1AU7A

Pit-1 mutant/dna complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
146
structure length
130
Chain Sequence
GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcription/dna
molecule keywords CONSENSUS DNA 25-MER
total genus 44
structure length 130
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1au7A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1au7A01
4A3LJ 4J1XA 1ZQ3P 3PO3J 4C3JJ 1SQ8A 3JREA 2L49A 3GN5A 1JJ6C 2EBYA 3S14J 2R5ZA 3FK6A 4Y52J 3JXDL 4JX4A 4X4CA 1D5YA 1PRVA 1AU7A 4A3GJ 1DU6A 1I50J 1MNMC 2HOSA 1RZRD 4IEJA 4L5EA 1LFUP 3QPLA 4BY1J 3B6CA 5E3NA 2FX0A 2TCTA 2PUCA 1OJLA 1RETA 3BG5A 1WH8A 5E3MA 3CMYA 4PU8A 1QRYA 3DNVB 2OR1L 1ZPQA 3TP3A 4HNVA 1ZUGA 2KPJA 4YBAA 4D5FA 3Q0WA 3I4NJ 1T33A 2JVLA 2AHQA 3FISA 5EZGA 2JCGA 4C2MJ 2IBDA 2EQRA 2HXIA 3HGGA 2AO9A 1WIZA 1ZZ7A 3FYAA 3BR0A 3BTLA 2HOTA 3C2BA 3A02A 4A3CJ 2WV1A 1ETVA 3HOVJ 3PO2J 2O7OA 2IU7A 2LTPA 4QTRA 1R9TJ 3JRGA 4B1RA 1MH3A 2NVYJ 4YG4A 4JCYA 2PMZN 3GBGA 1FTTA 1XC5A 1JKQC 4PU4C 1WH7A 4Y7NJ 1F43A 1YSEA 4YARA 1JT0A 3JRDA 5FKKA 1CJGA 1ZR2A 2XRLA 3Q3SA 2M0CA 1AHDP 1WCMJ 2LVSA 1MBHA 3BR3A 1R69A 2L7MP 3B7HA 1MBFA 2CROA 3OSGA 4M3DA 1GVDA 5J1UA 1P7IA 2PUGA 1ETYA 3SJMA 2DMNA 2B5AA 1JUMA 4IHYA 3A01B 1RPWA 5F04A 2OF7A 3E7LA 4A3IJ 1U9OA 1POGA 3HOXJ 2KEKA 4DYQA 1O4XA 3H3VK 2H1KA 3CQZJ 1T56A 3BQYA 1JFTA 2XB0X 2BNNA 1ETKA 2RAEA 2DA3A 2I10A 3FMYA 4W97A 2DMUA 3L1PA 3PXPA 1HDPA 1Z77A 3QPSA 5K7ZA 2LKXA 3W6VA 1I6HJ 2AW6A 3O9XA 1JH9A 2E1OA 2LLKA 1VPWA 1GV5A 2EZKA 1LE8A 1FJLA 5EGOB 1EFAA 2W48A 2ECBA 1GUUA 5FKOA 2JWTA 3LNQA 3OP9A 1LLIA 2CJJA 5EYRA 5IOZA 4A3BJ 1IJWC 3HDDA 5FJ8J 4BY7J 2MSYA 2KT0A 1H88C 3F52A 1IRZA 4D7MA 5EG0B 4X4BA 4EEFG 4XK4A 3SFIA 1JJ8C 4DZPA 1ADRA 1B72A 1UMQA 3QF3A 2VKVA 3GTQJ 2IVGA 1Y1WJ 2AXZA 1IUFA 2R5ZB 4X4IA 3QYXA 3BQZA 1NK3P 2XSDC 5IP9J 2K9NA 2XGDA 3GTPJ 2R7ZJ 1ZK8A 1ZVVA 1UG2A 3JRIA 4XIDA 2XB5A 2XPVA 5EZHA 2LYLA 3BDNA 3PM1A 3ZQLA 1SANA 3Q0VA 1VF9A 2X48A 1Y1VJ 1LCDA 3OQOA 4C3IJ 3LSGA 1B8IB 2CU7A 1NERA 4C3HJ 4J19A 3FIWA 3G1OA 2R5YB 2DMPA 4J1WA 2HOAA 3GN5B 2M8GX 3QQ6A 5M3FJ 3BG9A 2DA1A 3S1QJ 4RBOA 3M4OJ 1X2MA 4IHWA 3SCFA 1QP0A 2L9RA 1X2LA 1F36A 5J3LA 3CDLA 4X4EA 3HEFA 1JTXA 4V2GA 4XRSG 1BJZA 3R1FA 4A93J 3A03A 2B63J 3DCFA 2JK3A 4FN3A 1VNDA 3NAUA 2G0EA 3OMTA 1QQAA 2EF8A 2LYRA 2TRTA 3GTJJ 3ZQIA 1PUFA 2NVTJ 2DA5A 2DN0A 1W0UA 5IYDJ 1DWKA 1WPKA 2Y2ZA 4B3AA 2M9HA 2LYSA 5K7FA 4BBSJ 1ZZ8A 2EZIA 2EWTA 2IUOA 1LQCA 1Y9QA 2HINA 3VPRA 1MSEC 1PRAA 1R63A 4I6TA 4DYRA 2WUSR 1PUFB 3LFPA 4Z5HA 2LK2A 4JYKA 4MLOA 5M5XJ 2K40A 3JRAA 3LISA 1NEQA 3TP0A 5C4JJ 2IEKA 3TW6A 2DA4A 2XCJA 1QPIA 3OIOA 4OB4A 4M3GA 5F0FA 4X4FA 1U9NA 3ZOBA 4DYCA 4GQMA 4JQDA 2LD5A 1ZAYA 2D5VA 3HB9A 3MKLA 4PU3C 4MIMA 4XRSA 1JGGA 1ZTRA 1RKWA 1K61A 1LFBA 1APLC 5F27A 5DTDA 3HOWJ 1XS9A 1IDYA 2O38A 2NS7A 2HSGA 3HKZN 1YRNB 1UHSA 3OOUA 1NK2P 1QVTA 4FBIA 3CECA 2FD5A 1SFOJ 1Z0XA 4W1UA 2IVQA 1ZR4A 3CROL 2MG4A 5C3EJ 1ITYA 1BW5A 3JXBC 4X1EA 3TEDA 3SCHA 2GZUA 1L1MA 1VFCA 1B72B 3LSPA 2XGEA 1H89C 1BW6A 3SDGA 4ABZA 3BR6A 2CUEA 2EH3A 2ID6A 4A3EJ 3S16J 4O8BA 2O4AA 1ETOA 5J1RA 1JKPC 2Y9YA 3S8QA 3FK7A 2OPTA 3JRBA 2IV1A 3CCYA 5E3OA 2XPUA 2E2IJ 3MVPA 4XRMA 1QVUA 3JR9A 2XJ3A 3G1LA 2BNOA 2ICPA 5M3MJ 2COBA 2NOGA 3QWGA 2IAIA 3IH3A 3SCGA 4MFDA 5A7LA 5IOYA 5FKMA 4XICA 3G7DA 1IG7A 4A3MJ 2HI3A 3MN2A 4V2FA 1IC8A 3M3YJ 2LCVA 4X6AJ 2OFYA 3G1MA 4AC0A 1RPEL 3S1MJ 4A3DJ 4S0HB 2IVBA 1TWHJ 4PU7A 1MBJA 1PERL 1WI3A 2JA5J 3O8GA 2R93J 2NS8A 2DTZA 1FIAA 1JWLA 5GPCA 2LYPA 2YS9A 2E2JJ 1TWCJ 1FTZA 1QP4A 3ZHIA 3LSRA 1B8IA 2ECCA 3S1NJ 1ZZBA 2XGCA 2Y9ZA 1UTXA 2L7FP 3QQAA 2Y0SN 4DZJA 3GBFA 3JRHA 1ZKGA 2VPRA 2R5YA 2E2HJ 2X9DA 5J1YA 1HCRA 2GLOA 1S7EA 4BXXJ 2JMWA 2PPXA 5F08A 3KZ3A 4IWRA 1U8BA 9ANTA 3ZKCA 1PRUA 3Q0UA 5BNGA 2ICTA 3BG3A 1ORKA 4I6ZA 1FIPA 3VK0A 3HM5A 1K83J 2BNMA 2DMQA 2LYJA 2R0QC 3FKIJ 3NARA 3HBLA 3BD1A 4JCXA 4GFBA 2LP0A 1HDDC 3F0CA 2K9SA 2PE5A 1UXCA 2PUEA 3IH4A 3RZOJ 2AXUA 1JUSA 1RR7A 4M3FA 3ZHMA 4IA8A 2EBIA 5IP6A 3DEWA 2KEIA 3BT9A 1DU0A 2QF7A 1H8AC 2CUFA 2FJRA 4D7NA 1ZZCA 5EDNA 2R63A 1RZSA 4CYCB 1EF4A 4BBRJ 1I3QJ 2DA6A 2M34A 4FE4A 3TRBA 4MO7A 4YG1A 4CYCA 2LFBA 2O9LA 2PIJA 3S2HJ 3MLFA 3BR2A 2HYJA 3GTOJ 4UUSB 3JXCL 1GT0C 2WB1N 2KEJA 3HOZJ 5M5YJ 3EUSA 1NTCA 3KJXA 2YUSA 3KXAA 4AYBN 3WHBA 2HDDA 1WH6A 1QP7A 1A5JA 5GPAA 1RZRA 2HQ5A 5IYCJ 1IV6A 3BR5A 2CRGA 3ZQCA 2WIUB 3BS3A 1ZZ9A 4UUTA 1Q1VA 1ETXA 1A6IA 1MSFC 3F6WA 2GBYA 2H8RA 5M5WJ 3CLCA 4I76A 2GM4A 3I4MJ 2DA2A 1RESA 1FEXA 4A3FJ 3GTLJ 3G5GA 1WETA 5F0HA 3GTGJ 2LYKA 1JKRC 3WHCA 3OSFA 1AKHA 1GDTA 3K7AJ 5EGOA 2PUFA 2FJ1A 2KDZA 2LY9A 1OCTC 1MBKA 5K98B 2AUWA 1PNRA 1X2NA 3IH2A 4MCTA 1TC3C 2L0KA 4FCYA 4IHVA 2CQQA 2ELKA 1JKOC 2XPWA 2CSFA 2FQ4A 3LSJA 2K9QA 2LYQA 1IDZA 4GHJA 1VI0A 2GRMA 2JA7J 4LOCA 2PUAA 2N8GA 5GP9A 3RQIA 1HOMA 3H5TA 1MBEA 4B4CA 2BJCA 5FKLA 4MFEA 3O8HA 1BL0A 2LR8A 1HLVA 2A6CA 3ZQFA 5K7HA 2R1JL 1B0NA 2NVXJ 2ID3A 1DW9A 2M2EA 1W0TA 4A69C 4I6RA 4G12A 2AWIA 1LMB3 3S1RJ 4Z5DA 1WGXA 5IP7J 3JRFA 1JUPA 1QPZA 3OQMA 1ZGWA 1Y7YA 2JJ7A 3FYMA 4Z5CA 2X6OA 2MEZA 5EEAA 2EZLA 3IVPA 3LOCA 2AXVA 2MGQA 2JA6J 3UFDA 1ZZ6A 1HF0A 3BTIA 2XIUA 3RZZA 5JLXA 2GRLA 2CQXA 4I8TA 4X4GA 4I6UA 4YG7B 4A3JJ 2L7ZA 1UXDA 4X4DA 3HGYA 4Z59A 4BKXA 1OCPA 2ZB9A 5IPAA 5FLVA 1G2HA 2HXOA 4JP0A 4DW6A 4FTHA 1X57A 2MQKA 3U3WA 1RKTA 5F0CA 3RKQA 3IV5A 1JTYA 3BR1A 2XI8A 3RZDJ 4Y42A 2O49A 5C44J 1ZS4A 2DA7A 2VUMJ 2L8NA 3S15J 2JN6A 1E3OC 2JA8J 1ETWA 5E3LA 3JRCA 4FISA 1POUA 1MH4A 3UKGA 1XWRA 4UUSA 4A3KJ 3S17J 2ME0A 4M3EA 3B6AA 3S2DJ 1TWFJ 4QSHA 1QQBA 1P7JA 2Y30A 1CQTA 4M3BA 4QIWN 2PUBA 5FKNA 1JT6A 2VI6A 5C4XJ 3BTJA 3K2AA 1IGNA 4NDLA 2YU9J 2PUDA 4FE7A 2DMTA 1TWAJ 2O8KA 3A01A 4RDUA 1ETQA 2DJNA 1ENHA 1MBGA 2R92J 3GTMJ 2QCOA 4JX6A 3TW7A 5EF6A 5HODA 3ZQGA 4NDWA 1BDIA 5IYBJ 3HOUJ 4IHXA 2WAQN 1LE8B 3GTKJ 3HZIB 5F1JA 1YRNA 5DS9A 4X4HA 1JFSA 1WH5A 1U78A 4M6VA 2E19A 5JLWA 1AKHB 4AUXA 1GV2A 4MCXA 1LCCA 1RIOA 1OFCX 1TWGJ 3BTCA 2NVQJ 1X58A 2KZ8A 3H0GJ 4IVZA 5FLMJ 2ME6A 2MW8A 5EG0A 3F51A 1BDHA 2VKEA 3OQNA 3ZQHA 4F8DA 4D5CA 3HOYJ 1XG1A 2Y31A 1BA5A 1OSLA 2P81A 2EZHA 3D1NI 4Z58A 4JX5A
chains in the Genus database with same CATH superfamily
2BEOA 4AIHA 2BXYA 2L49A 2WY8Q 1U0JA 4AD9A 2JQ7A 1G3YA 2R5ZA 2BW3B 2FFHA 3U9GA 3KCCA 4X4CA 2J5OA 3EYIA 4H4KC 1AU7A 4PJJA 1EH6A 1MNMC 2M4GA 4A3GJ 1DU6A 2IW5A 3G0TA 3IKVA 2VB6A 3FXOA 2DTRA 3B6CA 5DDGA 2EJRA 2E7WA 2LKSA 3BG5A 4XKBA 5CPRB 5FROA 2ZMEB 5LGUA 3DNVB 3M8EA 1BR2A 1SD6A 1XX5A 3HZJA 3QP6A 3W6JB 1ZUGA 3QPTA 3TOAA 1WQ2A 3CMEI 1ZG3A 4D5FA 2KRCA 4GYGA 2JVLA 2XRNA 3C2GA 2AHQA 3IUOA 3PNTA 2IBDA 2JSCA 1OPCA 2HXIA 2AO9A 3HGGA 3D5SC 2G7HA 2EV6A 3RYRA 4E7SA 3A02A 2CSOA 1Y6IA 5J47A 1BI1A 4LMYA 2O7OA 4GXOA 4QTRA 5HVQC 1FYKA 1ZG5A 4B1RA 1FT9A 1X4OA 2PMZN 2VXDA 3GBGA 1XC5A 3TKYA 3K70C 2X6XA 3A0BC 2XROA 1TLHB 1F43A 1YSEA 1Y0UA 3JRDA 1BIAA 1PJRA 3OYLA 3Q3SA 4IOCF 1R5ID 1WCMJ 1R36A 1MBFA 1IUYA 4PUSA 1GVDA 2LLVA 1YYVA 2HU9A 4HF1A 2PUGA 2IP2A 5CQEA 3TQNA 3DF8A 5LHIA 5D5XB 4IHYA 1RPWA 2OCCH 4PSWA 5F04A 4BGDA 5LEKA 4U87A 2VLAA 4H0EA 4LITA 3KYDB 4Q2JA 1V4RA 2GAUA 3KYLA 1TQMA 1FYLA 3CQZJ 3CZ6A 3CF5F 2RDPA 2CQNA 2BNNA 1Y39A 4CXFA 3L1PA 1HDPA 2LKXA 4N4NB 1I6HJ 1EV7A 1JH9A 2E1OA 3MEJA 5BQTA 1LE8A 4HDUA 2DK8A 1NG7A 1P4XA 3CUQC 3NDBB 4ZJZA 4LB6B 5FKOA 3S8PA 1YFHA 3OP9A 1LLIA 2FEZA 4ENKA 5IOZA 3HDDA 2GWRA 1SD5A 1R1VA 3DWLE 3SHFA 2KRFA 1PYVA 1ADRA 3ABLH 3ZN1A 2VKVA 1LUJB 3SZTA 3GTQJ 3IWFA 4FQGA 2AXZA 3OOPA 3WGHA 3H3UA 4LK0F 1OCOH 2AQFA 2H6CA 1EKEA 3GTPJ 3NZLA 1UG2A 2P7VB 4ZH4F 2XB5A 1LNWA 2LYLA 2LOOA 2BY2A 2KIMA 2JPBA 1VF9A 4BQOA 2ZKZA 3OQOA 3LSGA 3R60A 4MHGA 1V5EA 2K3PA 4OINF 2CU7A 1W5CC 3LFUA 3ERMA 1ZARA 5F64A 1NERA 1WJAA 4Z2YA 5K5RA 2O3FA 2HOAA 3U21A 3PE5A 2Z5UA 5E1WA 2M8GX 2X51A 3DV8A 2BW3A 3E5UA 4IHWA 3F8MA 5LD2C 4ZZLA 3AG4H 4HOBA 1D1CA 1XTAA 4E7HA 3L00A 4EV0A 2EILH 3ECHA 5J8CA 3KL4A 1BJZA 1SAUA 3VFZA 3A03A 1ULYA 4FN3A 2K85A 1D0XA 3OMTA 4LFUA 1QQAA 3HUGA 2PXEA 3TDZC 2VJJA 2HOEA 1MJ9A 2M45A 1XMXA 5FFZA 4IOAF 3HRUA 1PUFA 2NVTJ 1HA8A 1W0UA 1DWKA 1WPKA 5E1ZB 3GO5A 2X4HA 4KJZA 4B3AA 4U7BA 2LYSA 1ZZ8A 1LQCA 1YQAA 2MC4A 3R4KA 4HX8A 3J81Z 3ZMTA 1R63A 4I6TA 3D5LA 3K4MA 2WUSR 1PUFB 3CUQA 4Z5HA 1AWCA 1KA8A 2O0YA 3ZQ7A 2BE5F 3I64A 4MGRA 2K40A 4M74A 2VOPA 2VC1A 3GF2A 2C6YA 2E60A 2HDWA 4RAYA 1SFKA 3TW6A 5D5UB 4LK1F 4M3GA 1T8IA 1Z3XA 3FDYA 2VOOA 5GAHJ 4GQMA 2VT2A 5HNHA 2CV1A 2VJIA 3HB9A 1UHWA 4ZC3A 4XLPF 2W25A 2EA2A 2VEOA 3QYBA 1RKWA 5HNFA 5F27A 4CSWA 1G3WA 4DBQA 2O38A 1QU3A 4IX7A 4IHSA 3FXRA 1Z0XA 1SFXA 2IVQA 1I1GA 2QBYB 1R00A 1HW1A 3GZDA 2P5VA 2QSFX 1L1MA 1VFCA 1DPRA 1SVMA 2VKDA 2XAFA 2XGEA 4A0XA 5JI6A 1H89C 1FOKA 3NXHA 3SDGA 4O8BA 3FMSA 3K2ZA 2ZNYA 1I3AA 1ETOA 1JKPC 3S8QA 4GCVA 2IV1A 1FBQA 2I8DA 3L2UA 1QVUA 3E6BA 3M1EA 5CVVA 3MWMA 2BNOA 2COBA 3WGIA 4IO9F 2ZBKA 3T5XA 3IH3A 3RQ4A 3KEYA 1FZPB 2QUFA 2KMUA 3GVAA 4AIDA 5IOYA 5FKMA 2L3DA 2ZFUA 2EIKH 2MLGA 2HKXA 4P9UA 3P9KA 1IG7A 2WB1A 4OAYA 3H1CA 3CESA 3M3YJ 4BXFA 1Z05A 2OFYA 2NNNA 4L9NA 4BYYA 1I5ZA 2DTZA 3KE2A 1FIAA 4E6KG 2YS9A 4LG0A 5KK1A 4Y3OA 1FTZA 1QP4A 1LFPA 3J7ZI 3ZHIA 3JAMK 2HFZA 2DYRH 4EATA 4CZZA 3QP5A 4UV8A 1ZKGA 2E2HJ 4BXXJ 2VQGA 5CVJA 3RTRA 3ULQB 3AG1H 1N25A 2PPXA 3KZ3A 9ANTA 3ZKCA 3P7NA 2ELHA 3K10A 3S32A 3VODA 3K4JA 4IZZA 1ZREA 3DBRB 3HSRA 1QA6A 1FIPA 4G9YA 1MKMA 3TO7A 1K83J 4BACA 2EV0A 4DE9A 4EQQA 4QLCU 1U2WA 1B59A 4MEYF 2R0QC 2LYJA 1ZGAA 3HOTA 2A6HF 1O3QA 1RUNA 1Z7LA 4KN7X 4JCXA 4GFBA 3LA7A 1HDDC 3F0CA 2HKOA 2PE5A 1GVJA 3LL7A 1UXCA 1YIJI 2PUEA 1JUSA 3IAS2 3CCEI 2PXLA 1TT0A 4DBRA 4XLFA 1H8AC 2FJRA 2P7CB 2R63A 3FXLA 4OOIA 1ZLJA 1RZSA 2H8WA 4PGGA 1MMNA 4BBRJ 1I3QJ 1IAWA 2CO5A 3E6DA 4BUPA 4HZFA 3FZVA 4CICA 2PIJA 3E0JB 3BR2A 4NB5A 1XN7A 3JXCL 2HQAA 3OKZA 4KNYA 4HPQA 3ROUA 2JSPA 2YUSA 1SD7A 2LYCA 5DD8A 4AYBN 2V7FA 1HW2A 1Y8RB 1MW7A 3BJAA 1KU3A 4B8XA 5IYCJ 1IV6A 5D6EA 1SVOA 2X6WA 2CRGA 2WIUB 3OYKA 4G6DA 3CDHA 1Z6RA 1BC8C 1ETXA 2XSJC 4P1WA 1MSFC 3F6WA 1S7AA 2L5QA 1T38A 2H8RA 5M5WJ 1QZXA 2GM4A 1MGTA 4UVAA 3GTLJ 5F0HA 1FOWA 2LYKA 3WHCA 3K7AJ 3H9QA 2PUFA 4N0BA 2FJ1A 2QVOA 3TBIA 2LY9A 2R7RA 2QQ9A 2AUWA 1YX5A 4WWCA 1E3PA 1X2NA 1QNTA 3RIRA 1K7AA 3QODA 2B7EA 4PSXA 4WVLA 5KCMA 2OZ6A 3I5UA 2CSFA 2FQ4A 2WY7Q 3TDUC 4MTDA 2K9QA 1IN4A 4ESFA 5JHFA 1NHAA 2Y69H 3IL2A 5TJJA 4OIPF 2N8GA 3RQIA 3PSFA 1YO5C 1XCBA 2AQEA 3KP6A 1KYZA 5ICGA 1A35A 