4DX3A

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
400
structure length
360
Chain Sequence
MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue
rcsb
source organism Agrobacterium tumefaciens
total genus 126
structure length 360
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dx3A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dx3A01
2QJMA 3RCYA 3EEZA 3TQPA 1PDZA 3RRAA 3MY9A 3GC2A 3ZVIA 4GISA 2ONEA 3V4BA 4JN8A 2OFJA 3RR1A 1SJBA 2OKTA 2QJJA 1OEPA 2OVLA 2P0IA 4MGGA 4E5TA 3CXOA 3CAWA 4IL0A 3MKCA 2OQHA 3R25A 3SN0A 2RDXA 3IJLA 2ZC8A 1KKRA 3KUMA 2GDQA 3TWBA 2P8BA 4JHMA 1EBHA 3UCCA 3FVDA 3SSZA 2I5QA 3ZVHA 2DW7A 3PK7A 3V5CA 3DGBA 3GY1A 3I6EA 4HCDA 2P88A 4A3RA 2PU1A 3IJQA 2MNRA 1WUFA 2GGIA 2OZ3A 3DG3A 2PP1A 2PTWA 3H12A 2FYMA 4GGHA 3EKGA 1KCZA 3JW7A 4H83A 3TJIA 3GD6A 2OX4A 4HPNA 2PSNA 4A6GA 3DERA 1EC9A 2MUCA 3SBFA 3VC5A 5FJUA 4E6MA 3I6TA 4Z1YA 4KWSA 2PCEA 4E8GA 3STPA 4ROPA 2QGYA 3OTRA 2PU0A 3SJNA 1E9IA 1MUCA 2AL1A 1BQGA 2PTXA 3H8AA 1ECQA 2FKPA 2OZ8A 4GFIA 2HNEA 3ZLGA 3I4KA 2PS2A 5FJOA 3UXKA 3N6HA 4GYPC 5IDZA 4X2PA 3T4WA 3VA8A 4IZGA 4K2SA 2XGZA 2GGHA 3R0KA 4DN1A 1L8PA 1ONEA 3H70A 3ZLHA 3UXLA 4K8GA 2QVHA 2DW6A 1FHVA 4Z17A 1P48A 3BOXA 3TOYA 3MSYA 3FYYA 4IP5A 1KKOA 4HNCA 4H1ZA 1R6WA 3UJ2A 2PTZA 4IL2A 2ZADA 3CYJA 4F4RA 2GGEA 3DFYA 3DEQA 1NU5A 1ELSA 3D46A 3DFHA 2GGJA 3FXGA 3QKEA 7ENLA 3T9PA 1NELA 4IT1A 1SJDA 1JPDX 2XH2A 3H7VA 3ES7A 4KPLA 2XSXA 3VCNA 3UJRA 3P93A 3VC6A 4GGBA 3UJEA 2GSHA 4DX3A 3BSMA 2AKMA 3QLDA 3QTPA 3BJSA 4J1OA 3UJFA 1XS2A 1SJAA 3U9IA 2P3ZA 3FV9A 4G8TA 2QJNA 3T6CA 2AKZA 3V3WA 1IYXA 4GIRA 1MDRA 3U4FA 3Q4DA 3CB3A 1SJCA 4YWSA 4DYEA 2QDEA 1EC8A 3DG6A 3MWCA 3R11A 3CK5A 3FJ4A 5ENLA 2PP3A 3NFUA 2PGEA 3N4EA 3DESA 3UCDA 1YEYA 4GMEA 3P0WA 3PWIA 5EU9A 3RITA 3R1ZA 2POZA 2O56A 1JDFA 3TTEA 3OP2A 1TKKA 2HXTA 3QPEA 1KD0A 4G7FA 4EWJA 2OPJA 5J04A 1JCTA 2OZTA 4H19A 2PODA 1TE6A 3GO2A 3THUA 4HNLA 3D47A 1MRAA 2OG9A 3Q45A 4KT2A 2PGWA 1W6TA 4M0XA 4IP4A 1MDLA 1RVKA 4FI4A 3RGTA 3DDMA 3S5SA 2OLAA 3N6JA 2QDDA 4ZCWA 3JVAA 2GL5A 3VDGA 3UJSA 3N4FA 3ES8A 4J3ZA 3NXLA 3ENLA 3MQTA 3RO6A 3HPFA 5FJPA 3NZGA 6ENLA 3R0UA 2XH0A 3ZVHB 3TCSA 4E4FA 4KEMA 3TWAA 2PMQA 4ZA0A 2HXUA 4DWDA 3K1GA 3JZUA 3DIPA 4E4UA 4JN7A 3DG7A 3MZNA 2GGGA 1MNSA 1TZZA 4GYPA 1JPMA 2P8CA 3PFRA 1PDYA 3OZYA 4HN8A 1EBGA 3OW1A 2CHRA 1DTNA 2OQYA 5BOFA 2QQ6A 1WUEA 3QN3A 2PPGA 3V5FA 1BKHA 3ZLFA 3T8QA 2XH7A 4HCLA 3R10A 3UGVA 2XH4A 4HYRA 2HZGA 3OZMA 3PWGA 4DHGA 4IHCA 4A35A 5FJRA 4FP1A 4MMWA 2NQLA 3CT2A 3VFCA 2PP0A 1FHUA 3SN1A 3FCPA 3VCCA 3IJIA 4ENLA 3SN4A 4K1WA 5FJTA 5BOEA 3B97A 3TW9A 2AL2B 1EC7A 1XPYA 3TJ4A 3P3BA 3OPSA 4M6UA 1P43A 2PTYA 3IK4A 4HCHA 2PA6A 4H2HA 3MUCA 2AL2A 1F9CA 4MKSA 2OO6A 3SQSA 3NO1A 3S47A 4DXKA 1R0MA
chains in the Genus database with same CATH superfamily
4PMJA 1I9CB 4Q33A 4PMQA 4DO7A 3MBFA 1GZJA 3S83A 3GTXA 4KRTA 2OYMA 3PNZA 1H49A 1LRNA 3G1DA 4UTFA 4A3QA 2HBVA 2HTMA 5CLTA 5T26A 2G4FA 2ONEA 1JYVA 1TMLA 3HG4A 5I3HA 3VDAA 2VD9A 3DI1A 4AY1A 2OWXA 4HVXA 1GREA 4E0CA 2QEZA 3MKCA 3W02A 1YNYA 3FHQA 3WH6A 2AAQA 5HJYA 3AMGA 3L21A 3PTMA 3TOPA 1J0YA 3RFAA 2E0PA 4GVIA 3FGCB 3LK6A 2PCQA 2FMOA 3SFKA 2DJXA 4HCDA 5CJ5A 2FVLA 3LERA 1FP8A 1KXQA 2BG5A 2WPCA 1PTDA 1XLIA 1C8VA 3UYCA 4S3DA 1EOMA 3COTA 4GJJA 2KX9A 3ZSSA 1XBXA 2FTWA 1XD0A 4LS1A 5C9ZA 1AQHA 4IH3A 3GVVA 3QKZA 4O0KA 3I3BA 1PZ1A 4PR4A 3BLIA 4Z2GA 1DEDA 1JULA 5BU6A 5HBFA 2XVKA 4IIDA 1LLOA 1BRLA 2XIQA 1ONFA 1ITXA 4AF0A 4CKQA 4S2BA 4HU0A 3LLFA 1SO4A 2VCBA 3ITGA 4LPCA 1QOQA 5K9XA 1Z7AA 5BNKA 2HVNA 5A3HA 3CWNA 2F7FA 4W89A 4GIYA 3RMJA 1GERA 3A12A 3HW2A 3VNLA 1QPQA 4HK6A 4H00A 1XLLA 1OY0A 5FEWA 5FSDC 4DJDC 3RM8A 2YBVA 3N25A 4FNSA 4PULA 3IUIA 2F9RA 1BF6A 3C0LA 4R3UA 3M7WA 4RDZA 1VZWA 4MLRA 4P61A 4NZ5A 2V30A 4UTWC 2ZIDA 1TZ7A 2DH2A 2GWNA 5RUBA 4AYGA 2FJKA 1OFBA 4FXRA 3TOYA 4FLRA 1V08A 2Z1WA 6PTDA 3TLLA 1K9FA 2V5DA 2WZTA 4HNCA 4UUIA 2NUXA 3S1VA 4MYAA 1BXNA 2YDAA 1ZZMA 3AYRA 1HO1A 2ADAA 4IL2A 2ZUSA 3ALFA 3VMNA 4GOAA 2C16A 3UU0A 1ZX9A 2Z26A 3P82A 2HEJA 3AS3A 3FXGA 1BYCA 3A9BA 1E1FA 5G2WA 3IPWA 3V7PA 4ILSA 2D2HA 1NELA 3VOHA 2DZWA 2ZC1A 2EG6A 3QZAA 4A05A 3T81A 1RP8A 1J18A 2ISSA 4CCCA 3CAKA 3AXIA 1Z6KA 1VCFA 3MJMA 3B8DA 2GSHA 3OEXA 1C9DA 1TPVA 3T55A 2VI0A 4I5RA 4B3KA 4HMEA 4LTSA 3QV8A 5B7YA 2ZQ0A 1BVWA 5CJMA 3I7SA 1XBVA 2H3DA 3G24A 1LG2A 3EANA 3MW7A 4HA3A 2PWGA 4W84A 1S3HA 3LXCA 1SJCA 2WANA 1PHQA 3KBJA 3WBYA 2YLAA 1G94A 1VYSX 3N17A 3UZWA 4JIIX 4RV3A 2Q09A 4O8AA 3R8HA 2W79A 3S2NA 4RX0A 4ADTA 2RHGA 1RV8A 3PWIA 3WG6A 4KCWA 4BCEA 5CZ0A 3W29A 3BLLA 2CZDA 3EDJA 2QCNA 2ZXDA 4DF0A 4G7FA 4UFJA 2CNCA 1WXZA 5CGTA 3OBAA 4ERIA 2PODA 1ISYA 1DQXA 3LXDA 5DCEA 1KM6A 3GVWA 4ZVJA 4RW5A 4B15A 4AUBA 4KH2A 2PGWA 1NTHA 2Y8VA 4E8DA 2Z28A 1KWGA 3K13A 3ITVA 2FFIA 4QDPA 1VCGA 4PH6A 4E2BA 1KFEA 2YXOA 4GKLA 4H9YA 3DOPA 2CLLA 3CLMA 4Q4MA 2CZEA 1CXHA 1BSLA 1QR7A 3IJ9A 2G4JA 3WNKA 1AUSL 3NS1B 4GYFA 1K9TA 4PMRA 3GG8A 3N12A 3NZGA 5D38A 1KV8A 3BXWA 1KCXA 2Y85A 4EAMA 3DAQA 1LORA 4BKNA 3K1GA 1GONA 3PG6A 3CUHA 3WJWA 1BGAA 2F6KA 4AZ6A 3PM6A 4FR6A 4FO4A 