1AU7A

Pit-1 mutant/dna complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
146
structure length
130
Chain Sequence
GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords CONSENSUS DNA 25-MER
publication title Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility.
pubmed rcsb
source organism Rattus norvegicus
total genus 44
structure length 130
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1au7A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1au7A01
4JX6A 1QQAA 1PRAA 4M3DA 1NK3P 1F36A 1YSEA 3QYXA 1Y1WJ 1R9TJ 2FD5A 1ETWA 3TW6A 1MBHA 1FTTA 2LYJA 1B8IB 3JRBA 1OCTC 1U9NA 4X4EA 3MVPA 4YBAA 1BJZA 3A02A 3FKIJ 2LYLA 1MBGA 4Z5HA 4I6UA 4A3GJ 2EBIA 3RZZA 5J3LA 4RDUA 5C3EJ 3GTQJ 4X4GA 1JT6A 4C3HJ 2HOTA 1AKHA 4CYCB 2VPRA 1LLIA 5IPAA 1B72A 2DA1A 3G1MA 3LSRA 1UG2A 1BL0A 1H8AC 2ME0A 2AUWA 3JXDL 4L5EA 1IV6A 3MN2A 3RKQA 5M3MJ 3BS3A 4GQMA 4FCYA 1PUFB 2XPVA 2LYRA 2JMWA 3FMYA 3OQNA 4YG1A 1R63A 5C44J 4V2GA 4I6TA 2DJNA 2WAQN 4A93J 1LE8B 5IP7J 1RZSA 3O9XA 1NTCA 3HEFA 4EEFG 2X6OA 1FJLA 1X2LA 2DN0A 1X2NA 2G0EA 4DYCA 2IVBA 3RQIA 2XRLA 4NDWA 2JK3A 4S0HB 2NVXJ 2DA7A 2O8KA 3ZQGA 5EG0A 2E19A 2HQ5A 3K7AJ 1OSLA 2MSYA 3KJXA 2Y31A 4JX4A 4XICA 2XGEA 5FKMA 1Y9QA 2K9QA 1LCCA 5EDNA 1JJ8C 2JA6J 2PUCA 2DA2A 3GBGA 3BR3A 4IHXA 3JRCA 2LLKA 5FKNA 2GLOA 2TRTA 3TRBA 1EF4A 3ZOBA 3TW7A 2JA5J 2HYJA 1HLVA 3GTLJ 4Z59A 1NERA 1UMQA 2EF8A 1VI0A 2FJ1A 3HDDA 2XGDA 3BD1A 3BT9A 3DNVB 2M34A 3BR0A 2DA5A 1X2MA 5IP6A 2E2JJ 3R1FA 1PERL 4MFEA 1NEQA 2CSFA 2EZLA 4B1RA 2L8NA 1WI3A 4PU8A 4OB4A 3QQAA 1VPWA 5F08A 2IVGA 3FYMA 4IEJA 1A6IA 4QTRA 1Y1VJ 2B5AA 1X57A 3B6AA 2CROA 3KXAA 2IUOA 5GPAA 4RBOA 4Y7NJ 1U78A 2KEKA 4A3CJ 5M5XJ 2CUEA 2KDZA 3IH3A 1EFAA 3G1OA 3H3VK 2X48A 2X9DA 5J1UA 1MSFC 3S1RJ 3S2DJ 3I4MJ 4A3BJ 2BNMA 5F04A 2LYKA 2XPWA 2K9SA 1WH6A 1ZZ6A 5EYRA 4XIDA 1OFCX 2DMQA 1GT0C 2IVQA 3U3WA 4Z58A 5EEAA 4JQDA 2R92J 5A7LA 3ZQCA 4G12A 2Y9YA 2P81A 4FE4A 5EZHA 5FKOA 3TEDA 1SFOJ 3SCGA 1XS9A 2LR8A 2XB5A 4XRSA 1WGXA 4M3GA 5IOZA 1T33A 5E3OA 3CDLA 1BDHA 4HNVA 3IH4A 4X4BA 3HBLA 3E7LA 5FLMJ 2R7ZJ 2JJ7A 2R1JL 1YRNA 3WHBA 2HI3A 1RESA 3H0GJ 4B3AA 2LFBA 2LYPA 1ZAYA 1AHDP 1IUFA 5GP9A 4BXXJ 3MLFA 3Q3SA 5EGOB 3GTJJ 1ZVVA 4A3MJ 2TCTA 4IA8A 4X4IA 5EZGA 4MO7A 2VI6A 3HGYA 3CMYA 2EZIA 3A01B 1ETXA 2B63J 2MG4A 3PO3J 5F0CA 5J1RA 1GV2A 4A3KJ 4DYRA 2O7OA 1IG7A 3HOUJ 1JKPC 5IYBJ 3HB9A 1IRZA 1L1MA 2R5YA 1TC3C 2NS8A 4A69C 3ZQFA 1E3OC 2HXIA 1PRUA 4BY7J 4V2FA 1H88C 3RZOJ 3BQZA 3M3YJ 1CJGA 2R5ZB 1HDDC 4A3DJ 2OPTA 2EQRA 4W1UA 1GV5A 5JLWA 1U8BA 1IJWC 4AUXA 2HOSA 2XB0X 4I6RA 3LNQA 4UUSB 1SANA 3OOUA 4GFBA 1QP4A 1OCPA 3JR9A 1MBJA 2JVLA 1LE8A 1ZZ9A 2CQQA 2AXUA 2WUSR 2LKXA 1POGA 3LSJA 3JRAA 1APLC 1GDTA 3S1NJ 2DMTA 2MGQA 2ELKA 3SFIA 1JUMA 1IC8A 3IH2A 4JYKA 4BBSJ 1ZZ8A 2IU7A 2IV1A 2AWIA 5F27A 1QRYA 3RZDJ 3O8HA 1I50J 1VNDA 2BNOA 3BTLA 2JCGA 2IBDA 2QCOA 4DZPA 1I3QJ 3MKLA 3F52A 2GM4A 1I6HJ 4D7MA 2PPXA 2DA6A 3IVPA 2E1OA 1ZGWA 2AHQA 3FK6A 4X4CA 2PMZN 1K61A 2FQ4A 5K7FA 4X6AJ 4MCXA 9ANTA 2NOGA 4LOCA 1ZR4A 1B72B 1DW9A 1ADRA 1RPWA 2Y2ZA 2K9NA 1RR7A 3JRDA 3IV5A 2Y9ZA 4UUTA 3JRIA 4IVZA 1WH5A 3LFPA 4M3BA 4O8BA 2ECCA 1ZTRA 1X58A 4IHYA 2WV1A 2NS7A 4X4FA 1BDIA 2PE5A 1VFCA 3OP9A 2I10A 2D5VA 3PM1A 2M0CA 1TWHJ 1DU6A 3LOCA 2CUFA 2ZB9A 4I76A 5IYDJ 2KZ8A 5IP9J 1LFUP 1RZRA 2GZUA 2OR1L 2COBA 2HXOA 3GTMJ 3F6WA 2EZKA 3GTPJ 1XWRA 5EG0B 4DZJA 2KT0A 2ECBA 3BR1A 2NVTJ 2GRLA 3HOYJ 3PXPA 2IAIA 1JUPA 2DA3A 2WB1N 2MW8A 5C4JJ 2DMPA 3OIOA 2DTZA 1RKWA 2LP0A 4PU3C 1JFSA 3VK0A 3FISA 2RAEA 5C4XJ 4X4DA 3QPSA 1W0TA 4FE7A 1MSEC 3W6VA 4XK4A 1SQ8A 3S8QA 5E3MA 3UKGA 1U9OA 2DA4A 3NAUA 3JREA 4MFDA 2H8RA 3S16J 1ETKA 3JXCL 2XPUA 4D7NA 1AU7A 1CQTA 1LCDA 3GN5A 1JUSA 2CJJA 3JXBC 2O4AA 4JP0A 3ZQIA 2DMUA 1UTXA 1WCMJ 3F0CA 3CECA 2HDDA 3TP3A 1H89C 4M3FA 2AXVA 2L49A 1QVUA 5EGOA 1HF0A 3LISA 3BR2A 3OMTA 3K2AA 3SDGA 1QP0A 2L0KA 2OF7A 1WH7A 1ZZBA 4YG7B 1JTXA 3UFDA 2JA8J 3B7HA 4A3IJ 3A01A 2XSDC 2EBYA 2HSGA 3ZKCA 4FISA 3M4OJ 2O49A 3DCFA 3OQOA 4PU7A 2KPJA 2JWTA 3FYAA 2LY9A 2QF7A 5DS9A 1WPKA 1A5JA 2EWTA 2PUEA 1RZRD 4JCYA 2R63A 4J19A 1JT0A 3KZ3A 2XIUA 1B8IA 3ZHMA 4Z5DA 5F0HA 4MLOA 2FX0A 1B0NA 3S2HJ 1BW5A 2AW6A 3OQMA 1ITYA 3ZQLA 1JH9A 4IHWA 3O8GA 4DW6A 1JTYA 2CQXA 3BR6A 2R5ZA 3S14J 3BTCA 2H1KA 4QIWN 3S17J 4CYCA 2O38A 5FLVA 1LQCA 1BA5A 3Q0WA 2LVSA 1TWFJ 2XCJA 1JWLA 2KEJA 1HOMA 2HOAA 1FEXA 1RIOA 2R0QC 2XI8A 1HDPA 4AC0A 4FN3A 2GRMA 1JKRC 1PUFA 5GPCA 3Q0VA 1JKQC 1T56A 3JRFA 1FTZA 2MQKA 1JKOC 1ZKGA 4ABZA 1TWCJ 1QVTA 3Q0UA 1MH4A 1ORKA 4NDLA 1RETA 4YARA 1QP7A 4X1EA 4BKXA 4JCXA 2Y0SN 3BG5A 3LSPA 2VKVA 1Q1VA 2E2IJ 3HZIB 3CLCA 3BQYA 4XRSG 3D1NI 3ZHIA 3A03A 3HOXJ 5IYCJ 5FKLA 2IEKA 2ID3A 3OSFA 3HOVJ 2MEZA 4M6VA 3GTKJ 2CRGA 3HM5A 5DTDA 4GHJA 1ETOA 1MBFA 2W48A 2K40A 4Y52J 5FJ8J 2LYSA 1TWGJ 3H5TA 5J1YA 2R5YB 2ICTA 1TWAJ 1Z77A 4Z5CA 5HODA 2A6CA 3QWGA 2PUDA 3GTGJ 4C3IJ 1OJLA 1Y7YA 1AKHB 3TP0A 1ZPQA 3CROL 3OSGA 1HCRA 4D5CA 1VF9A 1ZQ3P 2ID6A 4BY1J 2OFYA 2L7MP 3DEWA 1LFBA 3GBFA 1MH3A 4DYQA 3HKZN 2WIUB 1DWKA 2LK2A 2ICPA 2LYQA 1ZK8A 1ETYA 3BG9A 2YU9J 4X4HA 3SJMA 2VUMJ 3FIWA 4PU4C 1ZR2A 1IGNA 2JA7J 1D5YA 1MBKA 1XC5A 1UXDA 1ETVA 3BTIA 2N8GA 5E3NA 2LTPA 2LCVA 1QQBA 1WETA 3G5GA 5K7ZA 3SCFA 4D5FA 5FKKA 2AO9A 2XGCA 2PUAA 3SCHA 1XG1A 1UXCA 1RPEL 4A3LJ 2O9LA 1O4XA 2E2HJ 1ZZ7A 1GVDA 1R69A 3HOZJ 3BG3A 2YUSA 5EF6A 3G1LA 2NVQJ 3S1MJ 4F8DA 4C2MJ 1IDZA 4M3EA 4J1WA 1Z0XA 3HGGA 4FBIA 3HOWJ 1QPZA 1S7EA 4MIMA 3EUSA 3PO2J 1IDYA 1G2HA 4QSHA 3JRGA 3G7DA 2L7FP 1ETQA 2L9RA 4B4CA 5JLXA 4BBRJ 1MBEA 2M9HA 1P7JA 2KEIA 4A3FJ 2LD5A 3BDNA 3QQ6A 1NK2P 4FTHA 4XRMA 3NARA 3VPRA 3F51A 1ZUGA 2EH3A 4AYBN 1ZS4A 5K98B 4YG4A 2PIJA 3L1PA 4I6ZA 3C2BA 2DMNA 3B6CA 2FJRA 4I8TA 1ENHA 3BR5A 1MNMC 1FIAA 5F1JA 2YS9A 1WH8A 2L7ZA 1K83J 3FK7A 1WIZA 2JN6A 3LSGA 2BNNA 2R93J 2Y30A 1JFTA 2XJ3A 3QPLA 3ZQHA 3GTOJ 1PNRA 4A3EJ 2GBYA 1PRVA 3I4NJ 2M2EA 1LMB3 3CCYA 3WHCA 2CU7A 1F43A 1FIPA 1ZZCA 5IOYA 4JX5A 3JRHA 2NVYJ 5BNGA 4J1XA 3CQZJ 4Y42A 1QPIA 2HINA 3GN5B 4A3JJ 2BJCA 2PUFA 5E3LA 3S1QJ 1GUUA 4C3JJ 5F0FA 3QF3A 4MCTA 2AXZA 1POUA 5M5WJ 4IWRA 1DU0A 4IHVA 1UHSA 5M5YJ 2M8GX 2VKEA 3BTJA 1W0UA 4UUSA 1JGGA 1P7IA 5K7HA 2ME6A 5M3FJ 1JJ6C 3S15J 2PUGA 2EZHA 1YRNB 2PUBA 1RKTA 4W97A 1BW6A
chains in the Genus database with same CATH superfamily
2VC1A 3GFIA 1QQAA 1PRAA 4JK1X 3CESA 3CDIA 4YFNF 3DFGA 1GXPA 1FTTA 1HW1A 4M73A 2MABA 1OYWA 1B8IB 2Y48A 1SMTA 1U9NA 3PUBA 1R5GA 3FKIJ 2LYLA 4R79A 4BQQA 4PFOA 2OBPA 4A3GJ 4N9HA 3RZZA 5J3LA 4IRHA 1ZHFA 2DT5A 2FOWA 5C3EJ 2O6GE 3GTQJ 3OWQA 3FM3A 4X4GA 2CG4A 3NQOA 4C3HJ 4CYDA 1AKHA 5IPAA 1S5LC 3DBHB 2DA1A 3G1MA 4EK9A 2QBYA 5LHGA 2ZSIB 4U7DA 4WVLA 1BJAA 4LG3A 3CCQI 1IV6A 3RKQA 3RI4A 2IP2A 3DWLE 5BOXA 1FYMA 1ZG3A 3PNTA 4FCYA 4CICA 2DLLA 2LYRA 3V8JA 4YG1A 2IXSA 1FC3A 2XKOA 1FZPB 3KLNA 3GVAA 1MMSA 2H09A 3K70D 4M74A 1LQ1A 1Y39A 1LE8B 5IP7J 1S6LA 1NTCA 2UV1A 3M8FA 1IN5A 1LDJA 1D8KA 1X2NA 3VB2A 1YJ9I 4A6EA 4OAZA 4S0HB 2DA7A 5EG0A 5B3SH 1XB4A 3K7AJ 2A68F 1OSLA 4A5NA 2UWMA 2IS2A 2PXPA 2BY3A 2K9QA 2PXEA 5BMZA 4ETSA 2PUCA 2MC3A 4B44A 4XLHA 1J09A 1D3YA 2JUGA 3AKZA 3ZP5A 2EFNA 4I09A 3L2VA 2RVCA 3CCVI 4CCKA 1EF4A 2JA5J 2F5VA 3ROUA 2V1DA 1TP4A 1NERA 2YPRA 2EF8A 5CQEA 1XGMA 4XKBA 4KN7X 1VI0A 2FJ1A 2LREA 4FHTA 5D6FA 4IOAF 4GXOA 2M34A 5L3BA 1FOXA 5IP6A 4GCVA 4MFEA 5JI6A 2V1UA 2L8NA 1WI3A 3LAPA 1YJNI 4PU8A 4OB4A 2A6EF 3ML6A 4IQ4A 3R6SA 4YG2F 1VPWA 5BPDA 1UJ8A 2IVGA 2R7WA 3FYMA 1FNNA 3BJOA 2VQCA 2O8XA 1Y1VJ 5TGTA 3KYDB 3B6AA 3S32A 3AL0C 4RGSA 3WU0A 3KXAA 1DULA 3SFZA 2QA4I 4HQEA 3OYNA 3WTWC 1V55H 2CUEA 1XSDA 2UXXA 4ZYGA 5J1UA 3I4MJ 1WJ5A 3QP5A 2K9SA 4KUMA 2EFOA 2LG4A 4XIDA 5LRSA 1GT0C 1RR8C 2KZVA 3M9LA 4Z58A 4D0PA 2R92J 2OTJI 5F1RA 4G12A 2Y9YA 4LB5A 1QNTA 2K9LA 3F6VA 4M9XA 2LLWA 4GO1A 2LR8A 2FRHA 4HW0A 1WGXA 4QPOA 1H0MA 4EZIA 5H6QA 5JVTA 2ZFUA 2VJ5A 5E3OA 3CDLA 1KZHA 1SAUA 1BDHA 4Q47A 1BR2A 1XTAA 2Z2SB 3HBLA 4JBAA 2JJ7A 2R7ZJ 2Z3YA 2DK8A 3C1DA 2LFBA 4JOMA 2JTVA 1T08B 2VBZA 4BXXJ 2M1BA 2M8EA 2L7KA 4F3QA 3GZDC 4CXFA 2A5WA 2GIZA 2ZXWH 3KEYA 2GA2A 3T5XA 2YU3A 2MFZA 2XDVA 2OUMA 3CMYA 5D5XB 4L9TA 1HKTA 3HRTA 4Y17A 3OS2A 2ICWG 2M4GA 5ICGA 5E18F 1GV2A 3NROA 5L3GA 1OCZH 4DYRA 2O7OA 2M3AA 1IG7A 1VQ6I 1KGSA 5LGUA 1JKPC 3HB9A 1IRZA 1WWXA 4I0AA 3A0HC 4ESJA 2X85A 3JW4A 1DPRA 2HXIA 3QPTA 1H88C 2MXDA 2ZMEB 2VLAA 1J75A 4OINF 4A3DJ 2PXUA 5JLWA 2EQRA 1ADRA 1U8BA 1IJWC 2X4HA 2HOSA 2XB0X 4UUSB 3KX2A 1ODDA 2IW5A 3L2UA 1VQOI 4GFBA 2RC4A 1QP4A 1OCPA 2XUBA 4Y15A 3OYCA 3DEUA 2JVLA 2ELHA 4IZZA 1LE8A 2WUSR 3V7RA 2HYFA 3HUGA 1U3EM 4XOTA 3S2WA 4EM1A 5ILUA 3BY6A 2F48A 3WU1B 5F27A 4G7OF 3O8HA 5K5QA 1TW3A 1VNDA 2BNOA 3BTLA 1XPXA 1U5TB 1LB2A 2R3SA 1W36C 2M45A 2DQLA 2ETHA 4NB5A 2XAQA 1QPMA 3F52A 2GM4A 1I6HJ 4D7MA 2PPXA 2KP6A 4BXFA 2X6WA 1XX5A 4ZDLA 3IVPA 3F21A 1HW5A 1RUNA 1K61A 2VE9A 2DU9A 4ZTJA 2FNPA 2NOGA 4NC6A 3ZQ7A 3RPQA 2KKOA 3E5QA 2JPCA 2STTA 1Z7UA 3WU2C 3JRDA 4BGDA 3D5RC 3IV5A 3LFPA 4KA4A 1F1ZA 3I71A 1ZTRA 3ZPXA 1VQ8I 2WV1A 3I55I 1USTA 2NS7A 2L9VA 4J00A 3CMMA 4KT6A 3SDBA 4G8XA 1OYIA 1LUJB 2M0CA 4C30A 5D8LB 2JVGA 2W84A 3LOCA 1FOYA 3VSKA 4IX7A 2HNHA 3FXQA 4LK1F 4ESFA 2OR1L 3GTMJ 1XD7A 5D5UB 3GTPJ 3TOAA 4DZJA 1X3ZB 2PXFA 2MH9A 3HOYJ 2IAIA 2WB1N 2DA3A 2KLOA 2P5KA 4RLQA 1FBSA 1FMWA 4PJNA 5LGTA 2QQ9A 1T38A 5D4SA 1QHGA 3G6EI 2L3DA 5C4XJ 4P9UA 3OR2C 4E7JA 4S04A 5E79C 3EDPA 1MSEC 4N4NB 4XK4A 3S8QA 4YELA 3UKGA 1U9OA 3NAUA 3JREA 4MFDA 5FFXA 3L09A 3JXCL 4WCGA 3H9JA 4FT8A 1JUSA 3OYIA 3IKVA 5HNHA 1T6SA 3GZCA 2BV6A 3ZQIA 4ER3A 1WCMJ 2DBBA 1QVUA 5LHIA 2WY8Q 4OU0A 2VQLA 2OF7A 2WV0A 4GRIA 4M6YA 2WB1A 5DEQA 1A35A 2K5CA 4L5JA 1J9IA 1FY7A 2DW4A 2ZC2A 1K4TA 5BQTA 2JA8J 3B7HA 3ZCOA 3KFWX 3M4OJ 1IRFA 4PU7A 1HA8A 5DS9A 2AS5F 1R58A 4BEHA 1RZRD 4JCYA 2M30A 3HL2A 4L9NA 1HQ1A 2Q2EB 1S7OA 2WBMA 2KPMA 3H3UA 3LA7A 1IXRC 4O3MA 2HZDA 3RYPA 2VOOA 3EUAA 2AW6A 3OQMA 3PNYA 5EJCA 2JPBA 3F8FA 3HG9A 2MC4A 2ZMEA 2CQXA 3BR6A 2FA5A 2QGUA 4GYIA 3BTCA 1G59A 4QIWN 3S17J 2W57A 1NW3A 1DP7P 5FLVA 2DYSH 3GEZA 1BA5A 3Q0WA 2LVSA 1QU3A 3OYBA 1JWLA 2HOAA 1GHCA 1RIOA 3MQ0A 2R0QC 4AC0A 2K4JA 4ZDPA 2VL8A 3IUOA 1UCRA 1K78A 3DBRB 2H6CA 2MD0A 1G6NA 2RV8A 4M9ZA 3GUDA 4IQJA 5IY5H 2PXLA 1JKOC 2EPFA 4HF1A 1QVTA 5ED4A 3DPTA 3Q0UA 1MH4A 2F6CA 3HPGA 2OQGA 4YARA 2W85A 2ZBKA 4X1EA 2V79A 2Y0SN 4TV7A 2CSOA 2BHYA 2VKVA 3HZIB 1IF1A 4ZZDA 2D1HA 3WTVC 1BC8C 3A03A 3R0JA 2ID3A 2KIUA 3ABKH 