1B0NA 1GXQA 2ID3A 1YHQI 4MTEA 2XAJA 1W0TA 3HRMA 2A05A 3IC7A 3O2PE 3WU1B 4G12A 4XONA 2LG4A 1U5TA 3PFIA 4XKVA 2VKHA 2UUZA 4BJTA 2J5PA 2RV8A 3TELA 3D0SA 1ZGWA 2F5EA 2KDOA 3OYJA 1E17A 1H9GA 1P9QC 3M07A 4L5JA 1XSXA 4PJ0C 3OWQA 5LEJA 5BPDA 5L3CA 4BDYA 2KIQA 2XIUA 3RZZA 3CP8A 2K7LA 3F22A 1VQ9I 2EIJH 1UXDA 3HGYA 4BKXA 3WE2A 3ECOA 5GTIC 2PXDA 3BWGA 2MA3A 4ON0A 3CCJI 2WBMA 1XB4A 1YW7A 1RKTA 5F0CA 3CCVI 2BOLA 4NC6A 1MJBA 3RZDJ 4Y42A 2PXPA 2E1CA 4BAYA 3KEOA 2VUMJ 3S15J 1X1DA 5H20A 2JA8J 2V1UA 3PUBA 5E3LA 1QO0D 4L0ZB 5HS7A 3UKGA 1VTNC 4UB8C 5D8KB 3S17J 1LB2A 1G3TA 3WGGA 4Y33A 4MNUA 4QIWN 2PUBA 5FKNA 4UB6C 5C4XJ 3BTJA 4NDLA 2PUDA 1TWAJ 4RGRA 3A01A 2DOAA 3K1NA 3H35A 3OIPA 2DJNA 4A5NA 2H09A 2H1LA 2R92J 4JX6A 3ZQGA 2QBYA 1L3LA 1JHHA 5FFXA 3B73A 4LJZF 1LE8B 3GTKJ 3HZIB 3FHZA 1UFMA 2ZXJA 3WTXC 5DS9A 2KPMA 2Y48A 4X4HA 1WH5A 2JTVA 4PDKA 4MCXA 1P2FA 4HEA2 3KLNA 3DPUA 2CS3A 2A3SA 1RIOA 1OYIA 2VPLA 2NVQJ 3J7AY 4MQ9F 2RQQA 3H0GJ 3RKXA 2KZ8A 4KT6A 2UV1A 5EG0A 2LREA 3F51A 2X6YA 2EA4A 3AFHA 1YS6A 3R6SA 4JOMA 1FBSA 2Y75A 4F8DA 1O3SA 3ONQA 2PXKA 3J80Z 3V7CA 5B66C 5KAIC 2EZHA 1IN7A 4AU7A 4JX5A 4A3LJ 4ER3A 3E3VA 1ZHFA 3PO3J 4C3JJ 3GFMA 1WZ2A 3GN5A 1LPQA 4HSTA 2EBYA 1CF7A 3FK6A 4JX4A 3DKYA 3H3ZA 4IKFA 1I50J 2MH9A 1D8KA 4QPOA 4GO1A 4IEJA 4L5EA 3U1KA 5KHDA 3DTIA 4FX0A 2IGKA 3K4CA 5E3NA 2ZO4A 5DUKA 1OCCH 4JQFA 3J7YJ 1RETA 2DO7A 3DM5A 4PU8A 2OR1L 3GYHX 1ZPQA 1DDNA 4HNVA 2VQCA 2L01A 4C9YA 4YBAA 1Z9CA 2GXAA 3BCAA 5B5EC 3PQKA 3KP2A 3QAHA 3I4NJ 4FASD 3LSIA 4C2MJ 2VE9A 1Y56A 2K9MA 2M3AA 3RKWA 1ZZ7A 1SAXA 5DCMB 2ZSHB 1MDMB 3C2BA 3MAJA 1N78A 2WAQA 2EWNA 2R7WA 2UWMA 2EFQA 4ZZDA 4CH7A 1YJNI 4LB5A 3I59A 3HOVJ 5CVIA 4IHTA 1GHCA 3ABMH 2CW7A 1FWZA 3EUHA 1SFEA 4G6QA 2DOEA 5JR3A 2YX7A 3IWZA 2NVYJ 3S3MA 4JCYA 2LBFB 4XKWA 1FTTA 4PU4C 3SZGA 1JKQC 2LNMA 2DDAA 2P0WA 1RC9A 3IAM2 2XASA 1NW3A 1KZHA 2FOWA 5FKKA 2O8XA 3MZ8A 3WU2C 2XRLA 4EK9A 4BJ5C 3JW4A 3VEPA 5JUWA 4KT5C 1MBHA 2L7MP 2GIZA 3LQQA 3OSGA 5KAFC 5J1UA 3SJMA 2DMNA 1YLFA 3ZN0A 2IGMA 1USTA 1B1BA 1MNEA 3OS2A 3G71I 3L2RA 1ZG1A 3VYUB 3FMQA 3SYTA 5K5OA 1KYWA 2I5UA 1T56A 2CUZA 3BQYA 1JFTA 3G73A 5L3DA 2I10A 2CUJA 3MMYB 4ER6A 2FOKA 2XF6A 2PQ8A 2GQQA 3CDIA 3W6VA 2VODA 5DM7F 2AW6A 2LLKA 3GZCA 2DFIA 1GV5A 2EZKA 1FJLA 3WTZA 1UB9A 3EPZA 3LQXA 4OAZA 2JWTA 3LSHA 5EYRA 4A3BJ 1IJWC 4NQWA 1H88C 3E6CC 1IRZA 2JRMA 1WJDA 2K02A 2R7VA 3OY9A 4X4BA 4EEFG 1MMDA 3HSFA 2QWWA 2OTLI 1SC7A 1G3SA 2A68F 4X4IA 1Z1DA 2R5ZB 2XHKA 2PMZA 1WFXA 2XSDC 5CVRA 5IP9J 2HTSA 3OYGA 1NK3P 4OBMA 2YBDA 3ME5A 3OIQA 4EJOA 2HDCA 1OLTA 3LQRA 4EM0B 1X3ZB 2KIUA 4BHCA 5JVGF 2Q0OA 1SANA 3Q0VA 5E79C 4I99C 1V55H 1Y1VJ 1VQMI 2PI0A 4C3IJ 4J1WA 3GN5B 3JTHA 4AWXB 1HKQA 3S1QJ 2DA1A 3M4OJ 1X2MA 5J4YA 1ONVA 2NS0A 1DUXC 1VQ5I 4ZYHA 3I55I 4DE8A 2W1OA 3JAMZ 3P9CA 4EKGA 5DRYA 1XDSA 2B63J 4A93J 5L3EA 3K4BA 2JK3A 4KIFA 1B6AA 4HRAA 4XQFA 1NH3A 4L9TA 4IL6C 1TT5B 3SEQA 2LYRA 2TRTA 3GTJJ 4HSRA 5D5VB 2DQLA 2FBHA 2DA5A 1Z21A 2ZFWA 2JQEA 2XVCA 4Y4RA 5TRDA 2QSGX 5GAGi 2F48A 3K69A 3LA2A 4TV7A 2EB7A 2HS5A 2OC6A 2WA0A 4P5OA 2DCEA 4YG2F 1Y9QA 2HFHA 3I59B 1MSEC 2D2WA 1BM9A 1IXCA 2JUGA 2VN2A 4RLQA 2HVRA 3FX3A 2LK2A 2OQGA 3KYCB 4AVZA 4MLOA 4Y13A 3JRAA 4XOPA 3SXYA 3JTGA 5C4JJ 2IEKA 2XCJA 4XSZF 3OIOA 1QPIA 3IRQA 3NRVA 4R79A 3AG2H 1USSA 1EA3A 4DYCA 4HYEA 1FOYA 2E1NA 2D5VA 5HDNA 3MQ0A 2V1XA 2BVMA 4XRSA 2VC0A 1JGGA 1ZTRA 1W7PB 1LFBA 5CLSA 5GAGJ 5DTDA 1IDYA 2NS7A 1UHSA 4ITVA 4FBIA 3H5NA 4ER0A 4NNJA 2PX9A 4LLNA 1R71A 1XGMA 2O03A 2VQHA 3OWTA 3TEDA 3SCHA 3NWSA 1B72B 1ODDA 3W6KB 5J6XA 3LSPA 3GEZA 4CO8A 1BW6A 2EH3A 2XUBA 3FXUA 2O4AA 3EETA 4CDGA 3JRBA 2DT5A 2B9SA 2XPUA 3FXJA 3MD2A 1HKSA 3HYIA 4E7ZA 3ASNH 1QBJA 5E20A 3JR9A 1BJAA 1Z6TA 5FLXK 1GXPA 3HKZA 1DP3A 3Q5FA 3BC8A 2MD0A 1YJ9I 4OU0A 3CCUI 4GRIA 2NOGA 1T2KA 3HIFA 3K70D 3QWGA 2IAIA 4BXUA 4MFDA 2HCSA 1E2XA 5A7LA 4RM3A 2XXAA 1JI8A 4IXAA 1YIOA 4XICA 1IC8A 2LCVA 1XSDA 3CC2I 2CV0A 1RPEL 1R7JA 3PFYA 1DGRM 1LEBA 1E0EA 2K5CA 2A6TA 3T8TA 3PQJA 2R93J 2HNHA 2CW8A 4Q47A 5GPCA 2LYPA 2CV2A 1EH7A 1YS7A 3WG7H 5CQGA 3LSRA 1B8IA 3S1NJ 2Y9ZA 3OYDA 3JRHA 2XAGA 2X9DA 2Z2SB 5J1YA 2GLOA 3PIOF 1MJAA 3ZCOA 1U8BA 1RZ4A 5J40A 1QHHD 5BNGA 1SFUA 2ICTA 4HBLA 1R5HA 3IHUA 4UNOA 3VK0A 5FRMA 1J59A 4LGWA 3ESWB 4CCKA 2DYSH 4ZYEA 1BC7C 3NARA 2LP0A 2M0MA 4DGWB 3ZR8X 4BH9A 2K9SA 3L2WA 2L7KA 3ZHMA 3RZOJ 2AXUA 4BJ6C 4IRIA 4A6DA 3DKWA 4C30A 5IP6A 4MEXF 2A5WA 5EDNA 1T0FC 1OISA 3DLLF 5CYVA 2BY1A 2O9LA 5HLTA 2NAZA 3SX0A 2ZJRF 3R0AA 1XMKA 2FMYA 2HYJA 3ISPA 1KU2A 1GT0C 1S5LC 2WB1N 2WC2A 3HOZJ 1VQ4I 5E8GA 1NTCA 3KJXA 2X0LA 2HDDA 1H0MA 4O5VA 2FE3A 5CVUA 1Y8QB 1R49A 2Z16A 2VL8A 4UHTA 4U0VA 2EFWA 3KP5A 2E71A 4S05A 2V26A 5E8IA 1W36C 4CCJA 1Q1VA 2KZVA 2BVLA 2H94A 3ML6A 3OL3A 4Z6YA 1SMYF 3G3ZA 3I4MJ 2DBBA 1FEXA 2XIGA 1WETA 2ISZA 1JKRC 3OSFA 1MMAA 4BE0A 1MBKA 2LLWA 4U88A 4O6JA 2KQRA 1PNRA 1IRGA 1TC3C 2L0KA 4KITB 3HSEA 2BBYA 4LG3A 4BHPA 4KISA 3OR2C 1JKOC 2L4AA 1PP7U 6PAXA 3LSJA 1SMTA 2LYQA 4GHJA 3SDBA 4XORA 1YG2A 4ZDPA 3GUUA 3PSIA 4G7HF 3H9JA 1ON2A 3KIOA 1P4AA 2IGNA 4E7LA 4B4CA 2BJCA 3O8HA 1BL0A 2A6CA 2R1JL 3ZQFA 5K7HA 3UNGC 2HTJA 2NVXJ 2F4MB 2P6SA 2M2EA 3F6VA 1PP8F 5LHGA 3S1RJ 5BPIA 4KIGA 5FRNA 1WGXA 2MLKA 1X3UA 1YOVB 4NBQA 1JUPA 4I2OA 3BZKA 3F8BA 2F5FA 1LVAA 3IKTA 2MABA 2O5RA 5ILUA 4GYIA 2IS6A 2K9LA 1KQ8A 3BROA 2DFEA 4CGZA 2DDBA 5EEAA 4OIQF 3G4SI 2VBWA 3HHHA 1IRXA 1IO2A 4I09A 2AXVA 3GUDA 3K4KA 3RPQA 3IVPA 3JSOA 2NRAC 1ZZ6A 3SZPA 2GRLA 1LDDA 5TGTA 3M7GA 3ZXSA 1VQ7I 2ZMEC 4I6UA 3H36A 4YG7B 4A3JJ 4F55A 2L7ZA 2WADA 4XLNF 4I0AA 4AM3A 2ZB9A 2R7XA 5IPAA 3ZP5A 1IXRC 2M30A 4JP0A 3ZPXA 3TGNA 3DEUA 2KJBA 5DM6F 1KU7A 2JUCA 4HF0A 4RMNA 1JTYA 5H2FC 3HOSA 1TW2A 2XKOA 2GZWA 2XF5A 2DA7A 2ELJA 2P8TA 1UCRA 4IRHA 1KQ9A 1ETWA 1NG6A 4FISA 1WHUA 1MH4A 2ISYA 2V6CA 2ZJPF 2HVQA 4A3KJ 2HQNA 2ME0A 2VQLA 3B6AA 4KN4X 3S2DJ 4EVIA 1QQBA 1P7JA 3AKZA 1IZ1A 1ZAOA 4P55A 5FO5A 3MKYB 3TO9A 2KZGA 2D45A 1VQ8I 2ZCWA 1A36A 1LQ1A 4J00A 3MFKA 1ETQA 2FNPA 2L54A 2PJRA 2F5VA 4UXNA 1K79A 3HJEA 5D6FA 2LC2A 2ADUA 3TW7A 5EF6A 5HDGA 1J09A 3CC4I 2PFBA 5LGTA 2NYXA 2EINH 4XKCA 4A0ZA 5EJCA 3TEPA 5F1JA 3CP2A 2YPRA 1WI9A 3DEEA 1IN8A 4YFKF 3UR3C 1JFSA 1LCCA 1GV2A 3W2VA 1OFCX 3OYNA 4ESJA 3HRSA 5HOOA 2BZTA 4F93B 1W5SA 2V1NA 2VKEA 3OQNA 1FP2A 1VQKI 2F2EA 1R1TA 4D5CA 3OYFA 3W2AA 2V6EA 2KP6A 2EFNA 2GXGA 1BA5A 2P81A 3WTUC 3GLLA 5ICFA 4BS9A 3FF5A 3DU6A 4J1XA 4O3MA 3AG3H 5ICEA 1ZQ3P 1WJEA 5LGNA 3JREA 1D8JA 3S14J 4Y52J 3JXDL 3MKZA 1V3FA 4BEHA 4EMSA 1QB2A 3DXJF 1OQYA 1OMIA 1D5YA 2HOSA 2OV7A 3N05A 1RZRD 3L7WA 3FXMA 4BY1J 3U2RA 4XN0A 2LF8A 1XPXA 2TCTA 2IXSA 2W57A 5H6QA 4D0PA 5DCFA 3ZMDA 2PUCA 2QEXI 2QSHX 3QOXA 4PFPA 5JHUA 5E3MA 1QRYA 2M4KA 2V79A 5JFRA 2YX4A 3RDIA 2PXVA 2XKPA 3Q0WA 1T33A 3FISA 5EZGA 5J8FA 4F92B 3I0TA 4HV6A 4U7DA 1WIZA 2L9NA 2DLLA 3BR0A 3QYEA 2HOTA 2J7UA 4U0YA 4A3CJ 1YW9A 1UG0A 2E36A 3ZRGA 2IU7A 2LTPA 2LY1A 3GX4X 2BY3A 1O7LA 1J75A 2QKMB 5B1BH 4UUVA 1MH3A 4YG4A 3KLOA 1RUOA 4ER7A 3GWZA 2L02A 4B43A 4EQZA 2LF7A 2M8EA 4YARA 1CJGA 4HAMA 1ZR2A 1JGSA 2V9KA 2M0CA 2W00A 1AHDP 3BR3A 2LVSA 3B7HA 4DOZA 3BPXA 2CROA 2ACJA 2M5WA 1R23A 1G8XA 3I3LA 3C18A 2B5AA 1D1AA 1JUMA 1YX3A 2E1MB 4ZYGA 1WJCA 2P4WA 3HPHA 5ERIA 3A01B 2KFDA 4E7KA 2OF7A 3DPTA 4A3IJ 1U9OA 4OIOF 3HOXJ 2KEKA 4DYQA 2LNBA 1O4XA 1VQLI 3H3VK 2J7WA 2PEXA 1T39A 5BOXA 2XB0X 1KGSA 1ETKA 2RAEA 3A9XA 2DA3A 1BR4A 3CJTB 2AS5F 4DQ2A 3KETA 4GGGA 5K7ZA 3EYYA 3RPUD 1J2XA 3L2QA 2UXXA 3O6BB 1VPWA 1ZGJA 5ILVA 5EGOB 2W48A 2CFOA 2VONA 3GW2A 3CD6I 4GDFA 2CJJA 3NWTA 1V5GA 2IVMA 3KFWX 4ZTFA 2ESNA 5FJ8J 4BY7J 2MSYA 2KT0A 2MXDA 1Z3YA 5EG0B 2CG4A 5A2QK 2QLZA 3SFIA 3ABTA 4DZPA 1B72A 4FT8A 1FSEA 2IJLA 1K78B 4CCOA 2IVGA 1R4NB 1Y1WJ 3NROA 1IUFA 3K1PA 3QYXA 3N4MA 2DPDA 3BP8A 1S29A 1H9TA 3G2BA 2V3CC 2PXUA 4OMYA 1ZK8A 2M1BA 2L2OA 1BI0A 1IF1A 5ILSA 3DPLC 5EZHA 2CMPA 3FM3A 3BDNA 3PM1A 2PLYA 3K9TA 3ZQLA 4HG2A 3OMYA 2X1EA 2X48A 1B8IB 1AA7A 4YIFA 4J19A 1X4PA 3FIWA 2DMPA 4M6YA 1DP7P 3Q9SA 5HLGA 2DFFA 4OWRB 1OYYA 3QQ6A 4XL9A 1QP0A 1X2LA 3CDLA 4X4EA 3BOQA 4V2GA 4XRSG 1U8RA 1WVRA 4CCMA 3ZGKA 3H5AA 1KQ0A 5LFAA 3NAUA 4UVBA 2RVCA 5DV5A 3HL2A 2FA5A 1S72I 2VASA 1MDMA 1FOXA 4EJWA 1I1SA 2DN0A 4P96A 2M9HA 5ED4A 2R7FA 1HSJA 5EEHA 1R6RA 1R4MB 5K7FA 4BBSJ 2IUOA 2E1MC 1D5VA 3NEUA 3VPRA 2L4MA 1XDUA 1PRAA 2XAQA 2HR3A 5BMZA 2Z3YA 4CUGA 1WJFA 3TMOA 2W84A 2O6GE 4NHJA 3LFPA 4EKIA 4BU2A 4JYKA 4Y17A 2IA2A 3KX2A 2JA2A 2DA4A 3BY6A 1X3WB 4NC8A 5F0FA 4X4FA 1LVKA 3GZNB 3ZOBA 4JQDA 3PUFA 3R0JA 3OYHA 2LD5A 2X85A 1ZAYA 4L9VA 4LIVA 1WJBA 3MKLA 3DFGA 3GFLA 4MIMA 3CUQB 2GA1A 2RC4A 4F52A 1K61A 1C0WA 1S7OA 3FBIB 3N97A 3ZMZA 3FXQA 1XS9A 1OCZH 3O3KA 4WXCA 1NK2P 3CECA 1P6RA 2CQ7A 2L9VA 1K6YA 3LSTA 4EGZA 1YW8A 1ZR4A 3FWEA 1QZYA 3RPUA 2MG4A 1ITYA 3JXBC 5IT9K 4X1EA 2DK5A 3CLOA 1W36D 3LSKA 2GZUA 4WX9A 4ER5A 4ABZA 4A3EJ 1MZBA 2CUEA 2ID6A 5J1RA 2JZYA 2Y9YA 1WJ5A 3H9GA 4WXDA 5A2QZ 2OPTA 3CCYA 2YSRA 2E2IJ 1T6SA 1TQIA 2OAZA 3KPHA 3MVPA 4XRMA 3VYTB 1K4TA 2XJ3A 1PDNC 3WTWC 1J5YA 2DJIA 3BPVA 3F23A 3G1LA 1IN5A 1JHFA 5M3MJ 1JXSA 1ON1A 2JT1A 3EUKL 3B02A 1L0OC 3W3CA 3DBLB 1ZRFA 3GFJA 1DPUA 2AXTC 3KEQA 4A3MJ 2HI3A 2ZXWH 3MN2A 4EM2A 2M87A 2CWEA 4XLAA 3G1MA 4AC0A 1TW3A 3S1MJ 4A3DJ 4S0HB 1W1WE 1TWHJ 4PU7A 1WI3A 3KZYA 5CJ9A 4LG0B 3O8GA 3V8LA 5L3BA 2E2JJ 3VWSA 3V42A 4II3A 2VJ4A 2JCGA 2ECCA 3GBFA 1UTXA 4KYWA 3QQAA 3CO6C 2ZSIB 2R5YA 2VPRA 5DTQA 2M4HA 1HCRA 2RQPA 1S7EA 4IWRA 2JMWA 2R7TA 2RREA 2E5NA 1PRUA 4E70A 3E97A 4ETSA 4M71A 2ICWG 5DUIA 3BG3A 5LRSA 1TNSA 3QOEA 4R1HA 3SEZA 3A9ZA 2BNMA 4PFOA 2IS1A 1R22A 3WTTC 3FKIJ 4HQMA 3HBLA 4IQ4A 2O61A 3BD1A 5BS6A 1SVLA 3K4NA 4YRVA 2ZJ2A 2UXNA 2VXZA 1S9HA 4PJMA 1Q1HA 1RR7A 4M3FA 3LFKA 4IA8A 2HYFA 2TDXA 3QU3A 2EBIA 2FXAA 3DEWA 3V7RA 1F5TA 3GZ6A 2KEIA 2QF7A 3HUGB 3OV8A 2VIXA 2F5CA 1ZZCA 1BI3A 3KZIC 1D0ZA 2MFZA 4JBAA 4CYCB 4L0YB 1U3EM 1EF4A 2EK5A 3FHNA 5LBQA 2DA6A 2M34A 2OBPA 4FE4A 2ZNZA 4YG1A 4CYCA 2LFBA 1FNNA 1W7PD 4XN3A 1O57A 3OYCA 3V8JA 3GTOJ 2FNAA 5LLQA 4CYDA 3EUSA 5M5YJ 3EQLF 3KXAA 3LSMA 3A4CA 1WH6A 1A5JA 4V19K 1OR7A 1RZRA 1QZZA 2HQ5A 3ZMUA 5EEGA 2VJ5A 4ENMA 1FBUA 1ZYRF 2X1CA 3BR5A 4UY8I 4ENNA 3ZQCA 1FC3A 1W7PA 3F6OA 3BS3A 4U0WA 2IPQX 1ZZ9A 5HLIA 3CCSI 1XGSA 1M1EB 3Q9VA 2IGOA 3QWLA 1ACIA 4UUTA 1K6OA 4A6EA 3A0HC 2GIVA 2GBYA 3HTUA 4XLHA 4NUBA 2M7BA 5JVTA 3CLCA 1Z67A 1X1BA 3WE3A 4A3FJ 3JCUC 3VB2A 1YITI 1AKHA 