4DX3A

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
400
structure length
360
Chain Sequence
MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 126
structure length 360
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dx3A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dx3A01
3N4FA 3VCCA 3U9IA 7ENLA 3CXOA 4HCLA 3ENLA 3DG7A 3OP2A 2QJNA 2AL1A 3UJEA 3GC2A 4FI4A 3MKCA 1PDZA 2PSNA 3V5FA 1EC7A 2ZC8A 3DDMA 4Z1YA 3V5CA 2PS2A 3CT2A 4ROPA 4A3RA 4HNLA 2PCEA 3UXLA 3SN0A 3R25A 4GMEA 5FJPA 3IK4A 3GY1A 5BOFA 3QPEA 3ZVHB 4H2HA 2GDQA 3QN3A 3THUA 1R6WA 4K8GA 3EEZA 5FJOA 3H7VA 1TKKA 2O56A 3DERA 2AL2B 3PK7A 4HCDA 3PWGA 4MGGA 4IZGA 2OO6A 4J3ZA 2DW6A 3OTRA 3TOYA 4HN8A 3N6HA 2OLAA 5FJRA 2CHRA 3RRAA 2PTWA 3UXKA 5J04A 2GGHA 3H8AA 3JZUA 2XH7A 4ENLA 2ZADA 2QGYA 3STPA 4HCHA 3ZLFA 2GSHA 1EC8A 1SJAA 1FHUA 4DHGA 3MZNA 2PPGA 3VCNA 1L8PA 4GGBA 3CAWA 1E9IA 3CYJA 3BOXA 3H12A 4E4FA 3QKEA 3BJSA 3FXGA 3RR1A 3TJIA 4JN8A 3SJNA 3UCCA 2P8CA 1BKHA 3N4EA 3VFCA 3R0UA 1P43A 1FHVA 3I6TA 3R10A 5FJTA 3FJ4A 2XGZA 5EU9A 3PFRA 2P8BA 1NU5A 4DXKA 1MNSA 4M6UA 2QJJA 2HNEA 3PWIA 3ZVHA 3NO1A 3RCYA 4IP5A 2PGWA 5ENLA 3I6EA 3T8QA 3R1ZA 3NFUA 5IDZA 1WUFA 3DGBA 2MNRA 3T9PA 3TWAA 2FYMA 3IJIA 2AL2A 1P48A 3VC6A 3S5SA 3B97A 3P93A 5BOEA 3BSMA 2GGJA 3I4KA 3GO2A 1TZZA 3R11A 3SQSA 4A35A 3VA8A 1SJDA 4GFIA 4GYPA 4X2PA 3RO6A 2OQHA 2PODA 3V3WA 3JVAA 3T4WA 4YWSA 1KD0A 2PP0A 4GGHA 2PTZA 1EBHA 1DTNA 2ONEA 1JPDX 2GGIA 4IL2A 1XS2A 4A6GA 4GYPC 4E8GA 2XH0A 3FCPA 1XPYA 3SBFA 2P0IA 3TJ4A 3FVDA 4MKSA 3JW7A 2AKMA 4ZA0A 3EKGA 4ZCWA 4KWSA 3NZGA 3QTPA 4DYEA 1W6TA 3NXLA 3TWBA 1JDFA 1OEPA 2GL5A 3RITA 1MDLA 4E4UA 1WUEA 3RGTA 3FV9A 2PTXA 3N6JA 2OKTA 2OQYA 2POZA 2QDDA 3TCSA 2PA6A 1SJCA 3UCDA 2DW7A 2QQ6A 4IHCA 3ZLGA 2OG9A 3CB3A 4G8TA 1KKRA 4DN1A 1TE6A 3K1GA 5FJUA 2PMQA 2OZTA 4HYRA 4MMWA 3MUCA 2OX4A 3TQPA 1F9CA 3DEQA 3SN1A 2NQLA 3R0KA 3DFYA 4IP4A 3DG6A 3MWCA 2AKZA 3Q45A 3ES7A 1EBGA 3VDGA 3ZLHA 3FYYA 3D47A 2GGEA 3OW1A 2MUCA 1R0MA 1BQGA 1EC9A 2PGEA 3OZMA 2OZ8A 4KEMA 3HPFA 3OZYA 3DG3A 3MSYA 3DFHA 3CK5A 3TW9A 3UJFA 4HNCA 1MUCA 1KCZA 3ES8A 3DIPA 2FKPA 3GD6A 4K1WA 2P88A 3P3BA 2QJMA 3MY9A 4KPLA 1PDYA 1MRAA 3UJ2A 3SN4A 4GIRA 3T6CA 4H83A 2HXTA 3D46A 2QDEA 3SSZA 2RDXA 3KUMA 3DESA 3TTEA 2PP3A 1ONEA 2OZ3A 4IT1A 2HXUA 4H19A 4J1OA 3OPSA 4F4RA 4DWDA 2PTYA 2OPJA 1YEYA 1ELSA 2QVHA 2PU1A 4FP1A 4GISA 3UJRA 4Z17A 1SJBA 3H70A 2PU0A 1RVKA 4H1ZA 3V4BA 3MQTA 3QLDA 1NELA 4E5TA 4G7FA 1JCTA 1IYXA 4E6MA 1ECQA 2GGGA 6ENLA 4EWJA 4KT2A 2XH4A 4K2SA 4IL0A 3S47A 1MDRA 3UJSA 1JPMA 2OFJA 2I5QA 4JN7A 3IJLA 3IJQA 2XSXA 3Q4DA 2P3ZA 3VC5A 2PP1A 2XH2A 4M0XA 3U4FA 4JHMA 4DX3A 1KKOA 3ZVIA 2HZGA 2OVLA 3UGVA 3P0WA 4HPNA
chains in the Genus database with same CATH superfamily
3N4FA 3QMSA 1CTNA 1X6UA 5JRBA 3LK6A 1NIUA 4H9XA 4LJ3A 3N25A 3GWQA 2WKJA 1UBPC 4C5YA 2A3AA 3WUEA 3LZ3A 5FF0A 4XD5A 3OGRA 2OEKA 3E0WA 1T8QA 1R3TA 3AIWA 3T2OA 1Y65A 4C7GA 2CEQA 2VZTA 5D9NA 5JVLA 5E9AA 2CYGA 3AYRA 1XD1A 1GJPA 3ZVHB 1WKYA 5C5YA 1FRBA 3THUA 4ONVA 1VRDA 1G4EA 3EOLA 4K8GA 2VR2A 4CD5A 4OBSA 5MF5A 4UR8A 3DERA 2AL2B 1P5BA 1SO4A 2VUNA 1CEOA 3RX3A 3E0VA 4GFSA 3WBXA 3DJGX 2HV5A 1KQZA 3HG2A 1LLWA 2A79A 4HN8A 4F0RA 4O0KA 4LVGA 3S0CA 1QNSA 4O1FA 3IPWA 4H7ZA 4AU0A 3UY7A 1VBHA 2VC9A 3QOKA 2QAPA 1YE6A 3GE7A 4J9JA 4HMEA 3SDOA 3WH7A 1ITQA 4Q6XA 3ZLFA 4D9PA 4IH3A 4RNHA 1QPQA 4PTMA 1R9XA 2DT3A 3B8SA 2ZX8A 4NASA 3ZMRA 2QPSA 4L4OA 5CGMA 3LXBA 1DWGM 3C8FA 1MVYA 3R5EA 3E74A 3UCCA 1PHWA 1CT5A 2P8CA 1DWIM 3V35A 1K6AA 1LQAA 1HL9A 3DI0A 1FHVA 4LYPA 4NXSA 2E5BA 1AJZA 2ICSA 2WZIA 2VX7A 1NHPA 4S3EA 4K7YA 1OWQA 3KBVA 4M6UA 2YJQA 5CPTA 3LPPA 3PZ9A 5CH9A 3EDKA 3ZVHA 3QSTA 1BHGA 2V5BA 4WR3A 1FEAA 3EA1A 3T0DA 4J2MA 3NUKA 1LM1A 2AL2A 4JIPA 4FK9A 2PDMA 2PAJA 3NVVB 1ONRA 2VEKA 4MPKA 2E68A 4JHOA 3WLNA 1LROA 5BOEA 3GAKA 3GTHA 2FGZA 7REQB 4M29A 5C9UA 2WYSA 3S4TA 4S3CA 1SGJA 4JDBA 1SSDA 1M7PA 4LBUA 2J74A 2Q02A 1JOAA 4EM3A 1KM1A 3T4WA 4YWSA 4Q6JA 4EQXA 4GIYA 2V81A 5FEXA 1K8CA 3VD7A 4FNQA 2OSXA 4UTUA 2PDXA 3S2MA 3ITCA 4IL2A 4MWAC 4DBDA 1YXDA 2DZWA 2QCDB 3WH5A 4AD5A 3LCGA 3B9JB 4Q8VA 1W37A 2ZA1A 3O2LA 3UG8A 4FMVA 3FKKA 1RK6A 3FSUA 3C0LA 4YTSA 3GXNA 4AEEA 1XGZA 1OB0A 3TIMA 3CZ8A 3ANYA 1BYDA 2DSVA 1GOKA 1UR9A 2YW4A 3AIUA 3DFOA 4WVXA 4PMUA 2H6RA 4RW3A 5H2ZA 3IJ8A 4PMDA 4FX7A 2J9ZA 2C7FA 4GBDA 4U2YA 1ZLPA 4GQBA 1Q1WA 1FH8A 2OQYA 3VDHA 3GBDA 1UZ4A 1LLZA 3U4AA 2OG9A 2Y63A 2PWUA 1NOUA 2VVNA 3W38A 3CGTA 5CZKA 4AVFA 7REQA 4PBFA 1FFVC 4JKKA 1LL7A 2Y8VA 3NYZA 4HGXA 3WH9A 3KAOA 2JIEA 4GVHA 4B3ZA 4WDWA 4KPRA 4LPCA 4IP4A 4NZ3A 1LYXA 2CKRA 5HANA 3AZRA 4RNIA 1KWKA 2X1UA 5BWFA 5CCZA 5F4WA 1TR9A 5M1TA 3TZFA 3L0NA 3WLQA 4OU1A 5HR7A 4M1RA 1TZ9A 2IKGA 3HGJA 3STCA 2YL5A 2YA0A 2QCDA 4K6AA 2OMAA 2E7FA 2MUCA 2DUXA 4LBRA 3BAWA 3LV6A 3T07A 5CSSA 5FMHA 3APYA 2JBMA 3RNDA 3SQLA 3BGGA 4K8HA 4F40A 5GJPA 3WLSA 3P67A 1E72M 2GQ9A 5KMYA 1W0MA 5KTLA 3UYIA 1W9UA 4RXGA 3DFTA 3ITLA 4Z2LA 1TUFA 3GD6A 4LQ1A 2QPXA 4PULA 2X8GA 1F07A 1SYTA 1GOIA 1HKJA 5DMYA 3UF9A 2ACRA 2D73A 3UNTA 3SFKA 4OIFA 3W7CA 3BZJA 4IGSA 4B3KA 