1DULA

Structure of the ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ribonucleoprotein core of the signal recognition particle.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
molecule keywords 4.5 S RNA DOMAIN IV
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2000-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 1dulA00
1HQ1A 1QZXA 3KL4A 3NDBB 3LQXA 2FFHA 2PXQA 2PXTA 1QB2A 5GAGi 2PXPA 1MFQC 2PXEA 2XXAA 2PXDA 5GAHi 2JQEA 3DM5A 2V3CC 2PXBA 1DULA 2PXVA 2PXFA 2PXKA 2PXUA 2PXLA
chains in the Genus database with same CATH superfamily
4NDWA 1ZZ9A 4PU7A 3QWGA 3OKZA 2PXPA 3TEPA 3QFIA 3R1FA 2YBDA 1BDHA 3GZCA 2LYQA 3PXPA 1ZPQA 5A7LA 3R09A 1PERL 2PXFA 2MXDA 2R1JL 4PU8A 4OBMA 2ICTA 4Z5HA 4Q2JA 2EWTA 3M9LA 3D1NI 1ZZBA 2OFYA 4FBIA 2V3CC 4X4HA 3SCGA 2WUSR 2LYSA 2LYLA 3H5TA 2M4HA 2AXZA 1ZAYA 2PXQA 2HINA 2GRLA 4X4FA 2GZUA 3KXAA 3CLCA 2XXAA 1WH8A 4ER0A 1OCTC 3SX0A 2PXVA 2PUAA 2PUBA 2PXKA 4Z58A 3CROL 1S7EA 4IVZA 1BDIA 4X4GA 3ZKCA 1ZZCA 1DWKA 2WIUB 1CJGA 1JFSA 3F6WA 3OWQA 1RZRD 2IUOA 5K98B 4IA8A 3MLFA 2O4AA 3SCFA 5DTQA 1JH9A 1UXCA 1OSLA 4OB4A 3PE5A 3BDNA 2PUDA 1B0NA 1QPZA 4Z59A 3JXDL 3VK0A 1SQ8A 2BNNA 3DNVB 3KZ3A 5DT2A 1ZVVA 2O38A 1WIZA 2LYRA 4EQZA 1ZUGA 5JUWA 2AUWA 2GRMA 3OQNA 2PXLA 2FJRA 2KPJA 1ZZ7A 3G0TA 1R69A 2PXEA 1LLIA 3ZHIA 3VWSA 3MEJA 2PXBA 3B7HA 4HRAA 4I8TA 2LCVA 1QP4A 5DTRA 3A9ZA 1JWLA 2XI8A 3FYMA 2J7UA 1ZS4A 5GAGi 2L49A 3QOXA 2IU7A 2IV1A 1IC8A 2BNMA 3NROA 1GT0C 4DE8A 2LLWA 3GN5B 1RIOA 4YG4A 3QF3A 2CSFA 2LNMA 4YG7B 2VEOA 3L1PA 2D5VA 2JCGA 3BD1A 3OQOA 2HCNA 3O9XA 3GBFA 2PIJA 3GZDC 1X2LA 2L8NA 1WH6A 2L1PA 3F52A 1R63A 2PUGA 2BNOA 5DRTA 3SCHA 4MCXA 1QQBA 2AW6A 2B5AA 2KEKA 5DRYA 4F8DA 2O49A 1VPWA 3QYXA 2MQKA 2HSGA 4I6RA 4PU4C 3OQMA 4Z5DA 3ME5A 3ZPXA 3UWPA 4ER6A 1QZXA 2R63A 3QOWA 4Y42A 1ADRA 1PRUA 2MEZA 3JXCL 1XWRA 1E3OC 3CECA 4ER3A 2LYPA 2PE5A 1UTXA 1LMB3 3NZLA 1LCCA 4X4BA 4I6TA 2PXUA 3LFPA 3TFLA 1ZZ8A 2XCJA 3NDBB 2XJ3A 2FFHA 1QB2A 2LYKA 3LISA 1NERA 2JQEA 3F51A 2PUEA 2KEJA 1PNRA 1Y7YA 1AU7A 3LQXA 4J1WA 2LYJA 3EUSA 1ZZ6A 1Y9QA 3OMTA 5DSXA 3GZDA 2AWIA 3DM5A 4O8BA 1EFAA 1DW9A 1U2ZA 1LCDA 4IWRA 1DULA 2AXVA 3GN5A 3FYAA 3UFDA 3A9YA 2HCSA 4JCXA 4YARA 4J1XA 2KEIA 4FN3A 4I6UA 2PPXA 4JCYA 2BJCA 2ODRD 3S8QA 4EKGA 3HZIB 1RZRA 4EKIA 2JVLA 4GQMA 2CROA 3OP9A 1PRVA 1RPEL 2EF8A 1HF0A 2H8RA 2PUFA 4PU3C 1PRAA 3SR4A 