1AU7A

Pit-1 mutant/dna complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
146
structure length
130
Chain Sequence
GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONSENSUS DNA 25-MER
publication title Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcription/dna
total genus 44
structure length 130
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1au7A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1au7A01
3OQMA 3E7LA 1GUUA 2FD5A 4IHVA 4X4GA 3QQ6A 4NDLA 5K7ZA 5EEAA 5IP7J 3LSRA 5C44J 2FQ4A 3GTKJ 2I10A 2ID6A 4C3IJ 3BG3A 2LD5A 1W0TA 3GTMJ 2H1KA 4Z59A 2GRLA 4GFBA 3ZQLA 2Y31A 4BBSJ 1MBHA 3TW6A 3S14J 3ZKCA 2AXZA 2LCVA 2R5YB 1VI0A 2WUSR 2XSDC 1TWCJ 2MG4A 3HGGA 3ZQCA 5M3FJ 2IAIA 1OSLA 3CECA 2EZIA 4MO7A 1JUPA 2NVXJ 1FTZA 1PUFB 2PUGA 2QCOA 2O49A 2R5YA 2XGDA 4GQMA 2GRMA 2AW6A 3HEFA 1XC5A 3BTJA 2R92J 1K83J 1MH3A 4DZJA 1JUSA 2XIUA 1QPIA 2NOGA 2B5AA 4XRMA 3DEWA 2E2JJ 1NTCA 1IUFA 2MQKA 4X4HA 4JCYA 4AYBN 3CROL 1ENHA 1PUFA 2JCGA 3IH2A 4DYCA 4DW6A 3ZHIA 2OR1L 2HOAA 2TCTA 4JX4A 2HOTA 3ZQHA 5F0HA 3JRIA 3S1QJ 5K7FA 1ETQA 4W1UA 1W0UA 2D5VA 1GVDA 1TWAJ 4HNVA 2ME0A 2JMWA 5EDNA 1ZQ3P 4PU8A 3SCFA 4V2FA 5FKMA 5C3EJ 2E1OA 1ZGWA 4M3GA 1DU6A 4FBIA 3CMYA 4BKXA 3GTPJ 1BDHA 4UUSB 3RZZA 1FTTA 2XCJA 2K9SA 1WIZA 3O9XA 4Z58A 1ETXA 1RKTA 2LVSA 2ME6A 4JCXA 1JWLA 3O8HA 4BY1J 3GBGA 4MFDA 4MLOA 3BR6A 3IH3A 1FJLA 3FYMA 4YG4A 3Q0VA 4UUSA 3HOWJ 2K9QA 2AXVA 1MBJA 3LSJA 1X2MA 3K2AA 3SCGA 1UMQA 5M5XJ 2Y9YA 3BG5A 2KEKA 1LFUP 1WPKA 2N8GA 3BTCA 1WH5A 1BJZA 1SFOJ 5EF6A 2R63A 5FKKA 3ZQIA 3H3VK 4ABZA 3JRBA 3BS3A 3H0GJ 1JKPC 5IYDJ 2HINA 3CCYA 4C3JJ 2CROA 4X4FA 3A03A 3O8GA 5E3NA 2KT0A 3QWGA 4I6RA 2EBIA 1T56A 5F04A 2E2IJ 2JVLA 3WHBA 4X6AJ 2OFYA 1TWGJ 5J3LA 4A3BJ 4FE7A 4XRSG 2PUEA 4FISA 1RETA 3D1NI 3S17J 1H89C 4L5EA 2M34A 3JREA 2EBYA 5DTDA 4RBOA 4IHWA 2DA1A 4J1XA 1IDZA 2RAEA 4JYKA 1P7IA 1HF0A 5FJ8J 3JRCA 1MSFC 2JWTA 4IWRA 2BNOA 1U9NA 2VI6A 2IVQA 4A93J 1QP7A 4W97A 3FIWA 4Y7NJ 1JJ6C 1QQBA 1S7EA 1UG2A 3JXBC 1APLC 4F8DA 4NDWA 1ZKGA 2IUOA 1RPWA 5FKOA 3UKGA 2GLOA 2O38A 2CU7A 3NARA 5IOYA 3Q3SA 2HQ5A 1ZZCA 2HOSA 1LE8A 2B63J 3FISA 4XICA 2PMZN 1Y1WJ 1X2LA 5JLXA 3KZ3A 1IC8A 1L1MA 4BY7J 4MCXA 1ETOA 4XRSA 2JA8J 3F51A 1PRUA 4M3FA 2K40A 1YSEA 2XPUA 4Y52J 1B0NA 4PU3C 1G2HA 3WHCA 1ZUGA 1ZZBA 1TWHJ 2L0KA 5M5WJ 4A69C 3LSPA 2JA5J 4A3JJ 2BJCA 1LFBA 3G1LA 1JFSA 2R0QC 3B6CA 3BT9A 4BBRJ 3RZOJ 2ICTA 1RESA 3OSFA 1GDTA 4D5CA 1JJ8C 4G12A 1BL0A 3K7AJ 1YRNB 3HOZJ 2PE5A 1F43A 3C2BA 3F52A 1ZS4A 4A3FJ 4XK4A 1EFAA 2LKXA 2VKEA 1ETWA 4MFEA 4CYCA 2XGEA 2K9NA 2AHQA 2L9RA 2CUEA 3MVPA 2AWIA 1PNRA 4AUXA 2PIJA 2COBA 2LYSA 1P7JA 1YRNA 2DMQA 4IEJA 1VNDA 3JRFA 1ETYA 2LLKA 4DYQA 2KEJA 1ZZ9A 1Y1VJ 3QPSA 3VPRA 3JXCL 2NS8A 1OJLA 2LYPA 1JH9A 5GPAA 2Y0SN 3BG9A 1Y7YA 2NS7A 2FX0A 2LYQA 4X4EA 4BXXJ 3OOUA 3Q0WA 2CQXA 4I8TA 2XB0X 1OCPA 2YU9J 1GV2A 4QTRA 4PU4C 3VK0A 2L7FP 2DMNA 2E19A 1MBKA 4DZPA 1BW5A 3CLCA 2CRGA 2O9LA 2IU7A 2JJ7A 3QF3A 5EGOB 1A5JA 1IG7A 1FEXA 3HBLA 1Z77A 1BW6A 2XRLA 2VKVA 1JKRC 3S1RJ 1FIAA 1HLVA 2WV1A 1PRAA 2IBDA 3PO3J 3H5TA 5EGOA 2A6CA 1VFCA 1ZAYA 5IOZA 1ITYA 4OB4A 2DA7A 2DTZA 4A3CJ 2OF7A 2M9HA 2CSFA 2AO9A 1MSEC 3A02A 5C4JJ 4QIWN 1OFCX 3PXPA 4UUTA 4AC0A 2EWTA 1WETA 1AU7A 1ZTRA 1RR7A 2FJRA 5A7LA 2GBYA 3TW7A 1JGGA 2YS9A 4FE4A 5F1JA 1X58A 2ZB9A 5E3OA 1GT0C 1Y9QA 2NVTJ 1B72A 3LOCA 2LTPA 2MSYA 3FK6A 1QVUA 2IEKA 1IGNA 2NVQJ 4Z5CA 2M8GX 5FKLA 9ANTA 1EF4A 3QPLA 3S16J 2ICPA 3TP3A 2L49A 3OMTA 3GTJJ 1H88C 1XWRA 4X4BA 1WI3A 3JRDA 2WAQN 2DMPA 2HYJA 3S15J 3FYAA 1WCMJ 3S8QA 4DYRA 2YUSA 2DA2A 5K7HA 1HCRA 1UXDA 1IV6A 1RZRA 2PUBA 3M3YJ 2KDZA 2DMUA 3BR0A 2Y30A 1SQ8A 2DN0A 1ZZ6A 2E2HJ 2CUFA 3OSGA 4D5FA 5BNGA 2R93J 4FN3A 3BR3A 2CJJA 4LOCA 2JA6J 3SFIA 2BNMA 5IYBJ 5IPAA 4MIMA 3QQAA 2IVGA 4V2GA 3BTIA 1LE8B 4MCTA 1ORKA 4M3DA 5HODA 3HDDA 3M4OJ 2M0CA 2IVBA 2LK2A 4B4CA 2AUWA 4I6TA 1E3OC 3GN5B 3OP9A 3BR5A 1AHDP 1ZK8A 3HOXJ 2Y2ZA 5EZGA 1FIPA 1QVTA 1MBFA 5IYCJ 3JRHA 1JTYA 3KXAA 4JX6A 4YARA 1CJGA 1QP0A 3LNQA 4PU7A 2LY9A 3RZDJ 1Q1VA 1WH8A 3UFDA 5J1UA 1UHSA 1LCDA 1R69A 3GN5A 3KJXA 4D7NA 5F08A 2AXUA 3QYXA 2OPTA 5EG0B 5EZHA 1H8AC 5GP9A 3JRGA 1OCTC 4IHXA 2ECBA 2LYKA 1QP4A 3GTLJ 1PERL 5F0CA 2DA4A 1JKOC 3BR2A 3L1PA 2GZUA 5J1YA 1AKHA 1ADRA 5E3LA 1ZPQA 4CYCB 1ZR2A 1LLIA 3FMYA 4FCYA 1WH7A 5EG0A 3F0CA 1ETKA 2LP0A 1WH6A 5IP6A 1I50J 1D5YA 4IA8A 3HOUJ 3G1MA 3MLFA 2L8NA 2PUCA 1T33A 5EYRA 4X4DA 4FTHA 3DNVB 2PUDA 2NVYJ 1RKWA 2DJNA 5FKNA 2QF7A 2O8KA 2CQQA 1POUA 1BA5A 1X57A 4X4CA 1WGXA 4C2MJ 1IJWC 1MH4A 4Z5DA 3HZIB 2PUFA 4QSHA 4A3LJ 1POGA 2L7MP 3JR9A 2H8RA 2XJ3A 2L7ZA 3GBFA 2R5ZB 2HXOA 3DCFA 3HOVJ 2TRTA 2HDDA 1F36A 4A3IJ 3B7HA 3R1FA 1JFTA 2XPVA 3BR1A 2XPWA 5FLMJ 3GTGJ 5JLWA 3TP0A 3Q0UA 1CQTA 1NERA 4X1EA 2R5ZA 