3T4WA

The crystal structure of mandelate racemase/muconate lactonizing enzyme from sulfitobacter sp
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
SMKLQDLEVIVTAPPAPGWGGRYWILVKLTTDTGIVGWGECYAASVGPQAMRAVIEDVFARHMQGENPENIELMYRRAYSSGFTQRPDLTVMGAFSGLEIACWDILGKDRDRPVYALIGGRMNERVRGYTYLYPLPHHDMTAFWTSPEMAAESALDCVARGYTAIKFDPAGPYTMRGGHMPAMTDISQSVAFCKAIRAAVGDKADLLFGTHGQFTTAGAIRLGNAIAPYSPLWYEEPIPPDAVEQMAAVARAVPIPVATGERLTTKAEFAPVLRSGAAAILQPALGRVGGIWEAKKIAAMAEVYNAQIAPHLYAGPVEWAANIHLAASIPNILMCECIETPFHDQLIKSTIKVEDGFITAPTAAGLGLEVDEALARAHPYTGNGLHLEMQEAPCDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of mandelate racemase/muconate lactonizing enzyme from Sulfitobacter sp
rcsb
source organism Sulfitobacter sp. nas-14.1
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme family protei
total genus 133
structure length 396
sequence length 396
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3t4wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3t4wA01
1TZZA 1KKOA 2OZTA 2OLAA 3RRAA 3VCNA 2QDDA 2FKPA 2GGHA 3N6JA 2CHRA 3ZLHA 4HNLA 1PDYA 3JZUA 3PK7A 2OVLA 1OEPA 4HCLA 3T6CA 4HCHA 4F4RA 3MUCA 3I6EA 3P93A 2OQYA 3R10A 3NO1A 3SN0A 3DERA 4E4FA 1SJCA 3CYJA 2XH4A 1EBHA 3JVAA 1XS2A 3V4BA 2PU0A 3R11A 3GY1A 3TJ4A 1TE6A 4KPLA 1F9CA 1DTNA 3H12A 3TCSA 1BQGA 3UGVA 1NELA 1P48A 4IP4A 3R0UA 3CB3A 4JN7A 4EWJA 1FHUA 2OZ8A 1KD0A 3TOYA 3U9IA 2P8BA 2ZADA 2PGWA 3OZYA 3DG7A 3OTRA 4Z17A 1ONEA 3N4EA 2PP3A 3S5SA 3FVDA 4FP1A 3ES7A 1MNSA 4GISA 4IT1A 1MDRA 3SN4A 3IK4A 3N6HA 2OFJA 4M0XA 3QN3A 4DN1A 3GC2A 1RVKA 3H7VA 2HXUA 1PDZA 2FYMA 3DFHA 3H70A 2XH7A 3K1GA 3MQTA 2PTWA 3TW9A 2GGGA 2DW7A 2P3ZA 1TKKA 3I6TA 1E9IA 3ES8A 4E6MA 2O56A 4YWSA 1KKRA 3UJEA 2GDQA 2PMQA 1L8PA 2PA6A 3GO2A 1MUCA 2POZA 2PP1A 6ENLA 1KCZA 2HXTA 2P0IA 3NXLA 3CK5A 3Q4DA 4IP5A 3RGTA 4MGGA 3B97A 3SN1A 4MKSA 3V3WA 4DX3A 1JPDX 4E4UA 2XH0A 4J1OA 3T8QA 2OPJA 3V5FA 2QGYA 3OZMA 3UCCA 3CAWA 1EBGA 1R0MA 3R1ZA 3IJQA 4HNCA 2GGEA 3ZVIA 4JHMA 2AL2A 3UJRA 4HPNA 3NFUA 3EEZA 3P0WA 3UXKA 1ECQA 1IYXA 2OX4A 2PU1A 3NZGA 5FJPA 2PODA 2MUCA 1EC8A 4HYRA 4FI4A 3BSMA 3OP2A 3Q45A 5BOEA 3SBFA 4K1WA 1SJDA 4G7FA 2AL2B 3QPEA 1MRAA 3TQPA 4MMWA 3TWBA 3PWIA 3THUA 2AKZA 3SQSA 3T4WA 3BOXA 5FJUA 3MZNA 3VA8A 2AKMA 2QQ6A 3ZLGA 3MSYA 4E5TA 3IJLA 3UJSA 2I5QA 3MKCA 4GMEA 4GFIA 3ZVHA 3OW1A 2OKTA 3FJ4A 1WUEA 2QDEA 3V5CA 2AL1A 3S47A 5FJOA 2RDXA 3RCYA 1EC9A 1XPYA 2XSXA 2QJMA 4GGHA 1W6TA 1BKHA 3VFCA 4GYPA 2XH2A 2PPGA 4H1ZA 3SSZA 3CT2A 1SJAA 2PTXA 5EU9A 2QJJA 4A6GA 3BJSA 4E8GA 4J3ZA 2NQLA 3TJIA 4H2HA 3TTEA 3VCCA 1JDFA 3QLDA 7ENLA 2MNRA 4ZA0A 2PCEA 1EC7A 1R6WA 4GIRA 3KUMA 4IZGA 3DESA 1WUFA 3RITA 4HN8A 3PWGA 3ZLFA 4A3RA 2QVHA 3JW7A 2P8CA 4KEMA 3DIPA 2HNEA 3I4KA 4G8TA 3DEQA 2QJNA 2GGIA 1YEYA 2PGEA 1JCTA 3FV9A 5FJTA 1MDLA 4ENLA 1FHVA 4H83A 4KT2A 2GL5A 3R0KA 3UJ2A 4ZCWA 4DYEA 3HPFA 3P3BA 3EKGA 4JN8A 3T9PA 3UCDA 2XGZA 3UXLA 3RR1A 3OPSA 3GD6A 4ROPA 2PTYA 1JPMA 3DFYA 3D46A 4IHCA 5IDZA 4DHGA 3FYYA 3N4FA 4GGBA 3U4FA 2ONEA 4GYPC 2OG9A 4DXKA 2DW6A 1NU5A 3FCPA 2OO6A 3ZVHB 4K2SA 3SJNA 5J04A 3QKEA 3R25A 2GSHA 3CXOA 3IJIA 3ENLA 3STPA 3H8AA 1ELSA 3VC5A 2OZ3A 3PFRA 4Z1YA 3DG6A 3QTPA 2PTZA 5ENLA 2GGJA 1SJBA 4KWSA 1P43A 3MWCA 5FJRA 3DDMA 4A35A 3FXGA 5BOFA 3VC6A 3VDGA 2ZC8A 4HCDA 3DGBA 4IL2A 4DWDA 4K8GA 4IL0A 4M6UA 2HZGA 2OQHA 4X2PA 3D47A 2P88A 2PP0A 2PS2A 4H19A 3RO6A 2PSNA 3UJFA 3DG3A 3TWAA 3MY9A
chains in the Genus database with same CATH superfamily
4Q7BA 4GCAA 4DF1A 3UU0A 1W2PA 1LORA 4NX5A 3RX3A 3BARA 2CPUA 3CTTA 3CZKA 4XK2A 2PLJA 4NUWA 2JK6A 5I3JA 4YHGA 1UR3M 2BB0A 3N29A 1BWLA 2NT0A 3T0AA 3TN3A 3VFLA 1YW1A 4HCHA 4WGHA 5REQA 4A29A 4E38A 3EWCA 2ZIDA 4QNEA 2X0HA 3CYJA 1D3CA 1JD9A 4BWLA 2XH4A 1J8VA 3EX1A 3WNLA 3NIYA 3H2NA 3E3HA 1DL3A 3S2MA 4TVWA 2B7NA 2DIJA 3TCSA 4LGXA 1C91A 2W3SA 5A95A 3W7EA 3LNPA 2J7CA 3UGVA 3UZWA 3J7HA 3S6OA 2CFFA 5G1MA 4LYPA 3UG3A 1ALDA 2VX5A 3TYDA 1J96A 4ADTA 3A7UA 3PM6A 1GVSA 2AQOA 1LOLA 4BCEA 3DC0A 1S5TA 2VI0A 3S5SA 2HBVA 4FF5A 4GC4A 3EOEA 1PX8A 2Q8XA 1WAUA 4ZMGA 4MYAA 2Z7KA 4PB4A 1F07A 3OA5A 3C86A 3BLLA 4WEVX 3VNYA 3VIMA 4ACYA 1FXPA 4GBDA 2YW4A 3W23A 2J79A 4KETA 1ZRQA 4UFHA 3DX5A 5IHRA 5A6JA 1F3WA 4E6MA 4CVUA 2A4AA 3HZ3A 3M43A 5CLTA 3W6YA 1W3NA 4W7WA 3AMDA 1OX4A 2PA6A 1O5KA 4PCSA 3DKLA 2QPXA 2VZTA 2CXGA 4Q8NA 3I6RA 2FDMA 2Y5SA 3W37A 3I3BA 4AHQA 3B03A 2JGYA 3VGGA 4ZB2A 2C8NA 5FF2A 3VOJA 1NDVA 2V3AA 4PCFA 3EDDA 2XZ7A 4R53A 1KFWA 3NO5A 1XX1A 1S38A 4AYSA 3C52A 3UWYA 1ISZA 2NQHA 4GZ7A 4A22A 1JOAA 1YE4A 1SZEA 3W26A 1HJUA 1UROA 2DSUA 1DQXA 1RD5A 2QF7A 3BE7A 4HNCA 1E9YB 3LV6A 3VDBA 1QDSA 2ZZ0A 3UXKA 1ECQA 3ETRB 1AW2A 5A8MA 3NZGA 3R13A 2CU0A 2PWUA 3AXIA 3VNJA 4A3QA 4LAUA 3IRSA 4EXQA 5JH2A 2A3CA 1JCLA 1VP5A 4Z1CA 3TFXA 3P80A 4O4VA 1MEHA 4B5SA 4YCOA 1ITCA 3EWBX 1L6SA 4OTKA 4IMEA 4Y9AA 5LIWX 1QOQA 4GWEA 3ANYA 2O9OA 4HNUA 2GSEA 1TSIA 4F0HA 2Y0FA 3EMQA 1SB3B 3WD1A 4FNPA 1IR1A 5DX7A 4KWOA 1WZAA 1RQHA 3Q6JA 3H2EA 4HPHA 1EGVA 3BMWA 5AVNA 1VBGA 1SZNA 3TCEA 3PY2A 4N9EA 5JBFA 2OGJA 4NAFB 4LVAA 2DSVA 4UMBA 4OT7A 5FJOA 1TJ1A 1JZ6A 4ZQMA 2RJHA 2Z1WA 4H9ZA 4QG8A 3UZXA 2FZMA 3V5OA 3NXFA 1AMKA 4QFUA 2DFAA 3KXQA 3FLUA 