2XROA 4EQZA 1QZYA 1I3AA 3HM5A 5DTDA 4GHJA 2PFBA 3U1DA 3SEZA 5KAIC 1K79A 1RIOH 2R5YB 3FMSA 1Z77A 3W6JB 4B48A 1IXSB 3D5LA 5HODA 3G71I 3A2KA 2A6CA 2LSOA 3WTUC 5J8FA 1Y7YA 1ZAOA 3LA3A 1GXQA 1HCRA 4MQ9F 4D5CA 1ZQ3P 1VQLI 2ACJA 3ZR8X 1OLTA 4RM2A 1VQ7I 5DRTA 5DD8A 1MDMB 1MJ9A 3JCUC 1LFBA 1R6RA 5GAGJ 2DFHA 3OL4A 3QP6A 2ICPA 1DP3A 1B1BA 3HSRA 3PQKA 4HF2A 3HOSA 2YU9J 2DDBA 4IOCF 3SJMA 1UB9A 1X4PA 1RI7A 2OTLI 3O6BB 2LY2A 4BH9A 3VDXA 3DPUA 2IA2A 1IGNA 4AVPA 4HNUA 2A6TA 3ERED 2JA7J 1OCRH 3DTKA 1B4AA 2UZKA 3HPHA 2K9MA 3M8EA 4RA2A 5K7ZA 3WGIA 1FBQA 4PJ0C 5FKKA 1WRJA 2DAOA 2XGCA 4A3LJ 2FEZA 1W5TA 1O3SA 1ZZ7A 5E20A 1R69A 3BG3A 3I54A 5DDGA 2NVQJ 4F8DA 4XSZF 3N05A 4FBIA 1Z0XA 2Z1DA 3HGGA 2QSGX 1S7EA 4AD9A 1YITI 3PO2J 3F6OA 2HCNA 4LLLA 1PJRA 2WA0A 2A6HF 2DFIA 2L7FP 1ETQA 4BUPA 3J7ZI 3GCMA 2NRAC 1O3QA 1MBEA 1FT9A 1P7JA 2KEIA 3BZKA 1MNEA 2LD5A 4LG0B 4H4KC 4HEA2 2P6SA 3LQQA 2W7NA 2V1NA 2VKHA 3QQ6A 1UFMA 3S8PA 3E6BA 1RUOA 1I1GA 4OIOF 2P0WA 3LMMA 2EH3A 3P9IA 4AYBN 1Z9CA 4NNJA 1K6YA 2D45A 3C2BA 3B6CA 1LPQA 4PFPA 1ENHA 3L2RA 3V4GA 3H92A 3K6GA 2QQ8A 2VQGA 4I02A 2VC0A 4IRGA 4G6DA 3LSGA 1MNDA 1OCOH 2XASA 2QKLB 3N97A 2E7WA 5LEKA 3OYLA 1PNRA 2DODA 4LIUA 4ZC3A 3I4NJ 2HDWA 3RDIA 3WTTC 2M4HA 4UV8A 3WHCA 2F5DA 4G6QA 1ULYA 2DPUA 2E1MB 2BJCA 2PUFA 4NC8A 4ZZLA 3SZGA 5F0FA 4MCTA 4ZYDA 4ANJA 2J5OA 3CUQB 5M5WJ 2K3FA 3DXJF 4AYBA 4IHVA 2H94A 3MCZA 1UZCA 2M8GX 4HX7A 2LDUA 1P7IA 5K7HA 4GYGA 2ZXHA 2ME6A 4RB2C 1JJ6C 1ZRFA 3S15J 2M4KA 2P5LC 2PUBA 1TBXA 4FX4A 2EIKH 3SZTA 4JX6A 1DPUA 2FBHA 3CCMI 3WG9A 1YSEA 1Y1WJ 4L0YB 2IS1A 5LBQA 2ZCWA 1XDUA 1O7LA 1P6RA 3HIFA 1BR1A 2VASA 2M7BA 5CVUA 3SEQA 3IP4B 1Z6RA 2JSCA 3BJAA 3MAJA 4I01A 5LLQA 3JRBA 4YBAA 2IRFG 1MBGA 4PUSA 3ZQQA 1XSXA 3LA2A 2XHKA 2CWEA 3D5SC 3FXLA 4UVCA 4CYCB 1LLIA 3BWGA 3A9XA 2ZJRF 3ECOA 3C3WA 2ME0A 2M5WA 2KQRA 2JRMA 2BGCA 1R22A 3BS3A 4BACA 4HV6A 1PUFB 3OQNA 1R63A 4UUVA 4F7ZA 4I6TA 4E7HA 1IRGA 3UR3C 2HQAA 3O9XA 2X1EA 3V7CA 2CV1A 3GLXA 1FJLA 1X2LA 2DN0A 2G0EA 2NVXJ 2O8KA 3H5AA 3L7WA 1BC7C 1H9GA 2EIMH 4EJWA 4KN4X 2BXZA 3BG6A 2GAUA 1E0EA 4NUBA 4DBRA 3QOEA 1EA3A 1LCCA 1BOAA 2DA2A 5DUIA 3GBGA 2AQEA 3RKYA 4HV5A 2K3PA 2GLOA 1SEUA 4EJVA 3TRBA 3ZOBA 3ZRGA 2HVSA 1S7AA 1T8IA 2HYJA 3GTLJ 1UMQA 2NYXA 2V3CC 2NAZA 5LHHA 4U0YA 2XVCA 1LKXA 1FSHA 2HQRA 3BD1A 2QVOA 3DNVB 4LD5A 4AIHA 1FSEA 2LC2A 3K70C 1QBJA 1NEQA 3HYIA 2EZLA 3H5NA 4JQFA 4PSXA 3NDBB 2XGXA 2HVRA 2XKPA 3QQAA 3KZZA 2AXTC 4MQVA 5GTHC 4IEJA 4BE2A 3T8RA 4QTRA 3RPUA 1YS6A 3T8TA 1CF7A 1YI2I 2ISZA 4IRIA 1NG7A 3ABLH 5M5XJ 1QHHD 2EFQA 4Q2JA 2KDZA 4K2EA 1IV8A 2IVMA 1OQYA 3G1OA 2X9DA 1JGSA 1MSFC 1JHHA 4N9IA 3QYFA 4F93B 1F4KA 2DO7A 2XPWA 3P9KA 1ZZ6A 1R23A 5EYRA 4YFKF 3U3WA 3WGGA 2BZTA 3JTHA 5EEAA 4JQDA 5A7LA 3ZQCA 1O57A 2VPLA 1XDSA 1G3WA 2V9VA 2P81A 3O2PE 4Y4RA 4FE4A 5KNLA 2HTSA 5EZHA 4A0XA 3BP8A 3OOPA 4XLFA 4Z6YA 4XRSA 1HSJA 1UHMA 4M3GA 1HC8A 1HSTA 4X4BA 1VQKI 5FLMJ 3L2QA 2LF8A 4UVBA 4B3AA 1U6GA 4CGZA 5K1YA 5ICEA 2VB6A 3RKXA 5EGOB 3CJRB 4KIFA 4RAZA 2LH9A 1R7JA 2TCTA 4E4HA 1QGPA 4X4IA 2EFWA 4MO7A 3KIOA 2VI6A 4IXAA 4KMUX 3GFMA 1MKMA 3OKZA 4E7LA 1ETXA 5J40A 3F23A 2CYYA 2B63J 2VE8A 2MBFA 5AIPA 2NOJB 3H36A 4UB6C 2OAZA 5D6EA 4A3KJ 5HNFA 1AOYA 1ZARA 4UVAA 1J2XA 3HOUJ 2Z99A 3CJNA 1L1MA 1E3OC 3ZQFA 1PRUA 2BY1A 2QSFX 5L3CA 2KL4A 4V2FA 1HBXG 1UAAA 1W7PA 3BQZA 1YIJI 3RZOJ 3CP8A 3M3YJ 1CJGA 2BVLA 3W6KB 2J5PA 4II2A 3OOUA 1TLHB 4HLXA 1LNWA 1WJCA 3JR9A 3B73A 3TBIA 2CQQA 2IA0A 2AXUA 5CJ9A 3F8NA 4PCQA 1GDTA 2HR3A 2MGQA 3SFIA 4LMYA 1MMNA 1ZZ8A 4II3A 2PJRB 2WY7Q 4ITVA 3RZDJ 1SVMA 5IT3A 2QCOA 2QEXI 3MD2A 2HQNA 2PQ8A 4U87A 5D5VB 2L4MA 2PLYA 5FRNA 1BBYA 2CMPA 1Y0UA 3H35A 3REOA 3SYTA 3SZPA 1ZGWA 1TQIA 2AHQA 3FK6A 2J7WA 2PXKA 2ISYA 4CCJA 1KA8A 4MCXA 2OJED 1ZR4A 1B72B 1VZ0A 1R5ID 1QZXA 3EYIA 4UUTA 3JRIA 2FOKA 1WH5A 3KP7A 2BY2A 1WJDA 3Q9SA 2TDXA 4NQWA 4O8BA 3HOTA 3CO7C 3K4LA 5D5WB 1BDIA 1VFCA 2I10A 2CS3A 2P8TA 2HPMA 2RDPA 1K4SA 5IYDJ 2V6CA 1J5YA 3O3KA 2E7XA 4RGRA 5DYMA 4A0ZA 1TTYA 3CF2A 1QB2A 2ZMEC 4BNCA 3GFLA 2PXQA 1Z7LA 4HBLA 4ZJZA 3IAM2 3PXPA 2V26A 4XLPF 5CQGA 4EKIA 2L54A 2XV4S 3PFIA 2LP0A 2IT0A 4PU3C 3OYAA 1X19A 2XAGA 4H0EA 4HLYA 4N4OB 4WX9A 3A0BC 3CF5F 4X4DA 3W2AA 2YR2A 5HLIA 3KP5A 3QPSA 4E7SA 4FE7A 2XXAA 4LLNA 3W6VA 3CD6I 1SQ8A 5E3MA 3SX0A 2A05A 2G7UA 1U5TC 2H8RA 4ZTFA 1ETKA 4P55A 4D7NA 4RGUA 1N75A 3DP7A 1VQPI 3G4SI 2CJJA 3OIQA 3E6CC 1DUXC 1O7FA 1JXSA 3J80K 2WADA 1FYKA 4JP0A 1UTXA 3CECA 2AXVA 2L49A 3ZXSA 5EGOA 1KQ0A 2QYOA 3OMTA 3K2AA 4Q48A 1WH7A 2LNBA 2A69F 1ZZBA 1JTXA 3NRVA 5F64A 3S3MA 3VSLA 5CVRA 2PN6A 2XSDC 2EBYA 1D1BA 2HSGA 2R7QA 1CGPA 1P92A 4P1WA 2E1CA 3VEPA 2CQNA 2JWTA 4PJJA 2QF7A 3M1EA 1WPKA 2CQ7A 2EWTA 3VFZA 3GYHX 4J19A 2R63A 2OZUA 1MGTA 1Y8RB 5DSXA 5KAFC 2XIUA 1B8IA 3ZHMA 2UUZA 5F0HA 3HHHA 1HKQA 1BW5A 2V9KA 2A07F 2XXQA 2CW0F 3O8GA 3PUFA 2JVHA 4DW6A 2VXZA 4I0BA 4XKVA 2KRHA 2GXAA 3JSPA 1KQ9A 4E70A 1TT0A 2H1KA 4S05A 4C2UA 1R71A 3CMAI 1RRJA 1TWFJ 1YE9A 2KEJA 1HOMA 1XMXA 4Y3OA 4XSXF 2M87A 1XCVA 4IHTA 1YOVB 5CVJA 1EH7A 2X0LA 4FN3A 1W1WE 1JKRC 2VEOA 3PFYA 5GPCA 3Q0VA 1JKQC 2DK5A 4HNTA 2R7OA 3JRFA 4EQQA 2PJRA 3RTRA 1ZKGA 4CHUA 2K27A 2R7RA 1QP7A 3A9ZA 1W4MA 4BKXA 1HW2A 1YW8A 2WWYA 5JFRA 3OS1A 2CV0A 2IEKA 3ZMDA 1TW2A 4M6VA 3GTKJ 2CRGA 3AG4H 1FYLA 2W48A 4R8HA 3OYHA 1ZRCA 4CO8A 2E36A 5J1YA 1G3YA 3CJQB 2ICTA 3HXLA 1ONVA 3LSHA 1Q1HA 3TGNA 3LSIA 4DJAA 3GTGJ 1ZPQA 5L3DA 3CROL 3M1CA 4HRIA 2F5FA 3CUOA 4KT5C 5CPRB 3CCRI 2OFYA 2DJIA 3DEWA 4A5MA 4EJTA 4DYQA 2V9PA 3MFKA 3VODA 5CKTA 2X1DA 3U9GA 2FBIA 3TO7A 2Z33A 1ZK8A 3ECHA 3WG7H 4E7IA 1KONA 3HRSA 3V8LA 2OQRA 3BG9A 2Y75A 4X4HA 2CO5A 4YRVA 1IN6A 1D0ZA 2VUMJ 2EA2A 2G7HA 5DUKA 1ZR2A 2VBYA 1V5FA 1WJEA 1UXDA 3LL7A 3LAJA 3BTIA 2N8GA 3OS0A 3E1SA 2ZNZA 3G5GA 3SCFA 1BIBA 2VN2A 2AO9A 1SFUA 2Q0OA 3H9GA 2VXDA 1XG1A 3FBIB 4E7KA 1ZELA 3DKXA 1O4XA 3CLOA 2E2HJ 2OC6A 2LF7A 3MEJA 3G1LA 4MEYF 1ERDA 4C2MJ 3E6DA 3TKYA 3OIPA 5BPIA 2XF7A 1YIOA 4EATA 1IDYA 3G7DA 2X6XA 1MIJA 2L9RA 4B4CA 2E34A 5JLXA 4EGZA 2M9HA 1S3JA 1W5SA 3KP2A 4EGYA 1OYYA 5HS8A 3E3VA 2E60A 1EKEA 4A6DA 3NXHA 3ZMUA 3L9FA 4XRMA 3NARA 4MGRA 3GZNB 2E5ZA 3B02A 1ZUGA 4YG4A 2ESNA 1G3TA 5LEJA 3K4CA 4CZCA 4B09A 2DMNA 4I8TA 1QZZA 5CVIA 1MNMC 1T98A 1I39A 4OIRF 4HQMA 1TL8A 3IC7A 1O3RA 1J7KA 2C6YA 1JHFA 2M7AA 4O5VA 1FWZA 2IGOA 2Y30A 3WE2A 1VTNC 4A3EJ 4DE8A 3H0DA 1N78A 3COAC 2B7EA 2EJRA 3EUKL 1F43A 1ZZCA 3ESWB 4JX5A 4XLAA 4CSWA 1IO2A 3CQZJ 4XQFA 3UWPA 2HINA 4R1HA 3JAMK 2GIVA 4N0BA 4A3JJ 3ASNH 3GN5B 3S1QJ 2J7UA 2NXNB 3HSFA 4C3JJ 3QF3A 3SXYA 1BI2A 2XAHA 3K4NA 3M7GA 2AXZA 3C18A 4A0YA 5L3FA 4MNUA 1EH6A 1PVEA 4M6XA 3E6MA 3OR1C 4YIIA 1DU0A 1G4DA 1U2ZA 4XM3A 1V5GA 5M5YJ 2VKEA 1W0UA 4UUSA 1H9TA 5GAHJ 1V5EA 1YYVA 3BZ6A 2JUCA 3LSTA 1KU3A 1YRNB 4ER6A 5E8GA 2W82A 1RKTA 1Z21A 5HS9A 3K4KA 3AG1H 1UG0A 1NK3P 1F36A 2XRNA 4IKFA 1W36D 5ERIA 2O5RA 2FD5A 1R9TJ 3TW6A 2CUZA 1MBHA 4L18B 4F92B 2KMUA 1U5TA 2L2OA 2LYJA 2JSPA 3BLYA 5DM7F 4HX8A 1A36A 3KYLA 1BJZA 3A02A 3GZ6A 1D1AA 2V1XA 4I6UA 5FO5A 2RQPA 3I59B 2LMDA 2EILH 3OYGA 1A6QA 5DCMB 5E8IA 1JT6A 2COMA 4EVIA 2CFXA 2HOTA 2XAUA 5DRYA 2VPRA 3FMQA 4IPAA 2B9SA 2OCCH 3ASOH 1UG2A 2HTJA 4RAFA 2LBFB 2F4IA 3LSRA 1H8AC 3LSMA 2HFZA 1ZGAA 1P4XA 3BJ6A 1Y8QB 4L5EA 3CCUI 1W5CC 5M3MJ 1OCCH 1QO0D 1RC9A 2BXYA 1B9MA 2DOAA 1S72I 3I56I 5GAGi 2XPVA 2JMWA 2HCSA 4M72A 3VYTB 1MD0A 2OA4A 4V2GA 2WAQN 3KZYA 1NG6A 4E7ZA 2E1MC 4L9VA 1OR7C 1X3WB 2X6OA 4IF4A 4EEFG 1TNSA 2BY0A 2IGNA 3RQIA 4XORA 1XSVA 2JK3A 5DTMA 1MMDA 3CUQC 4HG2A 3ZQGA 3WTYC 4BQAA 2Y31A 4JX4A 2XXPA 1P4WA 2XGEA 5FKMA 1Y9QA 3BCAA 5EDNA 2JA6J 2VODA 4Q4ZF 1SD5A 2BW3B 4RLFA 4MEXF 2L9NA 3JRCA 3TFLA 2LLKA 5FKNA 4XN0A 4PGHA 4MTEA 2Y0MA 1HLVA 2O0YA 3TOBA 2PXBA 1WZ2A 1EJ9A 3CP2A 3HDDA 1LVKA 1OMIA 2WAQA 3BT9A 3OYJA 1VQ5I 2LRDA 3L00A 1X2MA 3C2GA 2O03A 2CSFA 1R4NB 1X1AA 1A6IA 2B5AA 2PMZA 2E71A 2L4AA 5JR3A 2HEOA 4B47A 2H27A 4A3CJ 2W00A 4V19K 1Z6TA 1X4OA 2OZ6A 1YW7A 3IH3A 1EFAA 3FXMA 2X48A 2DOEA 3DLAA 3S1RJ 2BNMA 4L9JA 5F04A 5B66C 3CC7I 1D5VA 2EV0A 3LFUA 2GZWA 3FHZA 1N77A 2Q2EA 2IVQA 2HVQA 4FQGA 4KNYA 3TEDA 1ZH5A 1Y56A 3AFHA 3K9TA 2XB5A 1XS9A 3SCGA 1FOKA 3K1NA 4LLGF 5IOZA 3VYSB 3VYRB 4HNVA 3M9AA 2R1JL 5ICCA 3SQNA 1YRNA 2HI3A 3I58A 3ME5A 1ZAYA 4B3XA 1AHDP 1IUFA 3RCOA 4UY8I 3KEQA 3MLFA 3E0JB 2MLGA 1KQ8A 2EV5A 4IA8A 2IJLA 4CH7A 5EZGA 4ENKA 4OBMA 1SFKA 2NNYA 2QM3A 1NHAA 2EZIA 2FE3A 3A01B 3K1MA 5DTQA 4KIBA 3CC2I 2GXGA 2VT3A 4M9SA 2VONA 3F8BA 4C9YA 1XGSA 5J1RA 4ZYHA 2HDCA 4RB1A 4PSWA 3QWLA 4CUGA 1R5HA 2R5YA 3PE5A 2NS8A 4A69C 5L3EA 1SMYF 1VQ4I 3MZYA 3HHGA 1FPQA 2PEXA 3R60A 2R5ZB 1HDDC 2ELJA 3G0TA 2OPTA 2PBIA 3ABUA 4AUXA 2H8WA 4UNOA 5LGNA 2ADUA 1BN5A 1SANA 1Z3YA 3BOQA 3W2VA 4Q5SF 1MJAA 3T0YA 3OYKA 2IS4A 1XMKA 2DFEA 3QU6A 2AQFA 1MDMA 2A61A 3FX3A 1ZREA 1ZZ9A 1ZGJA 2LKXA 3LSJA 3JRAA 3CCLI 3S1NJ 1IC8A 2ELKA 2VJ4A 2BVMA 1WKMA 4XR6A 4BJ5C 3BROA 3DV8A 4G9YA 3OMYA 1QRYA 2KJBA 4KFCA 3Q5FA 4DZPA 4RS8A 3ZMSA 3MKLA 3QOXA 1QA6A 2BW3A 2WC2A 2WAFA 2DA6A 5JHUA 4EV0A 2E1OA 4ER0A 3RQ4A 4X4CA 3KP6A 1IN4A 4X6AJ 2OCEA 1MZBA 4IO9F 2DXIA 2MLKA 3DQVC 4D1QA 2QBYB 4KITB 3K4MA 1RR7A 4LB6B 1PP7U 2Y9ZA 5FLXK 4F55A 2EINH 3FMRA 4M3BA 3G3ZA 2ECCA 2H6BA 3IKTA 3ELKA 1MJBA 3I4PA 4X4FA 2PE5A 3V42A 3MZHA 4LG0A 1LFPA 3OWTA 4HSRA 2D5VA 1M1EB 1WI9A 1W7PD 1DU6A 4M71A 2DOFA 2CUFA 4I76A 2FU4A 3DLLF 3G2BA 5IP9J 1LFUP 2IGKA 3JSOA 2XF5A 1T39A 2MA3A 4WXHA 2GZUA 3F6WA 2EZKA 4I99C 3GXOA 5EG0B 5EEHA 2KT0A 5FFZA 3K4JA 2ZFWA 3BR1A 5CVVA 2R7SA 4B8XA 3E5XA 5C4JJ 2DMPA 3OIOA 2DTZA 1RKWA 3KCCA 5J4VA 1USSA 1VQ9I 3QOWA 4AWXB 1R00A 3FISA 2RAEA 3K0LA 2F4OB 1F5TA 3HKZA 1O3TA 3QODA 3ZMVA 4ZYAA 4I7HA 2DA4A 3GMEA 4HX4A 4Y13A 2XPUA 3P5JA 2Y69H 1AU7A 2W25A 4G7ZF 5IT9K 3ZMTA 1OR7A 4Z2YA 3DKYA 3JXBC 3EETA 3ZPLA 3S3NA 2VIXA 2HWVA 3OY9A 2DQRA 5B1BH 2DMUA 2HU9A 3CUQA 2E5NA 3F0CA 2HDDA 1H89C 4M3FA 1X1BA 1I27A 3H3ZA 3BR2A 3ZN0A 4AIKA 2L0KA 4YG7B 2PXTA 1WQ2A 3A4CA 4A3IJ 1MMAA 3A01A 3ZKCA 4XLEA 3CTAA 2HYGD 2PI0A 3OQOA 2KPJA 3FYAA 2LY9A 3QRFF 2PUEA 4LK0F 3PL8A 1U0JA 2F2EA 2CW7A 1JT0A 5FGMA 2VOPA 3KZ3A 3I3LA 2KDOA 1PP8F 4UHTA 4MLOA 2FX0A 4LIVA 1B0NA 1X1PA 2YSRA 3ZQLA 1JTYA 3PSIA 2R5ZA 4CYCA 2O38A 3PQJA 3QU3A 3MKZA 2XCJA 3GF2A 5CLSA 2GA1A 4I98B 4KMFA 4HSTA 2D1VA 2FXAA 3MZ8A 2O61A 3HJEA 5H6RA 2GRMA 5J6XA 3K10A 4KISA 1SD4A 1PUFA 1Z3XA 3CZ6A 1KU2A 1T56A 4BQNA 4AIJA 1SAXA 3FXKA 4ABZA 3NWSA 1KYZA 3QFIA 3QOPA 