3QRHA 2Z1VA 1JPMA 2QF7A 3AS0A 3BAWA 1JCNA 3MYPA 4PN2A 2I14A 4X22A 1CGTA 2FH6A 4FX9A 1V6VA 1OYBA 1JL8A 1DPMA 4UTWA 2IQ0A 4PTWA 2Q71A 3F03K 1F74A 4UFMA 1MOKA 5BXTA 1Q6RA 3MO4A 4PTMA 1GVSA 3H2CA 3NO5A 1KR0A 4FSAA 1LL6A 5FEZA 4KWUA 1KB3A 4A35A 1PZ0A 1K7EA 3L4YA 3VIOA 2VENA 1XYFA 4JTUA 3G1SA 3VO0A 5D8WA 4Q32A 3S9IA 4QDWA 3W7KA 1F3EA 1DIKA 2VRJA 3ARSA 3NXFA 2G37A 1V51A 4DBSA 3W1XA 4EE9A 3ZO9A 4R85A 2G3MA 1OF6A 4IFOA 3WDQA 1JDCA 5E09A 1AH4A 2O9TA 5CC7A 4C6FA 2NVKX 1E6RA 1HX0A 2XZ7A 3GG0A 3KAOA 3OU8A 4MTVA 5D03A 1XBYA 2QKFA 4H4WA 1VENA 4ZTXA 4ADWA 1IGSA 1XIBA 3BLDA 5EBAA 2ICSA 1QI5A 5TAOA 3NG3A 3VKAA 1YDVA 1K6AA 2YKKA 3W1NA 1N61C 5IDIA 4S3KA 4WVXA 3PFMA 4PMVA 3HF3A 3GAKA 3UG5A 3W7HA 4AMAA 4C5ZA 1FOBA 1T6MA 2POTA 4XIMA 3E74A 3PANA 1IT0A 3SN0A 3UD6A 1XCWA 4H8NA 3GXTA 3JS3A 2JF6A 3N1AA 2VOTA 3SR6B 4M1RA 3A3HA 4MJ2A 1B5TA 2EQDA 1G4SA 2YOCA 4H9VA 4YVVA 4P8UA 3ZVHA 1FKXA 1S2TA 3POHA 3PPHA 1DJWA 3H2EA 3OA3A 2BMBA 1WUFA 5HQLA 2QV5A 5GQBA 1E1CA 5BXSA 2R1MA 1KCZA 1SGJA 1THFD 3LHZA 2XVNA 1REQB 1CXKA 1NWSA 4HSNA 1BG4A 3TA6A 3U7VA 5HATA 3NURA 3A7RA 4HN4A 1KRMA 3F4NA 1TELA 1O60A 4O52A 1JD9A 4X9SA 4BI5A 4C6LA 2GJXA 1W5QA 4U10A 3W7OA 1ZY8A 1OFOA 3CV6A 3KW3A 4KW2A 2X09A 4NIRA 4GFIA 3BW2A 1P6CA 3KBSA 1BZLA 1BAGA 3IAPA 3BCFA 5DF0A 4EIVA 3MDUA 4RZ6A 4XO6A 3VA8A 4A8RA 2QT3A 2VEFA 3QM3A 1XYLA 5DANA 3UXLA 2QVHA 5FMHA 1R2RA 2J7HA 2EEXA 4MNLA 3WFAA 4G7EA 4LBSA 3GXMA 1LYXA 4ERGA 1TMHA 1V02A 1LL4A 3GU2A 5HPCA 3TZFA 1E6XM 3N19B 1QPNA 4HYWA 1EH9A 2PDJA 3LV6A 3TYDA 1I2PA 4HBKA 3C0QA 1NDWA 4W85A 1AW2A 1DWJM 2REQB 4EXAA 3FG2P 1TA3B 4LH8A 4DUWA 2WVSA 5DCDA 3SI9A 2Z4GA 4B5VA 2QUMA 2HWGA 5A2AA 5BRPA 3BJFA 4GIEA 2BY2A 4DJFC 3O9NA 2VVSA 3ZOAA 2C19A 3ABZA 4WY0B 1FWCC 3HGJA 3POCA 4AWTA 5DY3A 3M0YA 2AKMA 2P5NA 3EDFA 5I5RA 4PFMA 5K2ZA 5G1YA 4UR7A 4C91A 2Y24A 1H2JA 1WXYA 2WZHA 5FEXA 1QI4A 2PB1A 2VR5A 2W67A 1BVZA 1DJXA 3LHUA 4ADUA 2YSWA 2A85A 3Q4DA 1Z69A 3IIVA 4CN1A 1RAKA 3WYZA 4DYEA 4N9EA 1QUMA 1E0WA 3R11A 4LANA 3MB9A 4S2CA 1JEZA 2EG8A 1N62C 3WLPA 1EJ7L 2XISA 4JDBA 3UCDA 1DE6A 1HJSA 1XG3A 1NFPA 5ABHA 4JTTA 2WNNA 4I8DA 2WMFA 1CB2A 3P14A 4HNLA 1D9EA 3PUEA 2Q01A 4MHBA 4ZGYA 1TG7A 3S1WA 4J3XA 5GJMA 5D04C 3EA2A 4BQ2A 2VEPA 4WSJA 1V3HA 3U2EA 2WSKA 3WFLA 1R30A 3WELA 3H54A 1N5XA 3VDGA 3M44A 3W27A 3ES8A 4BV6A 3W53A 1JPKA 4LW7A 3RDKA 2V5LA 1NDVA 6ENLA 3MMDA 3CQIA 3G0UA 4TX8A 4K7ZA 4EVZA 2C0HA 4TOQA 2D23A 1KLZA 3WK0A 1RXOB 4YTTA 4FMVA 4GI4A 5CZSA 4HN8A 3WLMA 2DZAA 3N11A 4C1NB 5BOFA 1QTWA 5H6HA 3QXBA 1Z41A 4GNKB 1ZDLA 2PRHA 3NQBA 4L80A 4V33A 4MG4A 3SUWA 4I9JA 1OFRA 3LCWA 4M6QA 3W7NA 1VFFA 3NCOA 3K8KA 4DUXA 2QULA 5KITA 1XIDA 5FIPA 3E12A 3SUSA 2ZA1A 3P84A 1UKQA 3A22A 4PC8A 3DYPA 4XAFA 3BTNA 1GUVA 3VPLA 3VFLA 1A3HA 3U2CA 3W73A 4RDVA 2JFEX 1SFTA 3R94A 4WDTA 3VXGA 2PRLA 3N3MA 1V4YA 3P8IA 4CD6A 1UB3A 2AL2B 4M52A 4WHBA 5A6BD 1UUMA 4US6A 1W3IA 2ZRWA 4R9OA 3AQUA 2HQAA 4AZIA 3PHAA 4XSMA 2VHLA 3F5KA 4QSHA 4GUGA 2O9OA 3VOJA 4HK7A 2OWCA 4N9DA 2Z6JA 3TYUA 1VBUA 4HZMA 3WJYA 3DX5A 2J79A 2PFHA 5XIMA 1JNEA 3MT1A 2P0OA 3LZ5A 2BB0A 2VEMA 1X98A 3KLJA 3R6IA 5BOOA 1CDGA 3ALGA 2WM0A 2WYSA 2R8WA 5IBXC 2WK2A 5FF4A 1YQ2A 3QOKA 3AWNA 3SW6A 1E9YB 1EDQA 4ZQRA 4JD4A 4HNTA 3NAVA 2VTFA 2UWFA 4PMYA 1W1YA 3CAWA 4KEUA 4XIAA 3B05A 3PUOA 3O63A 1I4NA 3NM1A 3QR0A 4UZUA 3LGEA 4OV4A 1UKTA 4EQRA 2WSQA 5ECUA 4OT7A 3BK0A 1IIHA 4GO8A 2TRSA 4HNOA 2PTDA 1HJVA 1IR2A 2HPIA 2DW7A 3WMCA 6CGTA 3VABA 1KLYA 1S39A 4DNHA 1G7UA 2NVDA 5A8OA 2BY3A 1Q6CA 4AD1A 3FA5A 4MY8A 3WEOA 3AIRA 1XIMA 3FAWA 1H0IA 1X96A 3R8GA 4XVDA 3BSHA 4MB1A 4ATLA 4DO5A 4Z1DA 1BRLB 1Y5XA 3C3UA 3CMFA 1VR6A 4KIRA 4P2VA 1OWQA 4HPNA 3SECA 2QMKA 5F2GA 4LVBA 2WHMA 4IX2A 4GI8A 4F48A 4H7ZA 1K8XA 4JEQA 1T8QA 2Y63A 3NYZA 2VX6A 1V59A 3TQ0A 5HQMA 4XB3A 3KBNA 3URAA 2NV9A 3OGRA 2Y2WA 5AYIA 5AC8A 3CHVA 1T0OA 3IK2A 1EZWA 4O11A 4RNFA 3CGEA 4UTTA 4RV8A 5SWUA 1BQGA 1W3JA 3WMSA 4BEQA 3N2OA 4KERA 3H8AA 3PVFA 1XUZA 1FBAA 5CZJA 2H9AA 3VM5A 3WSUA 3G0XA 2D0GA 2WV8A 4ZE4A 2BGQA 1QDSA 1KGXA 5FEPA 3PJUA 1JCMP 1TSIA 2ZTKA 4GZEA 4X2PA 1TZ9A 2BS9A 3O0FA 1O94A 1O66A 1RJPA 2HDJA 2VP8A 4MNJA 3R0KA 1E3XA 1QNSA 1KM3A 1RUSA 3NR0A 1F4AA 1KBJA 4BI6A 3MCMA 4Q6XA 1MFUA 3FYYA 1IXQA 4IP5A 1K70A 1NOFA 4FLQA 1PEZA 3IANA 1RCXB 1VFHA 4CCEA 5T9BG 4XUYA 4O50A 3UJ2A 3GAYA 3PAJA 1NHQA 3CYJA 4G56A 3CPUA 2ZWYA 3WLTA 2W0HA 3M6DA 2DZBA 3WZ0E 3DEQA 1TTIA 2A2IA 3BW4A 3CPGA 2GVYA 1JJKA 2GOKA 5AY7A 4U5KA 1HQTA 5JCNA 5LNRA 5FS9A 3T09A 3N9KA 2XH2A 4Q8MA 4F2UA 1T7LA 4DI9A 1TVNA 4MWAE 1H6VA 1H41A 4P7LA 4R7JA 2VEGA 1ZJBA 2GVEA 3VKBA 1E4MM 3PBGA 3QTPA 4RNHA 1H5YA 5H8UA 1UH3A 1HF6A 2QNEA 1B90A 3FV9A 1HTIA 2QUNA 3SQPA 1R8LA 1DWGM 4JIEA 3WLRA 4LX4A 1V6WA 1W3HA 2Z7KA 3QQWA 5C70A 5JCIA 4ATWA 4QIUA 4U33A 3U4FA 5AZ0A 4N02A 2C91A 4L64A 3D3FA 2YQUA 4PL1A 3S6OA 1LBFA 3KBMA 2YIHA 3W25A 2FPTA 1QPOA 3NQAA 2EQ8A 1BVNP 3M16A 3NSNA 5FI8A 2EJ1A 4LBRA 1BYAA 2SFPA 2WZEA 1AJ0A 3KDOA 3RITA 4XAZA 5DXXA 4JNZA 3ITOA 2CBVA 3TTEA 2CLFA 4D8ZA 1KFBA 3UPWA 1JCTA 1OIFA 3WH9A 3IEBA 1JOAA 5LA2A 1AQ0A 2CBIA 1J11A 1RPXA 2OG9A 1M7OA 4AEOA 4W7VA 7PTDA 