3T4WA

The crystal structure of mandelate racemase/muconate lactonizing enzyme from sulfitobacter sp
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
SMKLQDLEVIVTAPPAPGWGGRYWILVKLTTDTGIVGWGECYAASVGPQAMRAVIEDVFARHMQGENPENIELMYRRAYSSGFTQRPDLTVMGAFSGLEIACWDILGKDRDRPVYALIGGRMNERVRGYTYLYPLPHHDMTAFWTSPEMAAESALDCVARGYTAIKFDPAGPYTMRGGHMPAMTDISQSVAFCKAIRAAVGDKADLLFGTHGQFTTAGAIRLGNAIAPYSPLWYEEPIPPDAVEQMAAVARAVPIPVATGERLTTKAEFAPVLRSGAAAILQPALGRVGGIWEAKKIAAMAEVYNAQIAPHLYAGPVEWAANIHLAASIPNILMCECIETPFHDQLIKSTIKVEDGFITAPTAAGLGLEVDEALARAHPYTGNGLHLEMQEAPCDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme family protei
publication title The crystal structure of mandelate racemase/muconate lactonizing enzyme from Sulfitobacter sp
rcsb
source organism Sulfitobacter sp. nas-14.1
total genus 133
structure length 396
sequence length 396
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3t4wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3t4wA01
1SJCA 1ONEA 3SBFA 2OX4A 4E6MA 4IZGA 4ENLA 1P43A 3MWCA 3FCPA 4DXKA 2GDQA 2OFJA 3UJEA 3SN1A 3R10A 3UJRA 3QKEA 2XH7A 4GYPC 2PGEA 3N6HA 3TJIA 1EC8A 3S47A 4H19A 3ZVHB 1KKOA 3VC6A 2QGYA 2AL2B 3MY9A 3NZGA 3GO2A 3D47A 1JPDX 1SJBA 2OQYA 4DN1A 5BOEA 4JN7A 6ENLA 3JW7A 1JDFA 3ES7A 4HN8A 4KT2A 3TJ4A 1R6WA 1MUCA 2QDEA 2PTXA 4HNCA 1L8PA 2P0IA 1EC7A 4H83A 3UGVA 3V5FA 3NFUA 3DG6A 1KKRA 3DESA 4F4RA 3V5CA 3VDGA 3CK5A 1OEPA 2POZA 2PPGA 5FJPA 4FP1A 1NU5A 3IJQA 3UJ2A 4IP5A 2PCEA 3CB3A 4KEMA 3B97A 2PGWA 3T8QA 4E4UA 1BKHA 3NXLA 3OZYA 1EBGA 3V4BA 5FJOA 3N6JA 3Q45A 3SQSA 1EBHA 2PMQA 4GIRA 3STPA 3JVAA 1MDLA 1ECQA 3TTEA 4HCDA 5BOFA 2P3ZA 4H2HA 3SN4A 3CAWA 1SJAA 2CHRA 3V3WA 3S5SA 3JZUA 3PK7A 2RDXA 1MDRA 2PU0A 3TQPA 3RRAA 2OLAA 2PTYA 2QJMA 1KD0A 4IT1A 3SJNA 3TW9A 3IJIA 3ES8A 2OPJA 1E9IA 4IHCA 3DDMA 2FYMA 4YWSA 3H70A 3QLDA 2PODA 3H8AA 4E4FA 3VCCA 1TKKA 1RVKA 1YEYA 3MSYA 1MNSA 3EKGA 4Z1YA 4H1ZA 3UJFA 2GGHA 2QQ6A 5FJRA 4HPNA 3MQTA 1JPMA 2DW6A 3OZMA 3U9IA 2OQHA 3ZLFA 3R11A 4M0XA 3R0UA 4EWJA 7ENLA 5FJUA 2QJJA 4KPLA 4A35A 3DG7A 2OZ3A 5EU9A 3U4FA 3P3BA 3R0KA 3DEQA 3FVDA 3NO1A 3IJLA 2OO6A 2OVLA 3CT2A 3SN0A 4GGBA 4GISA 4MMWA 3R1ZA 4GGHA 3UCDA 1KCZA 4JHMA 4G8TA 1DTNA 2GGGA 2QVHA 2P88A 4J3ZA 3HPFA 2AKZA 1F9CA 3OP2A 4K8GA 3PFRA 3Q4DA 5IDZA 3ZVIA 3T4WA 3N4FA 2GGIA 3FJ4A 2HZGA 4GFIA 3FYYA 3K1GA 4IP4A 2OZ8A 3UCCA 4E5TA 3BOXA 2P8BA 2XSXA 3P0WA 1JCTA 3OPSA 3I4KA 4GMEA 2GL5A 4A3RA 3BSMA 3R25A 2HXTA 4FI4A 4A6GA 4ROPA 3KUMA 2QJNA 3OTRA 4K2SA 2GGEA 3ENLA 3OW1A 3QPEA 2PU1A 4MGGA 3VC5A 2XH2A 3RGTA 1XS2A 4E8GA 4X2PA 2XH4A 1W6TA 2HNEA 3QTPA 1FHVA 3DG3A 2OG9A 4DYEA 3ZVHA 2XH0A 3MZNA 3I6EA 3DIPA 2AL2A 3DGBA 1SJDA 3FXGA 4IL2A 3DERA 2PTWA 1FHUA 2O56A 1NELA 2PP1A 3UXKA 3ZLHA 1TE6A 2PTZA 3BJSA 2HXUA 4HNLA 1EC9A 3H7VA 3D46A 4JN8A 2PP0A 3GD6A 3TWBA 2MNRA 4MKSA 3N4EA 2XGZA 4KWSA 4Z17A 3T6CA 2QDDA 4DX3A 2OKTA 3RITA 4K1WA 1R0MA 2AKMA 3RR1A 4HYRA 3FV9A 3THUA 2ONEA 4HCLA 1MRAA 4J1OA 3DFHA 1XPYA 3TCSA 3VFCA 4HCHA 2PSNA 5ENLA 4DWDA 1ELSA 3PWGA 3VA8A 4DHGA 2PA6A 3SSZA 2AL1A 1WUEA 1P48A 2PP3A 3GY1A 4IL0A 3P93A 2FKPA 4GYPA 2MUCA 2P8CA 2ZC8A 3UXLA 3CYJA 2DW7A 1TZZA 3EEZA 3TOYA 1WUFA 5FJTA 2ZADA 2I5QA 3I6TA 3RCYA 3VCNA 1BQGA 3QN3A 3GC2A 4G7FA 3MKCA 3ZLGA 2GGJA 3H12A 2OZTA 3CXOA 1PDYA 3RO6A 3DFYA 2GSHA 3PWIA 2NQLA 4ZA0A 4M6UA 3TWAA 3UJSA 3IK4A 1PDZA 3MUCA 5J04A 1IYXA 3T9PA 4ZCWA 2PS2A
chains in the Genus database with same CATH superfamily
3TSMA 5AC8A 4AX7A 3P60A 3LOTA 3AMDA 5FIPA 2BTMA 4PCPA 1GZGA 4ECLA 5C7VA 2YLAA 1SUXA 1UWIA 1FKXA 4CQDA 3BSHA 2WC4A 4NU7A 2HPMA 1JPHA 4L6OA 1PBGA 4LALA 4IPIA 2ISSA 1OX4B 3CYVA 4N2YA 1GW9A 4TX8A 1R3RA 5DMMA 2G95A 2V8ZA 4Y96A 8CGTA 1V6WA 3O05A 2AL2B 3QZAA 4AB4A 1OIMA 1SO3A 2CESA 1KXHA 3B4UA 5A8OA 2E6AA 4NAEB 2XIOA 5CKSA 3ABOA 1JDFA 3E0LA 1YDVA 4HN8A 3VOJA 3KLLA 1DJYA 4XUYA 1OJTA 3D3AA 3T40A 1HVXA 4UMBA 3GDBA 2BHZA 2CLEA 3QQ0A 3IVTA 4C1LA 5FF0A 2J6VA 2FH6A 3DZ1A 4PTXA 1LORA 2IMRA 5BXSA 1PPIA 3NL2A 2WHLA 4OKDA 1JZ3A 1NM9A 4I5RA 1GYLA 2G0WA 4RNJA 4YU1A 1RH9A 4U5IA 1WDDA 1AH3A 5LA1A 2X8GA 4UR9A 3S9IA 4XD4A 4F3HA 1LPFA 3TQ0A 3NVTA 3NDOA 1RK6A 1X96A 4REQA 4LCQA 3R5EA 3UESA 1B2YA 2R1LA 5JCNA 3NL6A 3W01A 1MEIA 1PYFA 2YBTA 3QV8A 3EYPA 1RSCA 1OJXA 3IGXA 4QP0A 1AK5A 1GV4A 4IMEA 1XD0A 3FDKA 3ZT5A 1GEHA 3OB8A 3CIXA 1NH6A 3QHMA 3MUXA 1QO5A 4EPDC 2G3NA 5FL1A 2C91A 3SN4A 1AJ2A 4LBUA 4E38A 4UQEA 5JUVA 4IX0A 4M52A 3GG0A 3WF1A 1I1WA 1YMYA 3V1PA 3AIWA 1H0GA 2RGLA 2OPJA 3QC0A 4ZENA 3MW7A 2EPLX 5C8BB 3IC9A 3QLDA 4Q3MA 5TQLA 1LT8A 4GJIA 3WNKA 2WQPA 5HBFA 2FHBA 3PZUA 5F2MA 1E6PA 2V67A 2XYLA 3ARXA 4J7RA 1TO3A 4DZHA 2CLPA 4FA3A 4KKXA 5F1UA 3OGSA 3FOKA 4DNMA 3BGJA 5DCBA 4H8UA 1ENUA 5CCZA 4UQ9A 2CXEA 3UYCA 1XLFA 5IBXC 3N12A 3LQGA 4W88A 2ZX5A 3F4NA 4H50A 1DV7A 1EUAA 2XVLA 2P10A 5A1AA 5GJPA 5HA7A 2BS9A 4N6EA 2NX3A 2OODA 3DG7A 3F5JA 4XB3A 1TX0A 2D2GA 2AQVA 1Q7ZA 1TB3A 1Z69A 1H1NA 4NI8A 2X8CA 3N25A 2AQWA 3F03K 3VKAA 3UVAA 1EB3A 3NQ6A 4XTDA 1TR1A 5DF0A 4DJEA 1A5KC 4IPLA 4W8BA 1DVJA 4PFMA 3RPMA 4AF0A 4DQWA 4GI4A 4PCFA 1XLIA 3L5MA 3EMZA 5IDZA 3VNYA 4CD5A 2OOGA 3B06A 3CGEA 3PM6A 4BS0A 6REQB 1GYMA 5PTDA 1EDTA 2QCCA 