1ORKA 2FFHA 5HDKA 4AM3A 3HRUA 3BG5A 4JCXA 4BXUA 3MWMA 3CLCA 3ZHIA 5IYCJ 3OSFA 5F6FA 1DGRM 3F3XA 3QPHA 3CCJI 1MBFA 4Y52J 4P5OA 2K40A 4B43A 5FJ8J 3FDYA 4HDUA 2FQ3A 5AIQA 1HQCA 3MEXA 5DD4A 4Z5CA 4NBQA 3TQNA 3QWGA 1WJFA 2QWWA 1OJLA 1DDNA 1FBUA 5BS6A 1N25A 3OSGA 2W24A 2ZXJA 5TJJA 1VF9A 2BE5F 2ID6A 2MD5A 2LLVA 5H2FC 1ZG5A 4BY1J 1X3UA 2L7MP 4EJUA 5LD2C 1MH3A 2NS0A 1BI3A 1SD6A 4CCOA 2WIUB 2LK2A 3K2ZA 2LYQA 3J81K 3HZJA 3HUGB 3FXUA 1IW7F 1ON1A 4GGGA 4YIRX 3I64A 2IGMA 3EUHA 3TEPA 4HYEA 2DT6A 4LGWA 4YEJA 3K1PA 4BJ6C 1MBKA 2R7VA 1P2FA 1XC5A 4G7HF 3Q9VA 2LCVA 1WETA 4D5FA 4ESBA 2VBWA 3X2QH 2PUAA 1UXCA 2DYRH 4HAMA 1ON2A 3SR4A 4CCMA 2EA4A 1GVDA 2OD5A 3ERMA 4DNCA 5DV5A 4PJLA 2WAEA 2YUSA 3S1MJ 1BM9A 1PUEE 1OKRA 1MFQC 1TQPA 3H1CA 4J1WA 3ULQB 4OOIA 2CV2A 4MIMA 2RGVA 5CYVA 1R36A 3EUSA 1G2HA 2V6EA 4CCLA 4XRFA 4NC7A 5HLTA 1FMVA 2IPQX 1BI0A 3HRMA 2VQHA 3BDNA 1TT5B 2D2WA 2LYCA 2YX4A 1YG2A 2LKSA 4XOPA 3F51A 3IRQA 3LWFA 1ZS4A 2FBKA 4PDKA 3C7JA 3L1PA 2QUFA 4WF2A 3FWEA 5ICFA 1YFHA 2FF4A 2KRFA 3ZN1A 2CGPA 2GWRA 3BR5A 4EMSA 1FIAA 5F1JA 4ZYEA 1WH8A 2L9SA 2L7ZA 3FK7A 2X6YA 3IWFA 3M07A 1WIZA 4X4EA 2BNNA 1SVOA 5K5OA 1WJBA 4GDFA 2XJ3A 3GTOJ 2HOEA 5HDGA 1FLIA 1PRVA 2M2EA 1LMB3 2PMHA 2R7DA 3CCYA 4OAYA 4XLNF 4A2UA 5IOYA 3TELA 3GW2A 3JRHA 4RAYA 5KHDA 2GOMA 3J7YJ 4J1XA 1KYWA 1XN7A 4CA0A 3F8MA 4Y42A 1QPIA 4E6KG 4QPQA 2L01A 4ENJA 5FD5A 5E3LA 2KISA 2EWNA 4BHCA 1GUUA 2ODRD 2R7FA 3FXOA 3K69A 4ON0A 1P4AA 4BQOA 4XKCA 3U21A 1POUA 2KFDA 1R1UA 1UHSA 2HPIA 3BTJA 4PJMA 1JGGA 4XN3A 1LDKB 3A9YA 2W1OA 3F8CA 1B6AA 1J0RA 3CCSI 2FMLA 1SVLA 3W2WA 3RSNA 5LRRA 1C0WA 4M3DA 3FM5A 3PSFA 3QYXA 1FP2A 4OWRB 3KP4A 2FUG2 1EV7A 1ETWA 1T0FC 4BEHB 5A2QK 2ZXIA 2Q1ZB 4HOBA 4KDPA 1OCTC 1V4RA 4XBFA 1YHQI 3MVPA 3NWTA 1E17A 4Z5HA 2M0MA 1D1CA 2EBIA 3BCBA 2K02A 2G9WA 2EK5A 1D0YA 2KJCA 4RDUA 2R4GA 1VQMI 2R7TA 1GVJA 3BG7A 3MKYB 4FETA 2ESHA 3GFJA 3G73A 4HZFA 1B72A 3J7AY 1Y0NA 3FZVA 1BL0A 2BBYA 3AL0B 4BE1A 3WGHA 2CUJA 3JTGA 5FLXZ 3KZIC 2AUWA 3JXDL 2OV7A 3MN2A 4GQMA 1REPC 1K78B 3DKWA 3FMYA 1EH8A 1K7AA 1ACIA 5C44J 3VWSA 2ZJQF 3V7SA 2JQ7A 2DJNA 2BYVE 5KK1A 4A93J 2X1CA 1RZSA 1XMAA 2VBXA 1RNLA 3HEFA 5FB2A 1U8RA 4DYCA 2IVBA 2XRLA 4XL9A 4NDWA 3H9QA 2HS5A 5HVQC 2E19A 2HQ5A 3I5UA 2JT1A 2MSYA 1STZA 5K5RA 2XF6A 3OYMA 3KJXA 4XICA 1VQNI 5DT2A 3IHUA 2AXLA 2YX7A 4G94A 1FX7A 1JJ8C 1R4MB 1P9QC 2PXDA 1TQMA 3FHNA 4WWCA 1LJ9A 3AAFA 3LSKA 3VYUB 3BR3A 3NZLA 4IHXA 4CCNA 3WTZA 1PYVA 2R7XA 2TRTA 3OV8A 3TW7A 3TMOA 1LVAA 1HXDA 2A5YB 3ISPA 4Z59A 4IVNA 3CC4I 5IT9Z 2FMYA 2FNAA 1YW9A 4Y33A 2XGDA 4BYYA 2VJIA 2P7CB 4YIFA 1JE8A 4U7BA 3BR0A 2DA5A 2E2JJ 3R1FA 1PERL 4B1RA 2RN7A 4L5IA 4U0VA 3EPZA 5ILVA 2Z5UA 5F08A 1OISA 1LEBA 1Y6IA 1MMGA 1X57A 2CROA 2IUOA 5GPAA 4RBOA 4Y7NJ 1U78A 3T1BA 2KEKA 4EJOA 3N4MA 4X0GA 1L3LA 4FX0A 1UELB 1R49A 4AIDA 5JVGF 3R09A 1I6XA 2L02A 2OU2A 2X51A 1XGOA 3H3VK 4HRAA 3S2DJ 2PX9A 5HLHA 4A3BJ 4HA8A 2LYKA 2KRCA 4OMYA 5J4YA 1WH6A 1OFCX 2DMQA 1I5ZA 2K7LA 4G6TB 3FBNB 4HDVA 1AA7A 5HS7A 1OPCA 3UNGC 2RKHA 4RB0A 5HLGA 5FKOA 3V8KA 1T2KA 1SFOJ 3KP3A 2GQQA 4RGXA 2LNMA 1IUYA 2H1LA 1T33A 4WXDA 3KL4A 3IH4A 4DE9A 2Z9OA 1X1CA 3E7LA 1RZ4A 3D0SA 5GAHi 3WHBA 1RESA 3H0GJ 5LFAA 2LYPA 5GP9A 2FSWA 2VKDA 4MTDA 3Q3SA 3GTJJ 2XIGA 1ZVVA 4ER7A 3IAS2 2E35A 4A3MJ 3KETA 2KIMA 1SD7A 1KU9A 3WE3A 1G3SA 1L0OC 2CH0A 3HGYA 4LITA 1XGNA 3RIRA 6PAXA 5E17F 3E97A 5E1ZB 3ZMZA 1Z1DA 4XONA 1YTYA 5JHFA 1IRXA 2MG4A 3PO3J 5DTRA 3F9KA 5F0CA 3DTIA 2XAJA 2JA2A 3GLLA 3U1KA 1V54H 3OL3A 5H20A 1SFXA 4PGGA 5IYBJ 3OYEA 2JRTA 2ZNYA 1TC3C 4BY7J 4CZZA 2KIFA 3BPXA 3L2WA 3KLOA 4W1UA 1GV5A 3DBLB 2B0LA 1WFXA 3E5UA 4I6RA 4LFUA 4RM3A 3LNQA 3S93A 3HTSB 1U2WA 3TL4X 4KJZA 2CQKA 4KICA 1MBJA 1TNTA 3J81Z 1ZLJA 3FKJA 1ZYRF 1POGA 1APLC 2QLZA 2XC7A 2DMTA 1ZG1A 1JUMA 3IH2A 4JYKA 3RJPA 4BBSJ 2PXVA 4ZH4F 2IU7A 1Z05A 2IV1A 2K86A 2V4JC 1FP1D 4EM0B 2AWIA 5HOOA 1I50J 2JCGA 2IBDA 4CDGA 1IZ1A 1I3QJ 3WTXC 2DI3A 1A04A 3PJRA 4F91B 2PMZN 3GZDA 1D0XA 2FQ4A 3LFKA 5K7FA 3R0AA 9ANTA 4LOCA 3CCEI 2O3FA 1DW9A 4FASD 1A31A 1RPWA 2Y2ZA 1QQIA 2YBDA 1S9HA 2K9NA 3GWZA 3QAHA 3QYEA 4XKWA 4UB8C 1Z67A 4IVZA 3OYFA 4C2TA 1X58A 4IHYA 2P7VB 2IA1A 2Y0SA 4ENNA 4PZJA 4OMZA 1T0FA 3OP9A 3IRRA 2NVUB 3PM1A 4BDYA 1TWHJ 2ZJ2A 4U0WA 3CJTB 2ZB9A 3J80Z 2KZ8A 5B5EC 2MYSA 1RZRA 2HFHA 2COBA 2HXOA 2PG4A 1IAWA 4NHJA 5E1WA 3AG2H 5J8CA 1XWRA 2ECBA 4U88A 2NVTJ 2GRLA 2ZO4A 1JUPA 2MW8A 3ONQA 2K85A 1XCBA 3WTSC 2A3SA 5GADJ 1J59A 1JFSA 3P7NA 2RREA 4I2OA 1R1TA 3VK0A 2Z16A 1S29A 2RQQA 1JI8A 3CLQA 1W0TA 3ZGKA 5FD6A 3AG3H 2ZSHB 3DM5A 2STWA 5GAEJ 3CMEI 1YQAA 2BEOA 5KCMA 3S16J 4ZDOA 3HTUA 1KU7A 4IJAA 1CQTA 1LCDA 3GN5A 2KZGA 2O4AA 2RNJA 2ZJPF 4OIPF 1QZEA 1YLFA 3TP3A 4P9FA 1HF0A 3LISA 3SDGA 3HC7A 2CW8A 1QP0A 3J7AO 3ABMH 1S8NA 2I5UA 4DGWB 1CF7B 3UFDA 2DT7B 2KIQA 4FISA 2O49A 3DCFA 1WJAA 4EKGA 4BAYA 3QYBA 4ENMA 1BIAA 1A5JA 3MKWB 4BDZA 3I53A 3DPLC 5A2QZ 3CDHA 1IN7A 2WTEA 3H5RA 4BS9A 4BHPA 4Z5DA 1B9NA 3GX4X 4F52A 3S2HJ 1B59A 3DF8A 1ITYA 4IHSA 2QKMB 1ZRDA 4IHWA 1JH9A 3EUHC 3I59A 2IS6A 1ZLKA 2GOXB 4LJZF 3RPUD 2CFOA 5DCMA 4RB3C 3S14J 1I1SA 5JUWA 2QQBA 3HSEA 3U2RA 2LKPA 3TDZC 3DTEA 1LQCA 3RKWA 2XSJC 2JZYA 2LBFA 2BHZA 4ASNA 3BPVA 1FEXA 5AONA 3A1YA 5B1AH 3TDUC 3P9CA 1HDPA 2XI8A 1BI1A 3M8JA 4HPQA 2HGCA 5E1XA 4PK4A 2K4BA 5DCFA 2PMUA 4P96A 1FTZA 2MQKA 2F5EA 3PIPF 3KEOA 1SC7A 3BZCA 2W4SA 2ZKZA 1TWCJ 2DTRA 2L5QA 4NDLA 1RETA 3LSPA 1X1DA 1Q1VA 2HKXA 4BU2A 2E2IJ 5ILSA 3VWBA 2DPDA 3BQYA 4XRSG 3D1NI 5GTIC 3HOXJ 5FKLA 5TRDA 3HOVJ 2MEZA 3S3OA 2P4WA 1UHWA 3CO6C 5HDNA 1ETOA 3KPHA 2LYSA 1TWGJ 2DCEA 3H5TA 3FXJA 3I9V2 4WXCA 1BOBA 1TWAJ 2EFPA 1W7PB 4WK8F 1NH3A 5KVRA 3R4KA 2PUDA 4C3IJ 1YJWI 1AKHB 3TP0A 4UV9A 2KHMA 2L1PA 1WHUA 2P6TA 2HKOA 4BHBA 1YX3A 4ER5A 4RMNA 5FROA 4BL0B 3VOEA 3GBFA 3HKZN 4QWQA 5J47A 1DWKA 3F22A 3C2HA 3OYDA 4XNFA 2QENA 3GZ5A 1PDNC 1ETYA 4RAGA 1DGWY 1E3PA 4HF0A 2EB7A 4OIQF 3FIWA 3W3CA 4PU4C 4L0ZB 1WVRA 5D4RA 1D5YA 1IN8A 3FF5A 3GUUA 3LQRA 1ETVA 5E3NA 2LTPA 1T95A 1QQBA 4DIQA 3DU5A 4IL6C 4DQ2A 3EQLF 4QLCU 3SCHA 1G8XA 2EIJH 1RPEL 2HZTA 2V7FA 2O9LA 3DEEA 3HOZJ 5EF6A 2JQEA 3GO5A 3PIOF 2QZ8A 4M3EA 1IDZA 3IL2A 3HOWJ 4KIGA 4AU7A 1QPZA 4EM2A 3LQXA 3DU6A 5DM6F 4DOZA 4NQWB 2QQAA 4QSHA 3JRGA 4BBRJ 2VT2A 3I0TA 1HKSA 3RYRA 4DBQA 3TO9A 2UXNA 1BR4A 4A3FJ 3JAMZ 5TISC 3KE2A 1YO5C 2E1NA 3L2CA 1NK2P 3KYCB 4XMYA 4FTHA 3K4BA 5D8KB 1E3HA 3VPRA 4AVZA 1WSUA 1D8JA 3R61A 3BC8A 5K98B 2QSHX 3BDDA 4KYWA 2PIJA 4I6ZA 2VJJA 5EEGA 2F4MB 4MHGA 4UXNA 2FJRA 1YX5A 4O6JA 4J01A 2YS9A 1K83J 2JN6A 1MW7A 3TO6A 3F72A 4A12A 1Z91A 2R93J 2MH2A 2EV6A 1R1VA 1JFTA 3QPLA 3ZQHA 4D9JA 5FRMA 1E2XA 2GBYA 2NNNA 1GLNA 3EYYA 4BE0A 1FOWA 2CU7A 2LY1A 1FIPA 1ZN2A 2XAFA 4YFXF 2NVYJ 2GXBA 5BNGA 3ABTA 1K6OA 2F5CA 1LEAA 2P5VA 2DDAA 1YS7A 2LOOA 1AWCA 1DQUA 3PNVA 2Q8KA 4BJTA 3SHFA 1F9NA 4IWRA 3MMYB 2BOLA 2DFFA 3NEUA 3WODF 5M3FJ 1IXCA 2PUGA 4XLCA 2EZHA 1TZLA 2I8DA 3IWZA 1SFEA 2RNGA 2R7UA 1V3FA 2PJPA 3FXRA 1LDDA 4W97A 1BW6A
chains in the Genus database with same CATH topology
4JX6A 1QQAA 1PRAA 4M3DA 1NK3P 1F36A 1YSEA 3QYXA 1Y1WJ 1R9TJ 2FD5A 1ETWA 3TW6A 1MBHA 1FTTA 2LYJA 1B8IB 3JRBA 1OCTC 1U9NA 4X4EA 3MVPA 4YBAA 1BJZA 3A02A 3FKIJ 2LYLA 1MBGA 4Z5HA 4I6UA 4A3GJ 2EBIA 3RZZA 5J3LA 4RDUA 5C3EJ 3GTQJ 4X4GA 1JT6A 4C3HJ 2HOTA 1AKHA 4CYCB 2VPRA 1LLIA 5IPAA 1B72A 2DA1A 3G1MA 3LSRA 1UG2A 1BL0A 1H8AC 2ME0A 2AUWA 3JXDL 4L5EA 1IV6A 3MN2A 3RKQA 5M3MJ 3BS3A 4GQMA 4FCYA 1PUFB 2XPVA 2LYRA 2JMWA 3FMYA 3OQNA 4YG1A 1R63A 5C44J 4V2GA 4I6TA 2DJNA 2WAQN 4A93J 1LE8B 5IP7J 1RZSA 3O9XA 1NTCA 3HEFA 4EEFG 2X6OA 1FJLA 1X2LA 2DN0A 1X2NA 2G0EA 4DYCA 2IVBA 3RQIA 2XRLA 4NDWA 2JK3A 4S0HB 2NVXJ 2DA7A 2O8KA 3ZQGA 5EG0A 2E19A 2HQ5A 3K7AJ 1OSLA 2MSYA 3KJXA 2Y31A 4JX4A 4XICA 2XGEA 5FKMA 1Y9QA 2K9QA 1LCCA 5EDNA 1JJ8C 2JA6J 2PUCA 2DA2A 3GBGA 3BR3A 4IHXA 3JRCA 2LLKA 5FKNA 2GLOA 2TRTA 3TRBA 1EF4A 3ZOBA 3TW7A 2JA5J 2HYJA 1HLVA 3GTLJ 4Z59A 1NERA 1UMQA 2EF8A 1VI0A 2FJ1A 3HDDA 2XGDA 3BD1A 3BT9A 3DNVB 2M34A 3BR0A 2DA5A 1X2MA 5IP6A 2E2JJ 3R1FA 1PERL 4MFEA 1NEQA 2CSFA 2EZLA 4B1RA 2L8NA 1WI3A 4PU8A 4OB4A 3QQAA 1VPWA 5F08A 2IVGA 3FYMA 4IEJA 1A6IA 4QTRA 1Y1VJ 2B5AA 1X57A 3B6AA 2CROA 3KXAA 2IUOA 5GPAA 4RBOA 4Y7NJ 1U78A 2KEKA 4A3CJ 5M5XJ 2CUEA 2KDZA 3IH3A 1EFAA 3G1OA 3H3VK 2X48A 2X9DA 5J1UA 1MSFC 3S1RJ 3S2DJ 3I4MJ 4A3BJ 2BNMA 5F04A 2LYKA 2XPWA 2K9SA 1WH6A 1ZZ6A 5EYRA 4XIDA 1OFCX 2DMQA 1GT0C 2IVQA 3U3WA 4Z58A 5EEAA 4JQDA 2R92J 5A7LA 3ZQCA 4G12A 2Y9YA 2P81A 4FE4A 5EZHA 5FKOA 3TEDA 1SFOJ 3SCGA 1XS9A 2LR8A 2XB5A 4XRSA 1WGXA 4M3GA 5IOZA 1T33A 5E3OA 3CDLA 1BDHA 4HNVA 3IH4A 4X4BA 3HBLA 3E7LA 5FLMJ 2R7ZJ 2JJ7A 2R1JL 1YRNA 3WHBA 2HI3A 1RESA 3H0GJ 4B3AA 2LFBA 2LYPA 1ZAYA 1AHDP 1IUFA 5GP9A 4BXXJ 3MLFA 3Q3SA 5EGOB 3GTJJ 1ZVVA 4A3MJ 2TCTA 4IA8A 4X4IA 5EZGA 4MO7A 2VI6A 3HGYA 3CMYA 2EZIA 3A01B 1ETXA 2B63J 2MG4A 3PO3J 5F0CA 5J1RA 1GV2A 4A3KJ 4DYRA 2O7OA 1IG7A 3HOUJ 1JKPC 5IYBJ 3HB9A 1IRZA 1L1MA 2R5YA 1TC3C 2NS8A 4A69C 3ZQFA 1E3OC 2HXIA 1PRUA 4BY7J 4V2FA 1H88C 3RZOJ 3BQZA 3M3YJ 1CJGA 2R5ZB 1HDDC 4A3DJ 2OPTA 2EQRA 4W1UA 1GV5A 5JLWA 1U8BA 1IJWC 4AUXA 2HOSA 2XB0X 4I6RA 3LNQA 4UUSB 1SANA 3OOUA 4GFBA 1QP4A 1OCPA 3JR9A 1MBJA 2JVLA 1LE8A 1ZZ9A 2CQQA 2AXUA 2WUSR 2LKXA 1POGA 3LSJA 3JRAA 1APLC 1GDTA 3S1NJ 2DMTA 2MGQA 2ELKA 3SFIA 1JUMA 1IC8A 3IH2A 4JYKA 4BBSJ 1ZZ8A 2IU7A 2IV1A 2AWIA 5F27A 1QRYA 3RZDJ 3O8HA 1I50J 1VNDA 2BNOA 3BTLA 2JCGA 2IBDA 2QCOA 4DZPA 1I3QJ 3MKLA 3F52A 2GM4A 1I6HJ 4D7MA 2PPXA 2DA6A 3IVPA 2E1OA 1ZGWA 2AHQA 3FK6A 4X4CA 2PMZN 1K61A 2FQ4A 5K7FA 4X6AJ 4MCXA 9ANTA 2NOGA 4LOCA 1ZR4A 1B72B 1DW9A 1ADRA 1RPWA 2Y2ZA 2K9NA 1RR7A 3JRDA 3IV5A 2Y9ZA 4UUTA 3JRIA 4IVZA 1WH5A 3LFPA 4M3BA 4O8BA 2ECCA 1ZTRA 1X58A 4IHYA 2WV1A 2NS7A 4X4FA 1BDIA 2PE5A 1VFCA 3OP9A 2I10A 2D5VA 3PM1A 2M0CA 1TWHJ 1DU6A 3LOCA 2CUFA 2ZB9A 4I76A 5IYDJ 2KZ8A 5IP9J 1LFUP 1RZRA 2GZUA 2OR1L 2COBA 2HXOA 3GTMJ 3F6WA 2EZKA 3GTPJ 1XWRA 5EG0B 4DZJA 2KT0A 2ECBA 3BR1A 2NVTJ 2GRLA 3HOYJ 3PXPA 2IAIA 1JUPA 2DA3A 2WB1N 2MW8A 5C4JJ 2DMPA 3OIOA 2DTZA 1RKWA 2LP0A 4PU3C 1JFSA 3VK0A 3FISA 2RAEA 5C4XJ 4X4DA 3QPSA 1W0TA 4FE7A 1MSEC 3W6VA 4XK4A 1SQ8A 3S8QA 5E3MA 3UKGA 1U9OA 2DA4A 3NAUA 3JREA 4MFDA 2H8RA 3S16J 1ETKA 3JXCL 2XPUA 4D7NA 1AU7A 1CQTA 1LCDA 3GN5A 1JUSA 2CJJA 3JXBC 2O4AA 4JP0A 3ZQIA 2DMUA 1UTXA 1WCMJ 3F0CA 3CECA 2HDDA 3TP3A 1H89C 4M3FA 2AXVA 2L49A 1QVUA 5EGOA 1HF0A 3LISA 3BR2A 3OMTA 3K2AA 