5JRBA

Rad52(1-212) k102a/k133a/e202a mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
184
structure length
184
Chain Sequence
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLASKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEAARYNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD52 homolog
publication title Structure of the human DNA-repair protein RAD52 containing surface mutations
doi rcsb
source organism Homo sapiens
total genus 51
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jrbA01
1H2IA 5JRBA 1KN0A
chains in the Genus database with same CATH superfamily
2GL5A 4K7ZA 1P43A 2FKPA 2HQMA 3S47A 3MQTA 4EQWA 2OQHA 2C3CA 4H1ZA 3I6TA 3UJRA 3ZVIA 2WOVA 2GR0A 3ZLFA 3ES7A 2JK6A 1ONEA 3T4WA 2OX4A 1N5WC 1FFUC 2OZ3A 1TKKA 2PTZA 3BOXA 2PS2A 4MKSA 3DESA 4YWOA 1F9CA 4JN8A 2J3NA 3RITA 4DX3A 4F4RA 2AL2B 1ZKQA 4GISA 2FYMA 2WP6A 1SJCA 1TYTA 3CB3A 1V59A 3RRAA 1X2GA 3GC2A 2P8BA 2GQWA 2ZZ0A 3R07C 2HXTA 5TR3A 5BOFA 3T6CA 2YQUA 4M0XA 3IK4A 4ZOHB 3TJ4A 4MGGA 3R25A 1SJDA 3P0WA 3U4FA 1X2HA 3OW1A 3UXLA 6ENLA 4H19A 5U1OA 3DG3A 1FECA 3V3WA 3NVYB 4H4WA 3OC4A 4E4UA 2OZTA 1VQZA 1AOGA 2X50A 2WPCA 1XS2A 2CDUA 3A7RA 2YVFA 4GMEA 2ZZBA 3CGBA 2DW6A 2XGZA 2ZZCA 3CT2A 4IP4A 3HRDC 3VCNA 1N60C 3VC6A 2W54A 2X8GA 5FS8A 3H70A 1NU5A 2TPRA 2WPEA 2DW7A 4H4ZA 4DHGA 3UJ2A 1VDVA 1F8WA 3NVVB 4H83A 5JCNA 3QFAA 4H4UA 2NPXA 1GV4A 3QN3A 3KLJA 1EBDA 3UJSA 1BQGA 1YEYA 3THUA 1XDIA 1F3PA 5EU9A 4E5TA 1ZMDA 3MY9A 4NEWA 2PCEA 3N6JA 1SJAA 1MDLA 1R6WA 3L5OA 2AL2A 4HCDA 3MKCA 3VC5A 1P48A 1NHQA 4JN7A 3SQPA 3T9PA 1JDFA 1KN0A 2EQ7A 2WOWA 4DWDA 1KKOA 1MUCA 4IL0A 3AMZA 3V5CA 4BV6A 4BURA 4K2SA 4HCLA 3UCCA 2YVJA 3U9IA 2WPFA 3VDGA 2V6OA 1WYGA 3GY1A 2QGYA 3IJQA 4JHMA 4EMJA 2BC1A 2AL1A 3UCDA 1KKRA 2AKZA 3H8AA 4APNA 2HNEA 5ENLA 4GGBA 1GETA 3ZLHA 2GSHA 1N5XA 5GRTA 3TW9A 4KPLA 1OJTA 1GRTA 2OKTA 2XH0A 5FJTA 3TWBA 2QDDA 3CK5A 4GFIA 1N63C 3DH9A 2QJJA 4ADWA 2BC0A 4H4QA 3A7UA 3R0UA 3N6HA 4M52A 2MUCA 3SN4A 1GERA 3GRSA 2AAQA 1NHRA 2NQLA 1JROA 3N4FA 3EEZA 5KVIA 3DDMA 1BZLA 3SN1A 1XANA 4JDRA 2GGJA 3UJEA 