5CAKA 4D1JA 4UB9A 2VT0A 4AZ5A 1UJQA 5CH9A 3B8TA 1EBDA 4CD4A 3INPA 2BASA 2A4AA 1UWUA 3WBEA 2DT2A 3FA3A 3CHFA 2OLAA 3BAIA 1JAKA 2ZA3A 5JCKA 5F7UA 2QDDA 5I03A 3BGJA 1JYNA 1B9ZA 4LWWA 3CQ0A 5D9MA 4UNKA 2CBJA 5DBTA 4ACZA 4RUBA 1UQZA 5D4YA 4AISA 4JYFA 4L61A 3W2JA 3NJ3A 1GRBA 5BMXA 3CQHA 2L5HA 3WDRA 4XUGA 1B3VA 1SZRA 3UYIA 3KXQA 3WENA 1JPHA 1CGWA 1SR0A 2QAPA 3KLLA 1UMYA 2GGGA 4LYRA 1RR2A 2GVJA 2DU2A 3SSJA 1E6PA 3S46A 5EKYA 1DIEA 5D9PA 1OCJA 1EBGA 1OBAA 2A6LA 1A5OC 3L12A 1ADOA 2QQ6A 4GY1A 3QC0A 2DH3A 4ZQNA 3VINA 1MW2A 5HUPA 3L68A 3AALA 1UR0A 1UD8A 1A3WA 2Z25A 4MIMA 3T8QA 1WX0A 3T0TA 3NOYA 2NWRA 4Y9AA 5E9XA 1UZDA 3GXPA 2HS6A 3DH9A 4H8UA 3H55A 4XKYA 2JEPA 1G4PA 2C1HA 3QPZA 4TVUA 5BXPA 2Y88A 5E0FA 4D6DA 3STGA 1K4QA 1FHDA 3FCPA 4J9JA 1VFTA 2CZ5A 1ONWA 1XH0A 3DHUA 4WGHA 3T1GA 1PO9A 3EPOA 1L6YA 3NPVA 3S1UA 1VC4A 3EWZA 4B2DD 3IK4A 4R27A 3W1RA 1AZ1A 1HP4A 1Q3NA 2JEQA 5FS6A 1IWAA 3VOIA 3CU2A 1YPIA 3SQSA 1WKEA 3CQKA 3CIVA 5DCBA 5IOBA 1XLMA 4C6KA 3FDGA 4L1XA 1OADA 2B81A 2ZZCA 2WJZA 4XD4A 1Q7QA 3WF0A 4I5XA 1NVMA 4ZTYA 5JU6A 2CHOA 4JQ4A 5D9NA 4HP5A 2OKTA 5CZTA 4NP7A 1UWIA 1J0KA 3QFWA 3N9SA 2F61A 1JF5A 2HRWA 4JX5A 1FFUC 1I1WA 1EO5A 4OTKA 4ZXOA 4C6OA 1E1CB 4CNOA 4JHMA 2AAMA 3UVAA 3B8WA 2WKLA 4UZSA 1K8ZA 3LB0A 3WQ6A 4JTDA 4E3TA 3SB0A 1XIJA 2EJAA 3IS4A 3N29A 1I8JA 3ISIX 4XZNX 2WP5A 1FX6A 2CLPA 2IUZA 3UY8A 1X38A 1H7WA 1Q45A 1XRFA 3PJTA 5D9OA 5ABTA 1B3ZA 4Q8QA 2WPFA 5G1MA 3GD6A 2V6AA 4I6KA 3R0DA 1Q6LA 3QR3A 3S2MA 2VC6A 4GC4A 2GJXB 4AVNA 3W72A 3N15A 3ICJA 2D20A 3M41A 5KTLA 4LS0A 4C6BA 1UWSA 4KWSA 3CIWA 4R53A 2Q3RA 5DY2A 1EGMA 3VGFA 3QMRA 1W1A1 4J2MA 1JROA 4XO7A 3HU7A 4OUEA 3BSGA 3U48A 1NEYA 2I56A 3W1QA 1ICSA 4NVTA 1FWAC 4AIUA 2JKEA 4DWSD 2CWNA 1R3VA 1DWHM 2GWGA 1FWRA 2ZXAA 5A8GA 1SFSA 4I5UA 3UXKA 3TW6A 4BI7A 1MQQA 2ZE3A 1LJYA 1ODZA 3H2OA 4BY3A 3KOYA 4IMCA 1XQKA 3TSDA 2WPGA 3NUKA 1A5BA 1ZMCA 3STFA 4PUJA 2DVUA 1N8WA 2VZUA 1RCQA 3WBWA 1UH4A 3O6DA 1PAMA 1LRTA 1ALDA 4PBEA 4POCA 1OB0A 2TSYA 4D8LA 1TO3A 1VBRA 4GBDA 3HPXA 2JALA 4D8AA 4K8HA 3UVIA 2VMFA 2PDLA 3UNTA 1QNVA 1ZJIA 1XDIA 2O4QA 1F73A 1G1YA 1I45A 3H22A 2ZADA 4NEWA 3UZZA 1F6KA 1RVGA 1CGXA 4O15A 4H4TA 2GUYA 3G22A 1A5UA 1ZMDA 2PLMA 3KX6A 4UOQA 3T9PA 5I0DA 1V3KA 4GABA 5GNXA 1E9ZB 4UFLA 1SJDA 3FXYA 3T08A 4YCPA 3FHAA 1GV4A 3GW0A 3ZM8A 8TIMA 4UCFA 3ES7A 4WCJA 2AMXA 1XHCA 3SFWA 2NQJA 2NXIA 2PURA 3G1AA 5BWFA 3W22A 2OEMA 2QYGA 4ZZ9A 1E51A 1E4IA 2BX7A 4R34A 4XTIA 2WCAA 4HHPA 2P3ZA 5C5YA 2EPNA 5LNSA 3TX9A 3TMQA 3XIMA 3T6CA 4O54A 2E28A 1QOPA 4RR4A 1MDRA 4J5NA 8XIMA 2J25A 4R7OA 1A0DA 2VR4A 3KM8A 1JYWA 1FY6A 1I2NA 2FGBA 1XRVA 2VFHA 2Z24A 2TMDA 4HPGA 3THCA 3EWCA 3WD0A 5TD4A 2ZRYA 2PDUA 3LNMA 4TU1A 4GR1A 4EPEC 3II4A 4ORMA 4ZB5A 2E09A 2WSRA 3C0SA 3OVPA 4WJXA 2O56A 1TV2A 3CL6A 4AXKA 1E4NA 2G41A 1HT6A 1S2CA 1J10A 2VNCA 3FDKA 4WJ8A 2XINA 2W3ZA 2FLIA 3OQEA 1UIOA 2NX9A 2CXEA 3REQA 4U28A 4N4PA 2OR2A 4UTJA 2FZNA 4CU7A 4YU1A 1DJYA 3GH5A 4IOTA 1SSGA 3LGGA 1GOXA 4GH3A 2C0AA 2GQAA 4AZGA 5TF0A 3EUB3 3H21A 2Y70A 2GPTA 2GR2A 3SRKA 3TA9A 2VC9A 3GHUA 2ASHA 3QW3A 4LC6A 1E55A 3UG3A 2YL8A 3IARA 2W3RA 5ABGA 3ZMRA 5FJPA 2QHAA 4B4HA 3G18A 5A6TC 4B3ZA 3RCNA 2VX5A 9RUBA 4ZA0A 2DV0A 1XLAA 2A1YA 3WDPP 1T41A 3CQJA 4Y7EA 1U33A 3PWAA 1QHZA 4D1IA 3UBPC 1IWPA 4GZJA 4J3SA 4M81A 5D02A 2GZXA 2XN1A 4CN6A 3MV11 2QCLA 2XG9A 1BLIA 1L6SA 1F3TA 2IXUA 3CWOX 1JUBA 4GQGA 3VUSA 1P4CA 4RCXA 3N04A 3VZZA 1WUEA 5EBKA 4WK9A 2IQDA 1V6TA 4YTSA 2PPGA 1ZBVA 1STZA 2H8ZA 4JN6A 1TRDA 2XYLA 4A21A 4AIOA 3AYTA 3AHYA 2HZGA 3M07A 3CUFA 3NDYA 4FK9A 1OGBA 1H7PA 1W9XA 3NA8A 2FPVA 2Y5SA 2QCMA 2DDXA 1FHUA 3NTYA 4QJ1A 3P5YA 2V3FA 1SO6A 3MDWA 4MDOA 4HPHA 4IG2A 2P3EA 4AEFA 2CW6A 1DXFA 2PGRA 3W6LA 1PV8A 3QGKC 1DIDA 1XIEA 1RM6B 3PR2A 1C29A 1C8YA 3FLUA 3TH6A 3VK5A 5BW6A 3PBVA 1NDAA 1EHAA 3OB8A 3TFCA 1FCBA 5HXMA 5K4ZA 4HA1A 4GX9A 1U1HA 3VKKA 3QQ1A 3G0SA 3U2ZA 4FLSA 3U2OA 4XTDA 1VIZA 4IJCA 1DNCA 3S47A 4GA8A 3UETA 3GR8A 3IVTA 1V5XA 2BLEA 1IEXA 1IZJA 5EFDA 4KIEA 2Y8KA 3FEMA 3LCLA 4PE8A 4MB5A 3GC2A 3TYEA 2A7NA 5JUVA 1BQCA 3L23A 4QJ3B 4JN8A 1AFSA 1ITCA 3T40A 3VI2A 4JQAA 1O7AA 5TIMA 2WMIA 1VP5A 1SW3A 1X1NA 1UBSA 1BTCA 1E56A 3O06A 4K6AA 3W81A 4D6FA 4NF7A 4BJHA 4NG3A 4ZO7A 3WQGA 3W1MA 1S1RA 2QCDB 3M6YA 3NO3A 2PDPA 3EF6A 1KCKA 1Q6EA 1CCWB 1EL3A 4LUSA 4LAOA 3QV7A 2A3CA 3OYZA 3TLQA 3USZA 3B9JB 4C6MA 2V68A 4LBUA 5AYYA 2RGLA 4XBSA 7REQA 2FYMA 1XBZA 2JF7A 3TYCA 4DNAA 4HZ7A 5F4XA 3DBNA 3LNPA 1OX4B 4CVWA 3BQ5A 4B5XA 2X42A 4LCQA 2O9RA 5L6UA 3VX1A 2VRQA 1LWJA 2V5JA 3XISA 2J7BA 1VEPA 3CASA 2R6OA 1CW2A 2WNZA 3URHA 2PCEA 1YW1A 5CAHA 1KM4A 1KN0A 3HFTA 1V0KA 4MB3A 3R43A 5G5HB 3QSTA 5D2WA 1PTGA 1ADDA 1GRHA 2ZZ0A 2VRKA 2D3NA 1QW8A 4YWOA 5EBUA 2W55A 1SUXA 3LI0A 3T8LA 4AYSA 4ROQA 5DT7A 3QJAA 3DHPA 3D3AA 3K8MA 1DJGA 1WP6A 3S6DA 2ALRA 5BYWA 2CESA 2ZUNA 3ARPA 2WNWA 4JICA 1VQZA 3VUPA 5K9DA 1DJNA 3T2PA 4JBRA 3WFZA 1KGUA 4KBXA 1EB3A 3EWYA 4IQJA 4AH7A 1LZOA 3QYQA 1IEVA 1GESA 5CEWA 3VDHA 2Y4SA 1C3FA 4H1ZA 4ZO6A 1ZS2A 1UOZA 2FDSA 5D09A 1HXJA 2VELA 1NP0A 1LTDA 2PTZA 4IMGA 3QTGA 4UMBA 3QGAC 4UQ9A 3KDNA 6REQA 