3FMYA 4WVLA 1POUA 3QQ6A 3RZZA 2EBYA 1JFTA 2PUCA 4ER5A 4JQDA 1CQTA 2ICPA 1MFQC 1UXDA 2IVBA 1QP0A 1QQAA 5GAHi 5DTMA 1NW3A 3JXBC 3U3WA 2XIUA 3GUUA 4X4IA 2J7WA 3TELA 4EZIA 3IVPA 1HQ1A 1RZSA 4MCTA 1L1MA 2A6CA 4X4DA 1YSEA 4ER7A 4DE9A 2PXTA 3KJXA 4YBAA 2XXQA 3ZHMA 4GHJA 4EK9A 3BS3A 3A9XA 1X57A 2XSDC 3NXHA 1LQCA 3G5GA 1O4XA 3G7DA 3KL4A 3TRBA 4YG1A 2XXPA 2KZ8A 2IVQA 2HFZA 1NEQA 4X4CA 2PXDA 4Z5CA 2AXUA 2IVGA 1QP7A 4X4EA 1WETA 2OR1L 2LLVA
chains in the Genus database with same CATH topology
1HQ1A 1QZXA 3KL4A 3NDBB 3LQXA 2FFHA 2PXQA 2PXTA 1QB2A 5GAGi 2PXPA 1MFQC 2PXEA 2XXAA 2PXDA 5GAHi 2JQEA 3DM5A 2V3CC 2PXBA 1DULA 2PXVA 2PXFA 2PXKA 2PXUA 2PXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ1 A;  1QZX A;  3KL4 A;  3NDB B;  3LQX A;  2FFH A;  2PXQ A;  2PXT A;  1QB2 A;  5GAG i;  2PXP A;  1MFQ C;  2PXE A;  2XXA A;  2PXD A;  5GAH i;  2JQE A;  3DM5 A;  2V3C C;  2PXB A;  1DUL A;  2PXV A;  2PXF A;  2PXK A;  2PXU A;  2PXL A; 
#chains in the Genus database with same CATH topology
 4NDW A;  1ZZ9 A;  4PU7 A;  3QWG A;  3OKZ A;  2PXP A;  3TEP A;  3QFI A;  3R1F A;  2YBD A;  1BDH A;  3GZC A;  2LYQ A;  3PXP A;  1ZPQ A;  5A7L A;  3R09 A;  1PER L;  2PXF A;  2MXD A;  2R1J L;  4PU8 A;  4OBM A;  2ICT A;  4Z5H A;  4Q2J A;  2EWT A;  3M9L A;  3D1N I;  1ZZB A;  2OFY A;  4FBI A;  2V3C C;  4X4H A;  3SCG A;  2WUS R;  2LYS A;  2LYL A;  3H5T A;  2M4H A;  2AXZ A;  1ZAY A;  2PXQ A;  2HIN A;  2GRL A;  4X4F A;  2GZU A;  3KXA A;  3CLC A;  2XXA A;  1WH8 A;  4ER0 A;  1OCT C;  3SX0 A;  2PXV A;  2PUA A;  2PUB A;  2PXK A;  4Z58 A;  3CRO L;  1S7E A;  4IVZ A;  1BDI A;  4X4G A;  3ZKC A;  1ZZC A;  1DWK A;  2WIU B;  1CJG A;  1JFS A;  3F6W A;  3OWQ A;  1RZR D;  2IUO A;  5K98 B;  4IA8 A;  3MLF A;  2O4A A;  3SCF A;  5DTQ A;  1JH9 A;  1UXC A;  1OSL A;  4OB4 A;  3PE5 A;  3BDN A;  2PUD A;  1B0N A;  1QPZ A;  4Z59 A;  3JXD L;  3VK0 A;  1SQ8 A;  2BNN A;  3DNV B;  3KZ3 A;  5DT2 A;  1ZVV A;  2O38 A;  1WIZ A;  2LYR A;  4EQZ A;  1ZUG A;  5JUW A;  2AUW A;  2GRM A;  3OQN A;  2PXL A;  2FJR A;  2KPJ A;  1ZZ7 A;  3G0T A;  1R69 A;  2PXE A;  1LLI A;  3ZHI A;  3VWS A;  3MEJ A;  2PXB A;  3B7H A;  4HRA A;  4I8T A;  2LCV A;  1QP4 A;  5DTR A;  3A9Z A;  1JWL A;  2XI8 A;  3FYM A;  2J7U A;  1ZS4 A;  5GAG i;  2L49 A;  3QOX A;  2IU7 A;  2IV1 A;  1IC8 A;  2BNM A;  3NRO A;  1GT0 C;  4DE8 A;  