JIPA 1GEHA 3F5LA 3FJLA 3QGKC 1FFUC 4I9MA 3CUJA 2HQMA 3P8JA 3LLFA 3HFYA 4W84A 3W86A 3BCFA 3UGRA 2ZBTA 3N12A 3V4BA 2WQPA 1D2KA 3NNTA 2GWNA 5CC5A 3UG3A 4WGHA 4AUBA 1EBHA 5BOFA 3WFLA 3U4FA 3K8LA 4DXKA 4XZ9A 1KQYA 5MF5A 2HZGA 3LEPA 3P67A 3THAA 4G56A 1RSCA 2XUCA 4MM1A 2YXXA 2O7SA 2FB3A 1EB3A 3SEPA 4Y9PA 3B8SA 2YQUA 1ECQA 2EHHA 4GMEA 5A6MA 3FXYA 3BOFA 4DXXA 3QJAA 4JCLA 1DQUA 4TVDA 3A23A 3DFPA 3VCRA 3WQDA 1E56A 3QY7A 4MHBA 1KBIA 1F2JA 3VD5A 3VFLA 3FVDA 1ME9A 2DU2A 5T26A 4JY8A 1XINA 3A21A 4KETA 4RPQA 1OJTA 2V5KA 1PWMA 1Q13A 1M65A 3ES7A 2PAJA 4Q4OA 1TTJA 4FLQA 5A1AA 1LT7A 1GV4A 1L0PA 2XZ9A 4PR4A 4JFUA 3ARQA 1FWBC 2NQ9A 2HVOA 3WQPA 1LWIA 2JEQA 1ZHAA 3R11A 1KRBC 4I7VA 4H41A 4Z2IA 5I3IA 1XJBA 1PXGA 4K39A 4V33A 1H09A 1XIEA 5JH1A 1XSKA 3VNIA 5BYWA 4REQB 1N5XA 4BEQA 3W7RA 3ZS4A 2CLFA 3OZMA 2PBGA 2VRQA 5A6BD 3LM7A 3GU9A 1I8JA 2ISDA 1GZGA 1W2VA 1F8MA 1P0EA 2QJMA 4AXNA 4FHAA 4E38A 4EP8C 3E02A 1XLKA 4LUSA 3WNPA 1TTIA 1DJZA 3HMCA 3MSYA 1UKOA 4IMCA 1HVXA 4IOTA 1VIWA 4WDTA 1A5SA 1LOSA 3OZPA 4HNOA 3QR3A 4E6MA 4J3TA 4AB4A 1K8ZA 3TP4A 5IDIA 3BSHA 3SSJA 2E1DA 3MO7A 3SRDA 2WPGA 5TIMA 1R3SA 3VI2A 3T2QA 4XAFA 5BRQA 1PTGA 4P61A 3G0UA 2XFRA 1Z7AA 1WB0A 4PEEA 2WQDA 3WL1A 3MWCA 3LX9A 2E40A 2C3ZA 1VJIA 4PMJA 4GK8A 4H6KA 4JTKA 5ABTA 4L4PA 3EOUA 1GETA 3DGZA 3DENA 5C71A 3VZZA 1FWSA 1JGIA 1SR9A 5IM51 2JKPA 4RZ4A 3TYBA 4PUKA 3O06A 4ZE4A 3JZUA 3RO6A 1VBHA 2XPKA 3HG3A 4HTBA 4B2DA 1OFRA 3O6AA 3VE9A 1FBAA 3G1RA 1OF8A 3C8FA 4PCNA 1Y5VA 4B5NA 4NHVA 3NPUA 4UMAA 3MW7A 3K5XA 4X0VA 3T08A 2VDIA 3LBMA 1ZJIA 4NAFA 3T0TA 4D6EA 3FGCB 1B3XA 2E68A 4BV6A 3KBMA 4U4MA 1WDDA 4MDOA 5C54A 1J0JA 2J47A 4R7WA 3FX4A 2OZTA 4WOZA 3BAWA 1R9ZA 4C5ZA 5FJJA 3SY5A 1BXNA 3MDWA 3GRSA 4M5PA 3QQ0A 5FA5A 1P43A 2D3LA 4WLCA 2ZRUA 3PSWA 4B91A 3QTPA 1BGGA 2WMGA 3WQGA 1SFJA 2PGRA 4EMJA 4B9YA 2NVKX 3TWAA 1TJ1A 3I6EA 4UMCA 3C6CA 3ZT5A 1K70A 1M1BA 1UG6A 5D04C 3MCMA 1E71M 2DH3A 4YCOA 2I9UA 4GQGA 3IIVA 1ISYA 3EUB3 5LGZA 4B5VA 3B0VC 1PYMA 1IYXA 3JUGA 1AZ1A 4M24A 3MCOA 3D6NA 4C6EA 5DCEA 4P7LA 4EAMA 1FHUA 4M29A 4E4PA 4A29A 2D3NA 3BCDA 4BWLA 3MUY1 4WDUA 1V97A 2XDFA 2HVMA 1R0MA 4GYJA 3GC4A 1JG9A 3C0QA 3CBWA 3PK7A 1U5VA 1V6UA 1H41A 3M5YA 4S3KA 1AW5A 3R79A 4GQ0A 3CEUA 3DECA 2XM2A 3NG3A 4MY1A 2DEPA 3MWAA 2G8ZA 4LUIA 4MAZA 3W23A 3BLEA 2WANA 3TKFA 4DJDA 1WPCA 3U9IA 1JJKA 2YDRA 1XD1A 1E6QM 1UZDA 3T40A 5XIAA 3HIJA 3KL0A 2PP3A 3CHCA 2BP1A 1FWIC 3L68A 2WLYA 1M6IA 3NQFA 2R1KA 4GZIA 4WVXA 3R5EA 4EX4A 3IV3A 5DF0A 3II4A 4HSNA 3UA4A 1UP2A 3PC0A 4U3CA 1DIEA 3SR6B 3BOXA 2V9DA 4H4YA 1UBPC 4TQTA 3GD4A 3OJGA 1PTAA 4MSSA 2FTYA 4GCAA 1XC4A 2NLYA 1SM9A 1J01A 1J0YA 1HJVA 2FDMA 3UEQA 1EGVA 1LG1A 2DQXA 1K02A 4DRSA 3VD9A 4NAEB 3MBDA 4C1NB 3ITCA 2QF8A 4BURA 4XX6A 5FEWA 5CBIA 1TE6A 2OU4A 3W01A 2WP6A 5I77A 