1P4CA 1LP6A 3NTYA 5MF5A 2OGYA 3WH7A 3WLTA 3TP4A 4LUYA 3EPMA 1JYWA 4PRTA 4C6KA 1ICPA 1CNVA 6CGTA 3AYTA 4AZBA 1XRTA 2J7DA 4UQBA 3TAKA 4MB1A 3EXTA 3TC3A 2CNCA 2YDSA 3CIVA 1C9DA 1DIOA 5K2ZA 2B81A 4H4QA 3GYCA 2YCLA 3UR7A 4BS0A 2PTDA 3R94A 3WQFA 1VDVA 2QMKA 4P7QA 4MVAA 4JHZA 3VKBA 3JW7A 2YPIA 1JRBA 2DU2A 3I4KA 1ZAIA 3ZYZA 1GOKA 2R82A 1V0NA 5AC6A 1Q2RA 4D1JA 3CV1A 4RDZA 2BMBA 4ENLA 1RK5A 2FMOA 3W3OA 2PURA 3AXHA 3SO7A 3PZOA 3UERA 1O95A 1AG1O 3PBYA 3NOEA 4NF7A 1LRQA 3TOPA 3QR1A 3CWHA 1XUUA 1OJXA 2D23A 4LCSA 4AY7A 1DOSA 1E4IA 3RPDA 4J57A 2GJNA 4M1BA 3I4EA 1QMLA 3TTYA 1VHNA 1NU5A 4XZ9A 4OKDA 3FYOA 3SGGA 3W73A 2Q09A 3SGUA 4IJCA 5G1YA 3DFPA 5JXQA 3CB8A 3RDKA 1IT7A 4BURA 2JALA 5BNKA 1WKEA 3QFWA 1ELSA 2AAMA 1V3LA 1JI1A 3HGOA 1POKA 4RE0A 4V1XA 3LCGA 1DTUA 5D8WA 4RE3A 1ADOA 3W00A 3EMZA 3IVTA 3AIEA 2Y7FA 1KTBA 5IOBA 2MANA 4UIOA 3LQGA 1SSDA 4YTQA 1C3FA 2PP0A 4H9VA 4Q7NA 1X1NA 1H1YA 2C6QA 4DLMA 3MI6A 2DUAA 5D09A 3EA1A 3T0CA 2J7HA 2F6XA 4DVOA 1FCUA 4LCRA 5D05A 1E0UA 3T40A 3ZOAA 3MSDA 2E6FA 3NWRA 4DJEA 3BG9A 3M46A 4PUJA 2Y2WA 3SUUA 4DUVA 2BP1A 3ARQA 4H00A 3UR8A 1GYLA 4XVDA 3TONA 1E6ZA 3S1UA 4GYFA 4LBUA 3WNPA 2UBPC 5LNVA 3QRHA 3MWAA 4LUTA 3V35A 1ZJAA 2NVAA 2PWVA 1AL7A 1AUSL 3BL3A 4AWSA 3TJ4A 1R85A 2INFA 5LNSA 3U6WA 4R7OA 4GIAA 4JTLA 4GK8A 3KBSA 1KQYA 1W2VA 1EYEA 2XISA 4M6QA 2D3LA 1FHUA 2GSJA 2FVLA 1EXPA 4H7ZA 4PZVA 1ZGDA 3GR7A 2ZZ1A 5AOUA 2J88A 1QI3A 2Y5JA 1ISWA 5BU6A 5EY5A 3T09A 1H7WA 1ZBWA 1IGWA 2CIPA 3QQ0A 2D0FA 4AF0B 3MUIA 3W84A 4PMQA 4TV5A 1HKMA 3R5EA 4LC6A 4ZODA 2V3DA 1YBQB 2GUBA 3IK4A 5FAGA 2OFJA 3M0LA 5KEZA 4DN1A 4O0QA 2OWWA 3TYAA 3K2GA 3DI0A 3H7VA 5EB8A 3UWWA 4JDBA 1US3A 2F7FA 5H8UA 3W0KA 1S2TA 1UD5A 1PKMA 2F61A 4NAEB 4B5XA 1JRCA 3RHGA 2XGBA 3AHXA 3NQ8A 3O6DA 4I6VA 3EF6A 4NAFA 3CZJA 4LF2A 3VD3A 1K7XA 4B4HA 1MVYA 2AQWA 4XZNX 1L8PA 1T5AA 4MB4A 1UUMA 4AWTA 1R47A 1KCZA 2DY3A 3STCA 4QJ3B 5FACA 2YOCA 3NQFA 1ICSA 1UWRA 2VXNA 1LWJA 3QFAA 4TTUA 3ARVA 1JPKA 1K7FA 2CZFA 3P74A 3IPWA 4QEHA 3WMLA 1H7XA 4DO4A 3VNLA 3TMLA 4IIFA 3AM9A 5EBKA 4JNYA 4BZYA 2G4JA 2F84A 1TFVA 3L2LA 1JJKA 2YL5A 1X8CA 3S2LA 3REQB 3NVWB 1KM2A 3M9YA 3UVAA 1WDSA 1BYBA 3NFUA 2X42A 3CS2A 3P0WA 1VEOA 5HUOA 3W70A 2B7QA 3PC0A 2YQUA 5A6BD 3WMSA 3MUZ1 5D03A 4A05A 3LPFA 3N3TA 5GNYA 1ZTVA 2J9ZA 4M5PA 2VX4A 4GI8A 3VKDA 5CBIA 1F3PA 1W9VA 2QS8A 1DJXA 1JCYA 1W1B1 1DPMA 1XRFA 2VFIA 3VUSA 4HOXA 4C6PA 3H24A 5DY2A 1WKDA 2ZICA 3NAVA 4NP7A 4DLFA 4PCTA 1FWRA 4IGNA 1T7LA 2FIQA 2E5CA 1D9EA 1PL9A 2V81A 1U30A 1A4MA 1A5OC 3G1YA 1VPQA 3GD4A 4ZQCA 1B3ZA 1OCNA 2VURA 3ANUA 4LVDA 5KMYA 1OCQA 1VFHA 1KXTA 1MUMA 1SR9A 2V30A 5CBJA 3W7GA 2IQDA 4RW3A 1XLHA 2GDUA 4S3KA 2WQPA 1W9PA 1JUEA 4KERA 4MTVA 3IV3A 1BG4A 3KRZA 1BKHA 2YXGA 3A13A 4C1KA 4XKYA 1YHTA 3B9OA 3UA4A 3DK8A 3N11A 1GPFA 2ZA1A 1RLDA 3ATYA 5AHFA 5BU9A 4YYFA 1JCNA 5HMDA 1QPQA 3KLJA 1OVDA 3FA5A 4GCXA 2V5LA 5D2XA 3SIMA 3WJSA 3QEZA 3SY5A 4AZCA 4WUIA 3N9KA 4EXBA 3ITLA 4ZE5A 5EMUA 4AIOA 2B31A 4Z1BA 1KW1A 3KBVA 4M19A 4IMAA 3KUMA 4X61A 4L6HA 5CGTA 3DESA 1AQFA 3P8IA 4HQVA 4S3BA 1V3IA 4KEMA 3PJTA 1ZB5A 2O9RA 1XCWA 3AUOA 4O4WA 1P1XA 1AFSA 3MP3A 3HO8A 5A2AA 3B9NA 1FFQA 2AOSA 4MAZA 1CGYA 4UTJA 3R0KA 1GW9A 4JOMA 3PBWA 3OHIA 1TR9A 3OOQA 3P3BA 1CT5A 3DU0A 5EMJA 2QKFA 4X0VA 3BW4A 2ZRVA 2WP5A 1EF2A 3EAOA 4C1NA 4R27A 3P5ZA 4EP8C 2X09A 3U4FA 2NVDA 4TVCA 3LXAA 4Q6JA 1GREA 4EAMA 5E93A 1H5YA 3QLLA 1OFOA 4LYRA 4RDVA 1EX5A 2WZTA 3NQVA 4OBSA 2JKPA 2ON3A 3E0LA 3MJYA 4DYJA 2WCAA 1WZKA 1S7MA 1GOMA 3R43A 4AYGA 3IJ8A 1OT2A 2BHZA 2XFFA 5GJPA 2PI6A 3U8GA 1TX0A 1OABA 3NZRA 3DGHA 4Z1YA 2BGNE 4EF9A 5ENLA 1Z6KA 3N2OA 3MWCA 5I03A 1SVDA 5BOFA 3UPMA 3VDGA 2WSQA 2VC9A 3ZMRA 4FR1A 4UQDA 3LB0A 1XH0A 4GX9A 5FJIA 2DZVA 4LNYA 5CC6A 1OCBA 1XD0A 1MO9A 1W1PA 4WD0A 2O7QA 4FLQA 3ZZ1A 5CPOA 1VCVA 4GO8A 4ICCX 2JE8A 4UFKA 3SY1A 4H4PA 2Y70A 3GZAA 4C5ZA 3LSCA 2Y61A 3G1VA 3ALFA 3MHUA 1JIBA 3AYSA 1Y5VA 2ZXAA 3TTOA 3V75A 2OVLA 1NIUA 5D9NA 1DHPA 1FWIC 1UMLA 1CGXA 2QCGA 1RPXA 1X7IA 4CNOA 1B4KA 1Q4WA 5C2XA 1XG4A 2G3MA 2JGQA 4MADA 1CXHA 3R10A 2VC7A 3PAOA 4H50A 1JAKA 3VABA 1XICA 4IM4A 4JFTA 4B2DA 4UZSA 4O13A 3R11A 4RNFA 4LU0A 2WK2A 4QNWA 4W7UA 3WUEA 3LHTA 1ZP3A 4A3UA 3KDNA 4K68A 3ISIX 2ZUWA 2ZXQA 2VKZG 3NUKA 1P0NA 4ACZA 5I07A 2DZUA 4JTRA 3S1VA 1TCMA 4KRTA 2E77A 4NASA 4Q4RA 3LUTA 4C6NA 1DQUA 5AHLA 3A12A 2Z27A 4GISA 4K7YA 2CC0A 1CZ1A 2ACUA 1KM1A 1MDRA 1K4QA 3C56A 4HU0A 2DGAA 4F48A 2OXNA 4CCDA 7REQA 3PWAA 1B3VA 3VUPA 2V9DA 3WNKA 1I2PA 4E2VA 3MI3A 3WF4A 1PDZA 2GQAA 4HK5A 3OG2A 1E6XM 1TWSA 2AAAA 3UWVA 1RBOB 4MF4A 4V1YA 4CN6A 4ATLA 2PDKA 1UMYA 3LHUA 5A2CA 2DVXA 2XIQA 3GG0A 3WD4A 3WQ6A 2E68A 1UPMB 5EYWA 4ADSA 5I6SA 4QLKA 4CD6A 3LV5A 1IF2A 2W27A 6ALDA 1QCWA 2PP1A 4AISA 1GVYA 1KRMA 1DV7A 3G0SA 4W5UA 2PDHA 2OQLA 1LTDA 1CPUA 2WKGA 3TTSA 2Z1SA 3VYLA 3HMJG 3V1PA 4JTAA 4J1OA 1Q65A 2DSWA 3LB8A 2OPJA 2IKIA 4DZIA 3QSTA 3WNOA 1S5WA 1XRVA 3AIRA 3H2FA 3UCCA 3VDCA 3TX9A 3AU2A 2JFEX 3BXWA 2HK0A 4L4OA 4WGXA 3WK0A 3NR0A 2EQDA 3ABSA 1PYMA 3N4AA 1XGDA 3UJRA 5BMXA 1GESA 3EEZA 4AEOA 2VOMA 1REQB 1JXJA 2DORA 3MKKA 3NM1A 1HTIA 3M0ZA 1AJ2A 1ZJBA 2ABAA 3CUZA 2JIEA 4GINA 1EC8A 3L4UA 4OQVA 3OP2A 3W1MA 3V36A 