1DULA

Structure of the ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ribonucleoprotein core of the signal recognition particle.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
molecule keywords 4.5 S RNA DOMAIN IV
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2000-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 1dulA00
1DULA 1MFQC 1QB2A 2FFHA 5GAHi 2PXUA 3KL4A 2PXTA 3NDBB 2XXAA 3LQXA 2PXLA 2PXQA 2PXPA 1HQ1A 1QZXA 2JQEA 2PXDA 2PXKA 2PXFA 5GAGi 2PXBA 3DM5A 2PXEA 2PXVA 2V3CC
chains in the Genus database with same CATH superfamily
4MCXA 1EFAA 2PUGA 3FMYA 1ZZ9A 3JXDL 4X4BA 5DRYA 3QWGA 2OFYA 3QYXA 1L1MA 1BDHA 3F6WA 4X4IA 2O49A 1WH8A 2HINA 3G7DA 1ZZ7A 2PUEA 2CROA 4Z5CA 4YG1A 4EKGA 3QOWA 1NEQA 5DTMA 1JFSA 4F8DA 3R09A 3CECA 1QQBA 4PU7A 1JH9A 2LLVA 3GN5B 1AU7A 4YG4A 2PXQA 3QFIA 3QOXA 1PRVA 1ADRA 2PXKA 2IUOA 2MQKA 1OSLA 3GBFA 4EK9A 4EZIA 2PE5A 1QQAA 1DW9A 3LISA 2BNMA 2LYKA 1CJGA 3OWQA 3ZHIA 2M4HA 1Y7YA 2LLWA 2XCJA 2LYLA 3O9XA 1UXCA 5A7LA 2PUCA 1S7EA 1RPEL 2AXVA 3GZDA 2EWTA 4IWRA 2XIUA 2XJ3A 3TRBA 3IVPA 2HFZA 2LYJA 4X4HA 1ZVVA 1X57A 1HQ1A 1QZXA 1NERA 3F52A 2EF8A 4ER7A 3MLFA 3TEPA 3PXPA 1WH6A 4J1WA 2KEJA 2HSGA 2LYPA 1PRAA 3NZLA 1ZZ8A 3SCGA 4JQDA 2A6CA 2PUDA 3SX0A 4OB4A 2GRLA 2KEIA 1BDIA 1CQTA 2BNNA 3QQ6A 2O38A 4FBIA 2PXFA 1ZZCA 2B5AA 1QP0A 2ICTA 3CROL 5DTRA 2LYRA 4ER6A 3KL4A 4Q2JA 1ZPQA 4I6RA 1GT0C 4IA8A 5DRTA 2LCVA 2J7WA 4X4DA 1ZUGA 3JXBC 4X4EA 2BJCA 1Y9QA 4ER0A 2VEOA 2FFHA 4X4CA 1LMB3 2BNOA 2MXDA 4PU8A 3RZZA 4Z5DA 1ZAYA 3CLCA 3LQXA 1PNRA 4I6TA 2KEKA 2XXQA 1RZSA 1WIZA 2L8NA 1ZS4A 3B7HA 5JUWA 5K98B 1R63A 2JCGA 2R63A 1UXDA 2AWIA 3QF3A 2LYSA 3VK0A 2FJRA 1R69A 3OP9A 2IV1A 2KPJA 2XI8A 2IVGA 2JQEA 5DTQA 3ME5A 1WETA 3G0TA 2V3CC 2LNMA 3TFLA 1O4XA 4GHJA 2XSDC 1RZRA 3SR4A 1DWKA 2L49A 2ICPA 2IU7A 3GN5A 2OR1L 4PU3C 3GUUA 3EUSA 2AUWA 3U3WA 3BDNA 2GZUA 3TELA 4JCYA 2PXEA 4HRAA 1U2ZA 3A9YA 1LQCA 2D5VA 4Z5HA 4MCTA 1MFQC 2R1JL 2LYQA 4DE9A 3HZIB 1B0NA 4DE8A 2AXUA 3SCFA 2PXUA 2XXPA 2PXTA 1XWRA 3F51A 2EBYA 3ZKCA 2GRMA 1QP4A 3GZDC 3S8QA 2PXPA 2IVBA 1QP7A 2WUSR 3M9LA 2AW6A 4ER5A 2PUBA 2IVQA 4EKIA 1ZZBA 2WIUB 4WVLA 3BS3A 1RZRD 1NW3A 4PU4C 1LCDA 1OCTC 3UWPA 1X2LA 1JWLA 5DSXA 4YBAA 2L1PA 3H5TA 3FYMA 2KZ8A 3KJXA 3NXHA 4YG7B 4NDWA 2H8RA 2PXDA 4GQMA 1QPZA 5GAGi 4OBMA 3DM5A 4FN3A 1ZZ6A 1DULA 3ZPXA 3OMTA 4O8BA 3OQMA 3VWSA 