1Q1RA 3PK7A 1SJBA 1ZY8A 3R11A 1GREA 3N4EA 1R0MA 1RVKA 3DGHA 2OQYA 3TTEA 3DERA 2GH5A 1TYPA 1KD0A 1DTNA 3HW2A 4HPNA 2QQ6A 3MUCA 3FVDA 5EBKA 4H2HA 1MO9A 3DGBA 5BOEA 1GRHA 2W3SA 4IZGA 4FX9A 1PDYA 3RO6A 1NHPA 1GRBA 5FS7A 2GRTA 2POZA 2EQ8A 3B97A 4EWJA 2GDQA 4H4XA 2WBAA 1ELSA 1GSNA 3SSZA 5JCKA 4H50A 3SN0A 2PP1A 4EQSA 2W3RA 3TWAA 3V5FA 4DXKA 3D47A 2PPGA 2QJNA 3OPSA 3IJIA 3S5SA 4A3RA 2V3BA 3H12A 3LB8A 1BWCA 4KWSA 4J1OA 3CXBA 4JQ9A 4HNCA 4IP5A 3CGDA 7ENLA 2RABA 3KUMA 2GGGA 3FG2P 4FDCB 3TJIA 3II4A 1ZX9A 3QTPA 2A8XA 5JCLA 3DG6A 1NHSA 1GRFA 4M6UA 3MSYA 3PFRA 3SBFA 5FS9A 3PG6A 2PTWA 2ZADA 1MNSA 3DEQA 1ECQA 3CXOA 3MZNA 2EQ6A 3DGZA 3Q45A 2ONEA 3QKEA 5J04A 3GRTA 3VFCA 3DJJA 4DYEA 5ER0A 2P8CA 1GESA 2X8CA 3NVZB 3O0HA 2ZC8A 3R1ZA 2V3AA 4TVYA 1E9IA 4FP1A 1ZK7A 3BSMA 3UXKA 3CYJA 2GR1A 3PWGA 2GGEA 4GIRA 1T3QC 3UJFA 5FMHA 5G5HB 5FJUA 4GGHA 2PGWA 4GYPA 4ROPA 3NXLA 1M6IA 1WUEA 4LIIA 3QPEA 3OP2A 4ZCWA 3SQSA 2X99A 4HN8A 3H7VA 4J57A 1XPYA 3AN1A 1LPFA 4H4YA 2YVGA 3JVAA 1BKHA 2AKMA 3K1GA 2F5ZA 3RR1A 3HPFA 2WP5A 3VA8A 1DXLA 2QDEA 3FV9A 3H4KA 3FXGA 3JW7A 3D9XA 3P3BA 3ETRB 1EBHA 1YQZA 5JCIA 3PWIA 1ZXIC 4E6MA 4KT2A 2OVLA 4DNAA 4KEMA 1FIQB 3DFHA 4E8GA 1ZMCA 3NS1B 3OZMA 1MDRA 5G5GB 3VCCA 1GXFA 3TQPA 1EC7A 1JCTA 3CGEA 4EQXA 1STZA 1FEAA 4EMIA 4K8DA 3BJSA 1TE6A 4NEVA 3UGVA 4ENLA 1SB3B 1IYXA 3EAOA 3NZGA 5FS6A 4TVWA 2PP0A 3R10A 1EBGA 3DIPA 4IT1A 1JRPA 5JCMA 5JRBA 2GGIA 2P0IA 2GR3A 1L8PA 1MRAA 1W6TA 1DNCA 1WUFA 1OEPA 2QVHA 1V97A 2XSXA 3AM9A 2PU0A 3MWCA 2PMQA 4Z1YA 2OFJA 4J3ZA 3NO1A 4K1WA 4Z17A 1FEBA 4EQRA 2PSNA 3EF6A 4ZA0A 2R9ZA 4A35A 1NELA 3NRZB 3Q6JA 3JZUA 1GEUA 3ZVHA 4EM4A 1LVLA 3DFYA 4IHCA 2W0HA 3SR6B 4A6GA 1RM6B 3FYYA 5KVHA 1NDAA 2C3DA 1D7YA 5FJRA 1GRGA 4KPRA 2GR2A 3ENLA 2BCPA 2WOIA 1XHCA 2E3TA 1JEHA 2PODA 2GGHA 3CAWA 3EANA 4H4TA 4H4VA 4HYRA 3NVWB 2HXUA 1KCZA 3R0KA 2W55A 1N62C 2XH2A 4H4PA 4EM3A 2PTXA 1FFVC 1JPMA 2EQ9A 3GD3A 3ES8A 1Q1WA 3LXDA 3GD4A 4HCHA 3L8KA 3RNMA 3QLDA 4X2PA 3TOYA 5FJPA 1H2IA 4G7FA 4K8GA 1FHUA 3GD6A 4FI4A 1EC9A 1N61C 4HNLA 2P88A 4J56A 2P3ZA 2PU1A 2XH4A 3DK9A 2OZ8A 3OTRA 