4XD5A 3IV8A 1VD6A 3LLFA 4W87A 5LZLA 1UCWA 1UD4A 1QUMA 4LUJA 3WD3A 1AJ0A 5FL1A 1JL8A 5LIXX 3OVRA 4MUPA 3KL0A 4H4WA 1Z8AA 5AY7A 2AKMA 1Q6CA 2BVDA 4NT0A 3ZLGA 3NQGA 5EGRA 2NX1A 3AOFA 1R5YA 4YWIA 4BQ3A 4LYQA 1OYCA 1QW8A 3DAQA 3MB9A 4H9UA 2YVGA 2V5KA 1KFLA 4F2TA 5LIUX 3WJWA 3GW0A 1JYXA 2PDMA 1WUEA 3EGJA 3W25A 3B9JB 1HUVA 1KV8A 3L5LA 3PBVA 1B30A 3UQNA 1GRBA 1XPYA 2XSXA 3W7KA 3HQPA 2FZDA 4LUTB 4MJ4A 3NVVB 3BAYA 1WDWA 3E9AA 1P1MA 4QM1A 1XGEA 3B4YA 3WLKX 3EOSA 2X8RA 2TODA 3AHTA 3YPIA 4ZE4A 2BWGA 2E5BA 5D32A 3S9ZA 4TX6A 5T9BG 3CO4A 1R3QA 4J3UA 1F74A 4LAKA 1KBKA 3KOXA 3UZZA 1M53A 1MQPA 1F3EA 1CGWA 2EG7A 1WBJA 1MI3A 4MWAD 3IUHA 3R4IA 1E6QM 3RM8A 3O2LA 1ECEA 4MG4A 3IGSA 3LZ5A 3H4WA 4Q8WA 3U7BA 1OYAA 2C1GA 4C7DA 4E8CA 3SW6A 3DIPA 1JCXA 3GRTA 1NTHA 3DENA 4P7LA 3WQ4A 1G69A 3CT7A 3BWWA 1TR1A 4C6JA 4PFHA 4KS0A 4POCA 3MMTA 3N9SA 5BYWA 3CTLA 2YSWA 2EKCA 1D3GA 3L21A 1FWGC 2V3BA 2V2CA 1DQWA 4MLJA 5C71A 1SW3A 4BWLC 4EPKA 4DRSA 1QK2A 3SUVA 5CZSA 3DI1A 5AC7A 4YWOA 2ZE0A 3ABZA 3DC8A 4Q8PA 1IT0A 3THDA 4DXKA 2G3JA 5K3VA 4UTKA 1VR6A 2GLKA 4L1WA 4AD4A 2HTMA 4AF0A 4TVYA 3CGCA 4AWUA 4IH3A 1B3OA 4WSHA 1C29A 3LQLA 2OYLA 3QHMA 2PD9A 1I4NA 2DJXA 3WLIA 2YKKA 2O9TA 4WVXA 1H41A 3NL3A 3QTPA 4FX7A 1EP3A 4G1KA 1MW0A 3R6IA 2FGBA 5DN1A 4DUOA 1U5JA 1BYAA 3CEPA 5ABHA 5M3WA 2XFYA 1M7XA 4B5UA 4XSLA 2GVEA 4XG1A 3TWAA 3WDPP 1O6IA 1G4PA 3S1WA 1SW7A 2PBOA 4IPLA 1IXQA 1UH3A 4KCVA 1GXFA 2ZUVA 1XLAA 3LXBA 2CHRA 3GNRA 3W1XA 7TAAA 2VVNA 5I78A 1PZ1A 2Z00A 1EP1A 1PTGA 1PDYA 4QJ4B 4Z2KA 2WYSA 5EFFA 4H4ZA 5DT5A 1SQ7A 4UB9A 2WVTA 4UXDA 2GRTA 3A4AA 3P82A 4U31A 3SN0A 3KFTA 1SJCA 1TIWA 4FK9A 4HA3A 1VLIA 1J5SA 5AYXA 3ICJA 4CKQA 1JFXA 5KSWA 3GNXA 3QKZA 4WOQA 3WFZA 2B4GA 1LL4A 2Y8UA 5FIPA 1H7PA 3PG8A 4W93A 2YFOA 5SWUA 4GUIA 1CLKA 5BROA 4JN7A 3GUGA 1FECA 4JTQA 2ZCGA 5CPQA 1AQHA 1PPIA 2P8BA 3NPUA 2ESCA 3RYSA 1XL9A 3SCQA 1JUBA 4I9AA 3N4EA 2CZVA 1FWTA 1KFJA 3NDYA 1HVXA 3W1NA 2NX3A 3VPLA 3FVDA 2CCRA 3S9YA 1HKVA 1YQ2A 2WBAA 1K9FA 4M0XA 4H6QA 4UFLA 3VGEA 5HA7A 1K6AA 3M0VA 3LCIA 1M7PA 4DJDA 1OF6A 2DP3A 1E0TA 2W66A 4O17A 3G1SA 3FDKA 3GAYA 3WL0A 2DW7A 5C5YA 3MV11 4D8ZA 4LA1A 4M52A 1IQ8A 5DANA 1XYAA 4NZ3A 2P76A 4JFWA 2VR4A 3CQHA 3UG8A 1WDDA 4UTIA 3W86A 2FZNA 3NJ3A 4CQBA 1J11A 4PH6A 4GQ0A 2QUTA 1EX1A 1H62A 1JDCA 2DVTA 4NXKA 1TCDA 3N2MA 4IP5A 3VILA 4ATWA 5I3KA 1M68A 3K30A 1S46A 3BVJA 1LWIA 2C19A 3W76A 1XYBA 1TA3A 3K4AA 3BW2A 4NJGA 4DM1A 1G67A 8XIAA 4E3TA 3HA1A 1R2RA 1EJUC 3QR0A 4P8VA 4Y9OA 2B7OA 3GW3A 1AW5A 4S39A 1Q2SA 1STZA 2F6KA 3W6LA 2G0WA 3IUIA 3L0NA 3WF3A 4F8XA 4JHMA 1KCKA 3OGVA 3GS6A 4IWWA 4YVXA 3KHDA 2EBNA 4JBRA 3UR5A 2PEVA 2X2GA 3EDEA 2FQIA 2OR2A 1BXCA 1GJPA 3ARUA 4B5VA 2W61A 3FKRA 1AVAA 4MKNA 3F4NA 3BLEA 1F73A 3W72A 1C7TA 3IVSA 1W5QA 3IWPA 1PBGA 5E0KA 2YCLB 2YA1A 2NSXA 2CYGA 3GH5A 9XIAA 1SM9A 1QPRA 1A80A 2GWNA 2AKZA 3SQSA 4C60A 3BG3A 4MM1A 3OC4A 1QHOA 4JIQA 1Q6EA 1JRPA 4DNMA 4QJ1A 3MSYA 4QG9A 4M7SA 3ERPA 1UB3A 3IJLA 4AWEA 4NZJA 1Q1WA 1BF2A 4J28A 2ZUUA 4GVIA 2ABBA 3OJGA 1AA1B 1FH8A 4QP0A 4L9XA 2JEPA 3E2VA 3V5CA 4AHOA 3S47A 4F2UA 1JEHA 3MS8A 4RW5A 2BSLA 4MWAA 3AS0A 3LGDA 3HURA 1KQZA 3VD7A 3WDJA 5HWMA 4JFVA 4GYJA 1B54A 5BZAA 2QV5A 3W7CA 1S3HA 1WKFA 3N14A 3GG1A 4LY4A 1VBJA 1TA3B 2G4FA 4F3HA 2IUZA 3UXAA 4DZ5A 3NA8A 4E8GA 1TO3A 2ZUNA 3WELA 1RR2A 3VCCA 4A2SA 1XV8A 1ML1A 4PMNA 3AAMA 3N2CA 1OFAA 2B0MA 4TMBA 1M41A 4Q4KA 3H7UA 3QOMA 1VBRA 4US5D 3UWUA 1SGJA 2Y7DA 4JQAA 4QLJA 1E4MM 2RAGA 4UQAA 1OC7A 2G3FA 3HGSA 1K1DA 1V3MA 1F5ZA 3IGHX 4H8UA 3MSRA 3MVTA 3EB4A 3W27A 4GZIA 3M0MA 1XBXA 5LGZA 1W91A 5GPRA 4UCGA 1FX6A 5C9UA 2CITA 4US6A 3AMKA 4H7VA 3THCA 1JGIA 2E9BA 2IXVA 1XDLA 3OPSA 2QVNA 2WHLA 2CEQA 1Y7VA 3GHSA 4NNBA 2QAEA 3A4WA 4MSSA 1F8WA 1QBAA 2OELA 3CL7A 2ONEA 4GYPC 4JTJA 1WAWA 4ORIA 1SFJA 3FGCB 1WXZA 3CASA 3L7RA 3WLLA 1H2JA 3NG3A 1EPXA 4LFYA 1YIXA 2EPKX 1ME7A 3W01A 2FB2A 3W82A 3QKEA 4GD0A 3F2BA 2BGSA 3N19B 2GSHA 2JF7A 1VHCA 4WKFA 3M4HA 1A5MC 3BAIA 1QOPA 1CXIA 2YVFA 3QZEA 1NDZA 3HG2A 2V3EA 5I2UA 2QIWA 3IIOA 5TBOA 4M82A 3TE9A 1G6CA 1ICQA 3KCLA 4O1BA 3S42A 2BOEX 4XB3A 1IXPA 1O60A 2ISVA 4F9DA 3S3GA 2ZA3A 2HCVA 2YJQA 1O4UA 4WQ6A 5LIYX 1KA9F 3APYA 2PDNA 1DXFA 1QBBA 2PS2A 3HJZA 3DG3A 4KCWA 5BXTA 1RHCA 2UY5A 4KF1A 1PV8A 4EQRA 3N6JA 1GKPA 1UP0A 4XUYA 1CEOA 1UJQA 4HNLA 1F4HA 3W74A 4JX4A 4U3AA 2JK2A 1PTAA 4N2YA 3W9ZA 3QPZA 4Z0JA 3CGBA 4KRUA 2ZRXA 3LTPA 7REQB 4GUHA 2BODX 1CENA 3DERA 3E96A 1OADA 4ZSTA 3CUGA 1NPXA 1AODA 4GVGA 1KO0A 4N9CA 3CAVA 2ZRWA 5ER0A 2ISSA 3WBYA 3WEOA 4RE4A 1UKQA 4TVUA 3MMWA 4HSOA 1R30A 2QPUA 5MHBA 1HT6A 3ZWSA 1TPH1 4PCPA 2VEPA 3GE7A 2DSZA 3FA4A 1TPUA 5A6BA 1UH2A 4QS5A 1NOFA 4WLCA 4TVDA 1OQFA 2VP8A 1EJSC 1GOWA 2QULA 2DZPA 1BGAA 5DO8A 3STEA 1TRDA 5LYRA 5AHNA 3GDBA 2DQXA 2Z2BA 3BOLA 3PJXA 1UC4A 2HS8A 3QQWA 5CAHA 4AZIA 3BGAA 4YN5A 1MNSA 3H4GA 1LLOA 3TXZA 1KM0A 4XAZA 3RCNA 3TV8A 3PSWA 2E0PA 4A4AA 5E9AA 3HF3A 3VMPA 3S6DA 3WLNA 4NY2A 3LA4A 3P62A 1L9WA 2DIEA 2XH7A 5I79A 3MQTA 2GK1B 1D8CA 3VNKA 3NEVA 4UQCA 2A7PA 4PN2A 3Q65A 4RK8A 5C2CA 1FP9A 2CLOA 1ESWA 4LY8A 4YTSA 2O56A 4ML4A 2EGZA 1D2KA 2PMQA 3P67A 1HXJA 3U7VA 3UY8A 1PIGA 1V0KA 4F2BA 4HZ8A 4WIWA 1K4HA 1PIFA 