3KLKA 5XIAA 3TLQA 4UTWC 7PTDA 1WB0A 3GKAA 3FFSA 1J9YA 1GCYA 2CWNA 3BOXA 5DCEA 5CGQA 4JOMA 4OBSA 1QK2A 1FH8A 1MOKA 3WDJA 4GVIA 3CMFA 3A9BA 4FLSA 2QUTA 1BZLA 2CZ5A 1K02A 4NF7A 2XM1A 2DT0A 3QPEA 4PMDA 2D2HA 1GPFA 4IJCA 4R27A 3OQEA 2ZXQA 5K3VA 1MYRA 4KMQA 4IGHA 4O53A 5HDRA 5SWUA 2WWDA 2HISA 2ISDA 3WD3A 2QJIA 4F0LA 3AIRA 1AL7A 4A8RA 3N2CA 2TRSA 3NR0A 3OG2A 2H90A 1FHUA 3E38A 1B3VA 3CHDA 4YTSA 4E2BA 1XLLA 4YVVA 1H5YA 5JXQA 3WBYA 3H7VA 4PMQA 3VXGA 5C7HA 5D33A 1KCKA 4H9VA 2PP0A 1AZ2A 4LUSA 3PAOA 2MNRA 2YCLB 4TTUA 2PWEA 1WP6A 1UD2A 2C15A 2EG6A 5HMEA 3XIMA 4NAFA 3T6CA 1LLZA 4PMXA 4IJBA 3CGTA 1A47A 4UNLA 1F76A 3W76A 1JCYA 5C55A 1YQZA 1Q63A 3L4ZA 1PJ9A 1MEWA 2P76A 4H6EA 4IP7A 3R0DA 1YTEA 3CXBA 4HN4A 1A50A 2AGKA 4EF9A 3OHMB 2EGZA 4TIMA 2CZVA 1UBPC 2J9XA 4HPGA 5AYYA 1IXPA 4RDZA 3S2CA 2BVWA 4AXNA 4RZ6A 4C5ZA 4O12A 2ZBTA 2DW7A 3BG5A 3PZGA 4GQGA 1FECA 2WXDM 2XFRA 2ADAA 2OZ0A 2VRJA 4IIEA 4AW7A 3RUBL 1H7OA 3RDKA 3MI2A 2WMHA 1ZRQA 3PP7A 4G6CA 5DX7A 4DXVA 5IM51 4O18A 5EMKA 3B0PA 4AY8A 2GGJA 2Y61A 4YN5A 1G0CA 1OG0A 1E9LA 3CQ0A 1XBXA 3M47A 4NJIA 2IS7A 3ZXWA 1BXCA 1TMQA 3QR3A 4WSJA 1IYXA 1UKPA 3E0WA 3IACA 4ZCWA 1Q8AA 2VDHA 3QOKA 1PHQA 3NJ3A 1V6UA 4Z1BA 4MIMA 1C93A 2WSPA 1A5BA 3PTQA 2YA0A 5U4NA 3RM4A 4A8NA 4A3UA 1EIXA 2QIIA 4QROA 5HJLA 4HHHA 4MAVA 1J5TA 2WOQA 4H9UA 1RV8A 3L65A 5D02A 2YQUA 4HZ7A 1EC8A 3HGRA 3H2NA 3UT0A 1S5MA 4LS1A 4M81A 4H19A 4C60A 4M1BA 2VEPA 3OA5A 3NYZA 5BOEA 2OQYA 2PLJA 1SO5A 4Y6GA 3TX9A 4Q4SA 5DRIA 3DI1A 3F2DA 2GFTA 2PDXA 3HG2A 1JZ4A 4OECA 1PTAA 2VC7A 3KOYA 4QCFA 1MUCA 1G01A 3SUWA 2ZZ4A 1IZJA 4WHBA 2GPTA 2VX5A 4O14A 3WBEA 5I09A 3G24A 3LXDA 3KLJA 1DWGM 2ZFAA 4KEUA 1CGXA 2NVKX 3IGHX 3S46A 3CIWA 3BC9A 2EPNA 4DUVA 1O7AA 5I24A 1X7IA 3W1AA 1OFPA 1V51A 1H2JA 4FDCB 4ZO9A 2PWVA 1V79A 2Q71A 1UROA 4TV6A 1KXTA 2NV9A 3EWZA 3VIJA 4FXFA 2J9YA 2NSOA 1S2AA 4Q8QA 3LRMA 1EJUC 5FEWA 5A6TC 1B3WA 4N4PA 1FWWA 4DI9A 3KL3A 3QH2A 1L6GA 3ZZ1A 4RNIA 1R3YA 3CM4A 4IMGA 2W61A 4RK8A 5H8PA 4QEEA 2Y5JA 4F8XA 2AAAA 1KM5A 3QTGA 2PDNA 1H61A 5BXPA 1UWRA 3AAMA 5E6ZA 4RE3A 3STEA 3VZYA 2QPXA 2FYMA 2ZYFA 3Q67A 4GKTA 3EWYA 1A5LC 3H70A 1JF6A 2QCEA 4GVGA 1Q7QA 2XSBA 2WBGA 2YSWA 5E09A 1T5AA 3RMEA 2BMBA 2V5KA 5I3DA 4E3TA 1GOWA 1N82A 4IMAA 4HSHA 4KBXA 2Y6ZA 4KFOA 4ILSA 2DSWA 1BXBA 3PB0A 4JX4A 2QV4A 3OZMA 1GXFA 4RXGA 4C6BA 5CGMA 1G69A 2J6XA 4B5TA 1O5QA 1JNDA 3FY1A 4DELA 1TCMA 3SAZA 3HG3A 3WNPA 3U4FA 3QR1A 3EDKA 4JIQA 1WKYA 5J8LA 2YFOA 2A4AA 2CBIA 1K8YA 1ZLPA 3NO1A 1ZAHA 3N2BA 2OO6A 1JZ6A 2OVLA 1G6CA 3L4WA 4MUPA 3L5OA 2Y89A 1CB2A 4F2BA 3RCMA 2CW6A 2V81A 1FWHC 2H3DA 2PFHA 1GRAA 2Y7FA 1GONA 3B9AA 4NJGA 1GRFA 3NAVA 4X0NA 1NDWA 3N13A 3R4IA 4WX2A 2NWSA 4AX6A 1KBBA 4QFUA 2XVNA 4WUIA 4H6RA 4NEVA 4MB5A 5AN7A 5G4HC 4QXIA 1R3SA 2R1NA 3IUDA 4L9YA 3T42A 4XZLX 2ACSA 1OABA 4H9MA 1W3IA 1TX2A 2FJKA 4LX4A 2X0SA 2FZDA 3WJXA 2E3ZA 2VEGA 4JDBA 5F4WA 3EWBX 3M1ZA 3L12A 3UXDA 1JCTA 3RYSA 3KBNA 1BQCA 3QMTA 2VCCA 2FFIA 4DI8A 2OT0A 2GQWA 1EGMA 1XRSA 4O54A 1IT8A 1I6NA 2R1MA 3BUVA 3BMVA 2Y8UA 8XIMA 4H8HA 2A21A 4MGGA 5EY5A 3QW3A 4NNAA 4XX6A 3OIHA 3RLVA 2VCAA 2WCAA 3ABRA 1O5XA 3PPGA 3W88A 4AVFA 4M82A 4HQVA 4B16A 3MJMA 3NIYA 1UR3M 4UZUA 2GVGA 3MV11 2J7CA 5FF2A 4GLEA 1V3MA 3W24A 3W7IA 3LX9A 4YXGA 1IE7C 3GR8A 3BGGA 2HROA 3L4UA 2VT0A 1ZBVA 3KVLA 1IT7A 2FVMA 1UUMA 4PUMA 3M0KA 1QNPA 1SMDA 1O94A 3UG3A 4XO7A 2Q8ZA 4F2TA 5CLWA 5I3IA 1W5MA 3M5ZA 4Q8WA 3HQOA 1IT0A 2EQ8A 4K1WA 1H7XA 1F8MA 4HYRA 1JPKA 1IEQA 1F2JA 2BOEX 2HNHA 4HU3A 1VFUA 4GX9A 3W84A 1A5OC 3ISIX 3JU2A 1I75A 4O28A 4S38A 5MF5A 5AOUA 3CLMA 4MOZA 3CTLA 4ATLA 4HTYA 2BNJA 1NEYA 3PZQA 4KWVA 1LWHA 3W1UA 1OQFA 2QMJA 1EJVC 1AMKA 2FGBA 5D9NA 4WDXA 4MNMA 3APYA 3QEZA 1ZK7A 3F2BA 1XLAA 2X1SA 1XJBA 2VR2A 5IBXA 2E6YA 2DVUA 3NPVA 3P5ZA 1JZ2A 3W7NA 3B8TA 1TPWA 3EPNA 3ZT7A 2UV8G 2FH8A 1RA0A 2Q3RA 3JR2A 4GD0A 4CD4A 2ZX9A 4WY0B 3OODA 3SURA 1SW3A 1UD4A 4J35A 5FS8A 2JKAA 4EX4A 4ZA0A 3TWAA 1DWJM 3DOPA 1XLEA 3C0LA 3N2MA 1UG6A 2RDWA 2XU2A 4P7RA 1GJWA 3LGDA 1XCWA 4ENLA 4Q6XA 1CXEA 2QPUA 2D3LA 3OVRA 1IHIA 1R38A 1XRVA 4YHEA 2D2OA 2OFJA 5KZ6A 3SGZA 4U3AA 1JCJA 3NQMA 3DJGX 4ATWA 2ACQA 3TMLA 1CBGA 5EMJA 3BICA 2XH7A 2X42A 4JYDA 4IICA 2VP8A 3LCHA 3TJIA 5KETA 5LGXA 4B3KA 4GCXA 4HNOA 4OJYA 1NQKA 3LTSA 1HFBA 5KZDA 3QZEA 2V5CA 1E0XA 2HK0A 1POKA 1SJBA 2E67A 3VUPA 1G1YA 4U2YA 1XSKA 3P7YA 5DY2A 4PSRA 3L5AA 4JNMA 3PANA 3W38A 3FGCA 1BAGA 3Q2DA 4LEQA 2WZMA 3GVVA 3DG6A 4L9ZA 1EBDA 2DZPA 2QDHA 1KKRA 3AHYA 5G1YA 1ITXA 5HUPA 4B2DD 4PULA 3LHZA 4LVAA 2OELA 3LNPA 1QPNA 1NU5A 3WSUA 3GXDA 3IRSA 2A79A 3N14A 2OEJA 4MWAC 3GDTA 3ZOAA 1V3JA 1UP0A 2A6LA 1K03A 3PBGA 3GIPA 4PMUA 5CPMA 2VMFA 3CBWA 4AC1X 3EA2A 5TR3A 2X1UA 4PA8A 1VHNA 4IMDA 2VZOA 5I06A 1HJQA 2XJ7A 3WO8A 3HFYA 2V3AA 2V2HA 3VNZA 1JD7A 4GHRA 2CHRA 2OEMA 1IR2A 4H4WA 3B0XA 3NVWB 4LIIA 4ERAA 2WW5A 2ZZ5A 3L0KA 4D6DA 1R9XA 2CETA 2Y1HA 3DX5A 3F4CA 3OA3A 5FACA 2BHUA 1OCJA 5RUBA 2F5ZA 3G1AA 1BF6A 4CCEA 1C90A 3GNNA 3VCCA 2PDQA 4J3SA 2V6OA 1RVKA 1C9WA 1KFWA 4Z42C 2ZZ7A 4UTJA 5M3WA 1HT6A 2ZKMX 2PUZA 4Z1YA 4GA8A 3TYUA 1H2IA 2GGHA 4GUJA 3VOIA 4DBWA 3AXKA 3MQTA 3HURA 2QAPA 2QDGA 3T7VA 3F5LA 1NWSA 2PDGA 5E5CA 1LYXA 4NSBA 