3P93A 4DN1A 1K4QA 3LADA 2PA6A 3GO2A 4G8TA 2RDXA 2YAUA 2XH7A 1ONFA 3V4BA 1MOKA 2OLAA 3FJ4A 2OPJA 3CGCA 4GRTA 3T8QA 2CFYA 3RCYA 1JPDX 3B9JB 3ZLGA 3NFUA 2QJMA 1ZDLA 4H4RA 3A7AA 3DK4A 2OO6A 3D46A 3STPA 2QAEA 2X8HA 2E5AA 3EKGA 3IJLA 3FCPA 1FHVA 4E4FA 2NVKX 2PP3A 2HZGA 3EUB3 4IL2A 1TZZA 3I4KA 4GYPC 3Q4DA 2CHRA 2PTYA 5FJOA 5U25A 2I5QA 2O56A 4LA1A 4YWSA 3TCSA 1JOAA 3OZYA 3ZVHB 1EC8A 3RGTA 1PDZA 3I6EA 2MNRA 1NPXA 3DK8A 3QFBA 4MMWA 3SJNA 3URHA 2OG9A 1H6VA 5IDZA 4GR1A 4H4SA 1FO4A 3DJGX 3IC9A 4EMWA 1S7MA 2PGEA 1GRAA 3DG7A
chains in the Genus database with same CATH topology
4BURA 4K7ZA 3FG2P 4FDCB 3II4A 1ZX9A 2GR3A 2HQMA 2YVJA 2A8XA 1DNCA 2WPFA 5JCLA 4EQWA 1NHSA 1GRFA 2C3CA 2V6OA 5FS9A 4EMJA 2WOVA 2GR0A 3PG6A 2BC1A 1FEBA 4EQRA 3EF6A 2JK6A 2R9ZA 3Q6JA 4APNA 2EQ6A 3DGZA 1GEUA 1GETA 3GRTA 3DJJA 1LVLA 4EM4A 5GRTA 5ER0A 1OJTA 1GRTA 2W0HA 4YWOA 5KVHA 1NDAA 2C3DA 1D7YA 2J3NA 1GRGA 4KPRA 1GESA 2GR2A 3DH9A 2X8CA 3O0HA 4ADWA 2BCPA 2WOIA 1XHCA 1JEHA 2BC0A 4H4VA 4H4QA 1ZKQA 3EANA 4H4TA 2V3AA 4M52A 1GERA 1ZK7A 2WP6A 3GRSA 2GR1A 1TYTA 4H4PA 1V59A 3GD3A 4EM3A 2EQ9A 2GQWA 1Q1WA 2ZZ0A 5FMHA 5TR3A 2AAQA 1NHRA 3GD4A 3LXDA 3L8KA 5KVIA 2YQUA 3RNMA 4LIIA 1M6IA 1H2IA 1BZLA 1XANA 4J56A 4JDRA 3DK9A 2X99A 1Q1RA 5U1OA 4J57A 1ZY8A 1FECA 1GREA 1K4QA 1LPFA 3LADA 3OC4A 4H4WA 2YVGA 4H4YA 1AOGA 2X50A 3DGHA 2WPCA 2YAUA 2CDUA 2F5ZA 2GH5A 1ONFA 1TYPA 1MOKA 2WP5A 3CGCA 1DXLA 4GRTA 2YVFA 2ZZBA 2CFYA 3CGBA 3H4KA 3D9XA 2ZZCA 1YQZA 5EBKA 5JCIA 1ZDLA 4H4RA 1MO9A 2X8GA 3DK4A 1GRHA 5FS8A 4FX9A 4DNAA 1NHPA 2TPRA 2QAEA 1GRBA 2WPEA 2X8HA 2GRTA 4H4ZA 2EQ8A 1F8WA 5FS7A 5JCNA 1ZMCA 3QFAA 4H4XA 4H4UA 2NPXA 2WBAA 1GV4A 1GXFA 3KLJA 1EBDA 2NVKX 1GSNA 5JCKA 3CGEA 4H50A 1XDIA 4EQSA 1F3PA 4EQXA 1ZMDA 1FEAA 5U25A 4EMIA 4LA1A 4NEWA 1JOAA 4K8DA 3L5OA 4NEVA 1NPXA 1NHQA 3DK8A 3QFBA 3URHA 2V3BA 3SQPA 3EAOA 2EQ7A 1BWCA 1KN0A 2WOWA 3LB8A 5FS6A 1H6VA 4GR1A 4JQ9A 4H4SA 3CGDA 2RABA 3DJGX 3IC9A 4EMWA 5JCMA 5JRBA 4BV6A 1S7MA 1GRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2I A;  5JRB A;  1KN0 A; 