3SDGA 1QP0A 2L0KA 2OF7A 1WH7A 1ZZBA 4YG7B 1JTXA 3UFDA 2JA8J 3B7HA 4A3IJ 3A01A 2XSDC 2EBYA 2HSGA 3ZKCA 4FISA 3M4OJ 2O49A 3DCFA 3OQOA 4PU7A 2KPJA 2JWTA 3FYAA 2LY9A 2QF7A 5DS9A 1WPKA 1A5JA 2EWTA 2PUEA 1RZRD 4JCYA 2R63A 4J19A 1JT0A 3KZ3A 2XIUA 1B8IA 3ZHMA 4Z5DA 5F0HA 4MLOA 2FX0A 1B0NA 3S2HJ 1BW5A 2AW6A 3OQMA 1ITYA 3ZQLA 1JH9A 4IHWA 3O8GA 4DW6A 1JTYA 2CQXA 3BR6A 2R5ZA 3S14J 3BTCA 2H1KA 4QIWN 3S17J 4CYCA 2O38A 5FLVA 1LQCA 1BA5A 3Q0WA 2LVSA 1TWFJ 2XCJA 1JWLA 2KEJA 1HOMA 2HOAA 1FEXA 1RIOA 2R0QC 2XI8A 1HDPA 4AC0A 4FN3A 2GRMA 1JKRC 1PUFA 5GPCA 3Q0VA 1JKQC 1T56A 3JRFA 1FTZA 2MQKA 1JKOC 1ZKGA 4ABZA 1TWCJ 1QVTA 3Q0UA 1MH4A 1ORKA 4NDLA 1RETA 4YARA 1QP7A 4X1EA 4BKXA 4JCXA 2Y0SN 3BG5A 3LSPA 2VKVA 1Q1VA 2E2IJ 3HZIB 3CLCA 3BQYA 4XRSG 3D1NI 3ZHIA 3A03A 3HOXJ 5IYCJ 5FKLA 2IEKA 2ID3A 3OSFA 3HOVJ 2MEZA 4M6VA 3GTKJ 2CRGA 3HM5A 5DTDA 4GHJA 1ETOA 1MBFA 2W48A 2K40A 4Y52J 5FJ8J 2LYSA 1TWGJ 3H5TA 5J1YA 2R5YB 2ICTA 1TWAJ 1Z77A 4Z5CA 5HODA 2A6CA 3QWGA 2PUDA 3GTGJ 4C3IJ 1OJLA 1Y7YA 1AKHB 3TP0A 1ZPQA 3CROL 3OSGA 1HCRA 4D5CA 1VF9A 1ZQ3P 2ID6A 4BY1J 2OFYA 2L7MP 3DEWA 1LFBA 3GBFA 1MH3A 4DYQA 3HKZN 2WIUB 1DWKA 2LK2A 2ICPA 2LYQA 1ZK8A 1ETYA 3BG9A 2YU9J 4X4HA 3SJMA 2VUMJ 3FIWA 4PU4C 1ZR2A 1IGNA 2JA7J 1D5YA 1MBKA 1XC5A 1UXDA 1ETVA 3BTIA 2N8GA 5E3NA 2LTPA 2LCVA 1QQBA 1WETA 3G5GA 5K7ZA 3SCFA 4D5FA 5FKKA 2AO9A 2XGCA 2PUAA 3SCHA 1XG1A 1UXCA 1RPEL 4A3LJ 2O9LA 1O4XA 2E2HJ 1ZZ7A 1GVDA 1R69A 3HOZJ 3BG3A 2YUSA 5EF6A 3G1LA 2NVQJ 3S1MJ 4F8DA 4C2MJ 1IDZA 4M3EA 4J1WA 1Z0XA 3HGGA 4FBIA 3HOWJ 1QPZA 1S7EA 4MIMA 3EUSA 3PO2J 1IDYA 1G2HA 4QSHA 3JRGA 3G7DA 2L7FP 1ETQA 2L9RA 4B4CA 5JLXA 4BBRJ 1MBEA 2M9HA 1P7JA 2KEIA 4A3FJ 2LD5A 3BDNA 3QQ6A 1NK2P 4FTHA 4XRMA 3NARA 3VPRA 3F51A 1ZUGA 2EH3A 4AYBN 1ZS4A 5K98B 4YG4A 2PIJA 3L1PA 4I6ZA 3C2BA 2DMNA 3B6CA 2FJRA 4I8TA 1ENHA 3BR5A 1MNMC 1FIAA 5F1JA 2YS9A 1WH8A 2L7ZA 1K83J 3FK7A 1WIZA 2JN6A 3LSGA 2BNNA 2R93J 2Y30A 1JFTA 2XJ3A 3QPLA 3ZQHA 3GTOJ 1PNRA 4A3EJ 2GBYA 1PRVA 3I4NJ 2M2EA 1LMB3 3CCYA 3WHCA 2CU7A 1F43A 1FIPA 1ZZCA 5IOYA 4JX5A 3JRHA 2NVYJ 5BNGA 4J1XA 3CQZJ 4Y42A 1QPIA 2HINA 3GN5B 4A3JJ 2BJCA 2PUFA 5E3LA 3S1QJ 1GUUA 4C3JJ 5F0FA 3QF3A 4MCTA 2AXZA 1POUA 5M5WJ 4IWRA 1DU0A 4IHVA 1UHSA 5M5YJ 2M8GX 2VKEA 3BTJA 1W0UA 4UUSA 1JGGA 1P7IA 5K7HA 2ME6A 5M3FJ 1JJ6C 3S15J 2PUGA 2EZHA 1YRNB 2PUBA 1RKTA 4W97A 1BW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX6 A;  1QQA A;  1PRA A;  4M3D A;  1NK3 P;  1F36 A;  1YSE A;  3QYX A;  1Y1W J;  1R9T J;  2FD5 A;  1ETW A;  3TW6 A;  1MBH A;  1FTT A;  2LYJ A;  1B8I B;  3JRB A;  1OCT C;  1U9N A;  4X4E A;  3MVP A;  4YBA A;  1BJZ A;  3A02 A;  3FKI J;  2LYL A;  1MBG A;  4Z5H A;  4I6U A;  4A3G J;  2EBI A;  3RZZ A;  5J3L A;  4RDU A;  5C3E J;  3GTQ J;  4X4G A;  1JT6 A;  4C3H J;  2HOT A;  1AKH A;  4CYC B;  2VPR A;  1LLI A;  5IPA A;  1B72 A;  2DA1 A;  3G1M A;  3LSR A;  1UG2 A;  1BL0 A;  1H8A C;  2ME0 A;  2AUW A;  3JXD L;  4L5E A;  1IV6 A;  3MN2 A;  3RKQ A;  5M3M J;  3BS3 A;  4GQM A;  4FCY A;  1PUF B;  2XPV A;  2LYR A;  2JMW A;  3FMY A;  3OQN A;  4YG1 A;  1R63 A;  5C44 J;  4V2G A;  4I6T A;  2DJN A;  2WAQ N;  4A93 J;  1LE8 B;  5IP7 J;  1RZS A;  3O9X A;  1NTC A;  3HEF A;  4EEF G;  2X6O A;  1FJL A;  1X2L A;  2DN0 A;  1X2N A;  2G0E A;  4DYC A;  2IVB A;  3RQI A;  2XRL A;  4NDW A;  2JK3 A;  4S0H B;  2NVX J;  2DA7 A;  2O8K A;  3ZQG A;  5EG0 A;  2E19 A;  2HQ5 A;  3K7A J;  1OSL A;  2MSY A;  3KJX A;  2Y31 A;  4JX4 A;  4XIC A;  2XGE A;  5FKM A;  1Y9Q A;  2K9Q A;  1LCC A;  5EDN A;  1JJ8 C;  2JA6 J;  2PUC A;  2DA2 A;  3GBG A;  3BR3 A;  4IHX A;  3JRC A;  2LLK A;  5FKN A;  2GLO A;  2TRT A;  3TRB A;  1EF4 A;  3ZOB A;  3TW7 A;  2JA5 J;  2HYJ A;  1HLV A;  3GTL J;  4Z59 A;  1NER A;  1UMQ A;  2EF8 A;  1VI0 A;  2FJ1 A;  3HDD A;  2XGD A;  3BD1 A;  3BT9 A;  3DNV B;  2M34 A;  3BR0 A;  2DA5 A;  1X2M A;  5IP6 A;  2E2J J;  3R1F A;  1PER L;  4MFE A;  1NEQ A;  2CSF A;  2EZL A;  4B1R A;  2L8N A;  1WI3 A;  4PU8 A;  4OB4 A;  3QQA A;  1VPW A;  5F08 A;  2IVG A;  3FYM A;  4IEJ A;  1A6I A;  4QTR A;  1Y1V J;  2B5A A;  1X57 A;  3B6A A;  2CRO A;  3KXA A;  2IUO A;  5GPA A;  4RBO A;  4Y7N J;  1U78 A;  2KEK A;  4A3C J;  5M5X J;  2CUE A;  2KDZ A;  3IH3 A;  1EFA A;  3G1O A;  3H3V K;  2X48 A;  2X9D A;  5J1U A;  1MSF C;  3S1R J;  3S2D J;  3I4M J;  4A3B J;  2BNM A;  5F04 A;  2LYK A;  2XPW A;  2K9S A;  1WH6 A;  1ZZ6 A;  5EYR A;  4XID A;  1OFC X;  2DMQ A;  1GT0 C;  2IVQ A;  3U3W A;  4Z58 A;  5EEA A;  4JQD A;  2R92 J;  5A7L A;  3ZQC A;  4G12 A;  2Y9Y A;  2P81 A;  4FE4 A;  5EZH A;  5FKO A;  3TED A;  1SFO J;  3SCG A;  1XS9 A;  2LR8 A;  2XB5 A;  4XRS A;  1WGX A;  4M3G A;  5IOZ A;  1T33 A;  5E3O A;  3CDL A;  1BDH A;  4HNV A;  3IH4 A;  4X4B A;  3HBL A;  3E7L A;  5FLM J;  2R7Z J;  2JJ7 A;  2R1J L;  1YRN A;  3WHB A;  2HI3 A;  1RES A;  3H0G J;  4B3A A;  2LFB A;  2LYP A;  1ZAY A;  1AHD P;  1IUF A;  5GP9 A;  4BXX J;  3MLF A;  3Q3S A;  5EGO B;  3GTJ J;  1ZVV A;  4A3M J;  2TCT A;  4IA8 A;  4X4I A;  5EZG A;  4MO7 A;  2VI6 A;  3HGY A;  3CMY A;  2EZI A;  3A01 B;  1ETX A;  2B63 J;  2MG4 A;  3PO3 J;  5F0C A;  5J1R A;  1GV2 A;  4A3K J;  4DYR A;  2O7O A;  1IG7 A;  3HOU J;  1JKP C;  5IYB J;  3HB9 A;  1IRZ A;  1L1M A;  2R5Y A;  1TC3 C;  2NS8 A;  4A69 C;  3ZQF A;  1E3O C;  2HXI A;  1PRU A;  4BY7 J;  4V2F A;  1H88 C;  3RZO J;  3BQZ A;  3M3Y J;  1CJG A;  2R5Z B;  1HDD C;  4A3D J;  2OPT A;  2EQR A;  4W1U A;  1GV5 A;  5JLW A;  1U8B A;  1IJW C;  4AUX A;  2HOS A;  2XB0 X;  4I6R A;  3LNQ A;  4UUS B;  1SAN A;  3OOU A;  4GFB A;  1QP4 A;  1OCP A;  3JR9 A;  1MBJ A;  2JVL A;  1LE8 A;  1ZZ9 A;  2CQQ A;  2AXU A;  2WUS R;  2LKX A;  1POG A;  3LSJ A;  3JRA A;  1APL C;  1GDT A;  3S1N J;  2DMT A;  2MGQ A;  2ELK A;  3SFI A;  1JUM A;  1IC8 A;  3IH2 A;  4JYK A;  4BBS J;  1ZZ8 A;  2IU7 A;  2IV1 A;  2AWI A;  5F27 A;  1QRY A;  3RZD J;  3O8H A;  1I50 J;  1VND A;  2BNO A;  3BTL A;  2JCG A;  2IBD A;  2QCO A;  4DZP A;  1I3Q J;  3MKL A;  3F52 A;  2GM4 A;  1I6H J;  4D7M A;  2PPX A;  2DA6 A;  3IVP A;  2E1O A;  1ZGW A;  2AHQ A;  3FK6 A;  4X4C A;  2PMZ N;  1K61 A;  2FQ4 A;  5K7F A;  4X6A J;  4MCX A;  9ANT A;  2NOG A;  4LOC A;  1ZR4 A;  1B72 B;  1DW9 A;  1ADR A;  1RPW A;  2Y2Z A;  2K9N A;  1RR7 A;  3JRD A;  3IV5 A;  2Y9Z A;  4UUT A;  3JRI A;  4IVZ A;  1WH5 A;  3LFP A;  4M3B A;  4O8B A;  2ECC A;  1ZTR A;  1X58 A;  4IHY A;  2WV1 A;  2NS7 A;  4X4F A;  1BDI A;  2PE5 A;  1VFC A;  3OP9 A;  2I10 A;  2D5V A;  3PM1 A;  2M0C A;  1TWH J;  1DU6 A;  3LOC A;  2CUF A;  2ZB9 A;  4I76 A;  5IYD J;  2KZ8 A;  5IP9 J;  1LFU P;  1RZR A;  2GZU A;  2OR1 L;  2COB A;  2HXO A;  3GTM J;  3F6W A;  2EZK A;  3GTP J;  1XWR A;  5EG0 B;  4DZJ A;  2KT0 A;  2ECB A;  3BR1 A;  2NVT J;  2GRL A;  3HOY J;  3PXP A;  2IAI A;  1JUP A;  2DA3 A;  2WB1 N;  2MW8 A;  5C4J J;  2DMP A;  3OIO A;  2DTZ A;  1RKW A;  2LP0 A;  4PU3 C;  1JFS A;  3VK0 A;  3FIS A;  2RAE A;  5C4X J;  4X4D A;  3QPS A;  1W0T A;  4FE7 A;  1MSE C;  3W6V A;  4XK4 A;  1SQ8 A;  3S8Q A;  5E3M A;  3UKG A;  1U9O A;  2DA4 A;  3NAU A;  3JRE A;  4MFD A;  2H8R A;  3S16 J;  1ETK A;  3JXC L;  2XPU A;  4D7N A;  1AU7 A;  1CQT A;  1LCD A;  3GN5 A;  1JUS A;  2CJJ A;  3JXB C;  2O4A A;  4JP0 A;  3ZQI A;  2DMU A;  1UTX A;  1WCM J;  3F0C A;  3CEC A;  2HDD A;  3TP3 A;  1H89 C;  4M3F A;  2AXV A;  2L49 A;  1QVU A;  5EGO A;  1HF0 A;  3LIS A;  3BR2 A;  3OMT A;  3K2A A;  3SDG A;  1QP0 A;  2L0K A;  2OF7 A;  1WH7 A;  1ZZB A;  4YG7 B;  1JTX A;  3UFD A;  2JA8 J;  3B7H A;  4A3I J;  3A01 A;  2XSD C;  2EBY A;  2HSG A;  3ZKC A;  4FIS A;  3M4O J;  2O49 A;  3DCF A;  3OQO A;  4PU7 A;  2KPJ A;  2JWT A;  3FYA A;  2LY9 A;  2QF7 A;  5DS9 A;  1WPK A;  1A5J A;  2EWT A;  2PUE A;  1RZR D;  4JCY A;  2R63 A;  4J19 A;  1JT0 A;  3KZ3 A;  2XIU A;  1B8I A;  3ZHM A;  4Z5D A;  5F0H A;  4MLO A;  2FX0 A;  1B0N A;  3S2H J;  1BW5 A;  2AW6 A;  3OQM A;  1ITY A;  3ZQL A;  1JH9 A;  4IHW A;  3O8G A;  4DW6 A;  1JTY A;  2CQX A;  3BR6 A;  2R5Z A;  3S14 J;  3BTC A;  2H1K A;  4QIW N;  3S17 J;  4CYC A;  2O38 A;  5FLV A;  1LQC A;  1BA5 A;  3Q0W A;  2LVS A;  1TWF J;  2XCJ A;  1JWL A;  2KEJ A;  1HOM A;  2HOA A;  1FEX A;  1RIO A;  2R0Q C;  2XI8 A;  1HDP A;  4AC0 A;  4FN3 A;  2GRM A;  1JKR C;  1PUF A;  5GPC A;  3Q0V A;  1JKQ C;  1T56 A;  3JRF A;  1FTZ A;  2MQK A;  1JKO C;  1ZKG A;  4ABZ A;  1TWC J;  1QVT A;  3Q0U A;  1MH4 A;  1ORK A;  4NDL A;  1RET A;  4YAR A;  1QP7 A;  4X1E A;  4BKX A;  4JCX A;  2Y0S N;  3BG5 A;  3LSP A;  2VKV A;  1Q1V A;  2E2I J;  3HZI B;  3CLC A;  3BQY A;  4XRS G;  3D1N I;  3ZHI A;  3A03 A;  3HOX J;  5IYC J;  5FKL A;  2IEK A;  2ID3 A;  3OSF A;  3HOV J;  2MEZ A;  4M6V A;  3GTK J;  2CRG A;  3HM5 A;  5DTD A;  4GHJ A;  1ETO A;  1MBF A;  2W48 A;  2K40 A;  4Y52 J;  5FJ8 J;  2LYS A;  1TWG J;  3H5T A;  5J1Y A;  2R5Y B;  2ICT A;  1TWA J;  1Z77 A;  4Z5C A;  5HOD A;  2A6C A;  3QWG A;  2PUD A;  3GTG J;  4C3I J;  1OJL A;  1Y7Y A;  1AKH B;  3TP0 A;  1ZPQ A;  3CRO L;  3OSG A;  1HCR A;  4D5C A;  1VF9 A;  1ZQ3 P;  2ID6 A;  4BY1 J;  2OFY A;  2L7M P;  3DEW A;  1LFB A;  3GBF A;  1MH3 A;  4DYQ A;  3HKZ N;  2WIU B;  1DWK A;  2LK2 A;  2ICP A;  2LYQ A;  1ZK8 A;  1ETY A;  3BG9 A;  2YU9 J;  4X4H A;  3SJM A;  2VUM J;  3FIW A;  4PU4 C;  1ZR2 A;  1IGN A;  2JA7 J;  1D5Y A;  1MBK A;  1XC5 A;  1UXD A;  1ETV A;  3BTI A;  2N8G A;  5E3N A;  2LTP A;  2LCV A;  1QQB A;  1WET A;  3G5G A;  5K7Z A;  3SCF A;  4D5F A;  5FKK A;  2AO9 A;  2XGC A;  2PUA A;  3SCH A;  1XG1 A;  1UXC A;  1RPE L;  4A3L J;  2O9L A;  1O4X A;  2E2H J;  1ZZ7 A;  1GVD A;  1R69 A;  3HOZ J;  3BG3 A;  2YUS A;  5EF6 A;  3G1L A;  2NVQ J;  3S1M J;  4F8D A;  4C2M J;  1IDZ A;  4M3E A;  4J1W A;  1Z0X A;  3HGG A;  4FBI A;  3HOW J;  1QPZ A;  1S7E A;  4MIM A;  3EUS A;  3PO2 J;  1IDY A;  1G2H A;  4QSH A;  3JRG A;  3G7D A;  2L7F P;  1ETQ A;  2L9R A;  4B4C A;  5JLX A;  4BBR J;  1MBE A;  2M9H A;  1P7J A;  2KEI A;  4A3F J;  2LD5 A;  3BDN A;  3QQ6 A;  1NK2 P;  4FTH A;  4XRM A;  3NAR A;  3VPR A;  3F51 A;  1ZUG A;  2EH3 A;  4AYB N;  1ZS4 A;  5K98 B;  4YG4 A;  2PIJ A;  3L1P A;  4I6Z A;  3C2B A;  2DMN A;  3B6C A;  2FJR A;  4I8T A;  1ENH A;  3BR5 A;  1MNM C;  1FIA A;  5F1J A;  2YS9 A;  1WH8 A;  2L7Z A;  1K83 J;  3FK7 A;  1WIZ A;  2JN6 A;  3LSG A;  2BNN A;  2R93 J;  2Y30 A;  1JFT A;  2XJ3 A;  3QPL A;  3ZQH A;  3GTO J;  1PNR A;  4A3E J;  2GBY A;  1PRV A;  3I4N J;  2M2E A;  1LMB 3;  3CCY A;  3WHC A;  2CU7 A;  1F43 A;  1FIP A;  1ZZC A;  5IOY A;  4JX5 A;  3JRH A;  2NVY J;  5BNG A;  4J1X A;  3CQZ J;  4Y42 A;  1QPI A;  2HIN A;  3GN5 B;  4A3J J;  2BJC A;  2PUF A;  5E3L A;  3S1Q J;  1GUU A;  4C3J J;  5F0F A;  3QF3 A;  4MCT A;  2AXZ A;  1POU A;  5M5W J;  4IWR A;  1DU0 A;  4IHV A;  1UHS A;  5M5Y J;  2M8G X;  2VKE A;  3BTJ A;  1W0U A;  4UUS A;  1JGG A;  1P7I A;  5K7H A;  2ME6 A;  5M3F J;  1JJ6 C;  3S15 J;  2PUG A;  2EZH A;  1YRN B;  2PUB A;  1RKT A;  4W97 A;  1BW6 A; 