2OX1A 1JZ8A 4OUEA 4Z1AA 4A3YA 3AU6A 1H1NA 3C2OA 4YIWA 4NAEA 5CG0A 4MPKA 1IEWA 3N15A 2FPYA 3SN1A 1E5JA 1QOXA 2CLMA 2ZUSA 2XH0A 4RR4A 2C91A 2WMIB 2GQ8A 1BG9A 1WBHA 2GJLA 1K77A 3LG3A 4PTDA 4Q3MA 5JU6A 1R0MA 1H49A 2PDWA 3R1ZA 2CZEA 1WKYA 2BZNA 2YZRA 2FHBA 4W8BA 1RV8A 3EX2A 4CGTA 5H2ZA 2FTYA 2WNWA 4CD4A 2GR3A 4AVOA 2YBVA 1A3WA 2BHUA 3U3HA 3G22A 3PTQA 2QUNA 3LGEA 5IBXC 4KIRA 1GEHA 4MPQA 1J93A 1GHRA 3TMQA 3T0DA 4R5EA 5I09A 4M81A 3EXSA 3R8HA 1W1ZA 4KQNA 4NYUA 5EFDA 1O66A 1GJUA 4K8HA 2F2KA 5CBBA 3QPEA 5JCNA 2YGYA 4IIDA 1EDGA 3CLWA 4WCJA 1EH9A 3LPOA 1HGWA 4C6LA 2ALRA 2WWCA 4NRRA 4Y7EA 1GEQA 1J10A 2E6YA 3BOXA 4TO8A 3MBFA 5D8ZA 1V5XA 4AEFA 3CQJA 3NQ2A 2BBFA 3ITXA 4DIAA 2ZZBA 4HOZA 1YBQA 2XN0A 5KTLA 2BV9A 4RL3A 4UBPC 3HPSA 3UF9A 5F1VA 4NEVA 1I1WA 1RK6A 4ROQA 3UXIA 3N9RA 1FCVA 5DCBA 3TNBA 4PCNA 4TUFA 4AD5A 3QC0A 3GSMA 2VFFA 3II4A 3W1AA 1OB0A 5A6TC 2PTXA 5F2IA 1JZ3A 1K8XA 4DEFA 4QAWA 3LLXA 1OFBA 5DXXA 1OZQA 3H6OA 1V03A 3WF0A 2DPEA 3VZZA 2CETA 4LAMA 2XSAA 4HSNA 1KB3A 2MNRA 2ISFA 3UD6A 5I02A 1HJVA 3MJMA 4JR5A 5LIKX 4RNJA 2W91A 2V69A 4XO6A 3B9EA 4GY1A 4N4QA 4BFAA 4NHVA 5JQ9A 2GDVA 2BC0A 4LW7A 3NYDA 1XIHA 4KGJA 1DJNA 3O6AA 1PZ0A 1E9ZB 3H4XA 3A5FA 3M47A 3C3UA 1UR8A 4H83A 5DFAA 3DN5A 4UTFA 2J75A 3HPFA 1Q8JA 4JN8A 1IIHA 3T9PA 3QV6A 1KN0A 4L61A 4LBRA 1HX0A 2WMHA 3HG3A 3TSMA 3T2OA 4HJFA 4UNIA 1CB2A 3N4FA 4PYSA 5IXEA 4GGBA 1YDOA 3BICA 4MWAC 1VFTA 1SW0A 2A7NA 3DFOA 3LU2A 3M5ZA 3ZIZA 4GZJA 2WVVA 4FB7A 1UD2A 2HQAA 1K9EA 3PP7A 2V38A 5J5RA 4GRTA 2I5IA 3CWNA 2GH5A 1NDYA 2HWGA 4F0KA 1BPLB 2BVWA 4S3GA 1KM6A 1BFNA 2XGIA 2HPMA 5I00A 4F0SA 3SB0A 3DG6A 3L65A 1SJBA 4RZ6A 4WY0B 2LLEA 3ALGA 1RQBA 4AX6A 4HCDA 2XSBA 1Z3NA 4O8AA 5AFDA 2OMAA 4HA0A 3FHQA 2XUCA 1TVNA 3SEPA 1FQ0A 3D47A 1XLDA 2FFCA 2I5GA 2NV9A 2FH6A 4G2DA 3VKAA 4Q8OA 4ZO9A 1EL3A 2WPGA 1OGBA 4H6RA 2ZZCA 3GR8A 4IFOA 4HD5A 3DFSA 3ONBA 4YPJA 5F4XA 4TIMA 1QRQA 1GV4A 2VEFA 2Z4GA 2TAAA 4H8VA 2X8HA 4L9YA 2ACRA 3JZUA 5AC4A 1UZ1A 3CZEA 3I10A 7ODCA 4AZGA 3R8GA 3L4TA 2DT2A 1PKLA 2E7FA 3I7RA 3MUCA 2OQYA 4KRZA 3VMNA 4S3EA 1LL7A 3CMFA 3HIJA 1HGYA 4QDWA 1M6IA 1QNSA 1E4LA 3GY1A 1VEMA 1PZ3A 1KXVA 3ZR6A 2PZNA 3E0FA 1AH3A 4MDOA 4HIBA 1P48A 4L65A 4GX8A 5CEWA 3SSJA 1XXXA 1V51A 4D6GA 1B57A 5I3GA 3TOYA 1P0EA 2NX9A 1Y8BA 3GBEA 5TIMA 1J6OA 4PB5A 1NJJA 3HN3A 3SQMA 4YVVA 3VIPA 5HQEA 2YDAA 2EQ8A 2AGKA 3N6HA 3MT1A 3MA8A 1M9HA 5CSUA 1FRBA 1ZALA 4MNMA 4O0KA 5D33A 4ECLA 1THFD 2VJXA 4B3KA 1EXBA 1TWWA 1GQKA 2X7VA 2PDBA 2YZ5A 1HF6A 3IRDA 4JQ1A 4UOJA 1GRGA 1X1ZA 3S5YA 4Y2WA 2ZWYA 1J01A 3GNDA 1YNYA 4S3CA 1F3XA 2ATMA 5A6KA 2DDXA 5AHEA 3EMCA 2C79A 1PE1A 1WB0A 2GQ3A 3T2QA 3IIZA 2ZKMX 1H50A 4WK9A 3GXDA 2YVJA 3S9IA 4NZCA 2ZX5A 4EXAA 4E4UA 2HVNA 1QPKA 1UKSA 4J3XA 2GYIA 4GQGA 2WOVA 3C0SA 4P61A 4P7OA 1GPWA 5C9ZA 4C6MA 5GNXA 1W9XA 4G5DA 4PEEA 2IQTA 3MHFA 3ZJ6A 4I7VA 1I0DA 4JX6A 3QGVA 1FO4A 4I8DA 3Q2DA 4Q8MA 4ZOEA 4YHEA 3W2NA 2WZIA 4RLIA 2PU1A 3KP0A 5FJPA 5HOSA 3CGDA 5D2VA 1GVIA 1J6PA 3F5LA 3TUUA 1QASA 1RY8A 4DZHA 3MMUA 3MCNA 4Y9MA 1KR1A 2CDUA 3MUXA 2E8ZA 2KAUC 4XISA 4PSRA 1F76A 4ZOHB 1JULA 2BXZA 2W54A 4XZHA 1XH2A 3R0DA 4DAIA 4XUGA 4LJ3A 3THUA 3OG3A 2CESA 3SCWA 3WZ0E 1N62C 1OF8A 1QATA 3BGGA 4U2YA 5CSSA 4WXZA 4X3ZA 4Y6GA 5JH1A 1W1TA 4XAGA 3S2CA 4JTUA 1XIGA 4AXKA 3MCMA 1FEAA 2ZWZA 4DBWA 2EKGA 1RBAA 3M5VA 1AD4A 1ITXA 4MNKA 4HSHA 5A69A 3FSUA 4AHPA 4H4TA 1G4EA 5GNZA 2HRWA 1R3YA 1E51A 2XH2A 3EB3A 2C13A 3MU7A 2OEJA 4QTGA 3SAZA 4DPQA 3CT2A 4RJEA 1B3XA 5LNUA 1TWZA 5K9XA 3L4ZA 2QJJA 4O52A 2X1UA 4K6AA 2RDTA 1AL8A 2WPFA 4D6FA 2YR1A 1J0HA 1XFBA 4WF7A 4FX9A 2FZ8A 3GZ3A 3KRBA 1PYFA 4WRHA 3ITTA 2GVYA 4IOTA 5C9XA 4GLEA 3HM7A 2PF8A 5KETA 2XG9A 2EPNA 3H2OA 2C14A 3SDOA 8RUCA 5G4EA 4I9TA 3MDUA 3OLEA 2BY0A 2IKJA 3H55A 4CNNA 1TJ2A 5F1UA 1WDQA 3OBAA 4AZ7A 3NO3A 4C7FA 3PWGA 2R1NA 1QI5A 5JCKA 1HZYA 2GGIA 1YEYA 1V7AA 3GC5A 1SO4A 1JCTA 1UPPA 3FVMA 4BA0A 1H4PA 4E0CA 3HFTA 4H9YA 1E70M 5D4YA 1M5WA 4AG0A 2E4TA 4D6IA 4M51A 3KRSA 4H41A 1BLIA 1TTIA 3FYYA 4ALDA 3VGDA 4ML9A 1XPGA 1Z41A 3LBMA 3AJXA 1X97A 3MCOA 4R7WA 2R1MA 4Q32A 1A0CA 4TU1A 3M7SA 1UD8A 1JNDA 3WLHA 1E1EA 1MZRA 2EF9A 1XLBA 1W8GA 1EHAA 3GG7A 4MJZA 1TG7A 2BHYA 3ENLA 2QDHA 5CPTA 3DOPA 2WSRA 1CBGA 1YMYA 4M24A 1UWIA 3JZEA 1JZ5A 5JCLA 2GUYA 4IFRA 2IKHA 4IICA 3FXGA 3VC6A 4AMAA 1VEPA 5A2BA 4FNTA 2W9MA 5DRCA 4HNVA 3OLDA 1I2NA 3MPGA 2VD8A 1V02E 3W07A 4CD7A 2QUVA 3TN4A 5D02A 1FWWA 4GUJA 4AY8A 1OCJA 3SCTA 4PRWA 3NQEA 2OT0A 3G1RA 1B5TA 3WKZA 1DWJM 4GQRA 6XIAA 2QAPA 1GVEA 1QPNA 3I7QA 2OLAA 2IS7A 4ZB5A 3RLGA 2EQ6A 3PBGA 2W3ZA 5LKYA 1XWYA 2TMDA 4EPBC 4IQEA 4AU0A 2WANA 2IPFA 1NOWA 3PHAA 4UFIA 4ERIA 2C1HA 5FF0A 4H4SA 3AHZA 1O5RA 4UR9A 1YDYA 4E4PA 2NUWA 3P93A 2BY3A 1FTXA 2A3HA 4AD1A 4FZIA 1NWSA 4JTIA 1QNOA 1SZFA 3EKLA 3CM4A 3GXPA 1UD6A 5A6LA 1LJYA 4FIQA 1E4NA 4KPLA 5BRPA 2XM2A 3ITYA 1LOQA 5IDIA 4GYKA 2ADAA 4GE8A 3KTCA 3FA3A 2UZ9A 4HMCA 4R34A 1U1UA 4EWJA 2WPCA 1KGWA 5HWJA 4HK7A 4Y8EA 1KWKA 5FS8A 3L68A 3NEHA 5AECA 4DY1A 1MXSA 4K38A 1ONEA 1Y5XA 2H3DA 1C90A 3L2MA 3S5ZA 2WC7A 3THAA 4S2CA 1O1ZA 2XTKA 4IT1A 2DH3A 3VNDA 3WBXA 3NS1B 1HO4A 1DVJA 1D7YA 3SUWA 4K8EA 4UMAA 1XG3A 5CH9A 3FEQA 3HQOA 5L9FA 1P7TA 