4IIBA 2FJUB 5I3HA 7TIMA 2X40A 4DZ5A 1UBSA 3IGHX 4ATDA 3CIVA 3SIZA 1Q2SA 4KKXA 1F05A 2J7GA 5GJNA 3V36A 3TR9A 4V27A 3WUFA 3CWHA 3NYDA 3S5ZA 4R5EA 1J10A 1UD6A 2O56A 1L6GA 3LCGA 4BQ5A 2GQ9A 3A22A 4JNZA 2DT2A 3VZXA 3NDYA 3DFOA 3VC6A 4DB7A 5I78A 1A5UA 3V0TA 5H8MA 5U25A 4RXGA 2QGYA 4JTIA 1W3TA 3TC7A 4GYPA 2V5DA 1N62C 3PZVA 4XD6A 3O07A 1RY8A 2NVAA 2PTXA 4I8DA 5JCMA 1ADDA 3NEHA 3OG2A 5EL1A 1XW8A 5M5DA 2Z2BA 4LS0A 2WWDA 4LOCA 3AHZA 5CZ0A 4GJJA 3B9JB 1VFLA 4LVDA 2OX4A 4RE4A 4L4MA 1Q45A 1ZNNA 4XKMA 4CLMA 1WV2A 2QW5A 4DELA 2BC1A 1DWAM 1I6NA 1E6PA 3T2PA 2CKSA 3GDBA 4HMEA 4PH6A 3P2VA 3DK4A 3B0PA 3FJ6A 3UVIA 1BWLA 1FWEC 2P0IA 3GHTA 1EEXA 2XH2A 4QS5A 5G2WA 1XIFA 3ITTA 3WDJA 2UY4A 2RKXA 3TTSA 3QW4B 1POKA 1AJ2A 2PWUA 5LHFA 4DAFA 5DRCA 3AHVA 5HBFA 3UJ2A 1R7AA 3NDZA 1J9YA 3EANA 2PGEA 4L6OA 4XUYA 4LEQA 1MQPA 3L23A 3R10A 4B3KA 1XCFA 2D69A 3AWOA 4MWAD 3T81A 5AC6A 5FL1A 1YE4A 2C91A 4OUEA 3GB6A 1XCWA 3O16A 4WEVX 1BVZA 1EOKA 4XZIA 4UCFA 2G41A 4XKYA 4KRUA 3H55A 4FK9A 3AMKA 3WDRA 4LVBA 1BRLA 3D3AA 1WBJA 4Q4KA 3QRHA 4MOZA 4AVNA 4PL2A 2BOFX 4QM1A 4PE8A 1XLJA 1XIIA 2F9RA 2DW6A 4HZ7A 3CAKA 3HPXA 3H7UA 2VELA 3MKKA 4QHRA 2GVLA 2PZ0A 5G4EA 3NAVA 3UWEA 1NFGA 4QP0A 2IMRA 5JRBA 4ZBCA 2R24A 1YDYA 2QJIA 4CCEA 5HWNA 3LCHA 3IGSA 2J77A 4FSAA 2G3JA 3WDPP 1NOWA 3C0JA 3PG8A 3YPIA 4UQ9A 1R3YA 1XRTA 4P7RA 3DKLA 2JIEA 2GVGA 2ZX6A 4YPJA 4JTDA 2ZZ5A 1LG2A 3RX2A 3QZAA 1OT1A 4DJFA 1Q1WA 4FP1A 3WN6A 4RR4A 3W9ZA 4HD5A 1B3YA 1D7FA 3W7OA 1ZALA 1JD9A 2IQ0A 3LPOA 1V02E 2D24A 3AHXA 3QQ1A 1ONXA 3M7WA 3GXTA 3M07A 1YIXA 4UZUA 3KTSA 3SJ3A 1NHPA 4JGDA 2P76A 1GOMA 3MHGA 4C6KA 4UR9A 1J11A 1W3HA 3SCVA 4EACA 1TYTA 1GKRA 3TCSA 1QNPA 1VIZA 2PTWA 5F1VA 3NQ2A 4YWOA 3AXMA 2AQVA 3WBYA 2NWSA 1LM1A 5U7SA 1S2UA 2IPJA 3RDKA 3W76A 4QXIA 2CFYA 2NZLA 4A21A 3SJNA 4L4LA 1NIUA 2R6OA 1VENA 3A64A 1FWCC 2WPFA 4OZOA 4U31A 2OT0A 1E9LA 5A2AA 2PRLA 2BXZA 3KOXA 2B31A 3PB0A 2VYOA 5CGQA 3NQ7A 2WW5A 3BURA 2GUUA 2ZICA 3SCOA 3LXCA 1ONWA 1IIGA 1Y7VA 3A4AA 1GRHA 2WZTA 1R86A 1AQ0A 3BG5A 3MYOA 2FDSA 2ZA1A 3HG2A 4UQAA 4DBEA 4NRRA 3V0UA 1ZENA 4GCXA 1PX3A 3R13A 4NEWA 2CDUA 3R8GA 3ELFA 3CS2A 5DCBA 2BVDA 2A5HA 2JF6A 2YKKA 5DY2A 1PSCA 4ENLA 4XQ6A 3CL7A 3RPMA 2DVTA 1TPB1 3NQGA 1M53A 5CXPA 4GKLA 3GTHA 5C9ZA 5ABFB 1GJWA 1JIBA 3OG3A 1RBAA 1LL7A 3QFWA 1KV5A 4JXCA 3LQLA 1RVKA 1WXYA 2NQHA 5JCNA 1D8CA 5H1WA 3UA3A 4RNFA 3KBJA 2INFA 3SQPA 4REQA 4D8AA 3W2UA 2IKHA 4JFVA 3ZMRA 2OX1A 1KFKA 3AIBA 2WHLA 3WX7A 1TVLA 5IHSA 3TROA 4MNMA 3IIOA 4L61A 2FHCA 2C1IA 4DQWA 5A6LA 4FF5A 4W4QA 1XBXA 2GOKA 2I56A 2OB3A 4MB3A 4B5SA 4F2TA 1QW8A 4NVTA 4AWTA 1JPIA 4TVYA 3ABXA 2ZC1A 4AW7A 3ATYA 1AMYA 2ONEA 1POJA 2CYGA 1E72M 3DERA 3VGEA 4UOJA 3PBUA 2NSOA 3C61A 5BU6A 2WC3A 4WY0A 2NV2A 3I3BA 2WM1A 1O68A 3M5VA 4GVFA 1WDRA 3VXGA 1R46A 