4E8CA 5FF7A 1I4NA 2XWDA 5GJMA 5U25A 2VD8A 2H9AA 4HTBA 4J1OA 1D7KA 2D1ZA 4C6EA 4GRTA 5H91A 3AIRA 1F8WA 2XG9A 2CDUA 1B0IA 4AEFA 1E3XA 2X1SA 4S38A 1SJBA 3IVUA 3USBA 1QDSA 4RR4A 5E0CA 1H1ZA 3QH2A 2VR4A 1HO4A 3NM1A 2FTWA 1IYXA 2C91A 4HMDA 2CBUA 1F76A 2CZFA 2A3BA 3DHUA 4CCZA 4DJFC 3M6DA 3IJLA 1I0DA 1DKWA 3TQKA 3NVDA 5U7SA 1JAEA 1V3LA 3VIKA 4W7UA 3W75A 2AOSA 4I9TA 5FS8A 4XX6A 2A3LA 3SM0A 4GOAA 5CBIA 3A21A 3HO8A 4A2SA 2Z2AA 2J6VA 1XX1A 1ZNNA 2ZUSA 3THCA 1AW5A 1EJUC 4P7NA 2NX9A 4DUOA 4H6RA 3OP2A 2Y8KA 4M1BA 3KVLA 3ZXWA 3TZNA 2V5KA 1LDCA 3L12A 5IBXC 1W2PA 3IK2A 1UZHA 3LZ5A 2XFRA 5T26A 4A3YA 5A3HA 2P0OA 5E1QA 4A3RA 5I3HA 4NX0A 2G8ZA 3DX5A 1RQBA 4F66A 1K9TA 1ZTVA 3PBMA 4MYXA 3W71A 4AD2A 4CQ8A 3TEVA 3BLFA 2CW6A 5D2VA 1MXGA 1W3TA 1QPOA 3T7VA 3WLRA 1WNOA 4KRZA 4QDMA 1JDDA 1X2GA 1YDNA 3WK1A 1K4HA 1HNYA 3D0CA 1TWZA 2WQPA 2QCHA 5I3DA 3QEZA 1OFRA 1GSNA 4DWSA 4F9JA 1EQCA 1WO2A 4UWMA 4Q3MA 3CZGA 4MNJA 4XAFA 5AFDA 2AMGA 5JQ9A 4JXCA 4B3LA 2W3RA 2V5LA 3MV11 3E9AA 2OB3A 3NSMA 5DMLA 1P1MA 4UCGA 3UPWA 4S1FA 4TU1A 3AS2A 1CXKA 5DT5A 1EC8A 4Q4OA 2D69A 3H2MA 3B9EA 2NW0A 4C5ZA 1R8LA 3GYCA 3STFA 1PKMA 1C7SA 2UWFA 5I6SA 4PUMA 1EKOA 1Q6GA 5EMLA 4IJRA 3TCEA 5G5HB 1LOLA 5HMFA 4A8LA 1F6KA 4EQWA 3BLKA 1HO1A 2I1OA 4UXDA 2X30A 4EMJA 3N4EA 3UD6A 3VFCA 4GZIA 2VWTA 4NY2A 1BFNA 1UBSA 4PN2A 1KFBA 1C9WA 5H1WA 3M5XA 3E2RA 2Y1HA 3HTWA 3W1LA 2QJJA 3QY8A 4HZMA 3DK9A 3GFZA 3QHMA 1WV2A 2PGWA 2WHJA 1A53A 2O4MA 3EKZA 4DNAA 3AQUA 3L5AA 1L9WA 2WSKA 1DE6A 4GVIA 3CB8A 3TWAA 4JEQA 1XIEA 1RCOB 4C6NA 4Z2GA 1A4MA 1GT8A 1B57A 3VIMA 4M3PA 5LGXA 2QAFA 3BSMA 3G8RA 3TN6A 2GGJA 3I7QA 5HINA 3OIHA 2ATMA 2WCGA 4Z0JA 3VKCA 4XISA 4QAWA 2IMRA 1I0BA 4YL2A 5C9ZA 1S1PA 3ZOAA 2QUMA 3MC5A 4GYPA 4X2PA 3RHGA 5DELA 1KRBC 3EUB3 1RJPA 3ZM8A 1VEPA 3LGDA 1UKPA 3OU8A 1FKXA 4HA3A 2XVLA 4A4AA 1DTNA 2ONEA 3LXAA 1H7XA 3B8TA 2IKHA 5BXSA 2GJPA 3AIVA 2V3EA 4K37A 2JK2A 2WOIA 3IJ6A 1V0NA 2Z6IA 2PC4A 1DIKA 1K7EA 4QEEA 1I1WA 3QBUA 1KM5A 1TPH1 4ZENA 5A8NA 2OZ0A 4B92A 4ACYA 3DFPA 5FEZA 1MDLA 3VIGA 3DENA 1H50A 1FH9A 1H7WA 5HJLA 3SR6B 2HPMA 4NZJA 1HUVA 3MZ2A 3HQPA 2O0TA 4XZBA 1E0UA 4Q4MA 3UCDA 1HKVA 3CV6A 2DW7A 4ZXOA 2F5ZA 1U1JA 4L65A 3M64A 1W3KA 2V6AA 7TAAA 3P14A 4W85A 4FXFA 2EEXA 4M8UA 1F9CA 5BU9A 3IAQA 1BF2A 4OQVA 2JKEA 3MU7A 4JTAA 4WGXA 4LYKA 3RG6A 4ICCX 4WUIA 3MWCA 4AISA 2QPUA 2WMGA 4LRSA 4LANA 1HKKA 1GPWA 4ALDA 2VR5A 3W2NA 1O66A 4PUKA 4AMAA 1KM0A 1F6YA 2I17A 2GGEA 5CGTA 3L8KA 2ZZ2A 4XVDA 1Z9AA 2DZTA 2YBVA 1R0MA 4Z0SA 4PR4A 3OVRA 1IXQA 4K3ZA 2OYMA 3B9NA 5M5DA 3W7LA 3I6RA 3LLFA 3TN5A 1XSIA 1WXZA 3RLGA 5AC6A 3CHCA 3MP3A 2GK1B 3LB0A 4AEOA 1H62A 2OXNA 5J5RA 3VCRA 1WQ5A 1Q6DA 4H9TA 1OX4A 5E0FA 1KCZA 1SW7A 4H4UA 1XC6A 3MV01 2E5DA 2FDSA 4FX9A 1RALA 1ISVA 4JHZA 4W8BA 1EJ7L 4K8DA 1C8YA 3WQDA 4ILSA 3TV8A 4U33A 4TTGA 2E77A 4BWLA 2EJ1A 3NVWB 3NQDA 3VKKA 3A7RA 3GM8A 2PTYA 3W1QA 3N6QA 1BYCA 1ISZA 1W5QA 3D5HA 3VIPA 4X2RA 2F2KA 2BTMA 3F1QA 3E5BA 2DZBA 1ELSA 3A4WA 1DEDA 2PU1A 1TPVA 5T8GA 4OKDA 1TTJA 4NRRA 4Z17A 3LNPA 5A6TC 3ZS4A 3EB3A 3IACA 1RVKA 1B1YA 3H2NA 4O10A 2RHGA 2QCMA 2ZUMA 4EWJA 1PKYA 4IL0A 3GXDA 4DZIA 3TMLA 2BDQA 1QNVA 2Y5SA 5CZ0A 4RNFA 1BEUA 3MCNA 2XSXA 3CPGA 1XM3A 1XI3A 4WLCA 4JYDA 4MZ1A 2WOQA 1PSCA 2X7WA 1LRNA 2IPWA 4E4PA 1G7UA 1U22A 3VIJA 5GNZA 3WBAA 4Q8QA 2FH8A 1SFLA 3ITYA 3NTYA 5B7ZA 3PPHA 2NX1A 3FIGA 1EXBA 3H2FA 1RY8A 2PLMA 2NQ5A 3HQOA 3FGCA 1AZ2A 5DCEA 7ENLA 5KZ6A 2ZIDA 1TTIA 1WZMA 2QDHA 3EX6A 3WQ6A 2QJNA 5I06A 2J7FA 2XGIA 3B8VA 3VD9A 3LLDA 3R0DA 4PEEA 4AF0B 3V5FA 1TSIA 1HW6A 2X50A 4YWIA 3DDMA 3W7NA 3W02A 3PPCA 3WK2A 5JCIA 4AQLA 3M5YA 2V82A 1XSJA 3LX9A 4U5KA 3GY1A 2NPXA 3K5XA 3WUGA 4DYKA 1N8IA 1LQ2A 3M6YA 3LBOA 3QPEA 5HJYA 2OTDA 1GWJA 1NM9A 3NQ7A 1LOSA 1YQ2A 4WXZA 1J96A 4XZIA 4O18A 5D9MA 5FF3A 3ZJ7A 5IHSA 4GXWA 4KRUA 4D72A 4H4YA 3CPUA 3TC3A 4S3JA 3PWGA 3PHAA 1HJUA 3WL0A 1YIXA 1JNDA 2WBGA 2QV5A 2ZXBA 3QVQA 4OOZA 2GUBA 4J40A 5BOOA 2Y5JA 4US5A 3E49A 3SCPA 2O9OA 1D8WA 3DC0A 3RAOA 4H4IA 3FSTA 3PZQA 3L67A 1GTHA 3W6MA 4HCHA 5FIPA 5BZAA 2DIJA 2PWVA 3MS8A 4UFKA 1R85A 3MUIA 1UR3M 4PFHA 4BZYA 4JIQA 3S1XA 3GR7A 3BSGA 1JZ2A 4XAPA 4GHRA 4NJIA 2QJHA 1OT2A 3ABOA 4FA3A 1YMYA 2VEFA 3VYLA 4BQ3A 4CQ9A 3LQLA 4GINA 4KESA 3IJDA 4UOZA 1JF6A 3DFQA 4J3TA 2QT3A 2WJEA 3GH4A 3KTCA 2OOGA 1ZP3A 2BXYA 1B3WA 2NWRA 1BAGA 1PKLA 4BI7A 2OKOA 4H41A 5DN1A 1TV3A 4MNMA 3F5KA 4H6EA 1JDCA 2QCLA 3T8QA 2A4AA 4H8NA 4UTIA 4JOMA 1KV5A 1UIOA 4C6FA 1H7PA 3K4DA 4PEKA 3IJ7A 5I07A 1V6WA 3O6DA 3NZRA 3ALFA 1W8GA 4AZHA 4S39A 2VFEA 3KRSA 4O54A 3ARZA 1EWDA 3U0HA 3E12A 1EUAA 2V2CA 1R46A 4MJMA 1GG0A 4N6FA 1F3TA 2Y7DA 3W7MA 4I3GA 2X1IA 2OQHA 1XLIA 5KVHA 4GY1A 3ARQA 1BG9A 5E6ZA 2DH2A 3M0MA 4KCWA 1HX0A 1PZ0A 1I45A 1BWLA 1WX0A 1XLLA 3QXBA 5IHRA 4O14A 3M0JA 5EKYA 3WDQA 1XPYA 1QOQA 3SBFA 3G1AA 1GOOA 2QEZA 3HIJA 3GTIA 1PCKA 1OYCA 3UZJA 4ZODA 5CJ5A 4ZA0A 2P3EA 3QSRA 4R9XA 1LBLA 3A7UA 3NQ8A 1JAKA 3VX0A 3USZA 1Q85A 1RA0A 3GNRA 3IARA 1CLXA 5CPOA 4E4UA 5KSWA 1YNYA 4H8HA 3BG9A 5KEZA 3HFTA 3PSWA 1T41A 1I1XA 2XSAA 2PLJA 9RUBA 1HKWA 5CSUA 2Q6ZA 3DKLA 1Z32X 3BMXA 2ZZ3A 