3JRAA 1U9OA 1O4XA 2PPXA 4A3MJ 2EZKA 3BQYA 1X2NA 3I4MJ 3S1NJ 4Y42A 4EEFG 2VUMJ 2LFBA 3IVPA 4B3AA 1QPZA 5F27A 3OQNA 1NK3P 2BNNA 4YG7B 3S2HJ 2EH3A 4JX5A 2GM4A 3I4NJ 4I6UA 3TRBA 2XGCA 4JP0A 4A3EJ 2JA7J 3BDNA 3HM5A 1MBEA 1UXCA 2JK3A 1JT0A 4C3HJ 1DU0A 3GTQJ 2R1JL 1B72B 4RDUA 1DW9A 3S1MJ 1R9TJ 2JN6A 4Z5HA 2EQRA 1JKQC 2ID3A 2O4AA 1U78A 3IV5A 2EZLA 2X6OA 4J19A 1QRYA 5DS9A 1VF9A 3HB9A 3CDLA 3OQOA 2PUAA 4D7MA 2XB5A 3ZQGA 3FK7A 4M3EA 4A3KJ 3IH4A 1NEQA 2MEZA 1QQAA 2LYJA 3F6WA 3ZHMA 3RKQA 3S2DJ 1IRZA 1JTXA 1XG1A 3U3WA 4M6VA 2HSGA 5K98B 2FJ1A 2HI3A 1DWKA 4M3BA 4X4IA 4J1WA 2R7ZJ 2O7OA 3NAUA 1R63A 1PRVA 2KEIA 3ZQFA 2WIUB 3OIOA 1ZZ8A 1HOMA 5IP9J 1BDIA 2WB1N 5C4XJ 1IDYA 1JUMA 1JT6A 4XIDA 3LFPA 3MN2A 4GHJA 2KZ8A 2DA5A 4YG1A 4JQDA 4S0HB 1K61A 1TC3C 1NK2P 1HDDC 5GPCA 1B8IB 3BTLA 3JXDL 4A3GJ 2EF8A 3G5GA 2DMTA 3BD1A 3ZOBA 2ECCA 5F0FA 3SJMA 3EUSA 1GV5A 3G7DA 3MKLA 2MGQA 3B6AA 2LYLA 4O8BA 2HXIA 1ZVVA 4I76A 2LR8A 4I6ZA 1RZSA 1I3QJ 2M2EA 3W6VA 4IVZA 2DA3A 1SANA 1B8IA 2KPJA 1HDPA 3A01B 3G1OA 4IHYA 1ETVA 5M3MJ 5M5YJ 3HOYJ 2ELKA 2P81A 1AKHB 2XI8A 2X48A 3LSGA 1XS9A 1MBGA 5J1RA 1Z0XA 1ZR4A 4B1RA 4A3DJ 3PO2J 3SCHA 3CQZJ 3LISA 1VPWA 1TWFJ 1U8BA 3A01A 2X9DA 1UTXA 3HKZN 1MNMC 3SDGA 1RZRD 3PM1A 2W48A 2DA6A 3TEDA 2MW8A 1LMB3 1RPEL 1LQCA 1I6HJ 2Y9ZA 1LCCA 5E3MA 1RIOA 4YBAA 2G0EA 3RQIA 2VPRA 5FLVA 1ZZ7A 2EZHA 2IV1A 3HGYA 3BQZA 1A6IA 3GTOJ 2LYRA 3FKIJ
chains in the Genus database with same CATH superfamily
1FSEA 4YFXF 5ILSA 2GIVA 3FBIB 1BR1A 2KRFA 2FD5A 4B43A 1R5HA 3DKYA 3G71I 3J7AY 4D9JA 3FMRA 4GYGA 4XLFA 3BG3A 2LD5A 3GTMJ 1YW9A 2GWRA 1ACIA 2DT6A 2H1KA 1A31A 2FOWA 5B5EC 4GFBA 3ZQLA 3VWBA 2Y31A 2OCEA 4F55A 2PXFA 4AIKA 3VODA 3F8BA 1EA3A 3CMAI 3KYCB 1XGOA 2LCVA 2HYFA 2BW3B 4PJNA 2R5YB 1N78A 2X51A 3WU0A 5L3BA 2NNNA 2HKOA 3ZQCA 2LY1A 3LQQA 3W2VA 5AIQA 5M3FJ 2VN2A 2QKMB 3HXLA 3PFYA 2NVXJ 5E1ZB 1FTZA 3WTVC 1Y8QB 4GQMA 2GRMA 3HEFA 1SFUA 1JUSA 2XIUA 3NWSA 2E1NA 4BH9A 1ZLKA 3GUDA 4F91B 3NROA 1NTCA 5HOOA 3CROL 3LQRA 3GFLA 1PUFA 4KIFA 3EUKL 4DYCA 3N4MA 2EINH 3WGGA 4M6YA 4JX4A 1BOAA 2HOTA 5F0HA 1QZYA 2XAHA 1FOKA 1W0UA 2D5VA 5KHDA 3K6GA 4HLYA 2JMWA 3S32A 5EDNA 1ZQ3P 4V2FA 1B59A 2DBBA 2JPCA 3CMYA 3FX3A 4NC8A 4J01A 4PFOA 3GTPJ 1RNLA 4K2EA 2KZVA 1BJAA 3QOPA 4UHTA 2MBFA 2H1LA 3O9XA 5JVGF 1N75A 2M30A 2DOAA 4HA8A 1NH3A 3D5SC 3EETA 4UUSA 3QOWA 2ZXJA 1E3PA 2K9QA 4M72A 3U1KA 1ERDA 1YE9A 2X6XA 2G9WA 2BGCA 3I64A 4P55A 1WPKA 5FFXA 2N8GA 3BTCA 1SFOJ 2V6EA 2M7BA 3P9KA 2QLZA 5J40A 4U0WA 2LF7A 5LGUA 3CCJI 4I99C 2OQGA 4GGGA 1O3QA 3LFUA 2L5QA 3FMQA 5IYDJ 4AVZA 5FRNA 3GF2A 2XXQA 2YBDA 1HSJA 2XKOA 1P92A 2DU9A 3KFWX 3IKTA 1R4MB 1UAAA 1BOBA 2XV4S 4I6RA 5F04A 5L3DA 1O3TA 3WHBA 4NB5A 3LSIA 2KRCA 2R7OA 4IHSA 3BZKA 4YFKF 6PAXA 5BS6A 3CCMI 4BS9A 2W85A 4BEHB 4L5EA 4C2UA 2COMA 1Y8RB 2EBYA 3PUFA 1V5GA 1ZLJA 2HTJA 2PBIA 5DD4A 1OYIA 3O3KA 2GXAA 1IDZA 2FFHA 4JYKA 3JW4A 1JHFA 2CFOA 1UB9A 1MSFC 2JWTA 1ZRFA 1BN5A 2VI6A 1XSXA 1BR4A 4Y7NJ 2ELHA 2Q8KA 1SFKA 3QODA 1JJ6C 2PJRB 2FUG2 1QQBA 2JA2A 3R0JA 3I55I 3UNGC 3JXBC 1GXQA 1ZKGA 2FA5A 1LKXA 3A1YA 2O38A 5IOYA 4PFPA 2HQNA 3EYIA 2HQ5A 1ZZCA 3V7RA 4RGRA 2B63J 3AG2H 4HX8A 1X2LA 3ZQQA 1L1MA 2K40A 2XPUA 2YR2A 2X1CA 4Y52J 1VQ4I 3E5XA 4PU3C 3MEJA 1ZZBA 4RGUA 1TWHJ 1SVOA 3LSPA 2R7QA 1I1GA 2K5CA 1GLNA 4UV8A 4YIFA 1LFBA 1B4AA 2BJCA 3QP6A 4IKFA 5HS9A 4Q2JA 4BBRJ 4M9ZA 3ZMUA 4G12A 4MTEA 1JJ8C 2X6YA 2IPQX 2W1OA 3F52A 2V9PA 5EEHA 1RIOH 4A3FJ 1TNSA 4XK4A 2ZNZA 4YIRX 3GZDC 1EFAA 1BC8C 1JGSA 1T38A 1B9MA 4F7ZA 2AWIA 2ACJA 3OYAA 5DTQA 2LLKA 4XKVA 3Q9VA 1ZZ9A 4PJLA 1Y1VJ 3QPSA 3LMMA 3CCSI 3JXCL 1OJLA 5GPAA 2Y0SN 4NNJA 2NS7A 2LYQA 2WWYA 2O0YA 5HVQC 2IT0A 3M07A 2VJJA 4XR6A 2FU4A 3AFHA 4XSXF 2QM3A 3J81Z 1DPUA 1OCPA 2YU9J 4ZH4F 4QTRA 3VK0A 1HW5A 1FWZA 2E19A 1MBKA 3HRMA 2DAOA 2O9LA 1I5ZA 4OWRB 3VYRB 5B1AH 4PZJA 3CC4I 1A5JA 1FEXA 3S93A 3PL8A 1SMYF 3HBLA 1TP4A 4NHJA 5CLSA 2XRLA 3JTHA 4PCQA 3S1RJ 1ODDA 3I71A 1HLVA 4CDGA 1JKRC 3KEYA 4TV7A 3H5TA 1JHHA 3AAFA 2R7SA 2IS2A 3NDBB 4M9SA 4LIVA 1KZHA 2LNBA 1ITYA 2FBHA 2P5KA 2Q2EA 5D8KB 2ZFWA 2CSFA 5DYMA 3VYSB 4CCLA 1X1PA 1S9HA 4KT5C 5D5UB 3HKZA 1WETA 2IS6A 3KIOA 2FQ3A 2MXDA 3PIPF 1AU7A 4UY8I 1BIBA 1F4KA 2FJRA 4MQ9F 5H2FC 1X3UA 2UZKA 1E17A 2ZB9A 5H6QA 5D8LB 1B72A 3VDXA 1ZG3A 3LOCA 2LTPA 3FK6A 3GZCA 2NVQJ 1YQAA 3HJEA 4G9YA 4Z5CA 3MCZA 5FKLA 3VSLA 1SMTA 1EF4A 2VXZA 2BHYA 3TP3A 4J00A 2F5CA 3GTJJ 1XWRA 1G3TA 1BBYA 3RIRA 3JRDA 3JAMK 2DMPA 2HYJA 3DP7A 5JI6A 4F92B 2R7RA 4DYRA 1HCRA 1OLTA 4YG2F 4BE2A 4HF1A 4HNUA 1U6GA 2MD5A 3RJPA 1VQOI 1N25A 3WTXC 1SD7A 3OSGA 1B6AA 2R93J 3A0HC 2K85A 3MD2A 1T8IA 2JA6J 2GA1A 5IYBJ 2RGVA 3HHGA 2PXQA 3BPXA 4UNOA 2LLWA 1FP2A 1LE8B 2P5VA 4M3DA 4DBQA 5TJJA 2V9VA 2F4IA 1RC9A 1PJRA 1PYVA 2LK2A 2WADA 2AUWA 1E3OC 