1VB9A 3ZR6A 1ZHAA 1KQZA 3EPOA 1Q85A 5CGTA 1HP4A 1FQ0A 1Q13A 3M0ZA 3LBCA 3WN6A 4B5NA 2Q6ZA 3VKCA 1FFRA 1GOIA 4LAUA 4GY1A 3H2CA 1EYEA 4HMEA 1WXJA 4L4OA 3IAPA 5F1VA 3CV6A 4MMWA 3CGCA 1VEPA 4I8DA 7TAAA 4X60A 2IQTA 3GU9A 2NXHA 5JH1A 3GX9A 5LA0A 1CPUA 5K7JA 3ITCA 3W85A 3PY2A 3PC0A 4Z2HA 3CIVA 1DQUA 3CEUA 1EIBA 4K8GA 3HPXA 3PFRA 2VD8A 2HCVA 4RL3A 1CGWA 4DM2A 1Z41A 4XZBA 2BZNA 3WMLA 3A21A 1F4HA 1LQ2A 2GGIA 4AIEA 1LZOA 1J6OA 1ZP3A 3KVJA 3MHUA 3USZA 1GPWA 4DLFA 1D8WA 3FYYA 1OFDA 4XAGA 3VX0A 3GBDA 2EKCA 4REQB 1WNOA 1Y5XA 3UCCA 4HTBA 2W66A 3VDHA 4ZXLA 4LV9A 3TXZA 4WXZA 1XICA 4R9OA 2XVGA 3KTCA 3G3DA 3O15A 4EPEC 1KXQA 2Z24A 1J0KA 4QNEA 3KL0A 2WCSA 2PDYA 4K1GA 1NIUA 1DXLA 4AZBA 5LIYX 3II4A 1KTNA 1XP3A 1QNSA 5F2GA 5IRPA 3LM3A 1W3HA 4R7OA 3RGTA 1ISXA 2RAGA 4Z1AA 2HNEA 3U57A 2FZNA 2CLOA 4OWGA 2P53A 1X7FA 2X8RA 3BQ5A 2VI0A 3AMLA 5FF7A 3WQ8A 5DELA 4AZ5A 2DH2A 3LTPA 3A4AA 2Z7GA 4FHAA 4PMVA 1NELA 2PP1A 1H7NA 2I56A 1DJNA 2IPGA 2PTZA 1CGYA 3SCQA 3TYZA 1PX4A 2HXUA 4LEFA 3SJ3A 2FIQA 3TVAA 1KR0A 4N6FA 4XD3A 3R13A 5I3JA 1GQJA 2D0GA 1PXGA 1Q2SA 4Q8MA 1TPVA 4NYUA 2FFCA 1ZJIA 4Q32A 2ZX8A 4Y9PA 3KEHA 1EP1A 3FW6A 3ZJKA 2WANA 4CKQA 1ONXA 2E9LA 1XPYA 1LROA 3WLSA 1ZY9A 1H60A 3I3EA 4HK6A 2VGIA 1HGWA 4HMDA 3C86A 5T9CE 2IXVA 2DT1A 1WXZA 4AF0B 4GJ1A 4GYPA 2TPSA 3BQ6A 4GO8A 2OSYA 2YOCA 3EOUA 3GDRA 1UD6A 4ORIA 2V38A 3NZPA 3S1VA 4S3JA 4DF2A 3SUVA 4WJXA 3ZT6A 4AMAA 2RDTA 4N9DA 2RHGA 4MHBA 1VFSA 5TF0A 1FWTA 4I9JA 2R1KA 1P1XA 4IQEA 1CXHA 1PWLA 1PDYA 2YLLA 1V6TA 1VJZA 5LHFA 2O4QA 4E2VA 2YIHA 3TN6A 4QG8A 4EE9A 3PBYA 3WLLA 2PS2A 1V0MA 5CPTA 2GJNA 4UOQA 3LRKA 1JVNA 4CQCA 2OT1A 2ZQ0A 4DXKA 1UUQA 2H3BA 4EAMA 1GRHA 1JFXA 2G3FA 4ZGYA 3P82A 4X61A 2UBPC 4MKNA 5TBOA 2Z2UA 3R8RA 1QVBA 2P3EA 3WQFA 3LG3A 3GRTA 2PI6A 2TMDA 4QJ4B 3S1WA 4TX9A 4WR3A 4HZMA 1XIJA 2OB3A 3GU1A 3NZGA 5EB8A 3M0XA 3FA5A 5HQEA 4BEUA 1BHGA 4NZCA 5H8MA 1K8CA 1U33A 1LL4A 2OWWA 2Q01A 3JW7A 2YCKX 2X40A 2G41A 2D0HA 2EF9A 1LG1A 1T8XA 1Z42A 1XIBA 1MUWA 1V6YA 4XV0A 1W3TA 1XANA 2GOUA 4HMNA 4MUZA 2PAJA 1BTMA 1TQXA 1QRQA 3BVJA 2DPEA 4LUSB 3WJWA 5LIUX 3O0KA 2P5NA 2NZLA 3OG3A 1KM6A 3GNXA 2EO7A 4HOZA 2GSEA 4NAFB 4YVXA 1S1RA 2QUUA 4DZ5A 4AQLA 3IJ7A 4ZVJA 1VD6A 1GT8A 1H6VA 4O16A 2WMIB 3T55A 4JKMA 3AUJA 2W6RA 4B5WA 4AZ7A 2J66A 3ARVA 3WQ5A 1VYRA 1TVLA 2EPHA 3E3HA 3KVMA 3K8KA 1L6SA 4EQSA 2DSVA 3REQA 2QLYA 4QG6A 4MADA 4I9AA 1OYCA 2DIKA 3CUXA 3AJXA 3WMSA 3BG9A 1TV8A 4H00A 5HNTA 1UH4A 2XDFA 1VIWA 4KQNA 4MAZA 4UTMA 3M0YA 4DYJA 4DJDA 1RZMA 4PMYA 1TA3B 4IT1A 4BEQA 3SJNA 1ZCCA 3WELA 2Y0FA 4H9TA 2VEIA 1JXJA 1TQJA 4QDMA 2XN1A 3M0VA 1V3LA 3GYEA 1WE5A 3DHFA 1CB7B 3TONA 3EAOA 3U4AA 3BV4A 1TJPA 3GKFA 3TDFA 1EXPA 1FWDC 1HJUA 5FS9A 3O2LA 2C0AA 1XBVA 3PS7A 1QI5A 5H2ZA 3T0AA 3DI0A 4ZQOA 4IGMA 3HZ3A 2NV2A 4KFNA 1N8FA 4DIAA 4NZ4A 3AWOA 2WK2A 3A22A 3LXAA 2CIPA 1DTUA 2XUCA 5JIWA 4H4UA 4NZ5A 5FSEC 3ABZA 3GW0A 2BVYA 1W9UA 3DHDA 1WYIA 3GWQA 1E6XM 1WDWA 3CLWA 3VDAA 2PCQA 3VOFA 2DUAA 3AHXA 2PDMA 4J56A 3G1DA 5HWMA 2OYLA 2WMGA 1UC5A 3M46A 2FPVA 4LT9A 5LYRA 2VO5A 5AC4A 3FSUA 2HMCA 3GAYA 3TAOA 4OT7A 1RY8A 2YYUA 4K7YA 5A6JA 3DGZA 4JQ9A 3AM9A 1B31A 1I0BA 3QRHA 2Z0IA 3P2VA 4B3LA 1O12A 2YBVA 4YMZA 3TOPA 4IG2A 4N9EA 4HMCA 1XX1A 3JZEA 1EX5A 2J4GA 1WAWA 3NQBA 3STCA 4RDYA 4E5TA 4M56A 1FH7A 1VCGA 3NQDA 1KRBC 3CL7A 3VNDA 2Z4GA 5IDIA 2EG7A 2GVYA 4GMEA 2GH5A 1E4IA 3GRSA 2HSAA 1S2UA 4JQ2A 3S0CA 1QMLA 2JGQA 1IXOA 1B5TA 3R2GA 1US3A 4K2SA 4HOXA 2JEPA 1S7MA 3C2FA 3QFWA 2UZ9A 2V5LA 5D8ZA 3U2OA 4F0HA 2GZXA 2OMAA 2BX7A 5H8UA 2HJPA 3VGHA 3AO0A 4ZQMA 1M65A 3E5BA 1L6YA 2CZFA 3W7OA 2GLKA 1GW1A 3VX1A 1G4SA 5E0KA 1QPQA 1QNQA 1RK5A 4AY7A 2JK6A 1V6VA 4J3UA 1RQHA 3EA1A 3HQ1A 1QBBA 5LNVA 1NF7A 1XDJA 1E71M 1H7PA 1KTCA 1IR1A 3O6CA 3LY0A 4A8IA 4DLMA 2E68A 4JPGA 2YXGA 3CNYA 3TYCA 1OFRA 1R2RA 2NUWA 5IFTA 1ADOA 4GCAA 5D2YA 5FEZA 3UWQA 2V82A 3C8NA 4C6QA 2Z1VA 4LA1A 2VDGA 3ATZA 3GW3A 4DUXA 3E0FA 3K5XA 2C19A 4DX3A 2ZXDA 2WZIA 3L4XA 4D9PA 2GQAA 3VIPA 1R0MA 4IGNA 1RAKA 3KXQA 5K4XA 4J1OA 4AWUA 2J7BA 2PSNA 2YDQA 3C3NA 4LCRA 4JYFA 3HW2A 5KSWA 2YL9A 1KM3A 5E93A 1SMAA 3R12A 4H4QA 1KBIA 1JGIA 3N6QA 1TTQA 4MG4A 2HVMA 4US5D 3VD4A 3QZ6A 1HIZA 2G3MA 1QTWA 2QNEA 1ONWA 4D6IA 3MPGA 5HUOA 3SSJA 4BI7A 4E4PA 5AC5A 3FIGA 3W71A 3GS6A 1ZGDA 2GQ3A 4MNKA 4JICA 1M53A 2I5QA 1BQGA 3AU6A 2ACRA 4Q7NA 4QHRA 1K8XA 2CITA 1EX1A 3WQOA 3DFNA 1E4LA 2GSJA 3URQA 4JIHA 3IK4A 1GWJA 5J04A 5C9UA 3LZ3A 3WQ4A 1MXGA 4GIEA 3A64A 3GTIA 2FB2A 1KV8A 1CI1A 1VIZA 3MWCA 3S1XA 3FCPA 1C29A 3CQIA 1T99A 1N5WC 3AYRA 4GI8A 5ABGA 4QDPA 1Y65A 3P5YA 3WNOA 3T0DA 3INPA 3RX3A 1X6LA 3GXTA 2GR2A 4BR1A 1D3CA 2I5IA 1X6NA 3M41A 3PBMA 1YDNA 3S2MA 4YL2A 1LT7A 1M03A 3RJYA 4DEFA 1R86A 4IXHA 3GU2A 1VGAA 1GVIA 1RPXA 1UH2A 4DF1A 4MYXA 2A1YA 2WLYA 3UR2A 4UFKA 3PZNA 2QAEA 4AZGA 1PX8A 1HO4A 2INEA 3UETA 2QDEA 3VD3A 1S1PA 1JCNA 4KWWA 1K6AA 4AEFA 4OQVA 1WDQA 1GRBA 4CD6A 2A3AA 3VGEA 1GVOA 3TR2A 1MQQA 4TVYA 5CJNA 3A47A 1V7YA 1YTDA 2VEFA 3QKZA 1RPKA 2XSAA 2DUZA 1LLOA 1GESA 1ICSA 2OCZA 3W7DA 3AQUA 2E0PA 2PURA 4WOQA 1QPOA 3AISA 1VPQA 4NY2A 2YVGA 4WIWA 3JVAA 4PTMA 4ZE4A 2QCNA 3PZIA 3MO4A 3RIKA 2FPTA 3A4WA 1TJ0A 4J9JA 5C2XA 2WVSA 3WKZA 