4YL2A 1S7MA 4GUJA 3HPAA 1ITQA 1M5WA 2E1WA 3WLSA 1C7SA 3OVRA 3QOMA 4JTJA 1CGUA 4LB4A 1XWYA 3CL8A 1K03A 2OLSA 3B3DA 3GG1A 3S5NA 4ZB2A 3UJFA 3Q37A 1EWDA 1FHLA 1N63C 1EJUC 1SMDA 1YNQA 4TIMA 2AKZA 3PBYA 3W7RA 3LTYA 3G8EA 4BWLC 1C90A 3RM4A 4IXXA 4NAEB 1L6FA 2E6YA 1QWGA 3IIZA 4W5UA 5A6MA 1MO0A 4JX4A 3VIPA 3GD3A 2BVTA 2QJIA 2WJEA 5L9FA 4E3VA 1GCYA 1ICQA 5FOOA 2NX1A 4GJIA 1O1HA 3ATYA 3KEHA 4OECA 1F3WA 4GYKA 4X60A 3TSMA 3WNNA 4KETA 1VJSA 1SO3A 2PGEA 2CLHA 3W23A 4CD5A 2JE8A 2ZRZA 2Y8UA 2XUCA 1XKYA 2A8XA 4WQ6A 5EMYA 1FWTA 5BMWA 3GO2A 4NZJA 1HKIA 3EAUA 3D47A 5AVHA 1F4HA 1QI3A 3GFXA 1RY8A 4ACZB 1KO0A 1V97A 1A4LA 4IMEA 4GRTA 1B31A 4IIHA 1T3QC 2Q8LA 2FDMA 1MVYA 2PD5A 3ETRB 2ESCA 3RYSA 1MUWA 3WEMA 4RL3A 1CNVA 2GLKA 1H50A 4I90A 3ENLA 3HPFA 2HBXA 1HJWA 3TKFA 5A95A 2HXUA 1HL8A 2WB5A 4DAIA 1OCNA 4K36A 2QIIA 4AWUA 3VGDA 3CMJA 5G4HC 1Q13A 4DJED 3IRDA 4IMFA 2E5DA 2EBNA 1E9LA 4F3HA 1TR1A 1Y65A 2INEA 4DXXA 2JK6A 3W1AA 4XKYB 4DLMA 1PKMA 1VPYA 3QMSA 3LXAA 3V5FA 3R12A 3C6CA 3TYAA 3ZLFA 3T78A 1X6UA 2A3BA 4EMWA 3E0VA 4JIPA 5CZKA 3I3DA 3PWGA 3DFPA 3NGJA 2OCZA 1JDAA 4FNPA 4QJ4B 4REQA 4GI6A 4LRSA 4JFSA 5HUOA 3W37A 1CLKA 4C6CA 3TN5A 5FESA 2HISA 2D69A 2VFGA 4LC8A 5AYBA 4L9ZA 2EPKX 1TUFA 2R91A 4RJEA 4PMDA 2X41A 1B0IA 1H5VA 1EJXC 3CBWA 3W82A 3P81A 2HROA 4YHEA 1JZ7A 4QG9A 1OFEA 3TCEA 5LNWA 1OINA 4OUIA 1JUEA 2VFFA 1SU5A 3N2BA 1DJQA 4LFYA 4MWAC 4FR1A 3UWWA 1YBQA 3EOLA 1FWSA 5BCAA 1UHVA 3M0VA 1LDCA 2CEQA 5XINA 1LLZA 2OGJA 4E2DA 2TAAA 2FB3A 1R3TA 3WQ4A 4AIEA 1R9ZA 1BKSA 3LU2A 2W66A 2F8QA 3H4WA 1FWGC 3AHVA 4DJEC 3L5LA 1O12A 2DZXA 4O53A 5AC6A 4QNEA 4YVXA 2OMAA 3QR1A 2ZBTA 2WLZA 3M5ZA 3THQA 2PDMA 5K7JA 4NZFA 1P1MA 3CGCA 1OC7A 3N2CA 3M64A 3QFBA 2OELA 3DFSA 1ZL1A 1WPCA 4AD2A 3I6EA 3UQNA 2R1KA 1KTNA 2PU1A 3SGUA 3CO8A 1IV8A 4GXPA 3EEGA 4S3AA 5LIUX 5BROA 3B0XA 2VC7A 1F8WA 3U7BA 3H12A 4G5DA 1OIMA 3WMBA 4GGHA 3EKGA 5FD0A 1TPC1 2GUBA 2I17A 4YXGA 4LSBA 3EB3A 3QMTA 4XD6A 3SBFA 1EP3A 1NQ6A 2WP6A 4DY1A 1TX2A 3H2NA 3WDHA 2V3BA 4XG1A 3CZKA 1PWMA 4QLKA 1RH9A 1IZKA 1JPIA 3OOQA 2PTXA 1UPMB 2VZTA 2FZBA 4AG0A 1R46A 3ARUA 2FKPA 3A4WA 2ZDSA 2HNEA 3ARTA 4ZSUA 1ZRQA 3TE9A 5CCZA 1CEOA 2PS2A 4LUTA 3BO9A 3L4XA 3E2QA 2WC4A 4I9AA 1VYRA 1S5WA 1GPFA 3IJ6A 3VX0A 3RUBL 1PKYA 1XXXA 7ODCA 2NV2A 3RNMA 2XN2A 1RLDA 3B0PA 3H70A 3ZLHA 3WO8A 3M5VA 4PB5A 2WVVB 4J40A 4S3JA 3CL7A 2ZZ3A 2Q3OA 1OFDA 1FUYA 4PMUA 3GFZA 5HNRA 1LQ2A 3PJXA 3WF3A 1YADA 9XIAA 1UKPA 1ZLPA 1KQYA 2W27A 3SQLA 2IKIA 4JGDA 3GDLA 5I78A 4NZ1A 3PS7A 4F4RA 1B4EA 2GGEA 2RH9A 3ZJKA 3ZR6A 3OLGA 1NU5A 3SJ3A 3GDBA 3D46A 4GY0A 2PZNA 4UQCA 7ENLA 3O6CA 3NQMA 3UWUA 3KVKA 5EMJA 3UWQA 1TB3A 5EMLA 5KMYA 4ZFCA 1VD6A 5D2VA 2NQ5A 4PTNA 1PVNA 1DYSA 2OXNA 4QLLA 3P93A 4AY8A 1GW1A 5I7GA 3Q2DA 3BAJA 3Q65A 1EHNA 1DHKA 4J1OA 4Y6GA 3LM7A 1A53A 2R14A 4EXBA 3HFYA 2DY3A 2QJNA 1W31A 2A7RA 4ZQOA 4WX2A 2IPWA 4EQXA 1HNYA 4R33A 3O2LA 1X1ZA 3W83A 2CZFA 1H51A 3WJZA 2PDHA 1VFMA 4HNVA 4QCFA 2VCCA 3FEQA 3SM0A 1M7XA 1EC8A 4CCZA 3IGXA 1FECA 3AMKA 4UTIA 2E1DA 3GBDA 3D5HA 3WQFA 3R2GA 1PL9A 4H7VA 3CO4A 1P6BA 1OC6A 3ONCA 5C7HA 3H2MA 3N6QA 1PKNA 5EU9A 1TJRA 3FAXA 3R1ZA 1JDFA 5JH1A 3S3GA 4JTLA 1W54A 3QPEA 2BODX 3BL3A 1F3PA 4L4PA 3H23A 5EL1A 1JRBA 4GJ1A 2WPBA 3UERA 1PHWA 1DXIA 2EAWA 4W8LA 5CBJA 3OZOA 1Q2RA 3VE7A 5FF0A 2YVJA 1B9BA 1UASA 1Y5VA 5GNZA 3B0YA 4NYYA 2AQOA 4BK9A 1XIGA 3DGRA 2C1IA 3I3EA 3IJDA 2YZ5A 3LM3A 2J27A 3B4UA 1A5MC 3WH8A 2CLOA 3N6JA 4W87A 4HHHA 4AIBA 2G3FA 2VGGA 1W1TA 1Q6QA 3UR2A 1Q4NX 4FF5A 3NVZB 4W93A 1WCGA 2XVLA 1XCFA 3I7RA 2HK1A 4IPNB 2XH0A 3AS1A 3TWAA 3NQGA 2YJQA 1B54A 4C5YA 3AXMA 1EXBA 3TC7A 3QZEA 1IT7A 2PD9A 2ATMA 3TIMA 3E3HA 1Z89A 5F1VA 3B8VA 2CBUA 1VIWA 1EQCA 2GDUA 3C2FA 3HG5A 3F4VA 1ZENA 4H8HA 5M03A 3IV8A 4AAJA 3AN1A 3RCMA 4AMCA 5FAJA 3P6LA 4C60A 1YX1A 3DUGA 1NWRA 1EDGA 4KGLA 4UQAA 3WQ8A 5CG0A 1X2HA 1LWHA 1OF8A 1I75A 3DFNA 4IG2B 5J8LA 2OJPA 3QHNA 4IUGA 4MNMA 1M9HA 3WY1A 1HJXA 4FP1A 1TYPA 1MEWA 3MP5A 3RX4A 3KTXA 2HPMA 4ALDA 4A3UA 4NI3A 4DB7A 1ZBKA 1RQHA 4LOCA 1VEMA 3I7QA 1PUDA 4JY9A 4H9MA 3PSVA 3U4AA 4O1BA 1OC5A 1WQ5A 2V9DA 3V1HA 4Q4QA 1N82A 3MUCA 2I9EA 3L2LA 1F9CA 2PLKA 4BF7A 1R3SA 4OZOA 1HIZA 4Q7IA 1OD8A 4DXKA 3M46A 2DORA 1UD3A 3TFXA 2QJMA 5EMKA 4DF2A 1GKRA 4LNCA 3U5UA 5HPOA 3TEVA 1GQIA 1ODUA 1CECA 2YDSA 1NHPA 2X8CA 4N7QA 4RNJA 2JIWA 1A5KC 7TIMA 4DM1A 2QJJA 4ATDA 1BWKA 1QO5A 3B0VC 2OVLA 1QFEA 5CPSA 2J6VA 5I02A 3QFAA 4IL0A 3RG6A 1P0KA 3SDOA 3AIUA 4DZHA 1T8XA 1NJJA 2VGFA 1XL9A 1KKRA 5DXYA 4GVFA 2V3GA 1ZCOA 3V35A 3HA1A 3MHGA 3H6OA 4KCVA 2WOWA 1EUAA 4JQ3A 3ZT6A 5U25A 5I2UA 3DGBA 4HMNA 1C8QA 3B40A 4Y9OA 3EX6A 4H8VA 1G69A 2BVYA 3NQCA 3DJJA 4Q4RA 2IKGA 3AJXA 3DG3A 3VKDA 1I0BA 5AECA 3H7RA 1ZALA 2W62A 5I6SA 1Q4WA 3L0NA 2VC5A 4ZOBA 1Q7ZA 3FKRA 1EKOA 4A6GA 1XF0A 3BANA 1UP0A 2BVDA 3LB8A 3NZ1A 1QWKA 4IGNA 2J77A 3SZ8A 3KOZA 3SCPA 4L6OA 1E70M 3GNPA 3WUFA 1BXCA 3OTRA 1RSCA 1D8WA 4UQDA 5IHSA 4JAWA 1RY0A 1OYCA 4UTKA 1H7RA 4OVXA 3M0XA 4DUVA 4PCSA 5EA9A 4WXZA 2OZ8A 4ZR8A 1EEXA 2VUYA 1MZHA 4W9TA 3WL0A 3I4KA 4ZQMA 1XD1A 1OFPA 1QATA 1XJBA 3N6HA 1XFCA 1FCQA 3KBWA 