#chains in the Genus database with same CATH topology
 2GL5 A;  4K7Z A;  1P43 A;  2FKP A;  2HQM A;  3S47 A;  3MQT A;  4EQW A;  2OQH A;  2C3C A;  4H1Z A;  3I6T A;  3UJR A;  3ZVI A;  2WOV A;  2GR0 A;  3ZLF A;  3ES7 A;  2JK6 A;  1ONE A;  3T4W A;  2OX4 A;  1N5W C;  1FFU C;  2OZ3 A;  1TKK A;  2PTZ A;  3BOX A;  2PS2 A;  4MKS A;  3DES A;  4YWO A;  1F9C A;  4JN8 A;  2J3N A;  3RIT A;  4DX3 A;  4F4R A;  2AL2 B;  1ZKQ A;  4GIS A;  2FYM A;  2WP6 A;  1SJC A;  1TYT A;  3CB3 A;  1V59 A;  3RRA A;  1X2G A;  3GC2 A;  2P8B A;  2GQW A;  2ZZ0 A;  3R07 C;  2HXT A;  5TR3 A;  5BOF A;  3T6C A;  2YQU A;  4M0X A;  3IK4 A;  4ZOH B;  3TJ4 A;  4MGG A;  3R25 A;  1SJD A;  3P0W A;  3U4F A;  1X2H A;  3OW1 A;  3UXL A;  6ENL A;  4H19 A;  5U1O A;  3DG3 A;  1FEC A;  3V3W A;  3NVY B;  4H4W A;  3OC4 A;  4E4U A;  2OZT A;  1VQZ A;  1AOG A;  2X50 A;  2WPC A;  1XS2 A;  2CDU A;  3A7R A;  2YVF A;  4GME A;  2ZZB A;  3CGB A;  2DW6 A;  2XGZ A;  2ZZC A;  3CT2 A;  4IP4 A;  3HRD C;  3VCN A;  1N60 C;  3VC6 A;  2W54 A;  2X8G A;  5FS8 A;  3H70 A;  1NU5 A;  2TPR A;  2WPE A;  2DW7 A;  4H4Z A;  4DHG A;  3UJ2 A;  1VDV A;  1F8W A;  3NVV B;  4H83 A;  5JCN A;  3QFA A;  4H4U A;  2NPX A;  1GV4 A;  3QN3 A;  3KLJ A;  1EBD A;  3UJS A;  1BQG A;  1YEY A;  3THU A;  1XDI A;  1F3P A;  5EU9 A;  4E5T A;  1ZMD A;  3MY9 A;  4NEW A;  2PCE A;  3N6J A;  1SJA A;  1MDL A;  1R6W A;  3L5O A;  2AL2 A;  4HCD A;  3MKC A;  3VC5 A;  1P48 A;  1NHQ A;  4JN7 A;  3SQP A;  3T9P A;  1JDF A;  1KN0 A;  2EQ7 A;  2WOW A;  4DWD A;  1KKO A;  1MUC A;  4IL0 A;  3AMZ A;  3V5C A;  4BV6 A;  4BUR A;  4K2S A;  4HCL A;  3UCC A;  2YVJ A;  3U9I A;  2WPF A;  3VDG A;  2V6O A;  1WYG A;  3GY1 A;  2QGY A;  3IJQ A;  4JHM A;  4EMJ A;  2BC1 A;  2AL1 A;  3UCD A;  1KKR A;  2AKZ A;  3H8A A;  4APN A;  2HNE A;  5ENL A;  4GGB A;  1GET A;  3ZLH A;  2GSH A;  1N5X A;  5GRT A;  3TW9 A;  4KPL A;  1OJT A;  1GRT A;  2OKT A;  2XH0 A;  5FJT A;  3TWB A;  2QDD A;  3CK5 A;  4GFI A;  1N63 C;  3DH9 A;  2QJJ A;  4ADW A;  2BC0 A;  4H4Q A;  3A7U A;  3R0U A;  3N6H A;  4M52 A;  2MUC A;  3SN4 A;  1GER A;  3GRS A;  2AAQ A;  1NHR A;  2NQL A;  1JRO A;  3N4F A;  3EEZ A;  5KVI A;  3DDM A;  1BZL A;  3SN1 A;  1XAN A;  4JDR A;  2GGJ A;  3UJE A;  1Q1R A;  3PK7 A;  1SJB A;  1ZY8 A;  3R11 A;  1GRE A;  3N4E A;  1R0M A;  1RVK A;  3DGH A;  2OQY A;  3TTE A;  3DER A;  2GH5 A;  1TYP A;  1KD0 A;  1DTN A;  3HW2 A;  4HPN A;  2QQ6 A;  3MUC A;  3FVD A;  5EBK A;  4H2H A;  1MO9 A;  3DGB A;  5BOE A;  1GRH A;  2W3S A;  4IZG A;  4FX9 A;  1PDY A;  3RO6 A;  1NHP A;  1GRB A;  5FS7 A;  2GRT A;  2POZ A;  2EQ8 A;  3B97 A;  4EWJ A;  2GDQ A;  4H4X A;  2WBA A;  1ELS A;  1GSN A;  3SSZ A;  5JCK A;  4H50 A;  3SN0 A;  2PP1 A;  4EQS A;  2W3R A;  3TWA A;  3V5F A;  4DXK A;  3D47 A;  2PPG A;  2QJN A;  3OPS A;  3IJI A;  3S5S A;  4A3R A;  2V3B A;  3H12 A;  3LB8 A;  1BWC A;  4KWS A;  4J1O A;  3CXB A;  4JQ9 A;  4HNC A;  4IP5 A;  3CGD A;  7ENL A;  2RAB A;  3KUM A;  2GGG A;  3FG2 P;  4FDC B;  3TJI A;  3II4 A;  1ZX9 A;  3QTP A;  2A8X A;  5JCL A;  3DG6 A;  1NHS A;  1GRF A;  4M6U A;  3MSY A;  3PFR A;  3SBF A;  5FS9 A;  3PG6 A;  2PTW A;  2ZAD A;  1MNS A;  3DEQ A;  1ECQ A;  3CXO A;  3MZN A;  2EQ6 A;  3DGZ A;  3Q45 A;  2ONE A;  3QKE A;  5J04 A;  3GRT A;  3VFC A;  3DJJ A;  4DYE A;  5ER0 A;  2P8C A;  1GES A;  2X8C A;  3NVZ B;  3O0H A;  2ZC8 A;  3R1Z A;  2V3A A;  4TVY A;  1E9I A;  4FP1 A;  1ZK7 A;  3BSM A;  3UXK A;  3CYJ A;  2GR1 A;  3PWG A;  2GGE A;  4GIR A;  1T3Q C;  3UJF A;  5FMH A;  5G5H B;  5FJU A;  4GGH A;  2PGW A;  4GYP A;  4ROP A;  3NXL A;  1M6I A;  1WUE A;  4LII A;  3QPE A;  3OP2 A;  4ZCW A;  3SQS A;  2X99 A;  4HN8 A;  3H7V A;  4J57 A;  1XPY A;  3AN1 A;  1LPF A;  4H4Y A;  2YVG A;  3JVA A;  1BKH A;  2AKM A;  3K1G A;  2F5Z A;  3RR1 A;  3HPF A;  2WP5 A;  3VA8 A;  1DXL A;  2QDE A;  3FV9 A;  3H4K A;  3FXG A;  3JW7 A;  3D9X A;  3P3B A;  3ETR B;  1EBH A;  1YQZ A;  5JCI A;  3PWI A;  1ZXI C;  4E6M A;  4KT2 A;  2OVL A;  4DNA A;  4KEM A;  1FIQ B;  3DFH A;  4E8G A;  1ZMC A;  3NS1 B;  3OZM A;  1MDR A;  5G5G B;  3VCC A;  1GXF A;  3TQP A;  1EC7 A;  1JCT A;  3CGE A;  4EQX A;  1STZ A;  1FEA A;  4EMI A;  4K8D A;  3BJS A;  1TE6 