3GN5B 1WJDA 3GFIA 1XCVA 3HOXJ 4U88A 4YIIA 2ZFUA 3QU3A 5E8GA 1MBFA 1ZG5A 3WE2A 1JTYA 2JQ7A 3RI4A 1PDNC 3ZPLA 4XSZF 4YARA 1QP0A 3HC7A 1J5YA 2KPMA 2LY9A 3KYDB 2Y69H 3H3ZA 3OYBA 5J1UA 3A9YA 2AXUA 2OPTA 2XVCA 3FWEA 3MAJA 5D4SA 3JRGA 1X1CA 2ECBA 3U21A 3HTSB 2CV1A 4KN7X 2B7EA 4AM3A 2WY8Q 4EM2A 2CO5A 1AKHA 4LG0B 5E3LA 2MLGA 3QYEA 2CG4A 1ETKA 5J8FA 1U0JA 2MC3A 3FXMA 3ULQB 3HOUJ 1W7PB 3U9GA 2MH2A 1T33A 3S3NA 4X4DA 4OMYA 1OISA 2PUDA 2OAZA 2DJNA 2PX9A 4RM2A 3OIPA 1EH8A 4BU2A 4O5VA 1Z9CA 1X57A 4UXNA 4C2MJ 5CYVA 2CUJA 1ZYRF 1S72I 3OYGA 3CCEI 1A6QA 4A0ZA 4RB0A 4QSHA 3LA3A 3JR9A 3HRUA 2DFEA 5J6XA 3GBFA 1KU2A 5BQTA 3OYCA 2EK5A 1F36A 4YEJA 4Y33A 3CCVI 2XPWA 4II2A 5JLWA 3BZ6A 3O6BB 3L2QA 3IHUA 2ZBKA 2IW5A 2BHZA 3MZHA 3V7SA 2EA4A 1U9OA 2H27A 2BW3A 5CKTA 5CVRA 2PPXA 2EV6A 2EZKA 3BQYA 3I4MJ 3S1NJ 2VUMJ 2OQRA 1QPZA 4GO1A 4BXUA 5HS8A 3H9QA 3A9XA 4JX5A 2RNGA 1DPRA 4HNTA 5DM6F 2YX7A 4I6UA 3TRBA 3OYHA 3RKYA 1W7PD 4AU7A 2JA7J 3SFZA 1MBEA 3VOEA 1O3SA 1NHAA 3K2ZA 3M1EA 3V8JA 2KIUA 5K5QA 1MZBA 2KIFA 1YW7A 2JK3A 3G4SI 3E3VA 1JT0A 1VZ0A 2VQHA 1DU0A 4ER3A 1DW9A 1P4WA 4OMZA 5FFZA 4JQFA 2BXZA 2ID3A 4HDVA 1JE8A 1R36A 1FYMA 4ENMA 2X6OA 2STWA 4GYIA 2YX4A 4BE1A 2XB5A 2FNAA 1QZEA 2D1HA 3ERMA 1QZXA 3CP2A 2NXNB 4BYYA 3CDHA 3OV8A 1JTXA 1XG1A 3S2DJ 1UZCA 1FYLA 2PXEA 3LWFA 2BE5F 1M1EB 1ZH5A 1OCZH 5BPDA 1HA8A 2V6CA 2A07F 3K4BA 4YRVA 5IT9K 2O7OA 1WHUA 1KA8A 3ZMZA 2KEIA 3ZQFA 3Q5FA 3GEZA 1ZZ8A 3KP3A 1J0RA 1BDIA 2VE8A 5E8IA 3NRVA 2CV0A 3K4LA 2VBWA 3SR4A 2V4JC 2J5PA 4QWQA 4XIDA 2AXLA 1SVMA 3BLYA 4KICA 2Z3YA 4XLPF 4Y13A 2NVUB 1NK2P 1HDDC 3HIFA 2VQCA 5F0FA 3RCOA 1GV5A 3BJOA 1EH6A 4R1HA 2LYLA 4O8BA 2HXIA 5JR3A 1MDMB 4I76A 3J7YJ 1I3QJ 2KMUA 2FF4A 4RGSA 3QOXA 4RM3A 2LMDA 1SANA 2Y0SA 2YSRA 3G1OA 2P81A 5LLQA 5FLXK 1ZAOA 2HEOA 4I0AA 4F93B 4IQ4A 1Z0XA 3QP5A 5J1RA 1ZR4A 4B1RA 4B3XA 1BM9A 2DDAA 1EV7A 1HQ1A 4KNYA 1FC3A 2M7AA 2VBYA 3GFMA 3LISA 1WWXA 2VT2A 3KP5A 2VC0A 4S04A 1I27A 2MW8A 2ZXWH 1LMB3 3WTSC 1XCBA 2IGKA 2HKXA 3CTAA 1A35A 1LCCA 2V79A 2PXBA 2KJBA 1PP8F 3RQIA 2V1NA 3PQKA 5BOXA 5FLVA 1KU7A 1ZZ7A 2STTA 3E6BA 3HGYA 4Y17A 3GTOJ 2OTJI 3SZGA 4FBIA 1J9IA 1W1WE 5EEAA 1Q1HA 1VQLI 1CF7A 5C44J 1QU3A 3IP4B 4DE8A 2ID6A 3ZP5A 1W0TA 1OPCA 4Z59A 4CCNA 3K69A 2LKSA 3PE5A 3I5UA 3EYYA 2NNYA 1I1SA 2DJIA 3PSFA 2EIKH 5LFAA 4HSTA 5A2QZ 4L9TA 3KP4A 4ANJA 4IRGA 2Z33A 2GIZA 2ZXIA 3J7AO 2RNJA 2D45A 4Z2YA 2P5LC 1TWCJ 4X0GA 2NS0A 5DD8A 1OCRH 1YJNI 4RLQA 3SQNA 4HF0A 2IAIA 5ERIA 4ZTJA 1OSLA 1XPXA 2CQNA 2VC1A 4NUBA 2KIQA 2PUGA 2FNPA 1V5EA 1XC5A 3BTJA 3TO6A 2R92J 2HVSA 3DQVC 4DZJA 1YFHA 2HTSA 2VL8A 2Z9OA 3I0TA 1QPIA 3FMSA 2E2JJ 2ZKZA 2CS3A 4JCYA 2HZTA 3PFIA 4EGYA 1YJ9I 2JCGA 4OAZA 5FGMA 1BIAA 1P4XA 2KL4A 1R1TA 4RB2C 2PXLA 3EUHC 3ZQHA 5K7FA 1ETQA 1XSVA 4CCOA 4HSRA 1TWAJ 2GXGA 4HLXA 4ZYEA 3SCFA 4A0YA 5C3EJ 2BOLA 1O3RA 2E1OA 4G6DA 4HQMA 3TMOA 4RMNA 2KZGA 4OINF 1LB2A 2H94A 1BDHA 3OKZA 3FXKA 2IA1A 4XOTA 3E1SA 1Z21A 1ETXA 4KA4A 3E97A 4JCXA 1JWLA 3O8HA 2JVHA 1FX7A 2OA4A 3GBGA 4YG4A 4G7ZF 2PXPA 3FDYA 3K1PA 3WU2C 4E7IA 2NYXA 4D1QA 2PFBA 1PUEE 1VQ6I 1FY7A 1MBJA 3LSKA 1X2MA 2VB6A 4QPOA 1R5GA 3BG5A 4OOIA 2XF5A 1BJZA 2R63A 5FKKA 4ZDPA 3E5QA 1LJ9A 3H3VK 3ASNH 3OMYA 3JRBA 1K4SA 3BS3A 3OL4A 1Z91A 3CUOA 3CCYA 3BROA 4X4FA 3A03A 4CZCA 1R6RA 2LYCA 1Z7UA 2DODA 1MIJA 3KCCA 2JVLA 4X6AJ 3V8KA 3K4KA 4E7KA 2E34A 5J3LA 1LQ1A 1HBXG 4FE7A 2IA0A 2F6CA 3QAHA 2JTVA 3ECHA 4FISA 1RETA 2M4KA 4EJWA 3S17J 3ML6A 3JREA 1R49A 4J1XA 4RBOA 1BI0A 2FMYA 2RAEA 1I6XA 1P7IA 4PDKA 3JRCA 2K3FA 3L00A 5B66C 3AG1H 2IVQA 3FIWA 2RVCA 3ZRGA 4BDYA 1S8NA 2EFOA 4HBLA 1IN5A 2ZMEB 1S7EA 1APLC 4F8DA 1W5SA 2W25A 1YITI 2IUOA 5FKOA 2GOXB 1YG2A 1RI7A 3BJ6A 3MZ8A 2HOSA 2IS4A 1LE8A 4XICA 1Y1WJ 4ITVA 3CF2A 5JLXA 3D0SA 1YHQI 1IC8A 3ABLH 1WJFA 1ETOA 4E7SA 2JA8J 1HXDA 4IX7A 3SEZA 4B47A 3HRTA 2GAUA 3F8NA 2L9VA 2ZSIB 2EA2A 1G2HA 4GDFA 4RAFA 1SVLA 2VKDA 3WHCA 1ZUGA 4RGXA 1VQ8I 2E36A 2ZC2A 5GTHC 2JA5J 3VSKA 4BXFA 5BMZA 2R0QC 2ICTA 4A0XA 4D5CA 2VJ5A 3KZYA 2O03A 4EKIA 3JTGA 3OYLA 3C2BA 1TQMA 4XLEA 3WU1B 2V3CC 5DUKA 2EV5A 2V1XA 3AKZA 1SD6A 5CVUA 1PP7U 2K9NA 2AHQA 3MVPA 4KMUX 4DQ2A 5H6RA 4U0YA 3A9ZA 4GRIA 1PNRA 2WTEA 3H5AA 1P7JA 1YRNA 2DMQA 2XF6A 3JRFA 1VQKI 1W7PA 4IRHA 4HOBA 2R7UA 2X6WA 1TNTA 3I4PA 1JH9A 3A2KA 5HLTA 1Y7YA 2FX0A 4IZZA 2DXIA 4KFCA 2WBMA 4ENJA 1TQIA 3CC7I 3HSEA 5TRDA 5D6FA 4PU4C 1TQPA 5D5XB 4HRIA 4DZPA 4WX9A 1BW5A 1QZZA 1FNNA 4Y4RA 3FXJA 4ZYHA 3GX4X 3QF3A 5EGOB 1MMDA 4BHBA 3W3CA 1BW6A 5LGTA 4KIGA 3HPHA 2VKVA 1IV8A 1FIAA 1PRAA 2LG4A 1WVRA 3MEXA 1DULA 3KX2A 4O6JA 4AIJA 4G94A 3T5XA 2DA7A 2DTZA 1WJ5A 2DK8A 5K5RA 3A02A 5C4JJ 5CPRB 2QYOA 4XLAA 1W5TA 4AC0A 3GLLA 2EWTA 3WGHA 2ODRD 1SEUA 2VIXA 1MMSA 1RR7A 1P4AA 3ESWB 5KVRA 2ZJQF 1VQ9I 1JGGA 2YS9A 3NEUA 