1EP2A 4LQ1A 1PYMA 4UNIA 3C8NA 2JIEA 2VFEA 5CC6A 4NYUA 2DP3A 3A13A 4Z17A 2V38A 2Y7FA 5C55A 1A5AA 2PDXA 2EHHA 1A50A 1QVBA 5TBOA 3R58A 4D6IA 2BXYA 1CB7B 4GUIA 3UGRA 5K4XA 4U2ZA 2B7OA 1AMKA 4Q8NA 5CPMA 1V3LA 4TUFA 5EYWA 2GGJA 3MANA 3STEA 4JTHA 1NHRA 1GETA 1YTDA 5C7VA 3QW4B 3DFOA 5G5IA 1RBLA 3C2RA 3T05A 1OK4A 4GWEA 1QCWA 4GC3A 3QLDA 3P60A 3QLLA 4UTHA 3M0IA 1SJAA 1IWBA 4J57A 2WZMA 3ERPA 1JVNA 1A0EA 1XUUA 4WXYA 3VGEA 4GINA 1TWZA 4F0SA 3GRIA 4F40A 5CSRA 2RDTA 1WAUA 1JR1A 1NF0A 3LRLA 5JRBA 4KWWA 3EA1A 4XZIA 3AAMA 2CLIA 5HNTA 1TPFA 3DG6A 4O1EA 2DGAA 4NY2A 2V2HA 4DBWA 2YCEA 3WD2A 3GC5A 3BV7A 4A8IA 4MY9A 4ZQCA 1GOQA 3NGFA 1AD1A 2H8XA 1SO5A 2C13A 4AD3A 4NZ4A 4PRRA 2HXTA 3C86A 4XBJA 1Y7VA 3VIMA 3W75A 4H19A 1FDJA 2IKJA 4IFKA 1JGIA 3BICA 2RJHA 2V3EA 2Y7EA 1KW1A 4Z42C 3KCOA 1UD2A 3RPTA 1LL7A 4ZOCA 1H1ZA 1BD0A 3S8HA 2X2YA 4DJDD 3V18A 5I3JA 3RGTA 4DWSA 1D3GA 3UZYA 4DLFA 1CENA 3SY1A 4INFA 1CXEA 1NFGA 1SZGA 4NI8A 3LD5A 3W7QA 5LIXX 4MKVA 1GGOA 4BFAA 1NSJA 2NSOA 1MRQA 5CBIA 4S38A 1DHPA 1V8EA 1YTKA 3CUIA 2X1SA 4UR8A 3ECQA 4K68A 2I1OA 4S1FA 1E0VA 2EGZA 1WBJA 3BMWA 5HMEA 4H6QA 1ZB5A 3AWOA 1KFKA 4JL2A 1XLKA 2EPOA 2GFTA 3E0LA 3UPMA 2YL5A 1ZBWA 4PUWA 4X63A 2NQHA 3O07A 1GJWA 4AX7A 3HQPA 4RKAA 3AROA 2OQYA 1XG4A 3K46A 2GJNA 4UTUA 5E6YA 4FX6M 3G1HA 4HU3A 3SUUA 1JZ4A 7XIMA 5G1TA 2XH4A 3GVRA 3MI6A 4H7CA 5C9WA 3OYXA 3UA3A 5MKGA 1TVLA 3ONBA 5FJRA 5C0QA 1E4LA 2VX7A 1OJXA 3NNTA 3W85A 3B9NA 3LMZA 4GIAA 4V27A 5DQPA 2OYKA 1VAHA 1FWWA 5FJTA 3ITCA 3SCWA 1S5VA 1O68A 4LEFA 1VQTA 3GX9A 1SW7A 3QQ0A 3L4UA 4HT3A 3F5JA 1P43A 1H09A 1XHGA 3CT7A 2EKCA 2TODA 4DELA 4A22A 4H2HA 3V5OA 5HR6A 3GNOA 3WF4A 4KESA 4GLEA 5DT5A 1M7PA 2A21A 2OO6A 3W88A 3W6MA 2CDUA 1BTMA 4UXDA 1W9DM 1Z8AA 1F05A 4DM2A 1GTHA 3M7SA 1N60C 3VOGA 4OU1A 1GPWA 2IS7A 3MY9A 3E2SA 1XLJA 1W3NA 4P7QA 1R3QA 1QHPA 1F61A 3VYLA 1W5PA 2PWVA 1OEPA 3SIZA 1LOLA 3G3DA 4BQ5A 4PEEA 4QISA 4DZ5A 4US5D 5CPTA 2Y1HA 2E9LA 1V7YA 1NFBA 1J0JA 3AI0A 4L9XA 4LB3A 1LPFA 3KL5A 4N6FA 2O0TA 1PS9A 1QNOA 2FPYA 4WGXA 3LADA 3HQNA 4OHQA 4MADA 2ALDA 4F0LA 4NHVA 1EJRC 3VGGA 4JXCA 4JNYA 3GUGA 3N18A 4TTUA 4IM4A 2QUTA 1IE7C 1H7NA 2YFOA 1NQKA 3RLGA 2VQUA 5E70A 1JUKA 4MB4A 3GNRA 1EF2A 2ABBA 2CLMA 1J5SA 1OQFA 3LY0A 2WMHA 4LVAA 4FAMA 6XIAA 3UR7A 3ARRA 4HTBA 2OSXA 2CITA 3LV5A 4E8GA 4HA0A 2EQ6A 4UOJA 3S2LA 4LUTB 1WXJA 2WMKA 4QFUA 2AL1A 3SCOA 1DOSA 3GR4A 4TQTA 4JTCA 1GVIA 5C71A 4JFVA 3RU8X 1JZ8A 4XV0A 1GQKA 3ATZA 2YBUA 1QO2A 1UQYA 5CPLA 5T91A 4HB7A 2A6NA 4O4WA 3MI2A 4HA4A 4JTFA 4R5EA 4EK7A 4O17A 3QHMA 1OFQA 2Y5JA 5AN7A 1QW7A 3CHEA 3HJZA 1L8PA 1ZBCA 3LCIA 4O14A 2NX3A 4PBGA 4H4RA 3WKZA 3A47A 2VL4A 3CB8A 2ZXQA 3D6NA 2HVMA 4XAGA 3BOXA 3H24A 3HGSA 5BU9A 2E3TA 2OODA 3OO2A 3MHUA 4R7WA 3D0CA 3H4GA 4ONVA 3KVMA 4OWGA 3M5YA 1FA2A 5CBBA 4WDXA 5CJNA 3KVLA 4PODA 4BEUA 1JCJA 4KFPA 3UEQA 2NQ9A 4AC7C 2V67A 4GQBA 4JKKA 4ACYA 2TPRA 2X05A 5BRBA 4QROA 4DYKA 4C1LA 1C92A 2J8FA 2ZDRA 1XGZA 3WLOA 4Q8WA 4JIHA 4W86A 4Y9MA 3SCUA 5B80A 3WF2A 2ZUUA 1FCVA 4MWAB 1J0IA 1M41A 3GS6A 4E4PA 3AHZA 1JPDX 2UV8G 2D0HA 2Z27A 3VDBA 2P53A 4KPLA 4OOUA 3AYVA 5J5RA 5FJIA 2FZMA 3W87A 3O6AA 1GHRA 2ZZ1A 3UJEA 4DX3A 4XZMX 3VILA 2DJLA 3FGCA 4YIWA 4FF7A 4HD5A 3BUVA 2J8GA 1EIBA 1IXPA 1LCOA 1FFVC 2Z6IA 4QEHA 4H6EA 3E5PA 5AHIA 1F76A 3EOSA 3IC9A 1NIUA 4MZ1A 3VIFA 3DK4A 3EPNA 4HQVA 1TPDA 2QMJA 3WLQA 2VWSA 2ISWA 1GTEA 2QDEA 4FX8A 1M6JA 5M2FX 4ZENA 3GUWA 1KFJA 1SZEA 4EM4A 2E6AA 3EWDA 5DEZA 1YPXA 2FVKA 1WBHA 4DZAA 3BE7A 5TNVA 2FGZA 1HKWA 2QIWA 3UWZA 3PNUA 4JL1A 5E5CA 3V1PA 3EOOA 3QV6A 3V0UA 1NAL1 1B3WA 3NSMA 3IWPA 1UR3M 3BG3A 1E0XA 4M56A 5DMLA 1XICA 1QNRA 3WK3A 5U7SA 3ABQA 3C56A 3A4XA 4Z2IA 5K9CA 4IIBA 4N6EA 5C9UA 1P0NA 1F07A 1W9UA 2XFRA 1PIGA 1UBPC 4FLOA 2WVUA 1UD6A 1E0UA 2W91A 3LCHA 1TVPA 1WOAA 2B0MA 3T44A 3RX3A 2V5BA 5DMNA 3AYSA 4BQ3A 1DQUA 4LS2A 3ARXA 3HPSA 4H4XA 1YNPA 3MCNA 3S5ZA 1E40A 1KCLA 3RK8A 3TCSA 4C65A 1D3CA 3N13A 1X6NA 3L5AA 4H4UA 3OODA 3WCZA 1ZKQA 1EUNA 1CI1A 1UJPA 1ZNNA 2OX1A 3WDIA 4G1KA 4CU8A 1V93A 2V69A 2NSXA 3W9ZA 1TPB1 1JI2A 3CUZA 3IGUA 1H11A 2V2CA 1MWOA 2EO7A 4TMCA 1YXDA 3BPWA 1N5WC 1HN1A 1S2VA 5F1UA 4AZBA 1NDZA 3DI0A 5EMUA 5M3WA 5HMFA 3T0DA 3K4DA 3R10A 4PA8A 2XWDA 4N2YA 1ZXIC 4DJFD 3OZMA 3SEPA 1ME7A 3MMWA 3KLKA 4JYEA 3VIGA 2YR1A 2D2OA 4TXEA 4L7ZA 4XBKA 1ISXA 3M4HA 1CLXA 2OYLA 3WD1A 3LTSA 2V63A 1HP5A 3NIYA 1Q5MA 4P7RA 2V2DA 2ZX7A 3N4AA 1JFXA 2WQDA 1OGSA 1WV2A 4K8EA 3MJYA 1GKQA 4XD3A 4KMQA 2FTPA 3FJNA 4HCHA 2HS8A 4A3YA 3PBUA 1TTJA 3LBOA 3GSMA 4MLJA 4F0MA 3G1VA 4K3ZA 4DEFA 4MKSA 3SAZA 1T40A 1UD4A 4JQ9A 3ZZ1A 3TV8A 4IGMA 3W4RA 5A6AA 4NZCA 3TYBA 1EX5A 3H2AA 3HURA 3PSWA 3Q58A 2HCVA 1SM9A 4AB4A 3S1XA 5H8MA 1V6XA 3SY8A 1K8CA 3ZWSA 1W5OA 4S3EA 1O5XA 1L8NA 4BQ4A 3RR1A 4O10A 3MHFA 5IM51 1V6YA 2C1GA 1UC5A 3G3MA 4QTGA 1EO7A 3KCJA 2D22A 1Q6DA 3EOUA 4JTRA 1UWAA 2HNHA 2R1LA 4FEZA 1C93A 2RDXA 1IXNA 2OKOA 1HGYA 1Y5WA 2GJLA 6TAAA 3GXFA 4AD5A 1VDVA 1TPWA 2C6QA 4GK8A 2GDQA 2BVWA 4IWWA 2R82A 3BOFA 3OJGA 2VJXA 2V81A 1DQWA 1GSNA 4E38A 2C79A 3CH9A 1XANA 3URBA 2IW0A 1YDNA 2NXHA 3PZUA 2BHYA 2P88A 4WOQA 5KEZA 