1FA2A 2PWDA 4LIIA 2WJFA 3K1GA 1C8VA 4KEVA 4H4YA 3B8DA 1PWLA 5HR7A 1ZHAA 4XD4A 2XFRA 1I45A 3IARA 1LOSA 1NHRA 4GQQA 2ZDSA 3CHDA 5E6YA 4QAIA 4JL2A 4QR6A 1UA7A 2E9MA 5FA5A 1N63C 1AW1A 1BF6A 3WO8A 1F2JA 4CCCA 2QNEA 3BJFA 3Q4DA 5JVLA 3KAOA 1S2UA 3ITVA 4Z2GA 1FVPA 1XHGA 3WLPA 1UR9A 3GXIA 1M65A 1BVNP 3AALA 5E9XA 1H2IA 2YLAA 4LEQA 1V0MA 4PTMA 6TIMA 3VGHA 2W0UA 3A9IA 2QGYA 4EOUA 2XINA 1X96A 1HFBA 3IS4A 4JIIX 1ZUAX 2IMRA 3LSBA 4G9PA 2VWSA 3OIHA 4H8HA 1NAL1 1UUOA 1OK4A 1DBTA 2RFGA 5TF0A 5A8GA 2YX0A 5AVHA 3VO0A 1WYIA 1VBHA 3H53A 4HMEA 4AEEA 1E6SM 4DPPA 1FCBA 2PBGA 3DECA 2BS9A 2E5DA 4UTMA 4O16A 1VYPX 4CN1A 3SBFA 1DWGM 4H6KA 4UUIA 2XM1A 3DK9A 5T9CE 4ZL1A 4O57A 3AO0A 1NWRA 2VQUA 3GHRA 3RX4A 4AC7C 3G18A 2FVMA 3KX6A 3M0JA 2CW6A 1ONWA 2D2OA 3CO8A 2J6XA 3RXZA 4DZAA 2WVUA 2HVMA 1UP2A 2G8ZA 3CZLA 2QQ6A 2IW0A 3MW7A 4U2ZA 2G95A 3NGFA 4HVXA 3CHEA 1NH6A 2CLHA 4QCFA 4DBSA 1FHLA 4OV9A 4XZMX 1FH7A 3ZSTA 4X9SA 2HROA 3W7HA 1RD6A 2OSYA 5FCZA 1J0ZA 1J0IA 2VEIA 2OZ0A 4CVWA 3C61A 3CGEA 3WYZA 3T81A 3VD9A 4JPGA 3NQ6A 3W7JA 4Q8TA 3BLDA 3PB2A 3W2MA 3P8JA 2C1IA 1TPVA 2HQMA 5E0FA 1DWIM 3E02A 1UASA 3VFCA 3MVIA 3CH9A 1NSJA 3SSZA 2GQWA 2GJRA 3H2AA 4K3ZA 1XH1A 4G7EB 1MW1A 3NPXA 4AIEA 3AIBA 5DCEA 1WX0A 4R9OA 4N4PA 4B15A 1NF0A 3PZGA 1ZZMA 1M03A 3VXGA 5JIWA 4J3SA 4MYXA 1EC7A 1K9DA 3W1PA 4AZHA 2W3RA 3BSGA 1PXGA 4R85A 1QTWA 3AMCA 5ECUA 4UTHA 4JKMA 5EBUA 2YA2A 3VOFA 4Z2LA 4PTWA 1V59A 4M8UA 1EJTC 3NVDA 1GRHA 4EQSA 3WSUA 3POHA 4G8TA 1OX4B 2ZRZA 2PGEA 3VNIA 1J2BA 2V5CA 3RCMA 2VGIA 3WBWA 1WNOA 3CC1A 4H8NA 4OOUA 1QNRA 4A2RA 4UTUA 3GD3A 1YXYA 3UCDA 4XAFA 1K70A 4BQ4A 4ZTYA 3GTXA 1ZMCA 5CGQA 3HQNA 3AYVA 2WO5A 3DFYA 5FEZA 4IIBA 1V93A 3BQ5A 3F5KA 2XPKA 5TD4A 1OX6A 1TWIA 2H90A 5BXPA 3PN8A 4M3PA 5D37A 3N3MA 3VOIA 1W3LA 1K8CA 3CHCA 4TX8A 2WCSA 3FCPA 3D0CA 4UR8A 1QO2A 1M1BA 4ERAA 5B7YA 1NEYA 4J3WA 1M01A 3NQAA 3PUEA 2PGRA 4PMUA 3C2EA 4LXFA 2J3NA 2YAUA 4I5XA 3S1GA 1XBYA 2XWEA 1XBZA 1RP9A 3RIKA 5C2GA 1RQEA 3QFEA 4OV4A 5GJNA 4XQ6A 2I9UA 1JROA 3UWQA 1WO2A 1HKIA 4XTDA 4HHPA 3NGJA 1FWSA 3WLMA 3ITOA 3UG5A 3WFLA 1TYPA 4WJXA 4LWWA 1BWVA 2Q6ZA 2NT1A 4W86A 2QCHA 3LTYA 2GGHA 3CXBA 1TQXA 3N18A 1P5BA 4JCMA 3KCOA 1Q6DA 1XF0A 5F7UA 4PTNA 1I2OA 1EFZA 3OVPA 4LQ1A 1J18A 2PWEA 4LT9A 3KEHA 3L4XA 3I65A 4TR9A 2PC8A 3QV7A 1NDAA 3HJEA 3KOZA 3O15A 1Z32X 4CNTA 4PC8A 1JYNA 4P8UA 3H21A 3O6CA 3DYMA 1MZHA 1JZ7A 1DWHM 1NELA 3BCFA 1NARA 3EWYA 5FF3A 2FDSA 3BPWA 1AZ2A 1KCXA 5C0QA 3PJUA 5AZ1A 1QNPA 4QISA 2J8FA 1SUXA 1TYTA 4DJFD 1DORA 3DYPA 1JQXA 4QIUA 2E67A 2OWCA 2X0SA 3OB8A 2NQZA 3WDQA 1NWTA 1UR0A 3F03K 2VR2A 3QN3A 1Q6GA 3NL2A 5C9RA 4DNAA 1GGOA 2HXUA 2J27A 3H70A 2WZEA 3GKFA 2Q01A 4H6EA 4FPSA 3W85A 4IIEA 1X39A 5ABGA 2GGGA 1XRSA 1X6LA 6XIMA 4ZO6A 5AYZA 1F7BA 1UQZA 3WNMA 3KW3A 2WNZA 3EANA 5MKGB 1CECA 2GK1A 3H22A 4FOJA 4URIA 1R3TA 3MDWA 4TXEA 3E12A 3R12A 3G1XA 4PBFA 1N8IA 2VRKA 2WSYA 3MHGA 4ZO7A 5DRIA 4RZ5A 1OFDA 2Z1VA 1LPFA 4DX3A 3TA6A 1D3HA 4ZOAA 5D38A 5BMWA 3N04A 3M44A 2Z24A 3PZQA 3RU6A 1FDJA 4AY1A 4K39A 3N34A 1XUZA 3V5FA 5BXSA 4L7ZA 2OWXA 5KITA 1UOZA 2X1RA 5JBDA 1O7AA 3OYZA 1PHQA 1G1YA 1GOOA 2DT1A 3VIIA 2VC5A 1Z7AA 5C9WA 3R07C 1IYXA 5RUBA 2QCCA 4PR4A 4O15A 1F6PA 2PODA 3BZGA 3DBNA 1LUCA 2VR5A 4FI4A 1VB9A 1QVBA 3QMRA 1QJWA 3GRSA 3ARSA 3VNZA 1V6XA 3MUAA 3PTMA 1LDCA 4RDWA 1T96A 3WJXA 3F7JA 3P81A 3E2RA 4JDRA 1EO7A 2J25A 2V5BA 4PTXA 2VCBA 1F4AA 3EWXA 3W7OA 1QR7A 1FXQA 2RABA 2ZA2A 3WJYA 5CZJA 4LSBA 1NDWA 1ZQ5A 1BD0A 3NNTA 1H51A 1TMQA 4BQ2A 1JEZA 2J4GA 1B0IA 2X7WA 3K8LA 1NFPA 3IANA 2I5QA 2WMKA 4FXFA 4MNLA 3M7WA 4I5UA 5PTDA 4MIMA 2GFTA 2A5HA 3W7DA 4O1FA 3AZTA 4KKXA 4RDYA 1T40A 2V3FA 1ZY8A 4YJ5A 1FWFC 1P6CA 2CFYA 4INFA 5JCIA 4U4MA 4CU8A 3TYEA 3MO4A 4Q7IA 4C5YA 4D1IA 4TTGA 4AIUA 3JR2A 1XJBA 5CGMA 3BMVA 1TPFA 1ADDA 4MUZA 4XBJA 2I57A 2YL8A 1G01A 1UJPA 3L5MA 3AXMA 4QS6A 3BAKA 2VGBA 1Q5MA 1CTNA 2XIJA 3M0YA 4CD8A 2FH8A 4DUWA 4W88A 1P0KA 2CHOA 3BJSA 3TJIA 3GVGA 3B8IA 2VEKA 4GA8A 1H1ZA 4CQAA 6A3HA 2EG6A 4CLMA 3NCOA 4GIRA 2FB3A 2YCIX 3A23A 1UKOA 3ZM8A 3ARYA 1ITUA 3EX3A 3LHZA 2UY3A 4IZGA 1BWKA 1QHZA 1RJRA 3EOUA 2H8XA 5DMMA 3TK7A 4Y9PA 4IUGA 4GIYA 3UVIA 3TZNA 4PUMA 4P7RA 2V5DA 3MYPA 5GVJA 3MYOA 2GL5A 2QT3A 4W85A 1VJIA 3WQ5A 2Y88A 4GIEA 3LRKA 1VJSA 2GJXB 1KBBA 2PF0A 2V82A 2XN1A 2PTYA 3GFZA 4UQ9A 4IG2A 1GYMA 4WKAA 4DBUA 3SURA 1MRQA 2SFPA 4O11A 4QQUA 4DHGA 1S39A 4MWAB 3ZT5A 2HISA 3AWNA 4Q4MA 4FNRA 3A3XA 4KMQA 1ZLPA 3PZ9A 5D2TA 4MZ1A 1BGGA 1M7OA 4X0NA 2F5ZA 5HAOA 2ZX6A 1JPIA 2YB4A 4J40A 5D04C 5CLWA 2Z2AA 3ZVHB 4BR1A 4BKNA 4BF5A 4W7VA 3PULA 1E5NA 3QMTA 1I2QA 3STPA 1R7OA 1C8YA 1YLVA 2OZ3A 2A79A 4UFMA 4XBKA 5AN7A 1FDZA 2P10A 2OLHA 3IJDA 5E1QA 3QGAC 3A5VA 2ZC1A 3KE0A 1P43A 5KZEA 4GXWA 3VCRA 3H7RA 4JEQA 3V0TA 3PPGA 1E6PA 5D30A 4JIPA 6REQA 1W0MA 4C7GA 4EVZA 2P88A 3G1AA 1GQIA 1GYNA 4PTVA 4JGDA 4REQB 4M29A 4Q22A 4LTSA 1GZ1A 4W4QA 2J9XA 4UR7A 3UEQA 1Q13A 3T8LA 3VCNA 2QCEA 3FDGA 4J9JA 4Z42C 3PPHA 2GUUA 4C90A 3KS5A 1VFLA 3GYEA 2OEMA 4Q4SA 3PK7A 5D2YA 2FVKA 4QSHA 4DAFA 4LANA 3H2MA 3G1FA 4LPCA 5FAJA 2Q71A 3M07A 4QITA 2ZOXA 1POJA 4FO4A 5FS6A 1I2RA 1RCOB 4X22A 3IIVA 3W2UA 1R86A 2DUZA 5HNTA 1NQKA 4AXNA 4LS0A 2J62A 