2O4AA 3GZCA 3MEJA 3PE5A 1LLIA 1VPWA 2XXAA 2PXLA 3A9XA 3NROA 2MEZA 4I6UA 1JFTA 1POUA 3BD1A 2JVLA 3DNVB 2J7UA 4EQZA 3KXAA 1SQ8A 3FYAA 4Y42A 1PRUA 3G5GA 3SCHA 3R1FA 4X4FA 3OQOA 4J1XA 2PXBA 1RIOA 2YBDA 2HCNA 3KZ3A 2PIJA 3NDBB 2ODRD 3A9ZA 2HCSA 4I8TA 2PUAA 1IC8A 2PXVA 4Z58A 3L1PA 3ZHMA 2AXZA 3OQNA 3D1NI 3OKZA 3LFPA 1LCCA 1QB2A 4Z59A 5GAHi 1YSEA 1PERL 2PPXA 4IVZA 5DT2A 2CSFA 4YARA 1E3OC 1HF0A 1UTXA 2PUFA 4JCXA 3JXCL 4ER3A 4X4GA 3UFDA
chains in the Genus database with same CATH topology
1DULA 1MFQC 1QB2A 2FFHA 5GAHi 2PXUA 3KL4A 2PXTA 3NDBB 2XXAA 3LQXA 2PXLA 2PXQA 2PXPA 1HQ1A 1QZXA 2JQEA 2PXDA 2PXKA 2PXFA 5GAGi 2PXBA 3DM5A 2PXEA 2PXVA 2V3CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DUL A;  1MFQ C;  1QB2 A;  2FFH A;  5GAH i;  2PXU A;  3KL4 A;  2PXT A;  3NDB B;  2XXA A;  3LQX A;  2PXL A;  2PXQ A;  2PXP A;  1HQ1 A;  1QZX A;  2JQE A;  2PXD A;  2PXK A;  2PXF A;  5GAG i;  2PXB A;  3DM5 A;  2PXE A;  2PXV A;  2V3C C; 
#chains in the Genus database with same CATH topology
 4MCX A;  1EFA A;  2PUG A;  3FMY A;  1ZZ9 A;  3JXD L;  4X4B A;  5DRY A;  3QWG A;  2OFY A;  3QYX A;  1L1M A;  1BDH A;  3F6W A;  4X4I A;  2O49 A;  1WH8 A;  2HIN A;  3G7D A;  1ZZ7 A;  2PUE A;  2CRO A;  4Z5C A;  4YG1 A;  4EKG A;  3QOW A;  1NEQ A;  5DTM A;  1JFS A;  4F8D A;  3R09 A;  3CEC A;  1QQB A;  4PU7 A;  1JH9 A;  2LLV A;  3GN5 B;  1AU7 A;  4YG4 A;  2PXQ A;  3QFI A;  3QOX A;  1PRV A;  1ADR A;  2PXK A;  2IUO A;  2MQK A;  1OSL A;  3GBF A;  4EK9 A;  4EZI A;  2PE5 A;  1QQA A;  1DW9 A;  3LIS A;  2BNM A;  2LYK A;  1CJG A;  3OWQ A;  3ZHI A;  2M4H A;  1Y7Y A;  2LLW A;  2XCJ A;  2LYL A;  3O9X A;  1UXC A;  5A7L A;  2PUC A;  1S7E A;  1RPE L;  2AXV A;  3GZD A;  2EWT A;  4IWR A;  2XIU A;  2XJ3 A;  3TRB A;  3IVP A;  2HFZ A;  2LYJ A;  4X4H A;  1ZVV A;  1X57 A;  1HQ1 A;  1QZX A;  1NER A;  3F52 A;  2EF8 A;  4ER7 A;  3MLF A;  3TEP A;  3PXP A;  1WH6 A;  4J1W A;  2KEJ A;  2HSG A;  2LYP A;  1PRA A;  3NZL A;  1ZZ8 A;  3SCG A;  4JQD A;  2A6C A;  2PUD A;  3SX0 A;  4OB4 A;  2GRL A;  2KEI A;  1BDI A;  1CQT A;  2BNN A;  3QQ6 A;  2O38 A;  4FBI A;  2PXF A;  1ZZC A;  2B5A A;  1QP0 A;  2ICT A;  3CRO L;  5DTR A;  2LYR A;  4ER6 A;  3KL4 A;  4Q2J A;  1ZPQ A;  4I6R A;  1GT0 C;  4IA8 A;  5DRT A;  2LCV A;  2J7W A;  4X4D A;  1ZUG A;  3JXB C;  4X4E A;  2BJC A;  1Y9Q A;  4ER0 A;  2VEO A;  