4QCEA 3IJ8A 4MLJA 3RRAA 2OLAA 2OOFA 2REQA 2KZHA 5CJMA 3GXPA 3EOSA 4XVDA 3GC4A 4Y90A 1BVZA 5HMDA 2ZZ0A 2A5HA 4RPPA 4OFCA 4DBEA 3VGGA 5KZEA 4R9XA 1T8QA 1J18A 1HKVA 4DRSA 4H4SA 3MWAA 4JY9A 2FZ8A 1SQ7A 2DUXA 3LPPA 4M5PA 3URBA 2WHJA 3MSYA 4KH2A 1EQCA 2W3RA 1FRBA 5B7YA 4Q8UA 2PRHA 3SCTA 4H8VA 3WUEA 1JXKA 4GXPA 3CAVA 2DW6A 3IJ9A 2VQUA 4Q4RA 2ZUTA 4MFDA 3RK8A 5AYIA 2NVCA 1VRDA 2QUNA 3WLIA 2OGYA 4AD2A 1JRCA 1E1FA 3WLKX 2PC8A 2O9RA 2EQ9A 2Q3OA 4KIRA 3TW7A 3WQEA 3SCSA 1GYNA 1KWGA 4KEVA 1GSNA 1KCXA 1G7VA 2W92A 2ALDA 1W8GA 5TD4A 1W54A 3CHFA 3WK0A 5HNNA 3R1ZA 5LGZA 1NPXA 2D2JA 2PWUA 4JCMA 3SIZA 2GGGA 1WX0A 1NFGA 3FGCB 5HMSA 1NWUA 3ZVIA 1NY1A 1PL9A 3N4FA 1MO0A 2WJDA 1TIMA 4H7CA 4KERA 1TELA 4O50A 4YJ5A 1Q4NX 5A94A 4D8ZA 1OM0A 3CAKA 3TN3A 2OLSA 4EQWA 4C5YA 1FUYA 2C13A 4ACYA 4K3ZA 3BSGA 4IH3A 3AC0A 4O8AA 1WZLA 5U1OA 4PRRA 1EP2A 4B9YA 1XBYA 2BXZA 1LVLA 4RZ4A 3DC8A 5DO8A 1OZQA 1PTGA 2PGRA 5BNKA 3EF6A 4RV8A 3FKKA 1ISWA 2V30A 3KUMA 1JL8A 1UPPA 1FWIC 4N42A 1EA9C 2QUVA 2C71A 1X2HA 2OYMA 4DAFA 3ONCA 5A8PA 3URAA 1G4PA 3VKBA 2BFGA 5EMLA 4IOTA 3S8HA 4AVOA 3ITOA 3KCLA 4I8YA 4DYEA 4Q7IA 3OU8A 5HULA 3SIMA 2C18A 2C7FA 3T0CA 1MQPA 1W1ZA 2CLMA 1VBRA 3LRLA 3OOQA 1G9HA 3TTQA 3WQWA 4Z08A 3Q6JA 2F6XA 5D9MA 3NSMA 4BKNA 3RF9A 3BLFA 3C8FA 3ERPA 3LV6A 4D6GA 5A8QA 1AH4A 4AH7A 3KX6A 1JZ5A 1WCGA 3UR8A 5FEXA 1JFHA 1N2VA 4KWSA 2J74A 2DZVA 1C8VA 3WBWA 3MUZ1 4EM3A 1UQZA 1I2RA 4HYVA 4EXBA 5DANA 5HR6A 2XIMA 1KC7A 4U28A 2ONEA 3O1NA 1ALDA 2F2KA 4LQ1A 2XIBA 3W7HA 1DORA 4GC4A 2C8NA 3CZEA 4E8DA 3G1RA 1EHNA 2PDHA 1ELSA 3AICA 2XIIA 1BG4A 2PA6A 4IIFA 3QLLA 4MYAA 2Z7KA 3OBEA 4JQ1A 3MDUA 1EKOA 4FNTA 4FR6A 4IIHA 2H8ZA 4GBDA 1YXDA 1AW2A 1MZHA 2WVVA 4H4YA 2UY4A 4ORMA 2X99A 3TA9A 2YB1A 1S5TA 4U5KA 3C3UA 1W5PA 2VFGA 5D9OA 1KGXA 3A12A 2PRLA 3CPGA 2VFIA 3WEOA 2WOIA 2WPBA 4AEOA 1FKWA 2W5FA 2JK2A 4RDWA 3VD9A 2NLIA 1DWHM 3KFTA 3V0SA 1NDVA 1S3HA 3KRSA 1XGZA 3P81A 4Y9MA 4UTTA 1HL8A 2Z6JA 1JR1A 3RPDA 2V6AA 4GWEA 3CGDA 3B8UA 1ONEA 1HKMA 3EBVA 1V59A 3FHAA 1Z89A 2BDQA 3SO7A 3DYMA 3W7KA 2Z1BA 4NJKA 2D22A 3CHVA 4TV5A 2WOWA 3LQLA 4WXYA 1EZWA 3S5ZA 4BWLA 4EQRA 1E6NA 1FHDA 2E25A 3LI1A 3W26A 2GK1A 4URIA 3QHOA 4HPHA 4IXXA 3RX4A 1H0IA 3OZPA 4PFHA 4FAMA 3WBXA 4WRHA 4CNSA 1E1EA 4JFSA 1KM1A 1UHVA 1XXXA 3GXIA 5AHFA 3HRDC 3UCQA 2A3HA 3GTNA 3MY9A 1BD0A 4JIEA 1K4HA 3D47A 1HKIA 3DBPA 3CS2A 2PDCA 3ARSA 2VX7A 2A0NA 4NNCA 4GO9A 1XCXA 3KBSA 4XIMA 2BP1A 4ZSTA 4G9PA 3LERA 4HNCA 5DXYA 2ZUMA 2P0IA 1J0IA 2Y24A 4NX0A 4E2DA 3VDGA 1K9TA 1E5NA 2HK1A 4L80A 3AHVA 1JDDA 3BLEA 3RR4A 3QGKC 3WD1A 4IP5A 3TUUA 4KWOA 1VBJA 3GAKA 3CB3A 4S39A 4QJ5B 4LY8A 4M6PA 1L8NA 3HU7A 4AZ6A 2JKPA 4S3AA 5DEZA 4OV9A 1I45A 4CN1A 2VC5A 3V0TA 1B30A 3N6JA 3Q45A 4KCTA 3PWAA 4NVTA 2WPCA 1MDLA 3CUIA 4DO4A 3W02A 2IPJA 2R14A 3CPRA 4GK8A 3BMWA 3GG1A 1V8EA 5D8WA 3OVGA 5CG0A 3TQPA 2V3GA 3OZOA 1SO4A 2YW3A 4E3VA 3VGDA 3ZSSA 4R7WA 3WLOA 3H21A 5CPQA 2J7DA 4K36A 2WNQA 3CV7A 5CPSA 1E40A 5LIWX 1QOPA 1MNSA 4JFTA 4H1ZA 3C0QA 4DY1A 1CZ1A 1CT5A 1YPXA 2P1FA 4JDRA 3GDKA 4A22A 3AS3A 3UZYA 3IGUA 1WXYA 3TQVA 3ATYA 1IGSA 2WJFA 3IV3A 3L4TA 3NQ2A 4FXSA 2EQ7A 4Q6JA 1MSSA 3DH9A 5FJUA 2IPFA 1Q2RA 1J2WA 2Q8XA 3R0KA 3EX1A 4P8VA 3TFCA 3V1HA 4A21A 2ZXAA 1W8SA 2PZNA 1UMLA 1A4MA 3W1XA 3R43A 3FJLA 3U2CA 1YX1A 1MUMA 2ZRXA 3O0HA 5D2WA 4HVXA 5JCIA 2BASA 1X8FA 1UYQA 5CBBA 1I4NA 2WYSA 1TTIA 3WH7A 2VEMA 3W1QA 3H2EA 4HZ6A 2ZUVA 4ZR8A 2YA2A 2WZEA 3P61A 4ZODA 4IISA 3OP2A 5BU6A 3ITGA 2R82A 1BEUA 1W32A 1L0PA 2VURA 5G2HA 5FS6A 1J0ZA 3A5FA 4LNYA 1A0DA 1JD9A 1D3GA 3GNDA 1ZMCA 1WA3A 3RNDA 4QSFA 3QFBA 1OY0A 4Q8OA 5D9PA 5GNYA 3GDMA 2Y7GA 4LW7A 3T81A 1S2CA 4PMNA 2FPYA 4NHVA 4OZOA 1XL9A 4CN4A 4C91A 4ZOCA 3CZKA 3VMPA 3KCOA 3P0WA 4AZCA 4HK5A 1YKWA 3RM8A 1XLMA 5B80A 5T9BG 1I0DA 4I7UA 2QCGA 2CC0A 1GOOA 3A23A 3ABXA 1CIUA 4GG9A 1FCQA 3EMCA 3REQB 2WKLA 2DFAA 4WKAA 7REQA 1UA7A 5BRQA 5FAJA 5FJIA 1V4YA 2Y2WA 2XH2A 4DJEC 6TAAA 3FJ6A 1GOMA 3A6OA 2QCMA 1KXVA 2YA1A 4HNVA 3HN3A 3AZSA 4Y8FA 1QJWA 3KWXA 4WD0A 2V5BA 3ZVHA 4MNJA 1JEHA 1D2KA 3VIKA 4ZSUA 4EP8C 2E4TA 4PN2A 3DERA 4JTAA 2R1PA 1EJTC 2EPMX 4YCPA 4PTWA 4GXWA 1GEQA 1SZEA 1YPIA 3AYTA 1JDAA 3I7RA 4GIAA 2PE4A 2WM0A 4J40A 3OLEA 2HEJA 1SM9A 2W79A 1F5ZA 3WK3A 4ZOAA 3NVZB 3QGAC 4OUEA 3EA3A 1Q1RA 2XGZA 1GREA 2IKHA 1BGAA 1DPMA 4O1FA 1XUUA 1TMHA 1ZCOA 1K6WA 1STZA 1U83A 3WL0A 4IJRA 1H41A 4X9YA 4QITA 3UWZA 2VTFA 4BI5A 4CEUC 2C3CA 4FPSA 4ML9A 2VJXA 4QIUA 3ZM8A 2ZWYA 5CC7A 4PUEA 2J3NA 1IQ8A 2OR2A 1B3YA 4O1DA 4ERIA 1RBAA 4NASA 3NTYA 4QE1A 1PZ3A 1HVQA 2G50A 3SSZA 1JDCA 1DJHA 2R6OA 1UUOA 4X9SA 1HW6A 1VPYA 4HHMA 4EIVA 2XZ9A 3ITXA 1WO2A 2IXUA 2FKPA 3P93A 3MBDA 2P8CA 3GZ3A 3S42A 2OLHA 4CCCA 1LRTA 4TQTA 3B8WA 3ANYA 5IHSA 3VZXA 4JTUA 3TOYA 3FNDA 3M43A 3N9KA 2ZUSA 3TNOA 1SFTA 2X1RA 4J27A 4MWAD 1V97A 1P0NA 3C61A 1E56A 4IG2B 3BLDA 3KBVA 1PZ2A 1OX5A 3GHTA 3ZLGA 2EPKX 1EXBA 3MHGA 4CU7A 2G3JA 3T08A 1ISZA 2J47A 4R85A 3SZ8A 3BCFA 2J79A 1PDZA 1XI3A 4K7ZA 5D2TA 1K77A 3PAJA 2NVAA 3QTPA 4CQBA 2VWTA 2VR4A 1PYMA 3MO7A 3AMGA 4JFUA 2ZOXA 3JUGA 1CW2A 3H23A 2OX4A 2I7GA 1W1IE 3WNNA 3BW2A 2JIWA 4S3GA 3SFWA 5I77A 4PTNA 2NLYA 3UJEA 2VFDA 1OVDA 1IIGA 3PNZA 1W56A 3LN3A 