4L5IA 4F91B 4RAFA 4UV9A 1ZRCA 1MD0A 1T95A 5DEQA 4KMUX 2XC7A 1QZEA 3IH2A 4WF2A 3MZYA 1KONA 2ZXHA 4KFCA 1LDJA 3OL4A 3AL0B 3L09A 5F6FA 4IHVA 3F3XA 1D3YA 4B09A 2Z1DA 3WTYC 3ELKA 2HPIA 1Z91A 2XPWA 1T0FA 3E6MA 3H0DA 3OS0A 3S3OA 4BE1A 2HVSA 2QENA 1IDZA 5DRTA 3QU6A 1U6GA 2GRMA 2JA7J 4LOCA 2PUAA 5GP9A 3J81K 2IA0A 3H5TA 2VBYA 5L3FA 5AIQA 5HDKA 2LR8A 1O7FA 1HLVA 2KRHA 2E7XA 1X1PA 3I56I 2BXZA 1DW9A 4EZIA 3REOA 4A69C 2AWIA 2CQKA 3S3NA 1RNLA 3JRFA 2H6BA 2HCNA 4JK1X 4HNUA 2XAUA 3R61A 2DT7B 1N77A 3KP4A 2DXIA 3OQMA 1QPZA 1MNDA 2K4JA 4XR6A 4A5MA 2JJ7A 5KNLA 1Y7YA 1BN5A 3FYMA 4N9HA 3OYIA 3R09A 3FBNB 4ZTJA 2MEZA 2EZLA 2XGXA 2L1PA 3LOCA 4Q48A 3UFDA 4FX4A 1Z7UA 1HF0A 3BTIA 2UZKA 2QQ8A 3CJQB 2DAOA 4I8TA 1KU9A 3DQVC 2STTA 3L2CA 4XMYA 4ZYAA 2KISA 4J01A 4Z59A 4D1QA 1OCPA 1TNTA 1G2HA 2HXOA 4DW6A 3F8CA 2AXLA 2QA4I 3M8FA 4XNFA 5K5QA 4B47A 2XAHA 3IV5A 1D1BA 4A2UA 4IJAA 1XGNA 3BR1A 1A04A 4CZCA 1ZS4A 2W4SA 2P6TA 4YFNF 1HXDA 3WTVC 2JN6A 2R3SA 1Y0NA 2MYSA 2FQ3A 4BHBA 4UUSA 1TWFJ 3DTEA 1SD4A 4XLCA 5K1YA 1CQTA 2XDVA 2RGVA 2Q2EB 4M3BA 3WODF 1ZN2A 3F8FA 1JT6A 2VI6A 4EJVA 3K2AA 4HW0A 3FMRA 5TISC 3CJRB 1EH8A 2O8KA 4BQNA 5DD4A 1WWXA 2YR2A 1ENHA 1MBGA 4RGXA 1QHGA 4RA2A 2PXFA 1BDIA 5IYBJ 3LAJA 4FHTA 3VYRB 4M9ZA 1T98A 1YRNA 2B0LA 3G6EI 1U78A 1PVEA 1XGOA 2E19A 4AUXA 3QFIA 1K4SA 4N9IA 1TWGJ 3BTCA 2WAEA 1X58A 1XSVA 4RB0A 3CTAA 2ME6A 1TBXA 1BDHA 2EIMH 4G6TB 3DTKA 4I02A 2MC3A 4N4OB 3I58A 1TL8A 1HKTA 2PN6A 4ZDOA 3CMAI 3HOYJ 3BDDA 1TTYA 1XG1A 1F9NA 5FD6A 2R7SA 2GA2A 1YTYA 3E5QA 2Z99A 1FMVA 1X1CA 1SQ8A 4HLYA 4EGYA 1JJ6C 2DOFA 1A31A 3LA3A 3S2WA 2PXBA 4XSXF 2FU4A 1VQOI 4G94A 1RIOH 3CF2A 1PRVA 2BV6A 3BZ6A 2A61A 1HBXG 2V9PA 3CLQA 1LFUP 3QPLA 1ZH5A 4M73A 2FX0A 3GZ5A 1OJLA 4HX7A 2DFHA 4CCNA 4II2A 3D5RC 3CMYA 1JE8A 1WH8A 2OJED 3TP3A 2E34A 4RAZA 1F4KA 2WV0A 2KPJA 1TZLA 1I39A 3KZZA 2KKOA 3MKWB 2RKHA 3GMEA 4RS8A 4LLLA 5B1AH 2EQRA 1S8NA 3FYAA 3BTLA 3CC7I 2WV1A 1ETVA 3H5RA 3I53A 3PO2J 1R9TJ 2HEOA 2V4JC 2BY0A 2HZDA 3JRGA 2FUG2 2CYYA 1X19A 2D1HA 2OA4A 3BCBA 3C2HA 3GZDC 4YFXF 2Z9OA 1WH7A 2KHMA 4Y7NJ 1JT0A 1IV8A 1N75A 3PJRA 1STZA 1ZELA 1IRFA 1I27A 1T08B 1IW7F 4D9JA 4WCGA 4KMFA 4ENJA 3I4PA 2QYOA 1V5FA 2A5YB 1R69A 4BNCA 4M3DA 1XD7A 2VT3A 1BR1A 1P7IA 2OU2A 3C3WA 1ETYA 1QPMA 1REPC 2DI3A 2DPUA 2EPFA 4A0YA 2OQRA 3VSLA 4HLXA 3ZPLA 2FRHA 1VQPI 1R5GA 3E7LA 4IVNA 3CCLI 1POGA 4B3XA 2OUMA 2H1KA 3FKJA 1BBYA 5F1RA 1HW5A 2LSOA 5D5WB 3FMYA 4W97A 2DMUA 2ETHA 3PXPA 1Z77A 3QPSA 3O9XA 1OCRH 2Y0SA 2HZTA 1J0RA 1EFAA 2E35A 2ECBA 3OR1C 1GUUA 3TOBA 4DJAA 3LNQA 2GOXB 5DSXA 2L9SA 2EFOA 2KIFA 4DIQA 3OYMA 3GFIA 3F52A 2IRFG 2LMDA 3UWPA 2DODA 4D7MA 4XBFA 1IN6A 4XK4A 1JJ8C 4RGUA 2OTJI 2ZXIA 1UMQA 3RJPA 5HLHA 4FETA 3QF3A 4IQJA 3SR4A 4UVCA 3TO6A 4PGHA 2LKPA 1HSTA 1YI2I 1QQIA 4C2UA 2VBXA 2HWVA 3K6GA 3BQZA 4NQWB 3T1BA 5L3GA 3BJOA 2K9NA 2A6EF 2XGDA 2JVHA 2LRDA 4LD5A 2R7ZJ 4RB3C 4K2EA 1ZVVA 1U2ZA 3HPGA 3DU5A 4XIDA 3JRIA 2XPVA 3F72A 5FGMA 3GCMA 1VQNI 2PJPA 1LCDA 3ZQQA 2K3FA 5IT3A 4KA4A 3LWFA 2IS4A 2F4IA 4I01A 4C3HJ 3G1OA 2P5LC 2R5YB 1FP1D 2F5DA 4QPQA 1GLNA 1R1UA 5M3FJ 3BG9A 5E18F 3SCFA 4RBOA 2O49A 4YEJA 2L9RA 1UZCA 1F36A 3E1SA 2FMLA 5J3LA 3HEFA 1JTXA 2K4BA 3P5JA 4G7OF 1SEUA 4AIKA 3HXLA 3VSKA 3R1FA 2W24A 2DW4A 3DCFA 3K4LA 1F1ZA 1VNDA 2G0EA 4HX4A 2EF8A 2HQRA 5GAHi 1RR8C 2FSWA 3RYPA 4F3QA 3C7JA 4HNTA 4KIBA 2Q1ZB 4YIRX 3ZQIA 4QWQA 3VYSB 3DP7A 4A12A 5IYDJ 2RN7A 1DULA 2Y2ZA 3F8NA 3RI4A 3FXKA 2IS2A 1WSUA 5D4SA 3COAC 2EZIA 2EWTA 2A69F 4E7IA 4HRIA 2Q2EA 3PIPF 2HINA 2W7NA 3EUHC 4X0GA 2LDUA 5AIPA 3I9V2 3S93A 4DYRA 4I98B 2KJCA 2CW0F 1P4WA 5M5XJ 2LY2A 4KUMA 3ABUA 3LISA 1NEQA 3TP0A 4HV5A 2K86A 1HQ1A 3ABKH 4I0BA 4OB4A 1U9NA 1VZ0A 2WTEA 3WG9A 3BJ6A 2A07F 2IT0A 4YELA 4PU3C 3QPHA 1UHMA 5D8LB 3CCRI 4L18B 1APLC 4L9JA 4G7ZF 3HOWJ 2HSGA 1TQPA 3HKZN 1MMGA 1YRNB 3OOUA 2Q8KA 1QVTA 2FD5A 1SFOJ 1OKRA 4W1UA 3CROL 1BIBA 2IA1A 5C3EJ 1BW5A 2DQRA 1ZRDA 2ODRD 5J4VA 5GTHC 2RNJA 2YU3A 2Y0MA 3WTSC 4PCQA 4KDPA 2QGUA 3BR6A 4M6XA 3S16J 3FK7A 3IP4B 2MH2A 1D0YA 2JRTA 5E3OA 1IXSB 2PBIA 1WKMA 3HRTA 1FLIA 3AAFA 1WRJA 1K78A 2W82A 1S3JA 2KL4A 2ICPA 3U1DA 4Q4ZF 1YE9A 3SCGA 4PZJA 3HHGA 5E1XA 1LDKB 4AVPA 3GLXA 4B48A 1W4MA 2QQBA 3QOPA 5DTRA 3H92A 3G7DA 4V2FA 3HTSB 2M7AA 4X6AJ 4HQEA 1G59A 2DU9A 4AYBA 1FY7A 3PNVA 3MEXA 2BHZA 3I71A 4R8HA 2IVBA 1MBJA 1PERL 1U5TB 2JA5J 3CO7C 4BEHB 2NS8A 3TFLA 2NVUB 1JWLA 2PG4A 1YJWI 2EV5A 2V9VA 1HC8A 1FX7A 1TP4A 1TWCJ 3KP3A 3T0YA 3T8RA 3ASOH 4AIJA 3V7SA 4HF2A 4YIIA 2HPMA 2CFXA 2XGCA 1ZZBA 2L7FP 3MZHA 2Y0SN 4DZJA 3RSNA 2H27A 3RCOA 1XCVA 2ZC2A 5F08A 2ZMEA 4XLEA 3Q0UA 1LKXA 3CUOA 4XOTA 1ORKA 2HYGD 3VOEA 4I6ZA 2P5KA 2R7UA 1RI7A 3HM5A 4RM2A 2DMQA 3WU0A 2OD5A 2R7DA 2K27A 2OZUA 3QYFA 3VDXA 3EDPA 3W2WA 2V1DA 2NNYA 3I54A 3A1YA 1O3TA 3J80K 2XV4S 1LEAA 3FM5A 4EJTA 4XRFA 3IH4A 3BG7A 4BL0B 4LIUA 1PUEE 3GXOA 3LMMA 1B9MA 1VQ6I 3BT9A 1X1AA 1DU0A 4ANJA 2CUFA 4D7NA 3C1DA 4HA8A 3X2QH 3P9IA 4LLGF 1LJ9A 3ZMSA 4BQQA 3OYAA 2PMHA 3E5XA 3PNYA 1I6XA 3TRBA 4WXHA 4MO7A 1AOYA 4PJNA 3S2HJ 3CMMA 3MLFA 3BLYA 4MQVA 4UUSB 1UAAA 2VBZA 3L9FA 2KEJA 1MFQC 1OYWA 1QGPA 5ICCA 2D1VA 3M9LA 3WHBA 1QP7A 3A2KA 1MMSA 2ESHA 5GPAA 2BYVE 4IF4A 4OMZA 1B9NA 3MCZA 4F7ZA 4ZYDA 5IT9Z 3CCMI 3M9AA 4Q5SF 2GXBA 4HDVA 2PXTA 1A6IA 2F6CA 2JVGA 4I76A 2DA2A 1RESA 3G5GA 2CGPA 2PXQA 2Z33A 3GTGJ 4ASNA 3KP7A 4BE2A 3VWBA 1GDTA 5EGOA 3L2VA 2KDZA 1FPQA 3NQOA 3QRFF 1OCTC 5K98B 5B3SH 5DTMA 1ERDA 3CCQI 4MCTA 1V54H 4FCYA 3K0LA 2COMA 4EM1A 1G4DA 2CQQA 1E3HA 2ELKA 2GOMA 3DLAA 4RGSA 4BQAA 1B4AA 3SFZA 1J7KA 4S04A 2NXNB 4Y15A 2G7UA 3IRRA 1CF7B 4I7HA 1VI0A 2JPCA 2FBKA 2XF7A 1R58A 4CA0A 1HOMA 2R7QA 3F21A 1MBEA 2G9WA 5LRRA 5FKLA 4MFEA 4PJLA 3RKYA 3SQNA 4EJUA 2WAFA 2LH9A 3OS1A 3ZMVA 3BZCA 4I6RA 1LMB3 2MD5A 1BOBA 5KVRA 5LHHA 2WWYA 4Z5DA 1OR7C 5IP7J 3AL0C 4E7JA 3HC7A 3ERED 2F4OB 3BG6A 5DT2A 3CJNA 1G6NA 4ESBA 3DKXA 5HS9A 5IY5H 5GADJ 2ZJQF 1J9IA 2PMUA 4WK8F 1HQCA 4Z5CA 2X6OA 4IRGA 1U5TC 5FB2A 4PK4A 4RLFA 4G8XA 2HGCA 2MGQA 2JA6J 3M1CA 3V4GA 4M9XA 5JLXA 2CQXA 4X4GA 1UJ8A 3TL4X 1S6LA 5GAEJ 4OIRF 5D4RA 4X4DA 3M8JA 2FBIA 1BI2A 5FLVA 1X57A 4FTHA 1FYMA 3DBHB 3U3WA 2MQKA 1O3RA 2RNGA 4M72A 3V8KA 3RKQA 2X1DA 5DCMA 5DYMA 2XI8A 1RRJA 5C44J 1P92A 2OCEA 4KICA 3K1MA 2LBFA 2L8NA 4NC7A 1EJ9A 1E3OC 1FMWA 3JRCA 4C2TA 2E5ZA 1POUA 3OYEA 1XWRA 1CGPA 4M3EA 4QSHA 2XXQA 2Y30A 1FSHA 4RAGA 2QKLB 5CKTA 5FD5A 1IGNA 2YU9J 4RB1A 4FE7A 2DMTA 4ZDLA 1XMAA 2STWA 3HG9A 2XXPA 4E4HA 1DGWY 4RDUA 1W5TA 2W85A 4IPAA 3F9KA 1ZLKA 1DQUA 3GTMJ 2QCOA 5HODA 4NDWA 3HOUJ 4IHXA 2WAQN 2BGCA 1MIJA 3OYBA 2EFPA 5H6RA 2BHYA 2R4GA 4M6VA 5JLWA 1AKHB 3J7AO 2MBFA 4M9SA 5AONA 2PJRB 4P9FA 4B44A 3LAPA 4DNCA 2KLOA 5FLXZ 3JSPA 4IVZA 5FLMJ 2MW8A 4BDZA 2DT6A 2FF4A 1BOAA 4XM3A 4CCLA 2QM3A 2NOJB 3ZQHA 5HS8A 3QOWA 2R7OA 2QQAA 1UELB 3EUAA 3PL8A 2QZ8A 2CH0A 2Y31A 1OSLA 2VE8A 3A9YA 1A6QA 4RB2C 5E17F 3D1NI 4Z58A 4CHUA
chains in the Genus database with same CATH topology
4A3LJ 4J1XA 1ZQ3P 3PO3J 4C3JJ 1SQ8A 3JREA 2L49A 3GN5A 1JJ6C 2EBYA 3S14J 2R5ZA 3FK6A 4Y52J 3JXDL 4JX4A 4X4CA 1D5YA 1PRVA 1AU7A 4A3GJ 1DU6A 1I50J 1MNMC 2HOSA 1RZRD 4IEJA 4L5EA 1LFUP 3QPLA 4BY1J 3B6CA 5E3NA 2FX0A 2TCTA 2PUCA 1OJLA 1RETA 3BG5A 1WH8A 5E3MA 3CMYA 4PU8A 1QRYA 3DNVB 2OR1L 1ZPQA 3TP3A 4HNVA 1ZUGA 2KPJA 4YBAA 4D5FA 3Q0WA 3I4NJ 1T33A 2JVLA 2AHQA 3FISA 5EZGA 2JCGA 4C2MJ 2IBDA 2EQRA 2HXIA 3HGGA 2AO9A 1WIZA 1ZZ7A 3FYAA 3BR0A 3BTLA 2HOTA 3C2BA 3A02A 4A3CJ 2WV1A 1ETVA 3HOVJ 3PO2J 2O7OA 2IU7A 2LTPA 4QTRA 1R9TJ 3JRGA 4B1RA 1MH3A 2NVYJ 4YG4A 4JCYA 2PMZN 3GBGA 1FTTA 1XC5A 1JKQC 4PU4C 1WH7A 4Y7NJ 1F43A 1YSEA 4YARA 1JT0A 3JRDA 5FKKA 1CJGA 1ZR2A 2XRLA 3Q3SA 2M0CA 1AHDP 1WCMJ 2LVSA 1MBHA 3BR3A 1R69A 2L7MP 3B7HA 1MBFA 2CROA 3OSGA 4M3DA 1GVDA 5J1UA 1P7IA 2PUGA 1ETYA 3SJMA 2DMNA 2B5AA 1JUMA 4IHYA 3A01B 1RPWA 5F04A 2OF7A 3E7LA 4A3IJ 1U9OA 1POGA 3HOXJ 2KEKA 4DYQA 1O4XA 3H3VK 2H1KA 3CQZJ 1T56A 3BQYA 1JFTA 2XB0X 2BNNA 1ETKA 2RAEA 2DA3A 2I10A 3FMYA 4W97A 2DMUA 3L1PA 3PXPA 1HDPA 1Z77A 3QPSA 5K7ZA 2LKXA 3W6VA 1I6HJ 2AW6A 3O9XA 1JH9A 2E1OA 2LLKA 1VPWA 1GV5A 2EZKA 1LE8A 1FJLA 5EGOB 1EFAA 2W48A 2ECBA 1GUUA 5FKOA 2JWTA 3LNQA 3OP9A 1LLIA 2CJJA 5EYRA 5IOZA 4A3BJ 1IJWC 3HDDA 5FJ8J 4BY7J 2MSYA 2KT0A 1H88C 3F52A 1IRZA 4D7MA 5EG0B 4X4BA 4EEFG 4XK4A 3SFIA 1JJ8C 4DZPA 1ADRA 1B72A 1UMQA 3QF3A 2VKVA 3GTQJ 2IVGA 1Y1WJ 2AXZA 1IUFA 2R5ZB 4X4IA 3QYXA 3BQZA 1NK3P 2XSDC 5IP9J 2K9NA 2XGDA 3GTPJ 2R7ZJ 1ZK8A 1ZVVA 1UG2A 3JRIA 4XIDA 2XB5A 2XPVA 5EZHA 2LYLA 3BDNA 3PM1A 3ZQLA 1SANA 3Q0VA 1VF9A 2X48A 1Y1VJ 1LCDA 3OQOA 4C3IJ 3LSGA 1B8IB 2CU7A 1NERA 4C3HJ 4J19A 3FIWA 3G1OA 2R5YB 2DMPA 4J1WA 2HOAA 3GN5B 2M8GX 3QQ6A 5M3FJ 3BG9A 2DA1A 3S1QJ 4RBOA 3M4OJ 1X2MA 4IHWA 3SCFA 1QP0A 2L9RA 1X2LA 1F36A 5J3LA 3CDLA 4X4EA 3HEFA 1JTXA 4V2GA 4XRSG 1BJZA 3R1FA 4A93J 3A03A 2B63J 3DCFA 2JK3A 4FN3A 1VNDA 3NAUA 2G0EA 3OMTA 1QQAA 2EF8A 2LYRA 2TRTA 3GTJJ 3ZQIA 1PUFA 2NVTJ 2DA5A 2DN0A 1W0UA 5IYDJ 1DWKA 1WPKA 2Y2ZA 4B3AA 2M9HA 2LYSA 5K7FA 4BBSJ 1ZZ8A 2EZIA 2EWTA 2IUOA 1LQCA 1Y9QA 2HINA 3VPRA 1MSEC 1PRAA 1R63A 4I6TA 4DYRA 2WUSR 1PUFB 3LFPA 4Z5HA 2LK2A 4JYKA 4MLOA 5M5XJ 2K40A 3JRAA 3LISA 1NEQA 3TP0A 5C4JJ 2IEKA 3TW6A 2DA4A 2XCJA 1QPIA 3OIOA 4OB4A 4M3GA 5F0FA 4X4FA 1U9NA 3ZOBA 4DYCA 4GQMA 4JQDA 2LD5A 1ZAYA 2D5VA 3HB9A 3MKLA 4PU3C 4MIMA 4XRSA 1JGGA 1ZTRA 1RKWA 1K61A 1LFBA 1APLC 5F27A 5DTDA 3HOWJ 1XS9A 1IDYA 2O38A 2NS7A 2HSGA 3HKZN 1YRNB 1UHSA 3OOUA 1NK2P 1QVTA 4FBIA 3CECA 2FD5A 1SFOJ 1Z0XA 4W1UA 2IVQA 1ZR4A 3CROL 2MG4A 5C3EJ 1ITYA 1BW5A 3JXBC 4X1EA 3TEDA 3SCHA 2GZUA 1L1MA 1VFCA 1B72B 3LSPA 2XGEA 1H89C 1BW6A 3SDGA 4ABZA 3BR6A 2CUEA 2EH3A 2ID6A 4A3EJ 3S16J 4O8BA 2O4AA 1ETOA 5J1RA 1JKPC 2Y9YA 3S8QA 3FK7A 2OPTA 3JRBA 2IV1A 3CCYA 5E3OA 2XPUA 2E2IJ 3MVPA 4XRMA 1QVUA 3JR9A 2XJ3A 3G1LA 2BNOA 2ICPA 5M3MJ 2COBA 2NOGA 3QWGA 2IAIA 3IH3A 3SCGA 4MFDA 5A7LA 5IOYA 5FKMA 4XICA 3G7DA 1IG7A 4A3MJ 2HI3A 3MN2A 4V2FA 1IC8A 3M3YJ 2LCVA 4X6AJ 2OFYA 3G1MA 4AC0A 1RPEL 3S1MJ 4A3DJ 4S0HB 2IVBA 1TWHJ 4PU7A 1MBJA 1PERL 1WI3A 2JA5J 3O8GA 2R93J 2NS8A 2DTZA 1FIAA 1JWLA 5GPCA 2LYPA 2YS9A 2E2JJ 1TWCJ 1FTZA 1QP4A 3ZHIA 3LSRA 1B8IA 2ECCA 3S1NJ 1ZZBA 2XGCA 2Y9ZA 1UTXA 2L7FP 3QQAA 2Y0SN 4DZJA 3GBFA 3JRHA 1ZKGA 2VPRA 2R5YA 2E2HJ 2X9DA 5J1YA 1HCRA 2GLOA 1S7EA 4BXXJ 2JMWA 2PPXA 5F08A 3KZ3A 4IWRA 1U8BA 9ANTA 3ZKCA 1PRUA 3Q0UA 5BNGA 2ICTA 3BG3A 1ORKA 4I6ZA 1FIPA 3VK0A 