3FCPA 4S3GA 1LL4A 1X1ZA 5E9AA 4CD5A 4JTTA 4O15A 2VRKA 4FNSA 1V3IA 1XYBA 1QBAA 2F5ZA 3TW9A 5DY3A 3UJRA 3EAOA 1H0IA 2RJGA 4JDYA 1KLZA 1ZJHA 2Y7FA 3LZ5A 3SN0A 4ACYA 1FWNA 3GIQA 4K8DA 4ICNA 2BSLA 1JCYA 5C9UA 4LV9A 1EHNA 3BARA 3LI1A 4MPKA 3S2CA 3FJ4A 1TREA 4LW7A 5EMLA 1K6AA 1UKSA 1I60A 1IEVA 4J3WA 3LUTA 5T8GA 4CD6A 1UD8A 3W2MA 3TXZA 4HCHA 4JTHA 1GKPA 2CBJA 3AISA 3LCLA 1PJ9A 2DSWA 1X97A 2QUNA 4NNBA 5HWJA 2OMAA 3WMSA 2J7DA 3NQDA 3UWUA 4GPNA 5HR7A 3S5SA 4EQXA 4PBGA 4H6RA 1U1HA 2OYMA 3V0SA 1FHLA 3L7RA 4EF9A 4BI6A 4PMQA 3QHOA 4M1BA 5GJPA 2W62A 3PANA 4E2OA 2H90A 1E9ZB 1ISVA 1W5OA 3KE0A 2WYSA 1W5PA 4O1AA 4DBWA 3L5MA 1KGXA 5EPDA 3SUVA 2PF8A 1JCLA 1XIHA 2JKAA 1UZ1A 4GJ1A 3N25A 2BY3A 3PZNA 2QDGA 4HK5A 1JQXA 1IZCA 3WF2A 2FFCA 1RCOB 5FESA 3W38A 3OQ8A 2WMIB 3TTEA 1TQXA 1VYRA 1NOUA 1NEYA 4X2PA 1UR1A 3BV4A 1LT8A 3CGDA 1AMKA 3PFRA 4NZJA 4UCGA 1JZ8A 1GPWA 3WQ8A 1U5HA 3TYDA 1I2PA 3W7GA 3WH7A 3NZGA 1C9DA 1XF0A 1F4AA 4QJ1A 5AYZA 3G0SA 4ZCWA 4ZSTA 1MEWA 1FHDA 4GXWA 1KB3A 3AS3A 5G1MA 3P6LA 4PTWA 5AHIA 3I65A 2WHKA 4MFDA 4KEVA 5AHMA 3P74A 2J8TA 2CHOA 3ZIZA 2XH7A 3CH9A 3FEMA 1S5WA 4O16A 3GO2A 4GUJA 4CVUA 2PPGA 5HNTA 2VR2A 1GSNA 2D2JA 3AMLA 3NQ6A 1RZMA 1YNQA 2G37A 5EBKA 2PWFA 3K4DA 4LAZA 3W83A 4RE2A 3ARTA 4GJIA 1QCWA 2B7OA 4NAEA 3BAIA 1LRNA 1MZRA 4UTTC 3NQ8A 4W88A 3II1A 1R47A 2PDBA 1EP3A 1MWOA 3C2RA 4O0ZA 4M51A 2OQHA 3TYZA 4X60A 3KVLA 2JK2A 3GXPA 1S1PA 4LQ1A 1M7PA 2JEPA 3GVRA 1KTBA 3G8EA 3KDOA 2HXTA 3L21A 3ZT6A 4QSFA 1XD0A 3N15A 4HKPA 4ATLA 3TZFA 2AL2B 3R94A 5D33A 3CHDA 1TE1A 1VZWA 3RLGA 1ZS2A 4J27A 1EL3A 3MSGA 3EWZA 2X16A 1BWCA 2HBVA 1E6SM 4QRNA 2F8QA 4HT3A 4UWMA 3MCNA 1KM5A 3SCQA 1K4GA 1XIMA 2ATSA 2Z26A 3L4ZA 1ZBKA 1MW0A 5D2YA 1JDFA 2DJXA 3OEXA 2J8FA 2WZHA 2X0SA 3WEMA 3NQEA 1JOAA 3PZMA 2NQLA 5F7UA 1F3PA 3EX6A 4AEFA 1EF3A 4OHQA 1HTIA 4Q4MA 3AIEA 3DH7A 2XYLA 3CQIA 3U48A 4ADWA 2W63A 2ISWA 4LH8A 3UD6A 5AHNA 2GJPA 5HNRA 3PBVA 5HQLA 1VFSA 4WXYA 4XTDA 4O54A 3B0XA 2NWRA 4DJDD 4Q22A 4ZQCA 1KKRA 2C79A 4PL1A 4A2RA 4GGBA 2V6OA 3L4VA 1YKWA 4K38A 3S5OA 2E8ZA 4NNAA 1X38A 4H4IA 3MUAA 3LRMA 2WXDM 2V3AA 3QYSA 4YJ5A 5AVHA 3LV5A 3U3HA 4ZR8A 3S6OA 3G18A 4DUVA 4UTWC 4CNNA 2XTKA 1QNRA 2Y70A 3AWNA 1BQGA 1EQCA 3E0WA 3B9AA 1OZMA 1ME8A 5EFDA 6ENLA 1FWRA 1Q6EA 3F5JA 1GVQA 2H8XA 2FKPA 2CLHA 1Q85A 1J0KA 4JN8A 1P6WA 4FB7A 3ANVA 3U0HA 1P48A 1LROA 2WOIA 3BE7A 1NWTA 3IK2A 4B4FA 4Z1AA 1HL9A 5F4SA 3QC3A 2XM1A 2YCLB 5KZEA 5G4WA 1I4NA 2G96A 4JBRA 3KRZA 1TB3A 4LY4A 5D37A 5AKQA 5FS6A 3VGFA 3COTA 4D6FA 3CTLA 4UTJA 1JI1A 3TQPA 2JALA 2ZUWA 1BWVA 2F2HA 1UD5A 5I3KA 3RIKA 1E15A 2YBTA 2QPUA 4DBSA 3F4DA 1FTXA 1EWDA 3K13A 1IZKA 3AJ7A 1EYWA 4NSBA 3KVJA 2E1WA 4Z2GA 1HT6A 4CNPA 1ZAHA 3KZSA 4G5DA 1BQCA 1EDQA 1GYLA 3LNMA 1UWAA 1XDLA 1L2QA 3BXWA 4I9TA 3W6YA 4MDPA 2V2CA 