5AB3A 4LY8A 1X7IA 4I8YA 4C6JA 2ZA2A 3F4WA 2OZ3A 2PTWA 3AHXA 1JDEA 1KRAC 1U5JA 3C2OA 5H2ZA 4LUYA 1OD0A 4AVFA 1J12A 1KBKA 2Q02A 3BQ6A 2Z0IA 3WNLA 4JHZA 2W0UA 1ZQ5A 3BGAA 4LYKA 5KVIA 3KOFA 1ZGDA 2Z1XA 4PGLA 2W92A 4FXJA 3GDKA 5HMDA 1IZCA 2IKHA 3GR7A 4ES4A 2ZZ2A 4GUHA 1KR1A 1PZ3A 2Y5EA 1LRQA 1PE1A 3GVQA 1NHSA 4Z1CA 1E1EA 3GLCA 2CZVA 1W32A 4HPXA 4CNUA 2J7CA 5DMYA 5HNNA 4Z08A 2PWEA 1VRDA 2BGNE 3RF9A 1KTCA 4EQWA 1AJZA 3L4VA 1GWJA 3APYA 3RJYA 3WN6A 1AA1B 1FWJC 3PG9A 2DIJA 4O1CA 1GVEA 3AXXA 2F38A 5D33A 5CPQA 4D6CA 1U83A 3A21A 4IGHA 4HOWA 1V0NA 3GU1A 4PRTA 2GGHA 3AZRA 3C3NA 4G9PA 2UY3A 3WD3A 4DN1A 1ONEA 4B5NA 4FIQA 3C2YA 3L9CA 2DT0A 3WUGA 3KTSA 5D2YA 3QY6A 4M6PA 3RAOA 1P7TA 4RDYA 1WDRA 4FB7A 4K8DA 5C6MA 5KZ6A 2WNQA 2YA1A 3LMYA 3RJXA 1BXBA 2X1RA 3BG9A 2YCLB 3I68A 4Z0SA 2YVFA 2CETA 3TONA 4A2SA 2OGYA 3KVJA 2JKPA 4M82A 3B8UA 4X61A 3TU9A 1A5NC 1P5BA 1ELSA 3CHDA 3IIXA 4JQ2A 1PIFA 4Q3MA 4A8NA 4ZFMA 3GM8A 4UTTC 3THDA 2PE4A 1NOWA 3C2VA 4NNBA 1T99A 3LBCA 1GXFA 1DBTA 4JFWA 3PY2A 2ZOXA 1ZJHA 3CMGA 2D1ZA 3WLNA 3WNPA 4F9JA 1HJUA 1Q6GA 5CGMA 2CXGA 3YPIA 3M0LA 4JKMA 1KM1A 4Z1BA 3AISA 3M1ZA 3TN3A 1EJSC 4NJKA 1LUCA 4PB4A 2FZ8A 1VBGA 3WQ5A 2NWSA 4G8TA 3PAOA 4H9ZA 3MV01 4K38A 4AFYA 5D30A 3NPWA 3VU2A 3TYZA 4QAIA 1EGZA 4FNUA 3GC4A 1GYNA 2X0YA 1TPH1 2DZTA 3T42A 1REQA 1EXPA 1EFZA 5JH2A 1Q6FA 1X2GA 1RJQA 4H4QA 3FJ4A 4CNTA 2E9MA 4MF4A 1BYDA 1FXPA 2G0WA 1N2VA 2PP3A 3NFUA 4RZ4A 1NWTA 4IFKB 4HNNA 1XSKA 2R1NA 1W3KA 1IEIA 3LENA 1XIHA 4NT0A 2ZX8A 1M1BA 1KD0A 4EOUA 3F2DA 1M3UA 1HKVA 3THUA 1TPEA 2OWWA 3W07A 1XM3A 4HTYA 3W2MA 1K9DA 3WBXA 4CUCA 1OVDA 5C2CA 2J8TA 1MXDA 2BOEX 1YRRA 1PYFA 1DXEA 3B4YA 1RA5A 3HTWA 1ONRA 4HJFA 3WQOA 4TX6A 2H6RA 1LM1A 1UD5A 9XIMA 2YZRA 2YX0A 4LUJA 2PZ0A 1WYGA 3EDEA 4H01A 4I6VA 1JCXA 4QE5A 1RLCL 3UXIA 2OEJA 1R38A 4MM1A 4E8CA 4JFTA 4B9ZA 1XV8A 4DWDA 2WC7A 2A0NA 3WMLA 4JN7A 4QG8A 3GU9A 1XW8A 1NH6A 1D2KA 1R2SA 1RZMA 6A3HA 1U5HA 4H4VA 1E3ZA 4FNQA 1HFBA 1T5AA 1MEIA 3EWUA 1ESWA 1TA3A 3PFRA 5A8MA 1WAWA 1EOKA 4ASTA 2XU2A 3L67A 2BXZA 2CHRA 1TTQA 1OJTA 1OHLA 4YN5A 2F6UA 3C5QA 3GIYA 2A3LA 1WDQA 1VJIA 2XFWA 3LPPA 3W2KA 2CKRA 5T9CE 4S23A 1E0TA 4HYRA 2A3HA 1CTNA 4AF0B 1ZAIA 3OLIA 1RD5A 4O8RA 2DZUA 1C9WA 2CLKA 4P7NA 4XD5A 1DJIA 2G5WA 4WIWA 2NQLA 5D2TA 2GVLA 4LXFA 5C2XA 3VOCA 2VZVA 2DT3A 1PCWA 5HNUA 2XIOA 4RK8A 2FMNA 4CNSA 3IJIA 2VZSA 4JKLA 3HBLA 2EQ9A 2X1IA 1H7XA 2R24A 1B3XA 5A6KA 5ER0A 4JX6A 5HR7A 1XSJA 5HANA 4F66A 1XPYA 1XLGA 1Q8JA 2GUUA 4JIRA 2DZVA 4LT9A 3UP8A 3OGVA 5REQA 1E6QM 1V0LA 2FFCA 3SGGA 3T0BA 3MUAA 2O7QA 4RE4A 1JIBA 3RILA 1K77A 2GR0A 1K8YA 3XINA 2WWCA 3E96A 4YNGA 1QRQA 3ZFHA 1PDZA 4EKJA 1US3A 1LWIA 3MU7A 3TNOA 4LA1A 3O1NA 3MP4A 4GISA 3VIJA 3TN4A 1V6UA 3V4BA 4NXSA 2JK2A 2OFJA 4CQAA 5M1TA 3W7PA 4IPJA 3FNDA 3NVWB 3O05A 1GQJA 4HKPA 3EKZA 1KQZA 3CV7A 3TWBA 1V3JA 3J7HA 1EBHA 1Z9AA 3UCCA 2I5GA 3SSZA 3VNYA 4NKCA 1OCBA 3DH7A 5JBEA 3UWEA 3I6RA 1KTBA 5H1WA 4O28A 2ANUA 1W9VA 2PP1A 1UZHA 1DWAM 4ICCX 5G2HA 2E7FA 4HU8A 4PUKA 2CC0A 5G2IA 3W1UA 4N0RA 2VCAA 1SZNA 3CLWA 3F7JA 1XH1A 2HVOA 2QZRA 3K30A 2J7GA 5FJUA 2PDKA 2YDRA 3L0KA 3ME3A 4AWSA 3EWWA 3I6TA 3WUBA 1H62A 3WJXA 1H3GA 3GTNA 4FNTA 4YTRA 1A0CA 1LOSA 2F2HA 4Q4OA 4EQSA 1ML1A 2WAGA 4LYQA 3MYOA 4NQ1A 2G3JA 4ZODA 4JPGA 1WKDA 3CGDA 1TPUA 3A9IA 3E2RA 4RZBA 4YCOA 1GRGA 3VNJA 5HULA 3CYVA 4A2RA 1D7YA 5I24A 1XFBA 4MUZA 4GXMA 1O1ZA 3GXIA 3NPXA 4NJHA 4KQNA 4F0KA 2WQPA 3VGBA 3T2QA 2DZPA 3FSTA 2W4XA 1LBLA 1P1XA 4O57A 2DW6A 1G0CA 1YLVA 3QY7A 4FXSA 2VDIA 1P48A 1K6WA 4I9TA 3MSYA 4F0HA 1UKOA 4DRSA 2VYOA 4H4IA 1CZ1A 5AHNA 1UOKA 3KOXA 2QS8A 5LIYX 4XZWA 5LA1A 1R6WA 4UIOA 4Q4SA 3ZT5A 4P8VA 4TVYA 2ZUVA 1JQXA 3T07A 1E5JA 3GG7A 2J78A 3ORWA 3E0FA 1U1UA 3WD4A 1OG6A 5CLWA 1ICPA 3U3HA 3GBEA 3E38A 3GNNA 1XLBA 1VH7A 4LAKA 3HMCA 4IT1A 2GOUA 3OG3A 1QK2A 4FIRA 4A3HA 3A5FA 3GK0A 1J93A 5DFAA 4IIFA 3TC3A 1E15A 1NF7A 2J7DA 3S5OA 4GGBA 1QW9A 3A64A 4EACA 2C3ZA 2CKSA 1Q7MA 1DIOA 3MCOA 3IV3A 2C71A 4FHAA 2DIEA 3PBMA 4YVPA 2BHZA 1I60A 3LLDA 1ECEA 5LNVA 4TMBA 2OOFA 2AAAA 3G1FA 4MSSA 1T96A 3OIHA 2J75A 3CB3A 5C54A 4IIEA 5A8QA 3V36A 4A4AA 1GVRA 1O6IA 1CX9A 3EBVA 4UFHA 2C15A 3NQFA 3T4CA 1U1JA 2Q8ZA 4MJMA 1QBBA 3W3OA 1FWEC 1YYAA 3USBA 4YS1A 5FS8A 2HV5A 4GG9A 3OQ8A 3L8KA 3TSBA 3HM7A 1JEHA 3W26A 3OG2A 5T8GA 1GORA 4Z0JA 1MUMA 1IHIA 2OZTA 2XJ7A 3ZXWA 2VGBA 3LGDA 4IGSA 4IP4A 3QGVA 2EQ7A 1VHNA 1RVKA 4O19A 5AC5A 6ALDA 3CIXA 4XQ6A 2DPEA 3S5SA 4C6DA 3APTA 5LSMA 1CYGA 1OT2A 3APGA 4LJ3A 4NX0A 4W88A 5HA7A 2HJPA 1NDYA 1LLWA 1BFNA 1MZRA 1X8FA 3TC6A 3ZVHB 2D3LA 4QE1A 4CQ8A 4JCMA 2A3AA 3KS6A 3DG7A 4PCPA 3B9EA 4C1KA 4QX4A 4LV4A 2VXNA 2O9PA 1V03A 1PDYA 2J13A 1FKWA 3IAQA 1TJ0A 2UBPC 4MZYA 2VEIA 2XSBA 1EYWA 3TK7A 1I6NA 2GSEA 2XZ9A 4DNMA 5LHEA 3PTQA 3IUHA 2G95A 2PRMA 2QGHA 3L2MA 3M9YA 1TE1A 3V16A 3LHVA 2CU0A 3DGZA 1ME8A 1RJRA 1MSSA 4GZIA 4WY0F 4U5IA 1AG1O 2DUZA 1F2JA 4Q6JA 1UH2A 2FQIA 5LGXA 4IIGA 4QXIA 1NM9A 5BOEA 2ZFAA 4ECLA 1KM5A 2XHYA 4DIAA 3OLEA 4D6GA 1J6PA 1DORA 1EC7A 3PZNA 3NYDA 4O0QA 2V5CA 3OPSA 3GWQA 7A3HA 1YMYA 1DJHA 1JZ3A 2QUUA 2ABAA 1J96A 1WDDA 3WQEA 