3HM5A 1K83J 2BNMA 2DMQA 2LYJA 2R0QC 3FKIJ 3NARA 3HBLA 3BD1A 4JCXA 4GFBA 2LP0A 1HDDC 3F0CA 2K9SA 2PE5A 1UXCA 2PUEA 3IH4A 3RZOJ 2AXUA 1JUSA 1RR7A 4M3FA 3ZHMA 4IA8A 2EBIA 5IP6A 3DEWA 2KEIA 3BT9A 1DU0A 2QF7A 1H8AC 2CUFA 2FJRA 4D7NA 1ZZCA 5EDNA 2R63A 1RZSA 4CYCB 1EF4A 4BBRJ 1I3QJ 2DA6A 2M34A 4FE4A 3TRBA 4MO7A 4YG1A 4CYCA 2LFBA 2O9LA 2PIJA 3S2HJ 3MLFA 3BR2A 2HYJA 3GTOJ 4UUSB 3JXCL 1GT0C 2WB1N 2KEJA 3HOZJ 5M5YJ 3EUSA 1NTCA 3KJXA 2YUSA 3KXAA 4AYBN 3WHBA 2HDDA 1WH6A 1QP7A 1A5JA 5GPAA 1RZRA 2HQ5A 5IYCJ 1IV6A 3BR5A 2CRGA 3ZQCA 2WIUB 3BS3A 1ZZ9A 4UUTA 1Q1VA 1ETXA 1A6IA 1MSFC 3F6WA 2GBYA 2H8RA 5M5WJ 3CLCA 4I76A 2GM4A 3I4MJ 2DA2A 1RESA 1FEXA 4A3FJ 3GTLJ 3G5GA 1WETA 5F0HA 3GTGJ 2LYKA 1JKRC 3WHCA 3OSFA 1AKHA 1GDTA 3K7AJ 5EGOA 2PUFA 2FJ1A 2KDZA 2LY9A 1OCTC 1MBKA 5K98B 2AUWA 1PNRA 1X2NA 3IH2A 4MCTA 1TC3C 2L0KA 4FCYA 4IHVA 2CQQA 2ELKA 1JKOC 2XPWA 2CSFA 2FQ4A 3LSJA 2K9QA 2LYQA 1IDZA 4GHJA 1VI0A 2GRMA 2JA7J 4LOCA 2PUAA 2N8GA 5GP9A 3RQIA 1HOMA 3H5TA 1MBEA 4B4CA 2BJCA 5FKLA 4MFEA 3O8HA 1BL0A 2LR8A 1HLVA 2A6CA 3ZQFA 5K7HA 2R1JL 1B0NA 2NVXJ 2ID3A 1DW9A 2M2EA 1W0TA 4A69C 4I6RA 4G12A 2AWIA 1LMB3 3S1RJ 4Z5DA 1WGXA 5IP7J 3JRFA 1JUPA 1QPZA 3OQMA 1ZGWA 1Y7YA 2JJ7A 3FYMA 4Z5CA 2X6OA 2MEZA 5EEAA 2EZLA 3IVPA 3LOCA 2AXVA 2MGQA 2JA6J 3UFDA 1ZZ6A 1HF0A 3BTIA 2XIUA 3RZZA 5JLXA 2GRLA 2CQXA 4I8TA 4X4GA 4I6UA 4YG7B 4A3JJ 2L7ZA 1UXDA 4X4DA 3HGYA 4Z59A 4BKXA 1OCPA 2ZB9A 5IPAA 5FLVA 1G2HA 2HXOA 4JP0A 4DW6A 4FTHA 1X57A 2MQKA 3U3WA 1RKTA 5F0CA 3RKQA 3IV5A 1JTYA 3BR1A 2XI8A 3RZDJ 4Y42A 2O49A 5C44J 1ZS4A 2DA7A 2VUMJ 2L8NA 3S15J 2JN6A 1E3OC 2JA8J 1ETWA 5E3LA 3JRCA 4FISA 1POUA 1MH4A 3UKGA 1XWRA 4UUSA 4A3KJ 3S17J 2ME0A 4M3EA 3B6AA 3S2DJ 1TWFJ 4QSHA 1QQBA 1P7JA 2Y30A 1CQTA 4M3BA 4QIWN 2PUBA 5FKNA 1JT6A 2VI6A 5C4XJ 3BTJA 3K2AA 1IGNA 4NDLA 2YU9J 2PUDA 4FE7A 2DMTA 1TWAJ 2O8KA 3A01A 4RDUA 1ETQA 2DJNA 1ENHA 1MBGA 2R92J 3GTMJ 2QCOA 4JX6A 3TW7A 5EF6A 5HODA 3ZQGA 4NDWA 1BDIA 5IYBJ 3HOUJ 4IHXA 2WAQN 1LE8B 3GTKJ 3HZIB 5F1JA 1YRNA 5DS9A 4X4HA 1JFSA 1WH5A 1U78A 4M6VA 2E19A 5JLWA 1AKHB 4AUXA 1GV2A 4MCXA 1LCCA 1RIOA 1OFCX 1TWGJ 3BTCA 2NVQJ 1X58A 2KZ8A 3H0GJ 4IVZA 5FLMJ 2ME6A 2MW8A 5EG0A 3F51A 1BDHA 2VKEA 3OQNA 3ZQHA 4F8DA 4D5CA 3HOYJ 1XG1A 2Y31A 1BA5A 1OSLA 2P81A 2EZHA 3D1NI 4Z58A 4JX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L J;  4J1X A;  1ZQ3 P;  3PO3 J;  4C3J J;  1SQ8 A;  3JRE A;  2L49 A;  3GN5 A;  1JJ6 C;  2EBY A;  3S14 J;  2R5Z A;  3FK6 A;  4Y52 J;  3JXD L;  4JX4 A;  4X4C A;  1D5Y A;  1PRV A;  1AU7 A;  4A3G J;  1DU6 A;  1I50 J;  1MNM C;  2HOS A;  1RZR D;  4IEJ A;  4L5E A;  1LFU P;  3QPL A;  4BY1 J;  3B6C A;  5E3N A;  2FX0 A;  2TCT A;  2PUC A;  1OJL A;  1RET A;  3BG5 A;  1WH8 A;  5E3M A;  3CMY A;  4PU8 A;  1QRY A;  3DNV B;  2OR1 L;  1ZPQ A;  3TP3 A;  4HNV A;  1ZUG A;  2KPJ A;  4YBA A;  4D5F A;  3Q0W A;  3I4N J;  1T33 A;  2JVL A;  2AHQ A;  3FIS A;  5EZG A;  2JCG A;  4C2M J;  2IBD A;  2EQR A;  2HXI A;  3HGG A;  2AO9 A;  1WIZ A;  1ZZ7 A;  3FYA A;  3BR0 A;  3BTL A;  2HOT A;  3C2B A;  3A02 A;  4A3C J;  2WV1 A;  1ETV A;  3HOV J;  3PO2 J;  2O7O A;  2IU7 A;  2LTP A;  4QTR A;  1R9T J;  3JRG A;  4B1R A;  1MH3 A;  2NVY J;  4YG4 A;  4JCY A;  2PMZ N;  3GBG A;  1FTT A;  1XC5 A;  1JKQ C;  4PU4 C;  1WH7 A;  4Y7N J;  1F43 A;  1YSE A;  4YAR A;  1JT0 A;  3JRD A;  5FKK A;  1CJG A;  1ZR2 A;  2XRL A;  3Q3S A;  2M0C A;  1AHD P;  1WCM J;  2LVS A;  1MBH A;  3BR3 A;  1R69 A;  2L7M P;  3B7H A;  1MBF A;  2CRO A;  3OSG A;  4M3D A;  1GVD A;  5J1U A;  1P7I A;  2PUG A;  1ETY A;  3SJM A;  2DMN A;  2B5A A;  1JUM A;  4IHY A;  3A01 B;  1RPW A;  5F04 A;  2OF7 A;  3E7L A;  4A3I J;  1U9O A;  1POG A;  3HOX J;  2KEK A;  4DYQ A;  1O4X A;  3H3V K;  2H1K A;  3CQZ J;  1T56 A;  3BQY A;  1JFT A;  2XB0 X;  2BNN A;  1ETK A;  2RAE A;  2DA3 A;  2I10 A;  3FMY A;  4W97 A;  2DMU A;  3L1P A;  3PXP A;  1HDP A;  1Z77 A;  3QPS A;  5K7Z A;  2LKX A;  3W6V A;  1I6H J;  2AW6 A;  3O9X A;  1JH9 A;  2E1O A;  2LLK A;  1VPW A;  1GV5 A;  2EZK A;  1LE8 A;  1FJL A;  5EGO B;  1EFA A;  2W48 A;  2ECB A;  1GUU A;  5FKO A;  2JWT A;  3LNQ A;  3OP9 A;  1LLI A;  2CJJ A;  5EYR A;  5IOZ A;  4A3B J;  1IJW C;  3HDD A;  5FJ8 J;  4BY7 J;  2MSY A;  2KT0 A;  1H88 C;  3F52 A;  1IRZ A;  4D7M A;  5EG0 B;  4X4B A;  4EEF G;  4XK4 A;  3SFI A;  1JJ8 C;  4DZP A;  1ADR A;  1B72 A;  1UMQ A;  3QF3 A;  2VKV A;  3GTQ J;  2IVG A;  1Y1W J;  2AXZ A;  1IUF A;  2R5Z B;  4X4I A;  3QYX A;  3BQZ A;  1NK3 P;  2XSD C;  5IP9 J;  2K9N A;  2XGD A;  3GTP J;  2R7Z J;  1ZK8 A;  1ZVV A;  1UG2 A;  3JRI A;  4XID A;  2XB5 A;  2XPV A;  5EZH A;  2LYL A;  3BDN A;  3PM1 A;  3ZQL A;  1SAN A;  3Q0V A;  1VF9 A;  2X48 A;  1Y1V J;  1LCD A;  3OQO A;  4C3I J;  3LSG A;  1B8I B;  2CU7 A;  1NER A;  4C3H J;  4J19 A;  3FIW A;  3G1O A;  2R5Y B;  2DMP A;  4J1W A;  2HOA A;  3GN5 B;  2M8G X;  3QQ6 A;  5M3F J;  3BG9 A;  2DA1 A;  3S1Q J;  4RBO A;  3M4O J;  1X2M A;  4IHW A;  3SCF A;  1QP0 A;  2L9R A;  1X2L A;  1F36 A;  5J3L A;  3CDL A;  4X4E A;  3HEF A;  1JTX A;  4V2G A;  4XRS G;  1BJZ A;  3R1F A;  4A93 J;  3A03 A;  2B63 J;  3DCF A;  2JK3 A;  4FN3 A;  1VND A;  3NAU A;  2G0E A;  3OMT A;  1QQA A;  2EF8 A;  2LYR A;  2TRT A;  3GTJ J;  3ZQI A;  1PUF A;  2NVT J;  2DA5 A;  2DN0 A;  1W0U A;  5IYD J;  1DWK A;  1WPK A;  2Y2Z A;  4B3A A;  2M9H A;  2LYS A;  5K7F A;  4BBS J;  1ZZ8 A;  2EZI A;  2EWT A;  2IUO A;  1LQC A;  1Y9Q A;  2HIN A;  3VPR A;  1MSE C;  1PRA A;  1R63 A;  4I6T A;  4DYR A;  2WUS R;  1PUF B;  3LFP A;  4Z5H A;  2LK2 A;  4JYK A;  4MLO A;  5M5X J;  2K40 A;  3JRA A;  3LIS A;  1NEQ A;  3TP0 A;  5C4J J;  2IEK A;  3TW6 A;  2DA4 A;  2XCJ A;  1QPI A;  3OIO A;  4OB4 A;  4M3G A;  5F0F A;  4X4F A;  1U9N A;  3ZOB A;  4DYC A;  4GQM A;  4JQD A;  2LD5 A;  1ZAY A;  2D5V A;  3HB9 A;  3MKL A;  4PU3 C;  4MIM A;  4XRS A;  1JGG A;  1ZTR A;  1RKW A;  1K61 A;  1LFB A;  1APL C;  5F27 A;  5DTD A;  3HOW J;  1XS9 A;  1IDY A;  2O38 A;  2NS7 A;  2HSG A;  3HKZ N;  1YRN B;  1UHS A;  3OOU A;  1NK2 P;  1QVT A;  4FBI A;  3CEC A;  2FD5 A;  1SFO J;  1Z0X A;  4W1U A;  2IVQ A;  1ZR4 A;  3CRO L;  2MG4 A;  5C3E J;  1ITY A;  1BW5 A;  3JXB C;  4X1E A;  3TED A;  3SCH A;  2GZU A;  1L1M A;  1VFC A;  1B72 B;  3LSP A;  2XGE A;  1H89 C;  1BW6 A;  3SDG A;  4ABZ A;  3BR6 A;  2CUE A;  2EH3 A;  2ID6 A;  4A3E J;  3S16 J;  4O8B A;  2O4A A;  1ETO A;  5J1R A;  1JKP C;  2Y9Y A;  3S8Q A;  3FK7 A;  2OPT A;  3JRB A;  2IV1 A;  3CCY A;  5E3O A;  2XPU A;  2E2I J;  3MVP A;  4XRM A;  1QVU A;  3JR9 A;  2XJ3 A;  3G1L A;  2BNO A;  2ICP A;  5M3M J;  2COB A;  2NOG A;  3QWG A;  2IAI A;  3IH3 A;  3SCG A;  4MFD A;  5A7L A;  5IOY A;  5FKM A;  4XIC A;  3G7D A;  1IG7 A;  4A3M J;  2HI3 A;  3MN2 A;  4V2F A;  1IC8 A;  3M3Y J;  2LCV A;  4X6A J;  2OFY A;  3G1M A;  4AC0 A;  1RPE L;  3S1M J;  4A3D J;  4S0H B;  2IVB A;  1TWH J;  4PU7 A;  1MBJ A;  1PER L;  1WI3 A;  2JA5 J;  3O8G A;  2R93 J;  2NS8 A;  2DTZ A;  1FIA A;  1JWL A;  5GPC A;  2LYP A;  2YS9 A;  2E2J J;  1TWC J;  1FTZ A;  1QP4 A;  3ZHI A;  3LSR A;  1B8I A;  2ECC A;  3S1N J;  1ZZB A;  2XGC A;  2Y9Z A;  1UTX A;  2L7F P;  3QQA A;  2Y0S N;  4DZJ A;  3GBF A;  3JRH A;  1ZKG A;  2VPR A;  2R5Y A;  2E2H J;  2X9D A;  5J1Y A;  1HCR A;  2GLO A;  1S7E A;  4BXX J;  2JMW A;  2PPX A;  5F08 A;  3KZ3 A;  4IWR A;  1U8B A;  9ANT A;  3ZKC A;  1PRU A;  3Q0U A;  5BNG A;  2ICT A;  3BG3 A;  1ORK A;  4I6Z A;  1FIP A;  3VK0 A;  3HM5 A;  1K83 J;  2BNM A;  2DMQ A;  2LYJ A;  2R0Q C;  3FKI J;  3NAR A;  3HBL A;  3BD1 A;  4JCX A;  4GFB A;  2LP0 A;  1HDD C;  3F0C A;  2K9S A;  2PE5 A;  1UXC A;  2PUE A;  3IH4 A;  3RZO J;  2AXU A;  1JUS A;  1RR7 A;  4M3F A;  3ZHM A;  4IA8 A;  2EBI A;  5IP6 A;  3DEW A;  2KEI A;  3BT9 A;  1DU0 A;  2QF7 A;  1H8A C;  2CUF A;  2FJR A;  4D7N A;  1ZZC A;  5EDN A;  2R63 A;  1RZS A;  4CYC B;  1EF4 A;  4BBR J;  1I3Q J;  2DA6 A;  2M34 A;  4FE4 A;  3TRB A;  4MO7 A;  4YG1 A;  4CYC A;  2LFB A;  2O9L A;  2PIJ A;  3S2H J;  3MLF A;  3BR2 A;  2HYJ A;  3GTO J;  4UUS B;  3JXC L;  1GT0 C;  2WB1 N;  2KEJ A;  3HOZ J;  5M5Y J;  3EUS A;  1NTC A;  3KJX A;  2YUS A;  3KXA A;  4AYB N;  3WHB A;  2HDD A;  1WH6 A;  1QP7 A;  1A5J A;  5GPA A;  1RZR A;  2HQ5 A;  5IYC J;  1IV6 A;  3BR5 A;  2CRG A;  3ZQC A;  2WIU B;  3BS3 A;  1ZZ9 A;  4UUT A;  1Q1V A;  1ETX A;  1A6I A;  1MSF C;  3F6W A;  2GBY A;  2H8R A;  5M5W J;  3CLC A;  4I76 A;  2GM4 A;  3I4M J;  2DA2 A;  1RES A;  1FEX A;  4A3F J;  3GTL J;  3G5G A;  1WET A;  5F0H A;  3GTG J;  2LYK A;  1JKR C;  3WHC A;  3OSF A;  1AKH A;  1GDT A;  3K7A J;  5EGO A;  2PUF A;  2FJ1 A;  2KDZ A;  2LY9 A;  1OCT C;  1MBK A;  5K98 B;  2AUW A;  1PNR A;  1X2N A;  3IH2 A;  4MCT A;  1TC3 C;  2L0K A;  4FCY A;  4IHV A;  2CQQ A;  2ELK A;  1JKO C;  2XPW A;  2CSF A;  2FQ4 A;  3LSJ A;  2K9Q A;  2LYQ A;  1IDZ A;  4GHJ A;  1VI0 A;  2GRM A;  2JA7 J;  4LOC A;  2PUA A;  2N8G A;  5GP9 A;  3RQI A;  1HOM A;  3H5T A;  1MBE A;  4B4C A;  2BJC A;  5FKL A;  4MFE A;  3O8H A;  1BL0 A;  2LR8 A;  1HLV A;  2A6C A;  3ZQF A;  5K7H A;  2R1J L;  1B0N A;  2NVX J;  2ID3 A;  1DW9 A;  2M2E A;  1W0T A;  4A69 C;  4I6R A;  4G12 A;  2AWI A;  1LMB 3;  3S1R J;  4Z5D A;  1WGX A;  5IP7 J;  3JRF A;  1JUP A;  1QPZ A;  3OQM A;  1ZGW A;  1Y7Y A;  2JJ7 A;  3FYM A;  4Z5C A;  2X6O A;  2MEZ A;  5EEA A;  2EZL A;  3IVP A;  3LOC A;  2AXV A;  2MGQ A;  2JA6 J;  3UFD A;  1ZZ6 A;  1HF0 A;  3BTI A;  2XIU A;  3RZZ A;  5JLX A;  2GRL A;  2CQX A;  4I8T A;  4X4G A;  4I6U A;  4YG7 B;  4A3J J;  2L7Z A;  1UXD A;  4X4D A;  3HGY A;  4Z59 A;  4BKX A;  1OCP A;  2ZB9 A;  5IPA A;  5FLV A;  1G2H A;  2HXO A;  4JP0 A;  4DW6 A;  4FTH A;  1X57 A;  2MQK A;  3U3W A;  1RKT A;  5F0C A;  3RKQ A;  3IV5 A;  1JTY A;  3BR1 A;  2XI8 A;  3RZD J;  4Y42 A;  2O49 A;  5C44 J;  1ZS4 A;  2DA7 A;  2VUM J;  2L8N A;  3S15 J;  2JN6 A;  1E3O C;  2JA8 J;  1ETW A;  5E3L A;  3JRC A;  4FIS A;  1POU A;  1MH4 A;  3UKG A;  1XWR A;  4UUS A;  4A3K J;  3S17 J;  2ME0 A;  4M3E A;  3B6A A;  3S2D J;  1TWF J;  4QSH A;  1QQB A;  1P7J A;  2Y30 A;  1CQT A;  4M3B A;  4QIW N;  2PUB A;  5FKN A;  1JT6 A;  2VI6 A;  5C4X J;  3BTJ A;  3K2A A;  1IGN A;  4NDL A;  2YU9 J;  2PUD A;  4FE7 A;  2DMT A;  1TWA J;  2O8K A;  3A01 A;  4RDU A;  1ETQ A;  2DJN A;  1ENH A;  1MBG A;  2R92 J;  3GTM J;  2QCO A;  4JX6 A;  3TW7 A;  5EF6 A;  5HOD A;  3ZQG A;  4NDW A;  1BDI A;  5IYB J;  3HOU J;  4IHX A;  2WAQ N;  1LE8 B;  3GTK J;  3HZI B;  5F1J A;  1YRN A;  5DS9 A;  4X4H A;  1JFS A;  1WH5 A;  1U78 A;  4M6V A;  2E19 A;  5JLW A;  1AKH B;  4AUX A;  1GV2 A;  4MCX A;  1LCC A;  1RIO A;  1OFC X;  1TWG J;  3BTC A;  2NVQ J;  1X58 A;  2KZ8 A;  3H0G J;  4IVZ A;  5FLM J;  2ME6 A;  2MW8 A;  5EG0 A;  3F51 A;  1BDH A;  2VKE A;  3OQN A;  3ZQH A;  4F8D A;  4D5C A;  3HOY J;  1XG1 A;  2Y31 A;  1BA5 A;  1OSL A;  2P81 A;  2EZH A;  3D1N I;  4Z58 A;  4JX5 A; 