2ZE0A 1YHTA 2QCHA 2YBUA 3T2OA 1Y0EA 1HUVA 3WDQA 2BSLA 1NFPA 1K4QA 3AS1A 3LA4A 1LJYA 3U2ZA 3W7PA 3EUB3 1O1HA 3KBMA 1AA1B 1IWAA 3AS0A 4PB4A 1AUSL 3GO2A 1C91A 5M2FX 2ABBA 1M3UA 1JPDX 2OWCA 1IEIA 2VYOA 3ES7A 4I5XA 3CTTA 3LCLA 2W55A 2R24A 4OVXA 1AFSA 4RW5A 3JRKA 3UG5A 4W7UA 1L6FA 3SDOA 1GHRA 4LYPA 4APNA 4M7SA 5G5IA 3NFUA 1YW1A 1Z9AA 4F40A 1OGSA 5A6MA 3N17A 3NO5A 4JD4A 2OWXA 2BV9A 5FJPA 1P1MA 1AD1A 5FAGA 4YWIA 1C8QA 3LHTA 3VIFA 1OHLA 1WAUA 3RM9A 1NP0A 2RGMA 2D0FA 3B97A 3NZ1A 1BSLA 5DT7A 1N60C 3AALA 3G18A 1OG6A 3W25A 1E0TA 1EQPA 1XYMA 4MDPA 5EFFA 4KS0A 1Y7VA 2OYKA 1BYDA 2ZA3A 1YXYA 4KWUA 4Z2GA 3R7MA 3W7JA 1ZJBA 3EWDA 2FGLA 4CLMA 3V3WA 3KCJA 4RW3A 4NZJA 1Q8JA 5C2CA 1ZU8A 2QS8A 3BCDA 2PF8A 2PU0A 2QULA 4QQUA 1P6CA 1E3XA 3QPZA 4AAJA 2G4JA 1YBQB 3KHDA 5FA5A 4HA0A 4GQBA 5DBUA 3QMSA 3LCFA 3PUEA 4WEVX 4GR1A 4GZEA 1TYTA 3C2EA 3H8AA 5A6SA 1OX6A 1ZBCA 4MY8A 2Y70A 3FKRA 3A4XA 4YTUA 1TE1A 2J78A 1JUBA 4QDWA 3GFYA 3WFLA 4H4XA 1OIFA 5EYWA 3D5HA 2R91A 4Q4OA 1JIBA 4JQ3A 4M0XA 3TYAA 3R0UA 2RABA 3E12A 4PODA 4DM1A 2OXNA 3EX4A 3IEBA 3EX6A 3H24A 3BJFA 1UWTA 2XG9A 3UF9A 2VEKA 5KTLA 1GTHA 4QQ3A 3FVDA 4O52A 5G5HB 3QW4B 3VU2A 1NOFA 1SSGA 4RR4A 4RE4A 2G5WA 2E40A 4MSSA 4NQ1A 1FWNA 2IW0A 3MUAA 4JHMA 5D37A 1BWCA 4A3HA 5D05A 3EOEA 3W82A 4HYWA 5JBEA 3OVQA 1W37A 1E4NA 4MDOA 3I7QA 4M19A 5A2AA 3EAUA 4M6QA 5CSRA 3WF2A 2F7FA 3OEXA 1A5CA 2F2HA 2IUZA 1TVNA 3EX3A 2C3DA 1FP8A 4GFIA 4Y2WA 5CAHA 1LG2A 4H4RA 5GJNA 5J5DA 1E4MM 1HKWA 3UVIA 3Q37A 1CXFA 4KPRA 4QTGA 3KBJA 4NYYA 3O9NA 2OSXA 1RP8A 3T05A 5CC5A 4A8LA 3MMUA 1EF3A 4NI3A 3OQ8A 1C8XA 4GH3A 3LCWA 4A6GA 4XZWA 2VR5A 5JQ9A 3WQDA 1JEZA 1P7TA 3RN6A 2D24A 3WLTA 3B04A 2PLCA 5E1QA 1Q6RA 3AIUA 1H50A 3DG3A 2OG9A 2REQB 3LLDA 4S2CA 4FXRA 2ZTJA 3O0FA 3DIPA 2GVLA 2Q02A 3K4DA 5J5RA 4FF7A 3CMGA 4PH6A 4UNIA 3WYZA 3MVIA 2Y85A 3W7MA 3CH0A 1UD3A 3CHEA 1F6YA 1VBGA 4DVOA 3KTSA 2QCLA 3FEQA 5DY3A 1WPCA 1R47A 4W86A 1QWKA 3UWYA 1GETA 2YL5A 5LIKX 3SRDA 1M6JA 4HNTA 4FZIA 1TJ1A 1E51A 3AUOA 2OEKA 1UKQA 2DZBA 4X2RA 1F8WA 3RITA 2WNNA 3DFPA 2CEQA 4FNPA 4IIDA 3CV2A 5A3HA 3CUFA 1V7AA 1KRAC 5H1WA 1V6XA 4XSLA 3G6LA 2ZE3A 1BVWA 5CAKA 3B9NA 1N61C 3OO2A 4XQ6A 3C6CA 3DAQA 3LV5A 3I68A 3WQ6A 4EANA 2WHMA 1KV5A 3W1TA 1JPIA 3E74A 4HZ8A 4PMJA 2NQHA 5I7GA 2J8FA 4J57A 4XUGA 5I00A 2DU2A 3WF4A 1LTDA 4GC3A 4NEWA 3DU0A 3B9JB 1GEUA 1ZSXA 4PB3A 5IFPA 2GYIA 1J2BA 1NWRA 3CO8A 3A5VA 1HL2A 1KNWA 2JF6A 4A05A 4XZMX 4E0CA 1T40A 4HHPA 4IIGA 4L56A 4L4MA 2QJHA 3GB6A 4H2CA 3LSBA 4GZJA 3M07A 1PB0A 4M6UA 3S3GA 4DUOA 4PB5A 3P14A 1GVFA 2FZ9A 4H9XA 3W6YA 5JCKA 2ZZ3A 3BAWA 1TJ2A 3I4EA 1A5UA 2XN0A 7A3HA 3WDIA 4WGHA 5T26A 3PBVA 4LFYA 4JTIA 1G67A 5LIXX 3CPUA 3LXBA 3DECA 3VNIA 4RE0A 5TNVA 1EHAA 2VD9A 1XYBA 2EPOA 3TZFA 4PEEA 2PGEA 3GD4A 3PHAA 2E3TA 2X1IA 3F4VA 4WK9A 2VRKA 4PCTA 2E5BA 3E2RA 1X2GA 5AHEA 2ZUUA 4ASTA 4CEXC 4QLKA 1IWBA 1EDGA 1S2TA 1LOLA 4NZ1A 4R88A 1I2QA 4HHLA 1GTEA 1IEVA 4P8XA 2WC7A 1R6WA 3H26A 2VC6A 3ZJ6A 3NUKA 1P4CA 2PTXA 3LPFA 5CSUA 3RILA 4Z2LA 1ECEA 3NQ8A 2YVFA 4UMCA 2VL4A 4JHOA 1L6WA 1IWPA 3B8DA 4LAKA 1QT1A 2QEZA 3H4WA 4NNBA 1E6ZA 2C3ZA 4ALDA 3WLQA 3BDKA 1UKSA 3EOLA 1M7XA 4UZSA 2OO0A 3UJ2A 3TA6A 2EHHA 1UPMB 4UOJA 1YE4A 4KESA 4AD1A 1KWKA 2FGZA 3WLJA 3WLRA 4CVWA 3W2UA 1QOQA 1EFZA 2WSKA 5HXMA 1OC5A 2VCBA 2H9AA 3V4BA 4LWWA 1FY6A 4XBKA 3IK2A 4PL2A 4AXKA 2F38A 4CQAA 4ZQPA 3STPA 4K8DA 3FVMA 2WCGA 5EKYA 2TYSA 3ITVA 3UA4A 3A24A 1H62A 1W17A 4HPXA 5K9DA 1QPRA 3CO4A 3M64A 3VNKA 4JIRA 1MDRA 2YCIX 2WVVB 4P7NA 5D30A 2XM2A 2A7RA 3IJIA 2CLIA 4Z1CA 4IHCA 2KX9A 3UP8A 3F7JA 1G7UA 3W00A 2PODA 5A8NA 4O13A 1DP0A 4JFVA 2A85A 4HB7A 2NVDA 3EB4A 4RE2A 3HJZA 2NUYA 3OYXA 3EKGA 3GTHA 3UJFA 2F61A 2ISFA 1P0DA 1RCXB 1V3KA 3PB2A 3HM7A 3CJPA 4UQAA 1EEPA 2CFFA 3VIGA 1E15A 2DH3A 4W5ZA 4M6VA 1AG1O 1RR2A 3P3BA 1EO5A 4QE5A 2GK1B 4JNZA 3S6TA 5HMFA 1TYPA 3NQ7A 3IJLA 4O0QA 3LGEA 3O6DA 3W7GA 5D2VA 3A3WA 6REQA 1J01A 4XWUA 3GNPA 1QFEA 4O4VA 2W3SA 1DTNA 4W4QA 2EJAA 4BK9A 1C8YA 4M51A 1V3HA 1E0UA 2J27A 2DEPA 3KE0A 2YFNA 2WPFA 2GWGA 2Y63A 5FF4A 3FJNA 1WKFA 3BLIA 3W7EA 2GOKA 3L0GA 1R30A 3AIQA 4CCZA 2PDBA 5D2XA 4UFJA 4ZQNA 3B03A 1Q6EA 3GK0A 1GKQA 5I0DA 2DJLA 3MCOA 4H4TA 1HJWA 1REQB 2FLIA 2CXGA 2C79A 3L2MA 4IP4A 2NWRA 4U33A 3ORWA 4HIBA 4C6JA 4IPJA 1TTJA 4CNOA 1DJXA 5A6BD 3OLGA 3WY1A 1A53A 2QAFA 3CASA 4C6DA 5AC6A 3AOFA 4EM4A 4ROPA 1U1UA 5M17A 4NG3A 3S1GA 2JE8A 1H1YA 5EBUA 4N0RA 1O6IA 4RJEA 1RCOB 5B7ZA 1F8IA 4GJJA 4P8WA 1VHCA 4IPNB 5BROA 4JZ5A 2J9ZA 3D3FA 3QYQA 4WJEA 4LYKA 3I3DA 3FK4A 2PLKA 4NILA 1ME8A 4YTTA 1BYCA 3FX4A 2B7QA 4AHOA 3WQGA 3DGBA 2YCLA 5LNSA 1K70A 3MZ2A 4GACA 1BWVA 4EPBC 1N8WA 4Z0JA 1B3ZA 5LZLA 2Z2AA 3BW4A 3CAQA 1J0YA 1KFCA 3ZLHA 1JAEA 3GSMA 5C5YA 3KOZA 1BG9A 1QI3A 4JR5A 4TVWA 2PDWA 4I90A 3GD6A 2GDVA 1MXDA 2FZBA 1XLGA 1R2SA 2ZX7A 1JROA 1TV3A 4PBEA 2CLKA 2Y8VA 2YDAA 1J93A 1PKYA 2O9PA 1CEOA 4FNQA 3KRZA 2JKEA 3DENA 5MHBA 1ZNNA 3T0BA 1CLXA 4TMCA 1OFQA 5ENLA 2P0OA 5KMYA 3KZPA 1CXIA 3LB8A 3DCPA 1WOAA 3GR4A 1Z48A 3NCOA 4DO5A 2C6QA 3W2KA 3DGRA 4HU4A 1ISVA 4ZMGA 1FWFC 1DEDA 3NOYA 1QHZA 2XISA 3TROA 3M0LA 3ONBA 3VCRA 4BJHA 2QXWA 3R58A 4ADWA 3L2LA 3GIQA 1Q6CA 3OJGA 4KCUA 3W7RA 3CZ8A 