#chains in the Genus database with same CATH topology
 2VC1 A;  3GFI A;  1QQA A;  1PRA A;  4JK1 X;  3CES A;  3CDI A;  4YFN F;  3DFG A;  1GXP A;  1FTT A;  1HW1 A;  4M73 A;  2MAB A;  1OYW A;  1B8I B;  2Y48 A;  1SMT A;  1U9N A;  3PUB A;  1R5G A;  3FKI J;  2LYL A;  4R79 A;  4BQQ A;  4PFO A;  2OBP A;  4A3G J;  4N9H A;  3RZZ A;  5J3L A;  4IRH A;  1ZHF A;  2DT5 A;  2FOW A;  5C3E J;  2O6G E;  3GTQ J;  3OWQ A;  3FM3 A;  4X4G A;  2CG4 A;  3NQO A;  4C3H J;  4CYD A;  1AKH A;  5IPA A;  1S5L C;  3DBH B;  2DA1 A;  3G1M A;  4EK9 A;  2QBY A;  5LHG A;  2ZSI B;  4U7D A;  4WVL A;  1BJA A;  4LG3 A;  3CCQ I;  1IV6 A;  3RKQ A;  3RI4 A;  2IP2 A;  3DWL E;  5BOX A;  1FYM A;  1ZG3 A;  3PNT A;  4FCY A;  4CIC A;  2DLL A;  2LYR A;  3V8J A;  4YG1 A;  2IXS A;  1FC3 A;  2XKO A;  1FZP B;  3KLN A;  3GVA A;  1MMS A;  2H09 A;  3K70 D;  4M74 A;  1LQ1 A;  1Y39 A;  1LE8 B;  5IP7 J;  1S6L A;  1NTC A;  2UV1 A;  3M8F A;  1IN5 A;  1LDJ A;  1D8K A;  1X2N A;  3VB2 A;  1YJ9 I;  4A6E A;  4OAZ A;  4S0H B;  2DA7 A;  5EG0 A;  5B3S H;  1XB4 A;  3K7A J;  2A68 F;  1OSL A;  4A5N A;  2UWM A;  2IS2 A;  2PXP A;  2BY3 A;  2K9Q A;  2PXE A;  5BMZ A;  4ETS A;  2PUC A;  2MC3 A;  4B44 A;  4XLH A;  1J09 A;  1D3Y A;  2JUG A;  3AKZ A;  3ZP5 A;  2EFN A;  4I09 A;  3L2V A;  2RVC A;  3CCV I;  4CCK A;  1EF4 A;  2JA5 J;  2F5V A;  3ROU A;  2V1D A;  1TP4 A;  1NER A;  2YPR A;  2EF8 A;  5CQE A;  1XGM A;  4XKB A;  4KN7 X;  1VI0 A;  2FJ1 A;  2LRE A;  4FHT A;  5D6F A;  4IOA F;  4GXO A;  2M34 A;  5L3B A;  1FOX A;  5IP6 A;  4GCV A;  4MFE A;  5JI6 A;  2V1U A;  2L8N A;  1WI3 A;  3LAP A;  1YJN I;  4PU8 A;  4OB4 A;  2A6E F;  3ML6 A;  4IQ4 A;  3R6S A;  4YG2 F;  1VPW A;  5BPD A;  1UJ8 A;  2IVG A;  2R7W A;  3FYM A;  1FNN A;  3BJO A;  2VQC A;  2O8X A;  1Y1V J;  5TGT A;  3KYD B;  3B6A A;  3S32 A;  3AL0 C;  4RGS A;  3WU0 A;  3KXA A;  1DUL A;  3SFZ A;  2QA4 I;  4HQE A;  3OYN A;  3WTW C;  1V55 H;  2CUE A;  1XSD A;  2UXX A;  4ZYG A;  5J1U A;  3I4M J;  1WJ5 A;  3QP5 A;  2K9S A;  4KUM A;  2EFO A;  2LG4 A;  4XID A;  5LRS A;  1GT0 C;  1RR8 C;  2KZV A;  3M9L A;  4Z58 A;  4D0P A;  2R92 J;  2OTJ I;  5F1R A;  4G12 A;  2Y9Y A;  4LB5 A;  1QNT A;  2K9L A;  3F6V A;  4M9X A;  2LLW A;  4GO1 A;  2LR8 A;  2FRH A;  4HW0 A;  1WGX A;  4QPO A;  1H0M A;  4EZI A;  5H6Q A;  5JVT A;  2ZFU A;  2VJ5 A;  5E3O A;  3CDL A;  1KZH A;  1SAU A;  1BDH A;  4Q47 A;  1BR2 A;  1XTA A;  2Z2S B;  3HBL A;  4JBA A;  2JJ7 A;  2R7Z J;  2Z3Y A;  2DK8 A;  3C1D A;  2LFB A;  4JOM A;  2JTV A;  1T08 B;  2VBZ A;  4BXX J;  2M1B A;  2M8E A;  2L7K A;  4F3Q A;  3GZD C;  4CXF A;  2A5W A;  2GIZ A;  2ZXW H;  3KEY A;  2GA2 A;  3T5X A;  2YU3 A;  2MFZ A;  2XDV A;  2OUM A;  3CMY A;  5D5X B;  4L9T A;  1HKT A;  3HRT A;  4Y17 A;  3OS2 A;  2ICW G;  2M4G A;  5ICG A;  5E18 F;  1GV2 A;  3NRO A;  5L3G A;  1OCZ H;  4DYR A;  2O7O A;  2M3A A;  1IG7 A;  1VQ6 I;  1KGS A;  5LGU A;  1JKP C;  3HB9 A;  1IRZ A;  1WWX A;  4I0A A;  3A0H C;  4ESJ A;  2X85 A;  3JW4 A;  1DPR A;  2HXI A;  3QPT A;  1H88 C;  2MXD A;  2ZME B;  2VLA A;  1J75 A;  4OIN F;  4A3D J;  2PXU A;  5JLW A;  2EQR A;  1ADR A;  1U8B A;  1IJW C;  2X4H A;  2HOS A;  2XB0 X;  4UUS B;  3KX2 A;  1ODD A;  2IW5 A;  3L2U A;  1VQO I;  4GFB A;  2RC4 A;  1QP4 A;  1OCP A;  2XUB A;  4Y15 A;  3OYC A;  3DEU A;  2JVL A;  2ELH A;  4IZZ A;  1LE8 A;  2WUS R;  3V7R A;  2HYF A;  3HUG A;  1U3E M;  4XOT A;  3S2W A;  4EM1 A;  5ILU A;  3BY6 A;  2F48 A;  3WU1 B;  5F27 A;  4G7O F;  3O8H A;  5K5Q A;  1TW3 A;  1VND A;  2BNO A;  3BTL A;  1XPX A;  1U5T B;  1LB2 A;  2R3S A;  1W36 C;  2M45 A;  2DQL A;  2ETH A;  4NB5 A;  2XAQ A;  1QPM A;  3F52 A;  2GM4 A;  1I6H J;  4D7M A;  2PPX A;  2KP6 A;  4BXF A;  2X6W A;  1XX5 A;  4ZDL A;  3IVP A;  3F21 A;  1HW5 A;  1RUN A;  1K61 A;  2VE9 A;  2DU9 A;  4ZTJ A;  2FNP A;  2NOG A;  4NC6 A;  3ZQ7 A;  3RPQ A;  2KKO A;  3E5Q A;  2JPC A;  2STT A;  1Z7U A;  3WU2 C;  3JRD A;  4BGD A;  3D5R C;  3IV5 A;  3LFP A;  4KA4 A;  1F1Z A;  3I71 A;  1ZTR A;  3ZPX A;  1VQ8 I;  2WV1 A;  3I55 I;  1UST A;  2NS7 A;  2L9V A;  4J00 A;  3CMM A;  4KT6 A;  3SDB A;  4G8X A;  1OYI A;  1LUJ B;  2M0C A;  4C30 A;  5D8L B;  2JVG A;  2W84 A;  3LOC A;  1FOY A;  3VSK A;  4IX7 A;  2HNH A;  3FXQ A;  4LK1 F;  4ESF A;  2OR1 L;  3GTM J;  1XD7 A;  5D5U B;  3GTP J;  3TOA A;  4DZJ A;  1X3Z B;  2PXF A;  2MH9 A;  3HOY J;  2IAI A;  2WB1 N;  2DA3 A;  2KLO A;  2P5K A;  4RLQ A;  1FBS A;  1FMW A;  4PJN A;  5LGT A;  2QQ9 A;  1T38 A;  5D4S A;  1QHG A;  3G6E I;  2L3D A;  5C4X J;  4P9U A;  3OR2 C;  4E7J A;  4S04 A;  5E79 C;  3EDP A;  1MSE C;  4N4N B;  4XK4 A;  3S8Q A;  4YEL A;  3UKG A;  1U9O A;  3NAU A;  3JRE A;  4MFD A;  5FFX A;  3L09 A;  3JXC L;  4WCG A;  3H9J A;  4FT8 A;  1JUS A;  3OYI A;  3IKV A;  5HNH A;  1T6S A;  3GZC A;  2BV6 A;  3ZQI A;  4ER3 A;  1WCM J;  2DBB A;  1QVU A;  5LHI A;  2WY8 Q;  4OU0 A;  2VQL A;  2OF7 A;  2WV0 A;  4GRI A;  4M6Y A;  2WB1 A;  5DEQ A;  1A35 A;  2K5C A;  4L5J A;  1J9I A;  1FY7 A;  2DW4 A;  2ZC2 A;  1K4T A;  5BQT A;  2JA8 J;  3B7H A;  3ZCO A;  3KFW X;  3M4O J;  1IRF A;  4PU7 A;  1HA8 A;  5DS9 A;  2AS5 F;  1R58 A;  4BEH A;  1RZR D;  4JCY A;  2M30 A;  3HL2 A;  4L9N A;  1HQ1 A;  2Q2E B;  1S7O A;  2WBM A;  2KPM A;  3H3U A;  3LA7 A;  1IXR C;  4O3M A;  2HZD A;  3RYP A;  2VOO A;  3EUA A;  2AW6 A;  3OQM A;  3PNY A;  5EJC A;  2JPB A;  3F8F A;  3HG9 A;  2MC4 A;  2ZME A;  2CQX A;  3BR6 A;  2FA5 A;  2QGU A;  4GYI A;  3BTC A;  1G59 A;  4QIW N;  3S17 J;  2W57 A;  1NW3 A;  1DP7 P;  5FLV A;  2DYS H;  3GEZ A;  1BA5 A;  3Q0W A;  2LVS A;  1QU3 A;  3OYB A;  1JWL A;  2HOA A;  1GHC A;  1RIO A;  3MQ0 A;  2R0Q C;  4AC0 A;  2K4J A;  4ZDP A;  2VL8 A;  3IUO A;  1UCR A;  1K78 A;  3DBR B;  2H6C A;  2MD0 A;  1G6N A;  2RV8 A;  4M9Z A;  3GUD A;  4IQJ A;  5IY5 H;  2PXL A;  1JKO C;  2EPF A;  4HF1 A;  1QVT A;  5ED4 A;  3DPT A;  3Q0U A;  1MH4 A;  2F6C A;  3HPG A;  2OQG A;  4YAR A;  2W85 A;  2ZBK A;  4X1E A;  2V79 A;  2Y0S N;  4TV7 A;  2CSO A;  2BHY A;  2VKV A;  3HZI B;  1IF1 A;  4ZZD A;  2D1H A;  3WTV C;  1BC8 C;  3A03 A;  3R0J A;  2ID3 A;  2KIU A;  3ABK H;  2XRO A;  4EQZ A;  1QZY A;  1I3A A;  3HM5 A;  5DTD A;  4GHJ A;  2PFB A;  3U1D A;  3SEZ A;  5KAI C;  1K79 A;  1RIO H;  2R5Y B;  3FMS A;  1Z77 A;  3W6J B;  4B48 A;  1IXS B;  3D5L A;  5HOD A;  3G71 I;  3A2K A;  2A6C A;  2LSO A;  3WTU C;  5J8F A;  1Y7Y A;  1ZAO A;  3LA3 A;  1GXQ A;  1HCR A;  4MQ9 F;  4D5C A;  1ZQ3 P;  1VQL I;  2ACJ A;  3ZR8 X;  1OLT A;  4RM2 A;  1VQ7 I;  5DRT A;  5DD8 A;  1MDM B;  1MJ9 A;  3JCU C;  1LFB A;  1R6R A;  5GAG J;  2DFH A;  3OL4 A;  3QP6 A;  2ICP A;  1DP3 A;  1B1B A;  3HSR A;  3PQK A;  4HF2 A;  3HOS A;  2YU9 J;  2DDB A;  4IOC F;  3SJM A;  1UB9 A;  1X4P A;  1RI7 A;  2OTL I;  3O6B B;  2LY2 A;  4BH9 A;  3VDX A;  3DPU A;  2IA2 A;  1IGN A;  4AVP A;  4HNU A;  2A6T A;  3ERE D;  2JA7 J;  1OCR H;  3DTK A;  1B4A A;  2UZK A;  3HPH A;  2K9M A;  3M8E A;  4RA2 A;  5K7Z A;  3WGI A;  1FBQ A;  4PJ0 C;  5FKK A;  1WRJ A;  2DAO A;  2XGC A;  4A3L J;  2FEZ A;  1W5T A;  1O3S A;  1ZZ7 A;  5E20 A;  1R69 A;  3BG3 A;  3I54 A;  5DDG A;  2NVQ J;  4F8D A;  4XSZ F;  3N05 A;  4FBI A;  1Z0X A;  2Z1D A;  3HGG A;  2QSG X;  1S7E A;  4AD9 A;  1YIT I;  3PO2 J;  3F6O A;  2HCN A;  4LLL A;  1PJR A;  2WA0 A;  2A6H F;  2DFI A;  2L7F P;  1ETQ A;  4BUP A;  3J7Z I;  3GCM A;  2NRA C;  1O3Q A;  1MBE A;  1FT9 A;  1P7J A;  2KEI A;  3BZK A;  1MNE A;  2LD5 A;  4LG0 B;  4H4K C;  4HEA 2;  2P6S A;  3LQQ A;  2W7N A;  2V1N A;  2VKH A;  3QQ6 A;  1UFM A;  3S8P A;  3E6B A;  1RUO A;  1I1G A;  4OIO F;  2P0W A;  3LMM A;  2EH3 A;  3P9I A;  4AYB N;  1Z9C A;  4NNJ A;  1K6Y A;  2D45 A;  3C2B A;  3B6C A;  1LPQ A;  4PFP A;  1ENH A;  3L2R A;  3V4G A;  3H92 A;  3K6G A;  2QQ8 A;  2VQG A;  4I02 A;  2VC0 A;  4IRG A;  4G6D A;  3LSG A;  1MND A;  1OCO H;  2XAS A;  2QKL B;  3N97 A;  2E7W A;  5LEK A;  3OYL A;  1PNR A;  2DOD A;  4LIU A;  4ZC3 A;  3I4N J;  2HDW A;  3RDI A;  3WTT C;  2M4H A;  4UV8 A;  3WHC A;  2F5D A;  4G6Q A;  1ULY A;  2DPU A;  2E1M B;  2BJC A;  2PUF A;  4NC8 A;  4ZZL A;  3SZG A;  5F0F A;  4MCT A;  4ZYD A;  4ANJ A;  2J5O A;  3CUQ B;  5M5W J;  2K3F A;  3DXJ F;  4AYB A;  4IHV A;  2H94 A;  3MCZ A;  1UZC A;  2M8G X;  4HX7 A;  2LDU A;  1P7I A;  5K7H A;  4GYG A;  2ZXH A;  2ME6 A;  4RB2 C;  1JJ6 C;  1ZRF A;  3S15 J;  2M4K A;  2P5L C;  2PUB A;  1TBX A;  4FX4 A;  2EIK H;  3SZT A;  4JX6 A;  1DPU A;  2FBH A;  3CCM I;  3WG9 A;  1YSE A;  1Y1W J;  4L0Y B;  2IS1 A;  5LBQ A;  2ZCW A;  1XDU A;  1O7L A;  1P6R A;  3HIF A;  1BR1 A;  2VAS A;  2M7B A;  5CVU A;  3SEQ A;  3IP4 B;  1Z6R A;  2JSC A;  3BJA A;  3MAJ A;  4I01 A;  5LLQ A;  3JRB A;  4YBA A;  2IRF G;  1MBG A;  4PUS A;  3ZQQ A;  1XSX A;  3LA2 A;  2XHK A;  2CWE A;  3D5S C;  3FXL A;  4UVC A;  4CYC B;  1LLI A;  3BWG A;  3A9X A;  2ZJR F;  3ECO A;  3C3W A;  2ME0 A;  2M5W A;  2KQR A;  2JRM A;  2BGC A;  1R22 A;  3BS3 A;  4BAC A;  4HV6 A;  1PUF B;  3OQN A;  1R63 A;  4UUV A;  4F7Z A;  4I6T A;  4E7H A;  1IRG A;  3UR3 C;  2HQA A;  3O9X A;  2X1E A;  3V7C A;  2CV1 A;  3GLX A;  1FJL A;  1X2L A;  2DN0 A;  2G0E A;  2NVX J;  2O8K A;  3H5A A;  3L7W A;  1BC7 C;  1H9G A;  2EIM H;  4EJW A;  4KN4 X;  2BXZ A;  3BG6 A;  2GAU A;  1E0E A;  4NUB A;  4DBR A;  3QOE A;  1EA3 A;  1LCC A;  1BOA A;  2DA2 A;  5DUI A;  3GBG A;  2AQE A;  3RKY A;  4HV5 A;  2K3P A;  2GLO A;  1SEU A;  4EJV A;  3TRB A;  3ZOB A;  3ZRG A;  2HVS A;  1S7A A;  1T8I A;  2HYJ A;  3GTL J;  1UMQ A;  2NYX A;  2V3C C;  2NAZ A;  5LHH A;  4U0Y A;  2XVC A;  1LKX A;  1FSH A;  2HQR A;  3BD1 A;  2QVO A;  3DNV B;  4LD5 A;  4AIH A;  1FSE A;  2LC2 A;  3K70 C;  1QBJ A;  