4EPBC 3SGUA 3RK8A 5HQEA 4HPJA 4EPDC 1TV2A 4G8TA 3P7YA 2E1WA 2SFPA 2WWDA 1IXOA 3U2OA 5FAJA 2OZTA 4EE9A 4GPNA 3LEPA 3UWZA 3LTSA 4P8VA 3FVMA 3M46A 1VPQA 1ZBKA 1A5NC 1XG4A 1E55A 4O1CA 1TREA 5A6JA 2QCGA 4DVOA 4UFHA 1IXNA 1DJWA 1I2NA 2R8WA 3B0XA 5EL1A 4YS1A 3GG0A 5EB8A 2Z7KA 4L1XA 3SUSA 4MB1A 2OJPA 2ZX7A 3NIYA 1W31A 1EC9A 3LXCA 3S6DA 4DBUA 3LENA 1XH1A 3QY6A 3WQFA 2BVYA 5AYXA 1Y5XA 4HVXA 3AOFA 1OG0A 2BZNA 4QLKA 3V16A 2VDIA 4KRTA 8XIMA 2PC8A 1LOQA 2YZ5A 1M04A 1IEIA 2HS8A 2BASA 1E1CB 3LHZA 2QGHA 1B90A 3C2RA 2WPFA 3ABRA 3PB2A 2E40A 4XBJA 3NZQA 3M0KA 2V3DA 2P1FA 1JL8A 3VOJA 3KUMA 3NJ3A 1MQPA 4WRHA 1GEQA 1UMYA 4IT1A 2OELA 2DSWA 3N9SA 2WP6A 5LA0A 4QG9A 2WVUA 4I7UA 3UXDA 1VYPX 4QJ3B 1TCMA 1MW2A 1YYAA 5HDRA 3MQTA 4QQUA 2DV0A 1BTCA 2VRJA 4JTCA 3S47A 4NNCA 1V59A 2P10A 3UU0A 4CNNA 3BJFA 3GIYA 4NI8A 3UZZA 1TIMA 2DGAA 3VC5A 5A6KA 4ZTYA 4S3FA 4LC8A 4GK8A 2WOWA 1EPVA 4AY8A 3K8MA 1W5OA 4YYCA 2VI0A 4O8AA 4HD5A 4DB7A 4XTDA 3SSJA 3L4XA 4XZ9A 1E1CA 1TVPA 1UWAA 3R8RA 2OODA 3U2CA 4QJ5B 2VTFA 3Q6JA 3PULA 2GR0A 2C0HA 5TNVA 3IVTA 2X8HA 2QW5A 1OK4A 1JXKA 4HPHA 2FGBA 3VGBA 3N2CA 1UH4A 4RK8A 4FNUA 4KEVA 4GMEA 3T0BA 2INFA 3EANA 4HT3A 4AZGA 1EP1A 2B7OA 3MWAA 2GSJA 4H2HA 3OGSA 2GDQA 5BYWA 3HMJG 1I60A 4H7VA 3DYPA 1TELA 5B80A 1S3HA 3CZEA 2X0YA 2O56A 5M3WA 3SB0A 3SCVA 5E6YA 3A24A 4HCDA 3WLTA 3CBWA 1DP0A 3TOYA 1FEBA 1MOKA 3N6HA 1R38A 1R87A 3MUAA 1FX6A 3NDZA 4GACA 4KBXA 4Z1BA 1IGWA 1R86A 3A23A 4JTEA 2C0AA 1OIFA 5G4HC 1XCXA 2YCEA 4TXEA 3O0FA 4GYKA 4LUTB 4PTWA 3VIFA 4EPKA 4NG3A 4MZ8A 4GQ0A 4XO6A 5DQPA 3ECQA 1E70M 2W4XA 4K8EA 3LCHA 3LHWA 1CXEA 4AYSA 3UFYA 1SVDA 3K4WA 4JDYA 4ZSUA 2NSXA 4WK9A 1PO9A 4RUBA 3TYUA 3SY5A 4KCVA 4Z2KA 2CFFA 3CWHA 3W85A 1R2SA 4PL1A 1KBIA 2XFFA 1Q6CA 4JQ3A 2ADAA 3U5YA 1VC4A 2ZX6A 2YCLB 2FPVA 2P8BA 1F73A 2ACSA 1W3IA 2XHYA 3WDIA 1A4LA 2WZMA 4FEZA 3MW7A 4WXYA 4JN6A 4U3CA 1FWEC 3UW6A 4WOQA 2JALA 4H4ZA 4B5WA 5ABFB 1W1A1 4FR1A 2YXOA 3L0KA 3P74A 4IISA 3T4CA 4OTKA 3TROA 3ZSTA 5IFPA 5LNSA 2ESCA 2EBNA 4LY4A 4ASTA 4H4WA 4NKCA 3E5PA 1RV8A 1UD3A 4DZHA 3WZ0E 1TMQA 4DLFA 3I4KA 1I8JA 3LU2A 3PC0A 3DI1A 3M5VA 3ZSSA 5D2WA 3R11A 1NARA 2I5IA 4A35A 3PF3A 3WO8A 1CX9A 2I9UA 5TF0A 1X6LA 4LUTA 1JNEA 4REQB 2DZXA 3V3WA 2ZZ5A 3OZOA 4NNAA 4NUWA 3VK5A 4NYYA 3VTRA 3ZR5A 2C79A 2PP0A 1OINA 1NQKA 2PTZA 5HNUA 1T0OA 2J7EA 3FFSA 3TKFA 1FWWA 2GVEA 1XS2A 4D8LA 3FCPA 3DHPA 5I02A 3D9XA 3H55A 3NOEA 3GC4A 1W17A 2WXDM 1M7XA 3HPXA 4G2DA 1K9FA 1KGUA 2PZ0A 2BG5A 3S5OA 3RPMA 2FMOA 5LA1A 3UZ5A 4UFJA 4KWOA 4EM4A 3SW6A 5E5CA 2ZFAA 2D2HA 2XIIA 2VFDA 7TIMA 3WJZA 4RL3A 1IT7A 1D3CA 3J7HA 1DJZA 3VM7A 4AWUA 2Y7GA 3G5EA 1VBJA 4KWUA 4HBKA 4L1WA 3MYOA 1J5TA 1EDGA 4I90A 1AG1O 3B9DA 2RDUA 3V0SA 3AWOA 1GOMA 4UCFA 2I14A 3BL3A 4BY3A 4O17A 5FJUA 3ZO9A 1UR4A 1TE1A 3SCQA 1F3PA 3M41A 3NA8A 5BW6A 1W9PA 3SN1A 1Q6OA 1OJTA 1ESWA 2X41A 4H4TA 3W87A 4U3AA 4REQA 1G4PA 3OLDA 1AL7A 4H4PA 1UIPA 4PUDA 1U1HA 2QF7A 1C29A 1S5TA 1CIUA 3NG3A 3E0LA 1DHKA 2GDVA 5JIPA 3IGUA 4NZ4A 5H8MA 3AZTA 5LNRA 3S1VA 4OJYA 2RKXA 3G0SA 2A8XA 1GJUA 3HZ3A 4JTSA 1UD8A 3F4NA 1FWBC 2KAUC 3NQFA 1UWUA 4WY0F 4XBSA 1TX2A 1ALDA 2OWXA 1HQTA 3AN1A 4UQBA 1QWKA 4UTWA 5B7YA 4D6HA 4CNUA 5LHFA 4A05A 2Y89A 4MFEA 1SMAA 3OGVA 1VIWA 1W5PA 1UA7A 4GIRA 2VGIA 1H41A 3SSZA 2WMHA 3DESA 3MVTA 4NILA 1ZGDA 2HCVA 1BVZA 1S38A 1SZRA 2V63A 4BEQA 1GVQA 1UOKA 4FOJA 3P5ZA 3HFYA 3RX2A 2PWGA 2ATSA 3QTGA 3BARA 2CLFA 2OT1A 4PC8A 4TVUA 2QF8A 2QCEA 3BOLA 1O6IA 4HMNA 2QVHA 1GQJA 2FJUB 3UCQA 1UA3A 5JCLA 1I75A 2DP3A 3M47A 3GG1A 2PE4A 3ARXA 2DPEA 3KBNA 1X2HA 1XLCA 1TG7A 1L8NA 3EXRA 4QR6A 4ZEPA 3WQ4A 4C6IA 3BVJA 1V3IA 5ER0A 4M6VA 1JPMA 4HZ6A 1V6YA 2Q71A 2YLLA 1XV8A 3RX4A 3IJQA 4ZOHB 3EX1A 4HOZA 1KB3A 1MNZA 3MCMA 1EPXA 2HISA 4ADTA 3O06A 5HA7A 3SCTA 1AMYA 5I2UA 1R3WA 2BGSA 1DJIA 3MP4A 3W28A 5EMMA 1M01A 2PRHA 1Q65A 3TMQA 1BLIA 3UGVA 3AO0A 4Y90A 2WJDA 1B54A 1HJVA 5I03A 1HXJA 5DANA 1MYRA 4NVTA 4FX8A 3W1TA 4DO7A 2WC3A 2RGLA 1S2UA 4C6JA 2YBTA 4XTIA 1TPB1 9XIMA 3V7PA 4QXIA 4ERAA 4AY1A 1CB7B 4XZMX 1KWGA 5LNVA 3PZUA 1V79A 2HVOA 2PCEA 3DFSA 4UOQA 1ME9A 5CJMA 3BW3A 3EA2A 1W9XA 2ZVIA 2W92A 1GYMA 4ADWA 4FXJA 5HUOA 1FWGC 5K4ZA 4PTVA 1QRQA 3ZT5A 3I3EA 4U5IA 3P0XA 6XIMA 2NWSA 3BV7A 3GDBA 3NEHA 3WQWA 2PRLA 2INEA 5HXMA 3UQNA 3TFCA 3SAZA 4R27A 3WLJA 4IPNB 2PTWA 3M0VA 1E6SM 4EQRA 3UXKA 1GGOA 3MI6A 2DH3A 3E96A 1XIDA 4B5VA 1AQ0A 1HKIA 1C8XA 4HJFA 1IEVA 4O1DA 1GZGA 4RDVA 3RIKA 3S9IA 1FY6A 4ZQRA 4F2BA 3CYJA 5FCZA 3KVJA 4DF0A 3BJSA 1V97A 1XYLA 2OEJA 1CXLA 4HSHA 4PBGA 3RM4A 3LG3A 4ADUA 3CEPA 3EAUA 1FWCC 2QIWA 3V0UA 4XKMA 3N3TA 2PDJA 2R1LA 2WANA 1UWIA 3R8HA 3HF3A 2YW3A 3GU2A 5M2FX 4TX9A 3WQOA 4ATWA 4CU7A 4MHBA 4QQ3A 2BVDA 1KXTA 2WMIA 5K9CA 3PANA 2NUYA 2W6RA 3N2MA 2OCZA 3R1ZA 2WSPA 2CETA 4RPQA 1IF2A 3S83A 1KRCC 2WLZA 1XP3A 3RNMA 1WZLA 4XIMA 4H8UA 3A47A 1J0JA 3G1SA 5AN7A 3OQEA 3O0KA 3PBGA 3CZJA 5LNWA 3PG8A 3H2EA 4QCFA 4CVUA 3MMDA 4KWWA 3M16A 3W7IA 3SCUA 4O8RA 1SPQA 2NUXA 1P0BA 1YDVA 2VP8A 4RZ6A 2BB0A 3C2EA 4AH7A 1ZUAX 3H53A 1W1TA 4J3VA 4GUHA 4YNGA 4PMJA 1W56A 1R2TA 1JCMP 3DGRA 4ACZB 2VENA 4Z08A 