4JFUA 5B7ZA 1VPQA 3FY1A 4G7EB 2PDWA 3HV8A 1GRTA 4GQRA 2XFYA 1VFLA 3V0TA 4H4SA 3W7MA 3JUGA 3VD9A 5CC5A 3GTHA 3RRAA 4PTXA 3DBPA 1XLHA 4YHGA 3NVYB 1HVXA 4MYXA 3P61A 1W3LA 3HJEA 2Y7DA 4M1BA 3LSCA 4E5TA 5GJNA 5AHMA 3QSRA 4OFCA 3AC0A 1HUVA 4KKXA 3W01A 4PTDA 2PDBA 3VTRA 4PCTA 4DJDA 4KRUA 4H9XA 4NASA 1IQ8A 4Q8PA 3EAOA 4ERAA 2I5QA 2WW5A 3AU6A 1DXLA 3LEPA 4L6DA 1GOOA 5LIKX 4A3RA 1J6OA 2EF9A 2J62A 1VKFA 2E77A 5AYXA 4KFOA 2AOSA 3GNXA 3BDKA 4FNRA 2HE8A 3MO7A 4JDRA 7CGTA 3A4JA 4LIIA 3W00A 5G4WA 5AHEA 4DVOA 2H3BA 3NPUA 4LY4A 2Y6ZA 4L5ZA 1LROA 3G6MA 1S2UA 2CPUA 1UPPA 1VHCA 3AXKA 2WHJA 1OZMA 3K4AA 4QNWA 3G5EA 3EDDA 1CLVA 1GZGA 1NOUA 1KC7A 2ON3A 1R87A 1Q1RA 4ZE5A 2ZVRA 4JNMA 2PBOA 1P0DA 2PU0A 1GYLA 4EPDC 3OGSA 3NL3A 1FFRA 3CZGA 3UNDA 2R9ZA 2BV9A 4M6VA 3GXNA 2J9XA 4JCLA 5FCZA 3VD4A 4UMCA 1W2VA 4NRRA 1Z42A 3AMCA 1P7TB 1QI0A 2JKAA 4CD7A 3SCQA 4WKHA 1PB0A 3WNMA 4TR9A 1PBGA 1YXCA 4K8GA 3TP4A 4R88A 4IJRA 1SB3B 1KA9F 4J27A 2YFNA 4JZ5A 5JMUA 3CWHA 2WCGA 3C52A 1MMFA 2WVTA 1WZAA 4JOMA 2YW4A 4GYJA 3F2CA 2BY0A 5HJLA 2WOQA 3OLDA 2W6RA 1U30A 1W17A 3ZSTA 3R79A 2GJRA 3LX9A 5BRQA 3UZXA 4TX9A 3BAYA 3PUDA 1LUCB 4EF9A 3CC1A 3VGHA 1ZU8A 2OZ0A 2XM1A 1EQPA 1HKJA 1CIUA 4H50A 3VMPA 1J79A 1XLEA 2PF0A 2XPKA 3P80A 4QJ5B 5J5DA 5MHBA 5GJPA 4JDYA 4WKFA 2V6OA 3BSMA 3S4TA 3S5YA 1XGDA 2DUXA 4QE4A 1VFSA 3AO0A 4XZHA 1J9YA 4IICA 4JYDA 3U9IA 2ZX6A 2BWGA 3KWXA 1LG1A 4US5A 2Z00A 4IFRA 4Y8FA 1TJ2A 1UP3A 1R3RA 4GFSA 2BNJA 1MFVA 2QW5A 3HN3A 3BAXA 1ZK7A 3F1QA 3UXDA 2WOVA 2G8ZA 3GD4A 1WDWA 2P10A 4Y9PA 3PC0A 2FGLA 3DKJA 4S3FA 2HMCA 1XIIA 1JRPA 4WOZA 4WSHA 3MMTA 2BBFA 4FALA 4B16A 5FA5A 3BZGA 2NUYA 3GNDA 3WK1A 2YL9A 9CGTA 4G6CA 2POZA 3FX4A 2F5ZA 2ACRA 2QR6A 3OC4A 4BR1A 2D2JA 3IGHX 1AL7A 2VWTA 3HIJA 1IR1A 1CPUA 3Q45A 1CGYA 5JBDA 4M0XA 1KFLA 3I4EA 1E6NA 5AC7A 1EJWC 4S3CA 1JI1A 1H1NA 2PWDA 2RUSA 4PSPA 2J47A 3JVAA 1XISA 4PZVA 4P5UA 3N4FA 1XGEA 2EG7A 4CQ9A 4HJWA 1RA0A 3SRDA 1PSCA 5CPNA 4Q8UA 3UPBA 1PJ9A 5I79A 4EPKA 3NQ7A 4HHMA 4E4FA 2VDGA 5A2CA 3GHRA 2C3DA 1HO4A 3O15A 2E5CA 3NDOA 1V7AA 3DIPA 1Z3NA 4B91A 2DSKA 3SURA 1LT7A 1QBAA 2W5FA 1G5AA 4X2RA 4QM1A 5I07A 5KVHA 2AQVA 3R13A 3RPMA 3DK8A 1UUOA 3OZYA 3KHDA 4AY7A 3L5MA 2E3ZA 1JCLA 1OZQA 4QGCA 1MEHA 3LI1A 5FACA 1A4MA 4TTGA 1UZ1A 5JVLA 3E0WA 4H4ZA 4CEUC 4MDPA 2TPSA 4XZ9A 2GRTA 2IPJA 3A3WA 3FYPA 3P7YA 1TV8A 4PUUA 2FB2A 3NQVA 4BF5A 3U8GA 5HWNA 3AFBA 5DO8A 3TTYA 3GDTA 3VE9A 3G1YA 1B30A 1DKWA 2EKGA 1XP3A 1ZAHA 3W7LA 1W9PA 3KCLA 3NZQA 4HZ8A 3AUOA 4MMWA 4Q7BA 4W5ZA 4JTAA 1E6ZA 2F6XA 3HG3A 2PUZA 4HPJA 3TQKA 2H9AB 5LZLA 1J0HA 2P1FA 4I9MA 1IEQA 5AHLA 4K1WA 2QLYA 5REQB 1TYGA 4F2BA 4AHPA 3LHWA 3MKVA 2O92A 1TV5A 3O6YX 4WRHA 3WQPA 4GH1A 4FA3A 1Q85A 4RXGA 1FTXA 2D73A 2BC1A 3FW6A 3QH2A 1UR8A 4UQEA 4JTGA 1FQ0A 2OB3A 1CT5A 2J7FA 1UW9A 3NO1A 3PZMA 1L6WA 5I3KA 1R0MA 4H6KA 1IGWA 5JXQA 5CG7A 3MC5A 1AZ2A 2ACSA 4AZCA 2WC3A 1GOMA 5DX7A 1TWWA 1AQMA 1BF2A 5LXXA 5GRTA 1D7FA 3ABSA 2BOGX 1X39A 4LAZA 4HMCA 4W7WA 4YYFA 3BC9A 3VD3A 5I3FA 4UFIA 1U2YA 1TYTA 3PUGA 3RX2A 1B3OA 1J2WA 4QBXA 2ACQA 1K7FA 3K5XA 4HOXA 1W5NA 4H41A 2ZC8A 3G77A 2X7VA 3AHTA 3DFQA 4CVUA 1MQRA 4QSFA 3FVDA 3DGHA 4J4KA 1TV3A 3BJTA 3PK7A 3V5CA 1CGVA 3W6YA 1KBLA 1W1PA 2CERA 3C8FA 2YA0A 1O5KA 3AUJA 4L4LA 1D8CA 4FX7A 3E9AA 4IPIA 3I10A 1A5CA 3IJ7A 2WZIA 3TJIA 4OV9A 4J3UA 3AIVA 2GYIA 4KFNA 3R89A 4H04A 1JD7A 3CV2A 1K3UA 2VFDA 3TTOA 4KCUA 3T0CA 1EPXA 3UFYA 1QPKA 2CYGA 5FF3A 4WSKA 1GZ1A 2QGYA 4BS0A 5AOUA 1IIGA 1E9IA 3T7VA 1B4KA 1OK6A 5G4EA 3N14A 1O95A 4UBPC 3UF9A 5F4WA 3NSXA 1TWIA 2AGKA 3L7RA 5IFTA 3IVUA 3OHIA 1A3XA 4DJFA 4AZHA 4A29A 2YB4A 4MAZA 2BSLA 1SW0A 1FWFC 5E6ZA 4L1WA 2PDNA 5ABEA 2HSAA 4AVOA 4GPNA 1VF8A 2UY4A 1UWTA 2XVGA 3T4WA 3W76A 4GBUA 4Z2LA 1KWKA 3S2CA 4JTEA 4RE0A 4C6QA 2CCRA 1JZ6A 4IISA 5EFFA 4GXWA 1VBJA 1TTPA 2DSZA 2J24A 3EKLA 3W0KA 4M3PA 3LYEA 5CSUA 2RFGA 3WK2A 1TWDA 3EDKA 4HU4A 4PMOA 4PYSA 4GVGA 3S6TA 3O0KA 4MWAD 2V82A 4LCSA 3SY5A 5A2BA 5G5GB 3AZTA 3EX2A 5HMSA 1Q1WA 4BURA 1YKWA 2X8RA 4K1GA 1EZ2A 2QCGA 3R4IA 3LA4A 1X6LA 3M0ZA 3QKEA 1J8VA 1MNZA 4CU6A 4QCEA 2QPXA 4JTSA 1X8CA 3G1XA 1D3HA 1N8IA 2QCDA 4AX6A 3JZEA 1POJA 1TRIA 3BJSA 2IPGA 2GQWA 1XS2A 1TWSA 3ID7A 3ANVA 3GH7A 1NWUA 3WQVA 4AC1X 3L2IA 4DXVA 3QV9A 4GCXA 1W9BM 4X3ZA 3UR5A 1HGWA 4K7VA 3A4AA 2Z2AA 4GIRA 1FIQB 1OT1A 2X40A 4B9YA 3MA8A 4ZO8A 2V8ZA 4RDWA 3DZ1A 3SCNA 1BGGA 2FHBA 3S9YA 5DN1A 3DENA 3CZJA 4F9DA 4PUNA 3URNA 3GQYA 3LXBA 1OX4A 4NILA 1XC4A 4O1FA 3GDMA 2B7QA 4K7YA 4ZQPA 4ZSTA 5JCMA 3VDCA 3VNMA 4Q22A 3TN6A 2EPLX 2QVNA 3DN5A 2YVGA 4LALA 3MSRA 1ITUA 2OTDA 3GKFA 5I09A 3AIWA 1NPXA 2OEKA 3LPGA 4AU0A 2GSJA 1UR2A 3FJ6A 1UIPA 1ZJAA 1DVJA 2YLLA 1RHCA 1VEOA 4B5SA 1TKKA 1QHOA 3GZAA 2WHKA 2OPJA 2QPSA 4L1GA 2V5KA 4IMAA 4RPQA 1GK8A 2NT1A 2O4MA 4K39A 3KFTA 4V2XA 1W1ZA 1FDZA 1TR9A 1QXLA 4H4PA 1TJPA 4KT2A 1UROA 1VGAA 1AODA 4APNA 1VPXA 1PCKA 2BC0A 2NV1A 5AHFA 1WKFA 3CGBA 3G1RA 5AZ1A 1M65A 3ZJ7A 1L2UA 2PEVA 1XDLA 4QRNA 3LHYA 3LLXA 3ZWTA 1HKMA 3DC0A 2BGSA 4ZCWA 1N8FA 1YPFA 4B3LA 6TIMA 4IP7A 4KEZA 1BSIA 1P0EA 3N2XA 3W2NA 5CSSA 2X0HA 2QV4A 4GHRA 2RKXA 