#chains in the Genus database with same CATH topology
 2BEO A;  4AIH A;  2BXY A;  2L49 A;  2WY8 Q;  1U0J A;  4AD9 A;  2JQ7 A;  1G3Y A;  2R5Z A;  2BW3 B;  2FFH A;  3U9G A;  3KCC A;  4X4C A;  2J5O A;  3EYI A;  4H4K C;  1AU7 A;  4PJJ A;  1EH6 A;  1MNM C;  2M4G A;  4A3G J;  1DU6 A;  2IW5 A;  3G0T A;  3IKV A;  2VB6 A;  3FXO A;  2DTR A;  3B6C A;  5DDG A;  2EJR A;  2E7W A;  2LKS A;  3BG5 A;  4XKB A;  5CPR B;  5FRO A;  2ZME B;  5LGU A;  3DNV B;  3M8E A;  1BR2 A;  1SD6 A;  1XX5 A;  3HZJ A;  3QP6 A;  3W6J B;  1ZUG A;  3QPT A;  3TOA A;  1WQ2 A;  3CME I;  1ZG3 A;  4D5F A;  2KRC A;  4GYG A;  2JVL A;  2XRN A;  3C2G A;  2AHQ A;  3IUO A;  3PNT A;  2IBD A;  2JSC A;  1OPC A;  2HXI A;  2AO9 A;  3HGG A;  3D5S C;  2G7H A;  2EV6 A;  3RYR A;  4E7S A;  3A02 A;  2CSO A;  1Y6I A;  5J47 A;  1BI1 A;  4LMY A;  2O7O A;  4GXO A;  4QTR A;  5HVQ C;  1FYK A;  1ZG5 A;  4B1R A;  1FT9 A;  1X4O A;  2PMZ N;  2VXD A;  3GBG A;  1XC5 A;  3TKY A;  3K70 C;  2X6X A;  3A0B C;  2XRO A;  1TLH B;  1F43 A;  1YSE A;  1Y0U A;  3JRD A;  1BIA A;  1PJR A;  3OYL A;  3Q3S A;  4IOC F;  1R5I D;  1WCM J;  1R36 A;  1MBF A;  1IUY A;  4PUS A;  1GVD A;  2LLV A;  1YYV A;  2HU9 A;  4HF1 A;  2PUG A;  2IP2 A;  5CQE A;  3TQN A;  3DF8 A;  5LHI A;  5D5X B;  4IHY A;  1RPW A;  2OCC H;  4PSW A;  5F04 A;  4BGD A;  5LEK A;  4U87 A;  2VLA A;  4H0E A;  4LIT A;  3KYD B;  4Q2J A;  1V4R A;  2GAU A;  3KYL A;  1TQM A;  1FYL A;  3CQZ J;  3CZ6 A;  3CF5 F;  2RDP A;  2CQN A;  2BNN A;  1Y39 A;  4CXF A;  3L1P A;  1HDP A;  2LKX A;  4N4N B;  1I6H J;  1EV7 A;  1JH9 A;  2E1O A;  3MEJ A;  5BQT A;  1LE8 A;  4HDU A;  2DK8 A;  1NG7 A;  1P4X A;  3CUQ C;  3NDB B;  4ZJZ A;  4LB6 B;  5FKO A;  3S8P A;  1YFH A;  3OP9 A;  1LLI A;  2FEZ A;  4ENK A;  5IOZ A;  3HDD A;  2GWR A;  1SD5 A;  1R1V A;  3DWL E;  3SHF A;  2KRF A;  1PYV A;  1ADR A;  3ABL H;  3ZN1 A;  2VKV A;  1LUJ B;  3SZT A;  3GTQ J;  3IWF A;  4FQG A;  2AXZ A;  3OOP A;  3WGH A;  3H3U A;  4LK0 F;  1OCO H;  2AQF A;  2H6C A;  1EKE A;  3GTP J;  3NZL A;  1UG2 A;  2P7V B;  4ZH4 F;  2XB5 A;  1LNW A;  2LYL A;  2LOO A;  2BY2 A;  2KIM A;  2JPB A;  1VF9 A;  4BQO A;  2ZKZ A;  3OQO A;  3LSG A;  3R60 A;  4MHG A;  1V5E A;  2K3P A;  4OIN F;  2CU7 A;  1W5C C;  3LFU A;  3ERM A;  1ZAR A;  5F64 A;  1NER A;  1WJA A;  4Z2Y A;  5K5R A;  2O3F A;  2HOA A;  3U21 A;  3PE5 A;  2Z5U A;  5E1W A;  2M8G X;  2X51 A;  3DV8 A;  2BW3 A;  3E5U A;  4IHW A;  3F8M A;  5LD2 C;  4ZZL A;  3AG4 H;  4HOB A;  1D1C A;  1XTA A;  4E7H A;  3L00 A;  4EV0 A;  2EIL H;  3ECH A;  5J8C A;  3KL4 A;  1BJZ A;  1SAU A;  3VFZ A;  3A03 A;  1ULY A;  4FN3 A;  2K85 A;  1D0X A;  3OMT A;  4LFU A;  1QQA A;  3HUG A;  2PXE A;  3TDZ C;  2VJJ A;  2HOE A;  1MJ9 A;  2M45 A;  1XMX A;  5FFZ A;  4IOA F;  3HRU A;  1PUF A;  2NVT J;  1HA8 A;  1W0U A;  1DWK A;  1WPK A;  5E1Z B;  3GO5 A;  2X4H A;  4KJZ A;  4B3A A;  4U7B A;  2LYS A;  1ZZ8 A;  1LQC A;  1YQA A;  2MC4 A;  3R4K A;  4HX8 A;  3J81 Z;  3ZMT A;  1R63 A;  4I6T A;  3D5L A;  3K4M A;  2WUS R;  1PUF B;  3CUQ A;  4Z5H A;  1AWC A;  1KA8 A;  2O0Y A;  3ZQ7 A;  2BE5 F;  3I64 A;  4MGR A;  2K40 A;  4M74 A;  2VOP A;  2VC1 A;  3GF2 A;  2C6Y A;  2E60 A;  2HDW A;  4RAY A;  1SFK A;  3TW6 A;  5D5U B;  4LK1 F;  4M3G A;  1T8I A;  1Z3X A;  3FDY A;  2VOO A;  5GAH J;  4GQM A;  2VT2 A;  5HNH A;  2CV1 A;  2VJI A;  3HB9 A;  1UHW A;  4ZC3 A;  4XLP F;  2W25 A;  2EA2 A;  2VEO A;  3QYB A;  1RKW A;  5HNF A;  5F27 A;  4CSW A;  1G3W A;  4DBQ A;  2O38 A;  1QU3 A;  4IX7 A;  4IHS A;  3FXR A;  1Z0X A;  1SFX A;  2IVQ A;  1I1G A;  2QBY B;  1R00 A;  1HW1 A;  3GZD A;  2P5V A;  2QSF X;  1L1M A;  1VFC A;  1DPR A;  1SVM A;  2VKD A;  2XAF A;  2XGE A;  4A0X A;  5JI6 A;  1H89 C;  1FOK A;  3NXH A;  3SDG A;  4O8B A;  3FMS A;  3K2Z A;  2ZNY A;  1I3A A;  1ETO A;  1JKP C;  3S8Q A;  4GCV A;  2IV1 A;  1FBQ A;  2I8D A;  3L2U A;  1QVU A;  3E6B A;  3M1E A;  5CVV A;  3MWM A;  2BNO A;  2COB A;  3WGI A;  4IO9 F;  2ZBK A;  3T5X A;  3IH3 A;  3RQ4 A;  3KEY A;  1FZP B;  2QUF A;  2KMU A;  3GVA A;  4AID A;  5IOY A;  5FKM A;  2L3D A;  2ZFU A;  2EIK H;  2MLG A;  2HKX A;  4P9U A;  3P9K A;  1IG7 A;  2WB1 A;  4OAY A;  3H1C A;  3CES A;  3M3Y J;  4BXF A;  1Z05 A;  2OFY A;  2NNN A;  4L9N A;  4BYY A;  1I5Z A;  2DTZ A;  3KE2 A;  1FIA A;  4E6K G;  2YS9 A;  4LG0 A;  5KK1 A;  4Y3O A;  1FTZ A;  1QP4 A;  1LFP A;  3J7Z I;  3ZHI A;  3JAM K;  2HFZ A;  2DYR H;  4EAT A;  4CZZ A;  3QP5 A;  4UV8 A;  1ZKG A;  2E2H J;  4BXX J;  2VQG A;  5CVJ A;  3RTR A;  3ULQ B;  3AG1 H;  1N25 A;  2PPX A;  3KZ3 A;  9ANT A;  3ZKC A;  3P7N A;  2ELH A;  3K10 A;  3S32 A;  3VOD A;  3K4J A;  4IZZ A;  1ZRE A;  3DBR B;  3HSR A;  1QA6 A;  1FIP A;  4G9Y A;  1MKM A;  3TO7 A;  1K83 J;  4BAC A;  2EV0 A;  4DE9 A;  4EQQ A;  4QLC U;  1U2W A;  1B59 A;  4MEY F;  2R0Q C;  2LYJ A;  1ZGA A;  3HOT A;  2A6H F;  1O3Q A;  1RUN A;  1Z7L A;  4KN7 X;  4JCX A;  4GFB A;  3LA7 A;  1HDD C;  3F0C A;  2HKO A;  2PE5 A;  1GVJ A;  3LL7 A;  1UXC A;  1YIJ I;  2PUE A;  1JUS A;  3IAS 2;  3CCE I;  2PXL A;  1TT0 A;  4DBR A;  4XLF A;  1H8A C;  2FJR A;  2P7C B;  2R63 A;  3FXL A;  4OOI A;  1ZLJ A;  1RZS A;  2H8W A;  4PGG A;  1MMN A;  4BBR J;  1I3Q J;  1IAW A;  2CO5 A;  3E6D A;  4BUP A;  4HZF A;  3FZV A;  4CIC A;  2PIJ A;  3E0J B;  3BR2 A;  4NB5 A;  1XN7 A;  3JXC L;  2HQA A;  3OKZ A;  4KNY A;  4HPQ A;  3ROU A;  2JSP A;  2YUS A;  1SD7 A;  2LYC A;  5DD8 A;  4AYB N;  2V7F A;  1HW2 A;  1Y8R B;  1MW7 A;  3BJA A;  1KU3 A;  4B8X A;  5IYC J;  1IV6 A;  5D6E A;  1SVO A;  2X6W A;  2CRG A;  2WIU B;  3OYK A;  4G6D A;  3CDH A;  1Z6R A;  1BC8 C;  1ETX A;  2XSJ C;  4P1W A;  1MSF C;  3F6W A;  1S7A A;  2L5Q A;  1T38 A;  2H8R A;  5M5W J;  1QZX A;  2GM4 A;  1MGT A;  4UVA A;  3GTL J;  5F0H A;  1FOW A;  2LYK A;  3WHC A;  3K7A J;  3H9Q A;  2PUF A;  4N0B A;  2FJ1 A;  2QVO A;  3TBI A;  2LY9 A;  2R7R A;  2QQ9 A;  2AUW A;  1YX5 A;  4WWC A;  1E3P A;  1X2N A;  1QNT A;  3RIR A;  1K7A A;  3QOD A;  2B7E A;  4PSX A;  4WVL A;  5KCM A;  2OZ6 A;  3I5U A;  2CSF A;  2FQ4 A;  2WY7 Q;  3TDU C;  4MTD A;  2K9Q A;  1IN4 A;  4ESF A;  5JHF A;  1NHA A;  2Y69 H;  3IL2 A;  5TJJ A;  4OIP F;  2N8G A;  3RQI A;  3PSF A;  1YO5 C;  1XCB A;  2AQE A;  3KP6 A;  1KYZ A;  5ICG A;  1A35 A;  1B0N A;  1GXQ A;  2ID3 A;  1YHQ I;  4MTE A;  2XAJ A;  1W0T A;  3HRM A;  2A05 A;  3IC7 A;  3O2P E;  3WU1 B;  4G12 A;  4XON A;  2LG4 A;  1U5T A;  3PFI A;  4XKV A;  2VKH A;  2UUZ A;  4BJT A;  2J5P A;  2RV8 A;  3TEL A;  3D0S A;  1ZGW A;  2F5E A;  2KDO A;  3OYJ A;  1E17 A;  1H9G A;  1P9Q C;  3M07 A;  4L5J A;  1XSX A;  4PJ0 C;  3OWQ A;  5LEJ A;  5BPD A;  5L3C A;  4BDY A;  2KIQ A;  2XIU A;  3RZZ A;  3CP8 A;  2K7L A;  3F22 A;  1VQ9 I;  2EIJ H;  1UXD A;  3HGY A;  4BKX A;  3WE2 A;  3ECO A;  5GTI C;  2PXD A;  3BWG A;  2MA3 A;  4ON0 A;  3CCJ I;  2WBM A;  1XB4 A;  1YW7 A;  1RKT A;  5F0C A;  3CCV I;  2BOL A;  4NC6 A;  1MJB A;  3RZD J;  4Y42 A;  2PXP A;  2E1C A;  4BAY A;  3KEO A;  2VUM J;  3S15 J;  1X1D A;  5H20 A;  2JA8 J;  2V1U A;  3PUB A;  5E3L A;  1QO0 D;  4L0Z B;  5HS7 A;  3UKG A;  1VTN C;  4UB8 C;  5D8K B;  3S17 J;  1LB2 A;  1G3T A;  3WGG A;  4Y33 A;  4MNU A;  4QIW N;  2PUB A;  5FKN A;  4UB6 C;  5C4X J;  3BTJ A;  4NDL A;  2PUD A;  1TWA J;  4RGR A;  3A01 A;  2DOA A;  3K1N A;  3H35 A;  3OIP A;  2DJN A;  4A5N A;  2H09 A;  2H1L A;  2R92 J;  4JX6 A;  3ZQG A;  2QBY A;  1L3L A;  1JHH A;  5FFX A;  3B73 A;  4LJZ F;  1LE8 B;  3GTK J;  3HZI B;  3FHZ A;  1UFM A;  2ZXJ A;  3WTX C;  5DS9 A;  2KPM A;  2Y48 A;  4X4H A;  1WH5 A;  2JTV A;  4PDK A;  4MCX A;  1P2F A;  4HEA 2;  3KLN A;  3DPU A;  2CS3 A;  2A3S A;  1RIO A;  1OYI A;  2VPL A;  2NVQ J;  3J7A Y;  4MQ9 F;  2RQQ A;  3H0G J;  3RKX A;  2KZ8 A;  4KT6 A;  2UV1 A;  5EG0 A;  2LRE A;  3F51 A;  2X6Y A;  2EA4 A;  3AFH A;  1YS6 A;  3R6S A;  4JOM A;  1FBS A;  2Y75 A;  4F8D A;  1O3S A;  3ONQ A;  2PXK A;  3J80 Z;  3V7C A;  5B66 C;  5KAI C;  2EZH A;  1IN7 A;  4AU7 A;  4JX5 A;  4A3L J;  4ER3 A;  3E3V A;  1ZHF A;  3PO3 J;  4C3J J;  3GFM A;  1WZ2 A;  3GN5 A;  1LPQ A;  4HST A;  2EBY A;  1CF7 A;  3FK6 A;  4JX4 A;  3DKY A;  3H3Z A;  4IKF A;  1I50 J;  2MH9 A;  1D8K A;  4QPO A;  4GO1 A;  4IEJ A;  4L5E A;  3U1K A;  5KHD A;  3DTI A;  4FX0 A;  2IGK A;  3K4C A;  5E3N A;  2ZO4 A;  5DUK A;  1OCC H;  4JQF A;  3J7Y J;  1RET A;  2DO7 A;  3DM5 A;  4PU8 A;  2OR1 L;  3GYH X;  1ZPQ A;  1DDN A;  4HNV A;  2VQC A;  2L01 A;  4C9Y A;  4YBA A;  1Z9C A;  2GXA A;  3BCA A;  5B5E C;  3PQK A;  3KP2 A;  3QAH A;  3I4N J;  4FAS D;  3LSI A;  4C2M J;  2VE9 A;  1Y56 A;  2K9M A;  2M3A A;  3RKW A;  1ZZ7 A;  1SAX A;  5DCM B;  2ZSH B;  1MDM B;  3C2B A;  3MAJ A;  1N78 A;  2WAQ A;  2EWN A;  2R7W A;  2UWM A;  2EFQ A;  4ZZD A;  4CH7 A;  1YJN I;  4LB5 A;  3I59 A;  3HOV J;  5CVI A;  4IHT A;  1GHC A;  3ABM H;  2CW7 A;  1FWZ A;  3EUH A;  1SFE A;  4G6Q A;  2DOE A;  5JR3 A;  2YX7 A;  3IWZ A;  2NVY J;  3S3M A;  4JCY A;  2LBF B;  4XKW A;  1FTT A;  4PU4 C;  3SZG A;  1JKQ C;  2LNM A;  2DDA A;  2P0W A;  1RC9 A;  3IAM 2;  2XAS A;  1NW3 A;  1KZH A;  2FOW A;  5FKK A;  2O8X A;  3MZ8 A;  3WU2 C;  2XRL A;  4EK9 A;  4BJ5 C;  3JW4 A;  3VEP A;  5JUW A;  4KT5 C;  1MBH A;  2L7M P;  2GIZ A;  3LQQ A;  3OSG A;  5KAF C;  5J1U A;  3SJM A;  2DMN A;  1YLF A;  3ZN0 A;  2IGM A;  1UST A;  1B1B A;  1MNE A;  3OS2 A;  3G71 I;  3L2R A;  1ZG1 A;  3VYU B;  3FMQ A;  3SYT A;  5K5O A;  1KYW A;  2I5U A;  1T56 A;  2CUZ A;  3BQY A;  1JFT A;  3G73 A;  5L3D A;  2I10 A;  2CUJ A;  3MMY B;  4ER6 A;  2FOK A;  2XF6 A;  2PQ8 A;  2GQQ A;  3CDI A;  3W6V A;  2VOD A;  5DM7 F;  2AW6 A;  2LLK A;  3GZC A;  2DFI A;  1GV5 A;  2EZK A;  1FJL A;  3WTZ A;  1UB9 A;  3EPZ A;  3LQX A;  4OAZ A;  