1LBLA 3WFAA 4LUTB 1FH8A 1TZZA 3BTNA 1ZCOA 1V3KA 2PCEA 4UFHA 8TIMA 5DBUA 4ALDA 4GY1A 1ZBCA 1AFSA 3EB2A 4IQLA 1XIJA 1JEHA 1DL3A 2OEKA 2CC0A 1K1DA 3GH4A 4FALA 1XLIA 5C0QA 4WGXA 3BK0A 3WNKA 4H1ZA 4NJKA 3CWNA 1FUYA 1UPPA 4XIAA 3K4WA 1WX0A 2HPMA 3G0XA 5M3WA 1JCMP 1WUFA 3PZIA 4AHQA 3HRDC 2OOGA 3GR7A 4EXBA 4IXXA 3JRKA 4B90A 5FD0A 3O9NA 2JIWA 3KOZA 3GH7A 4OWGA 1XM3A 4PMZA 4KEMA 4Z2LA 1R9XA 2Q6ZA 2GQWA 1OFPA 2E77A 4G8TA 1FH7A 3NO3A 4MKSA 5FJUA 4WHBA 3CUHA 2X7WA 1ZXIC 3KTCA 1GERA 1JUKA 2HXUA 2DZVA 2EBNA 3QH2A 4S3DA 2B7NA 2HCVA 3SGGA 4EIVA 3MHFA 4GWEA 3C2FA 4K1GA 2EPMX 5DT5A 1PBGA 3BAJA 2GVEA 2DZAA 4C6QA 2ZZ4A 4GGHA 2QV5A 1FXQA 2JFEX 4ZODA 3OLEA 2YVGA 1US0A 2XFFA 3DCPA 1TKKA 1QK0A 5A6KA 3S1WA 2BLEA 8XIAA 3ICJA 1OD8A 5A8GA 2DORA 2QPSA 1V5XA 1AW1A 1EC7A 1KTNA 1M68A 3V75A 5EMMA 3T0AA 2FTWA 1H51A 2PGWA 4ASTA 1DTUA 1EHAA 3TONA 4KIEA 3H6OA 4EQSA 3GX9A 2VM8A 2W6RA 1W9UA 1RA5A 3ZR5A 1GTEA 3EEGA 3DGHA 4DJFD 1K9DA 1SW0A 2X09A 1YQZA 3B03A 2A3HA 3G6LA 4DM1A 5A6JA 1CGXA 3VMNA 1OD0A 3S2NA 1M5WA 1J2WA 3NVDA 1V3JA 3SB0A 4MNJA 1XICA 3VKBA 1NY1A 2DDXA 2OGJA 3H2CA 1ADSA 4PTNA 3FEQA 1OG6A 7CGTA 2QCHA 3QFAA 1TV4A 1TVNA 4YTRA 1DE5A 1CXHA 3VINA 3GIPA 5ABHA 4EK7A 4PCFA 4GE8A 1V4YA 5F2GA 2YBUA 5LNRA 2WZEA 1DQXA 1RXOB 1B3ZA 4F40A 1Z44A 4MWAC 1XWYA 3AC0A 4GY0A 1XBYA 1XG4A 4H4PA 4G7FA 1J6PA 1DJYA 4IP5A 1VEPA 1E5JA 1HKKA 4QISA 2SFPA 3XISA 2V5JA 3LSBA 3TN4A 3WD4A 3N17A 4FX7A 2X2GA 3OBKA 3CMFA 1XLMA 4HZ8A 2OXNA 4NYUA 2FB2A 3GNDA 4GUHA 1LQ2A 4U33A 1ZAIA 4H4UA 3DYOA 1QK2A 1TIMA 1XKYA 1NVMA 4Q33A 4GX8A 5KVHA 1QI4A 2Q8XA 3KCOA 3OZOA 2FZ8A 2E5BA 1RM6B 1R6WA 1BWKA 4X9YA 2X50A 3ZJ6A 3HPSA 3G6MA 2CKRA 3ABOA 1OT2A 5I0DA 4JKMA 1E55A 5CAHA 3S1VA 3CB8A 4BS0A 1B9ZA 4UC5A 2GR2A 5DMLA 4PB3A 1TWDA 3WK1A 1EXBA 4JHOA 3NXLA 2YW4A 5AECA 2ZA2A 1PKMA 1UP3A 1YHTA 3R0UA 3F2BA 3S1UA 1QASA 4R34A 4KGJA 2EXOA 3RLHA 4LA1A 1UROA 3QV6A 1MDRA 4C6PA 4AG0A 1UWRA 1VBGA 2P3ZA 2Q3RA 3UQNA 1B3VA 3SFKA 1JZ2A 3TWBA 1JULA 5LSMA 4JYEA 4MZ8A 4KWVA 4PA8A 4AIEA 1QNQA 2OGYA 4GNJA 2YL6A 2PRHA 4A8LA 2A4AA 2EPHA 3TYUA 4ZOAA 3K1DA 3URNA 3LCXA 4XZNX 1Q8JA 3TC6A 2XFWA 3AALA 4WR3A 4HTYA 3O6DA 1GOOA 3H22A 5H2ZA 2WMIA 3NGFA 1YQ2A 3SDOA 5LXEA 2OEMA 3R0DA 6REQB 4XZHA 2IKIA 1NWUA 3LB0A 4GISA 4LF1A 4QDWA 3N6JA 1HW6A 4Q4SA 1RK5A 4EOUA 3GNRA 3TA9A 1N61C 1WBHA 2G3FA 3O63A 5H6HA 5A8QA 2J78A 4NZFA 2PD9A 2J7FA 3QKZA 3CQHA 2Z1XA 3PN8A 1YBQB 1XLLA 2UY2A 3GG1A 3GHSA 1VBRA 2GJLA 4XVDA 1A5MC 2R9ZA 2REQB 1PX4A 3HU7A 4GNVA 1UMYA 3B9DA 4OT7A 5LIXX 3QGVA 4S3JA 3LENA 1FECA 5HNUA 1C7TA 3E2RA 3Q6JA 1X6LA 4NP7A 4AX7A 3EOEA 2GDUA 3GE7A 2Z6IA 2EQDA 1QI2A 3BZJA 5RUBA 3W25A 3KBWA 2X8RA 4M52A 4RZ6A 4WK9A 4IP7A 2TRSA 1O5KA 2YL8A 3PWIA 1O1ZA 4MB5A 4EXQA 1HF6A 4EVZA 2BVWA 3DFYA 4O0KA 1S2AA 1GRGA 1BYCA 3O15A 1Q6LA 