1NEQ A;  3HYI A;  2EZL A;  3H5N A;  4JQF A;  4PSX A;  3NDB B;  2XGX A;  2HVR A;  2XKP A;  3QQA A;  3KZZ A;  2AXT C;  4MQV A;  5GTH C;  4IEJ A;  4BE2 A;  3T8R A;  4QTR A;  3RPU A;  1YS6 A;  3T8T A;  1CF7 A;  1YI2 I;  2ISZ A;  4IRI A;  1NG7 A;  3ABL H;  5M5X J;  1QHH D;  2EFQ A;  4Q2J A;  2KDZ A;  4K2E A;  1IV8 A;  2IVM A;  1OQY A;  3G1O A;  2X9D A;  1JGS A;  1MSF C;  1JHH A;  4N9I A;  3QYF A;  4F93 B;  1F4K A;  2DO7 A;  2XPW A;  3P9K A;  1ZZ6 A;  1R23 A;  5EYR A;  4YFK F;  3U3W A;  3WGG A;  2BZT A;  3JTH A;  5EEA A;  4JQD A;  5A7L A;  3ZQC A;  1O57 A;  2VPL A;  1XDS A;  1G3W A;  2V9V A;  2P81 A;  3O2P E;  4Y4R A;  4FE4 A;  5KNL A;  2HTS A;  5EZH A;  4A0X A;  3BP8 A;  3OOP A;  4XLF A;  4Z6Y A;  4XRS A;  1HSJ A;  1UHM A;  4M3G A;  1HC8 A;  1HST A;  4X4B A;  1VQK I;  5FLM J;  3L2Q A;  2LF8 A;  4UVB A;  4B3A A;  1U6G A;  4CGZ A;  5K1Y A;  5ICE A;  2VB6 A;  3RKX A;  5EGO B;  3CJR B;  4KIF A;  4RAZ A;  2LH9 A;  1R7J A;  2TCT A;  4E4H A;  1QGP A;  4X4I A;  2EFW A;  4MO7 A;  3KIO A;  2VI6 A;  4IXA A;  4KMU X;  3GFM A;  1MKM A;  3OKZ A;  4E7L A;  1ETX A;  5J40 A;  3F23 A;  2CYY A;  2B63 J;  2VE8 A;  2MBF A;  5AIP A;  2NOJ B;  3H36 A;  4UB6 C;  2OAZ A;  5D6E A;  4A3K J;  5HNF A;  1AOY A;  1ZAR A;  4UVA A;  1J2X A;  3HOU J;  2Z99 A;  3CJN A;  1L1M A;  1E3O C;  3ZQF A;  1PRU A;  2BY1 A;  2QSF X;  5L3C A;  2KL4 A;  4V2F A;  1HBX G;  1UAA A;  1W7P A;  3BQZ A;  1YIJ I;  3RZO J;  3CP8 A;  3M3Y J;  1CJG A;  2BVL A;  3W6K B;  2J5P A;  4II2 A;  3OOU A;  1TLH B;  4HLX A;  1LNW A;  1WJC A;  3JR9 A;  3B73 A;  3TBI A;  2CQQ A;  2IA0 A;  2AXU A;  5CJ9 A;  3F8N A;  4PCQ A;  1GDT A;  2HR3 A;  2MGQ A;  3SFI A;  4LMY A;  1MMN A;  1ZZ8 A;  4II3 A;  2PJR B;  2WY7 Q;  4ITV A;  3RZD J;  1SVM A;  5IT3 A;  2QCO A;  2QEX I;  3MD2 A;  2HQN A;  2PQ8 A;  4U87 A;  5D5V B;  2L4M A;  2PLY A;  5FRN A;  1BBY A;  2CMP A;  1Y0U A;  3H35 A;  3REO A;  3SYT A;  3SZP A;  1ZGW A;  1TQI A;  2AHQ A;  3FK6 A;  2J7W A;  2PXK A;  2ISY A;  4CCJ A;  1KA8 A;  4MCX A;  2OJE D;  1ZR4 A;  1B72 B;  1VZ0 A;  1R5I D;  1QZX A;  3EYI A;  4UUT A;  3JRI A;  2FOK A;  1WH5 A;  3KP7 A;  2BY2 A;  1WJD A;  3Q9S A;  2TDX A;  4NQW A;  4O8B A;  3HOT A;  3CO7 C;  3K4L A;  5D5W B;  1BDI A;  1VFC A;  2I10 A;  2CS3 A;  2P8T A;  2HPM A;  2RDP A;  1K4S A;  5IYD J;  2V6C A;  1J5Y A;  3O3K A;  2E7X A;  4RGR A;  5DYM A;  4A0Z A;  1TTY A;  3CF2 A;  1QB2 A;  2ZME C;  4BNC A;  3GFL A;  2PXQ A;  1Z7L A;  4HBL A;  4ZJZ A;  3IAM 2;  3PXP A;  2V26 A;  4XLP F;  5CQG A;  4EKI A;  2L54 A;  2XV4 S;  3PFI A;  2LP0 A;  2IT0 A;  4PU3 C;  3OYA A;  1X19 A;  2XAG A;  4H0E A;  4HLY A;  4N4O B;  4WX9 A;  3A0B C;  3CF5 F;  4X4D A;  3W2A A;  2YR2 A;  5HLI A;  3KP5 A;  3QPS A;  4E7S A;  4FE7 A;  2XXA A;  4LLN A;  3W6V A;  3CD6 I;  1SQ8 A;  5E3M A;  3SX0 A;  2A05 A;  2G7U A;  1U5T C;  2H8R A;  4ZTF A;  1ETK A;  4P55 A;  4D7N A;  4RGU A;  1N75 A;  3DP7 A;  1VQP I;  3G4S I;  2CJJ A;  3OIQ A;  3E6C C;  1DUX C;  1O7F A;  1JXS A;  3J80 K;  2WAD A;  1FYK A;  4JP0 A;  1UTX A;  3CEC A;  2AXV A;  2L49 A;  3ZXS A;  5EGO A;  1KQ0 A;  2QYO A;  3OMT A;  3K2A A;  4Q48 A;  1WH7 A;  2LNB A;  2A69 F;  1ZZB A;  1JTX A;  3NRV A;  5F64 A;  3S3M A;  3VSL A;  5CVR A;  2PN6 A;  2XSD C;  2EBY A;  1D1B A;  2HSG A;  2R7Q A;  1CGP A;  1P92 A;  4P1W A;  2E1C A;  3VEP A;  2CQN A;  2JWT A;  4PJJ A;  2QF7 A;  3M1E A;  1WPK A;  2CQ7 A;  2EWT A;  3VFZ A;  3GYH X;  4J19 A;  2R63 A;  2OZU A;  1MGT A;  1Y8R B;  5DSX A;  5KAF C;  2XIU A;  1B8I A;  3ZHM A;  2UUZ A;  5F0H A;  3HHH A;  1HKQ A;  1BW5 A;  2V9K A;  2A07 F;  2XXQ A;  2CW0 F;  3O8G A;  3PUF A;  2JVH A;  4DW6 A;  2VXZ A;  4I0B A;  4XKV A;  2KRH A;  2GXA A;  3JSP A;  1KQ9 A;  4E70 A;  1TT0 A;  2H1K A;  4S05 A;  4C2U A;  1R71 A;  3CMA I;  1RRJ A;  1TWF J;  1YE9 A;  2KEJ A;  1HOM A;  1XMX A;  4Y3O A;  4XSX F;  2M87 A;  1XCV A;  4IHT A;  1YOV B;  5CVJ A;  1EH7 A;  2X0L A;  4FN3 A;  1W1W E;  1JKR C;  2VEO A;  3PFY A;  5GPC A;  3Q0V A;  1JKQ C;  2DK5 A;  4HNT A;  2R7O A;  3JRF A;  4EQQ A;  2PJR A;  3RTR A;  1ZKG A;  4CHU A;  2K27 A;  2R7R A;  1QP7 A;  3A9Z A;  1W4M A;  4BKX A;  1HW2 A;  1YW8 A;  2WWY A;  5JFR A;  3OS1 A;  2CV0 A;  2IEK A;  3ZMD A;  1TW2 A;  4M6V A;  3GTK J;  2CRG A;  3AG4 H;  1FYL A;  2W48 A;  4R8H A;  3OYH A;  1ZRC A;  4CO8 A;  2E36 A;  5J1Y A;  1G3Y A;  3CJQ B;  2ICT A;  3HXL A;  1ONV A;  3LSH A;  1Q1H A;  3TGN A;  3LSI A;  4DJA A;  3GTG J;  1ZPQ A;  5L3D A;  3CRO L;  3M1C A;  4HRI A;  2F5F A;  3CUO A;  4KT5 C;  5CPR B;  3CCR I;  2OFY A;  2DJI A;  3DEW A;  4A5M A;  4EJT A;  4DYQ A;  2V9P A;  3MFK A;  3VOD A;  5CKT A;  2X1D A;  3U9G A;  2FBI A;  3TO7 A;  2Z33 A;  1ZK8 A;  3ECH A;  3WG7 H;  4E7I A;  1KON A;  3HRS A;  3V8L A;  2OQR A;  3BG9 A;  2Y75 A;  4X4H A;  2CO5 A;  4YRV A;  1IN6 A;  1D0Z A;  2VUM J;  2EA2 A;  2G7H A;  5DUK A;  1ZR2 A;  2VBY A;  1V5F A;  1WJE A;  1UXD A;  3LL7 A;  3LAJ A;  3BTI A;  2N8G A;  3OS0 A;  3E1S A;  2ZNZ A;  3G5G A;  3SCF A;  1BIB A;  2VN2 A;  2AO9 A;  1SFU A;  2Q0O A;  3H9G A;  2VXD A;  1XG1 A;  3FBI B;  4E7K A;  1ZEL A;  3DKX A;  1O4X A;  3CLO A;  2E2H J;  2OC6 A;  2LF7 A;  3MEJ A;  3G1L A;  4MEY F;  1ERD A;  4C2M J;  3E6D A;  3TKY A;  3OIP A;  5BPI A;  2XF7 A;  1YIO A;  4EAT A;  1IDY A;  3G7D A;  2X6X A;  1MIJ A;  2L9R A;  4B4C A;  2E34 A;  5JLX A;  4EGZ A;  2M9H A;  1S3J A;  1W5S A;  3KP2 A;  4EGY A;  1OYY A;  5HS8 A;  3E3V A;  2E60 A;  1EKE A;  4A6D A;  3NXH A;  3ZMU A;  3L9F A;  4XRM A;  3NAR A;  4MGR A;  3GZN B;  2E5Z A;  3B02 A;  1ZUG A;  4YG4 A;  2ESN A;  1G3T A;  5LEJ A;  3K4C A;  4CZC A;  4B09 A;  2DMN A;  4I8T A;  1QZZ A;  5CVI A;  1MNM C;  1T98 A;  1I39 A;  4OIR F;  4HQM A;  1TL8 A;  3IC7 A;  1O3R A;  1J7K A;  2C6Y A;  1JHF A;  2M7A A;  4O5V A;  1FWZ A;  2IGO A;  2Y30 A;  3WE2 A;  1VTN C;  4A3E J;  4DE8 A;  3H0D A;  1N78 A;  3COA C;  2B7E A;  2EJR A;  3EUK L;  1F43 A;  1ZZC A;  3ESW B;  4JX5 A;  4XLA A;  4CSW A;  1IO2 A;  3CQZ J;  4XQF A;  3UWP A;  2HIN A;  4R1H A;  3JAM K;  2GIV A;  4N0B A;  4A3J J;  3ASN H;  3GN5 B;  3S1Q J;  2J7U A;  2NXN B;  3HSF A;  4C3J J;  3QF3 A;  3SXY A;  1BI2 A;  2XAH A;  3K4N A;  3M7G A;  2AXZ A;  3C18 A;  4A0Y A;  5L3F A;  4MNU A;  1EH6 A;  1PVE A;  4M6X A;  3E6M A;  3OR1 C;  4YII A;  1DU0 A;  1G4D A;  1U2Z A;  4XM3 A;  1V5G A;  5M5Y J;  2VKE A;  1W0U A;  4UUS A;  1H9T A;  5GAH J;  1V5E A;  1YYV A;  3BZ6 A;  2JUC A;  3LST A;  1KU3 A;  1YRN B;  4ER6 A;  5E8G A;  2W82 A;  1RKT A;  1Z21 A;  5HS9 A;  3K4K A;  3AG1 H;  1UG0 A;  1NK3 P;  1F36 A;  2XRN A;  4IKF A;  1W36 D;  5ERI A;  2O5R A;  2FD5 A;  1R9T J;  3TW6 A;  2CUZ A;  1MBH A;  4L18 B;  4F92 B;  2KMU A;  1U5T A;  2L2O A;  2LYJ A;  2JSP A;  3BLY A;  5DM7 F;  4HX8 A;  1A36 A;  3KYL A;  1BJZ A;  3A02 A;  3GZ6 A;  1D1A A;  2V1X A;  4I6U A;  5FO5 A;  2RQP A;  3I59 B;  2LMD A;  2EIL H;  3OYG A;  1A6Q A;  5DCM B;  5E8I A;  1JT6 A;  2COM A;  4EVI A;  2CFX A;  2HOT A;  2XAU A;  5DRY A;  2VPR A;  3FMQ A;  4IPA A;  2B9S A;  2OCC H;  3ASO H;  1UG2 A;  2HTJ A;  4RAF A;  2LBF B;  2F4I A;  3LSR A;  1H8A C;  3LSM A;  2HFZ A;  1ZGA A;  1P4X A;  3BJ6 A;  1Y8Q B;  4L5E A;  3CCU I;  1W5C C;  5M3M J;  1OCC H;  1QO0 D;  1RC9 A;  2BXY A;  1B9M A;  2DOA A;  1S72 I;  3I56 I;  5GAG i;  2XPV A;  2JMW A;  2HCS A;  4M72 A;  3VYT B;  1MD0 A;  2OA4 A;  4V2G A;  2WAQ N;  3KZY A;  1NG6 A;  4E7Z A;  2E1M C;  4L9V A;  1OR7 C;  1X3W B;  2X6O A;  4IF4 A;  4EEF G;  1TNS A;  2BY0 A;  2IGN A;  3RQI A;  4XOR A;  1XSV A;  2JK3 A;  5DTM A;  1MMD A;  3CUQ C;  4HG2 A;  3ZQG A;  3WTY C;  4BQA A;  2Y31 A;  4JX4 A;  2XXP A;  1P4W A;  2XGE A;  5FKM A;  1Y9Q A;  3BCA A;  5EDN A;  2JA6 J;  2VOD A;  4Q4Z F;  1SD5 A;  2BW3 B;  4RLF A;  4MEX F;  2L9N A;  3JRC A;  3TFL A;  2LLK A;  5FKN A;  4XN0 A;  4PGH A;  4MTE A;  2Y0M A;  1HLV A;  2O0Y A;  3TOB A;  2PXB A;  1WZ2 A;  1EJ9 A;  3CP2 A;  3HDD A;  1LVK A;  1OMI A;  2WAQ A;  3BT9 A;  3OYJ A;  1VQ5 I;  2LRD A;  3L00 A;  1X2M A;  3C2G A;  2O03 A;  2CSF A;  1R4N B;  1X1A A;  1A6I A;  2B5A A;  2PMZ A;  2E71 A;  2L4A A;  5JR3 A;  2HEO A;  4B47 A;  2H27 A;  4A3C J;  2W00 A;  4V19 K;  1Z6T A;  1X4O A;  2OZ6 A;  1YW7 A;  3IH3 A;  1EFA A;  3FXM A;  2X48 A;  2DOE A;  3DLA A;  3S1R J;  2BNM A;  4L9J A;  5F04 A;  5B66 C;  3CC7 I;  1D5V A;  2EV0 A;  3LFU A;  2GZW A;  3FHZ A;  1N77 A;  2Q2E A;  2IVQ A;  2HVQ A;  4FQG A;  4KNY A;  3TED A;  1ZH5 A;  1Y56 A;  3AFH A;  3K9T A;  2XB5 A;  1XS9 A;  3SCG A;  1FOK A;  3K1N A;  4LLG F;  5IOZ A;  3VYS B;  3VYR B;  4HNV A;  3M9A A;  2R1J L;  5ICC A;  3SQN A;  1YRN A;  2HI3 A;  3I58 A;  3ME5 A;  1ZAY A;  4B3X A;  1AHD P;  1IUF A;  3RCO A;  4UY8 I;  3KEQ A;  3MLF A;  3E0J B;  2MLG A;  1KQ8 A;  2EV5 A;  4IA8 A;  2IJL A;  4CH7 A;  5EZG A;  4ENK A;  4OBM A;  1SFK A;  2NNY A;  2QM3 A;  1NHA A;  2EZI A;  2FE3 A;  3A01 B;  3K1M A;  5DTQ A;  4KIB A;  3CC2 I;  2GXG A;  2VT3 A;  4M9S A;  2VON A;  3F8B A;  4C9Y A;  1XGS A;  5J1R A;  4ZYH A;  2HDC A;  4RB1 A;  4PSW A;  3QWL A;  4CUG A;  1R5H A;  2R5Y A;  3PE5 A;  2NS8 A;  4A69 C;  5L3E A;  1SMY F;  1VQ4 I;  3MZY A;  3HHG A;  1FPQ A;  2PEX A;  3R60 A;  2R5Z B;  1HDD C;  2ELJ A;  3G0T A;  2OPT A;  2PBI A;  3ABU A;  4AUX A;  2H8W A;  4UNO A;  5LGN A;  2ADU A;  1BN5 A;  1SAN A;  1Z3Y A;  3BOQ A;  3W2V A;  4Q5S F;  1MJA A;  3T0Y A;  3OYK A;  2IS4 A;  1XMK A;  2DFE A;  3QU6 A;  2AQF A;  1MDM A;  2A61 A;  3FX3 A;  1ZRE A;  1ZZ9 A;  1ZGJ A;  2LKX A;  3LSJ A;  3JRA A;  3CCL I;  3S1N J;  1IC8 A;  2ELK A;  2VJ4 A;  2BVM A;  1WKM A;  4XR6 A;  4BJ5 C;  3BRO A;  3DV8 A;  4G9Y A;  3OMY A;  1QRY A;  2KJB A;  4KFC A;  3Q5F A;  4DZP A;  4RS8 A;  3ZMS A;  3MKL A;  3QOX A;  1QA6 A;  2BW3 A;  2WC2 A;  2WAF A;  2DA6 A;  5JHU A;  4EV0 A;  2E1O A;  4ER0 A;  3RQ4 A;  4X4C A;  3KP6 A;  1IN4 A;  4X6A J;  2OCE A;  1MZB A;  4IO9 F;  2DXI A;  2MLK A;  3DQV C;  4D1Q A;  2QBY B;  4KIT B;  3K4M A;  1RR7 A;  4LB6 B;  1PP7 U;  2Y9Z A;  5FLX K;  4F55 A;  2EIN H;  3FMR A;  4M3B A;  3G3Z A;  2ECC A;  2H6B A;  3IKT A;  3ELK A;  1MJB A;  3I4P A;  4X4F A;  2PE5 A;  3V42 A;  3MZH A;  4LG0 A;  1LFP A;  3OWT A;  4HSR A;  2D5V A;  1M1E B;  1WI9 A;  1W7P D;  1DU6 A;  4M71 A;  2DOF A;  2CUF