2JWT A;  3LSH A;  5EYR A;  4A3B J;  1IJW C;  4NQW A;  1H88 C;  3E6C C;  1IRZ A;  2JRM A;  1WJD A;  2K02 A;  2R7V A;  3OY9 A;  4X4B A;  4EEF G;  1MMD A;  3HSF A;  2QWW A;  2OTL I;  1SC7 A;  1G3S A;  2A68 F;  4X4I A;  1Z1D A;  2R5Z B;  2XHK A;  2PMZ A;  1WFX A;  2XSD C;  5CVR A;  5IP9 J;  2HTS A;  3OYG A;  1NK3 P;  4OBM A;  2YBD A;  3ME5 A;  3OIQ A;  4EJO A;  2HDC A;  1OLT A;  3LQR A;  4EM0 B;  1X3Z B;  2KIU A;  4BHC A;  5JVG F;  2Q0O A;  1SAN A;  3Q0V A;  5E79 C;  4I99 C;  1V55 H;  1Y1V J;  1VQM I;  2PI0 A;  4C3I J;  4J1W A;  3GN5 B;  3JTH A;  4AWX B;  1HKQ A;  3S1Q J;  2DA1 A;  3M4O J;  1X2M A;  5J4Y A;  1ONV A;  2NS0 A;  1DUX C;  1VQ5 I;  4ZYH A;  3I55 I;  4DE8 A;  2W1O A;  3JAM Z;  3P9C A;  4EKG A;  5DRY A;  1XDS A;  2B63 J;  4A93 J;  5L3E A;  3K4B A;  2JK3 A;  4KIF A;  1B6A A;  4HRA A;  4XQF A;  1NH3 A;  4L9T A;  4IL6 C;  1TT5 B;  3SEQ A;  2LYR A;  2TRT A;  3GTJ J;  4HSR A;  5D5V B;  2DQL A;  2FBH A;  2DA5 A;  1Z21 A;  2ZFW A;  2JQE A;  2XVC A;  4Y4R A;  5TRD A;  2QSG X;  5GAG i;  2F48 A;  3K69 A;  3LA2 A;  4TV7 A;  2EB7 A;  2HS5 A;  2OC6 A;  2WA0 A;  4P5O A;  2DCE A;  4YG2 F;  1Y9Q A;  2HFH A;  3I59 B;  1MSE C;  2D2W A;  1BM9 A;  1IXC A;  2JUG A;  2VN2 A;  4RLQ A;  2HVR A;  3FX3 A;  2LK2 A;  2OQG A;  3KYC B;  4AVZ A;  4MLO A;  4Y13 A;  3JRA A;  4XOP A;  3SXY A;  3JTG A;  5C4J J;  2IEK A;  2XCJ A;  4XSZ F;  3OIO A;  1QPI A;  3IRQ A;  3NRV A;  4R79 A;  3AG2 H;  1USS A;  1EA3 A;  4DYC A;  4HYE A;  1FOY A;  2E1N A;  2D5V A;  5HDN A;  3MQ0 A;  2V1X A;  2BVM A;  4XRS A;  2VC0 A;  1JGG A;  1ZTR A;  1W7P B;  1LFB A;  5CLS A;  5GAG J;  5DTD A;  1IDY A;  2NS7 A;  1UHS A;  4ITV A;  4FBI A;  3H5N A;  4ER0 A;  4NNJ A;  2PX9 A;  4LLN A;  1R71 A;  1XGM A;  2O03 A;  2VQH A;  3OWT A;  3TED A;  3SCH A;  3NWS A;  1B72 B;  1ODD A;  3W6K B;  5J6X A;  3LSP A;  3GEZ A;  4CO8 A;  1BW6 A;  2EH3 A;  2XUB A;  3FXU A;  2O4A A;  3EET A;  4CDG A;  3JRB A;  2DT5 A;  2B9S A;  2XPU A;  3FXJ A;  3MD2 A;  1HKS A;  3HYI A;  4E7Z A;  3ASN H;  1QBJ A;  5E20 A;  3JR9 A;  1BJA A;  1Z6T A;  5FLX K;  1GXP A;  3HKZ A;  1DP3 A;  3Q5F A;  3BC8 A;  2MD0 A;  1YJ9 I;  4OU0 A;  3CCU I;  4GRI A;  2NOG A;  1T2K A;  3HIF A;  3K70 D;  3QWG A;  2IAI A;  4BXU A;  4MFD A;  2HCS A;  1E2X A;  5A7L A;  4RM3 A;  2XXA A;  1JI8 A;  4IXA A;  1YIO A;  4XIC A;  1IC8 A;  2LCV A;  1XSD A;  3CC2 I;  2CV0 A;  1RPE L;  1R7J A;  3PFY A;  1DGR M;  1LEB A;  1E0E A;  2K5C A;  2A6T A;  3T8T A;  3PQJ A;  2R93 J;  2HNH A;  2CW8 A;  4Q47 A;  5GPC A;  2LYP A;  2CV2 A;  1EH7 A;  1YS7 A;  3WG7 H;  5CQG A;  3LSR A;  1B8I A;  3S1N J;  2Y9Z A;  3OYD A;  3JRH A;  2XAG A;  2X9D A;  2Z2S B;  5J1Y A;  2GLO A;  3PIO F;  1MJA A;  3ZCO A;  1U8B A;  1RZ4 A;  5J40 A;  1QHH D;  5BNG A;  1SFU A;  2ICT A;  4HBL A;  1R5H A;  3IHU A;  4UNO A;  3VK0 A;  5FRM A;  1J59 A;  4LGW A;  3ESW B;  4CCK A;  2DYS H;  4ZYE A;  1BC7 C;  3NAR A;  2LP0 A;  2M0M A;  4DGW B;  3ZR8 X;  4BH9 A;  2K9S A;  3L2W A;  2L7K A;  3ZHM A;  3RZO J;  2AXU A;  4BJ6 C;  4IRI A;  4A6D A;  3DKW A;  4C30 A;  5IP6 A;  4MEX F;  2A5W A;  5EDN A;  1T0F C;  1OIS A;  3DLL F;  5CYV A;  2BY1 A;  2O9L A;  5HLT A;  2NAZ A;  3SX0 A;  2ZJR F;  3R0A A;  1XMK A;  2FMY A;  2HYJ A;  3ISP A;  1KU2 A;  1GT0 C;  1S5L C;  2WB1 N;  2WC2 A;  3HOZ J;  1VQ4 I;  5E8G A;  1NTC A;  3KJX A;  2X0L A;  2HDD A;  1H0M A;  4O5V A;  2FE3 A;  5CVU A;  1Y8Q B;  1R49 A;  2Z16 A;  2VL8 A;  4UHT A;  4U0V A;  2EFW A;  3KP5 A;  2E71 A;  4S05 A;  2V26 A;  5E8I A;  1W36 C;  4CCJ A;  1Q1V A;  2KZV A;  2BVL A;  2H94 A;  3ML6 A;  3OL3 A;  4Z6Y A;  1SMY F;  3G3Z A;  3I4M J;  2DBB A;  1FEX A;  2XIG A;  1WET A;  2ISZ A;  1JKR C;  3OSF A;  1MMA A;  4BE0 A;  1MBK A;  2LLW A;  4U88 A;  4O6J A;  2KQR A;  1PNR A;  1IRG A;  1TC3 C;  2L0K A;  4KIT B;  3HSE A;  2BBY A;  4LG3 A;  4BHP A;  4KIS A;  3OR2 C;  1JKO C;  2L4A A;  1PP7 U;  6PAX A;  3LSJ A;  1SMT A;  2LYQ A;  4GHJ A;  3SDB A;  4XOR A;  1YG2 A;  4ZDP A;  3GUU A;  3PSI A;  4G7H F;  3H9J A;  1ON2 A;  3KIO A;  1P4A A;  2IGN A;  4E7L A;  4B4C A;  2BJC A;  3O8H A;  1BL0 A;  2A6C A;  2R1J L;  3ZQF A;  5K7H A;  3UNG C;  2HTJ A;  2NVX J;  2F4M B;  2P6S A;  2M2E A;  3F6V A;  1PP8 F;  5LHG A;  3S1R J;  5BPI A;  4KIG A;  5FRN A;  1WGX A;  2MLK A;  1X3U A;  1YOV B;  4NBQ A;  1JUP A;  4I2O A;  3BZK A;  3F8B A;  2F5F A;  1LVA A;  3IKT A;  2MAB A;  2O5R A;  5ILU A;  4GYI A;  2IS6 A;  2K9L A;  1KQ8 A;  3BRO A;  2DFE A;  4CGZ A;  2DDB A;  5EEA A;  4OIQ F;  3G4S I;  2VBW A;  3HHH A;  1IRX A;  1IO2 A;  4I09 A;  2AXV A;  3GUD A;  3K4K A;  3RPQ A;  3IVP A;  3JSO A;  2NRA C;  1ZZ6 A;  3SZP A;  2GRL A;  1LDD A;  5TGT A;  3M7G A;  3ZXS A;  1VQ7 I;  2ZME C;  4I6U A;  3H36 A;  4YG7 B;  4A3J J;  4F55 A;  2L7Z A;  2WAD A;  4XLN F;  4I0A A;  4AM3 A;  2ZB9 A;  2R7X A;  5IPA A;  3ZP5 A;  1IXR C;  2M30 A;  4JP0 A;  3ZPX A;  3TGN A;  3DEU A;  2KJB A;  5DM6 F;  1KU7 A;  2JUC A;  4HF0 A;  4RMN A;  1JTY A;  5H2F C;  3HOS A;  1TW2 A;  2XKO A;  2GZW A;  2XF5 A;  2DA7 A;  2ELJ A;  2P8T A;  1UCR A;  4IRH A;  1KQ9 A;  1ETW A;  1NG6 A;  4FIS A;  1WHU A;  1MH4 A;  2ISY A;  2V6C A;  2ZJP F;  2HVQ A;  4A3K J;  2HQN A;  2ME0 A;  2VQL A;  3B6A A;  4KN4 X;  3S2D J;  4EVI A;  1QQB A;  1P7J A;  3AKZ A;  1IZ1 A;  1ZAO A;  4P55 A;  5FO5 A;  3MKY B;  3TO9 A;  2KZG A;  2D45 A;  1VQ8 I;  2ZCW A;  1A36 A;  1LQ1 A;  4J00 A;  3MFK A;  1ETQ A;  2FNP A;  2L54 A;  2PJR A;  2F5V A;  4UXN A;  1K79 A;  3HJE A;  5D6F A;  2LC2 A;  2ADU A;  3TW7 A;  5EF6 A;  5HDG A;  1J09 A;  3CC4 I;  2PFB A;  5LGT A;  2NYX A;  2EIN H;  4XKC A;  4A0Z A;  5EJC A;  3TEP A;  5F1J A;  3CP2 A;  2YPR A;  1WI9 A;  3DEE A;  1IN8 A;  4YFK F;  3UR3 C;  1JFS A;  1LCC A;  1GV2 A;  3W2V A;  1OFC X;  3OYN A;  4ESJ A;  3HRS A;  5HOO A;  2BZT A;  4F93 B;  1W5S A;  2V1N A;  2VKE A;  3OQN A;  1FP2 A;  1VQK I;  2F2E A;  1R1T A;  4D5C A;  3OYF A;  3W2A A;  2V6E A;  2KP6 A;  2EFN A;  2GXG A;  1BA5 A;  2P81 A;  3WTU C;  3GLL A;  5ICF A;  4BS9 A;  3FF5 A;  3DU6 A;  4J1X A;  4O3M A;  3AG3 H;  5ICE A;  1ZQ3 P;  1WJE A;  5LGN A;  3JRE A;  1D8J A;  3S14 J;  4Y52 J;  3JXD L;  3MKZ A;  1V3F A;  4BEH A;  4EMS A;  1QB2 A;  3DXJ F;  1OQY A;  1OMI A;  1D5Y A;  2HOS A;  2OV7 A;  3N05 A;  1RZR D;  3L7W A;  3FXM A;  4BY1 J;  3U2R A;  4XN0 A;  2LF8 A;  1XPX A;  2TCT A;  2IXS A;  2W57 A;  5H6Q A;  4D0P A;  5DCF A;  3ZMD A;  2PUC A;  2QEX I;  2QSH X;  3QOX A;  4PFP A;  5JHU A;  5E3M A;  1QRY A;  2M4K A;  2V79 A;  5JFR A;  2YX4 A;  3RDI A;  2PXV A;  2XKP A;  3Q0W A;  1T33 A;  3FIS A;  5EZG A;  5J8F A;  4F92 B;  3I0T A;  4HV6 A;  4U7D A;  1WIZ A;  2L9N A;  2DLL A;  3BR0 A;  3QYE A;  2HOT A;  2J7U A;  4U0Y A;  4A3C J;  1YW9 A;  1UG0 A;  2E36 A;  3ZRG A;  2IU7 A;  2LTP A;  2LY1 A;  3GX4 X;  2BY3 A;  1O7L A;  1J75 A;  2QKM B;  5B1B H;  4UUV A;  1MH3 A;  4YG4 A;  3KLO A;  1RUO A;  4ER7 A;  3GWZ A;  2L02 A;  4B43 A;  4EQZ A;  2LF7 A;  2M8E A;  4YAR A;  1CJG A;  4HAM A;  1ZR2 A;  1JGS A;  2V9K A;  2M0C A;  2W00 A;  1AHD P;  3BR3 A;  2LVS A;  3B7H A;  4DOZ A;  3BPX A;  2CRO A;  2ACJ A;  2M5W A;  1R23 A;  1G8X A;  3I3L A;  3C18 A;  2B5A A;  1D1A A;  1JUM A;  1YX3 A;  2E1M B;  4ZYG A;  1WJC A;  2P4W A;  3HPH A;  5ERI A;  3A01 B;  2KFD A;  4E7K A;  2OF7 A;  3DPT A;  4A3I J;  1U9O A;  4OIO F;  3HOX J;  2KEK A;  4DYQ A;  2LNB A;  1O4X A;  1VQL I;  3H3V K;  2J7W A;  2PEX A;  1T39 A;  5BOX A;  2XB0 X;  1KGS A;  1ETK A;  2RAE A;  3A9X A;  2DA3 A;  1BR4 A;  3CJT B;  2AS5 F;  4DQ2 A;  3KET A;  4GGG A;  5K7Z A;  3EYY A;  3RPU D;  1J2X A;  3L2Q A;  2UXX A;  3O6B B;  1VPW A;  1ZGJ A;  5ILV A;  5EGO B;  2W48 A;  2CFO A;  2VON A;  3GW2 A;  3CD6 I;  4GDF A;  2CJJ A;  3NWT A;  1V5G A;  2IVM A;  3KFW X;  4ZTF A;  2ESN A;  5FJ8 J;  4BY7 J;  2MSY A;  2KT0 A;  2MXD A;  1Z3Y A;  5EG0 B;  2CG4 A;  5A2Q K;  2QLZ A;  3SFI A;  3ABT A;  4DZP A;  1B72 A;  4FT8 A;  1FSE A;  2IJL A;  1K78 B;  4CCO A;  2IVG A;  1R4N B;  1Y1W J;  3NRO A;  1IUF A;  3K1P A;  3QYX A;  3N4M A;  2DPD A;  3BP8 A;  1S29 A;  1H9T A;  3G2B A;  2V3C C;  2PXU A;  4OMY A;  1ZK8 A;  2M1B A;  2L2O A;  1BI0 A;  1IF1 A;  5ILS A;  3DPL C;  5EZH A;  2CMP A;  3FM3 A;  3BDN A;  3PM1 A;  2PLY A;  3K9T A;  3ZQL A;  4HG2 A;  3OMY A;  2X1E A;  2X48 A;  1B8I B;  1AA7 A;  4YIF A;  4J19 A;  1X4P A;  3FIW A;  2DMP A;  4M6Y A;  1DP7 P;  3Q9S A;  5HLG A;  2DFF A;  4OWR B;  1OYY A;  3QQ6 A;  4XL9 A;  1QP0 A;  1X2L A;  3CDL A;  4X4E A;  3BOQ A;  4V2G A;  4XRS G;  1U8R A;  1WVR A;  4CCM A;  3ZGK A;  3H5A A;  1KQ0 A;  5LFA A;  3NAU A;  4UVB A;  2RVC A;  5DV5 A;  3HL2 A;  2FA5 A;  1S72 I;  2VAS A;  1MDM A;  1FOX A;  4EJW A;  1I1S A;  2DN0 A;  4P96 A;  2M9H A;  5ED4 A;  2R7F A;  1HSJ A;  5EEH A;  1R6R A;  1R4M B;  5K7F A;  4BBS J;  2IUO A;  2E1M C;  1D5V A;  3NEU A;  3VPR A;  2L4M A;  1XDU A;  1PRA A;  2XAQ A;  2HR3 A;  5BMZ A;  2Z3Y A;  4CUG A;  1WJF A;  3TMO A;  2W84 A;  2O6G E;  4NHJ A;  3LFP A;  4EKI A;  4BU2 A;  4JYK A;  4Y17 A;  2IA2 A;  3KX2 A;  2JA2 A;  2DA4 A;  3BY6 A;  1X3W B;  4NC8 A;  5F0F A;  4X4F A;  1LVK A;  3GZN B;  3ZOB A;  4JQD A;  3PUF A;  3R0J A;  3OYH A;  2LD5 A;  2X85 A;  1ZAY A;  4L9V A;  4LIV A;  1WJB A;  3MKL A;  3DFG A;  3GFL A;  4MIM A;  3CUQ B;  2GA1 A;  2RC4 A;  4F52 A;  1K61 A;  1C0W A;  1S7O A;  3FBI B;  3N97 A;  3ZMZ A;  3FXQ A;  1XS9 A;  1OCZ H;  3O3K A;  4WXC A;  1NK2 P;  3CEC A;  1P6R A;  2CQ7 A;  2L9V A;  1K6Y A;  3LST A;  4EGZ A;  1YW8 A;  1ZR4 A;  3FWE A;  1QZY A;  3RPU A;  2MG4 A;  1ITY A;  3JXB C;  5IT9 K;  4X1E A;  2DK5 A;  3CLO A;  1W36 D;  3LSK A;  2GZU A;  4WX9 A;  4ER5 A;  4ABZ A;  4A3E J;  1MZB A;  2CUE A;  2ID6 A;  5J1R A;  2JZY A;  2Y9Y A;  1WJ5 A;  3H9G A;  4WXD A;  5A2Q Z;  2OPT A;  3CCY A;  2YSR A;  2E2I J;  1T6S A;  1TQI A;  2OAZ A;  3KPH A;  3MVP A;  4XRM A;  3VYT B;  1K4T A;  2XJ3 A;  1PDN C;  3WTW C;  1J5Y A;  2DJI A;  3BPV A;  3F23 A;  3G1L A;  1IN5 A;  1JHF A;  5M3M J;  1JXS A;  1ON1 A;  2JT1 A;  3EUK L;  3B02 A;  1L0O C;  3W3C A;  3DBL B;  1ZRF A;  3GFJ A;  1DPU A;  2AXT C;  3KEQ A;  4A3M J;  2HI3 A;  2ZXW H;  3MN2 A;  4EM2 A;  2M87 A;  2CWE A;  4XLA A;  3G1M A;  4AC0 A;  1TW3 A;  3S1M J;  4A3D J;  4S0H B;  1W1W E;  1TWH