3X2QH 2VXDA 5F1JA 1Y9QA 4WXCA 1LEBA 2IXSA 2NVTJ 1IGNA 3NWTA 4E7LA 9ANTA 3S8PA 2BY3A 4KIBA 1AOYA 2JUCA 1HQCA 3E6DA 2WV0A 1IUYA 3I9V2 3RKWA 3TQNA 2CYYA 1IXCA 4BAYA 3S8QA 5K7HA 1K78B 1IF1A 3LAPA 2DMUA 2CMPA 3BR0A 3D5RC 2K27A 2XC7A 1ZZ6A 3WTYC 4HV5A 4U7BA 3ZR8X 2BBYA 5DTRA 1YS7A 3ABMH 2EFNA 1Z6RA 3HTUA 5IPAA 2KKOA 4MIMA 3QQAA 3J80Z 2IVGA 1NW3A 1ORKA 1J2XA 3ASOH 1ZRCA 3ZMTA 4WVLA 2L02A 3GZNB 3ZMDA 3OYFA 3P5JA 4FT8A 1AHDP 5GADJ 1IXSB 3SXYA 3TGNA 1CJGA 4JX6A 2QQ9A 3CUQB 4XMYA 3LNQA 1Q1VA 3KYLA 1WH8A 2BYVE 3KJXA 3CCUI 1R58A 4BQAA 2J7WA 5EG0B 3DBLB 1OCTC 4IHXA 2IS1A 4ER6A 1LUJB 3V7CA 1PERL 3LAJA 3BR2A 3GZDA 5H20A 2OUMA 4FCYA 2ZO4A 4KJZA 2IJLA 2XAUA 2LP0A 2HNHA 2DLLA 3TL4X 3W2AA 1O7LA 4U87A 1D5YA 3GFJA 5ILVA 1I39A 4FETA 2XF7A 3PNVA 1G4DA 1UELB 4I2OA 5LRSA 4L9JA 1U5TB 2CQQA 2EPFA 3BP8A 1G3WA 3MZYA 4HYEA 3GWZA 1WGXA 2JQEA 5KAIC 1T6SA 3NXHA 1MH4A 2X0LA 4P5OA 4Z5DA 3HZIB 1X1AA 3FKJA 4XN0A 2IRFG 2QWWA 4HPQA 3SZTA 5F1RA 2XKPA 3CJRB 4A3LJ 1P6RA 2XJ3A 2L7ZA 1R5ID 1MJ9A 1MKMA 4ZC3A 3R1FA 3TDUC 2QVOA 1XDUA 1D1BA 2XPVA 1ZG1A 3BR1A 3GTGJ 2MH9A 1FOWA 1BC7C 3TP0A 3Q0UA 1GXPA 1MMGA 4X1EA 3JSPA 2R5ZA 2DTRA 3RDIA 2FXAA 2MABA 4G8XA 4XL9A 4KDPA 3KPHA 1E2XA 2WAQA 4Y42A 4EEFG 1R7JA 4B3AA 1V54H 3OQNA 4ZDOA 4WF2A 3I59B 1HW2A 2BNNA 3L2UA 3QYBA 3UWPA 4BJTA 1BR2A 2GM4A 3I4NJ 1FZPB 2QQ8A 4A3EJ 1DUXC 3BDNA 3HM5A 4HZFA 3OR1C 3HUGB 3OYNA 5E20A 2L54A 3DLAA 3PQJA 2LH9A 2MLKA 1D0YA 2GA2A 2JN6A 2E5ZA 3QWLA 2EQRA 4H4KC 3F6OA 4NQWB 2PI0A 2O4AA 2JZYA 1U78A 2M4GA 3GYHX 4HV6A 3W2WA 5LEKA 4J19A 2R7XA 4LGWA 3AG3H 4D7MA 3ZQGA 4WK8F 4A3KJ 3IH4A 4M9XA 3T8TA 1NEQA 1MGTA 5K5OA 2MEZA 3KL4A 5ICGA 3IRRA 2LYJA 1IRZA 2KISA 3WE3A 4BHPA 1BI2A 4M6VA 4G6TB 1YTYA 1FMWA 1HKQA 5K98B 2HI3A 3AL0B 4BE0A 4RB3C 3J7ZI 1DWKA 4J1WA 2P7VB 2R7ZJ 3CP8A 2ICWG 3DU5A 3FHNA 2DPDA 1XMAA 1OQYA 5J4YA 4MEYF 5F64A 4C2TA 4A5NA 1SAUA 1SD5A 2Z99A 3N05A 2OJED 4PGHA 5C4XJ 4PUSA 2LNMA 2JSPA 1JT6A 4IL6C 5D4RA 3MN2A 4JQDA 1TC3C 1EKEA 4IF4A 2HCNA 3BTLA 3JXDL 3S3MA 4EV0A 3G5GA 5J8CA 3SJMA 1S6LA 2VOOA 5FRMA 3CF5F 2V26A 2XAGA 3B6AA 3OYEA 1ZVVA 5D5WB 3BY6A 3W6VA 2HOEA 3ZN0A 1B8IA 2KPJA 3K70D 1LDKB 4A12A 3A01B 3KZIC 3T0YA 4IHYA 5M3MJ 3C3WA 3F8CA 3OS0A 2E60A 2XI8A 2X48A 3LSGA 1S29A 1MBGA 3P9CA 3CJTB 3U1DA 4A3DJ 1Y0UA 3DTIA 1C0WA 3CQZJ 3PO2J 3SCHA 1TWFJ 1U8BA 3TELA 4ESFA 2X9DA 4A6DA 1UTXA 1MFQC 3V8LA 3TO9A 5DCFA 3F6VA 3HYIA 3I58A 3SDGA 3PM1A 1XGSA 2W48A 3CO6C 1MNMC 2R7VA 1RZRD 1RPEL 2L1PA 2BY0A 1RIOA 3GO5A 4YBAA 1YJWI 3FXRA 2QBYA 2A69F 3E0JB 2FBKA 2G0EA 4BL0B 4EJUA 3OOPA 3L2CA 3G6EI 1YIOA 3H5NA 2VPRA 5E1WA 3KP6A 2EZHA 4ENNA 2HVRA 2M8EA 4HG2A 2IV1A 4RA2A 3VYTB 2LYRA 4XLCA 2BZTA 5AONA 2IGOA 4IHVA 2G7UA 3QQ6A 4NDLA 1RUNA 4YELA 5IP7J 3LSRA 4XLHA 3GTKJ 2I10A 4C3IJ 2TDXA 3R60A 2KP6A 1FOXA 5DRTA 2ZMEC 1MBHA 1YLFA 3ELKA 2IP2A 3SDBA 3TW6A 2AQFA 2OD5A 3S14J 1U2ZA 5LHIA 4ENKA 3NZLA 1G3SA 2Z16A 2UXXA 2WUSR 2IGMA 2K86A 3QPTA 3HPGA 1YX5A 2MG4A 3HGGA 3BZCA 4RB1A 3A0BC 3RPUD 2KDOA 1S5LC 2Z2SB 1WRJA 1YOVB 3CECA 1LDDA 1SFXA 3LSHA 3H92A 4IVNA 4E7HA 3VYUB 1PUFB 2O49A 2R5YA 2XGDA 3FM5A 2AW6A 2LF8A 2PEXA 1TTYA 3MMYB 4MNUA 1MH3A 2EFPA 1ZRDA 1YYVA 2DYRH 2NOGA 4IQJA 2DQLA 1IUFA 4A2UA 4AYBN 1FMVA 3DBRB 4XQFA 3IH2A 2H6CA 3G3ZA 3ZHIA 2OR1L 2HOAA 2ISZA 2H6BA 3F72A 4LITA 5FROA 3S1QJ 2EIMH 2AS5F 3GUUA 4W1UA 4UVAA 2QGUA 4H0EA 3DXJF 1GVDA 5DV5A 4HNVA 3DM5A 2ME0A 1B1BA 3EPZA 3QPHA 3HRSA 3OWQA 5HNHA 4PU8A 5FKMA 1ZGWA 2ELJA 4M3GA 3WTZA 2ZJRF 1QO0D 3L7WA 4Y15A 3TDZC 4UUSB 2V1UA 2NOJB 1Z67A 4II3A 3E6CC 1FTTA 2XCJA 2LSOA 2QQBA 3CZ6A 2K9SA 3RPQA 4B48A 1RKTA 2LVSA 3KEQA 2E1MB 4IXAA 2UUZA 3BR6A 3IH3A 1IAWA 1FJLA 4BNCA 3Q0VA 3FYMA 1ZGJA 3ERED 5ICCA 1MW7A 2M3AA 2QZ8A 2E1CA 5GTIC 2W4SA 1UMQA 5M5XJ 4XN3A 2DPUA 3DF8A 2Y9YA 2L4AA 1WH5A 1ULYA 2QSFX 3R09A 2I5UA 3IAM2 2D2WA 2Z1DA 1UG0A 2DFFA 5JVTA 1TT5B 2OV7A 4ABZA 3H0GJ 1JKPC 2HINA 4M73A 4C3JJ 1X3ZB 1J75A 2CGPA 2X85A 3O8GA 4LJZF 5E3NA 2HGCA 5DTMA 1Z3XA 4R8HA 2P0WA 1MMNA 1T56A 2HFZA 2CW8A 3GVAA 4XBFA 1KYZA 1TWGJ 2YPRA 2OFYA 4OAYA 2Y0MA 4XRSG 5CVIA 4D0PA 3J81K 1U2WA 3D1NI 2PXKA 1H89C 4DOZA 4Q4ZF 2DT7B 4HX4A 5DTDA 4IHWA 2DA1A 4XORA 2KJCA 3KE2A 2ZNYA 1IRXA 1KONA 1A36A 1LDJA 5TISC 4N0BA 4I09A 1HF0A 5FJ8J 3WG7H 2XUBA 1K78A 2BNOA 1U9NA 2R7WA 4BEHA 4A93J 1QP7A 4W97A 3K4CA 3PNTA 1AWCA 4IOCF 2ZSHB 1UG2A 2PG4A 3R6SA 4NDWA 1V55H 2OBPA 4CCMA 2GLOA 3UKGA 3QYFA 2CU7A 4GCVA 5EJCA 2ETHA 3I56I 3C18A 2Y48A 3CMEI 1TW2A 2PJRA 1SFEA 4MCXA 1O7FA 4XRSA 3F51A 4IPAA 4QLCU 4EGZA 1KQ9A 1YSEA 1GHCA 3ZGKA 4XRFA 2O6GE 3CUQA 1WQ2A 3KETA 4OIOF 5CVVA 4A69C 2XASA 1HW1A 4ZDLA 5KK1A 3G1LA 1VQNI 1HKSA 2EB7A 3B6CA 1RESA 3HOZJ 1P2FA 1BL0A 2F48A 5IY5H 1F43A 4ON0A 5IT3A 3CUQC 1RZ4A 2LKXA 2VKEA 1KYWA 3M9LA 1IO2A 1WJEA 2XGEA 2L9RA 