1XHGA 2B81A 4C6MA 1Y5VA 5GRTA 4PMYA 3W86A 3BLEA 1US3A 1UHVA 3I3DA 1BWCA 2VFFA 3RLHA 1KBLA 1W6TA 4GI4A 3GTNA 4C6OA 2E6AA 2HRWA 3ITXA 1WUEA 1ZDLA 4GO8A 2G5WA 3W22A 2DUZA 4XD6A 3LHYA 4NEWA 1W1VA 3WYZA 2HQMA 2QDGA 2CPUA 2YCKX 4W88A 4O4VA 1IIHA 3DECA 1E3ZA 4WSKA 1XC4A 1RA5A 3K1GA 4F8XA 1FWDC 1LT8A 3QZ6A 5AC8A 1JYVA 4JY9A 3DEQA 2X7VA 1JCLA 3LY0A 1DXLA 1X38A 3KRUA 2GDUA 4ATDA 3MMTA 4F2TA 4AX7A 1VFLA 1XIIA 3QLLA 1EUNA 3CTLA 5GJNA 4JQ1A 4AVNA 4ZQOA 3C0JA 4TX6A 3LQGA 4JTFA 4AZBA 3VDGA 3FYYA 3FXYA 4CNSA 2J24A 4GY7A 3TTQA 2V3FA 3GXIA 2DIEA 1DJXA 3VNKA 3KOWA 3II1A 1QOXA 1OCBA 4P7QA 3CZKA 3BQ6A 2V5JA 3EA3A 5ECVA 4AIUA 4H04A 3QZEA 3ETRB 1RR2A 5U1OA 1YX1A 4DXXA 3N73A 4RW5A 2NQHA 2C71A 2PDIA 2QJMA 2BFGA 1TR1A 2FHFA 2C1HA 3MBFA 3PTMA 4IMGA 1J12A 4DNHA 3KP0A 1XIFA 2A7PA 2WM1A 3D46A 1UD4A 4GR1A 5K9DA 2DQXA 4OUEA 1BTMA 4LVBA 3W1AA 3PB0A 3I7SA 1LPFA 4DZAA 3TN4A 4Q4QA 1UQYA 3M7SA 4CQBA 2ISSA 4LAUA 4PTDA 1XLGA 3UYCA 1TB3A 3SIMA 3P8JA 4IPJA 4LCRA 4GCXA 4DJDC 3VPLA 4FP1A 2Z7GA 4M5PA 4DY1A 5CC3A 2GVYA 3PUGA 1TMLA 1HIZA 2PWHA 1EDTA 4L4MA 1V7AA 4QFUA 2VX5A 3A4AA 2NVCA 2JF7A 1KXQA 3VU2A 2W0HA 4AZ5A 1VHCA 3NSNA 4M19A 2FZBA 3TW6A 3BCFA 2WO5A 2CFYA 3Q4DA 4TOQA 3B8UA 4ZOAA 3CH0A 4ORIA 3T42A 1ONWA 1RCXB 4M0XA 4QE5A 1YXYA 4JHMA 4JPGA 5DFAA 3A6OA 3P84A 4X9SA 2XIQA 3MDWA 4HMCA 1LUCB 2VZVA 2X0HA 4BS0A 3R94A 4PB4A 1UG6A 4MADA 3ENLA 3PZMA 4AUBA 4LAMA 2O9PA 4UNKA 3GTXA 1M65A 1F8MA 2AL1A 2QIIA 1AODA 2J4GA 3GC2A 3WDHA 1P7TB 1QUMA 4W9TA 3HV9A 3VNMA 3EDFA 4BV6A 4QS6A 1E71M 1W3HA 1XIHA 2YL8A 3MUY1 2G3FA 4B4FA 3DXIA 5CBJA 4P5UA 4LH8A 4UTKA 3KL0A 4OZOA 3EPOA 4GIEA 1Q6FA 4O1AA 2ZE3A 2WLYA 3TC7A 1XF0A 5JH2A 3NDYA 2ZX9A 5L6UA 1YDYA 2FH6A 3PJXA 1N82A 4OT7A 1Q6RA 2ZZ6A 3NRZB 3W3OA 2GQ3A 4PTNA 3WJWA 4WDUA 1CPUA 1OZQA 4L6DA 3KZPA 5LYRA 2OX1A 3CH9A 4FLSA 3WH6A 1UPPA 4LFYA 2W3SA 3LI1A 1V77A 4MJ2A 4FLQA 1ZFJA 3RRAA 4IGNA 1H09A 4N9CA 3JUGA 2Y5EA 3EPNA 3T1GA 2J13A 3P60A 2PDKA 5F1UA 2B7NA 2XH7A 3U7BA 4MWAB 4O11A 4F0KA 3IIXA 5A6LA 3NYDA 2BP1A 4R85A 1X1NA 4LB4A 1IT0A 2BBFA 1UKQA 2J7GA 3VCNA 1A3WA 5FAGA 3SADA 1L8PA 3NVTA 5D37A 2DZAA 3ERPA 3KFTA 3DH7A 3BZGA 2ZTKA 4P7RA 2YXGA 3WF2A 3NCOA 3TA6A 1GRAA 3WUBA 3RF9A 3KRBA 2EPLX 2QCFA 3M07A 2E8YA 2J9XA 4WJ8A 4FLOA 2DJLA 1DXIA 3U7VA 2CLOA 4IXXA 1ZP4A 4LS2A 1H3GA 4FALA 4ZE5A 3PFRA 2B4GA 4DM2A 4DXKA 1WDPA 2QS8A 2BHYA 4YIWA 5TIMA 1M5WA 5D33A 4I6KA 1BGAA 1IHIA 2D20A 3VNJA 2BOEX 1S1RA 3EDJA 4IMCA 2VUYA 1M6JA 1OY0A 1XRVA 4CD8A 4Y6GA 4YVVA 2IS7A 1SO3A 5A2AA 3EOSA 4MFDA 2A21A 2ACQA 3KP1A 4J5NA 3NQ6A 3W01A 3AU6A 2J7CA 1MEIA 1XCFA 3NQVA 2WJZA 2C3CA 3O05A 1R3VA 9XIAA 3P93A 3DH9A 1QOPA 3RCMA 1VB9A 1ENUA 2YBUA 4NL1A 4WKFA 4JQ9A 3VKDA 3IANA 1ML1A 3WMSA 1QO5A 5BCAA 4MWAA 4D6DA 4PUUA 2DZPA 1EP2A 1ZS2A 5DCBA 1DWHM 2AQWA 1NWUA 1CGVA 4DRSA 2XDFA 1VGAA 3CUXA 1JYNA 2UY2A 5CPMA 1S2WA 4L1GA 3TC6A 2RAGA 4H6QA 1NOWA 1KBKA 4GI9A 3R8GA 1KQYA 1EGZA 3JW7A 3SJ3A 1A50A 1W1B1 4PUWA 4CVWA 3WMBA 1XGDA 4AW7A 3SQMA 3HU7A 3UWYA 3NVYB 1ZK7A 1MZHA 3SRKA 4KWSA 4UC5A 2Q01A 1DIDA 4LS0A 1FECA 2HS6A 3WFZA 4LVDA 3KS6A 3OOQA 4NF7A 1XUUA 4GNKB 3NGJA 3AXMA 5FS6A 1ODZA 3QGAC 3TAOA 1N8FA 1EQPA 1JXJA 2OKTA 2V0TA 2GZXA 4F79A 2Y7EA 4PCTA 3DZ1A 2PA6A 3M1ZA 1GVEA 1XQLA 1KKRA 1GKPA 1MFUA 1WDRA 4NP7A 2PMQA 2QUUA 3IJ9A 3CUGA 1W3NA 3EWBX 2I57A 1CI1A 1FUYA 3HM7A 1K77A 4O13A 3GC5A 3AHXA 1EOMA 3PFMA 4Q7NA 3GHSA 4GKLA 2A3HA 3N15A 3K8LA 3WF3A 1YQZA 1K6WA 1TUXA 4FAMA 4YCOA 3K1DA 1T99A 1IE7C 4FR6A 1R5YA 3JRKA 3W72A 1CZ1A 4MNLA 3N4AA 2WJFA 2E6DA 3U8GA 2DT1A 4IFKB 1RQHA 4D1IA 4M24A 1A47A 5A8OA 4UFIA 3V1PA 1M68A 5MHBA 1RD5A 1XSKA 3QW4B 1XJBA 1EJSC 2YX0A 2ALDA 1K8ZA 3LMZA 1JPKA 3VIHA 1Q1RA 3LN3A 4AZIA 1O1HA 1GVFA 3BG3A 3N34A 5DY2A 1O7AA 3WMCA 1UMLA 1GONA 3GLCA 3GXMA 2UY3A 1PDYA 4MNKA 2I9EA 3IV3A 1D7YA 4H83A 1OJXA 2IQTA 3RO8A 1IEWA 3B40A 3C2YA 3V36A 3WBWA 3CAQA 1DOSA 3GK0A 2J8FA 1ONFA 4HN4A 4DWDA 1O5QA 3BPWA 4JD4A 3B0UX 3CUJA 4DJFA 3KRZA 4JR5A 2JFEX 5CXPA 7CGTA 2NUWA 1PWLA 1WBJA 2F6KA 1TV4A 5T9CE 2EAWA 1NELA 1FWAC 3KEHA 1VYRA 1WBHA 2O9RA 4TMCA 4JCLA 1VFMA 1HVQA 1Q8AA 3A13A 3BE7A 2WV8A 2EKGA 4XSMA 1HTIA 4IFKA 4QSFA 3DU0A 2DORA 5A94A 1DXEA 1JZ4A 4FB7A 2IKJA 2CLKA 4HU3A 5G1MA 3IIOA 2D0GA 1KCLA 1YE4A 2EPMX 2HE5A 4JICA 2HZGA 4QM1A 1ADOA 4GNVA 5D09A 3ABXA 3C2VA 1FFRA 3ZT7A 4HYVA 1HT6A 5IBXA 2G3IA 3H6OA 1PB0A 3AC0A 3N04A 2FGLA 3WQCA 5LHEA 1EBDA 2Y24A 3DG7A 4GC4A 5E0KA 5TBOA 2ZZBA 1HF6A 5FJJA 5EFFA 3MSDA 2Z25A 2XSBA 4S2CA 5JBFA 1H7OA 3K8KA 1QHPA 1Z44A 5ABHA 1HJQA 2ON3A 1G94A 1XBXA 4LYQA 3SN0A 2GFTA 2QMJA 1TMHA 5I5RA 3GNPA 3K2GA 3RILA 2OSWA 1H51A 5GQBA 4CNPA 3VOFA 4IIEA 1DQWA 1TPUA 1CYGA 1EJTC 3CPRA 4QLJA 3GHUA 2ZDSA 1LWJA 4ROQA 1FQ0A 3IGSA 2CERA 1B3YA 5CSRA 5FL1A 1V7YA 4FXSA 4LVAA 1WDWA 3G1RA 2BXVA 3BURA 2V9DA 4JKMA 1GV4A 4GRSA 5A6SA 2UV8G 1RD6A 2XTKA 4J7RA 1XLFA 2YSWA 4DO6A 3KL3A 3L0GA 3Q2DA 5AY7A 2VGGA 3A7AA 3MUXA 4JS3A 1OT1A 3H8AA 1LF1A 3GVGA 1C7TA 1VLIA 4IPIA 1BF6A 4ENLA 2VCBA 1W2VA 8RUCA 4WKHA 4JQAA 2WHKA 1SJAA 4LU0A 3UETA 3LYEA 4DHGA 4M6PA 4HP5A 1T5AA 3CAWA 3BICA 4U4MA 3VNLA 4D6JA 1MO9A 4HZ7A 1NSJA 3FY1A 5REQB 3PM6A 3K30A 4N4QA 3ZJ6A 2ZKMX 1UD2A 3L68A 2FB2A 3PBUA 5DEZA 3VGGA 3BAJA 3S2CA 1H11A 5HAOA 3T0TA 7A3HA 1NU5A 2XN0A 3HPAA 4YTUA 4PA8A 3GNXA 5LXEA 4QS5A 4LNYA 3LS9A 1AD4A 3QQ1A 1SFTA 4LCSA 2DSUA 3BUVA 3MHUA 4JTKA 4XUYA 3KBJA 1E73M 4DEFA 2WKLA 4CNTA 4GJJA 1P48A 4D6EA 4AD1A 5HPOA 2ZUUA 4AC1X 1H7NA 4FIRA 5BRBA 1F7BA 1RQEA 4H7CA 3O16A 1K4QA 2A7NA 2DQWA 5KINA 4GD0A 1V4YA 4R34A 3ORWA 4O53A 1JGMA 4U2ZA 1D9EA 2DDXA 1L6GA 3PBWA 3RDKA 3KBMA 4EANA 4E2OA 1DJHA 1S5NA 4NT0A 2JE8A 1Q2SA 1XLJA 3UG5A 1JD9A 1TYTA 1KCXA 3R6IA 1J01A 4CGTA 3TVAA 2WHLA 1KFCA 1RLCL 1S2TA 2J47A 3WEMA 2XVPA 3L4ZA 4MB5A 1GVYA 1AL8A 3MMWA 2WSQA 3SUTA 1ZENA 5JBDA 4Y9PA 4JTTA 1VQTA 5FD0A 4MM1A 3VDAA 3OLGA 3QJAA 4U31A 3Q65A 1V02E 1UROA 2MANA 3CUHA 5AHNA 1UCWA 2F6XA 3ONCA 4IHCA 1PZ3A 3O6AA 3AMCA 2DUAA 3TH6A 3MUCA 2OX4A 4TMBA 4PMQA 2E25A 2VCCA 5HK4A 4CEUC 2UY4A 5DXXA 1QHOA 2AAAA 1VHNA 5HMSA 1A5CA 2EQ9A 3PG6A 1UP0A 1OADA 3SY1A 1D3GA 3PAOA 4LCQA 4QNWA 3WELA 3D47A 3DFNA 3BH4A 1FDJA 2PGRA 1UZ1A 4DPQA 3RCNA 1W5MA 2R91A 4GJIA 2PGEA 5K2ZA 5A8QA 1UZDA 1JZ6A 1GRBA 4WJEA 1MEWA 2NQZA 1KTCA 3LRMA 3TW9A 1C9DA 1F4AA 2ACUA 3UT0A 5D04C 2PLCA 1FTXA 4ZFCA 3O9NA 3CZLA 3LMYA 3FHAA 1TV5A 1CNVA 4S3KA 3SRFA 5C70A 5CAKA 1EDQA 3SN4A 4LSBA 3F5LA 5F4XA 1B2YA 5DCDA 1ZAHA 1E6NA 3HGSA 1MO0A 4HOXA 3KVMA 1NWTA 3MMUA 1DJQA 3KHDA 3S5YA 5MKGB 1J0YA 1V6TA 1V6XA 4W89A 3AXIA 1J2BA 1YTKA 1N61C 2AAMA 4GISA 8TIMA 3EB4A 2NSOA 3H4GA 2Y70A 2J79A 5AECA 1TPC1 3N1AA 3VAVA 3H4XA 2CLPA 2A3CA 3N2BA 4H1ZA 5HNNA 3VKAA 3AMGA 3N9KA 3R89A 3GNOA 1PE1A 3POHA 2HMCA 4IG2B 4OECA 4B90A 2VEGA 1W1ZA 1BYBA 3G3DA 5JU6A 4IMFA 4CQAA 1E4LA 4MSSA 2XISA 4XV0A 1XKJA 4ZBCA 5CG7A 1ZAIA 1JQXA 2G3MA 4ZMGA 1KKOA 2E09A 3VMPA 1M9HA 1E1FA 1L6YA 1SZNA 4NAFA 4NJKA 1G1YA 3HBLA 2PEVA 3LERA 2NXHA 4UB9A 1IR1A 2ZDRA 4LB3A 4E2BA 4N0RA 1XYCA 1CWYA 1Z8AA 2X2YA 2F6UA 4DWSD 1IR2A 1Q4NX 3EWZA 3FLUA 1NWSA 2BXZA 5D05A 4Y7EA 3UJEA 2QULA 3LNMA 2DSKA 1N2VA 3MKCA 1WDSA 1JUBA 2BVWA 1VLWA 4JNZA 2W27A 1U83A 1EL3A 4GH1A 4P8XA 2GJXB 5MKGA 5D9PA 1GRFA 4UQAA 5FJPA 4AY7A 4I7VA 1N62C 1H6VA 4Q8PA 5C9WA 5CZJA 3CJPA 4ZOCA 2QXWA 3HG3A 1SR9A 4DI9A 3EXTA 1MSSA 1YBQA 3FW6A 4B9ZA 4GKTA 3DCPA 5D2XA 2OYLA 5EMYA 3H7VA 3VNYA 1LCOA 2BC0A 1GVRA 3W26A 2YDSA 4AIBA 1BXBA 3OHMB 4IG2A 1Q13A 1KV8A 5CGQA 5IM51 3PK7A 2YVGA 1E5NA 3W88A 1GQNA 3CWOX 3VKBA 5PTDA 1UWQA 2DT0A 1RH9A 4QG8A 2CHRA 3GUGA 2VDGA 2J88A 1AA1B 3BC9A 5CLTA 2OT0A 5FF4A 4AAJA 3A5FA 1W3LA 2D0FA 3TYEA 4XAGA 2EJAA 2A7RA 4YJ5A 1YXCA 2BY3A 4JTLA 1B3VA 1OBAA 1AOGA 2GUUA 1C90A 2A1YA 3TYCA 4GXPA 2BVTA 2E5CA 1LWHA 2CBVA 3VUSA 1J6PA 2GSEA 3CS2A 3D3AA 1J0IA 3QR3A 2ZUVA 3I68A 2PWEA 1T40A 1QU4A 2GJXA 2H9AB 4BQ2A 1MNSA 3E0FA 3KOFA 2WSRA 5AC4A 4R7OA 2H8ZA 4YMZA 2PWDA 3W73A 3KXQA 4JQ2A 4M51A 3OLEA 3I6EA 1EYEA 5HJXA 4YWOA 4C7DA 2V69A 1GEHA 3DGBA 4Z2IA 5D2TA 5E93A 2A5HA 3OLIA 4ZOBA 4YLWA 3W6LA 2H90A 4ML9A 4HNTA 1Q5MA 1K4GA 2REQB 3SI9A 4AB4A 4JX5A 4EKJA 3WQEA 2A6LA 1SJDA 5C7VA 1UH2A 1FWSA 2BNJA 2DFAA 5K9XA 3W7EA 2ODOA 3DHDA 3AAMA 4V1XA 3TJXA 1U5HA 3AIBA 2C19A 4KGJA 1KCKA 5G2HA 4Z1DA 1JI2A 1IEQA 2PDQA 3TSMA 3GH5A 1JPDX 4QDPA 1O95A 2I5GA 4QITA 5CC7A 2VEMA 4IFOA 2POTA 4JGDA 1EHAA 2TAAA 1DWAM 1F8IA 1E0VA 1HZYA 4M81A 3S6OA 1ADDA 4XZNX 1XLEA 5T9BG 5CPQA 3EWXA 2BY2A 4GQGA 2E0PA 1AQFA 1HVXA 3QTPA 4JL1A 1LJYA 3GB6A 3WNOA 1JDFA 3MA8A 1WYIA 3RITA 2ISDA 6REQB 3W37A 2CITA 3PR2A 2O55A 5CC6A 3WY1A 3URHA 3RGTA 1XISA 1GHRA 5I09A 3COTA 1J18A 4JTIA 3FYPA 2J27A 1OCNA 1SMDA 3HW2A 1EEXA 3MB9A 4MG4A 4D6GA 3DGZA 2ZXQA 3CL6A 1U5VA 2QYGA 4BEUA 2REQA 2BX7A 3B3DA 4DWSB 3E02A 5HR6A 1WXYA 1WE5A 3AJ7A 1H49A 5EMUA 3RR4A 4BCEA 1CLKA 2WWCA 3P5YA 1GQKA 4I9MA 3UZYA 3N3MA 2V3GA 3NL5A 3WJYA 2E28A 3GDRA 2DJXA 2WOVA 3KVKA 3WQGA 2FHCA 5LIKX 3WQ5A 2Y8UA 4W84A 2QKFA 2YCIX 3Q45A 1KFKA 3BJTA 2YDQA 3IC9A 4ZSTA 3DYOA 2WNNA 2V2HA 1GCYA 3B9OA 2OWCA 1FOBA 2JKPA 4RKAA 4ECLA 3RLUA 1WB0A 4OHQA 3ARSA 2YL6A 3TFXA 2X99A 2BC1A 4AIOA 3FJ6A 3EEGA 3VI2A 2FTPA 1AH3A 3WF4A 2X42A 4FHAA 4WJXA 4ERIA 3STGA 5I00A 4PMOA 8CGTA 1MUCA 3MANA 6REQA 1J0ZA 4HNNA 3MO7A 2P88A 1RBLA 3E2QA 4PH6A 1GZJA 1UC4A 4UTTC 4GZJA 5HUPA 1EOKA 1ZBVA 3EWDA 4X3ZA 4ZFMA 2Q09A 3F4DA 2D0HA 4KQNA 2WVVB 2VEPA 4C6BA 1TZ7A 5I3GA 3AXHA 4QLLA 4Y9AA 4MWAE 1V6VA 3WK3A 1TWIA 4BK9A 2Z6JA 4S3DA 1GW9A 4J4KA 3SQPA 4G5DA 3TNOA 1UASA 3H22A 3WD0A 1DV7A 2XVGA 4LYRA 5CPLA 2Z0IA 1RM6B 4BR1A 3GXFA 3EPMA 3QHOA 4LUIA 1OFAA 3ANUA 3G1FA 1HGYA 3UR2A 3M0YA 4PSPA 4O12A 4HA1A 1AUSL 2YA2A 1ZL1A 3OYXA 3B4UA 4UFMA 2VGBA 4DLMA 3BK0A 2TODA 3O6CA 4H8VA 1O68A 3CLWA 3GIPA 5AVHA 1FP8A 1WPCA 3WNKA 4EXQA 1EGMA 4TVWA 4L4PA 4FOUA 1E0XA 1H63A 1L6FA 3U4FA 1ITUA 1VJZA 4RE3A 4JQ4A 5FF2A 2I56A 4O1EA 1OFOA 1P6BA 3MPGA 3OC4A 1ICPA 3H2OA 3S2LA 3UR8A 5G5IA 4F0HA 2ANUA 3VCCA 1PEZA 1OYBA 3CXOA 2XWEA 3GXTA 3A5VA 3F5JA 3OG2A 1UC5A 2WVVA 1EA0A 2Z28A 4US5D 1Q3NA 1Y5WA 4WY0A 1G4SA 4L9YA 1X1OA 3VNZA 3EWWA 1J9YA 4Z1YA 3FJLA 4YHGA 2W66A 4NXKA 4HNLA 3EX4A 4DBSA 4GVFA 3FYOA 1M41A 1JCYA 2XIBA 3HURA 3VIIA 4MKVA 2XPKA 3NPVA 3TSDA 3L4YA 4EXAA 4GXMA 4RJEA 2ZICA 1Q7MA 