3OQ8A 1I6NA 1TVLA 3U2ZA 3VE9A 3H12A 4C91A 2QUMA 3GU2A 3O9NA 2R1KA 2HS6A 4B90A 1TTJA 3PG9A 3VD4A 3M0XA 3R0UA 3NDZA 4J2PA 4RZBA 3VZYA 2FJKA 5M1TA 2BG5A 4E3VA 4ASTA 3AROA 2QZRA 1X1OA 5BRBA 4W89A 3WJZA 4OGZA 4UMCA 4P8XA 3AMZA 2YYTA 2EXOA 4GI4A 1US0A 1YRRA 2EPOA 5DMLA 3BCDA 4HN4A 4L4PA 4X60A 1K6WA 4GH3A 1Q6FA 1M7JA 5BCAA 1MSSA 4UOQA 2VFDA 1KM3A 2X30A 2A7RA 1R2TA 1QWKA 2ZUMA 1RVKA 1YTKA 2A21A 3N2TA 3HG4A 3TH6A 3ABXA 3LI1A 1MW3A 3AI0A 1SZRA 3PSVA 3UNDA 5HBFA 4OWGA 1XKJA 3O3RA 3U57A 1S1PA 3E6EA 3MTWA 5LNWA 3CUFA 3CV2A 1TMLA 1WDRA 3NZQA 2R8WA 1ZSXA 3CPUA 3B0YA 1PEZA 3TLLA 2I56A 2JKAA 3QZAA 4KFPA 4H9XA 1YPXA 1G4SA 4KH2A 5ABEA 3VGBA 4GUGA 4GACA 4WOZA 1YNPA 3UW6A 1KR0A 3L4WA 1JXKA 4GKTA 1W9DM 4EE9A 1Z44A 4WHBA 3MSGA 3Q67A 3K1DA 5CAKA 3ABOA 3MMDA 1G4TA 3A21A 4RCXA 5H6HA 3VIFA 2IXUA 1C8XA 4I7UA 3WMBA 1UR4A 1W5NA 4ZOCA 1HL8A 2VFHA 4HPNA 3ZJKA 1A5AA 4LF1A 4LV4A 3AHVA 3F4VA 1HL9A 2D0HA 1KM4A 4PMOA 4K7ZA 2QHAA 3CPRA 1VYSX 2WSPA 2Q8ZA 2ZZ7A 2OODA 1OZMA 1U1JA 2RUSA 1YYAA 3VM7A 4L1GA 2VDIA 3TQPA 1XSJA 1CX9A 3GDKA 1UZ4A 3D3FA 4LUSB 3FW6A 3ARPA 2YLLA 5G2HA 3TW7A 3W02A 3CL6A 5BOOA 4J3TA 2DUXA 1RVGA 2PC4A 1EIXA 4GHRA 2FHCA 1RJQA 3HGRA 1PSCA 1V02A 2QYGA 1B31A 4AD3A 1R9ZA 2P53A 3L66A 4AFYA 1KGXA 3APTA 3I68A 3TSDA 3CZ8A 3GB6A 3SQLA 3AQUA 3A3WA 1CIUA 1REQA 1TTPA 5FF7A 3FHAA 1CCWB 1QNQA 5GRTA 4ZB0A 3GDMA 3WLOA 1OGSA 4OHQA 1EZ2A 4WY0F 3FJ6A 4CU6A 1A0EA 4JTDA 2FLIA 1GOXA 3BUVA 4W8LA 1W6TA 1XI3A 3PPFA 4UTWA 5G5HB 4H1ZA 4IMFA 4BEQA 2EQ7A 2Z1XA 4I9JA 5CCZA 3DKJA 3QBUA 4M56A 2Z0IA 4V2XA 3BO9A 3POCA 4PFMA 3AZSA 5G2IA 1JDFA 2V6AA 2P5NA 3SFKA 1HVQA 7ENLA 3ARZA 3ORWA 1TWDA 1OSEA 1LVLA 3VI2A 4EMIA 4N9BA 1XISA 1ZY9A 3LY0A 2X99A 1WUFA 3OGSA 2F6UA 3E49A 5IFTA 1A5SA 3LLDA 3UY7A 1GK8A 4MY9A 5TR3A 3DEQA 2DV0A 3PBUA 5C70A 3GX9A 3A9BA 2FTPA 4LVBA 5FJJA 2Z1BA 3CH0A 4RV8A 3ZR4A 4O1AA 4MOZA 3PUOA 4NKCA 3UXLA 1DJHA 4ROPA 4HTBA 1QI0A 1P7TB 5F4WA 3VAVA 2OO0A 4E2OA 3GU1A 1CLVA 3DFTA 1SMAA 2R91A 3T4CA 1T0OA 4CNPA 4IXHA 3T55A 4EQWA 1A3XA 3GUWA 1E56A 3A47A 4GUFA 4LS1A 4GVHA 4D2JA 2FGLA 4MFDA 3LI0A 5D2WA 3S0CA 1E3XA 1JG9A 5FS7A 2Y8KA 4K2SA 4S3DA 3B0XA 2V68A 3T1GA 2FGZA 3IJIA 4G1NA 4WDUA 2Y1HA 4AC1X 4ATDA 3PFRA 1TV2A 2PLMA 1K02A 1JCJA 3WN6A 2GGJA 2W67A 4JIRA 2TPRA 4KWVA 1DIDA 1A47A 2ZC8A 4QGCA 5XIMA 4GOAA 1RZMA 1KXQA 1E55A 1XINA 4GFSA 3URBA 3XINA 4IL0A 4H4IA 1HJQA 4DYKA 3WLRA 1WOBA 3BAJA 4IPNB 2RHGA 1T8QA 1WZMA 1IWPA 2QJHA 1LUCB 5I0DA 4JKLA 4IQDA 1JD7A 3M6YA 2VWTA 3TKFA 4WX2A 2O4QA 1YDNA 1R9XA 2QEZA 3RNMA 3O0FA 3G0UA 4G6CA 1V6VA 4HBKA 2QLYA 3C6CA 4P5UA 4IPIA 1MQQA 2DT3A 1TRIA 2OTDA 3TJXA 4QBXA 1MQRA 1BXBA 4XX6A 1XIFA 1TIMA 4JQ4A 2E40A 4W84A 1OFQA 3QSRA 3BAXA 3IIXA 1C7SA 3W1UA 1BRLA 2QCLA 3L23A 1T41A 3URQA 3KOYA 4DJDD 3NQ7A 4JD4A 5DBUA 1SFSA 2NQ9A 3C5QA 2VTFA 1RY0A 1ZFJA 3QHOA 1PUDA 4JQ3A 2W6RA 1BQGA 4CD5A 3N13A 2D24A 1VF8A 1JFHA 1UHVA 3AC0A 4HGXA 1EEXA 5CPNA 5CSYA 5KVHA 2A3AA 4ZZ9A 4V27A 1YXDA 5IBXA 2EJ1A 1EGMA 3NQMA 4CUCA 4R3UA 1NF7A 2Z28A 5DELA 3B06A 3O07A 1N5WC 1W9BM 1J0KA 4NJIA 4S38A 5LXXA 4A21A 1KBIA 1LQ2A 2REQB 4CNSA 3SIZA 4R33A 3C3NA 3WQ8A 3B4UA 4IIHA 1TV5A 2DQWA 4DI9A 2EJAA 2ASHA 3I3DA 3O7UA 3P61A 1A5LC 3CAQA 1F6YA 4E2DA 3E74A 1ZAHA 1G0CA 2XVPA 3E5PA 1KKRA 2YCJA 3UJEA 2GDQA 3RMEA 1XR2A 1PCWA 3BLOA 4ICNA 5M5DA 2BY2A 1MUCA 1CLXA 4QLLA 3QY7A 2ZQ0A 4FX8A 2OYMA 3BC9A 1EDTA 1JYVA 3M16A 4OU1A 3KWXA 3T07A 1XCFA 3KZSA 4NIRA 1XYCA 4AZCB 1ISVA 2X16A 4S1FA 1JNEA 1RAKA 2ALDA 2P1FA 1IZKA 4D6JA 3OGRA 1A5BA 3OO2A 3LCFA 3A7RA 1X7FA 4NG3A 1LLWA 4IISA 1CGUA 4O10A 2UV8G 3CNYA 1KM5A 3C2RA 5HNRA 1TB3A 2NXHA 3GH4A 1XIIA 1TV4A 2W5FA 3SI9A 1Q8AA 5TAOA 1W1YA 1G9HA 4JCLA 4JNZA 3V18A 2RH9A 2MUCA 3BLKA 2ZX9A 2VRJA 3KBJA 4G56A 5A8OA 2GZXA 1B1YA 1GQLA 2ISDA 1UR2A 4Z1DA 3TWBA 4TV6A 4CCEA 3WQVA 4YTTA 2FMNA 4HHMA 3TR2A 4B9ZA 3F5JA 1PVNA 4OZOA 5FJUA 3G5EA 5JUVA 3W53A 3LS9A 3NURA 5FOOA 1YQZA 3MZNA 3UYCA 2W55A 4MZYA 1DEDA 4ZXOA 4D6DA 3FY1A 3BJTA 3S8HA 4QG6A 3ONCA 3MKCA 4RNHA 2CHNA 1J4EA 3AIWA 3H54A 3W7IA 4RXFA 3OLGA 3NSXA 3C8NA 2A6LA 5F2GA 1MFVA 1W17A 3C2YA 5GQBA 1ODZA 3WUBA 2OEKA 1UBSA 1EQCA 3QXBA 4O12A 1BYDA 3SRFA 1UW9A 1X6NA 3TVAA 1KTCA 4AD0A 1OFEA 2QJMA 4NI8A 3QV8A 1EGZA 5CPLA 5LHEA 3LRLA 2Z26A 1MFUA 4Z2HA 4BI6A 3FKKA 4KWWA 3WNNA 1TX2A 2FPTA 3TDFA 4PL2A 3WENA 3CV7A 4DJFC 1BWCA 1GEUA 1XLKA 1OG0A 2VD9A 4F0RA 3KVLA 3DJJA 3K46A 4QROA 1L0PA 3WH8A 4C6DA 2Q02A 2X8GA 2NQJA 4HZ6A 1H7OA 1C9WA 1FWCC 4LUIA 1R6WA 4QE1A 4O8RA 1UH4A 5HJXA 2G50A 3K4WA 5IHSA 1JR1A 1EPVA 4D6CA 4A3RA 1N8FA 1E9LA 1JVNA 5HPCA 3DJGX 1ZCOA 1RCXB 3RM9A 4AAJA 2TYSA 3GWQA 1EIBA 1O5QA 2BGQA 4KIEA 3T0TA 4XKMA 2H9AB 1VRXA 4NVTA 1ISXA 3UJ2A 4IGMA 5I77A 5AC5A 3E1F1 4ICMA 5B7ZA 1YXCA 4PODA 6REQB 1V7YA 1F61A 3GK0A 3GD6A 3B0VC 4OFCA 4EPDC 1VGAA 3M1ZA 1GG1A 3EUB3 5ABTA 2WLZA 3MBDA 5C6MA 2CLKA 1UWSA 2YL9A 2CBIA 1W5MA 1ZENA 4IFKA 5CG7A 1T8XA 1PZ2A 1EKOA 2DW6A 2BNJA 1L8NA 4W5ZA 4AUBA 7PTDA 1SO6A 1S2VA 4JTFA 4LOCA 3TN5A 3FNDA 2HPIA 1TTQA 5G5GB 4FR6A 3H4KA 2VEMA 4AIBA 4JTCA 5D9OA 3SCUA 4XV0A 3FAWA 3VVGA 4ZQRA 5L6UA 2NXGA 4A35A 4F40A 4PRRA 3KBWA 4I5RA 3WLQA 4IIGA 1O94A 4QE4A 3GAKA 2F2HA 2E8YA 1LG1A 5LSMA 3E5BA 1J12A 