3EEZA 2PD5A 3AJ7A 4GUHA 3BPWA 1UZDA 3FAXA 3UWUA 3L4YA 4CGTA 3W1LA 2PZ0A 1XBZA 5EL1A 4Y8EA 5I78A 1EOKA 2OJPA 2GJRA 3LENA 4NZFA 4AZCB 3PZVA 3MUCA 2CBUA 3NSXA 2CDUA 1GVQA 1SJCA 4AZHA 3M0MA 4ZOBA 3HJEA 5H91A 1TWWA 1VBHA 3NVYB 3ELFA 3CHCA 5C9RA 3RMJA 4WKHA 5I3KA 1R7AA 4FLRA 4G56A 3XINA 1F3TA 1HP5A 4B90A 3QMRA 4PUDA 4LGXA 1EJ7L 4GYPC 4D1JA 5LKYA 1KM2A 1XPGA 3ZVHB 3VINA 2WBKA 2A3BA 3HOJA 4S1FA 2C0HA 4EXAA 2ISWA 1D3HA 6ENLA 1XSIA 1LUCA 1WBJA 3WEZA 3IUHA 3CUHA 4B9ZA 3H2FA 3UWWA 3OIXA 1SU5A 4XD6A 2I57A 3WF3A 3BMXA 3F4DA 2IKJA 3H2OA 1NVMA 1XR2A 3AIVA 3BV7A 1MO9A 4OE7A 3PZOA 2UY3A 4QE4A 2ZA2A 4GUGA 1OK4A 1M1BA 4GRTA 3BAIA 5C0QA 3UNTA 5XINA 1PEZA 3VM7A 1KFEA 1DJWA 4I7VA 4XAYA 3KHJA 1HTIA 3V7PA 1V03A 3HG5A 2PCEA 4F0MA 2B7OA 4Q8PA 2OSWA 3E6EA 3ME3A 5AVNA 4MZYA 1MWOA 3DFOA 5FL0A 3UD6A 1I2NA 3H4XA 1VKFA 2OU4A 4QM1A 3NXLA 1U1JA 3NPXA 3OZYA 4PYSA 2GWNA 5GJMA 5G4WA 3MP3A 4RKAA 1NHSA 3L23A 5AZ1A 4IQJA 4JX5A 5BOFA 2ZRYA 3GNOA 1PWMA 1MEHA 2DV0A 3P8IA 1JNEA 2RDXA 3B8SA 1V0KA 3ZWSA 3MMWA 3LEPA 4Q33A 3GYCA 1KD0A 4G5DA 2PDPA 2OQLA 3TW9A 2GQ8A 3BTNA 2ZVIA 4JTDA 1Q66A 1M41A 1EH9A 3M7SA 3QJAA 3IIOA 2BCPA 1BRLA 3OGRA 2AGTA 1TKKA 1AL8A 3FDGA 4U2ZA 4XIAA 3GH4A 4K38A 3BAJA 4WDWA 2QR6A 4HGXA 2GRTA 4GI9A 5CPOA 4PUJA 3W4RA 1NHRA 1P6BA 2VFHA 2NT0A 1X98A 4HPNA 1FDYA 4RCXA 4S3DA 4UCFA 2W91A 3U9IA 3W1MA 3ZLFA 5JIPA 3GQYA 4EWJA 3CUGA 2ZRWA 1OF6A 4JTSA 3NS1B 4O17A 3WLMA 1VP5A 3VNMA 1O95A 3MI3A 5CPNA 4EOUA 4ICMA 3POHA 4MB4A 2W3ZA 1SFJA 2PEVA 1BYAA 3UY8A 2QHAA 3VIHA 3T4CA 1CXKA 4DJDC 4F9JA 3OHIA 3UCDA 1KCZA 4GRSA 1XIEA 5AYXA 3N2OA 3P0XA 5CEWA 1W1A1 1S2WA 3TQKA 2V5DA 3T07A 4FNUA 2DP3A 3BGAA 3AYVA 3KS6A 3MJYA 3Q4DA 4LUTA 5AY7A 1JQXA 2Z27A 5GQBA 1VQZA 5CPLA 4EPKA 2OTDA 3GHUA 3HO8A 3QOMA 4Z0SA 3QYSA 3DGHA 3S5YA 1F07A 1XYFA 2WBAA 1BPLB 4BFAA 2EQ6A 1Q4WA 3K1GA 5A95A 5FOOA 3NRZB 4FX7A 1EPVA 4E2OA 3HGOA 3AU2A 2HQMA 1KLZA 3WQVA 1K9FA 1DXFA 4FNSA 1GJUA 2XPKA 3QF0A 4CU8A 4FI4A 2NQ9A 4JXCA 2DZXA 2F6KA 5EGRA 4JQAA 1DQWA 2NQJA 1AQFA 4L5ZA 2ESCA 4D72A 2WKJA 3HIJA 1W2VA 4NX5A 2NQZA 1W9VA 3SFKA 4TO8A 4UB9A 4XG1A 1BYBA 3BLKA 4I9TA 1LQ0A 4IX2A 4PTVA 4K8HA 5ER0A 4XZIA 3GM8A 1E6QM 3NL5A 2Z26A 2NUXA 3UG8A 3M9YA 4HJWA 1QO2A 1ZJAA 1DJZA 2ASHA 1Y8BA 1GQKA 2ZRZA 2ZUNA 4ADTA 1AW5A 2GJXA 3GFXA 4LV4A 3TLLA 4L1XA 3TC3A 4HSOA 1R3WA 3ICJA 1VF8A 3POCA 2JFEX 1X6UA 2BG5A 2V5JA 1NDYA 5E0CA 2XFFA 1GOQA 4XSMA 3M0HA 4ZB0A 3NEVA 3MB9A 3EPMA 1T3QC 4PRTA 3THUA 2AAQA 3NQFA 3MMDA 4LNCA 1DIKA 3PJXA 2CPUA 4QNWA 1H5VA 4CNTA 3UR7A 3N3MA 4L9XA 3APTA 5A2CA 2DY3A 6TIMA 3KP0A 4AISA 4LUIA 5CLTA 3S5NA 1CDGA 3RJXA 4HA3A 4DHGA 3TV8A 5JCLA 3SUSA 1NDZA 2Z2BA 1HXJA 1IEXA 3QY8A 1POJA 3DKLA 1GVRA 3EB2A 3W7QA 1KQYA 3GXMA 5E70A 2CBVA 3MU7A 3TEVA 4EWND 5D38A 3L68A 5HPCA 1T41A 3Q94A 1DIEA 1TZZA 1XKJA 2J75A 3MYPA 4UBPC 2VKZG 3NPWA 4DNHA 5H6HA 3VDBA 2QMKA 2E28A 1HO1A 1ZALA 1TMLA 1OFEA 3N19B 3PSWA 3BH4A 4PUUA 2E8ZA 5G5GB 3TNBA 1FWEC 4ADSA 5DMYA 2XFYA 4MY9A 2IPWA 3IJ6A 3QHNA 1A5MC 3UNDA 3UPMA 2X16A 1ITCA 1P7TB 3O6AA 5KVIA 2Y7EA 3QV9A 4NIRA 2PRMA 3CB8A 1RD6A 5FI8A 5G2WA 4PTDA 5D32A 3MYOA 1JG9A 1O5KA 4F66A 3G3MA 5GNXA 4TVCA 1MFUA 4AWTA 1GORA 1E0WA 2YDSA 1RA5A 2AOSA 1CCWB 3KOWA 5D03A 3PUGA 4F0SA 5AHLA 4ZO6A 4RLIA 3EWCA 1S5WA 3EXTA 3LK6A 3EWWA 1WZKA 1ZL1A 5MKGA 3WMCA 1RHCA 5AYZA 3VE9A 2G37A 4YVPA 5G2IA 1TV2A 4HPJA 3KBWA 3VOCA 4IQDA 4ADUA 1U2YA 4HD5A 1XUZA 1XW8A 4IFRA 4IUOA 2YB4A 4C6FA 2FTYA 5I2UA 1QBAA 4CVUA 1OCQA 1EO7A 4F9DA 1E9YB 3MHFA 3ALGA 4OBTA 1OT2A 4LVBA 4FXJA 1CXLA 4DZAA 2WSQA 3PTKA 2DSUA 4B15A 5F4XA 1MXSA 2CKRA 3MANA 4C6LA 3SQSA 3RLGA 4UUIA 4GIRA 4V1YA 4PMOA 4CNPA 3E96A 4B2DA 1N55A 4HCDA 2P3ZA 3WEMA 1SJAA 1UCWA 2O92A 3CC1A 1ZAIA 2E1WA 5JCMA 1BGGA 5C2GA 3ARUA 3W7LA 3F4WA 5REQA 1LRNA 2OX1A 4V2XA 2W0UA 4UR7A 3W1PA 3OGVA 4E4FA 2YAUA 2B7PA 3K4AA 4W85A 3BANA 3WH8A 4RNFA 1FWSA 3BLOA 3L5LA 3VIIA 3LD5A 3THQA 2KAUC 3LUTA 4YTRA 2ZWZA 3N3TA 3WBAA 2WHKA 2VGBA 1CLVA 2HVOA 5FJRA 1DXIA 3RO8A 3G22A 2PD9A 4DJED 4O1CA 2YCJA 3LHWA 3W87A 3I7SA 4J4KA 3U0HA 5ABFA 4R3UA 2ACUA 2TSYA 4W89A 1JRPA 2WWCA 3OBAA 3KS5A 1E1CA 4B91A 3PN8A 3GLCA 5EU9A 2JF7A 1HKKA 2BY2A 5CSSA 1WDPA 4QX4A 2ZX6A 3PUDA 3UXAA 2E7FA 3HMJG 3EWXA 1F6PA 5HANA 2PDJA 4LVGA 1KLYA 2YYTA 4Z2JA 1FWRA 1XF0A 4CQ9A 4WOZA 3TE9A 1E6SM 3M4HA 1J4EA 3IRDA 2QVHA 4GZIA 3G5EA 3VABA 4WF7A 1PUDA 1J0JA 3E2QA 3TTYA 3LLFA 3TXVA 3AIEA 1ME9A 4QJ1A 1FEAA 1X1NA 1N7KA 1C3FA 1PCWA 4JCLA 1X1ZA 4P7LA 2V63A 3VMOA 1WZAA 2BGQA 3HTWA 4GQ0A 2A6NA 1NOWA 4YS1A 2OZ8A 2P8BA 2ZDRA 4OOUA 5DLCA 3TR9A 4UTFA 3EANA 3MC5A 3W86A 4AD3A 4GYKA 3T1GA 4IIBA 1TVPA 4MNLA 2H9AB 4LS2A 4ROQA 2Q09A 1W0MA 6A3HA 1TUFA 4C6NA 1EP3A 3GTFA 5LNUA 3AI0A 1P0EA 3VC5A 3LPOA 4E8GA 1EJXC 3KTXA 3DHUA 3IS4A 1VR6A 1LBFA 1UP3A 3UQNA 3LS9A 2Z1KA 1XG3A 3CWNA 3CZLA 2FMOA 3ECQA 3I6EA 4J3XA 3FXGA 4IL2A 2FVLA 7TIMA 3CWHA 1YTKA 3L21A 3IANA 4XKMA 1H09A 2VZSA 2B7NA 2I16A 1N62C 5AVHA 1LF1A 4TMBA 3RHGA 2PBOA 4CN6A 1TPUA 1LWIA 3U5YA 1TE6A 3BO9A 1I60A 3CH9A 3TC7A 4HNLA 3VNLA 1FWJC 1EC9A 1TWIA 3TZNA 5BXTA 1SVDA 3NEHA 3LLXA 2Y5EA 2A7NA 2GJLA 2TODA 3TWBA 1KRMA 1JRBA 4JTHA 2J24A 3S9ZA 1FA2A 1GUVA 1DE5A 2QDDA 4AIUA 3RG6A 2Z25A 4JX6A 