3NQAA 3VM5A 1JYNA 1UC4A 4GI4A 5HMSA 1KFBA 4I5UA 4RNIA 1Y5WA 2Z00A 4BA0A 4BR1A 3G1XA 4ZB5A 2W91A 2GZXA 3WLSA 5JBDA 4JYDA 4DO6A 2AMGA 3H24A 1UH2A 2O9PA 3APGA 1W8SA 2AL2A 2E9LA 4DUXA 2PP1A 3F4VA 2TODA 5HR6A 3URHA 3W2JA 2WKGA 2ZE0A 2NUWA 1N7KA 2PDQA 3SZ8A 3QOKA 5LA0A 2PWDA 3T2OA 2CETA 1TQJA 1QHZA 2E5AA 4JOMA 1PL9A 4EQRA 1YTEA 2ZUNA 2FMNA 3C2VA 3IJ9A 3RCMA 6TIMA 2XSXA 1JDAA 3FYOA 1TPC1 5EMUA 3P84A 5J5RA 2LLEA 3L0NA 1FCUA 5GNZA 1U2YA 1DJHA 3P62A 2AAAA 4MJMA 5I3DA 4HP5A 2VZTA 5HULA 1PHQA 2CESA 1VYSX 3IJDA 4POCA 4U28A 1JYXA 1OM0A 3BV7A 2ZFAA 3H70A 3TQ0A 3ID7A 3CZJA 3GXFA 4WSHA 2HE5A 4GVGA 5CPTA 4EQWA 4WXZA 4AFYA 4XUGA 1H7NA 1KM2A 3GNPA 1XG3A 3MI6A 3LK6A 3RNDA 3CPRA 1OCBA 3PUDA 2E28A 3QLDA 4HMDA 4JKLA 1DE6A 4GVHA 2H8ZA 5KTLA 1WAUA 2ZX5A 1GHRA 3TJLA 2NX9A 1P5BA 5FEXA 4AZGA 2DT3A 4IPPA 1UUOA 5LIUX 5CZKA 3F4NA 3UXDA 3FG2P 2Y7GA 2Z4GA 3N29A 5E1QA 1P0NA 2PUZA 1I2RA 4ROQA 1GOIA 3M5ZA 1FY6A 1Z9AA 4H9VA 3W7IA 4DO7A 1MYRA 1ZY8A 2WPBA 4NKCA 4Y9AA 3AYSA 3BQ6A 3PFMA 1KFJA 3O1NA 4I90A 4A2SA 1OC6A 5BXPA 3RM4A 4MLJA 1XRFA 3LM3A 3L8KA 3LI0A 3KW3A 1FCBA 3ZXWA 3H2EA 1JYVA 4CD7A 1C9WA 1JNDA 1FWGC 1NTHA 2CZFA 2GLKA 1J2BA 5E9XA 4BQ3A 1THFD 5HMFA 1HGYA 3BJSA 4O1BA 1WE5A 4IISA 4Q8VA 1DOSA 3ITYA 4M6UA 4EPKA 4PUJA 3NVWB 3KRBA 4LANA 4MWAB 4G1KA 4JN7A 1ME7A 1JRBA 1MEIA 3DN5A 1YXDA 3IRSA 3EWXA 1RCQA 3VOIA 1QVBA 3N34A 2ZYFA 1ELSA 1WXZA 1TPVA 2BBFA 5D09A 2J7EA 3UCCA 3QN3A 1WO2A 1UD2A 4LV4A 4MF4A 1SSGA 2NV9A 3KL3A 3B04A 4LVAA 3RN6A 1MSSA 2CPUA 4ZOEA 5CPSA 4DJED 2PBOA 3A4JA 2E5DA 2WMKA 2YW3A 4TX6A 3KXQA 4HOWA 3PSVA 2C18A 1GJPA 1M7OA 4N42A 5E09A 3BW3A 4BF9A 3UT0A 3VMPA 3QR1A 3H4KA 3TFXA 2WVVB 5I03A 4LUTA 4CEUC 4IPJA 2OOFA 5G1TA 3GG8A 4B5UA 1YXYA 4IMAA 3TNOA 4QNWA 2Z1BA 3W00A 1EEPA 1OIMA 1E3ZA 3G1YA 4LALA 4DO5A 3BW4A 3JR2A 5BMWA 1TPUA 1E51A 2NQZA 4HNNA 4JX6A 1DJNA 2QDEA 4UR8A 1W9VA 1S3HA 4NRSA 4AAJA 1XLDA 2FGLA 4C90A 3E0FA 3D46A 1NU5A 4H4WA 2EJAA 1W91A 4B15A 1ONFA 1OC7A 2CXGA 5FF3A 3GK0A 1HJQA 1NHQA 2FPTA 2PDFA 2X1UA 1Q3NA 3OA5A 5HAOA 3T78A 5CGTA 3TJIA 1KCKA 4XAPA 2V68A 3BOLA 1XHGA 1Q7ZA 3PG9A 3KLKA 3VYLA 4ADTA 3MP3A 1JPHA 2PTDA 4YHGA 4O14A 2P0OA 2BC0A 4QITA 1QW7A 3N4EA 4NX5A 3BSMA 5JQ9A 5JH2A 2V2DA 4ZENA 3LU2A 4IFRA 4AY8A 3WQEA 3WLOA 1B31A 2YXOA 3QV9A 3QBUA 2D2OA 3W1QA 3BLLA 4FIQA 1PEZA 3L5OA 1B2YA 1GRBA 1PAMA 2QEZA 3SN1A 3ATZA 3OP2A 1GOWA 1AH3A 3EF6A 1QW9A 5CC7A 2WBKA 1FXPA 1QMLA 2A1YA 3AYTA 4IJCA 3N2MA 5DANA 1SZFA 1B9BA 1V7YA 5GQBA 5JMUA 3STPA 3P60A 2QR6A 2DVUA 3ERPA 1XLFA 3TAOA 4FX8A 3W1TA 5U4NA 3C3UA 3CIXA 3IUIA 2H3DA 3KAOA 5FSEC 4MG4A 1LQAA 3DHDA 1I2NA 4BWLC 2YA0A 1GNXA 3TMLA 4W87A 1TX2A 2CLLA 3U2CA 1TELA 3MKVA 3TX9A 2ZUMA 1WP6A 4M7TA 3S5YA 3OOQA 4HK7A 3BANA 1FEAA 3LHUA 2ON3A 4H00A 3SFWA 1JZ5A 1O5QA 5A2CA 2ZX8A 1JDEA 4HPXA 