4N4OB 4KT6A 5HDGA 4AUXA 2PIJA 1VNDA 1HC8A 2A6EF 2JSCA 2KEJA 2JUGA 2R7TA 3BJAA 3VPRA 4UB6C 1T0FA 1E3HA 3EUHA 3CESA 3DPUA 3H35A 3ABTA 1U3EM 4X4EA 4BXXJ 1FSHA 4AD9A 4ZYGA 2D1VA 3OOUA 4UUVA 3EUAA 4G7HF 3K0LA 2R4GA 4N9HA 3DBHB 1FP1D 1GV2A 2VKHA 3SEQA 2XRNA 2L7FP 3CLQA 2DMNA 1T0FC 1X4PA 5ICFA 1BI1A 2CRGA 2JRMA 5E79C 4WWCA 3CLCA 2JJ7A 1USTA 2J5OA 3S2WA 1U5TC 1IG7A 4FHTA 2RV8A 4CA0A 2W7NA 1Z77A 2EIJH 3FXQA 1XMKA 1R1VA 2L9SA 4NC6A 4BJ6C 2HR3A 3PO3J 3IWFA 3M1CA 4ZYAA 3SHFA 3MKZA 1ZAYA 4A3CJ 2M9HA 3V4GA 4DBRA 2W84A 1DDNA 1D8KA 3PXPA 1A04A 4ZZDA 1N77A 2XSJC 1L3LA 1S7AA 2OZUA 1K4TA 4B09A 2CQ7A 2W24A 4C30A 4LD5A 3CMMA 3TW7A 4FE4A 3HUGA 2HYGD 5E3OA 3WGIA 4Y3OA 1R4NB 3QRFF 2MSYA 4NQWA 2IEKA 2XXAA 1WKMA 5E18F 2M8GX 3MFKA 4OIPF 4L0ZB 2O3FA 2P6TA 3S16J 4ZTFA 1W36D 1QHHD 3OR2C 1VQ5I 4Q5SF 3DKWA 5E17F 5ICEA 3FHZA 1ZHFA 2B9SA 2WAQN 1XSDA 3HSFA 3IKVA 3K70C 2F5VA 3CCLI 2MFZA 4I01A 1RZRA 3SX0A 2YUSA 2DA2A 1UXDA 1IV6A 3M3YJ 3ZMSA 2MD0A 4KITB 2LREA 2R7FA 4XKBA 5DEQA 1BI3A 2DN0A 4M71A 1XMXA 4CSWA 3G73A 2E2HJ 4DE9A 3GZ5A 1G8XA 2CUFA 4IRIA 4FN3A 2CJJA 4LOCA 4JBAA 2ZJ2A 2BNMA 1Z7LA 1LNWA 2FEZA 3AL0C 4KYWA 3GZ6A 1LPQA 2IVBA 4NC7A 4B4CA 3F8MA 2HCSA 1LVAA 3BR5A 3P7NA 3TKYA 1ZK8A 2Y2ZA 5EZGA 1FIPA 1QVTA 1X4OA 2KIMA 5JHUA 3JRHA 3MKYB 1RRJA 3KXAA 1D1AA 5TGTA 2M1BA 4O3MA 4PU7A 4AYBA 2A5WA 3ZXSA 3GN5A 1MNDA 5F08A 3QYXA 1S7OA 5EZHA 1LEAA 5GP9A 5LEJA 1H8AC 1QP4A 2GZWA 4L9NA 3WODF 4E4HA 2LYKA 5F0CA 2DA4A 1JKOC 4LIUA 5KNLA 2VODA 3GCMA 2XAQA 5DRYA 2DK5A 1ADRA 3RPUA 3GLXA 3H5RA 1G59A 1ZPQA 4CYCB 1QBJA 3ZQ7A 3FMYA 2CSOA 4BHCA 1FLIA 1YO5C 1T08B 4E7JA 5IP6A 4HF2A 1WH6A 1IN4A 1I50J 4I02A 3SZPA 4IA8A 4CCKA 3MLFA 3H0DA 2RN7A 4UVCA 5F6FA 2RQPA 4LG0A 4FTHA 3PJRA 4GXOA 3C2GA 2GXBA 1W5CC 2EJRA 5FO5A 2VJ4A 2O8KA 4ZJZA 1POUA 2EWNA 1BA5A 3H1CA 2M5WA 1KGSA 1GVJA 4FASD 3OYMA 1IJWC 5E1XA 5L3EA 2PUFA 1IZ1A 1TT0A 4EVIA 1POGA 2E35A 2L7MP 3KLNA 2DOEA 5ED4A 3DCFA 3JAMZ 2VEOA 1D1CA 2TRTA 4A3IJ 3B7HA 4BQNA 1JFTA 3GXOA 4EJOA 4AVPA 5GAGJ 3DEEA 1IRFA 3IC7A 2P8TA 4DIQA 4CUGA 1U8RA 5DT2A 3R0AA 3COAC 4E6KG 3JRAA 4QPQA 3FXLA 4L5JA 1O4XA 4CH7A 2HDCA 2JPBA 2WAFA 2ZXHA 1USSA 4S05A 3ME5A 1X2NA 4XONA 5HNFA 2LFBA 2PN6A 3BOQA 2MA3A 3BDDA 1X19A 5F27A 2ESHA 1SC7A 1NK3P 4YG7B 3ZPXA 1T2KA 2K4BA 2XAFA 5DDGA 1EJ9A 2DOFA 5D6EA 1E0EA 2K9LA 1UXCA 4I98B 3TEPA 2X1DA 4L9VA 5B3SH 2R1JL 3GTQJ 4EKGA 3DTKA 4RDUA 4FX4A 4LMYA 4Z5HA 1QA6A 3IRQA 3S3OA 1JKQC 2GQQA 3V42A 3I54A 4LLGF 1UHMA 3IV5A 2EZLA 3KP7A 1WJBA 1QRYA 2F5DA 5DS9A 3CDLA 3ONQA 3OQOA 2PUAA 1WSUA 4M3EA 1ZGAA 2FSWA 4XLNF 2P6SA 1QQAA 2HWVA 3ZHMA 1X3WB 3RKQA 5LD2C 1TL8A 2ZCWA 1F1ZA 4DJAA 1Z1DA 2FJ1A 5LRRA 2K9MA 2L01A 4CICA 3OWTA 3DPLC 2V9KA 4M3BA 5CQGA 3TO7A 1ZN2A 3BPVA 2XDVA 3WTUC 2ESNA 3FM3A 2F5FA 3BC8A 5A2QK 2EV0A 3CD6I 2WIUB 1QQIA 2LKPA 3OIOA 4OU0A 1HOMA 5IP9J 3OS1A 4LLLA 3OY9A 2JVGA 2WAEA 1JUMA 3Q9SA 3JSOA 3W6JB 2J7UA 2DA5A 4S0HB 1K61A 4DGWB 5GPCA 4EM0B 2E1MC 3H9GA 2EF8A 3BD1A 2VQGA 3ZOBA 2ECCA 2K02A 2L2OA 4UB8C 3G7DA 3MKLA 1XX5A 2MGQA 1D8JA 1JXSA 1XGNA 4I6ZA 3K10A 1IW7F 1RZSA 5HDKA 2P4WA 2LLVA 2M2EA 1KU3A 4IVZA 3A4CA 2DA3A 4EJVA 3CO7C 3RTRA 1XTAA 1HDPA 4L5IA 1LFPA 1ETVA 5K1YA 3HOYJ 2PQ8A 1MDMA 2ZJPF 1XS9A 1P9QC 4LFUA 4KMFA 4OIQF 1MJBA 4PSXA 5LBQA 5JHFA 2PXVA 4Q48A 5L3CA 3TEDA 1Y6IA 4LLNA 2DDBA 1LQCA 1I6HJ 1STZA 2Y9ZA 4I7HA 5E3MA 3NQOA 2DQRA 1HSTA 2OC6A 2HS5A 1Y39A 1CF7B 3RSNA 1Z05A 3UR3C 1I3AA 5EEGA 3FKIJ 2RC4A 1TZLA 4MEXF 3FF5A 3E7LA 3OQMA 1GUUA 3TBIA 4X4GA 3OIQA 5K7ZA 2XROA 1K6OA 4BDZA 3LL7A 2FQ4A 3QU6A 4E7ZA 1O57A 1R00A 4LK1F 3VEPA 4XKCA 3DV8A 2K4JA 1IN6A 1K6YA 1DP3A 2E7WA 4B44A 2GRLA 4BBSJ 3HOTA 1YI2I 4N4NB 3EDPA 5IT9Z 3B02A 2DFIA 2FOKA 3HOSA 3ZKCA 2AXZA 4CYDA 2Z5UA 2DI3A 3DKXA 2LDUA 2JT1A 1VI0A 1YS6A 2XSDC 1QGPA 2HFHA 1VQ7I 5DSXA 2ADUA 4DNCA 2EZIA 4MO7A 2W57A 3H36A 1JUPA 2QCOA 4EK9A 1K83J 1OYWA 2HPMA 1W4MA 4LG3A 2XAJA 3DFGA 2B5AA 4XRMA 3DEWA 3PNYA 2MQKA 1FBUA 3KP2A 4ESBA 2WB1A 4X4HA 1XB4A 5HDNA 1ENHA 2BY2A 3OL3A 2A3SA 2LBFB 2ISYA 1K79A 2Q1ZB 3REOA 3WG9A 1ONVA 4DW6A 3HL2A 2R7DA 2P7CB 2TCTA 4Z6YA 2L9NA 3JRIA 5FLXZ 1OKRA 4ER7A 2CUZA 4C9YA 3M8FA 1WZ2A 5B1BH 2HQAA 1DU6A 1REPC 2Y75A 3C7JA 4BKXA 1J7KA 4FQGA 3LSTA 1X1DA 4CZZA 3HG9A 3RZZA 1UCRA 2IGNA 1WIZA 4Z58A 3BCBA 2ME6A 2BY1A 4ZYDA 3FBNB 3IUOA 3HZJA 4MFDA 4BY1J 4MLOA 2H09A 1UHWA 1L0OC 1W36C 3HOWJ 2C6YA 4RS8A 2AXVA 3LSJA 3SCGA 3FXUA 3K2AA 2CW0F 2F4MB 1Z6TA 2L4MA 5D5VB 3K4MA 1KU9A 5DCMB 2E71A 2KEKA 2BVMA 1LFUP 2H8WA 2FMLA 5EF6A 2AXTC 3R61A 1H9GA 2F2EA 3ZQIA 1CGPA 1D0ZA 5J4VA 2WC2A 3PIOF 2R3SA 1NG6A 3PUBA 3RQ4A 4EQQA 2CROA 2OZ6A 3N97A 2KT0A 3BWGA 3ABKH 3H9JA 3RYRA 5BPIA 2HZDA 3QWGA 4AIDA 2EBIA 1FT9A 2E2IJ 3ZCOA 1VTNC 2JRTA 5J47A 4L0YB 3E5UA 2CFXA 3G2BA 4V19K 2DT5A 3CJNA 4A3BJ 2PUEA 