1JF6A 1L6WA 3P60A 2VEGA 2GQ9A 4O1CA 2Z6IA 3MKVA 4JYEA 2PSNA 3BSHA 1WXYA 2VHLA 1OIFA 1LCOA 4HHHA 2VDGA 1US2A 2ZX7A 4OJYA 3UG4A 4W8AA 1FUYA 1HO1A 1EQPA 1KCLA 4B4FA 4YTUA 2VFEA 1WOAA 1DE5A 4O19A 1FOBA 3WQPA 5AC8A 4TMCA 2XU2A 1UIPA 2R94A 2VC6A 4MB3A 3USZA 5EA9A 3TC6A 4ZO8A 3IJ6A 5E70A 3KVMA 4DJED 2DIKA 4DWSB 1DNCA 1X38A 1UWUA 2V63A 3SUSA 4HZMA 1JDDA 2J9YA 2QJGA 4UNLA 3ZS4A 1F9CA 1LT7A 3KTXA 2J8TA 5HQMA 3TZFA 2YL6A 1LF1A 4MWAE 4YU1A 1H61A 1UKPA 4Q8UA 3A7AA 3CB3A 1I0BA 3HPXA 1MXDA 1VS1A 3SRDA 1DJWA 5CXPA 3R58A 1XLLA 3HBLA 4OVXA 5I23A 3GDRA 3OZYA 4NZ5A 3VDAA 3OTRA 5B80A 1JGMA 4RV3A 1TPC1 1J0YA 2VM8A 3CZGA 2WVVB 4XD3A 3RPTA 2TSYA 2YB1A 1K4GA 4NZ4A 3EAUA 2HNHA 4BI7A 2E3ZA 4H2CA 3JRKA 3AYRA 3W7NA 3CL8A 1H7NA 3NSMA 1J2WA 3BLFA 3MANA 5A1AA 4LB3A 3CV6A 3QYSA 2FYMA 4BF7A 4JN6A 2Z1KA 3KOWA 2VT0A 3KCJA 2O4MA 3CJPA 1EEPA 3SZ8A 1Q6LA 3W29A 4FX6M 1XHCA 2OYKA 2ICSA 2P3ZA 4ZFMA 2G41A 5JIPA 2PDPA 1E9IA 1Q66A 1CI1A 2X50A 5FD0A 5TNVA 3PG6A 3CLMA 3G2GA 4B5NA 4H7CA 1ZPTA 1QNVA 3GC4A 3GO2A 1BSLA 1Q45A 5D9PA 1IHIA 6ENLA 3QJAA 2ACSA 1KV5A 3CK5A 3FJLA 3A3HA 4LV9A 2V5JA 3GNNA 3LRMA 4XO7A 1S5MA 3GXNA 1QPOA 3M5XA 3V3WA 4C6FA 4WJEA 3O8AA 1R8LA 2BOFX 1UWQA 4ILSA 1G94A 1BRLB 1ZL1A 1MO0A 3OU8A 4L4LA 3VX1A 3CAWA 5HWNA 1HQTA 3PZUA 2PB1A 1GTEA 5ABFB 4L64A 3HQ1A 2OSWA 3Q58A 5IRPA 1CGTA 1QI2A 2HDJA 1AQMA 1GUVA 4HTYA 3ZVIA 2Y62A 3LCLA 3W22A 3LPGA 4E2BA 3UCQA 1RXOB 1S1RA 3VINA 5U7SA 2PDGA 5DEZA 4FXJA 1RCQA 1DJQA 4GJIA 3LNMA 1NWUA 1GVQA 1U5HA 3KS6A 3U2CA 3T2PA 3BV7A 3QOKA 4MY1A 3RF9A 1QT1A 2Z25A 3SJ3A 3B9AA 3RAOA 4MZ8A 3BANA 4NU7A 4UCFA 3TTQA 1JZ2A 2Z29A 1Q7ZA 4WDTA 1JAEA 3RMJA 2I16A 3QVQA 1KFBA 2PRHA 3HG5A 1OFPA 2Z7GA 4LUSA 3ARXA 1CXLA 3EPNA 5H1WA 5A8QA 3QH2A 2OKTA 3FJ4A 3O0KA 1B9BA 3LM3A 3R79A 1Z42A 2AL1A 7XIMA 4L80A 1K7EA 3VOHA 1R87A 5A6AA 2OB3A 3F4WA 2WPEA 4MJ2A 3P6LA 3RCYA 4L56A 4J56A 1V77A 3EWWA 2F38A 3ZJ7A 4CQ9A 1W5OA 3E2QA 1WPCA 4GYPA 2WAGA 2YXOA 1Q4NX 1S3TC 3C0QA 3HGJA 3UGRA 1SJAA 1MW2A 2GOKA 5J8LA 3FXYA 3BURA 3KBNA 2D0GA 1H6VA 2G96A 2VUNA 3G24A 3W38A 3JU2A 4F79A 1UZDA 1UZHA 5FF4A 3RNDA 4UNKA 2WCGA 1XM3A 4IPPA 4LRTA 4ZA0A 3H26A 1XIMA 3RUBL 3GFYA 4N42A 8XIMA 3TC7A 3GLCA 3E0IA 3A24A 4PMRA 4ERGA 4ACZB 3BLPX 4OBRA 3IJ7A 1UC5A 2EPHA 1PS9A 4Z0SA 1F05A 3KM8A 3GTIA 3H23A 1VBUA 1OIMA 2HEJA 1TE1A 3GNOA 5G2WA 1KRCC 4KT2A 1DXIA 3QQ1A 2NPXA 5A8PA 1GZJA 2PWHA 1TQJA 3EEGA 4B92A 2BLEA 2JEQA 2XVNA 1S2CA 5DQPA 4V28A 3L0KA 4J2MA 4IMDA 4J4KA 4NJJA 1SO5A 2ZZ4A 5AZ0A 2ZXBA 1PWMA 1XSIA 5BXRA 1N8WA 1UWTA 2ZZ3A 2WLYA 1V6WA 4PE8A 4BEUA 5EBAA 4GNJA 3OYXA 2OKOA 4NXSA 1XIJA 1DIEA 4HZ7A 1VRDA 3CXOA 4GH1A 4PMZA 3FGCA 3KL5A 1UBPC 3WD2A 5DF0A 1ADSA 1FWJC 4B3ZA 3O6YX 4CEUC 4EANA 8TIMA 2PWFA 1EHNA 1KFCA 3LOTA 3LX9A 5KZDA 4M6UA 5FL0A 3KOFA 3NQDA 1RLCL 2PAJA 2DZWA 3RO6A 3NQCA 4RX0A 4BF9A 4PUEA 3TJLA 3DFNA 1H0GA 2FHFA 1FH9A 3MY9A 3ZQ9A 1AQ0A 5DXYA 1W56A 1VFUA 4ONVA 3RRAA 4RE2A 1OT1A 1ONXA 2A3EA 1LYXA 4DXVA 2FPVA 3MO7A 3ZLHA 1GORA 3GVRA 4N6EA 3L12A 3TQ0A 2WXDM 3Q94A 3EA3A 4S23A 3UYIA 4B16A 3T6CA 1ISYA 1Q85A 1GJWA 3WIJA 2WHJA 2RDWA 3WK1A 4LRSA 3NPVA 3IGUA 2HE5A 1XYMA 2WVSA 4G7EA 2RDUA 3HV9A 3SCRA 2G97A 1VFMA 1ZJIA 2RGMA 4FXSA 3STFA 1RBLA 1CYGA 1DJIA 4MFEA 4XIMA 5HINA 3V4BA 3HU7A 4R88A 1YPFA 4H4VA 3CGTA 1RH9A 3CQ0A 4WY0A 4DB7A 1TJPA 1DKWA 4R7JA 3S6TA 4MKVA 5E5CA 3NZPA 3QV9A 4ZXLA 1IEQA 2VVSA 2OZ8A 1KD0A 5FSEC 1C92A 3UFYA 3U4AA 1KFEA 1GVOA 1ZK7A 1YDVA 3UZJA 3V7PA 3G8EA 3DG7A 2YA0A 3W28A 4PUWA 1I9CB 1DYSA 2XVKA 3CIXA 4DJFA 4PL1A 1LRNA 2C18A 3AISA 3TW6A 3T78A 5LHFA 2R6OA 1XIDA 2F9RA 4D72A 3ES7A 3TAOA 2INZA 2VNCA 4FALA 4L4MA 4LH8A 4A8IA 1QU4A 3SN4A 3STGA 3KTSA 4CN4A 1W1IE 3B3DA 3BMXA 4QXIA 3FFSA 4RXGA 4Z2IA 1FFVC 3OA3A 3GVVA 2E1WA 3A4JA 4Q33A 4FHAA 3WDRA 1TKKA 3I6TA 2FTWA 3ES8A 3UNTA 1S2WA 4MJMA 1HKKA 3V0UA 3VGFA 1LM1A 1A50A 1EP2A 1XLMA 2Y89A 1R3WA 1QAPA 5BWAA 1ITQA 1W8SA 4HNTA 2V2HA 1CDGA 1VPYA 4GJJA 3NXLA 1CWYA 2VFGA 2ZVRA 3VIOA 3GHTA 3UZYA 5LA2A 3QFBA 1A0DA 2GR1A 1DE6A 2W4XA 1X98A 1CXEA 3LD5A 3NDOA 1JPDX 1R3SA 1ME8A 3JUGA 3W7RA 3W75A 2QR6A 1ZBKA 4FOKA 1EZWA 5I3FA 5F2LA 3T8QA 3B04A 1XC4A 3A22A 3O1NA 1TPB1 1VFOA 5CZTA 1DP0A 1EBGA 3GIQA 4X9YA 3CUIA 4IJRA 1Q6QA 2C0AA 1S2AA 3P7YA 3DHFA 4IFKB 4JTEA 3E2SA 1TPDA 3BW3A 1HIZA 4J3VA 2VZVA 1MXGA 4HB7A 3L5AA 4UC5A 2QF8A 2R9ZA 3RILA 1E1FA 4IPJA 1ZAJA 4RUBA 2QIIA 2IPJA 4FXRA 2Z2UA 3DK4A 4K1GA 5HDRA 3Q45A 3HTWA 4V33A 5AYBA 4H04A 4K1WA 1MUWA 1SO3A 1HP5A 2E25A 3BDKA 2PE4A 1MRAA 5HMEA 1V08A 2IKGA 4U28A 3UPBA 4F66A 3BTNA 2PZ0A 3T4WA 4CQ8A 5K9DA 3T0BA 3F2DA 3PJWA 2AAQA 2ACQA 2GOUA 3VA8A 2VX6A 3UP8A 3VNMA 3Q37A 1N2VA 4U33A 1XYFA 1BZLA 3KLLA 2A3BA 3II1A 3MI2A 5DT7A 5I3HA 5U25A 2CERA 2DH2A 3E38A 4DF2A 1BYCA 2HSAA 3CIWA 3PNZA 4ZEPA 2BXYA 5DY3A 4EQXA 1RPKA 1MEWA 2V8ZA 2X05A 3U48A 3DBPA 3P84A 4PGLA 3L4YA 4UWMA 1EC9A 3UBPC 2NUYA 4DBEA 3S2JA 1VKFA 1GETA 5AKQA 3LCHA 5KINA 2Q3OA 2E28A 2XYLA 3TU9A 1QK0A 2ZBTA 1IZCA 3CHVA 3AZRA 1Q6RA 4Q6XA 4TOQA 2E5AA 5EMYA 2QMJA 3NQBA 3GM8A 4RPQA 2B7PA 4UZUA 1E1CA 1EB3A 3M0IA 3WQWA 1G7UA 2QCDB 3QC3A 2NSOA 3QLDA 4I6KA 4DXXA 3ECQA 3ABQA 1AH0A 3WG6A 5CKSA 3UXDA 4UTTA 3B8UA 3PF3A 1W31A 5EL1A 1IGSA 5DBTA 4CU7A 