2AKMA 2J77A 3RR1A 4GVHA 3FV9A 3EX2A 3G1HA 5CZTA 3U8GA 1EOMA 3S9YA 3V0UA 3LCIA 3RAOA 1U1HA 3RLUA 4C1NA 3NDYA 1UZ1A 2ZC1A 4KGLA 4W9TA 1FWCC 2NXIA 2ZICA 3FYPA 2AL1A 2J25A 4UTUA 2B0MA 4W84A 3TSBA 4KEZA 3GY1A 4JYEA 3ZJ8A 4IL0A 4XZNX 3QSTA 4X3ZA 1ZFJA 4GYFA 3G0UA 1FOBA 4XO6A 2O9TA 3BW3A 1LBMA 3LADA 2NX1A 3LTYA 1VFHA 2CNCA 1FBAA 3IJDA 3KAOA 1GJPA 1R3QA 3WFZA 4D1IA 1WKDA 1HGYA 1MZRA 3GC2A 2NV1A 3GVWA 2R94A 4H4PA 2DVTA 1SO6A 3UZ5A 4PMRA 1SW0A 1SYTA 3ARTA 1QXLA 4UTHA 3ZWTA 4CQ8A 2X50A 5AECA 1R8LA 4ACZA 5ECVA 1EYWA 2GUBA 3B9DA 1W1YA 4YYFA 3HB9A 1F3XA 1BWKA 2PWGA 4I6KA 2D23A 4BV6A 2JEQA 2GDQA 1VCFA 2E8YA 2D69A 3DXIA 1HX0A 3VVGA 3AXIA 1XLHA 3A3HA 1XGDA 3EB3A 2FQIA 4RXFA 1YNYA 4GKLA 5IXEA 2AAMA 2WVTA 4R7JA 4H01A 1JYXA 3SI9A 3LGGA 4HJFA 3E5PA 3VC6A 3EMQA 3R94A 1B0IA 3L66A 3VIMA 1TV7A 4CD7A 1L2UA 3TKFA 4DN1A 3B8VA 1GKPA 2CZDA 5CG7A 3WG6A 2VHLA 1YXCA 4NXKA 1O4UA 4LUYA 2WB5A 4FLOA 4C1KA 4JN6A 5G1TA 4UTTC 1DL3A 2YJQA 2WMIA 1AODA 2V68A 3UGVA 4JKKA 4LSBA 4DWSA 3BG3A 4C6IA 4S3KA 1N63C 1OEPA 4C65A 1TRDA 4C7DA 1FIQB 2VZVA 2ZTKA 2CERA 2J7GA 4ZB2A 3PNUA 2WP5A 4FOJA 4L6HA 1UMYA 3NQEA 4GUFA 3RX2A 4O8RA 3W53A 1E72M 2TAAA 1OD0A 4BWLC 1XINA 3T8QA 2GR0A 1CWYA 1GERA 1K4GA 3ZS4A 3I10A 5LNWA 4DO7A 1Q1WA 1TA3A 2VUYA 3DBNA 4UFIA 1F7BA 4BZYA 3W2MA 3AMKA 4DNAA 4JTJA 3QQ1A 2XTKA 3A7UA 2HVNA 3WUFA 3OLDA 4EMJA 3GG7A 4FOUA 1RUSA 2DZUA 4WQ6A 1Y5WA 3L8KA 3O3RA 1UZHA 3CEPA 3C5QA 3NZRA 1MQRA 4PC8A 5AHNA 2QYGA 1K7FA 5KEZA 2P50A 4OIFA 3R79A 2UY2A 3NM3A 4GNVA 3M6DA 3D9XA 2GJPA 3HV9A 3BAKA 1Q3NA 3FA4A 4U31A 3MT1A 3TSDA 4C6MA 4PE8A 4J5NA 2GUYA 2YCEA 1YDOA 5JVLA 1XH2A 1TZ9A 4UQBA 3L7RA 1VPXA 3R11A 3VO0A 1QOXA 4TUFA 2J7EA 3TTSA 2YZRA 2VX6A 1Z6KA 4HNNA 1QWGA 3G1VA 1AH0A 2ZIDA 4J2PA 3ITYA 3WFAA 4FS9A 3UGRA 2WVUA 1A3XA 2VRQA 1D8CA 5JU6A 3CWOX 2DZAA 1O1ZA 3ABQA 3CT2A 3SN0A 4S2BA 1B9BA 4M7TA 3E1F1 3BWWA 4N9CA 4FSAA 4Y9OA 1LUCB 1K9DA 3WK2A 3WJSA 4WZHA 1QI4A 1DYSA 2BXVA 4JTGA 1U5JA 4B5VA 3OBKA 3FA3A 1F3EA 4A4AA 3H7RA 5AB3A 1Q6GA 5HNRA 1OWQA 4G1KA 2V3BA 5CSYA 3TYBA 4GOAA 1LBLA 2FJUB 2FZMA 1SZGA 3LCXA 2SFPA 3U6WA 4DF0A 3VD7A 4ZB5A 1RQEA 2VVNA 4EF8A 4V33A 2B4GA 3GUWA 3W75A 4ICCX 2CWXA 2FTWA 5C9WA 5EMMA 4P61A 4QAWA 3WJYA 1M7PA 5I23A 3AS2A 2V2CA 4B5SA 1PZ1A 2Z28A 5ABTA 4HNUA 1EEXA 5AKQA 3WH5A 1W5NA 1Z32X 1OD8A 2QJNA 1D9EA 3WENA 2E5DA 2PWHA 4S3BA 2X8HA 3BLPX 3UFYA 1M04A 3M5YA 4IQLA 4C6PA 3P6LA 1K3UA 1UD5A 3LDVA 5HQLA 3EDFA 2XH4A 1OF8A 1CYGA 4BF5A 3CUZA 3DFQA 1XH1A 1UC4A 2INZA 2FDSA 3PG9A 5DMNA 1E0VA 5BRBA 1H3GA 5K9CA 1GG1A 2HS8A 3LBMA 1S5VA 2ZUWA 1Q65A 1B1YA 1KTBA 1ISYA 5HPOA 1W91A 1E70M 3KDNA 1BRLB 3L67A 4PBFA 3IWPA 3PZ9A 4L65A 1N5XA 1UR9A 3W6MA 3TK7A 1UR1A 4A2RA 4KRTA 2FTPA 3BJSA 1K9EA 2ISVA 1H7RA 1G5AA 4UR8A 1KW1A 3VI2A 3W27A 3N4EA 4L4LA 2HRWA 4HSNA 3CL6A 1QI2A 2EBNA 1V3IA 5U7SA 3CU2A 5A6KA 4DJFA 3VOGA 4Z17A 1CLKA 4Y9AA 3RLHA 1YQ2A 4NP7A 1QW9A 1FO4A 3O06A 3MV01 2YW4A 4IF2A 2VFEA 2DVXA 3TCSA 3B0UX 4WSHA 2WMFA 2IKGA 1CTNA 4HK7A 3G0XA 1XIIA 2HV5A 3GRIA 4FNRA 3C0SA 1O66A 2E77A 4AYSA 2Q8LA 4JTLA 4G1NA 1XRFA 2MUCA 2DQXA 3UXLA 4FX6M 4B5XA 2G97A 1TRIA 4LUTB 2F9RA 2WMJA 4GH1A 4EXQA 4PL1A 4O1AA 4HKPA 1ODUA 1J96A 2ZADA 1X8CA 3NOEA 3U48A 3HMCA 3VPLA 3BZJA 2X0YA 2BHYA 4EMWA 4Q7BA 1EUNA 3CXOA 5C54A 2WLZA 1BTCA 1XFBA 1T6MA 1D7YA 3H22A 1HF6A 3HA1A 4ZQCA 1RBOB 1V5XA 3TC6A 3UJSA 3O7UA 4US5A 1ML1A 1Q6LA 4ZFCA 3EXRA 4FIQA 2YGYA 1SFSA 2YPIA 4L64A 1P43A 2FVKA 2WZHA 3IVUA 3I3BA 2ALRA 1U22A 4D6FA 2I9EA 1UKOA 3WDHA 1FP9A 1PS9A 3SY8A 4LH8A 1PSCA 2TPRA 4L7ZA 3S83A 3UR5A 5ABEA 3URHA 4X22A 2NX9A 4W93A 3H2MA 1KKOA 3NO3A 2A3CA 2ANUA 3MKVA 3CQKA 3O6YX 1V77A 2GDUA 5G4EA 4BQ3A 4ZZ9A 3ZIZA 5JMUA 3AN1A 3N2XA 4TU1A 2E1DA 5A2BA 1F4AA 3VKKA 4ONVA 3PPFA 2GJXB 3KDOA 3CZJA 3I65A 5HINA 2C1GA 4UMAA 1ONRA 3UY7A 4LUJA 3O16A 3L9CA 4IFKA 2EG8A 2AQOA 4QS5A 3V5CA 5CQ1A 1J6PA 2F84A 1R3TA 1A0CA 5HWNA 5F4SA 1E6RA 1JGMA 4P8UA 4B4FA 3N9RA 5D09A 1OFOA 3SY1A 3E2VA 3VK5A 1A5AA 2BC1A 5C71A 2ON3A 4V27A 1RY0A 1JUEA 2Z1SA 1US2A 2HQAA 1SGJA 4FR1A 3QPYA 3RRXA 5DN1A 1TUXA 5FJOA 4YCOA 2FHCA 4H6KA 3HG4A 4YTQA 4NJJA 3H4KA 5T8GA 5KITA 1R9ZA 4LB3A 3A7AA 1TREA 2I9UA 3C2OA 4PUKA 1FFUC 3WH9A 2V69A 3LYEA 3CAWA 5C9ZA 3RU6A 3AYSA 3N29A 4PGLA 1QATA 3ARYA 4MLRA 5BZAA 2PTYA 1VDVA 2QJMA 3SR7A 1F3WA 1BWLA 4W7VA 5HNUA 2VUNA 1TSIA 1XDLA 3UERA 3W7CA 6ALDA 3M6YA 3W2LA 4QS6A 4AHPA 3WNLA 2V3FA 2QJGA 2VXNA 1VFMA 3G8EA 1DIDA 1PKNA 4C6OA 1V08A 4UFHA 1MW3A 4A29A 2G3IA 3S6OA 3PULA 2QQ6A 5A8MA 4GYJA 4DUWA 1E73M 4UTWA 3NG3A 1NF0A 1A4LA 4MTVA 2OQHA 1Y5VA 3VTRA 4KFPA 1OSEA 1CNVA 2A7PA 4PZVA 5T91A 7ENLA 2A3EA 3W6LA 5GVJA 1V0LA 5I07A 4MJMA 4PUWA 2QCDA 2D1ZA 3FSTA 1W3KA 3L2IA 1RJRA 4WKFA 2ZZBA 3LCGA 1F3PA 2XIJA 1UJQA 3AIBA 4QJ3B 2C14A 1B3XA 1VAHA 4RPQA 3EGJA 3K2GA 1IXNA 2NSXA 1XGEA 2HDJA 5HQMA 4G8TA 4UOZA 5MKGB 2P88A 3GVQA 3HPFA 1HKJA 1ICQA 3AROA 5KZMA 1CGUA 2XVKA 4HU0A 1S5NA 4GE8A 5CZJA 1FDZA 2DDXA 1FDJA 1UR4A 1IZKA 3K8MA 1UD8A 5BXRA 1EJSC 3SQLA 3P74A 2WZTA 4LAMA 1RD5A 1XC6A 1XQKA 2G96A 2HZGA 4XKYA 1ADSA 3SQMA 3TIMA 3GTXA 4C7GA 4JTEA 2C1IA 2PDKA 4RNHA 1WDSA 1ZXIC 2JALA 2EXOA 3HGJA 2VVSA 3HPAA 3V36A 5DMLA 4FOKA 3UU0A 4E8CA 5XIMA 5E9XA 