3DBPA 2W5FA 1WYGA 5CPSA 1L6SA 1V3JA 2GJNA 3AZSA 3NO3A 4E3VA 1ADSA 3SCOA 1QATA 3INPA 4W7VA 2RJHA 5EBAA 2DW6A 2CNCA 4N9EA 4XBKA 1ZCCA 2J7HA 1REQA 3HGRA 3MO4A 4HTYA 2WM0A 4IUOA 5F4SA 3G3MA 4HZ8A 2GSHA 3MBDA 4I5XA 1X8CA 3KX6A 1FHUA 4AG0A 4YYFA 1P1XA 1XWYA 2PPGA 3SCWA 1A3HA 1OX4B 4IQLA 4GGBA 1YPIA 2TYSA 1QI5A 2WPCA 4QG6A 2NXIA 3W1NA 3Q37A 3ITGA 3BMVA 2GQ8A 1EIXA 3ITVA 3PBVA 3LUTA 1THFD 3TYBA 1KM6A 4JN8A 1ZSXA 4DNMA 1KW1A 1RK5A 1KRMA 1F2JA 4FF7A 1BKHA 1UOZA 2CZDA 2CWXA 1B4EA 5FJTA 2PDBA 2CHOA 1UWRA 3TYZA 1TRIA 3UVAA 4JTUA 4QBXA 3T0AA 3EXSA 2V5DA 4JY8A 1QTWA 2FFIA 4PZVA 3QMRA 2XVNA 1WDDA 4B16A 1TJPA 3Q94A 3LD5A 4QGCA 3CV1A 2MNRA 3EDEA 3OA5A 3IJIA 1JZ7A 3CM4A 3NQ2A 3VC6A 3S5SA 5A2BA 1V3KA 2FIQA 5FEWA 2WVSA 3GXPA 4V28A 2ZZ1A 3VDBA 4GCAA 2HBVA 2A85A 2WZTA 3DJJA 1UWTA 3P2VA 1VBGA 3EMCA 3MI3A 2BOFX 5HMDA 2EQ8A 1PX8A 1TZZA 4LOCA 1G69A 3IS4A 5JIWA 5FI8A 4HHLA 1MW1A 1JD7A 4GG9A 4JFTA 2VZSA 4RZ4A 2YB4A 4QIUA 1CGYA 1DORA 2Y0FA 4H4SA 1QI3A 3UNDA 3FGCB 4J27A 3UG4A 4E8GA 4PB5A 1VFHA 5DY3A 1BWKA 2X09A 1IZKA 3B05A 3EYPA 5FSDC 1TFVA 3EWUA 3GKAA 4APNA 3DN5A 1DWJM 4CLMA 4AIEA 2Z27A 3H7UA 4RE4A 3G8EA 4IICA 4RV8A 2C18A 2X2GA 3KWSA 4GIAA 1B3XA 1EH9A 3AALA 4NJJA 2J9YA 2RDTA 5LNUA 1OC7A 3HOJA 3UGRA 3WLIA 1EO7A 1UD5A 2R1KA 2DVUA 4X0VA 3W29A 1O12A 4G56A 3BQ5A 1EJXC 1TYGA 3A3XA 4JYEA 2Z1KA 4KH2A 1EZ2A 6TAAA 1FFQA 2QDDA 3G2GA 1QNRA 3TCSA 5F2LA 4HK5A 3T81A 1D7FA 2HJPA 4A8IA 4P8WA 2QQ6A 3O7UA 1GOQA 1LRTA 1XGEA 3BLLA 1NDZA 1EJVC 4HYRA 1R47A 4C6CA 4R88A 2J7BA 1H1YA 2WSYA 2V68A 5CSYA 2GUYA 4WD0A 2ZUTA 1V0KA 1NHQA 3UG3A 3QFWA 4V2XA 3F2DA 2YA1A 1J11A 3TX9A 2EPNA 2IPGA 4JAWA 2TPRA 1DXFA 1OG6A 1T7LA 4L7ZA 1JZ5A 1O4UA 3IUDA 4B15A 1TTPA 3OZMA 3QC0A 4Q8WA 4B91A 2YIHA 2OEMA 1MW0A 1DBTA 1CW2A 2IQ0A 2Z24A 3EX3A 1PXGA 2WMJA 1NH6A 3UWEA 4JIRA 4FSAA 3D3FA 4XKYB 1NP2A 4XSLA 3VIOA 2GJRA 3ES8A 2FZNA 2Q8LA 2JQXA 1P0NA 1TJ1A 1I2RA 2PDLA 4RE2A 2HEJA 2V3BA 3P81A 1UKTA 1XLBA 2R82A 4M56A 1PIFA 1RBOB 5CZSA 3QKZA 1PTAA 3SO7A 2C16A 3CASA 4RXFA 2DVXA 1ONEA 1VEOA 2D3LA 2BY0A 2HXUA 4YCPA 1PBGA 4PRRA 3CUFA 1KXHA 4X61A 5BXPA 4HPXA 4KMQA 3S1WA 2XVKA 4V1YA 4RV3A 1EWEA 1MI3A 4EK7A 2VMFA 1PIIA 4E0CA 1X96A 4BKNA 4E2VA 5LSMA 3N17A 5BNKA 2E3TA 4P61A 3GG7A 3I10A 5IRPA 1PKNA 2GGGA 1A5UA 2D24A 4GYFA 4NJGA 3OZPA 1KNWA 1H7RA 1XDLA 3LM3A 2GPTA 4E3TA 2D3NA 1CENA 1RBAA 5DLCA 1FWHC 3LLXA 1KR0A 3SFWA 1VDVA 5FACA 2XH2A 4QDWA 3G1DA 3WKZA 3BSHA 3W2JA 4CU8A 3ABSA 2DSZA 1A3XA 4J3XA 3IV8A 2WAGA 3IAPA 1QASA 2ZBTA 4XKYA 4NYUA 1XCWA 1EJRC 4Q7IA 4NAEA 1QK0A 2HVNA 1BSIA 3FNDA 1XR2A 3H2CA 3C86A 3MSRA 3SCSA 4PCSA 1SSGA 4TV6A 3AM9A 1KFLA 1RUSA 2VFHA 1O94A 3GIQA 1A5SA 3PZVA 4JYFA 4UTJA 2RGMA 3RU6A 4O4WA 5LIYX 1X39A 4AZCA 4AMCA 3CQHA 1WKEA 5XINA 1DJYA 2ZC8A 4Q4RA 1TWDA 3ALGA 1DIOA 3L4WA 4UQEA 1NEYA 2HBXA 4CCEA 4E8DA 1DPMA 3HQ1A 2A6NA 3DOPA 4EF9A 2G95A 3GVRA 2V38A 1K03A 2PF8A 3NDOA 3N19B 4DJED 4HK7A 3UA4A 3B06A 1R7AA 2O7SA 1FCQA 3DYMA 4JFWA 1UP2A 1KFWA 2Q3RA 5FJOA 4F0SA 3ITOA 1RP9A 3S1GA 3I65A 4ORMA 4RE0A 5IFTA 1BQCA 3U6WA 2ZZCA 1UB3A 4IM4A 2OQLA 3NQMA 3GD3A 1POJA 1GVSA 3OTRA 3HA1A 2ZA3A 5HNRA 3WL1A 4RZBA 4GJ1A 3DK8A 3NAVA 2PBOA 5J04A 2GGHA 4JFUA 3RMEA 3C0QA 1YW1A 1UKOA 1HL8A 3FG2P 1I2OA 1XYZA 5I0DA 1SZFA 1KFJA 1G9HA 1UKSA 2Z1XA 2ZYFA 4PUNA 1L2QA 2PGFA 1GESA 1K7XA 3LCIA 3H12A 1V0MA 3T78A 2O7QA 2Y2WA 3TJIA 4H9UA 2NV9A 4IIDA 5AYYA 4XO7A 4PCPA 4DF2A 1RLDA 4FDCB 2A2IA 5JCNA 4WX2A 3EF6A 2WCSA 3KCOA 3I6TA 1W91A 2GH5A 1ECEA 1RHCA 4ZO6A 3GVVA 1E9LA 2HQAA 2VX4A 5JH1A 4Q22A 4WSHA 4XZLX 1JULA 4Z1AA 5C71A 1EF2A 2Q8ZA 1OC5A 3LPGA 1B30A 3OB8A 1KA9F 1QNPA 1GNXA 4QNEA 4PL2A 3NFUA 1VENA 4QHRA 3SCRA 1OGGA 4KEUA 2JEPA 5HWJA 5H6HA 1OGSA 3BAXA 1IZCA 4OWGA 3BCJA 1QT1A 1GJWA 5DO8A 5KETA 1LRQA 1E6QM 3GU1A 2ZUNA 3L5MA 5BMXA 3QQWA 3LXDA 4ZB0A 1XIGA 2WZHA 2XFYA 3TAKA 4Y96A 4QTGA 1P0DA 1JYWA 1PYMA 1JI1A 4UFLA 3TNBA 4C1KA 4MOZA 3W2UA 3PZOA 1XICA 4XZHA 3UWVA 2NLIA 4NU7A 5FS7A 1EGVA 1KD0A 3AISA 3UA3A 3B0YA 4UNLA 4GGHA 3KZSA 4QISA 2X8CA 3T2QA 4FNRA 3S9ZA 2XN1A 1MW3A 2ZWYA 1Z42A 1ZJHA 3JR2A 3C5QA 1PX3A 3FVDA 4POCA 4L9ZA 3M5ZA 1DNCA 4LAKA 2FFCA 2YVJA 3PNZA 1GVOA 1B3OA 4QRNA 3KDOA 2NVAA 4FX6M 1S46A 4Z1CA 3F7JA 1F61A 2YKKA 3F4CA 4EMWA 5BWAA 2VO5A 1OEPA 2QZRA 3XIMA 3C8NA 4AXNA 1UD6A 2VURA 1MQRA 4DBWA 3W2LA 4IWWA 3CHVA 5E9XA 4FNSA 3W23A 4AXKA 3HN3A 1H1NA 4ZQCA 3TYDA 4FPSA 3HG4A 2D2JA 1RAKA 3W83A 3EAOA 3GDTA 2C1GA 3B4YA 3GQYA 1OFQA 4WOZA 1PAMA 1Q63A 4WHBA 2E8ZA 4FLRA 1H4PA 3PTQA 4UTFA 3R07C 4LA1A 3LCWA 3R0KA 1XYBA 3VGFA 3DFYA 4A8NA 2VZUA 3WLHA 4R7JA 3T09A 4UZSA 1OFBA 2YR1A 1BVNP 3VNDA 3RPDA 2PZNA 4UOJA 4KEZA 4JIIX 3ES7A 4H9YA 4J3UA 3AROA 4NI3A 4K7VA 1W5NA 2JGQA 5AHIA 4RDZA 2XYLA 3KWXA 2IXUA 5EA9A 3THAA 3A22A 4KCUA 4NHVA 1EFZA 1BQGA 4O16A 4EPEC 3CGBA 1K02A 4KEMA 3W82A 3HPFA 1Q2RA 2GVJA 5HATA 2V67A 1F3WA 3SEPA 1QNQA 3BO9A 1SQ7A 2XFWA 3W7HA 4I9AA 4G7EB 2RDWA 4JFSA 3ME3A 4W93A 4K1WA 3VGHA 2DT2A 3NZPA 3PAJA 4TR9A 1H5VA 4LT9A 3MKVA 1KM2A 2INZA 4W87A 1BZLA 3RN6A 1MRAA 1KBBA 2JEQA 3CMFA 1W54A 1JPIA 2E67A 3CT7A 1MMFA 3BCDA 3GYEA 2QDEA 2ZZ4A 