4NT0A 4GR1A 2OZ0A 4OU1A 1BXCA 1KN0A 1IEXA 3C5QA 4DJDC 2V67A 3BGJA 4HU3A 5LXXA 3RGTA 3AHYA 1SU5A 4Q8PA 4AHOA 4UTTA 5BOOA 4MMWA 2CWNA 1L6FA 5C6MA 2O55A 1CXIA 1I0BA 3ANYA 5D02A 1Q65A 4E0CA 3E5BA 1NDVA 1C8VA 3DK8A 3BJTA 5A6BA 3Q67A 3IJ8A 3IWPA 4GYKA 2HS8A 3HQPA 4CU7A 3TYEA 3ZLFA 3RU8X 4FNRA 3EDEA 1KGUA 2A6LA 3HBLA 3OIHA 3PZGA 4XK2A 3S1XA 1O60A 1OINA 3WY1A 2ZC8A 2QCNA 2Z0IA 4JIEA 3ZQ9A 1MNSA 2WP5A 3LGEA 3Q45A 2C13A 2FFIA 1KFEA 3PZTA 4NZ5A 4IUOA 1CLXA 1D3CA 4GC3A 4MKNA 2G3NA 2FTPA 3KFTA 2VXNA 1CLVA 3N9RA 3P80A 1Z48A 3FSTA 4ADSA 1ZX9A 3VX0A 2QAFA 1KD0A 2QAEA 1XGEA 2DT0A 4L1GA 8RUCA 1TV5A 1BEUA 2B7QA 3CPUA 2C7FA 3GU1A 1FIQB 1AVAA 4D6HA 4N4QA 4ZXOA 3Q2DA 3XINA 1F3TA 2G50A 4FXFA 1YADA 2PURA 1CB7B 4H9UA 2ZXQA 1EUNA 1HGWA 3R8RA 3WL0A 3VIFA 2RHGA 4ORIA 1GEQA 4ZGYA 1CEOA 1JPKA 2CZEA 1ADOA 3EPNA 3Q94A 1EJRC 3W6MA 2D0GA 5DFAA 1OZQA 1SJAA 3KBSA 1C8QA 1XRVA 2QUTA 4MAVA 4Z0JA 1Z89A 4QJ5B 3NSXA 1UWUA 1KWKA 1HG3A 1I45A 4UTWA 3ZR6A 3WLLA 1RK6A 3D3FA 4HPNA 4H9YA 3RMJA 2P88A 2PFHA 4LFYA 3CIWA 3CK5A 3NPVA 3LS9A 4EMIA 2WV8A 5CCZA 2E8YA 4KERA 1XX1A 2ZIDA 1KCXA 1LP6A 3BLKA 2WZMA 1QO5A 2TAAA 2A85A 4DUWA 4IQEA 4O19A 3KTXA 1LLWA 4L64A 6REQA 3GBDA 2Q01A 1J6OA 1KBKA 4YHEA 2VFDA 1VF8A 7A3HA 3VIHA 4TXEA 5DXXA 3G3DA 4O50A 4N4PA 4I7WA 1KLYA 3CUXA 4HK6A 3CQ0A 3K4AA 4Y8EA 1YPFA 1L6WA 3PZ9A 1Q6FA 1YBQA 1A0EA 3INPA 4HA3A 1WZKA 1Q5MA 2REQA 3BMXA 3ONBA 3VUPA 1MQRA 2XJ7A 4HNVA 5CEWA 2XH0A 2D2HA 3LZ3A 8A3HA 3M5XA 1TCDA 5LNVA 5G5IA 3CGEA 1UWTA 5FF7A 5D2WA 4NEVA 3IACA 1WUEA 4KRZA 1G7UA 1RQEA 2W27A 3GS6A 2OKTA 2EPOA 4JEQA 4BCEA 3WUGA 3M4HA 4LC8A 1HP5A 3AIRA 2WPCA 4LYPA 3MMTA 5I3GA 3ZT7A 1AQFA 1Q6OA 4NXKA 3FIGA 4GY7A 1VFFA 4M19A 3LA4A 3VMOA 1EF2A 1FDZA 1LJYA 4M3PA 4OKDA 2DT1A 3VDHA 2ZZ2A 4NL1A 1E1FA 5ABGA 3SIMA 3VD4A 1R38A 4HBKA 4GVIA 4A6GA 4US6A 1RVGA 2DSVA 4GHRA 1EA0A 3UBPC 1CWYA 3E0VA 1XBZA 1KM0A 1XYMA 1LOQA 4AU0A 1NWSA 5CPMA 3VNMA 1P0BA 2VP8A 2E4TA 3CZKA 5KMYA 1U22A 2NLIA 4Q7NA 1ICSA 4H4RA 4ML9A 4I9AA 1HZYA 4P7OA 1RPKA 2V82A 3EGJA 4TO8A 2TMDA 1UUMA 4MZYA 3LMZA 3GWQA 3RYSA 5HANA 1JPDX 1PIIA 5CGMA 2Y24A 1W54A 3DYMA 2CZ5A 3ABQA 4MWAE 3WKZA 2BVYA 3GDTA 3PY2A 2A8XA 2BTMA 4PBFA 3N2OA 1DWIM 4NX0A 2EGZA 4RE3A 1VFTA 1VPXA 4GNKB 1XFCA 2OT1A 3N6QA 4PMNA 3V5OA 3TQVA 1OYBA 3EOLA 3E49A 4WRHA 3CPGA 3EXSA 3W1RA 2XG9A 4FXRA 4AH7A 4PCSA 5A3HA 2XSAA 3GZ3A 3GBEA 1OCQA 4CQBA 3AI0A 4DX3A 4YVVA 2Z1VA 2YCEA 4JIRA 4LRSA 4FEZA 3T44A 5FEPA 3CJPA 4P5UA 1EYEA 3STGA 2Z25A 3VM7A 3M0XA 4NJGA 2EKGA 1S3TC 3B0UX 3CAQA 1VC4A 1HJUA 4O53A 1BTCA 4I9JA 5E6ZA 1AJ0A 3CMJA 1GUVA 3MANA 5CPOA 4Z0SA 1TRIA 5EMKA 3EX4A 1CGVA 2Y63A 2KZHA 3K8MA 1IEWA 1EPXA 4CQDA 1OFOA 2J3NA 9CGTA 1EBGA 4EWJA 1BVNP 3NPXA 4HYWA 1P0KA 1A5AA 2J9XA 2VEFA 4MWAA 2RGLA 3AZTA 4X3ZA 4GOAA 3L12A 2VUYA 3JZEA 