2FFH A;  4X4C A;  1LMB 3;  2BNO A;  2MXD A;  4PU8 A;  3RZZ A;  4Z5D A;  1ZAY A;  3CLC A;  3LQX A;  1PNR A;  4I6T A;  2KEK A;  2XXQ A;  1RZS A;  1WIZ A;  2L8N A;  1ZS4 A;  3B7H A;  5JUW A;  5K98 B;  1R63 A;  2JCG A;  2R63 A;  1UXD A;  2AWI A;  3QF3 A;  2LYS A;  3VK0 A;  2FJR A;  1R69 A;  3OP9 A;  2IV1 A;  2KPJ A;  2XI8 A;  2IVG A;  2JQE A;  5DTQ A;  3ME5 A;  1WET A;  3G0T A;  2V3C C;  2LNM A;  3TFL A;  1O4X A;  4GHJ A;  2XSD C;  1RZR A;  3SR4 A;  1DWK A;  2L49 A;  2ICP A;  2IU7 A;  3GN5 A;  2OR1 L;  4PU3 C;  3GUU A;  3EUS A;  2AUW A;  3U3W A;  3BDN A;  2GZU A;  3TEL A;  4JCY A;  2PXE A;  4HRA A;  1U2Z A;  3A9Y A;  1LQC A;  2D5V A;  4Z5H A;  4MCT A;  1MFQ C;  2R1J L;  2LYQ A;  4DE9 A;  3HZI B;  1B0N A;  4DE8 A;  2AXU A;  3SCF A;  2PXU A;  2XXP A;  2PXT A;  1XWR A;  3F51 A;  2EBY A;  3ZKC A;  2GRM A;  1QP4 A;  3GZD C;  3S8Q A;  2PXP A;  2IVB A;  1QP7 A;  2WUS R;  3M9L A;  2AW6 A;  4ER5 A;  2PUB A;  2IVQ A;  4EKI A;  1ZZB A;  2WIU B;  4WVL A;  3BS3 A;  1RZR D;  1NW3 A;  4PU4 C;  1LCD A;  1OCT C;  3UWP A;  1X2L A;  1JWL A;  5DSX A;  4YBA A;  2L1P A;  3H5T A;  3FYM A;  2KZ8 A;  3KJX A;  3NXH A;  4YG7 B;  4NDW A;  2H8R A;  2PXD A;  4GQM A;  1QPZ A;  5GAG i;  4OBM A;  3DM5 A;  4FN3 A;  1ZZ6 A;  1DUL A;  3ZPX A;  3OMT A;  4O8B A;  3OQM A;  3VWS A;  2O4A A;  3GZC A;  3MEJ A;  3PE5 A;  1LLI A;  1VPW A;  2XXA A;  2PXL A;  3A9X A;  3NRO A;  2MEZ A;  4I6U A;  1JFT A;  1POU A;  3BD1 A;  2JVL A;  3DNV B;  2J7U A;  4EQZ A;  3KXA A;  1SQ8 A;  3FYA A;  4Y42 A;  1PRU A;  3G5G A;  3SCH A;  3R1F A;  4X4F A;  3OQO A;  4J1X A;  2PXB A;  1RIO A;  2YBD A;  2HCN A;  3KZ3 A;  2PIJ A;  3NDB B;  2ODR D;  3A9Z A;  2HCS A;  4I8T A;  2PUA A;  1IC8 A;  2PXV A;  4Z58 A;  3L1P A;  3ZHM A;  2AXZ A;  3OQN A;  3D1N I;  3OKZ A;  3LFP A;  1LCC A;  1QB2 A;  4Z59 A;  5GAH i;  1YSE A;  1PER L;  2PPX A;  4IVZ A;  5DT2 A;  2CSF A;  4YAR A;  1E3O C;  1HF0 A;  1UTX A;  2PUF A;  4JCX A;  3JXC L;  4ER3 A;  4X4G A;  3UFD A; 
#chains in the Genus database with same CATH homology
 1DUL A;  1MFQ C;  1QB2 A;  2FFH A;  5GAH i;  2PXU A;  3KL4 A;  2PXT A;  3NDB B;  2XXA A;  3LQX A;  2PXL A;  2PXQ A;  2PXP A;  1HQ1 A;  1QZX A;  2JQE A;  2PXD A;  2PXK A;  2PXF A;  5GAG i;  2PXB A;  3DM5 A;  2PXE A;  2PXV A;  2V3C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...