4KUMA 2WY7Q 1DQUA 2HQRA 2M34A 1V3FA 3JCUC 3RYPA 2QKLB 4KISA 1J09A 4CGZA 4IJAA 4IWRA 4G7OF 4E70A 2NRAC 4UV9A 2VONA 3TFLA 4PJMA 1YIJI 1QHGA 5HLGA 1T98A 3B73A 4HQEA 2FRHA 1RPWA 2M4HA 3M8EA 3NARA 4WXDA 4G6QA 5GAHJ 3Q3SA 5JFRA 2VPLA 3E6MA 3I53A 3K4JA 3LA2A 3FISA 2PMZN 5GAGi 2ZMEA 1AA7A 2L7KA 3KZ3A 2DW4A 2OCCH 4RAZA 1R22A 4BY7J 4XOPA 1XD7A 4ZZLA 4MTDA 3CCQI 1PRUA 4M3FA 4MQVA 1B0NA 2QSGX 2L0KA 3VB2A 5M5WJ 2OU2A 3OYIA 2NAZA 3FXOA 1WI9A 4EQZA 4A3JJ 1X1BA 1JFSA 3BT9A 4PJJA 3RZOJ 2CQKA 1GDTA 3OSFA 3C1DA 2PLYA 5HLIA 1MMAA 1YRNB 3K7AJ 5AIPA 3FZVA 3OS2A 4HDUA 2PE5A 5GAEJ 1FYKA 1ZS4A 3HHHA 4EMSA 1D5VA 1ON2A 1ETWA 4MFEA 4CYCA 2CUEA 2A68F 1FOYA 2EILH 2COBA 2LYSA 5JUWA 4IEJA 3HSRA 4LB5A 1ETYA 2V1DA 4DYQA 2VQLA 3QOEA 1D3YA 2VJIA 4U7DA 4NBQA 2NS8A 4B8XA 5KAFC 2LYPA 3BG9A 2A61A 1IN7A 1SD4A 2CW7A 2HPIA 3W6KB 4IOAF 3Q0WA 2CQXA 1F9NA 3T8RA 3TOAA 4I8TA 2XB0X 3IAS2 3J80K 2A6TA 1NG7A 2IU7A 4P9FA 2QEXI 1OCCH 4LK0F 2LRDA 4AWXB 4WCGA 1Z3YA 2PXUA 2WV1A 2G7HA 2IBDA 3IL2A 4PJ0C 3L2RA 4MGRA 4N9IA 1LVKA 5EGOA 2A6CA 1VFCA 4OIRF 5IOZA 1Y56A 4OB4A 3ZMVA 1XN7A 2OF7A 2F5EA 4ASNA 2LY2A 3O2PE 5ILUA 2AO9A 1MSEC 2A6HF 4QIWN 4RAGA 2KHMA 1OFCX 4UUTA 3ECOA 4M74A 1TLHB 4CO8A 2I8DA 3MKWB 2A5YB 1VQMI 4PK4A 1ZTRA 1VQPI 2KLOA 4BQQA 2QA4I 1QNTA 5A7LA 2GBYA 1DP7P 2AQEA 1X58A 1B9NA 5KCMA 4F3QA 1GT0C 3QFIA 2CH0A 2V7FA 2L3DA 3KLOA 1J59A 1QVUA 4XM3A 3DEUA 2X1EA 4BQOA 4FX0A 1T39A 4HX7A 3QPLA 2ICPA 2L49A 3OMTA 1H88C 2MC4A 4X4BA 1D0XA 2EFQA 2QSHX 1WI3A 1ZARA 4PGGA 2O61A 5FD5A 4Q47A 3S15J 3FYAA 4HRAA 1WCMJ 2Q0OA 2BV6A 3GMEA 2PUBA 2FE3A 2E7XA 2KDZA 2OTLI 3CJQB 2K7LA 4EZIA 1SQ8A 2Y30A 3DU6A 3LSMA 3K1NA 2UV1A 2RKHA 2O5RA 2XGXA 2KRHA 4XKWA 2EFWA 4D5FA 5BNGA 4EATA 3BR3A 4RLFA 1TW3A 4HW0A 3RKXA 1DGWY 3SFIA 4P96A 2KFDA 4MCTA 3H3UA 4V2GA 3BTIA 2E5NA 5HODA 1MNEA 3HDDA 1V5FA 5LHGA 4ER0A 1F5TA 5HLHA 2M0CA 3M4OJ 4I6TA 1PVEA 3OP9A 3LQXA 2UXNA 1FBSA 3MWMA 1H0MA 1WJAA 5IYCJ 2VBZA 1IN8A 4JOMA 4EJTA 3RZDJ 3WTWC 2RQQA 2PMUA 3UFDA 1UHSA 2XXPA 1R69A 1LCDA 3L9FA 4D7NA 4BUPA 2QQAA 4PSWA 1KQ0A 3CDIA 3GTLJ 1ON1A 2DYSH 3L1PA 2GZUA 2RDPA 2RREA 5J1YA 2BXYA 4JK1X 3L2VA 1ZR2A 1LLIA 1WH7A 5EG0A 3F0CA 1G3YA 2XIGA 2CWEA 1EH7A 4L18B 3G1MA 2L8NA 2PUCA 3K9TA 3VFZA 5EYRA 4CHUA 2VBXA 3LA7A 3DNVB 2NVYJ 1RKWA 4BJ5C 5FKNA 2QF7A 4A5MA 4LB6B 4ER5A 1R71A 3L09A 4X4CA 2HU9A 4KN4X 2BEOA 3EQLF 3I3LA 3K4NA 3WTTC 2VASA 3VWSA 4P1WA 2M0MA 5L3FA 2H8RA 1U5TA 2R5ZB 2HXOA 3HOVJ 1HKTA 2HDDA 4UVBA 5FLMJ 3M8JA 2HVQA 2B0LA 4EM1A 1CQTA 2GOMA 1NERA 1R23A 5HS7A 4MHGA 3DPTA 4IO9F 1QB2A 4BACA 3F22A 2DCEA 4R79A 1JI8A 3DWLE 4A3MJ 2Q2EB 3ABUA 4XNFA 1ZREA 2BVLA 3IVPA 1OMIA 2VLAA 3G0TA 3P9IA 2PMHA 3T1BA 5FB2A 1OCOH 2FBIA 3S2HJ 2DO7A 2EH3A 4WXHA 2XGCA 3D5LA 3LFKA 4JP0A 2A05A 1IXRC 2UWMA 4F52A 2CV2A 3GW2A 3I59A 1MJAA 4C3HJ 2PXDA 1B72B 3IWZA 1FPQA 1T95A 3CCRI 1R9TJ 3S1MJ 2LBFA 2QENA 1Y0NA 2W00A 1YW8A 4CCJA 4RAYA 1UJ8A 1RR8C 1VF9A 3HB9A 1QPMA 1FBQA 2K3PA 3FK7A 2X4HA 5LGNA 1IRGA 4OBMA 3C2HA 2PMZA 3ISPA 3L2WA 2DFHA 3F6WA 5LHHA 1G6NA 3MQ0A 3U3WA 3OYKA 2WA0A 3ROUA 2HSGA 3F23A 4M6XA 1MD0A 1S3JA 5CVJA 4X4IA 1V4RA 2IVMA 2W82A 1SAXA 3NAUA 5FD6A 3CC2I 5GAHi 1ZELA 1R63A 1PRVA 3CLOA 2WB1N 4HEA2 2QUFA 4IHTA 1UFMA 1IDYA 3F3XA 5CJ9A 3F21A 2M45A 4A6EA 5DCMA 3SYTA 5L3GA 3LFPA 4YG1A 5CQEA 1RUOA 1KQ8A 2KZ8A 2LOOA 4GHJA 3BG7A 3R4KA 2VT3A 1B8IB 4P9UA 4A3GJ 1TBXA 2DMTA 1YX3A 3EUSA 1XDSA 1H9TA 4HAMA 2PJPA 2O8XA 3M9AA 3U2RA 2LR8A 2IA2A 3M7GA 4I0BA 3BG6A 3TOBA 2PXTA 5M5YJ 2ELKA 3F9KA 2F4OB 2HDWA 4AIHA 4YFNF 3KEOA 5DUIA 2VE9A 3KZZA 1AKHB 3DLLF 1OR7A 2M87A 2QBYB 1DGRM 1VPWA 1XGMA 3A01A 2VOPA 3AG4H 2LC2A 3HKZN 5DM7F 2YU3A 3PSIA 2DA6A 3ZN1A 3K1MA 1WJCA 2XHKA 2MYSA 3DTEA 4CXFA 2KQRA 3OYJA 3F8FA 1K7AA 3BCAA 1WFXA 1OR7C 4ESJA 1OYYA 4ETSA 4BGDA 3BQZA 1A6IA 1R1UA 3OYDA 4U0VA
chains in the Genus database with same CATH topology
3OQMA 3E7LA 1GUUA 2FD5A 4IHVA 4X4GA 3QQ6A 4NDLA 5K7ZA 5EEAA 5IP7J 3LSRA 5C44J 2FQ4A 3GTKJ 2I10A 2ID6A 4C3IJ 3BG3A 2LD5A 1W0TA 3GTMJ 2H1KA 4Z59A 2GRLA 4GFBA 3ZQLA 2Y31A 4BBSJ 1MBHA 3TW6A 3S14J 3ZKCA 2AXZA 2LCVA 2R5YB 1VI0A 2WUSR 2XSDC 1TWCJ 2MG4A 3HGGA 3ZQCA 5M3FJ 2IAIA 1OSLA 3CECA 2EZIA 4MO7A 1JUPA 2NVXJ 1FTZA 1PUFB 2PUGA 2QCOA 2O49A 2R5YA 2XGDA 4GQMA 2GRMA 2AW6A 3HEFA 1XC5A 3BTJA 2R92J 1K83J 1MH3A 4DZJA 1JUSA 2XIUA 1QPIA 2NOGA 2B5AA 4XRMA 3DEWA 2E2JJ 1NTCA 1IUFA 2MQKA 4X4HA 4JCYA 4AYBN 3CROL 1ENHA 1PUFA 2JCGA 3IH2A 4DYCA 4DW6A 3ZHIA 2OR1L 2HOAA 2TCTA 4JX4A 2HOTA 3ZQHA 5F0HA 3JRIA 3S1QJ 5K7FA 1ETQA 4W1UA 1W0UA 2D5VA 1GVDA 1TWAJ 4HNVA 2ME0A 2JMWA 5EDNA 1ZQ3P 4PU8A 3SCFA 4V2FA 5FKMA 5C3EJ 2E1OA 1ZGWA 4M3GA 1DU6A 4FBIA 3CMYA 4BKXA 3GTPJ 1BDHA 4UUSB 3RZZA 1FTTA 2XCJA 2K9SA 1WIZA 3O9XA 4Z58A 1ETXA 1RKTA 2LVSA 2ME6A 4JCXA 1JWLA 3O8HA 4BY1J 