1X1OA 4MUPA 3ITOA 4LIIA 3BJFA 3AROA 2DV0A 4KEZA 4ATWA 2OZ3A 2O0TA 3FJNA 5EMYA 4M80A 3VVGA 5EFFA 3NCOA 3CQJA 5AVNA 3N14A 1HXJA 3WQ6A 1JVNA 4H6EA 3DOPA 1G4TA 4KPLA 5C8BB 1MFUA 1H1YA 2OCZA 4DM2A 2WVVA 4NJHA 3GAKA 5DQPA 1KCLA 2XGIA 3OLIA 1XI3A 5LIKX 5ECUA 2KX9A 1XRSA 1YNPA 3VC5A 2W61A 3B9NA 2ZUTA 3T8LA 4L9YA 1LDCA 1X96A 2Q8ZA 5BWFA 4GQRA 1NWRA 4KCVA 3P7YA 2QUMA 1F61A 4EAYA 4URIA 3N6HA 4QBXA 1M01A 3WG6A 3W7JA 1K9FA 1OFDA 3H4XA 2GH5A 4OOUA 5L6UA 2VGBA 3EMZA 4UMBA 5LNWA 3BGAA 1LBMA 4CQAA 2W55A 4E2DA 1YTKA 2XN2A 4LS2A 5HJYA 3GW0A 1HJXA 1QNSA 1QFEA 1TJ2A 3SCPA 2O92A 4LBUA 3ARXA 4EPEC 3LHTA 1XIGA 4HPJA 1V7AA 5BWAA 4K36A 1VFOA 4GZJA 3THCA 1FDJA 2O9TA 1J79A 1VHCA 2QYGA 3EPMA 4U3AA 2CCRA 3W27A 3ALFA 3C0LA 4N9DA 1Q7QA 3RLVA 3WMLA 1J5SA 1HKWA 2OPJA 1C29A 1UIPA 3QLLA 3LHZA 1XDMA 3WENA 3T6CA 1YXCA 2W9MA 3DYPA 2QCGA 3EB3A 3DFQA 4X61A 1S38A 1MO0A 3UZWA 3HA1A 2J88A 3W7LA 4JEJA 2I5GA 4ZO8A 3VGHA 3NJ3A 4CNSA 2P10A 2EG7A 2Y61A 2PZNA 4NIRA 4Y7EA 2XIOA 1HN1A 4H2HA 5G2HA 1IQ8A 1K8YA 3I4KA 3MUCA 5HMDA 1EGMA 4ERAA 1XH1A 3KCLA 3CV7A 2YZRA 1OGSA 3FW6A 3N9SA 4ZOHB 4NJJA 5FI8A 5HUOA 4F0KA 5ABEA 3TSMA 2Y62A 3H12A 4IT1A 4XD3A 4BK9A 4O1DA 2DH2A 3R8HA 3K1GA 4JICA 4ACZA 1QDSA 2CLKA 3GZAA 3FOKA 1BYBA 1QI3A 1X6UA 2QIWA 3O05A 5G5GB 1DBTA 1XLCA 4GIRA 1KKOA 1VCGA 4US5A 3QSTA 4KEUA 2I5QA 4EXAA 3V1PA 1UC5A 1ISWA 1ZB5A 3HMJG 4IL2A 3TN3A 2VWSA 5E0CA 4FNUA 2VKZG 4IJRA 4UIOA 4Z17A 3GC2A 5HATA 2FH8A 4FNQA 5F2LA 3W3OA 1W31A 1G94A 3K46A 1GXFA 1XUUA 4S3CA 4BFAA 4P8UA 2AOSA 2ZXBA 3VGDA 3H23A 4UOZA 1I1WA 5CLWA 3O2LA 1BLIA 2DZPA 2ZA3A 4P7QA 4R53A 1GW9A 2GGJA 1LPFA 4F0LA 1KR1A 1H7OA 4R27A 3KBVA 1KRAC 3AS1A 5FIPA 2J62A 6CGTA 1JL8A 4D8ZA 1TWWA 4JR5A 4X9SA 4DNHA 3GTFA 4ZB0A 3UR5A 4UTFA 1ZRQA 4YXGA 3CASA 5IOBA 4L80A 1LWJA 4YS1A 4QE5A 1JCXA 5CJNA 1HKMA 2VOTA 3GD3A 1K8CA 1NM9A 3W7NA 2XIIA 3WJYA 3THDA 1FWFC 2F84A 4NUWA 1RJPA 2WMFA 3A24A 3ME3A 3WEZA 3NWRA 4NZ1A 2NXIA 3CTTA 4GFIA 3GQYA 3WF0A 5HQEA 3HN3A 3PJXA 3L4TA 3L4UA 3ZOAA 5FEZA 3AQUA 1P7TA 5J04A 2E3ZA 2ZWYA 3C3NA 1UCWA 1MDLA 1TIWA 5CC3A 3WEOA 3W53A 3WCZA 4JFTA 1SJBA 1GJUA 1R9YA 2DFAA 2V30A 4PMOA 4KWUA 3EAUA 1K3UA 3TA6A 4F9JA 4JN6A 2OYLA 3HQOA 4DJEC 3PG6A 2X41A 3MT1A 2RH9A 4A3YA 9XIAA 2DW7A 4JIIX 2YXGA 1VBJA 4FLOA 3A47A 4J1OA 2HROA 1RJQA 3RRXA 1SPQA 2WNNA 1VP5A 1YW1A 3PTKA 2ZQ0A 2NT1A 3RMEA 2PWEA 5FS8A 2OO6A 2HBXA 2VEGA 3LGGA 2JK6A 1H6VA 1T40A 3MI2A 4FR6A 1DHPA 2DGAA 1IWBA 3S2JA 1FO4A 3AMCA 4MYAA 2DUXA 4V1XA 2P50A 4BF5A 1YX1A 2AAQA 1H7XA 1Q66A 4UFJA 1MOKA 4GIYA 4MFEA 1IWPA 2PEVA 3WBXA 4YTSA 2X2YA 3W37A 1WXJA 4K37A 2VZSA 2J9ZA 2ZRYA 3WH5A 3SRHA 1SO4A 4RZBA 3TQKA 1BPLB 1O5XA 3W73A 3R1ZA 5FF2A 3WLMA 3S9IA 4GUIA 1JEZA 4XZBA 1CTNA 3G5EA 1KO0A 4CCDA 1UUQA 3W84A 3RRAA 4R3UA 5BRPA 4CNTA 3EBVA 1R2TA 2VC5A 