A;  4NEV A;  3UGV A;  4ENL A;  1SB3 B;  1IYX A;  3EAO A;  3NZG A;  5FS6 A;  4TVW A;  2PP0 A;  3R10 A;  1EBG A;  3DIP A;  4IT1 A;  1JRP A;  5JCM A;  5JRB A;  2GGI A;  2P0I A;  2GR3 A;  1L8P A;  1MRA A;  1W6T A;  1DNC A;  1WUF A;  1OEP A;  2QVH A;  1V97 A;  2XSX A;  3AM9 A;  2PU0 A;  3MWC A;  2PMQ A;  4Z1Y A;  2OFJ A;  4J3Z A;  3NO1 A;  4K1W A;  4Z17 A;  1FEB A;  4EQR A;  2PSN A;  3EF6 A;  4ZA0 A;  2R9Z A;  4A35 A;  1NEL A;  3NRZ B;  3Q6J A;  3JZU A;  1GEU A;  3ZVH A;  4EM4 A;  1LVL A;  3DFY A;  4IHC A;  2W0H A;  3SR6 B;  4A6G A;  1RM6 B;  3FYY A;  5KVH A;  1NDA A;  2C3D A;  1D7Y A;  5FJR A;  1GRG A;  4KPR A;  2GR2 A;  3ENL A;  2BCP A;  2WOI A;  1XHC A;  2E3T A;  1JEH A;  2POD A;  2GGH A;  3CAW A;  3EAN A;  4H4T A;  4H4V A;  4HYR A;  3NVW B;  2HXU A;  1KCZ A;  3R0K A;  2W55 A;  1N62 C;  2XH2 A;  4H4P A;  4EM3 A;  2PTX A;  1FFV C;  1JPM A;  2EQ9 A;  3GD3 A;  3ES8 A;  1Q1W A;  3LXD A;  3GD4 A;  4HCH A;  3L8K A;  3RNM A;  3QLD A;  4X2P A;  3TOY A;  5FJP A;  1H2I A;  4G7F A;  4K8G A;  1FHU A;  3GD6 A;  4FI4 A;  1EC9 A;  1N61 C;  4HNL A;  2P88 A;  4J56 A;  2P3Z A;  2PU1 A;  2XH4 A;  3DK9 A;  2OZ8 A;  3OTR A;  3P93 A;  4DN1 A;  1K4Q A;  3LAD A;  2PA6 A;  3GO2 A;  4G8T A;  2RDX A;  2YAU A;  2XH7 A;  1ONF A;  3V4B A;  1MOK A;  2OLA A;  3FJ4 A;  2OPJ A;  3CGC A;  4GRT A;  3T8Q A;  2CFY A;  3RCY A;  1JPD X;  3B9J B;  3ZLG A;  3NFU A;  2QJM A;  1ZDL A;  4H4R A;  3A7A A;  3DK4 A;  2OO6 A;  3D46 A;  3STP A;  2QAE A;  2X8H A;  2E5A A;  3EKG A;  3IJL A;  3FCP A;  1FHV A;  4E4F A;  2NVK X;  2PP3 A;  2HZG A;  3EUB 3;  4IL2 A;  1TZZ A;  3I4K A;  4GYP C;  3Q4D A;  2CHR A;  2PTY A;  5FJO A;  5U25 A;  2I5Q A;  2O56 A;  4LA1 A;  4YWS A;  3TCS A;  1JOA A;  3OZY A;  3ZVH B;  1EC8 A;  3RGT A;  1PDZ A;  3I6E A;  2MNR A;  1NPX A;  3DK8 A;  3QFB A;  4MMW A;  3SJN A;  3URH A;  2OG9 A;  1H6V A;  5IDZ A;  4GR1 A;  4H4S A;  1FO4 A;  3DJG X;  3IC9 A;  4EMW A;  1S7M A;  2PGE A;  1GRA A;  3DG7 A; 
#chains in the Genus database with same CATH homology