2LLW A;  3GN5 B;  1RIO A;  4YG4 A;  3QF3 A;  2CSF A;  2LNM A;  4YG7 B;  2VEO A;  3L1P A;  2D5V A;  2JCG A;  3BD1 A;  3OQO A;  2HCN A;  3O9X A;  3GBF A;  2PIJ A;  3GZD C;  1X2L A;  2L8N A;  1WH6 A;  2L1P A;  3F52 A;  1R63 A;  2PUG A;  2BNO A;  5DRT A;  3SCH A;  4MCX A;  1QQB A;  2AW6 A;  2B5A A;  2KEK A;  5DRY A;  4F8D A;  2O49 A;  1VPW A;  3QYX A;  2MQK A;  2HSG A;  4I6R A;  4PU4 C;  3OQM A;  4Z5D A;  3ME5 A;  3ZPX A;  3UWP A;  4ER6 A;  1QZX A;  2R63 A;  3QOW A;  4Y42 A;  1ADR A;  1PRU A;  2MEZ A;  3JXC L;  1XWR A;  1E3O C;  3CEC A;  4ER3 A;  2LYP A;  2PE5 A;  1UTX A;  1LMB 3;  3NZL A;  1LCC A;  4X4B A;  4I6T A;  2PXU A;  3LFP A;  3TFL A;  1ZZ8 A;  2XCJ A;  3NDB B;  2XJ3 A;  2FFH A;  1QB2 A;  2LYK A;  3LIS A;  1NER A;  2JQE A;  3F51 A;  2PUE A;  2KEJ A;  1PNR A;  1Y7Y A;  1AU7 A;  3LQX A;  4J1W A;  2LYJ A;  3EUS A;  1ZZ6 A;  1Y9Q A;  3OMT A;  5DSX A;  3GZD A;  2AWI A;  3DM5 A;  4O8B A;  1EFA A;  1DW9 A;  1U2Z A;  1LCD A;  4IWR A;  1DUL A;  2AXV A;  3GN5 A;  3FYA A;  3UFD A;  3A9Y A;  2HCS A;  4JCX A;  4YAR A;  4J1X A;  2KEI A;  4FN3 A;  4I6U A;  2PPX A;  4JCY A;  2BJC A;  2ODR D;  3S8Q A;  4EKG A;  3HZI B;  1RZR A;  4EKI A;  2JVL A;  4GQM A;  2CRO A;  3OP9 A;  1PRV A;  1RPE L;  2EF8 A;  1HF0 A;  2H8R A;  2PUF A;  4PU3 C;  1PRA A;  3SR4 A;  3FMY A;  4WVL A;  1POU A;  3QQ6 A;  3RZZ A;  2EBY A;  1JFT A;  2PUC A;  4ER5 A;  4JQD A;  1CQT A;  2ICP A;  1MFQ C;  1UXD A;  2IVB A;  1QP0 A;  1QQA A;  5GAH i;  5DTM A;  1NW3 A;  3JXB C;  3U3W A;  2XIU A;  3GUU A;  4X4I A;  2J7W A;  3TEL A;  4EZI A;  3IVP A;  1HQ1 A;  1RZS A;  4MCT A;  1L1M A;  2A6C A;  4X4D A;  1YSE A;  4ER7 A;  4DE9 A;  2PXT A;  3KJX A;  4YBA A;  2XXQ A;  3ZHM A;  4GHJ A;  4EK9 A;  3BS3 A;  3A9X A;  1X57 A;  2XSD C;  3NXH A;  1LQC A;  3G5G A;  1O4X A;  3G7D A;  3KL4 A;  3TRB A;  4YG1 A;  2XXP A;  2KZ8 A;  2IVQ A;  2HFZ A;  1NEQ A;  4X4C A;  2PXD A;  4Z5C A;  2AXU A;  2IVG A;  1QP7 A;  4X4E A;  1WET A;  2OR1 L;  2LLV A; 
#chains in the Genus database with same CATH homology
 1HQ1 A;  1QZX A;  3KL4 A;  3NDB B;  3LQX A;  2FFH A;  2PXQ A;  2PXT A;  1QB2 A;  5GAG i;  2PXP A;  1MFQ C;  2PXE A;  2XXA A;  2PXD A;  5GAH i;  2JQE A;  3DM5 A;  2V3C C;  2PXB A;  1DUL A;  2PXV A;  2PXF A;  2PXK A;  2PXU A;  2PXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...