3KBWA 4M82A 3VFLA 3CMJA 1CXIA 1H60A 4DJDA 3IWPA 1CB2A 3ARWA 1ZPTA 2PP3A 4LUYA 2Y4SA 4F4RA 2KZHA 3EKLA 5I77A 5XIAA 3GS6A 2IW0A 4QJ1A 1UYQA 4JTQA 3LCFA 3KLKA 3AXXA 3GH7A 3VMOA 3PJUA 3V4BA 3WDPP 5C2GA 1IGSA 1UJQA 3AMZA 5GVJA 1ITCA 4R53A 3B04A 1ZU8A 1NFPA 2NXGA 3QF0A 5I23A 1CXHA 2YYUA 4TQTA 4HOWA 2J75A 3TQ0A 4NNBA 2QUTA 5A6BA 2WBAA 5KZMA 3TXZA 3L4UA 5JXQA 4UMCA 1KGXA 4JTGA 4CN4A 1XANA 3CWNA 4M7TA 3NNTA 3L65A 1W1IE 4EP8C 1L2UA 1NDWA 4G7EA 1NVMA 3P0WA 2HTMA 3URNA 2CC0A 4H50A 3B0VC 3F4VA 1O5KA 4O57A 3DHFA 3S1UA 2RFGA 2HVMA 4LEFA 4M6QA 4TVCA 1VD6A 1QI2A 3PY2A 4OVXA 2J6XA 2PF0A 4UTMA 1M03A 3AMDA 3EWCA 5D9OA 2VJXA 2Y61A 2Q3OA 5I24A 2QNEA 4HU0A 2OGYA 3GBEA 2YYTA 1X7IA 4QEHA 3IK4A 3WQPA 2CLHA 3LSCA 5BOFA 3EWYA 3LM7A 4AHQA 2C3DA 4AD0A 4YTRA 2G3NA 3V0TA 1GORA 4RX0A 4B2DD 2V2DA 3PZTA 2AQOA 3MTWA 5D8WA 3VUPA 1XPGA 3OODA 5EBKA 2EG8A 1B9BA 1QCWA 1DQUA 1GYNA 4Q8UA 4L56A 3HPSA 1F05A 4MVAA 4NJHA 3S2JA 3GUWA 1QAPA 4MY1A 1ZKQA 4I8DA 1HJXA 3ABQA 3LADA 1ZY9A 1UUMA 3VOGA 1A0CA 3LCLA 1TPWA 3PBYA 1TIWA 1TRDA 1EX5A 2HROA 4K36A 3AHYA 1VCGA 1KTNA 2VRKA 3PWAA 4HU8A 3ZT6A 3CAKA 1M53A 1XQKA 1SO5A 2VOMA 2YFNA 2FZ8A 3VGDA 3ISIX 4IP7A 4NSBA 1RPKA 3RR1A 3TOPA 3LRKA 2EF9A 3AS1A 1O60A 4MDOA 1E6PA 1IWAA 3SJNA 4B5UA 3VO0A 2PDFA 3R0UA 1VP5A 4MUPA 3FJ4A 1UH3A 5EU9A 4ATLA 3IRDA 3VOCA 4GC3A 3R58A 2VT0A 2E9LA 4BA0A 2F61A 2HNEA 3M0LA 5TQLA 4JBRA 3A64A 1YTDA 3H4KA 5ENLA 1XYMA 5BU6A 2VFGA 3C52A 5J5DA 3VE9A 4DAFA 2DY3A 2FYMA 4DUVA 2EGZA 3B97A 1PPIA 3ID7A 2JF6A 3W9ZA 1EP3A 1A80A 3ATYA 3GHRA 4HIBA 1ZCOA 3AUJA 5BXTA 4IQJA 1QPKA 1K3UA 1V0LA 5BROA 3VZXA 1J93A 2QJGA 2UBPC 3B0PA 2Q8XA 3GO2A 1EEPA 4KERA 4TV5A 1JUKA 3Q67A 1JCNA 3WD4A 3VABA 1EO5A 4OUIA 2WCAA 1W32A 2EPOA 4MAVA 5C6MA 3QV9A 1XDIA 5BMWA 4YTQA 3VD3A 1CCWB 3WNNA 3OVQA 1VIZA 2YFOA 4IMAA 3UEQA 3ARVA 3WFLA 4LS1A 3TJ4A 1CLVA 4O28A 1Q8JA 4WCJA 1FP9A 4UMAA 1FKWA 1YADA 4Y9NA 3RRXA 1XBVA 3O15A 1GUVA 1GW1A 2G96A 3CC1A 1TJ0A 4HKPA 3NXLA 4PMZA 1LZOA 3TWBA 3LGGA 4W5ZA 3WENA 4PMXA 3R13A 1E56A 4IIGA 4KKXA 3CAVA 1LL4A 1D2KA 1LORA 2DEPA 3L5OA 3PJWA 5H8UA 2EG6A 3GRTA 1DL3A 2ABAA 4IGHA 2XZ9A 4KGLA 1NF7A 3CB3A 4DN1A 2D2OA 1TO3A 4HA4A 1OF8A 3BOFA 1T96A 1B5TA 1R9YA 5EMJA 5JCMA 2J77A 4CD7A 1J79A 3DC8A 2ZZ7A 3QPZA 3WG6A 3EMQA 3SURA 3O3RA 1XRSA 2PDWA 4IIFA 4YVXA 2RUSA 3C6CA 1S2VA 3I4EA 2VEIA 1OZMA 1VEMA 4P7OA 3W53A 1ZJAA 3A12A 3BAYA 3GZ3A 4CQDA 3VGEA 2VM8A 1TCDA 2OYKA 1E1EA 5G4EA 4UQCA 2CWNA 2OZ8A 1XIBA 3QFBA 1PX4A 3QW3A 3WFAA 4YXGA 1SFSA 1G6CA 1RCQA 1OF6A 2G97A 3UJFA 3FA5A 4P8UA 3T2PA 2PDHA 1OIMA 2FKPA 2XIJA 1NY1A 1VPXA 3LTPA 3MUZ1 3CO4A 3P3BA 3W76A 3GX9A 1VFTA 3NVZB 4KPLA 1I9CB 6TIMA 3MHFA 2WMIB 5AKQA 4EIVA 3GHTA 1VJIA 3UJ2A 1G0CA 1B31A 5L9FA 4WSJA 3WLMA 2WKGA 3QMTA 1GQIA 3N2TA 4OFCA 2NZLA 5C7HA 2OZ3A 1RXOB 3APGA 1E6XM 4C65A 1E0WA 3VINA 1ZHAA 3NM3A 1SB3B 4KFNA 2G4JA 2ZWZA 3VM5A 3A9BA 5C54A 1YEYA 4A8RA 3H23A 1ISYA 2VD9A 3W0KA 4Y8EA 4OBRA 1N5WC 2VDHA 3H70A 5DBUA 3TA9A 1R3YA 3CGEA 3QLDA 2ZTJA 3KOYA 4G7FA 3RPTA 1W9VA 2WPGA 3SCNA 5K7JA 2XU2A 1NDAA 4KT2A 4GVGA 2EQ6A 1MDRA 1OC6A 5GNYA 4MY9A 1E6ZA 3WJXA 4ZQMA 1S7MA 3AI0A 5FKYA 2P3ZA 4JL2A 3VDCA 1KM3A 4F0MA 3BV4A 3I3BA 2BGNE 3CQ0A 5HMEA 1HL2A 1Y8BA 3HB9A 4HJWA 2OVLA 4WIWA 3PZIA 3H7RA 1EX1A 3V18A 4Q4PA 1QW8A 2JIWA 1QPNA 2C3ZA 3FAWA 3VMNA 5HNTA 4Y2WA 2A3EA 1JCJA 4HCLA 3L21A 4LEQA 3LGEA 4PSRA 3G24A 3KS5A 1R3SA 1MEHA 4XD3A 2O9TA 4DZ5A 4JZ5A 3C2FA 3QV6A 4ZE4A 4D2JA 2ZX5A 4LC6A 1XW8A 3CT2A 2Y85A 2GOUA 3GNDA 5FOOA 2YDRA 1SW3A 4LUJA 3R25A 4ZGYA 1A5MC 4LVFA 3O8AA 2ZXDA 4BURA 2YOCA 3IGXA 1CGTA 1ME7A 4MJZA 4DYJA 3CUZA 1OCJA 4QCEA 3NURA 1M7JA 3AUOA 3EEZA 4S3GA 3DAQA 1R7OA 3C0SA 3MHGA 4XQ6A 1VRXA 3NS1B 4MF4A 4GUIA 3LB8A 5HWNA 1GQLA 4DXVA 4X0NA 1F4HA 4UTHA 4Y8FA 1S5MA 1FHLA 1J6OA 1ZXIC 1WZKA 2E1DA 2ZADA 3NPXA 3RXZA 4Z42C 3FEQA 2WPBA 4C90A 4CU6A 2XJ7A 3IGHX 1NDYA 4S3BA 3NPUA 5A2CA 4NEVA 2CCRA 4DIAA 4MLJA 3EGJA 3QRHA 4BJHA 2DZUA 1BG4A 2DVTA 1M7OA 4EX4A 1NF0A 3E1F1 3CGDA 4AWSA 3AJXA 5AHLA 3DGHA 2WNQA 5I3FA 5G2WA 4MWAD 2IKIA 5HPCA 3WBYA 2GK1A 4RDWA 1HG3A 3AS3A 3WF0A 5LGZA 3R2GA 4CCCA 3W7GA 3FKRA 4GUJA 1YPFA 4LF1A 5U4NA 4H4RA 4FXRA 4ZQNA 1JG9A 1UR8A 4IP5A 1F3EA 1J8VA 2Z2UA 1J2WA 4C1NB 1PL9A 1WUFA 4GQQA 3T9PA 4GH3A 4US6A 1PV8A 2NV2A 4YN5A 4JDRA 1SM9A 1KO0A 1K9DA 2I16A 2GJLA 3CXBA 3W1MA 3VOHA 3UVIA 5AYIA 4LIIA 1AZ1A 1JQVA 4EWND 3WEOA 2J78A 3BAKA 4D6FA 4HNUA 1IWBA 1UQZA 3PS7A 2GR2A 2VC7A 4IPLA 4CCDA 5CQ1A 1C93A 2NV1A 4Q33A 5TD4A 3A3WA 3UWUA 1VS1A 2W62A 1YNPA 3TTSA 4QROA 4BQ5A 3PUEA 5DX7A 2UY5A 4UUIA 1FWJC 4A2RA 4R5EA 1OM0A 3KW3A 1LG1A 1OHLA 2XGBA 2GGIA 1Q4WA 4DQWA 2RABA 1K7FA 1GREA 3W7RA 2OLHA 4UR9A 1U33A 3TONA 1BRLB 1ZJIA 2WZEA 3NQBA 2BV9A 2CLEA 2WB5A 1VYSX 2NQJA 3NR0A 2C1IA 4WDTA 3D6NA 4Y9MA 2ZRYA 1DWFM 3WEZA 3I7RA 5I3KA 2QHAA 1S2AA 2HK0A 4XG1A 5TAOA 1UP3A 4IMDA 4C1NA 4GUGA 1FHDA 3NOYA 3FV9A 4AF0A 3UZXA 4Q7BA 4WKAA 6CGTA 1P0EA 3M43A 1CGXA 4H4XA 2X1TA 1N60C 4FS9A 1PZ1A 1H5YA 1KFEA 3WNPA 1FCBA 4N7QA 1FWFC 1LWIA 1GEUA 5HOSA 1L6WA 4QE4A 1B3ZA 3FAXA 3FHQA 1ISXA 4HNVA 4GYJA 1H0GA 2TMDA 4R33A 1KC7A 