3WLJA 3EWUA 4XZMX 1RD5A 1ITCA 1E4LA 4OQVA 3NZQA 3NL3A 2W0UA 1DVJA 4N2YA 4FDCB 3BL3A 3GHRA 1V8EA 1JCNA 2DP3A 5IFPA 4Q3MA 1H62A 2XN0A 4QROA 1H0GA 3O3RA 3QKEA 3EDDA 2X1RA 2FZBA 3VIIA 3GDLA 2X1TA 3RLUA 5AYXA 2XH4A 2Z1KA 3FAXA 1ZUAX 3ARYA 3UZ5A 3BG3A 2GJNA 4LAUA 1YDNA 1EJVC 1EJSC 2XISA 4WY0B 2POZA 4DWDA 2X8CA 4AIBA 3LBOA 4NZ3A 4JY9A 1Q2RA 3EA1A 4IMGA 1ZSXA 3PPHA 4Y9MA 3K30A 3LRKA 3MJMA 5LYRA 5F1UA 1YDOA 3TSDA 4LYRA 4MPQA 4PEKA 5K9DA 3GUWA 3BMWA 4PUDA 4B9ZA 2J66A 1QPOA 4TV6A 4DWSD 2CWXA 2ICSA 2X7VA 4AD3A 3NSNA 5D9OA 4KWWA 5K9CA 2FZDA 4HCLA 2VRJA 3V3WA 2ZZ7A 1MXGA 2CZVA 2FZ9A 3OODA 4W85A 4FOJA 4UFKA 1KBJA 4I8YA 3TAKA 2H3BA 3UXLA 4PTVA 3KLJA 1NDZA 5BNKA 3DAQA 1XLAA 3ITGA 1A5KC 4W7UA 3IVUA 3CEPA 4M1RA 2GVJA 2E6YA 4LU0A 2ZXAA 1MW3A 4MB4A 4C5YA 3IAQA 1QT1A 2R82A 4H8VA 1W9PA 1VHNA 2HJPA 4H4ZA 1IEQA 5AC8A 3PWGA 2XVGA 2BGQA 1JAKA 3LB8A 3UNTA 3NL2A 1RALA 2VR5A 3ZM8A 1U30A 4IUGA 1EZWA 2WJEA 4C6DA 1E0TA 1B1YA 3NL6A 1OADA 1HKVA 2RGMA 4XVEA 2XN1A 4IIEA 3UPMA 4DF2A 2PRMA 1WAWA 2QLYA 2CHNA 1A49A 3MQTA 1W1PA 4QS6A 4LJ3A 2WBAA 4GYFA 4LB3A 3CC1A 1TCMA 3KVKA 1OABA 5E5CA 3W7QA 3PTDA 2YX0A 3WYZA 4UNLA 3ARPA 4XTIA 3PF3A 5C7VA 1SGJA 4GI8A 3MSDA 1FWHC 4I6KA 1UB3A 1C8YA 2EG6A 2W67A 5EKYA 4GFSA 1S1RA 5G2IA 3S4TA 2YL9A 1F74A 4DZAA 1ZTVA 1AH0A 2XIMA 1ENUA 4LYQA 2CLPA 3RPTA 1X7IA 2FH6A 2ZCGA 4NZCA 3FA5A 4H3DA 1STZA 4H83A 1OFBA 2CIPA 2XGBA 4LCQA 3TN6A 2PDIA 3WD3A 1MNZA 1PX8A 1OX5A 1L8PA 3ARZA 3GNNA 1I2QA 3VFCA 1F76A 5C2CA 5LKYA 4XSLA 3PJUA 1EIBA 3W7KA 2WZIA 3UXIA 5DMYA 3TNBA 2A3LA 4QCFA 1JXJA 2PA6A 3LBCA 2ZRVA 3F4CA 2R1LA 4D1IA 1TRDA 1I1XA 3ITXA 2Z27A 2ZUVA 3V1HA 3OGVA 4HB7A 4H4XA 1M7XA 2VNCA 1V6XA 5EYWA 1JZ3A 7REQB 3W72A 2ZXDA 5A6SA 4EM3A 4GBDA 4UR7A 8CGTA 1SO3A 1LLOA 4F3HA 3TE9A 1TJ0A 1F7BA 1KRMA 2D73A 3W22A 1V3LA 2YIHA 5DO8A 3OA3A 3RM8A 2X1SA 3BAYA 5I5RA 3MU7A 4LAOA 1RBLA 1W56A 2WVSA 1YDVA 4JAWA 2W5FA 3RJYA 1JAEA 4M6PA 1GVOA 2QIIA 2PP0A 3URBA 1RLDA 4D6DA 2E6AA 1TYPA 3UNDA 4FO4A 4H4SA 4CUCA 2PLMA 3ISIX 5FF4A 4MJ4A 4PB5A 1GCYA 3DHFA 3OU8A 1XHCA 3USBA 3NUKA 3KVMA 1PKLA 4H8UA 1IT8A 3IGXA 5JCLA 1BSLA 3P0WA 3GFYA 4X22A 2V3GA 3R25A 1L2UA 3S6TA 3IIPA 3NOYA 4Q6XA 2A3BA 1UD4A 5TF0A 3W2NA 4Y2WA 4K1WA 4LYKA 4FXSA 5EY5A 3AM9A 3UFYA 2WBGA 2Y7EA 4QE1A 1JQVA 4ZOCA 2FZMA 5D9MA 5I79A 1VFUA 3C56A 4HPHA 1OX6A 4OECA 1O12A 2VQTA 3PZQA 1VFMA 3F5KA 1HX0A 3A7UA 1F8IA 3S9YA 2PWHA 1GZ1A 3UETA 1CPUA 4J7RA 3OC4A 2J4GA 3LOTA 1D3HA 4ZFMA 4LRTA 2I57A 1V03A 1LUCB 2WNZA 2ACRA 3AUOA 3T0CA 3GKAA 3S3GA 3SQSA 4J56A 4WJ8A 2ZZBA 3EX1A 4AVFA 1DWFM 2PDWA 3L5LA 4FZIA 2IPGA 2WWCA 4NJIA 1S5MA 3OGRA 2WCAA 1GOKA 3J7HA 4H01A 4X0NA 3G1VA 4RNJA 1JI2A 1GQLA 4JTJA 1FFQA 1BYAA 4AD1A 1AG1O 1JR1A 1F9CA 3IC9A 1U1UA 3H2AA 1QJWA 1OK4A 2ZE3A 4M8UA 3W1MA 3VOJA 1YLVA 1KFWA 2BCPA