J;  4PU7 A;  1WI3 A;  3KZY A;  5CJ9 A;  4LG0 B;  3O8G A;  3V8L A;  5L3B A;  2E2J J;  3VWS A;  3V42 A;  4II3 A;  2VJ4 A;  2JCG A;  2ECC A;  3GBF A;  1UTX A;  4KYW A;  3QQA A;  3CO6 C;  2ZSI B;  2R5Y A;  2VPR A;  5DTQ A;  2M4H A;  1HCR A;  2RQP A;  1S7E A;  4IWR A;  2JMW A;  2R7T A;  2RRE A;  2E5N A;  1PRU A;  4E70 A;  3E97 A;  4ETS A;  4M71 A;  2ICW G;  5DUI A;  3BG3 A;  5LRS A;  1TNS A;  3QOE A;  4R1H A;  3SEZ A;  3A9Z A;  2BNM A;  4PFO A;  2IS1 A;  1R22 A;  3WTT C;  3FKI J;  4HQM A;  3HBL A;  4IQ4 A;  2O61 A;  3BD1 A;  5BS6 A;  1SVL A;  3K4N A;  4YRV A;  2ZJ2 A;  2UXN A;  2VXZ A;  1S9H A;  4PJM A;  1Q1H A;  1RR7 A;  4M3F A;  3LFK A;  4IA8 A;  2HYF A;  2TDX A;  3QU3 A;  2EBI A;  2FXA A;  3DEW A;  3V7R A;  1F5T A;  3GZ6 A;  2KEI A;  2QF7 A;  3HUG B;  3OV8 A;  2VIX A;  2F5C A;  1ZZC A;  1BI3 A;  3KZI C;  1D0Z A;  2MFZ A;  4JBA A;  4CYC B;  4L0Y B;  1U3E M;  1EF4 A;  2EK5 A;  3FHN A;  5LBQ A;  2DA6 A;  2M34 A;  2OBP A;  4FE4 A;  2ZNZ A;  4YG1 A;  4CYC A;  2LFB A;  1FNN A;  1W7P D;  4XN3 A;  1O57 A;  3OYC A;  3V8J A;  3GTO J;  2FNA A;  5LLQ A;  4CYD A;  3EUS A;  5M5Y J;  3EQL F;  3KXA A;  3LSM A;  3A4C A;  1WH6 A;  1A5J A;  4V19 K;  1OR7 A;  1RZR A;  1QZZ A;  2HQ5 A;  3ZMU A;  5EEG A;  2VJ5 A;  4ENM A;  1FBU A;  1ZYR F;  2X1C A;  3BR5 A;  4UY8 I;  4ENN A;  3ZQC A;  1FC3 A;  1W7P A;  3F6O A;  3BS3 A;  4U0W A;  2IPQ X;  1ZZ9 A;  5HLI A;  3CCS I;  1XGS A;  1M1E B;  3Q9V A;  2IGO A;  3QWL A;  1ACI A;  4UUT A;  1K6O A;  4A6E A;  3A0H C;  2GIV A;  2GBY A;  3HTU A;  4XLH A;  4NUB A;  2M7B A;  5JVT A;  3CLC A;  1Z67 A;  1X1B A;  3WE3 A;  4A3F J;  3JCU C;  3VB2 A;  1YIT I;  1AKH A;  4L5I A;  4F91 B;  4RAF A;  4UV9 A;  1ZRC A;  1MD0 A;  1T95 A;  5DEQ A;  4KMU X;  2XC7 A;  1QZE A;  3IH2 A;  4WF2 A;  3MZY A;  1KON A;  2ZXH A;  4KFC A;  1LDJ A;  3OL4 A;  3AL0 B;  3L09 A;  5F6F A;  4IHV A;  3F3X A;  1D3Y A;  4B09 A;  2Z1D A;  3WTY C;  3ELK A;  2HPI A;  1Z91 A;  2XPW A;  1T0F A;  3E6M A;  3H0D A;  3OS0 A;  3S3O A;  4BE1 A;  2HVS A;  2QEN A;  1IDZ A;  5DRT A;  3QU6 A;  1U6G A;  2GRM A;  2JA7 J;  4LOC A;  2PUA A;  5GP9 A;  3J81 K;  2IA0 A;  3H5T A;  2VBY A;  5L3F A;  5AIQ A;  5HDK A;  2LR8 A;  1O7F A;  1HLV A;  2KRH A;  2E7X A;  1X1P A;  3I56 I;  2BXZ A;  1DW9 A;  4EZI A;  3REO A;  4A69 C;  2AWI A;  2CQK A;  3S3N A;  1RNL A;  3JRF A;  2H6B A;  2HCN A;  4JK1 X;  4HNU A;  2XAU A;  3R61 A;  2DT7 B;  1N77 A;  3KP4 A;  2DXI A;  3OQM A;  1QPZ A;  1MND A;  2K4J A;  4XR6 A;  4A5M A;  2JJ7 A;  5KNL A;  1Y7Y A;  1BN5 A;  3FYM A;  4N9H A;  3OYI A;  3R09 A;  3FBN B;  4ZTJ A;  2MEZ A;  2EZL A;  2XGX A;  2L1P A;  3LOC A;  4Q48 A;  3UFD A;  4FX4 A;  1Z7U A;  1HF0 A;  3BTI A;  2UZK A;  2QQ8 A;  3CJQ B;  2DAO A;  4I8T A;  1KU9 A;  3DQV C;  2STT A;  3L2C A;  4XMY A;  4ZYA A;  2KIS A;  4J01 A;  4Z59 A;  4D1Q A;  1OCP A;  1TNT A;  1G2H A;  2HXO A;  4DW6 A;  3F8C A;  2AXL A;  2QA4 I;  3M8F A;  4XNF A;  5K5Q A;  4B47 A;  2XAH A;  3IV5 A;  1D1B A;  4A2U A;  4IJA A;  1XGN A;  3BR1 A;  1A04 A;  4CZC A;  1ZS4 A;  2W4S A;  2P6T A;  4YFN F;  1HXD A;  3WTV C;  2JN6 A;  2R3S A;  1Y0N A;  2MYS A;  2FQ3 A;  4BHB A;  4UUS A;  1TWF J;  3DTE A;  1SD4 A;  4XLC A;  5K1Y A;  1CQT A;  2XDV A;  2RGV A;  2Q2E B;  4M3B A;  3WOD F;  1ZN2 A;  3F8F A;  1JT6 A;  2VI6 A;  4EJV A;  3K2A A;  4HW0 A;  3FMR A;  5TIS C;  3CJR B;  1EH8 A;  2O8K A;  4BQN A;  5DD4 A;  1WWX A;  2YR2 A;  1ENH A;  1MBG A;  4RGX A;  1QHG A;  4RA2 A;  2PXF A;  1BDI A;  5IYB J;  3LAJ A;  4FHT A;  3VYR B;  4M9Z A;  1T98 A;  1YRN A;  2B0L A;  3G6E I;  1U78 A;  1PVE A;  1XGO A;  2E19 A;  4AUX A;  3QFI A;  1K4S A;  4N9I A;  1TWG J;  3BTC A;  2WAE A;  1X58 A;  1XSV A;  4RB0 A;  3CTA A;  2ME6 A;  1TBX A;  1BDH A;  2EIM H;  4G6T B;  3DTK A;  4I02 A;  2MC3 A;  4N4O B;  3I58 A;  1TL8 A;  1HKT A;  2PN6 A;  4ZDO A;  3CMA I;  3HOY J;  3BDD A;  1TTY A;  1XG1 A;  1F9N A;  5FD6 A;  2R7S A;  2GA2 A;  1YTY A;  3E5Q A;  2Z99 A;  1FMV A;  1X1C A;  1SQ8 A;  4HLY A;  4EGY A;  1JJ6 C;  2DOF A;  1A31 A;  3LA3 A;  3S2W A;  2PXB A;  4XSX F;  2FU4 A;  1VQO I;  4G94 A;  1RIO H;  3CF2 A;  1PRV A;  2BV6 A;  3BZ6 A;  2A61 A;  1HBX G;  2V9P A;  3CLQ A;  1LFU P;  3QPL A;  1ZH5 A;  4M73 A;  2FX0 A;  3GZ5 A;  1OJL A;  4HX7 A;  2DFH A;  4CCN A;  4II2 A;  3D5R C;  3CMY A;  1JE8 A;  1WH8 A;  2OJE D;  3TP3 A;  2E34 A;  4RAZ A;  1F4K A;  2WV0 A;  2KPJ A;  1TZL A;  1I39 A;  3KZZ A;  2KKO A;  3MKW B;  2RKH A;  3GME A;  4RS8 A;  4LLL A;  5B1A H;  2EQR A;  1S8N A;  3FYA A;  3BTL A;  3CC7 I;  2WV1 A;  1ETV A;  3H5R A;  3I53 A;  3PO2 J;  1R9T J;  2HEO A;  2V4J C;  2BY0 A;  2HZD A;  3JRG A;  2FUG 2;  2CYY A;  1X19 A;  2D1H A;  2OA4 A;  3BCB A;  3C2H A;  3GZD C;  4YFX F;  2Z9O A;  1WH7 A;  2KHM A;  4Y7N J;  1JT0 A;  1IV8 A;  1N75 A;  3PJR A;  1STZ A;  1ZEL A;  1IRF A;  1I27 A;  1T08 B;  1IW7 F;  4D9J A;  4WCG A;  4KMF A;  4ENJ A;  3I4P A;  2QYO A;  1V5F A;  2A5Y B;  1R69 A;  4BNC A;  4M3D A;  1XD7 A;  2VT3 A;  1BR1 A;  1P7I A;  2OU2 A;  3C3W A;  1ETY A;  1QPM A;  1REP C;  2DI3 A;  2DPU A;  2EPF A;  4A0Y A;  2OQR A;  3VSL A;  4HLX A;  3ZPL A;  2FRH A;  1VQP I;  1R5G A;  3E7L A;  4IVN A;  3CCL I;  1POG A;  4B3X A;  2OUM A;  2H1K A;  3FKJ A;  1BBY A;  5F1R A;  1HW5 A;  2LSO A;  5D5W B;  3FMY A;  4W97 A;  2DMU A;  2ETH A;  3PXP A;  1Z77 A;  3QPS A;  3O9X A;  1OCR H;  2Y0S A;  2HZT A;  1J0R A;  1EFA A;  2E35 A;  2ECB A;  3OR1 C;  1GUU A;  3TOB A;  4DJA A;  3LNQ A;  2GOX B;  5DSX A;  2L9S A;  2EFO A;  2KIF A;  4DIQ A;  3OYM A;  3GFI A;  3F52 A;  2IRF G;  2LMD A;  3UWP A;  2DOD A;  4D7M A;  4XBF A;  1IN6 A;  4XK4 A;  1JJ8 C;  4RGU A;  2OTJ I;  2ZXI A;  1UMQ A;  3RJP A;  5HLH A;  4FET A;  3QF3 A;  4IQJ A;  3SR4 A;  4UVC A;  3TO6 A;  4PGH A;  2LKP A;  1HST A;  1YI2 I;  1QQI A;  4C2U A;  2VBX A;  2HWV A;  3K6G A;  3BQZ A;  4NQW B;  3T1B A;  5L3G A;  3BJO A;  2K9N A;  2A6E F;  2XGD A;  2JVH A;  2LRD A;  4LD5 A;  2R7Z J;  4RB3 C;  4K2E A;  1ZVV A;  1U2Z A;  3HPG A;  3DU5 A;  4XID A;  3JRI A;  2XPV A;  3F72 A;  5FGM A;  3GCM A;  1VQN I;  2PJP A;  1LCD A;  3ZQQ A;  2K3F A;  5IT3 A;  4KA4 A;  3LWF A;  2IS4 A;  2F4I A;  4I01 A;  4C3H J;  3G1O A;  2P5L C;  2R5Y B;  1FP1 D;  2F5D A;  4QPQ A;  1GLN A;  1R1U A;  5M3F J;  3BG9 A;  5E18 F;  3SCF A;  4RBO A;  2O49 A;  4YEJ A;  2L9R A;  1UZC A;  1F36 A;  3E1S A;  2FML A;  5J3L A;  3HEF A;  1JTX A;  2K4B A;  3P5J A;  4G7O F;  1SEU A;  4AIK A;  3HXL A;  3VSK A;  3R1F A;  2W24 A;  2DW4 A;  3DCF A;  3K4L A;  1F1Z A;  1VND A;  2G0E A;  4HX4 A;  2EF8 A;  2HQR A;  5GAH i;  1RR8 C;  2FSW A;  3RYP A;  4F3Q A;  3C7J A;  4HNT A;  4KIB A;  2Q1Z B;  4YIR X;  3ZQI A;  4QWQ A;  3VYS B;  3DP7 A;  4A12 A;  5IYD J;  2RN7 A;  1DUL A;  2Y2Z A;  3F8N A;  3RI4 A;  3FXK A;  2IS2 A;  1WSU A;  5D4S A;  3COA C;  2EZI A;  2EWT A;  2A69 F;  4E7I A;  4HRI A;  2Q2E A;  3PIP F;  2HIN A;  2W7N A;  3EUH C;  4X0G A;  2LDU A;  5AIP A;  3I9V 2;  3S93 A;  4DYR A;  4I98 B;  2KJC A;  2CW0 F;  1P4W A;  5M5X J;  2LY2 A;  4KUM A;  3ABU A;  3LIS A;  1NEQ A;  3TP0 A;  4HV5 A;  2K86 A;  1HQ1 A;  3ABK H;  4I0B A;  4OB4 A;  1U9N A;  1VZ0 A;  2WTE A;  3WG9 A;  3BJ6 A;  2A07 F;  2IT0 A;  4YEL A;  4PU3 C;  3QPH A;  1UHM A;  5D8L B;  3CCR I;  4L18 B;  1APL C;  4L9J A;  4G7Z F;  3HOW J;  2HSG A;  1TQP A;  3HKZ N;  1MMG A;  1YRN B;  3OOU A;  2Q8K A;  1QVT A;  2FD5 A;  1SFO J;  1OKR A;  4W1U A;  3CRO L;  1BIB A;  2IA1 A;  5C3E J;  1BW5 A;  2DQR A;  1ZRD A;  2ODR D;  5J4V A;  5GTH C;  2RNJ A;  2YU3 A;  2Y0M A;  3WTS C;  4PCQ A;  4KDP A;  2QGU A;  3BR6 A;  4M6X A;  3S16 J;  3FK7 A;  3IP4 B;  2MH2 A;  1D0Y A;  2JRT A;  5E3O A;  1IXS B;  2PBI A;  1WKM A;  3HRT A;  1FLI A;  3AAF A;  1WRJ A;  1K78 A;  2W82 A;  1S3J A;  2KL4 A;  2ICP A;  3U1D A;  4Q4Z F;  1YE9 A;  3SCG A;  4PZJ A;  3HHG A;  5E1X A;  1LDK B;  4AVP A;  3GLX A;  4B48 A;  1W4M A;  2QQB A;  3QOP A;  5DTR A;  3H92 A;  3G7D A;  4V2F A;  3HTS B;  2M7A A;  4X6A J;  4HQE A;  1G59 A;  2DU9 A;  4AYB A;  1FY7 A;  3PNV A;  3MEX A;  2BHZ A;  3I71 A;  4R8H A;  2IVB A;  1MBJ A;  1PER L;  1U5T B;  2JA5 J;  3CO7 C;  4BEH B;  2NS8 A;  3TFL A;  2NVU B;  1JWL A;  2PG4 A;  1YJW I;  2EV5 A;  2V9V A;  1HC8 A;  1FX7 A;  1TP4 A;  1TWC J;  3KP3 A;  3T0Y A;  3T8R A;  3ASO H;  4AIJ A;  3V7S A;  4HF2 A;  4YII A;  2HPM A;  2CFX A;  2XGC A;  1ZZB A;  2L7F P;  3MZH A;  2Y0S N;  4DZJ A;  3RSN A;  2H27 A;  3RCO A;  1XCV A;  2ZC2 A;  5F08 A;  2ZME A;  4XLE A;  3Q0U A;  1LKX A;  3CUO A;  4XOT A;  1ORK A;  2HYG D;  3VOE A;  4I6Z A;  2P5K A;  2R7U A;  1RI7 A;  3HM5 A;  4RM2 A;  2DMQ A;  3WU0 A;  2OD5 A;  2R7D A;  2K27 A;  2OZU A;  3QYF A;  3VDX A;  3EDP A;  3W2W A;  2V1D A;  2NNY A;  3I54 A;  3A1Y A;  1O3T A;  3J80 K;  2XV4 S;  1LEA A;  3FM5 A;  4EJT A;  4XRF A;  3IH4 A;  3BG7 A;  4BL0 B;  4LIU A;  1PUE E;  3GXO A;  3LMM A;  1B9M A;  1VQ6 I;  3BT9 A;  1X1A A;  1DU0 A;  4ANJ A;  2CUF A;  4D7N A;  3C1D A;  4HA8 A;  3X2Q H;  3P9I A;  4LLG F;  1LJ9 A;  3ZMS A;  4BQQ A;  3OYA A;  2PMH A;  3E5X A;  3PNY A;  1I6X A;  3TRB A;  4WXH A;  4MO7 A;  1AOY A;  4PJN A;  3S2H J;  3CMM A;  3MLF A;  3BLY A;  4MQV A;  4UUS B;  1UAA A;  2VBZ A;  3L9F A;  2KEJ A;  1MFQ C;  1OYW A;  1QGP A;  5ICC A;  2D1V A;  3M9L A;  3WHB A;  1QP7 A;  3A2K A;  1MMS A;  2ESH A;  5GPA A;  2BYV E;  4IF4 A;  4OMZ A;  1B9N A;  3MCZ A;  4F7Z A;  4ZYD A;  5IT9 Z;  3CCM I;  3M9A A;  4Q5S F;  2GXB A;  4HDV A;  2PXT A;  1A6I A;  2F6C A;  2JVG A;  4I76 A;  2DA2 A;  1RES A;  3G5G A;  2CGP A;  2PXQ A;  2Z33 A;  3GTG J;  4ASN A;  3KP7 A;  4BE2 A;  3VWB A;  1GDT A;  5EGO A;  3L2V A;  2KDZ A;  1FPQ A;  3NQO A;  3QRF F;  1OCT C;  5K98 B;  5B3S H;  5DTM A;  1ERD A;  3CCQ I;  4MCT A;  1V54 H;  4FCY A;  3K0L A;  2COM A;  4EM1 A;  1G4D A;  2CQQ A;  1E3H A;  2ELK A;  2GOM A;  3DLA A;  4RGS A;  4BQA A;  1B4A A;  3SFZ A;  1J7K A;  4S04 A;  2NXN B;  4Y15 A;  2G7U A;  3IRR A;  1CF7 B;  4I7H A;  1VI0 A;  2JPC A;  2FBK A;  2XF7 A;  1R58 A;  4CA0 A;  1HOM A;  2R7Q A;  3F21 A;  1MBE A;  2G9W A;  5LRR A;  5FKL A;  4MFE A;  4PJL A;  3RKY A;  3SQN A;  4EJU A;  2WAF A;  2LH9 A;  3OS1 A;  3ZMV A;  3BZC A;  4I6R A;  1LMB 3;  2MD5 A;  1BOB A;  5KVR A;  5LHH