A;  4I76 A;  2FU4 A;  3DLL F;  3G2B A;  5IP9 J;  1LFU P;  2IGK A;  3JSO A;  2XF5 A;  1T39 A;  2MA3 A;  4WXH A;  2GZU A;  3F6W A;  2EZK A;  4I99 C;  3GXO A;  5EG0 B;  5EEH A;  2KT0 A;  5FFZ A;  3K4J A;  2ZFW A;  3BR1 A;  5CVV A;  2R7S A;  4B8X A;  3E5X A;  5C4J J;  2DMP A;  3OIO A;  2DTZ A;  1RKW A;  3KCC A;  5J4V A;  1USS A;  1VQ9 I;  3QOW A;  4AWX B;  1R00 A;  3FIS A;  2RAE A;  3K0L A;  2F4O B;  1F5T A;  3HKZ A;  1O3T A;  3QOD A;  3ZMV A;  4ZYA A;  4I7H A;  2DA4 A;  3GME A;  4HX4 A;  4Y13 A;  2XPU A;  3P5J A;  2Y69 H;  1AU7 A;  2W25 A;  4G7Z F;  5IT9 K;  3ZMT A;  1OR7 A;  4Z2Y A;  3DKY A;  3JXB C;  3EET A;  3ZPL A;  3S3N A;  2VIX A;  2HWV A;  3OY9 A;  2DQR A;  5B1B H;  2DMU A;  2HU9 A;  3CUQ A;  2E5N A;  3F0C A;  2HDD A;  1H89 C;  4M3F A;  1X1B A;  1I27 A;  3H3Z A;  3BR2 A;  3ZN0 A;  4AIK A;  2L0K A;  4YG7 B;  2PXT A;  1WQ2 A;  3A4C A;  4A3I J;  1MMA A;  3A01 A;  3ZKC A;  4XLE A;  3CTA A;  2HYG D;  2PI0 A;  3OQO A;  2KPJ A;  3FYA A;  2LY9 A;  3QRF F;  2PUE A;  4LK0 F;  3PL8 A;  1U0J A;  2F2E A;  2CW7 A;  1JT0 A;  5FGM A;  2VOP A;  3KZ3 A;  3I3L A;  2KDO A;  1PP8 F;  4UHT A;  4MLO A;  2FX0 A;  4LIV A;  1B0N A;  1X1P A;  2YSR A;  3ZQL A;  1JTY A;  3PSI A;  2R5Z A;  4CYC A;  2O38 A;  3PQJ A;  3QU3 A;  3MKZ A;  2XCJ A;  3GF2 A;  5CLS A;  2GA1 A;  4I98 B;  4KMF A;  4HST A;  2D1V A;  2FXA A;  3MZ8 A;  2O61 A;  3HJE A;  5H6R A;  2GRM A;  5J6X A;  3K10 A;  4KIS A;  1SD4 A;  1PUF A;  1Z3X A;  3CZ6 A;  1KU2 A;  1T56 A;  4BQN A;  4AIJ A;  1SAX A;  3FXK A;  4ABZ A;  3NWS A;  1KYZ A;  3QFI A;  3QOP A;  1ORK A;  2FFH A;  5HDK A;  4AM3 A;  3HRU A;  3BG5 A;  4JCX A;  4BXU A;  3MWM A;  3CLC A;  3ZHI A;  5IYC J;  3OSF A;  5F6F A;  1DGR M;  3F3X A;  3QPH A;  3CCJ I;  1MBF A;  4Y52 J;  4P5O A;  2K40 A;  4B43 A;  5FJ8 J;  3FDY A;  4HDU A;  2FQ3 A;  5AIQ A;  1HQC A;  3MEX A;  5DD4 A;  4Z5C A;  4NBQ A;  3TQN A;  3QWG A;  1WJF A;  2QWW A;  1OJL A;  1DDN A;  1FBU A;  5BS6 A;  1N25 A;  3OSG A;  2W24 A;  2ZXJ A;  5TJJ A;  1VF9 A;  2BE5 F;  2ID6 A;  2MD5 A;  2LLV A;  5H2F C;  1ZG5 A;  4BY1 J;  1X3U A;  2L7M P;  4EJU A;  5LD2 C;  1MH3 A;  2NS0 A;  1BI3 A;  1SD6 A;  4CCO A;  2WIU B;  2LK2 A;  3K2Z A;  2LYQ A;  3J81 K;  3HZJ A;  3HUG B;  3FXU A;  1IW7 F;  1ON1 A;  4GGG A;  4YIR X;  3I64 A;  2IGM A;  3EUH A;  3TEP A;  4HYE A;  2DT6 A;  4LGW A;  4YEJ A;  3K1P A;  4BJ6 C;  1MBK A;  2R7V A;  1P2F A;  1XC5 A;  4G7H F;  3Q9V A;  2LCV A;  1WET A;  4D5F A;  4ESB A;  2VBW A;  3X2Q H;  2PUA A;  1UXC A;  2DYR H;  4HAM A;  1ON2 A;  3SR4 A;  4CCM A;  2EA4 A;  1GVD A;  2OD5 A;  3ERM A;  4DNC A;  5DV5 A;  4PJL A;  2WAE A;  2YUS A;  3S1M J;  1BM9 A;  1PUE E;  1OKR A;  1MFQ C;  1TQP A;  3H1C A;  4J1W A;  3ULQ B;  4OOI A;  2CV2 A;  4MIM A;  2RGV A;  5CYV A;  1R36 A;  3EUS A;  1G2H A;  2V6E A;  4CCL A;  4XRF A;  4NC7 A;  5HLT A;  1FMV A;  2IPQ X;  1BI0 A;  3HRM A;  2VQH A;  3BDN A;  1TT5 B;  2D2W A;  2LYC A;  2YX4 A;  1YG2 A;  2LKS A;  4XOP A;  3F51 A;  3IRQ A;  3LWF A;  1ZS4 A;  2FBK A;  4PDK A;  3C7J A;  3L1P A;  2QUF A;  4WF2 A;  3FWE A;  5ICF A;  1YFH A;  2FF4 A;  2KRF A;  3ZN1 A;  2CGP A;  2GWR A;  3BR5 A;  4EMS A;  1FIA A;  5F1J A;  4ZYE A;  1WH8 A;  2L9S A;  2L7Z A;  3FK7 A;  2X6Y A;  3IWF A;  3M07 A;  1WIZ A;  4X4E A;  2BNN A;  1SVO A;  5K5O A;  1WJB A;  4GDF A;  2XJ3 A;  3GTO J;  2HOE A;  5HDG A;  1FLI A;  1PRV A;  2M2E A;  1LMB 3;  2PMH A;  2R7D A;  3CCY A;  4OAY A;  4XLN F;  4A2U A;  5IOY A;  3TEL A;  3GW2 A;  3JRH A;  4RAY A;  5KHD A;  2GOM A;  3J7Y J;  4J1X A;  1KYW A;  1XN7 A;  4CA0 A;  3F8M A;  4Y42 A;  1QPI A;  4E6K G;  4QPQ A;  2L01 A;  4ENJ A;  5FD5 A;  5E3L A;  2KIS A;  2EWN A;  4BHC A;  1GUU A;  2ODR D;  2R7F A;  3FXO A;  3K69 A;  4ON0 A;  1P4A A;  4BQO A;  4XKC A;  3U21 A;  1POU A;  2KFD A;  1R1U A;  1UHS A;  2HPI A;  3BTJ A;  4PJM A;  1JGG A;  4XN3 A;  1LDK B;  3A9Y A;  2W1O A;  3F8C A;  1B6A A;  1J0R A;  3CCS I;  2FML A;  1SVL A;  3W2W A;  3RSN A;  5LRR A;  1C0W A;  4M3D A;  3FM5 A;  3PSF A;  3QYX A;  1FP2 A;  4OWR B;  3KP4 A;  2FUG 2;  1EV7 A;  1ETW A;  1T0F C;  4BEH B;  5A2Q K;  2ZXI A;  2Q1Z B;  4HOB A;  4KDP A;  1OCT C;  1V4R A;  4XBF A;  1YHQ I;  3MVP A;  3NWT A;  1E17 A;  4Z5H A;  2M0M A;  1D1C A;  2EBI A;  3BCB A;  2K02 A;  2G9W A;  2EK5 A;  1D0Y A;  2KJC A;  4RDU A;  2R4G A;  1VQM I;  2R7T A;  1GVJ A;  3BG7 A;  3MKY B;  4FET A;  2ESH A;  3GFJ A;  3G73 A;  4HZF A;  1B72 A;  3J7A Y;  1Y0N A;  3FZV A;  1BL0 A;  2BBY A;  3AL0 B;  4BE1 A;  3WGH A;  2CUJ A;  3JTG A;  5FLX Z;  3KZI C;  2AUW A;  3JXD L;  2OV7 A;  3MN2 A;  4GQM A;  1REP C;  1K78 B;  3DKW A;  3FMY A;  1EH8 A;  1K7A A;  1ACI A;  5C44 J;  3VWS A;  2ZJQ F;  3V7S A;  2JQ7 A;  2DJN A;  2BYV E;  5KK1 A;  4A93 J;  2X1C A;  1RZS A;  1XMA A;  2VBX A;  1RNL A;  3HEF A;  5FB2 A;  1U8R A;  4DYC A;  2IVB A;  2XRL A;  4XL9 A;  4NDW A;  3H9Q A;  2HS5 A;  5HVQ C;  2E19 A;  2HQ5 A;  3I5U A;  2JT1 A;  2MSY A;  1STZ A;  5K5R A;  2XF6 A;  3OYM A;  3KJX A;  4XIC A;  1VQN I;  5DT2 A;  3IHU A;  2AXL A;  2YX7 A;  4G94 A;  1FX7 A;  1JJ8 C;  1R4M B;  1P9Q C;  2PXD A;  1TQM A;  3FHN A;  4WWC A;  1LJ9 A;  3AAF A;  3LSK A;  3VYU B;  3BR3 A;  3NZL A;  4IHX A;  4CCN A;  3WTZ A;  1PYV A;  2R7X A;  2TRT A;  3OV8 A;  3TW7 A;  3TMO A;  1LVA A;  1HXD A;  2A5Y B;  3ISP A;  4Z59 A;  4IVN A;  3CC4 I;  5IT9 Z;  2FMY A;  2FNA A;  1YW9 A;  4Y33 A;  2XGD A;  4BYY A;  2VJI A;  2P7C B;  4YIF A;  1JE8 A;  4U7B A;  3BR0 A;  2DA5 A;  2E2J J;  3R1F A;  1PER L;  4B1R A;  2RN7 A;  4L5I A;  4U0V A;  3EPZ A;  5ILV A;  2Z5U A;  5F08 A;  1OIS A;  1LEB A;  1Y6I A;  1MMG A;  1X57 A;  2CRO A;  2IUO A;  5GPA A;  4RBO A;  4Y7N J;  1U78 A;  3T1B A;  2KEK A;  4EJO A;  3N4M A;  4X0G A;  1L3L A;  4FX0 A;  1UEL B;  1R49 A;  4AID A;  5JVG F;  3R09 A;  1I6X A;  2L02 A;  2OU2 A;  2X51 A;  1XGO A;  3H3V K;  4HRA A;  3S2D J;  2PX9 A;  5HLH A;  4A3B J;  4HA8 A;  2LYK A;  2KRC A;  4OMY A;  5J4Y A;  1WH6 A;  1OFC X;  2DMQ A;  1I5Z A;  2K7L A;  4G6T B;  3FBN B;  4HDV A;  1AA7 A;  5HS7 A;  1OPC A;  3UNG C;  2RKH A;  4RB0 A;  5HLG A;  5FKO A;  3V8K A;  1T2K A;  1SFO J;  3KP3 A;  2GQQ A;  4RGX A;  2LNM A;  1IUY A;  2H1L A;  1T33 A;  4WXD A;  3KL4 A;  3IH4 A;  4DE9 A;  2Z9O A;  1X1C A;  3E7L A;  1RZ4 A;  3D0S A;  5GAH i;  3WHB A;  1RES A;  3H0G J;  5LFA A;  2LYP A;  5GP9 A;  2FSW A;  2VKD A;  4MTD A;  3Q3S A;  3GTJ J;  2XIG A;  1ZVV A;  4ER7 A;  3IAS 2;  2E35 A;  4A3M J;  3KET A;  2KIM A;  1SD7 A;  1KU9 A;  3WE3 A;  1G3S A;  1L0O C;  2CH0 A;  3HGY A;  4LIT A;  1XGN A;  3RIR A;  6PAX A;  5E17 F;  3E97 A;  5E1Z B;  3ZMZ A;  1Z1D A;  4XON A;  1YTY A;  5JHF A;  1IRX A;  2MG4 A;  3PO3 J;  5DTR A;  3F9K A;  5F0C A;  3DTI A;  2XAJ A;  2JA2 A;  3GLL A;  3U1K A;  1V54 H;  3OL3 A;  5H20 A;  1SFX A;  4PGG A;  5IYB J;  3OYE A;  2JRT A;  2ZNY A;  1TC3 C;  4BY7 J;  4CZZ A;  2KIF A;  3BPX A;  3L2W A;  3KLO A;  4W1U A;  1GV5 A;  3DBL B;  2B0L A;  1WFX A;  3E5U A;  4I6R A;  4LFU A;  4RM3 A;  3LNQ A;  3S93 A;  3HTS B;  1U2W A;  3TL4 X;  4KJZ A;  2CQK A;  4KIC A;  1MBJ A;  1TNT A;  3J81 Z;  1ZLJ A;  3FKJ A;  1ZYR F;  1POG A;  1APL C;  2QLZ A;  2XC7 A;  2DMT A;  1ZG1 A;  1JUM A;  3IH2 A;  4JYK A;  3RJP A;  4BBS J;  2PXV A;  4ZH4 F;  2IU7 A;  1Z05 A;  2IV1 A;  2K86 A;  2V4J C;  1FP1 D;  4EM0 B;  2AWI A;  5HOO A;  1I50 J;  2JCG A;  2IBD A;  4CDG A;  1IZ1 A;  1I3Q J;  3WTX C;  2DI3 A;  1A04 A;  3PJR A;  4F91 B;  2PMZ N;  3GZD A;  1D0X A;  2FQ4 A;  3LFK A;  5K7F A;  3R0A A;  9ANT A;  4LOC A;  3CCE I;  2O3F A;  1DW9 A;  4FAS D;  1A31 A;  1RPW A;  2Y2Z A;  1QQI A;  2YBD A;  1S9H A;  2K9N A;  3GWZ A;  3QAH A;  3QYE A;  4XKW A;  4UB8 C;  1Z67 A;  4IVZ A;  3OYF A;  4C2T A;  1X58 A;  4IHY A;  2P7V B;  2IA1 A;  2Y0S A;  4ENN A;  4PZJ A;  4OMZ A;  1T0F A;  3OP9 A;  3IRR A;  2NVU B;  3PM1 A;  4BDY A;  1TWH J;  2ZJ2 A;  4U0W A;  3CJT B;  2ZB9 A;  3J80 Z;  2KZ8 A;  5B5E C;  2MYS A;  1RZR A;  2HFH A;  2COB A;  2HXO A;  2PG4 A;  1IAW A;  4NHJ A;  5E1W A;  3AG2 H;  5J8C A;  1XWR A;  2ECB A;  4U88 A;  2NVT J;  2GRL A;  2ZO4 A;  1JUP A;  2MW8 A;  3ONQ A;  2K85 A;  1XCB A;  3WTS C;  2A3S A;  5GAD J;  1J59 A;  1JFS A;  3P7N A;  2RRE A;  4I2O A;  1R1T A;  3VK0 A;  2Z16 A;  1S29 A;  2RQQ A;  1JI8 A;  3CLQ A;  1W0T A;  3ZGK A;  5FD6 A;  3AG3 H;  2ZSH B;  3DM5 A;  2STW A;  5GAE J;  3CME I;  1YQA A;  2BEO A;  5KCM A;  3S16 J;  4ZDO A;  3HTU A;  1KU7 A;  4IJA A;  1CQT A;  1LCD A;  3GN5 A;  2KZG A;  2O4A A;  2RNJ A;  2ZJP F;  4OIP F;  1QZE A;  1YLF A;  3TP3 A;  4P9F A;  1HF0 A;  3LIS A;  3SDG A;  3HC7 A;  2CW8 A;  1QP0 A;  3J7A O;  3ABM H;  1S8N A;  2I5U A;  4DGW B;  1CF7 B;  3UFD A;  2DT7 B;  2KIQ A;  4FIS A;  2O49 A;  3DCF A;  1WJA A;  4EKG A;  4BAY A;  3QYB A;  4ENM A;  1BIA A;  1A5J A;  3MKW B;  4BDZ A;  3I53 A;  3DPL C;  5A2Q Z;  3CDH A;  1IN7 A;  2WTE A;  3H5R A;  4BS9 A;  4BHP A;  4Z5D A;  1B9N A;  3GX4 X;  4F52 A;  3S2H J;  1B59 A;  3DF8 A;  1ITY A;  4IHS A;  2QKM B;  1ZRD A;  4IHW A;  1JH9 A;  3EUH C;  3I59 A;  2IS6 A;  1ZLK A;  2GOX B;  4LJZ F;  3RPU D;  2CFO A;  5DCM A;  4RB3 C;  3S14 J;  1I1S A;  5JUW A;  2QQB A;  3HSE A;  3U2R A;  2LKP A;  3TDZ C;  3DTE A;  1LQC A;  3RKW A;  2XSJ C;  2JZY A;  2LBF A;  2BHZ A;  4ASN A;  3BPV A;  1FEX A;  5AON A;  3A1Y A;  5B1A H;  3TDU C;  3P9C A;  1HDP A;  2XI8 A;  1BI1 A;  3M8J A;  4HPQ A;  2HGC A;  5E1X A;  4PK4 A;  2K4B A;  5DCF A;  2PMU A;  4P96 A;  1FTZ A;  2MQK A;  2F5E A;  3PIP F;  3KEO A;  1SC7 A;  3BZC A;  2W4S A;  2ZKZ A;  1TWC J;  2DTR A;  2L5Q A;  4NDL A;  1RET A;  3LSP A;  1X1D A;  1Q1V A;  2HKX A;  4BU2 A;  2E2I J;  5ILS A;  3VWB A;  2DPD A;  3BQY A;  4XRS G;  3D1N I;  5GTI C;  3HOX J;  5FKL A;  5TRD A;  3HOV J;  2MEZ A;  3S3O A;  2P4W A;  1UHW A;  3CO6 C;  5HDN A;  1ETO A;  3KPH A;  2LYS A;  1TWG J;  2DCE A;  3H5T A;  3FXJ A;  3I9V 2;  4WXC A;  1BOB A;  1TWA J;  2EFP A;  1W7P B;  4WK8 F;  1NH3 A;  5KVR A;  3R4K A;  2PUD A;  4C3I J;  1YJW I;  1AKH B;  3TP0 A;  4UV9 A;  2KHM A;  2L1P A;  1WHU A;  2P6T A;  2HKO A;  4BHB A;  1YX3 A;  4ER5 A;  4RMN A;  5FRO A;  4BL0 B;  3VOE A;  3GBF A;  3HKZ N;  4QWQ A;  5J47 A;  1DWK A;  3F22 A;  3C2H A;  3OYD A;  4XNF A;  2QEN A;  3GZ5 A;  