2O7SA 3L4VA 4Q4PA 3K8MA 2DT0A 3W1TA 3W7LA 3WQGA 1PKNA 3D6NA 4HN8A 1GONA 4FSAA 5FESA 2ZXDA 4GQBA 4D8LA 2QVHA 3KVJA 2JF6A 3GTFA 3KP1A 3C0LA 3UA3A 2P8CA 2CKRA 4ZOBA 4NEWA 4GR1A 1QW9A 4L6OA 1W37A 1JDAA 2AQVA 3EXRA 1ZKQA 2HV5A 4FIRA 3RJXA 4C6CA 4JY8A 1XQKA 1PJ9A 4DYEA 2J78A 3BCJA 4M6VA 3V0SA 3EKGA 3W7QA 4JEJA 2WP6A 3W1LA 2J13A 1FWBC 4HU8A 1NFBA 4DI8A 1UG6A 2BTMA 4IQJA 4KW2A 3DH7A 2E9LA 5C8BB 2PRLA 4IHCA 5IDZA 3WH9A 4JHOA 5JCMA 4U5IA 1XD1A 3WEMA 1ODUA 1TZ9A 2CWNA 3APGA 3VZXA 2DZXA 4N7QA 3EOLA 2E6DA 1X2HA 3W1QA 4OE7A 4EM4A 2POTA 2TRSA 1DJGA 1U1HA 3OEXA 3LHWA 3N2XA 3CPGA 4JDYA 1H60A 3VC5A 3RLUA 4XWUA 5F4SA 1YNQA 1NHQA 4GZEA 4LVGA 4JYFA 2ZTKA 1HKWA 1IIGA 2NQ5A 2J7FA 1T99A 4ZFCA 1EJRC 1A4LA 4KPRA 1LZOA 4FA3A 4XD6A 4GY0A 3WD0A 3G6MA 2A1YA 3CWOX 2BX7A 1M6JA 1H3GA 4LX4A 2WKLA 4QRNA 3O05A 1V6YA 2VGFA 1M3UA 3LBCA 4D8AA 5A6SA 3CU2A 2OSXA 4QDPA 4PUUA 2A0NA 3GXFA 2DVUA 2J74A 3I3EA 4IMGA 3WF2A 3EX6A 3QR3A 4QQ3A 4AH7A 3DGZA 4IXXA 2DZTA 3GXTA 4FLRA 3VDHA 1OEPA 3ZSSA 1A5NC 4YXGA 1FBAA 4HCLA 3DXIA 2VRQA 1WE5A 3L67A 3VU2A 2ZTJA 3LXDA 2QCNA 1W1A1 5DLCA 5GJMA 4MAVA 1D7KA 1NOUA 3F4CA 4LYKA 2HVOA 4DWSD 5F2MA 3B8VA 2G3IA 1O5XA 1TREA 2UY4A 1S5NA 3WUGA 3WUFA 1DTNA 1AJZA 1DWFM 2EPMX 3M0KA 5HNNA 1MMFA 3EA2A 3SCOA 4X63A 4PMDA 1FWDC 3MP4A 3QW3A 2E6AA 1UWAA 2CLIA 1GVFA 1BEUA 1E40A 3A64A 2WPBA 1BTCA 1E3ZA 1EOKA 1HP4A 4Z17A 3OLIA 4WDXA 4PUDA 3W4RA 3FK4A 3MV01 4GXPA 4APNA 2WOQA 3LHVA 4O54A 9CGTA 1XIBA 4FP1A 2J7EA 1FHDA 2GWGA 4UFJA 4LBSA 2D3NA 4EMJA 3TYBA 4JTKA 1BVWA 3PR2A 2WNQA 3R2GA 1RP8A 2Y6ZA 4MB5A 3SUTA 3URHA 1GQNA 3GC2A 3RFAA 3WFAA 4WZHA 4ZTXA 1CXKA 2PDCA 3WLJA 4L5ZA 4PULA 4GC3A 6TAAA 2XIBA 1PAMA 2CLPA 5AB3A 1LL6A 3PTDA 4I9MA 1G5AA 1GNXA 3LMYA 5DMNA 1TVPA 4EMWA 3HRDC 3NZ1A 3U0HA 5FKYA 1IWBA 2RJGA 1R38A 5H8PA 3WMCA 4YVPA 1RM6B 4LEFA 3S4TA 1B2YA 1OY0A 4IJBA 1PIIA 5CZKA 3TSBA 2ZRYA 2CBJA 4NSBA 4MGGA 4TX9A 5T26A 4PSPA 3KRUA 4JICA 2Q3RA 1W3TA 3BQ6A 2XVGA 1XLGA 4O0ZA 3N17A 1XP3A 5LA0A 3GTHA 1BKSA 3L8KA 3FYPA 3RK8A 4H3DA 2X1TA 4GG9A 4DJDC 3PZMA 4OIFA 5CJMA 3TROA 4C6EA 3RRXA 1CW2A 1UR1A 1Q6OA 3IJQA 3GQYA 1X6UA 2CKSA 2GGEA 2Z6JA 2YXXA 4CQCA 7TIMA 3QPYA 3BH4A 2AL2A 1W3JA 3WBAA 2X40A 2BVYA 1TUXA 5K4XA 3E0WA 1E0VA 1VIWA 4NJKA 2HMCA 4JTHA 4F0MA 2YBTA 1XDMA 2VZSA 1W3HA 3EPOA 2YBUA 3W7PA 1QXLA 4HYRA 5I3DA 3BSMA 1YKWA 2Y85A 1HJXA 1OYBA 4M6PA 4G7FA 1QI4A 1SFTA 4JNMA 1HL2A 2ZUTA 1DHKA 1DJYA 2HJPA 1YX1A 4JX5A 3SM0A 3M6DA 2WHMA 5JMUA 4B5WA 2XVLA 3TIMA 1XW8A 2C16A 4O28A 3UJSA 1XSKA 2UY2A 3NL5A 2XZ9A 1VFFA 1R9YA 5I3IA 3ZVHA 3OW1A 2VCAA 2BVTA 3WK3A 1U5VA 1QWGA 2QDEA 1JUKA 3T42A 3AJ7A 3LPPA 3GVQA 1MNZA 4NL1A 4Z2JA 1H63A 2PGFA 3GTNA 4HKPA 1QO5A 3RR4A 1TPWA 2J6VA 3OODA 3QTGA 2KX9A 1WA3A 2PCQA 3V16A 3EBVA 3FOKA 1E15A 4H01A 1GOQA 3A4XA 5A5WA 3CMGA 3G77A 1FKWA 3PS7A 1DWAM 1GRFA 1XFCA 1TPEA 2CBUA 1IR2A 2DEPA 4C1LA 1IXNA 5M17A 2EAWA 1PX4A 2FZBA 1E0XA 4DO7A 3FAXA 1F6KA 2W79A 4RZ4A 3PZNA 3RITA 3LYEA 1E6NA 3GH7A 2J8GA 2WZMA 1XGZA 3N6QA 2X8CA 2HNEA 4JTGA 3VIKA 4J7RA 4IG2B 4DF0A 3FV9A 1TV8A 5LA1A 1E6RA 3HW2A 1V4YA 3VOCA 2ZZ2A 8CGTA 1K3UA 5G4HC 5CJNA 3UESA 4ZVJA 3RPMA 2V6OA 1TUFA 1W3KA 3AWOA 2XGZA 1Q1RA 3HB9A 1B3YA 3P14A 1SSGA 1XKYA 3D46A 3DH9A 4KEZA 1ZMDA 2VQTA 2CZ5A 2NLYA 3VKJA 3AUJA 4NZ1A 2O55A 3CMJA 1GHSA 2J24A 3CYVA 4LAZA 2NV1A 1OK6A 3OZPA 1EJXC 3USBA 2V3GA 2XIOA 2OO6A 3VOGA 5AYIA 1KBJA 1IEXA 3SJNA 4JQ9A 3CEUA 1M04A 4XZLX 1UKTA 1DXEA 2WMIA 4XZBA 1YADA 3GFXA 1FCQA 4Y90A 3H8AA 4FLSA 4BQ5A 4YTRA 3FJNA 3GKAA 5D9MA 1AMYA 3D9XA 1VZWA 3KZPA 4EAYA 5FMHA 4UOZA 2GR2A 3LHYA 3QY6A 4EX4A 3WH6A 1DJZA 5AHMA 5CQ1A 1L2UA 1LLZA 4IL2A 3HOJA 1F8MA 4NYYA 4ZENA 3EZ4A 1GZGA 2HZGA 3O06A 3SY8A 5HQLA 2V2DA 3ZWTA 4DQWA 5JBEA 2D20A 1EO5A 5DMYA 1LBFA 3VE7A 1PO9A 1GCYA 3BZJA 4EACA 4JAWA 1B90A 1GERA 1BXNA 5LNRA 1FFRA 2NVKX 5FEPA 3BGJA 1F3TA 4ZQOA 2WMFA 2X1SA 5HR6A 1EJ7L 3PZIA 5HULA 2BY1A 3HPAA 3EWUA 3TQKA 4JIEA 4DWSC 4HYWA 2RGLA 2REQA 5CC5A 4E4FA 1EOMA 1HJSA 2EHHA 2D2HA 4F9JA 4C1NB 2GVGA 2PWGA 3ZFHA 2I7GA 1WQ5A 1EBHA 2R1LA 3JVAA 1XS2A 2XHYA 1J9YA 4KEUA 1LROA 3N2BA 1LQAA 4Y9NA 3QF0A 1B3WA 4QEEA 5G5IA 1JF5A 2VZUA 2WMJA 3C8FA 2IPGA 2ZDRA 1J79A 2VO5A 4PMVA 3U9IA 1IE7C 2C7FA 3URAA 2PGWA 2C3ZA 4DBDA 2WOIA 1U2YA 4WSKA 2ZFAA 3AIQA 2YCEA 7A3HA 3ITCA 4O50A 1FWHC 2ISWA 5ABFA 2UWFA 2EG8A 4A8LA 1FY6A 2PP3A 4B3LA 3VD5A 1RA0A 4HK6A 2CLEA 2QPSA 2YDRA 1H5VA 4FOUA 3PVFA 4OBTA 4P2VA 1GTHA 3SCNA 2XDFA 4UTTC 3ARRA 4I8YA 2HK1A 4H9TA 3DUGA 3VIHA 3U5UA 2WB5A 2OU4A 2VL4A 3VIGA 1V3JA 1VQTA 3VKCA 3DFHA 2J7GA 4JZ5A 2NW0A 1XQLA 3LCXA 1R3RA 3S46A 3TXVA 4WXYA 2X1IA 4K36A 1ZBCA 4GNKB 4NZFA 1KLZA 4N02A 1PB0A 4V15A 5BW6A 1O12A 4WDWA 2D73A 2ZX8A 4YNGA 5KVIA 3QZ6A 4B91A 4RNIA 1MOKA 1E71M 2HXTA 2P0IA 3CBWA 3H2CA 1VJZA 4JQ2A 4CQDA 1W5PA 3PTKA 5A94A 3RGTA 2J77A 1B9ZA 2W63A 3PPCA 3W87A 1Y5WA 1H09A 2OOGA 1Z9AA 4DJEC 4GO9A 1V0LA 4HMNA 5HJLA 1E43A 1GW1A 4UTWC 4NJHA 4ES4A 3WCZA 4DO6A 1U22A 2DSKA 2JQXA 3FEMA 4DELA 4WKHA 4JL1A 4GNVA 4HNNA 4GKLA 1VFSA 2JIWA 2WWDA 4I7WA 2R14A 1ZX9A 1J5TA 4NI3A 3C2VA 1FWNA 1GT8A 3GIYA 2Y7EA 1ONFA 4QCEA 2G5WA 1B4EA 3SR7A 3VKKA 5BOEA 3IIPA 1R46A 3FX4A 3DHDA 3EWDA 1Y65A 2AL2B 5AHIA 4OECA