3GBGA 4MFDA 4MLOA 3BR6A 3IH3A 1FJLA 3FYMA 4YG4A 3Q0VA 4UUSA 3HOWJ 2K9QA 2AXVA 1MBJA 3LSJA 1X2MA 3K2AA 3SCGA 1UMQA 5M5XJ 2Y9YA 3BG5A 2KEKA 1LFUP 1WPKA 2N8GA 3BTCA 1WH5A 1BJZA 1SFOJ 5EF6A 2R63A 5FKKA 3ZQIA 3H3VK 4ABZA 3JRBA 3BS3A 3H0GJ 1JKPC 5IYDJ 2HINA 3CCYA 4C3JJ 2CROA 4X4FA 3A03A 3O8GA 5E3NA 2KT0A 3QWGA 4I6RA 2EBIA 1T56A 5F04A 2E2IJ 2JVLA 3WHBA 4X6AJ 2OFYA 1TWGJ 5J3LA 4A3BJ 4FE7A 4XRSG 2PUEA 4FISA 1RETA 3D1NI 3S17J 1H89C 4L5EA 2M34A 3JREA 2EBYA 5DTDA 4RBOA 4IHWA 2DA1A 4J1XA 1IDZA 2RAEA 4JYKA 1P7IA 1HF0A 5FJ8J 3JRCA 1MSFC 2JWTA 4IWRA 2BNOA 1U9NA 2VI6A 2IVQA 4A93J 1QP7A 4W97A 3FIWA 4Y7NJ 1JJ6C 1QQBA 1S7EA 1UG2A 3JXBC 1APLC 4F8DA 4NDWA 1ZKGA 2IUOA 1RPWA 5FKOA 3UKGA 2GLOA 2O38A 2CU7A 3NARA 5IOYA 3Q3SA 2HQ5A 1ZZCA 2HOSA 1LE8A 2B63J 3FISA 4XICA 2PMZN 1Y1WJ 1X2LA 5JLXA 3KZ3A 1IC8A 1L1MA 4BY7J 4MCXA 1ETOA 4XRSA 2JA8J 3F51A 1PRUA 4M3FA 2K40A 1YSEA 2XPUA 4Y52J 1B0NA 4PU3C 1G2HA 3WHCA 1ZUGA 1ZZBA 1TWHJ 2L0KA 5M5WJ 4A69C 3LSPA 2JA5J 4A3JJ 2BJCA 1LFBA 3G1LA 1JFSA 2R0QC 3B6CA 3BT9A 4BBRJ 3RZOJ 2ICTA 1RESA 3OSFA 1GDTA 4D5CA 1JJ8C 4G12A 1BL0A 3K7AJ 1YRNB 3HOZJ 2PE5A 1F43A 3C2BA 3F52A 1ZS4A 4A3FJ 4XK4A 1EFAA 2LKXA 2VKEA 1ETWA 4MFEA 4CYCA 2XGEA 2K9NA 2AHQA 2L9RA 2CUEA 3MVPA 2AWIA 1PNRA 4AUXA 2PIJA 2COBA 2LYSA 1P7JA 1YRNA 2DMQA 4IEJA 1VNDA 3JRFA 1ETYA 2LLKA 4DYQA 2KEJA 1ZZ9A 1Y1VJ 3QPSA 3VPRA 3JXCL 2NS8A 1OJLA 2LYPA 1JH9A 5GPAA 2Y0SN 3BG9A 1Y7YA 2NS7A 2FX0A 2LYQA 4X4EA 4BXXJ 3OOUA 3Q0WA 2CQXA 4I8TA 2XB0X 1OCPA 2YU9J 1GV2A 4QTRA 4PU4C 3VK0A 2L7FP 2DMNA 2E19A 1MBKA 4DZPA 1BW5A 3CLCA 2CRGA 2O9LA 2IU7A 2JJ7A 3QF3A 5EGOB 1A5JA 1IG7A 1FEXA 3HBLA 1Z77A 1BW6A 2XRLA 2VKVA 1JKRC 3S1RJ 1FIAA 1HLVA 2WV1A 1PRAA 2IBDA 3PO3J 3H5TA 5EGOA 2A6CA 1VFCA 1ZAYA 5IOZA 1ITYA 4OB4A 2DA7A 2DTZA 4A3CJ 2OF7A 2M9HA 2CSFA 2AO9A 1MSEC 3A02A 5C4JJ 4QIWN 1OFCX 3PXPA 4UUTA 4AC0A 2EWTA 1WETA 1AU7A 1ZTRA 1RR7A 2FJRA 5A7LA 2GBYA 3TW7A 1JGGA 2YS9A 4FE4A 5F1JA 1X58A 2ZB9A 5E3OA 1GT0C 1Y9QA 2NVTJ 1B72A 3LOCA 2LTPA 2MSYA 3FK6A 1QVUA 2IEKA 1IGNA 2NVQJ 4Z5CA 2M8GX 5FKLA 9ANTA 1EF4A 3QPLA 3S16J 2ICPA 3TP3A 2L49A 3OMTA 3GTJJ 1H88C 1XWRA 4X4BA 1WI3A 3JRDA 2WAQN 2DMPA 2HYJA 3S15J 3FYAA 1WCMJ 3S8QA 4DYRA 2YUSA 2DA2A 5K7HA 1HCRA 1UXDA 1IV6A 1RZRA 2PUBA 3M3YJ 2KDZA 2DMUA 3BR0A 2Y30A 1SQ8A 2DN0A 1ZZ6A 2E2HJ 2CUFA 3OSGA 4D5FA 5BNGA 2R93J 4FN3A 3BR3A 2CJJA 4LOCA 2JA6J 3SFIA 2BNMA 5IYBJ 5IPAA 4MIMA 3QQAA 2IVGA 4V2GA 3BTIA 1LE8B 4MCTA 1ORKA 4M3DA 5HODA 3HDDA 3M4OJ 2M0CA 2IVBA 2LK2A 4B4CA 2AUWA 4I6TA 1E3OC 3GN5B 3OP9A 3BR5A 1AHDP 1ZK8A 3HOXJ 2Y2ZA 5EZGA 1FIPA 1QVTA 1MBFA 5IYCJ 3JRHA 1JTYA 3KXAA 4JX6A 4YARA 1CJGA 1QP0A 3LNQA 4PU7A 2LY9A 3RZDJ 1Q1VA 1WH8A 3UFDA 5J1UA 1UHSA 1LCDA 1R69A 3GN5A 3KJXA 4D7NA 5F08A 2AXUA 3QYXA 2OPTA 5EG0B 5EZHA 1H8AC 5GP9A 3JRGA 1OCTC 4IHXA 2ECBA 2LYKA 1QP4A 3GTLJ 1PERL 5F0CA 2DA4A 1JKOC 3BR2A 3L1PA 2GZUA 5J1YA 1AKHA 1ADRA 5E3LA 1ZPQA 4CYCB 1ZR2A 1LLIA 3FMYA 4FCYA 1WH7A 5EG0A 3F0CA 1ETKA 2LP0A 1WH6A 5IP6A 1I50J 1D5YA 4IA8A 3HOUJ 3G1MA 3MLFA 2L8NA 2PUCA 1T33A 5EYRA 4X4DA 4FTHA 3DNVB 2PUDA 2NVYJ 1RKWA 2DJNA 5FKNA 2QF7A 2O8KA 2CQQA 1POUA 1BA5A 1X57A 4X4CA 1WGXA 4C2MJ 1IJWC 1MH4A 4Z5DA 3HZIB 2PUFA 4QSHA 4A3LJ 1POGA 2L7MP 3JR9A 2H8RA 2XJ3A 2L7ZA 3GBFA 2R5ZB 2HXOA 3DCFA 3HOVJ 2TRTA 2HDDA 1F36A 4A3IJ 3B7HA 3R1FA 1JFTA 2XPVA 3BR1A 2XPWA 5FLMJ 3GTGJ 5JLWA 3TP0A 3Q0UA 1CQTA 1NERA 4X1EA 2R5ZA 3JRAA 1U9OA 1O4XA 2PPXA 4A3MJ 2EZKA 3BQYA 1X2NA 3I4MJ 3S1NJ 4Y42A 4EEFG 2VUMJ 2LFBA 3IVPA 4B3AA 1QPZA 5F27A 3OQNA 1NK3P 2BNNA 4YG7B 3S2HJ 2EH3A 4JX5A 2GM4A 3I4NJ 4I6UA 3TRBA 2XGCA 4JP0A 4A3EJ 2JA7J 3BDNA 3HM5A 1MBEA 1UXCA 2JK3A 1JT0A 4C3HJ 1DU0A 3GTQJ 2R1JL 1B72B 4RDUA 1DW9A 3S1MJ 1R9TJ 2JN6A 4Z5HA 2EQRA 1JKQC 2ID3A 2O4AA 1U78A 3IV5A 2EZLA 2X6OA 4J19A 1QRYA 5DS9A 1VF9A 3HB9A 3CDLA 3OQOA 2PUAA 4D7MA 2XB5A 3ZQGA 3FK7A 4M3EA 4A3KJ 3IH4A 1NEQA 2MEZA 1QQAA 2LYJA 3F6WA 3ZHMA 3RKQA 3S2DJ 1IRZA 1JTXA 1XG1A 3U3WA 4M6VA 2HSGA 5K98B 2FJ1A 2HI3A 1DWKA 4M3BA 4X4IA 4J1WA 2R7ZJ 2O7OA 3NAUA 1R63A 1PRVA 2KEIA 3ZQFA 2WIUB 3OIOA 1ZZ8A 1HOMA 5IP9J 1BDIA 2WB1N 5C4XJ 1IDYA 1JUMA 1JT6A 4XIDA 3LFPA 3MN2A 4GHJA 2KZ8A 2DA5A 4YG1A 4JQDA 4S0HB 1K61A 1TC3C 1NK2P 1HDDC 5GPCA 1B8IB 3BTLA 3JXDL 4A3GJ 2EF8A 3G5GA 2DMTA 3BD1A 3ZOBA 2ECCA 5F0FA 3SJMA 3EUSA 1GV5A 3G7DA 3MKLA 2MGQA 3B6AA 2LYLA 4O8BA 2HXIA 1ZVVA 4I76A 2LR8A 4I6ZA 1RZSA 1I3QJ 2M2EA 3W6VA 4IVZA 2DA3A 1SANA 1B8IA 2KPJA 1HDPA 3A01B 3G1OA 4IHYA 1ETVA 5M3MJ 5M5YJ 3HOYJ 2ELKA 2P81A 1AKHB 2XI8A 2X48A 3LSGA 1XS9A 1MBGA 5J1RA 1Z0XA 1ZR4A 4B1RA 4A3DJ 3PO2J 3SCHA 3CQZJ 3LISA 1VPWA 1TWFJ 1U8BA 3A01A 2X9DA 1UTXA 3HKZN 1MNMC 3SDGA 1RZRD 3PM1A 2W48A 2DA6A 3TEDA 2MW8A 1LMB3 1RPEL 1LQCA 1I6HJ 2Y9ZA 1LCCA 5E3MA 1RIOA 4YBAA 2G0EA 3RQIA 2VPRA 5FLVA 1ZZ7A 