1PDN C;  1ETY A;  4RAG A;  1DGW Y;  1E3P A;  4HF0 A;  2EB7 A;  4OIQ F;  3FIW A;  3W3C A;  4PU4 C;  4L0Z B;  1WVR A;  5D4R A;  1D5Y A;  1IN8 A;  3FF5 A;  3GUU A;  3LQR A;  1ETV A;  5E3N A;  2LTP A;  1T95 A;  1QQB A;  4DIQ A;  3DU5 A;  4IL6 C;  4DQ2 A;  3EQL F;  4QLC U;  3SCH A;  1G8X A;  2EIJ H;  1RPE L;  2HZT A;  2V7F A;  2O9L A;  3DEE A;  3HOZ J;  5EF6 A;  2JQE A;  3GO5 A;  3PIO F;  2QZ8 A;  4M3E A;  1IDZ A;  3IL2 A;  3HOW J;  4KIG A;  4AU7 A;  1QPZ A;  4EM2 A;  3LQX A;  3DU6 A;  5DM6 F;  4DOZ A;  4NQW B;  2QQA A;  4QSH A;  3JRG A;  4BBR J;  2VT2 A;  3I0T A;  1HKS A;  3RYR A;  4DBQ A;  3TO9 A;  2UXN A;  1BR4 A;  4A3F J;  3JAM Z;  5TIS C;  3KE2 A;  1YO5 C;  2E1N A;  3L2C A;  1NK2 P;  3KYC B;  4XMY A;  4FTH A;  3K4B A;  5D8K B;  1E3H A;  3VPR A;  4AVZ A;  1WSU A;  1D8J A;  3R61 A;  3BC8 A;  5K98 B;  2QSH X;  3BDD A;  4KYW A;  2PIJ A;  4I6Z A;  2VJJ A;  5EEG A;  2F4M B;  4MHG A;  4UXN A;  2FJR A;  1YX5 A;  4O6J A;  4J01 A;  2YS9 A;  1K83 J;  2JN6 A;  1MW7 A;  3TO6 A;  3F72 A;  4A12 A;  1Z91 A;  2R93 J;  2MH2 A;  2EV6 A;  1R1V A;  1JFT A;  3QPL A;  3ZQH A;  4D9J A;  5FRM A;  1E2X A;  2GBY A;  2NNN A;  1GLN A;  3EYY A;  4BE0 A;  1FOW A;  2CU7 A;  2LY1 A;  1FIP A;  1ZN2 A;  2XAF A;  4YFX F;  2NVY J;  2GXB A;  5BNG A;  3ABT A;  1K6O A;  2F5C A;  1LEA A;  2P5V A;  2DDA A;  1YS7 A;  2LOO A;  1AWC A;  1DQU A;  3PNV A;  2Q8K A;  4BJT A;  3SHF A;  1F9N A;  4IWR A;  3MMY B;  2BOL A;  2DFF A;  3NEU A;  3WOD F;  5M3F J;  1IXC A;  2PUG A;  4XLC A;  2EZH A;  1TZL A;  2I8D A;  3IWZ A;  1SFE A;  2RNG A;  2R7U A;  1V3F A;  2PJP A;  3FXR A;  1LDD A;  4W97 A;  1BW6 A; 
#chains in the Genus database with same CATH homology
 4JX6 A;  1QQA A;  1PRA A;  4M3D A;  1NK3 P;  1F36 A;  1YSE A;  3QYX A;  1Y1W J;  1R9T J;  2FD5 A;  1ETW A;  3TW6 A;  1MBH A;  1FTT A;  2LYJ A;  1B8I B;  3JRB A;  1OCT C;  1U9N A;  4X4E A;  3MVP A;  4YBA A;  1BJZ A;  3A02 A;  3FKI J;  2LYL A;  1MBG A;  4Z5H A;  4I6U A;  4A3G J;  2EBI A;  3RZZ A;  5J3L A;  4RDU A;  5C3E J;  3GTQ J;  4X4G A;  1JT6 A;  4C3H J;  2HOT A;  1AKH A;  4CYC B;  2VPR A;  1LLI A;  5IPA A;  1B72 A;  2DA1 A;  3G1M A;  3LSR A;  1UG2 A;  1BL0 A;  1H8A C;  2ME0 A;  2AUW A;  3JXD L;  4L5E A;  1IV6 A;  3MN2 A;  3RKQ A;  5M3M J;  3BS3 A;  4GQM A;  4FCY A;  1PUF B;  2XPV A;  2LYR A;  2JMW A;  3FMY A;  3OQN A;  4YG1 A;  1R63 A;  5C44 J;  4V2G A;  4I6T A;  2DJN A;  2WAQ N;  4A93 J;  1LE8 B;  5IP7 J;  1RZS A;  3O9X A;  1NTC A;  3HEF A;  4EEF G;  2X6O A;  1FJL A;  1X2L A;  2DN0 A;  1X2N A;  2G0E A;  4DYC A;  2IVB A;  3RQI A;  2XRL A;  4NDW A;  2JK3 A;  4S0H B;  2NVX J;  2DA7 A;  2O8K A;  3ZQG A;  5EG0 A;  2E19 A;  2HQ5 A;  3K7A J;  1OSL A;  2MSY A;  3KJX A;  2Y31 A;  4JX4 A;  4XIC A;  2XGE A;  5FKM A;  1Y9Q A;  2K9Q A;  1LCC A;  5EDN A;  1JJ8 C;  2JA6 J;  2PUC A;  2DA2 A;  3GBG A;  3BR3 A;  4IHX A;  3JRC A;  2LLK A;  5FKN A;  2GLO A;  2TRT A;  3TRB A;  1EF4 A;  3ZOB A;  3TW7 A;  2JA5 J;  2HYJ A;  1HLV A;  3GTL J;  4Z59 A;  1NER A;  1UMQ A;  2EF8 A;  1VI0 A;  2FJ1 A;  3HDD A;  2XGD A;  3BD1 A;  3BT9 A;  3DNV B;  2M34 A;  3BR0 A;  2DA5 A;  1X2M A;  5IP6 A;  2E2J J;  3R1F A;  1PER L;  4MFE A;  1NEQ A;  2CSF A;  2EZL A;  4B1R A;  2L8N A;  1WI3 A;  4PU8 A;  4OB4 A;  3QQA A;  1VPW A;  5F08 A;  2IVG A;  3FYM A;  4IEJ A;  1A6I A;  4QTR A;  1Y1V J;  2B5A A;  1X57 A;  3B6A A;  2CRO A;  3KXA A;  2IUO A;  5GPA A;  4RBO A;  4Y7N J;  1U78 A;  2KEK A;  4A3C J;  5M5X J;  2CUE A;  2KDZ A;  3IH3 A;  1EFA A;  3G1O A;  3H3V K;  2X48 A;  2X9D A;  5J1U A;  1MSF C;  3S1R J;  3S2D J;  3I4M J;  4A3B J;  2BNM A;  5F04 A;  2LYK A;  2XPW A;  2K9S A;  1WH6 A;  1ZZ6 A;  5EYR A;  4XID A;  1OFC X;  2DMQ A;  1GT0 C;  2IVQ A;  3U3W A;  4Z58 A;  5EEA A;  4JQD A;  2R92 J;  5A7L A;  3ZQC A;  4G12 A;  2Y9Y A;  2P81 A;  4FE4 A;  5EZH A;  5FKO A;  3TED A;  1SFO J;  3SCG A;  1XS9 A;  2LR8 A;  2XB5 A;  4XRS A;  1WGX A;  4M3G A;  5IOZ A;  1T33 A;  5E3O A;  3CDL A;  1BDH A;  4HNV A;  3IH4 A;  4X4B A;  3HBL A;  3E7L A;  5FLM J;  2R7Z J;  2JJ7 A;  2R1J L;  1YRN A;  3WHB A;  2HI3 A;  1RES A;  3H0G J;  4B3A A;  2LFB A;  2LYP A;  1ZAY A;  1AHD P;  1IUF A;  5GP9 A;  4BXX J;  3MLF A;  3Q3S A;  5EGO B;  3GTJ J;  1ZVV A;  4A3M J;  2TCT A;  4IA8 A;  4X4I A;  5EZG A;  4MO7 A;  2VI6 A;  3HGY A;  3CMY A;  2EZI A;  3A01 B;  1ETX A;  2B63 J;  2MG4 A;  3PO3 J;  5F0C A;  5J1R A;  1GV2 A;  4A3K J;  4DYR A;  2O7O A;  1IG7 A;  3HOU J;  1JKP C;  5IYB J;  3HB9 A;  1IRZ A;  1L1M A;  2R5Y A;  1TC3 C;  2NS8 A;  4A69 C;  3ZQF A;  1E3O C;  2HXI A;  1PRU A;  4BY7 J;  4V2F A;  1H88 C;  3RZO J;  3BQZ A;  3M3Y J;  1CJG A;  2R5Z B;  1HDD C;  4A3D J;  2OPT A;  2EQR A;  4W1U A;  1GV5 A;  5JLW A;  1U8B A;  1IJW C;  4AUX A;  2HOS A;  2XB0 X;  4I6R A;  3LNQ A;  4UUS B;  1SAN A;  3OOU A;  4GFB A;  1QP4 A;  1OCP A;  3JR9 A;  1MBJ A;  2JVL A;  1LE8 A;  1ZZ9 A;  2CQQ A;  2AXU A;  2WUS R;  2LKX A;  1POG A;  3LSJ A;  3JRA A;  1APL C;  1GDT A;  3S1N J;  2DMT A;  2MGQ A;  2ELK A;  3SFI A;  1JUM A;  1IC8 A;  3IH2 A;  4JYK A;  4BBS J;  1ZZ8 A;  2IU7 A;  2IV1 A;  2AWI A;  5F27 A;  1QRY A;  3RZD J;  3O8H A;  1I50 J;  1VND A;  2BNO A;  3BTL A;  2JCG A;  2IBD A;  2QCO A;  4DZP A;  1I3Q J;  3MKL A;  3F52 A;  2GM4 A;  1I6H J;  4D7M A;  2PPX A;  2DA6 A;  3IVP A;  2E1O A;  1ZGW A;  2AHQ A;  3FK6 A;  4X4C A;  2PMZ N;  1K61 A;  2FQ4 A;  5K7F A;  4X6A J;  4MCX A;  9ANT A;  2NOG A;  4LOC A;  1ZR4 A;  1B72 B;  1DW9 A;  1ADR A;  1RPW A;  2Y2Z A;  2K9N A;  1RR7 A;  3JRD A;  3IV5 A;  2Y9Z A;  4UUT A;  3JRI A;  4IVZ A;  1WH5 A;  3LFP A;  4M3B A;  4O8B A;  2ECC A;  1ZTR A;  1X58 A;  4IHY A;  2WV1 A;  2NS7 A;  4X4F A;  1BDI A;  2PE5 A;  1VFC A;  3OP9 A;  2I10 A;  2D5V A;  3PM1 A;  2M0C A;  1TWH J;  1DU6 A;  3LOC A;  2CUF A;  2ZB9 A;  4I76 A;  5IYD J;  2KZ8 A;  5IP9 J;  1LFU P;  1RZR A;  2GZU A;  2OR1 L;  2COB A;  2HXO A;  3GTM J;  3F6W A;  2EZK A;  3GTP J;  1XWR A;  5EG0 B;  4DZJ A;  2KT0 A;  2ECB A;  3BR1 A;  2NVT J;  2GRL A;  3HOY J;  3PXP A;  2IAI A;  1JUP A;  2DA3 A;  2WB1 N;  2MW8 A;  5C4J J;  2DMP A;  3OIO A;  2DTZ A;  1RKW A;  2LP0 A;  4PU3 C;  1JFS A;  3VK0 A;  3FIS A;  2RAE A;  5C4X J;  4X4D A;  3QPS A;  1W0T A;  4FE7 A;  1MSE C;  3W6V A;  4XK4 A;  1SQ8 A;  3S8Q A;  5E3M A;  3UKG A;  1U9O A;  2DA4 A;  3NAU A;  3JRE A;  4MFD A;  2H8R A;  3S16 J;  1ETK A;  3JXC L;  2XPU A;  4D7N A;  1AU7 A;  1CQT A;  1LCD A;  3GN5 A;  1JUS A;  2CJJ A;  3JXB C;  2O4A A;  4JP0 A;  3ZQI A;  2DMU A;  1UTX A;  1WCM J;  3F0C A;  3CEC A;  2HDD A;  3TP3 A;  1H89 C;  4M3F A;  2AXV A;  2L49 A;  1QVU A;  5EGO A;  1HF0 A;  3LIS A;  3BR2 A;  3OMT A;  3K2A A;  3SDG A;  1QP0 A;  2L0K A;  2OF7 A;  1WH7 A;  1ZZB A;  4YG7 B;  1JTX A;  3UFD A;  2JA8 J;  3B7H A;  4A3I J;  3A01 A;  2XSD C;  2EBY A;  2HSG A;  3ZKC A;  4FIS A;  3M4O J;  2O49 A;  3DCF A;  3OQO A;  4PU7 A;  2KPJ A;  2JWT A;  3FYA A;  2LY9 A;  2QF7 A;  5DS9 A;  1WPK A;  1A5J A;  2EWT A;  2PUE A;  1RZR D;  4JCY A;  2R63 A;  4J19 A;  1JT0 A;  3KZ3 A;  2XIU A;  1B8I A;  3ZHM A;  4Z5D A;  5F0H A;  4MLO A;  2FX0 A;  1B0N A;  3S2H J;  1BW5 A;  2AW6 A;  3OQM A;  1ITY A;  3ZQL A;  1JH9 A;  4IHW A;  3O8G A;  4DW6 A;  1JTY A;  2CQX A;  3BR6 A;  2R5Z A;  3S14 J;  3BTC A;  2H1K A;  4QIW N;  3S17 J;  4CYC A;  2O38 A;  5FLV A;  1LQC A;  1BA5 A;  3Q0W A;  2LVS A;  1TWF J;  2XCJ A;  1JWL A;  2KEJ A;  1HOM A;  2HOA A;  1FEX A;  1RIO A;  2R0Q C;  2XI8 A;  1HDP A;  4AC0 A;  4FN3 A;  2GRM A;  1JKR C;  1PUF A;  5GPC A;  3Q0V A;  1JKQ C;  1T56 A;  3JRF A;  1FTZ A;  2MQK A;  1JKO C;  1ZKG A;  4ABZ A;  1TWC J;  1QVT A;  3Q0U A;  1MH4 A;  1ORK A;  4NDL A;  1RET A;  4YAR A;  1QP7 A;  4X1E A;  4BKX A;  4JCX A;  2Y0S N;  3BG5 A;  3LSP A;  2VKV A;  1Q1V A;  2E2I J;  3HZI B;  3CLC A;  3BQY A;  4XRS G;  3D1N I;  3ZHI A;  3A03 A;  3HOX J;  5IYC J;  5FKL A;  2IEK A;  2ID3 A;  3OSF A;  3HOV J;  2MEZ A;  4M6V A;  3GTK J;  2CRG A;  3HM5 A;  5DTD A;  4GHJ A;  1ETO A;  1MBF A;  2W48 A;  2K40 A;  4Y52 J;  5FJ8 J;  2LYS A;  1TWG J;  3H5T A;  5J1Y A;  2R5Y B;  2ICT A;  1TWA J;  1Z77 A;  4Z5C A;  5HOD A;  2A6C A;  3QWG A;  2PUD A;  3GTG J;  4C3I J;  1OJL A;  1Y7Y A;  1AKH B;  3TP0 A;  1ZPQ A;  3CRO L;  3OSG A;  1HCR A;  4D5C A;  1VF9 A;  1ZQ3 P;  2ID6 A;  4BY1 J;  2OFY A;  2L7M P;  3DEW A;  1LFB A;  3GBF A;  1MH3 A;  4DYQ A;  3HKZ N;  2WIU B;  1DWK A;  2LK2 A;  2ICP A;  2LYQ A;  1ZK8 A;  1ETY A;  3BG9 A;  2YU9 J;  4X4H A;  3SJM A;  2VUM J;  3FIW A;  4PU4 C;  1ZR2 A;  1IGN A;  2JA7 J;  1D5Y A;  1MBK A;  1XC5 A;  1UXD A;  1ETV A;  3BTI A;  2N8G A;  5E3N A;  2LTP A;  2LCV A;  1QQB A;  1WET A;  3G5G A;  5K7Z A;  3SCF A;  4D5F A;  5FKK A;  2AO9 A;  2XGC A;  2PUA A;  3SCH A;  1XG1 A;  1UXC A;  1RPE L;  4A3L J;  2O9L A;  1O4X A;  2E2H J;  1ZZ7 A;  1GVD A;  1R69 A;  3HOZ J;  3BG3 A;  2YUS A;  5EF6 A;  3G1L A;  2NVQ J;  3S1M J;  4F8D A;  4C2M J;  1IDZ A;  4M3E A;  4J1W A;  1Z0X A;  3HGG A;  4FBI A;  3HOW J;  1QPZ A;  1S7E A;  4MIM A;  3EUS A;  3PO2 J;  1IDY A;  1G2H A;  4QSH A;  3JRG A;  3G7D A;  2L7F P;  1ETQ A;  2L9R A;  4B4C A;  5JLX A;  4BBR J;  1MBE A;  2M9H A;  1P7J A;  2KEI A;  4A3F J;  2LD5 A;  3BDN A;  3QQ6 A;  1NK2 P;  4FTH A;  4XRM A;  3NAR A;  3VPR A;  3F51 A;  1ZUG A;  2EH3 A;  4AYB N;  1ZS4 A;  5K98 B;  4YG4 A;  2PIJ A;  3L1P A;  4I6Z A;  3C2B A;  2DMN A;  3B6C A;  2FJR A;  4I8T A;  1ENH A;  3BR5 A;  1MNM C;  1FIA A;  5F1J A;  2YS9 A;  1WH8 A;  2L7Z A;  1K83 J;  3FK7 A;  1WIZ A;  2JN6 A;  3LSG A;  2BNN A;  2R93 J;  2Y30 A;  1JFT A;  2XJ3 A;  3QPL A;  3ZQH A;  3GTO J;  1PNR A;  4A3E J;  2GBY A;  1PRV A;  3I4N J;  2M2E A;  1LMB 3;  3CCY A;  3WHC A;  2CU7 A;  1F43 A;  1FIP A;  1ZZC A;  5IOY A;  4JX5 A;  3JRH A;  2NVY J;  5BNG A;  4J1X A;  3CQZ J;  4Y42 A;  1QPI A;  2HIN A;  3GN5 B;  4A3J J;  2BJC A;  2PUF A;  5E3L A;  3S1Q J;  1GUU A;  4C3J J;  5F0F A;  3QF3 A;  4MCT A;  2AXZ A;  1POU A;  5M5W J;  4IWR A;  1DU0 A;  4IHV A;  1UHS A;  5M5Y J;  2M8G X;  2VKE A;  3BTJ A;  1W0U A;  4UUS A;  1JGG A;  1P7I A;  5K7H A;  2ME6 A;  5M3F J;  1JJ6 C;  3S15 J;  2PUG A;  2EZH A;  1YRN B;  2PUB A;  1RKT A;  4W97 A;  1BW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...