1TREA 1Q2SA 4KGJA 5AVNA 3G6LA 2VGIA 3NL6A 5M5DA 3MVTA 4WD0A 3U57A 2E9BA 3MZNA 2YGYA 1JF6A 1EA0A 4GX8A 3NZRA 1RK5A 1VJZA 1ZSXA 1IXOA 2RDUA 5HAOA 3PZOA 1UA3A 5D32A 3WQDA 1S46A 4HMDA 2RAGA 2E5BA 1GW9A 2VDHA 4ORIA 3WX7A 3QN3A 4IXHA 1W1IE 4U2YA 3JRKA 5IBXA 1AK5A 2H90A 1AD4A 2WLYA 1TX0A 2BHUA 3P0XA 5FSEC 1FH8A 4DBEA 3TUUA 2YAUA 8A3HA 4CQDA 4D6JA 1XKJA 1N55A 1H1YA 1AOGA 1VLIA 3P8JA 2XFFA 2NUWA 3WH5A 2XIJA 2X30A 3IVSA 3FN9A 4C6IA 1WDSA 1ADSA 4AD0A 3AMZA 3EA3A 3VCCA 3DCPA 2X1TA 4NAEA 2YW3A 5D2XA 1W1VA 3TW9A 2EXOA 3O16A 4Q4PA 1R5YA 2GVGA 2XDFA 1RPKA 2F2KA 3P3BA 1ZY9A 3B9AA 3SQMA 2NPXA 3S1GA 2IXVA 2ZWZA 3PF3A 3IRSA 3E2VA 1TV7A 1S5NA 2E8YA 2ZTJA 2P50A 1G6CA 3MUXA 3MTWA 4D6HA 3PN8A 1JAEA 3P67A 5HWJA 1G4TA 4DI8A 1WZKA 3BZJA 4GZ7A 3CZ8A 3MP3A 2OU4A 4CCDA 4B4FA 5JIWA 2DQWA 3BURA 3UXAA 3VIKA 3WNOA 8RUCA 1KXVA 1GOKA 3U6WA 4HOZA 3UWVA 3EXRA 5A6BA 3QVQA 4YMZA 1XRSA 1YE4A 4FOKA 3FSUA 2XGIA 3GZ3A 4W8BA 3EGJA 4GNJA 1SJBA 1OGGA 4MJZA 2ODOA 2VUNA 2P0IA 4MGGA 3EX4A 1ZCCA 1W5MA 4N9CA 1SMAA 3UG8A 3LCFA 1IT8A 1CBGA 1X1OA 1EJVC 4UC5A 4GI9A 2BP1A 2PI6A 3TXZA 2BZNA 2ZE0A 1H7OA 4EXQA 4O0ZA 4FOJA 1R47A 4QQUA 3R07C 2ISVA 5A6SA 2Y62A 3BOLA 2X50A 4V1YA 5LNUA 3RR4A 1R86A 4PCFA 2GGIA 2ZCGA 4TVDA 4XKMA 3AM9A 2J3NA 2VKZG 4H83A 4LCRA 1NARA 5DRCA 4OBTA 4AHOA 3E5BA 2DEPA 4I7VA 1KGWA 4H3DA 4E6MA 1H63A 3STCA 1XYCA 4V28A 2ZRVA 4DYJA 4PBFA 2R1PA 3M0MA 4V15A 2OO0A 1V3MA 1DE5A 4OGZA 3C61A 5HQEA 1FP9A 3MWAA 3WJSA 3CUXA 4N42A 4V1XA 1GVFA 2ZKMX 4GKTA 3AIBA 3W1PA 3REQB 3W7EA 1WOBA 1K4HA 3A7AA 4MPQA 2PDGA 2PWHA 1FWDC 3BWWA 4C6EA 4HYVA 1QASA 4TV5A 4K2SA 1NY1A 3LSBA 3W84A 1FVPA 1FEAA 4FZIA 2O7SA 4UQBA 4L56A 3TNBA 3MKKA 1KKOA 2VD8A 3HZ3A 4Q4KA 3MPGA 5CQ1A 3GVGA 3LTPA 2W63A 1E72M 1JG9A 3DECA 3TZNA 5KSWA 3A6OA 4WKAA 3OBEA 3ABOA 4PRWA 1L6GA 1G01A 4QLJA 1XLFA 5H8PA 1LQAA 4MVAA 1CXIA 2BY1A 3SR7A 3ZR5A 1XLDA 3RLUA 3SUTA 4D2JA 1E43A 5LA0A 1Z44A 3NVTA 5BWAA 2YBTA 4U31A 2RJGA 3L66A 3WDJA 1WO2A 4I7UA 3IACA 2PDFA 3H7VA 4C7GA 3DHFA 1ZUAX 3LUTA 3PZ9A 4NUWA 3W38A 4M8UA 1HKKA 4M24A 3VC6A 4XWUA 3EMQA 4NU7A 3AJ7A 3EB4A 3M5XA 1HVQA 5JCLA 1AVAA 3DKLA 5M17A 1XQLA 4O18A 3VMOA 1F6PA 3R5EA 1TQXA 3P62A 3VD7A 3VNDA 1M6IA 3V3WA 4Y8EA 3DHDA 1F8MA 3EXTA 1XLCA 8XIAA 4MKNA 1MI3A 3K4WA 2EPHA 5IXEA 1R9XA 3ANYA 3GRTA 1WKYA 3HOJA 5KZDA 1KNWA 1OG0A 5ECVA 3T0AA 3ARZA 4AW7A 3LOTA 3MWCA 1US0A 3CH0A 4HZ6A 3VNZA 1TUXA 3FKKA 2J66A 1RD6A 3KRSA 1GG0A 3AIEA 4QS6A 1QPRA 2QAFA 4P8XA 3KTCA 3LN3A 3ITXA 4IMDA 2ZZ6A 1Y8BA 2MANA 3MUIA 3ZQ9A 3SUVA 3EX1A 2X16A 3UA4A 3FYOA 3MBDA 4J2PA 4EWJA 4H2CA 3BLFA 4DUOA 5DBUA 3RN6A 3ITYA 4MJ4A 5AYZA 1XI3A 2XM2A 3DYMA 3VKCA 1DL3A 5K3VA 3AZSA 3C0JA 2B7NA 2WJFA 4UCGA 1W6TA 2Z29A 2E4TA 3E6EA 3QPYA 1ZAJA 2ISDA 1MDLA 4FI4A 5FJJA 3DDMA 4ML4A 2GR3A 3WQWA 1ZTVA 1W91A 2WMIB 1ZP3A 3SCTA 4OOZA 2WVVA 5PTDA 1QT1A 1VCVA 3UJSA 4M19A 2I9UA 4RNIA 4I7WA 4C7DA 4ZEPA 3NXLA 3QYSA 3LPOA 2PF8A 5KZMA 3RO6A 5A8NA 4LUSB 3R0UA 2E68A 2NT0A 2CWXA 3JZUA 2GQ8A 5HJXA 4E4UA 4W7UA 2Y7GA 4RE3A 3HQOA 1BWLA 3KRZA 3EYPA 1MO9A 7REQB 1ISZA 4JTQA 4YLWA 1S2WA 4CEXC 2YB1A 2J9YA 5ABFA 2XWEA 4LVGA 1KFWA 2QJGA 2XIIA 4TVWA 1O5QA 1UCWA 3E1F1 3PTKA 1DTNA 2RGMA 1TV4A 3ZJ6A 1M04A 4X0VA 4YPJA 4DPPA 1C7TA 3WLJA 2QPUA 2A5HA 1BKHA 4NEVA 1GVYA 1M7JA 3VVGA 4HCLA 1F3XA 4GRSA 4DHGA 3F5LA 4DWSC 3M0HA 4CGTA 4YYCA 4N4QA 3WF1A 3Q6JA 1OABA 2WSYA 3CHCA 2DVXA 2JBMA 2X1UA 3KL0A 4DBUA 3SN4A 4ICMA 1WZLA 1BHGA 1JQVA 3DXIA 3M0KA 2WHLA 4WJEA 1PX8A 3TAOA 5LIWX 5LGZA 1KXHA 3L4ZA 3LRMA 5DMMA 2W61A 1OFAA 2E6FA 5MF5A 4PUEA 1BWCA 2VX4A 3NQ2A 3SRFA 4RE2A 2Q6ZA 3QC3A 3TROA 1AL8A 4M51A 4AZCB 3ZIZA 2PDIA 5IRPA 5BXRA 5CPOA 1XYAA 4Q8TA 3WBAA 4QS5A 4QQ3A 3BCDA 3CS2A 2FZ9A 3UT0A 3EEZA 2WKJA 3NEVA 2Y89A 1OM0A 1JZ2A 3RU6A 1PXGA 1QOXA 1Y0EA 3EB2A 5LXEA 4B2DA 2I57A 6REQB 2ZRUA 3ELFA 2OSYA 1JXKA 2WM1A 4FPSA 3FOKA 5I23A 1SPQA 3ANUA 4C90A 3R25A 5A94A 3FIGA 2TYSA 1X97A 1UR4A 4WZHA 3KL3A 5D05A 1PWLA 5E9AA 1J01A 3H7UA 3VNKA 4H4YA 1WB0A 1B3YA 2C3CA 2ZXBA 2C7FA 1GEQA 2MNRA 1ZHAA 3RHGA 4EPBC 3GH4A 4FDCB 2YCIX 1UP2A 2F84A 1JXJA 5AC4A 1JNDA 1ISWA 4HK5A 3NRZB 3W7DA 1GQNA 1DP0A 3WLIA 3VC5A 4Y96A 3O7UA 3EXSA 1JZ5A 2PWUA 4ADSA 1E5NA 2FVMA 2YCKX 1SZFA 1E73M 2INZA 3U0HA 1SFJA 1UWRA 3GTFA 2G96A 4AXNA 3S0CA 1FH7A 1KBIA 3NQDA 2QJHA 1BPLB 1I2OA 1UWQA 2BXVA 2WMGA 3H53A 3PPFA 3RO8A 1ECQA 3VM7A 4C6PA 2IPFA 1HG3A 3GHSA 3FA4A 3QBUA 3ZLGA 4WUIA 1A5LC 1F6YA 4O1DA 3RNDA 3CUGA 1H2IA 3E0IA 2WBGA 3TW7A 4UOZA 2NVCA 2OT1A 4EMJA 2VQTA 2XGZA 4W4QA 5F2IA 4F2TA 1FWHC 1VRXA 1FEBA 1G4EA 1XDJA 4CLMA 3CJPA 2ZZ4A 3ZJ8A 3AS2A 2WO5A 3PZVA 1AQFA 1L0PA 2FHFA 1EYEA 1DV7A 1UR9A 5U4NA 5KETA 2VM8A 1QAPA 4A8LA 1GNXA 2FZDA 4CQBA 3NOEA 5C9RA 1RBOB 2X8GA 1PKLA 5FS7A 2OLHA 4JIQA 3NEHA 5DRIA 2FTYA 1AW1A 4GCAA 3Q94A 2A7PA 2XGBA 4F79A 3II1A 2QCEA 4JR5A 4MAVA 2GJPA 3M47A 3NQ8A 1JDDA 3URQA 2PLCA 4MPKA 4ML9A 1WYIA 4HSHA 4Y2WA 1RQBA 3W1TA 1UG6A 3NVDA 2G3NA 4YWIA 1RP9A 1AH0A 2VR2A 2AQWA 1LP6A 4IQDA 2HK0A 2X8HA 4UR9A 3LPFA 1UMLA 3CUJA 1FFQA 1GYMA 1S5MA 2B4GA 3GE7A 4WDWA 4H9TA 3WL1A 1MW0A 4H9UA 3HV9A 3BW3A 3QY8A 5I00A 4REQB 4NJGA