4EXBA 4GBUA 4Q32A 1FCVA 1TX0A 1GPFA 3DG6A 1N55A 3DK4A 2X05A 1CGUA 3MCOA 3TE9A 4UNIA 5CG0A 1HJSA 5K4XA 4MKNA 4K68A 2PDNA 4AZ6A 1I6NA 1WZAA 5AHFA 2XM1A 2PDUA 3AICA 4AZ7A 2WP5A 4B5NA 2BWGA 4L9XA 2GQAA 5C2XA 2WHMA 1YTEA 4DJFD 3W7KA 1BRLA 4FO4A 4LNCA 3GG8A 3G6MA 4OE7A 4XVEA 3V1HA 1RP8A 1Q6EA 3WK0A 2QR6A 3ZJ8A 4CUCA 3EX2A 1VPYA 2FQIA 1S2CA 3MY9A 1I2QA 4UZUA 1QR7A 4IJBA 3AHVA 1NAL1 4ML4A 5I79A 2V6OA 3BGAA 3MT1A 4G6CA 1EXPA 3NL6A 1G7VA 1DHPA 1B9ZA 1ODUA 3QFAA 1XDMA 5D38A 3U3HA 3GVWA 4FOKA 1M3UA 5DXYA 2F9RA 4K38A 1X97A 3EOUA 3REQB 2B7PA 4ZXLA 1XRFA 1QFEA 1VCVA 3WLPA 3BLPX 7PTDA 1XL9A 1UUQA 2R94A 4BQ4A 2PCQA 1NHRA 5EFDA 4C1LA 1PJ9A 3NQAA 3GSMA 2VC5A 4E5TA 1A49A 3E0IA 3R43A 5ABTA 3FN9A 2QMKA 3ABZA 3W24A 3UWWA 3W1PA 3W4RA 1OQFA 2CZEA 4GZEA 3LPOA 4JN7A 4H4QA 3A4XA 1Y7VA 1S5VA 4HU4A 3EOOA 1ZX9A 1EYWA 1FBAA 3W7JA 3BMWA 3WDJA 1KGWA 4RPPA 3BDKA 4CNOA 5AVNA 3APTA 4AWTA 1V93A 3URQA 4BF7A 1T3QC 1WKDA 3QPYA 1EF3A 2VFIA 4IMEA 3LTYA 3NSXA 3U9IA 4DUWA 1SO6A 5LXXA 4KWVA 2QUVA 3FDKA 3KHJA 4S23A 1NHSA 2ZRWA 3NQGA 3M44A 1FFUC 4YU1A 3S2NA 1EC7A 3HRDC 2OSYA 1UW9A 3KDNA 4HPGA 2ZRXA 4PODA 3LBCA 1A0EA 1VZWA 3W27A 1WOBA 3VXGA 3KCLA 3REQA 3CL7A 4A29A 2XIOA 5D8ZA 1Q7QA 3UXLA 3CL8A 4L6HA 4YTTA 1OFDA 1BPLB 2P5NA 3AHTA 2NQ9A 4JIEA 3ARPA 5JBEA 1OD0A 4KFPA 5FJIA 1R30A 2VQUA 1GZ1A 3PNUA 4A3HA 1AMKA 3MP5A 4M52A 4AHPA 2QAEA 1W3JA 2G4FA 4N4PA 3PTKA 3TK7A 3CLMA 4MGGA 3SUWA 3FA3A 1ZB5A 3G22A 1V6UA 5G5GB 3AMKA 4I5RA 2OLAA 3RMJA 3E6EA 5FJRA 4IQDA 8XIAA 1OSEA 1WXJA 3TUUA 3LDVA 3L2LA 2W79A 4LAOA 3JZUA 2BODX 3ZJKA 3PVFA 2QGYA 4DWSC 3STPA 3S42A 3UBPC 1TVNA 3KTXA 1P4CA 1VKFA 4ZQPA 2H8XA 4H4VA 2FPTA 3WNLA 7XIMA 2PB1A 2D23A 1LP6A 1O1ZA 4E4FA 1EIBA 3QKEA 2VHLA 4GLEA 3W7DA 3FA4A 3IIVA 3CQIA 1PTGA 4IGMA 1E4NA 1LT7A 1P43A 3R10A 3URBA 3SGGA 1KRAC 2XGZA 1TJRA 3LV5A 4QSHA 1LBFA 2JGYA 3DUGA 5D2YA 3SIZA 2PFHA 2GWNA 3QR1A 5D32A 4NRSA 3RCYA 4N42A 5FESA 3OHIA 1LQ0A 1QPRA 1SFJA 5IDZA 4KIRA 4MTVA 1TTQA 4TX8A 3CQKA 4HHMA 4LV9A 3OBKA 6A3HA 1UJPA 4AVOA 5ABGA 4H9ZA 3ANVA 2G37A 1XKYA 3HGOA 1R9ZA 4L5ZA 4PYSA 4XD4A 4EVZA 4GUFA 3RFAA 2ZCGA 4GI6A 2QVNA 3OG3A 5A5WA 3RO6A 2Y6ZA 4K7ZA 2GOKA 3AS0A 2PODA 3NQCA 2BOGX 3JVAA 4O0QA 1AH4A 3KLJA 1U2YA 1XRTA 3N2OA 4GYPC 1NQ6A 1O5RA 2G0WA 1RJRA 3H4WA 3GRIA 1V3HA 3WDRA 1SUXA 4N6EA 1QW9A 4FNPA 1P6WA 1D3HA 3V75A 4KW2A 4URIA 3EKGA 4NZ1A 3P61A 4B4HA 1LLOA 3NZGA 1FA2A 3CYVA 2FDMA 2O4QA 2VXNA 2X8RA 2J62A 2EO7A 2WVTA 3OVGA 2R9ZA 1A5LC 4DJEA 3NL2A 1HP5A 2CLLA 4JEJA 1J10A 1PVNA 5AC7A 4BI5A 3BLDA 3N6JA 3IIPA 3FJNA 1MXDA 1H0IA 1JCXA 3H24A 3G1XA 4YHEA 4ZO8A 3ZLGA 1BVWA 3S9YA 3SZ8A 5AHEA 2WNWA 3WMLA 1GRHA 4MMWA 1R2RA 4I6VA 3TQPA 4W7WA 2EG7A 4CN6A 1BWVA 4ICNA 2EHHA 5D4YA 4F3HA 2VYOA 4I5UA 2ISVA 5CEWA 4W86A 3O6YX 5J8LA 4ZVJA 2DU2A 4R3UA 3UY8A 4LX4A 1DVJA 4JCMA 1MRQA 2J25A 4PCNA 3N14A 1NTHA 3GU9A 3S5NA 3OW1A 1YLVA 5HULA 4CQCA 1ZJBA 4RZ5A 2V8ZA 1ICQA 4QJ4B 1NP0A 2CLMA 3DG3A 4GZ7A 4BF5A 5KITA 3ZQ9A 1WAWA 3GDKA 4UTTA 1PYFA 3VZZA 3JZEA 4ADSA 3FK4A 1SR0A 2YZRA 3SGZA 2IUZA 3W2MA 4K39A 3G77A 1N7KA 1A5BA 2V5CA 5AYBA 4ZO7A 1XH2A 4X63A 1ISWA 1WAUA 1NDVA 3AHZA 3T6CA 3MJMA 4EACA 4GABA 2E6YA 2CLIA 4O1BA 5I7GA 2QJIA 5G2IA 3W7PA 4GY0A 2YAUA 2YCLA 3IIZA 5AYZA 3CU2A 2F7FA 4S3AA 4H19A 3H54A 2Z29A 1GKQA 2CIPA 2ZA2A 2VNCA 3KOZA 4BWLC 4HK6A 5ABFA 3EMZA 1KM4A 4JNYA 4IIBA 2HNHA 5CAHA 1J4EA 1DJGA 6ENLA 3KLLA 5DRIA 2XH4A 4MZYA 1TWSA 1J0KA 3AYSA 3CO8A 3C2OA 3UJSA 2GQWA 4QAIA 4N02A 3EOEA 4X60A 4F9DA 3TP4A 3LPFA 1GTEA 1XLKA 2YXXA 1KR1A 2W67A 1FIQB 1PUDA 1UPMB 3OJGA 3W81A 1AK5A 2PDCA 4O0ZA 4LGXA 3UR5A 2PP1A 1BD0A 1POKA 2W0UA 3SY8A 2AAQA 3ZVIA 3G6LA 3ZYZA 1ZY8A 1QNOA 3TXVA 5EPDA 4C6LA 2FVKA 4C60A 1AFSA 2ZZ0A 1EA9C 3XINA 3AFBA 1K8XA 1JEZA 3NWRA 1CDGA 4MAZA 3URAA 1ZMCA 1OD8A 1JDAA 1W9DM 5C2CA 3S6TA 4AX6A 1HN1A 4G9PA 1E0TA 1I2PA 2ZOXA 4DUXA 4IJCA 2A0NA 3TR9A 4R9OA 1PDZA 1T8XA 1UR1A 5EGRA 3ZIZA 1JZ8A 3BLIA 3V5CA 2PS2A 4ZZ9A 4PTXA 3W70A 4JTRA 3WNMA 4ROPA 3G1HA 4ERGA 2WPEA 1YKWA 4Q8TA 5LKYA 2CESA 4MIMA 1SZEA 3UPBA 4W4QA 1XLHA 3JU2A 2XZ7A 1A5OC 2YPIA 2PWFA 3OA3A 1V5XA 4I8YA 3F2BA 3HPZA 1ZRQA 1GG1A 1ME8A 1WA3A 4Q8OA 4L6OA 4BFAA 5DMMA 1DYSA 3RLVA 4GX8A 4B9YA 3VD4A 2B7QA 1H2IA 1OVDA 1XD0A 3A9IA 4AYGA 1JPHA 4YVPA 5M17A 3IRSA 2OO6A 4IZGA 3R7MA 4M7SA 3VX1A 4LXFA 2J7DA 3FDGA 2BS9A 4Z2JA 1ZZMA 2OOFA 4Q8NA 3ITTA 2RH9A 4HHHA 4KS0A 1XHCA 2V3AA 2YL9A 1QI0A 4F0LA 5IDIA 1TWWA 1FCUA 4U28A 5JUVA 1R3RA 3QV7A 1JRPA 3GTFA 5K3VA 1RSCA 2XM2A 2ZVRA 2PURA 3G0UA 3UPMA 3HQNA 3MZNA 1MUWA 1CGWA 3PZGA 4R7WA 1C8QA 1QW7A 3GDLA 3BOXA 4TTUA 3M9YA 4O15A 1JRBA 2EPKX 3W7QA 5EBUA 3VILA 3VZYA 1GVIA 1X98A 2HDJA 3WD3A 1Q45A 3KE0A 4UQDA 3CUIA 1NJJA 2I7GA 4C6DA 1F3XA 5DRCA 5KZDA 3SR7A 2TSYA 4L61A 3AYTA 3ELFA 1RVGA 1JGIA 3WIJA 4FNTA 1AJ2A 2W9MA 2J3NA 1KTBA 4UQ9A 3TR2A 4JX4A 5XIMA 2WC7A 1VCFA 5H8PA 3LHVA 3PWIA 4NQ1A 3L9CA 3NO1A 2F8QA 3QQ0A 1Z7AA 4ZB5A 1QJWA 1YRRA 2Y7FA 4NX5A 1QVBA 1V03A 2C8NA 2RJGA 3R79A 4D6CA 4MJ4A 2TRSA 1STZA 3BXWA 4OBTA 5FEPA 4O19A 3ICJA 1NWRA 3TW7A 2YGYA 3B8DA 3QFEA 4GX9A 4ZTXA 3N12A 5C9RA 3QYQA 4XAYA 1E43A 2YCJA