3KOFA 3NWRA 5C6MA 4Q8TA 1DJIA 4EMIA 5DFAA 4JL1A 1DKWA 1LP6A 4M80A 4DPQA 1TTPA 2XVPA 4C6KA 4M24A 1W6TA 4GX8A 3DUGA 1A3WA 4PCSA 3UA3A 1VFFA 1FHVA 2FB3A 4JS3A 1TPDA 2YL6A 3SUUA 1XYZA 1ZPTA 1W31A 5HJYA 1H1ZA 5REQB 2H6RA 2XH0A 2A2IA 1EWDA 3CV1A 3GH5A 2WC3A 1ONFA 1PIFA 3HV8A 4PSPA 5K9XA 4XAZA 1UWQA 4AVNA 1AQMA 4UFMA 3CL8A 2O56A 5TIMA 2F8QA 3B9EA 3UXKA 1GOXA 3CQHA 3THAA 1W1B1 2VX4A 5TAOA 1F61A 1RBLA 1QNVA 3A13A 4MY1A 3CZGA 3TTOA 4JN8A 4QGCA 5DCDA 1QW7A 2GVJA 1T0OA 1IEWA 3V35A 1QNOA 1VENA 4MKVA 4QR6A 1XDMA 5ABFB 4N4QA 3UPBA 4H4ZA 3EKLA 3WLNA 1PHWA 1V0NA 1E1CB 4O0KA 3GE7A 1RXOB 1XRTA 3EXSA 3FYOA 3MP5A 3E49A 3M44A 1HZYA 1GGOA 4LS0A 1PKLA 3IIVA 3GH7A 1QASA 4FK9A 4AZIA 4HCHA 1XC4A 3EEGA 4IUGA 2X7VA 1TPH1 4Q4QA 3PF3A 1H4PA 2BY3A 1O60A 1CX9A 4B5UA 2D3NA 1VJSA 3GXFA 4JL2A 5D4YA 2MANA 3QY7A 1FHLA 3W28A 1YPFA 1Z44A 4KCWA 4IM4A 3FLUA 3UG4A 3VYLA 1Z3NA 3MP4A 4UQCA 3EDEA 2RJGA 3DK9A 3QC3A 4JTCA 1WUFA 1XISA 5FJTA 4GY7A 3I6TA 5CBIA 5BWFA 4C6EA 5I3GA 3W73A 1GQIA 3DFYA 6CGTA 1GHSA 5HJXA 4H7VA 4DB7A 3BZGA 3KP1A 5LA2A 1XLKA 3G1SA 3S6DA 3MCNA 1KCLA 3QXBA 2EAWA 4D6HA 2CLFA 3SBFA 1SZRA 2Y7DA 2X0HA 1G94A 2ZVRA 1JI2A 2VFFA 4O0ZA 3HBLA 2NW0A 4DBUA 5FMHA 2DIJA 1TWZA 1U5HA 3XISA 1KGWA 3UJRA 2DIEA 3PBWA 3PBUA 4GINA 4D6EA 5LNRA 4AIBA 3F2CA 3VILA 1QU4A 2CHOA 4ZL1A 2PDFA 3OLIA 1ME7A 4JAWA 1R9YA 2VWSA 1HJXA 1HN1A 3WD0A 1G4EA 3H2AA 1J11A 2JGYA 3IIPA 4V1XA 3BJTA 2PGFA 1BF2A 1SR9A 1SW7A 1EL3A 1DOSA 3FAWA 3N4AA 1AOGA 2X41A 4U4MA 3O07A 1DIOA 3SY5A 3ITTA 4J2MA 1H7WA 3AXHA 4I9MA 1UJPA 3DFTA 4LVDA 3AMZA 3TN4A 3W2JA 4DJDD 4MM1A 2I1OA 2QCFA 4KEMA 4DAIA 5E9AA 4JQ4A 3Q58A 4XK2A 5DBTA 1XYCA 1VLWA 1AQ0A 2PDIA 2CZEA 3BAXA 1KFBA 1XM3A 1J79A 3SB0A 4J3WA 4C1NB 5I02A 2W67A 3CGBA 3NQVA 4D8AA 2X05A 1GKRA 1TPFA 3QSRA 1GQLA 3PSVA 1ECQA 1YDYA 4JKLA 4R34A 2JBMA 4MPQA 4ZQRA 1WKEA 4TTGA 4H2HA 2Z29A 2VGFA 1ZAJA 3VZZA 4CU6A 1I2OA 1X97A 4QG9A 4DYKA 1SZNA 2WPGA 1Z8AA 1MW1A 1ZY8A 2E5CA 1R46A 4ZTXA 1E9IA 2XZ7A 2BLEA 4PBGA 5CJ5A 1JJKA 2IKIA 1M01A 3DDMA 4LYRA 4YWSA 2HWGA 5FD0A 2DT2A 3K46A 1YLVA 5BW6A 1RM6B 1YEYA 3W1RA 2WKGA 3NVDA 4AG0A 2V0TA 1S38A 2BBFA 4JTFA 1B57A 4DWSD 4P7QA 4ACZB 3A9IA 1W1TA 5GRTA 1QR7A 3WDRA 4LRTA 3ARRA 4HA4A 4LU0A 2J7HA 1HG3A 1GRGA 1EF2A 4UFLA 1AJZA 1C7SA 3LHVA 4OGZA 3P8JA 5FEPA 5BU9A 2VGGA 1LLWA 1W1PA 3N11A 2WSYA 1JDEA 1S2VA 4QISA 4WY0F 8XIAA 3NYDA 2QF8A 4I7WA 4ZXOA 2HPIA 3SADA 1KBJA 2J88A 3W9ZA 3UWVA 5JH2A 1BXNA 3VE7A 1OYBA 1JAKA 4ZTYA 1TG7A 3P80A 3SEPA 3V18A 3P67A 4CUCA 4GABA 4P2VA 1NP2A 1M9HA 5EPDA 2PB1A 1ITUA 4L4PA 3MDWA 3O8AA 4HBKA 2XIQA 1GRTA 2C1HA 4MZ1A 3M7WA 4DWSB 3VKJA 5HOSA 3PJWA 3EZ4A 3GD3A 4OU1A 3FJ4A 3B4YA 4ZOEA 4N9BA 3TU9A 1CECA 2WV8A 4Z1DA 4UC5A 3U7VA 2O7SA 2ZDSA 3A4JA 4DBDA 4HOWA 4ZE5A 3PR2A 3I4KA 4B3ZA 4ML4A 2GL5A 3NQGA 1I9CB 1K1DA 4A3RA 3R25A 4PMZA 3WK1A 3CMJA 1FXPA 1QHPA 5FESA 5EA9A 4GY0A 1ZS2A 1XQLA 3STFA 1B4KA 2Z1WA 1JCLA 2GGEA 3W29A 1XHCA 3LMZA 3OW1A 3UZZA 1XD1A 2CLLA 9XIAA 4QRNA 4F48A 1XS2A 3KL5A 1PO9A 2XN2A 3STGA 2ZZ2A 1VYPX 1XIDA 2X2YA 4JTRA 1LL6A 5I3FA 3WDPP 4LC8A 4LYQA 4LPCA 2ATSA 3TH6A 3E02A 3U3HA 4XZ9A 4ZBCA 4BF7A 4H41A 4BQ5A 2AMXA 3FG2P 1I1XA 1BSIA 1Q6OA 4AYGA 1RP9A 4O15A 4AWEA 3TFXA 4WGXA 4HP5A 1OCBA 5I03A 2D20A 3VIOA 1VFTA 3C2VA 1B90A 4GQQA 2X7WA 1EJRC 3QFAA 1PKMA 4JEJA 4ZO7A 3TJLA 1XDIA 5LHEA 1PV8A 5CZSA 4ZEPA 2WSRA 1IF2A 1I2PA 2WNZA 1VQTA 4XVEA 4NZ3A 4HCLA 1PX3A 3COTA 4K39A 3WF0A 8TIMA 3NQCA 3EDDA 2C16A 4ZO8A 4M29A 4LVFA 1VLIA 3WX7A 3ZR5A 4ATDA 2OKOA 1XLCA 4GI6A 3BARA 3PWGA 1V02A 3AZRA 1AZ1A 1QCWA 1PE1A 5IOBA 5FCZA 5BMWA 4IPPA 4Q8NA 4AD5A 3EKZA 3BOFA 3IAQA 4XBJA 3W37A 3T0TA 4RX0A 3FN9A 3A7RA 1N8IA 3M5XA 1C7TA 3HPSA 1JYVA 2X2GA 4IMFA 4YWOA 3F1QA 1UIPA 3LNMA 3RFAA 1RVGA 5D04C 4G7EA 3RCYA 3VCNA 1TPEA 4NXSA 3PJUA 3IPWA 4BURA 1PTDA 1CGVA 5C70A 2BY0A 1RJPA 4EQXA 3MI6A 3PWIA 4CD8A 3LPGA 4R53A 1Q6QA 4P5UA 4JIPA 2R8WA 1BKSA 3APGA 3PTMA 1ZX9A 4J3VA 4DJFD 2CHNA 2WO5A 4IZGA 4RUBA 3DYPA 4LJ3A 5JBFA 4MWAA 2BGSA 3R10A 2ZRVA 3QQWA 4G2DA 1S46A 3RPTA 1EPXA 4YPJA 1GG0A 3QV7A 3IIXA 3NQAA 1J8VA 1TJRA 1ZQ5A 1J10A 2W62A 4NRSA 3VKDA 2CKSA 1JI1A 1TPC1 3S2NA 2RDUA 5HR7A 4D6CA 3QGVA 4F2UA 1UQYA 4GUIA 1MNZA 3HGSA 4JHZA 3L4VA 3TJ4A 4W8AA 1QK0A 1QPKA 3W22A 4K7VA 4BF9A 1UR2A 3U5UA 3SQPA 3AZTA 1EC7A 9RUBA 3HF3A 1SB3B 3WLHA 4LAZA 4O1EA 2L5HA 3G77A 2POZA 2PPGA 4FP1A 2ZZ1A 1RQBA 3IJQA 1BFNA 2Y62A 1XWYA 4WLCA 2DT3A 7XIMA 1KBKA 2PGWA 3PG8A 3MSRA 4FALA 1JQVA 4Z2KA 1BKHA 2ZZ6A 3T78A 3DYOA 1XLJA 1DJQA 4MB1A 1OT1A 3GHRA 1YBQA 1L2QA 5DQPA 1EBHA 1XIGA 1H51A 1UP2A 3OC4A 5EBAA 5FF3A 1ODZA 1H49A 4H04A 3UWEA 1QDSA 4KRUA 3PK7A 1GQNA 2QZRA 3BURA 1W9DM 2AMGA 3GHSA 1VRXA 5HAOA 3NPUA 3ES8A 1IGWA 2RJHA 1PIIA 2EQDA 3AFBA 1R3VA 5A5WA 3ZSTA 4NT0A 4CNUA 1UOKA 5DRCA 5M5DA 1LOSA 1MVYA 2BVDA 4OBRA 1GK8A 1AVAA 4UTKA 1KFJA 1ZP4A 4JNYA 4GBUA 4EACA 4D8LA 3VAVA 1JPMA 2YL8A 1DQXA 1DHPA 1KFKA 3V16A 1NHPA 1BLIA 4LBRA 3UW6A 2PDUA 1DJGA 3W70A 3NZQA 5BRPA 5BCAA 4M3PA 3LU2A 4KPLA 4A35A 2OZ3A 4M1RA 4TR9A 3DK8A 3D0CA 3PZMA 1H11A 1NOUA 9XIMA 3M5VA 4LC6A 2WNWA 4ICNA 7CGTA 3QFEA 2EEXA 4U10A 2PDLA 1ESWA 3N34A 1ZBWA 4HU8A 4RZ5A 4GGHA 3LHUA 1S3TC 1TPB1 4Z2IA 2EKGA 3W23A