A;  2WWY A;  4Z5D A;  1OR7 C;  5IP7 J;  3AL0 C;  4E7J A;  3HC7 A;  3ERE D;  2F4O B;  3BG6 A;  5DT2 A;  3CJN A;  1G6N A;  4ESB A;  3DKX A;  5HS9 A;  5IY5 H;  5GAD J;  2ZJQ F;  1J9I A;  2PMU A;  4WK8 F;  1HQC A;  4Z5C A;  2X6O A;  4IRG A;  1U5T C;  5FB2 A;  4PK4 A;  4RLF A;  4G8X A;  2HGC A;  2MGQ A;  2JA6 J;  3M1C A;  3V4G A;  4M9X A;  5JLX A;  2CQX A;  4X4G A;  1UJ8 A;  3TL4 X;  1S6L A;  5GAE J;  4OIR F;  5D4R A;  4X4D A;  3M8J A;  2FBI A;  1BI2 A;  5FLV A;  1X57 A;  4FTH A;  1FYM A;  3DBH B;  3U3W A;  2MQK A;  1O3R A;  2RNG A;  4M72 A;  3V8K A;  3RKQ A;  2X1D A;  5DCM A;  5DYM A;  2XI8 A;  1RRJ A;  5C44 J;  1P92 A;  2OCE A;  4KIC A;  3K1M A;  2LBF A;  2L8N A;  4NC7 A;  1EJ9 A;  1E3O C;  1FMW A;  3JRC A;  4C2T A;  2E5Z A;  1POU A;  3OYE A;  1XWR A;  1CGP A;  4M3E A;  4QSH A;  2XXQ A;  2Y30 A;  1FSH A;  4RAG A;  2QKL B;  5CKT A;  5FD5 A;  1IGN A;  2YU9 J;  4RB1 A;  4FE7 A;  2DMT A;  4ZDL A;  1XMA A;  2STW A;  3HG9 A;  2XXP A;  4E4H A;  1DGW Y;  4RDU A;  1W5T A;  2W85 A;  4IPA A;  3F9K A;  1ZLK A;  1DQU A;  3GTM J;  2QCO A;  5HOD A;  4NDW A;  3HOU J;  4IHX A;  2WAQ N;  2BGC A;  1MIJ A;  3OYB A;  2EFP A;  5H6R A;  2BHY A;  2R4G A;  4M6V A;  5JLW A;  1AKH B;  3J7A O;  2MBF A;  4M9S A;  5AON A;  2PJR B;  4P9F A;  4B44 A;  3LAP A;  4DNC A;  2KLO A;  5FLX Z;  3JSP A;  4IVZ A;  5FLM J;  2MW8 A;  4BDZ A;  2DT6 A;  2FF4 A;  1BOA A;  4XM3 A;  4CCL A;  2QM3 A;  2NOJ B;  3ZQH A;  5HS8 A;  3QOW A;  2R7O A;  2QQA A;  1UEL B;  3EUA A;  3PL8 A;  2QZ8 A;  2CH0 A;  2Y31 A;  1OSL A;  2VE8 A;  3A9Y A;  1A6Q A;  4RB2 C;  5E17 F;  3D1N I;  4Z58 A;  4CHU A; 
#chains in the Genus database with same CATH homology
 4A3L J;  4J1X A;  1ZQ3 P;  3PO3 J;  4C3J J;  1SQ8 A;  3JRE A;  2L49 A;  3GN5 A;  1JJ6 C;  2EBY A;  3S14 J;  2R5Z A;  3FK6 A;  4Y52 J;  3JXD L;  4JX4 A;  4X4C A;  1D5Y A;  1PRV A;  1AU7 A;  4A3G J;  1DU6 A;  1I50 J;  1MNM C;  2HOS A;  1RZR D;  4IEJ A;  4L5E A;  1LFU P;  3QPL A;  4BY1 J;  3B6C A;  5E3N A;  2FX0 A;  2TCT A;  2PUC A;  1OJL A;  1RET A;  3BG5 A;  1WH8 A;  5E3M A;  3CMY A;  4PU8 A;  1QRY A;  3DNV B;  2OR1 L;  1ZPQ A;  3TP3 A;  4HNV A;  1ZUG A;  2KPJ A;  4YBA A;  4D5F A;  3Q0W A;  3I4N J;  1T33 A;  2JVL A;  2AHQ A;  3FIS A;  5EZG A;  2JCG A;  4C2M J;  2IBD A;  2EQR A;  2HXI A;  3HGG A;  2AO9 A;  1WIZ A;  1ZZ7 A;  3FYA A;  3BR0 A;  3BTL A;  2HOT A;  3C2B A;  3A02 A;  4A3C J;  2WV1 A;  1ETV A;  3HOV J;  3PO2 J;  2O7O A;  2IU7 A;  2LTP A;  4QTR A;  1R9T J;  3JRG A;  4B1R A;  1MH3 A;  2NVY J;  4YG4 A;  4JCY A;  2PMZ N;  3GBG A;  1FTT A;  1XC5 A;  1JKQ C;  4PU4 C;  1WH7 A;  4Y7N J;  1F43 A;  1YSE A;  4YAR A;  1JT0 A;  3JRD A;  5FKK A;  1CJG A;  1ZR2 A;  2XRL A;  3Q3S A;  2M0C A;  1AHD P;  1WCM J;  2LVS A;  1MBH A;  3BR3 A;  1R69 A;  2L7M P;  3B7H A;  1MBF A;  2CRO A;  3OSG A;  4M3D A;  1GVD A;  5J1U A;  1P7I A;  2PUG A;  1ETY A;  3SJM A;  2DMN A;  2B5A A;  1JUM A;  4IHY A;  3A01 B;  1RPW A;  5F04 A;  2OF7 A;  3E7L A;  4A3I J;  1U9O A;  1POG A;  3HOX J;  2KEK A;  4DYQ A;  1O4X A;  3H3V K;  2H1K A;  3CQZ J;  1T56 A;  3BQY A;  1JFT A;  2XB0 X;  2BNN A;  1ETK A;  2RAE A;  2DA3 A;  2I10 A;  3FMY A;  4W97 A;  2DMU A;  3L1P A;  3PXP A;  1HDP A;  1Z77 A;  3QPS A;  5K7Z A;  2LKX A;  3W6V A;  1I6H J;  2AW6 A;  3O9X A;  1JH9 A;  2E1O A;  2LLK A;  1VPW A;  1GV5 A;  2EZK A;  1LE8 A;  1FJL A;  5EGO B;  1EFA A;  2W48 A;  2ECB A;  1GUU A;  5FKO A;  2JWT A;  3LNQ A;  3OP9 A;  1LLI A;  2CJJ A;  5EYR A;  5IOZ A;  4A3B J;  1IJW C;  3HDD A;  5FJ8 J;  4BY7 J;  2MSY A;  2KT0 A;  1H88 C;  3F52 A;  1IRZ A;  4D7M A;  5EG0 B;  4X4B A;  4EEF G;  4XK4 A;  3SFI A;  1JJ8 C;  4DZP A;  1ADR A;  1B72 A;  1UMQ A;  3QF3 A;  2VKV A;  3GTQ J;  2IVG A;  1Y1W J;  2AXZ A;  1IUF A;  2R5Z B;  4X4I A;  3QYX A;  3BQZ A;  1NK3 P;  2XSD C;  5IP9 J;  2K9N A;  2XGD A;  3GTP J;  2R7Z J;  1ZK8 A;  1ZVV A;  1UG2 A;  3JRI A;  4XID A;  2XB5 A;  2XPV A;  5EZH A;  2LYL A;  3BDN A;  3PM1 A;  3ZQL A;  1SAN A;  3Q0V A;  1VF9 A;  2X48 A;  1Y1V J;  1LCD A;  3OQO A;  4C3I J;  3LSG A;  1B8I B;  2CU7 A;  1NER A;  4C3H J;  4J19 A;  3FIW A;  3G1O A;  2R5Y B;  2DMP A;  4J1W A;  2HOA A;  3GN5 B;  2M8G X;  3QQ6 A;  5M3F J;  3BG9 A;  2DA1 A;  3S1Q J;  4RBO A;  3M4O J;  1X2M A;  4IHW A;  3SCF A;  1QP0 A;  2L9R A;  1X2L A;  1F36 A;  5J3L A;  3CDL A;  4X4E A;  3HEF A;  1JTX A;  4V2G A;  4XRS G;  1BJZ A;  3R1F A;  4A93 J;  3A03 A;  2B63 J;  3DCF A;  2JK3 A;  4FN3 A;  1VND A;  3NAU A;  2G0E A;  3OMT A;  1QQA A;  2EF8 A;  2LYR A;  2TRT A;  3GTJ J;  3ZQI A;  1PUF A;  2NVT J;  2DA5 A;  2DN0 A;  1W0U A;  5IYD J;  1DWK A;  1WPK A;  2Y2Z A;  4B3A A;  2M9H A;  2LYS A;  5K7F A;  4BBS J;  1ZZ8 A;  2EZI A;  2EWT A;  2IUO A;  1LQC A;  1Y9Q A;  2HIN A;  3VPR A;  1MSE C;  1PRA A;  1R63 A;  4I6T A;  4DYR A;  2WUS R;  1PUF B;  3LFP A;  4Z5H A;  2LK2 A;  4JYK A;  4MLO A;  5M5X J;  2K40 A;  3JRA A;  3LIS A;  1NEQ A;  3TP0 A;  5C4J J;  2IEK A;  3TW6 A;  2DA4 A;  2XCJ A;  1QPI A;  3OIO A;  4OB4 A;  4M3G A;  5F0F A;  4X4F A;  1U9N A;  3ZOB A;  4DYC A;  4GQM A;  4JQD A;  2LD5 A;  1ZAY A;  2D5V A;  3HB9 A;  3MKL A;  4PU3 C;  4MIM A;  4XRS A;  1JGG A;  1ZTR A;  1RKW A;  1K61 A;  1LFB A;  1APL C;  5F27 A;  5DTD A;  3HOW J;  1XS9 A;  1IDY A;  2O38 A;  2NS7 A;  2HSG A;  3HKZ N;  1YRN B;  1UHS A;  3OOU A;  1NK2 P;  1QVT A;  4FBI A;  3CEC A;  2FD5 A;  1SFO J;  1Z0X A;  4W1U A;  2IVQ A;  1ZR4 A;  3CRO L;  2MG4 A;  5C3E J;  1ITY A;  1BW5 A;  3JXB C;  4X1E A;  3TED A;  3SCH A;  2GZU A;  1L1M A;  1VFC A;  1B72 B;  3LSP A;  2XGE A;  1H89 C;  1BW6 A;  3SDG A;  4ABZ A;  3BR6 A;  2CUE A;  2EH3 A;  2ID6 A;  4A3E J;  3S16 J;  4O8B A;  2O4A A;  1ETO A;  5J1R A;  1JKP C;  2Y9Y A;  3S8Q A;  3FK7 A;  2OPT A;  3JRB A;  2IV1 A;  3CCY A;  5E3O A;  2XPU A;  2E2I J;  3MVP A;  4XRM A;  1QVU A;  3JR9 A;  2XJ3 A;  3G1L A;  2BNO A;  2ICP A;  5M3M J;  2COB A;  2NOG A;  3QWG A;  2IAI A;  3IH3 A;  3SCG A;  4MFD A;  5A7L A;  5IOY A;  5FKM A;  4XIC A;  3G7D A;  1IG7 A;  4A3M J;  2HI3 A;  3MN2 A;  4V2F A;  1IC8 A;  3M3Y J;  2LCV A;  4X6A J;  2OFY A;  3G1M A;  4AC0 A;  1RPE L;  3S1M J;  4A3D J;  4S0H B;  2IVB A;  1TWH J;  4PU7 A;  1MBJ A;  1PER L;  1WI3 A;  2JA5 J;  3O8G A;  2R93 J;  2NS8 A;  2DTZ A;  1FIA A;  1JWL A;  5GPC A;  2LYP A;  2YS9 A;  2E2J J;  1TWC J;  1FTZ A;  1QP4 A;  3ZHI A;  3LSR A;  1B8I A;  2ECC A;  3S1N J;  1ZZB A;  2XGC A;  2Y9Z A;  1UTX A;  2L7F P;  3QQA A;  2Y0S N;  4DZJ A;  3GBF A;  3JRH A;  1ZKG A;  2VPR A;  2R5Y A;  2E2H J;  2X9D A;  5J1Y A;  1HCR A;  2GLO A;  1S7E A;  4BXX J;  2JMW A;  2PPX A;  5F08 A;  3KZ3 A;  4IWR A;  1U8B A;  9ANT A;  3ZKC A;  1PRU A;  3Q0U A;  5BNG A;  2ICT A;  3BG3 A;  1ORK A;  4I6Z A;  1FIP A;  3VK0 A;  3HM5 A;  1K83 J;  2BNM A;  2DMQ A;  2LYJ A;  2R0Q C;  3FKI J;  3NAR A;  3HBL A;  3BD1 A;  4JCX A;  4GFB A;  2LP0 A;  1HDD C;  3F0C A;  2K9S A;  2PE5 A;  1UXC A;  2PUE A;  3IH4 A;  3RZO J;  2AXU A;  1JUS A;  1RR7 A;  4M3F A;  3ZHM A;  4IA8 A;  2EBI A;  5IP6 A;  3DEW A;  2KEI A;  3BT9 A;  1DU0 A;  2QF7 A;  1H8A C;  2CUF A;  2FJR A;  4D7N A;  1ZZC A;  5EDN A;  2R63 A;  1RZS A;  4CYC B;  1EF4 A;  4BBR J;  1I3Q J;  2DA6 A;  2M34 A;  4FE4 A;  3TRB A;  4MO7 A;  4YG1 A;  4CYC A;  2LFB A;  2O9L A;  2PIJ A;  3S2H J;  3MLF A;  3BR2 A;  2HYJ A;  3GTO J;  4UUS B;  3JXC L;  1GT0 C;  2WB1 N;  2KEJ A;  3HOZ J;  5M5Y J;  3EUS A;  1NTC A;  3KJX A;  2YUS A;  3KXA A;  4AYB N;  3WHB A;  2HDD A;  1WH6 A;  1QP7 A;  1A5J A;  5GPA A;  1RZR A;  2HQ5 A;  5IYC J;  1IV6 A;  3BR5 A;  2CRG A;  3ZQC A;  2WIU B;  3BS3 A;  1ZZ9 A;  4UUT A;  1Q1V A;  1ETX A;  1A6I A;  1MSF C;  3F6W A;  2GBY A;  2H8R A;  5M5W J;  3CLC A;  4I76 A;  2GM4 A;  3I4M J;  2DA2 A;  1RES A;  1FEX A;  4A3F J;  3GTL J;  3G5G A;  1WET A;  5F0H A;  3GTG J;  2LYK A;  1JKR C;  3WHC A;  3OSF A;  1AKH A;  1GDT A;  3K7A J;  5EGO A;  2PUF A;  2FJ1 A;  2KDZ A;  2LY9 A;  1OCT C;  1MBK A;  5K98 B;  2AUW A;  1PNR A;  1X2N A;  3IH2 A;  4MCT A;  1TC3 C;  2L0K A;  4FCY A;  4IHV A;  2CQQ A;  2ELK A;  1JKO C;  2XPW A;  2CSF A;  2FQ4 A;  3LSJ A;  2K9Q A;  2LYQ A;  1IDZ A;  4GHJ A;  1VI0 A;  2GRM A;  2JA7 J;  4LOC A;  2PUA A;  2N8G A;  5GP9 A;  3RQI A;  1HOM A;  3H5T A;  1MBE A;  4B4C A;  2BJC A;  5FKL A;  4MFE A;  3O8H A;  1BL0 A;  2LR8 A;  1HLV A;  2A6C A;  3ZQF A;  5K7H A;  2R1J L;  1B0N A;  2NVX J;  2ID3 A;  1DW9 A;  2M2E A;  1W0T A;  4A69 C;  4I6R A;  4G12 A;  2AWI A;  1LMB 3;  3S1R J;  4Z5D A;  1WGX A;  5IP7 J;  3JRF A;  1JUP A;  1QPZ A;  3OQM A;  1ZGW A;  1Y7Y A;  2JJ7 A;  3FYM A;  4Z5C A;  2X6O A;  2MEZ A;  5EEA A;  2EZL A;  3IVP A;  3LOC A;  2AXV A;  2MGQ A;  2JA6 J;  3UFD A;  1ZZ6 A;  1HF0 A;  3BTI A;  2XIU A;  3RZZ A;  5JLX A;  2GRL A;  2CQX A;  4I8T A;  4X4G A;  4I6U A;  4YG7 B;  4A3J J;  2L7Z A;  1UXD A;  4X4D A;  3HGY A;  4Z59 A;  4BKX A;  1OCP A;  2ZB9 A;  5IPA A;  5FLV A;  1G2H A;  2HXO A;  4JP0 A;  4DW6 A;  4FTH A;  1X57 A;  2MQK A;  3U3W A;  1RKT A;  5F0C A;  3RKQ A;  3IV5 A;  1JTY A;  3BR1 A;  2XI8 A;  3RZD J;  4Y42 A;  2O49 A;  5C44 J;  1ZS4 A;  2DA7 A;  2VUM J;  2L8N A;  3S15 J;  2JN6 A;  1E3O C;  2JA8 J;  1ETW A;  5E3L A;  3JRC A;  4FIS A;  1POU A;  1MH4 A;  3UKG A;  1XWR A;  4UUS A;  4A3K J;  3S17 J;  2ME0 A;  4M3E A;  3B6A A;  3S2D J;  1TWF J;  4QSH A;  1QQB A;  1P7J A;  2Y30 A;  1CQT A;  4M3B A;  4QIW N;  2PUB A;  5FKN A;  1JT6 A;  2VI6 A;  5C4X J;  3BTJ A;  3K2A A;  1IGN A;  4NDL A;  2YU9 J;  2PUD A;  4FE7 A;  2DMT A;  1TWA J;  2O8K A;  3A01 A;  4RDU A;  1ETQ A;  2DJN A;  1ENH A;  1MBG A;  2R92 J;  3GTM J;  2QCO A;  4JX6 A;  3TW7 A;  5EF6 A;  5HOD A;  3ZQG A;  4NDW A;  1BDI A;  5IYB J;  3HOU J;  4IHX A;  2WAQ N;  1LE8 B;  3GTK J;  3HZI B;  5F1J A;  1YRN A;  5DS9 A;  4X4H A;  1JFS A;  1WH5 A;  1U78 A;  4M6V A;  2E19 A;  5JLW A;  1AKH B;  4AUX A;  1GV2 A;  4MCX A;  1LCC A;  1RIO A;  1OFC X;  1TWG J;  3BTC A;  2NVQ J;  1X58 A;  2KZ8 A;  3H0G J;  4IVZ A;  5FLM J;  2ME6 A;  2MW8 A;  5EG0 A;  3F51 A;  1BDH A;  2VKE A;  3OQN A;  3ZQH A;  4F8D A;  4D5C A;  3HOY J;  1XG1 A;  2Y31 A;  1BA5 A;  1OSL A;  2P81 A;  2EZH A;  3D1N I;  4Z58 A;  4JX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...