 4BUR A;  4K7Z A;  3FG2 P;  4FDC B;  3II4 A;  1ZX9 A;  2GR3 A;  2HQM A;  2YVJ A;  2A8X A;  1DNC A;  2WPF A;  5JCL A;  4EQW A;  1NHS A;  1GRF A;  2C3C A;  2V6O A;  5FS9 A;  4EMJ A;  2WOV A;  2GR0 A;  3PG6 A;  2BC1 A;  1FEB A;  4EQR A;  3EF6 A;  2JK6 A;  2R9Z A;  3Q6J A;  4APN A;  2EQ6 A;  3DGZ A;  1GEU A;  1GET A;  3GRT A;  3DJJ A;  1LVL A;  4EM4 A;  5GRT A;  5ER0 A;  1OJT A;  1GRT A;  2W0H A;  4YWO A;  5KVH A;  1NDA A;  2C3D A;  1D7Y A;  2J3N A;  1GRG A;  4KPR A;  1GES A;  2GR2 A;  3DH9 A;  2X8C A;  3O0H A;  4ADW A;  2BCP A;  2WOI A;  1XHC A;  1JEH A;  2BC0 A;  4H4V A;  4H4Q A;  1ZKQ A;  3EAN A;  4H4T A;  2V3A A;  4M52 A;  1GER A;  1ZK7 A;  2WP6 A;  3GRS A;  2GR1 A;  1TYT A;  4H4P A;  1V59 A;  3GD3 A;  4EM3 A;  2EQ9 A;  2GQW A;  1Q1W A;  2ZZ0 A;  5FMH A;  5TR3 A;  2AAQ A;  1NHR A;  3GD4 A;  3LXD A;  3L8K A;  5KVI A;  2YQU A;  3RNM A;  4LII A;  1M6I A;  1H2I A;  1BZL A;  1XAN A;  4J56 A;  4JDR A;  3DK9 A;  2X99 A;  1Q1R A;  5U1O A;  4J57 A;  1ZY8 A;  1FEC A;  1GRE A;  1K4Q A;  1LPF A;  3LAD A;  3OC4 A;  4H4W A;  2YVG A;  4H4Y A;  1AOG A;  2X50 A;  3DGH A;  2WPC A;  2YAU A;  2CDU A;  2F5Z A;  2GH5 A;  1ONF A;  1TYP A;  1MOK A;  2WP5 A;  3CGC A;  1DXL A;  4GRT A;  2YVF A;  2ZZB A;  2CFY A;  3CGB A;  3H4K A;  3D9X A;  2ZZC A;  1YQZ A;  5EBK A;  5JCI A;  1ZDL A;  4H4R A;  1MO9 A;  2X8G A;  3DK4 A;  1GRH A;  5FS8 A;  4FX9 A;  4DNA A;  1NHP A;  2TPR A;  2QAE A;  1GRB A;  2WPE A;  2X8H A;  2GRT A;  4H4Z A;  2EQ8 A;  1F8W A;  5FS7 A;  5JCN A;  1ZMC A;  3QFA A;  4H4X A;  4H4U A;  2NPX A;  2WBA A;  1GV4 A;  1GXF A;  3KLJ A;  1EBD A;  2NVK X;  1GSN A;  5JCK A;  3CGE A;  4H50 A;  1XDI A;  4EQS A;  1F3P A;  4EQX A;  1ZMD A;  1FEA A;  5U25 A;  4EMI A;  4LA1 A;  4NEW A;  1JOA A;  4K8D A;  3L5O A;  4NEV A;  1NPX A;  1NHQ A;  3DK8 A;  3QFB A;  3URH A;  2V3B A;  3SQP A;  3EAO A;  2EQ7 A;  1BWC A;  1KN0 A;  2WOW A;  3LB8 A;  5FS6 A;  1H6V A;  4GR1 A;  4JQ9 A;  4H4S A;  3CGD A;  2RAB A;  3DJG X;  3IC9 A;  4EMW A;  5JCM A;  5JRB A;  4BV6 A;  1S7M A;  1GRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...