2EZHA 2IV1A 3HGYA 3BQZA 1A6IA 3GTOJ 2LYRA 3FKIJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OQM A;  3E7L A;  1GUU A;  2FD5 A;  4IHV A;  4X4G A;  3QQ6 A;  4NDL A;  5K7Z A;  5EEA A;  5IP7 J;  3LSR A;  5C44 J;  2FQ4 A;  3GTK J;  2I10 A;  2ID6 A;  4C3I J;  3BG3 A;  2LD5 A;  1W0T A;  3GTM J;  2H1K A;  4Z59 A;  2GRL A;  4GFB A;  3ZQL A;  2Y31 A;  4BBS J;  1MBH A;  3TW6 A;  3S14 J;  3ZKC A;  2AXZ A;  2LCV A;  2R5Y B;  1VI0 A;  2WUS R;  2XSD C;  1TWC J;  2MG4 A;  3HGG A;  3ZQC A;  5M3F J;  2IAI A;  1OSL A;  3CEC A;  2EZI A;  4MO7 A;  1JUP A;  2NVX J;  1FTZ A;  1PUF B;  2PUG A;  2QCO A;  2O49 A;  2R5Y A;  2XGD A;  4GQM A;  2GRM A;  2AW6 A;  3HEF A;  1XC5 A;  3BTJ A;  2R92 J;  1K83 J;  1MH3 A;  4DZJ A;  1JUS A;  2XIU A;  1QPI A;  2NOG A;  2B5A A;  4XRM A;  3DEW A;  2E2J J;  1NTC A;  1IUF A;  2MQK A;  4X4H A;  4JCY A;  4AYB N;  3CRO L;  1ENH A;  1PUF A;  2JCG A;  3IH2 A;  4DYC A;  4DW6 A;  3ZHI A;  2OR1 L;  2HOA A;  2TCT A;  4JX4 A;  2HOT A;  3ZQH A;  5F0H A;  3JRI A;  3S1Q J;  5K7F A;  1ETQ A;  4W1U A;  1W0U A;  2D5V A;  1GVD A;  1TWA J;  4HNV A;  2ME0 A;  2JMW A;  5EDN A;  1ZQ3 P;  4PU8 A;  3SCF A;  4V2F A;  5FKM A;  5C3E J;  2E1O A;  1ZGW A;  4M3G A;  1DU6 A;  4FBI A;  3CMY A;  4BKX A;  3GTP J;  1BDH A;  4UUS B;  3RZZ A;  1FTT A;  2XCJ A;  2K9S A;  1WIZ A;  3O9X A;  4Z58 A;  1ETX A;  1RKT A;  2LVS A;  2ME6 A;  4JCX A;  1JWL A;  3O8H A;  4BY1 J;  3GBG A;  4MFD A;  4MLO A;  3BR6 A;  3IH3 A;  1FJL A;  3FYM A;  4YG4 A;  3Q0V A;  4UUS A;  3HOW J;  2K9Q A;  2AXV A;  1MBJ A;  3LSJ A;  1X2M A;  3K2A A;  3SCG A;  1UMQ A;  5M5X J;  2Y9Y A;  3BG5 A;  2KEK A;  1LFU P;  1WPK A;  2N8G A;  3BTC A;  1WH5 A;  1BJZ A;  1SFO J;  5EF6 A;  2R63 A;  5FKK A;  3ZQI A;  3H3V K;  4ABZ A;  3JRB A;  3BS3 A;  3H0G J;  1JKP C;  5IYD J;  2HIN A;  3CCY A;  4C3J J;  2CRO A;  4X4F A;  3A03 A;  3O8G A;  5E3N A;  2KT0 A;  3QWG A;  4I6R A;  2EBI A;  1T56 A;  5F04 A;  2E2I J;  2JVL A;  3WHB A;  4X6A J;  2OFY A;  1TWG J;  5J3L A;  4A3B J;  4FE7 A;  4XRS G;  2PUE A;  4FIS A;  1RET A;  3D1N I;  3S17 J;  1H89 C;  4L5E A;  2M34 A;  3JRE A;  2EBY A;  5DTD A;  4RBO A;  4IHW A;  2DA1 A;  4J1X A;  1IDZ A;  2RAE A;  4JYK A;  1P7I A;  1HF0 A;  5FJ8 J;  3JRC A;  1MSF C;  2JWT A;  4IWR A;  2BNO A;  1U9N A;  2VI6 A;  2IVQ A;  4A93 J;  1QP7 A;  4W97 A;  3FIW A;  4Y7N J;  1JJ6 C;  1QQB A;  1S7E A;  1UG2 A;  3JXB C;  1APL C;  4F8D A;  4NDW A;  1ZKG A;  2IUO A;  1RPW A;  5FKO A;  3UKG A;  2GLO A;  2O38 A;  2CU7 A;  3NAR A;  5IOY A;  3Q3S A;  2HQ5 A;  1ZZC A;  2HOS A;  1LE8 A;  2B63 J;  3FIS A;  4XIC A;  2PMZ N;  1Y1W J;  1X2L A;  5JLX A;  3KZ3 A;  1IC8 A;  1L1M A;  4BY7 J;  4MCX A;  1ETO A;  4XRS A;  2JA8 J;  3F51 A;  1PRU A;  4M3F A;  2K40 A;  1YSE A;  2XPU A;  4Y52 J;  1B0N A;  4PU3 C;  1G2H A;  3WHC A;  1ZUG A;  1ZZB A;  1TWH J;  2L0K A;  5M5W J;  4A69 C;  3LSP A;  2JA5 J;  4A3J J;  2BJC A;  1LFB A;  3G1L A;  1JFS A;  2R0Q C;  3B6C A;  3BT9 A;  4BBR J;  3RZO J;  2ICT A;  1RES A;  3OSF A;  1GDT A;  4D5C A;  1JJ8 C;  4G12 A;  1BL0 A;  3K7A J;  1YRN B;  3HOZ J;  2PE5 A;  1F43 A;  3C2B A;  3F52 A;  1ZS4 A;  4A3F J;  4XK4 A;  1EFA A;  2LKX A;  2VKE A;  1ETW A;  4MFE A;  4CYC A;  2XGE A;  2K9N A;  2AHQ A;  2L9R A;  2CUE A;  3MVP A;  2AWI A;  1PNR A;  4AUX A;  2PIJ A;  2COB A;  2LYS A;  1P7J A;  1YRN A;  2DMQ A;  4IEJ A;  1VND A;  3JRF A;  1ETY A;  2LLK A;  4DYQ A;  2KEJ A;  1ZZ9 A;  1Y1V J;  3QPS A;  3VPR A;  3JXC L;  2NS8 A;  1OJL A;  2LYP A;  1JH9 A;  5GPA A;  2Y0S N;  3BG9 A;  1Y7Y A;  2NS7 A;  2FX0 A;  2LYQ A;  4X4E A;  4BXX J;  3OOU A;  3Q0W A;  2CQX A;  4I8T A;  2XB0 X;  1OCP A;  2YU9 J;  1GV2 A;  4QTR A;  4PU4 C;  3VK0 A;  2L7F P;  2DMN A;  2E19 A;  1MBK A;  4DZP A;  1BW5 A;  3CLC A;  2CRG A;  2O9L A;  2IU7 A;  2JJ7 A;  3QF3 A;  5EGO B;  1A5J A;  1IG7 A;  1FEX A;  3HBL A;  1Z77 A;  1BW6 A;  2XRL A;  2VKV A;  1JKR C;  3S1R J;  1FIA A;  1HLV A;  2WV1 A;  1PRA A;  2IBD A;  3PO3 J;  3H5T A;  5EGO A;  2A6C A;  1VFC A;  1ZAY A;  5IOZ A;  1ITY A;  4OB4 A;  2DA7 A;  2DTZ A;  4A3C J;  2OF7 A;  2M9H A;  2CSF A;  2AO9 A;  1MSE C;  3A02 A;  5C4J J;  4QIW N;  1OFC X;  3PXP A;  4UUT A;  4AC0 A;  2EWT A;  1WET A;  1AU7 A;  1ZTR A;  1RR7 A;  2FJR A;  5A7L A;  2GBY A;  3TW7 A;  1JGG A;  2YS9 A;  4FE4 A;  5F1J A;  1X58 A;  2ZB9 A;  5E3O A;  1GT0 C;  1Y9Q A;  2NVT J;  1B72 A;  3LOC A;  2LTP A;  2MSY A;  3FK6 A;  1QVU A;  2IEK A;  1IGN A;  2NVQ J;  4Z5C A;  2M8G X;  5FKL A;  9ANT A;  1EF4 A;  3QPL A;  3S16 J;  2ICP A;  3TP3 A;  2L49 A;  3OMT A;  3GTJ J;  1H88 C;  1XWR A;  4X4B A;  1WI3 A;  3JRD A;  2WAQ N;  2DMP A;  2HYJ A;  3S15 J;  3FYA A;  1WCM J;  3S8Q A;  4DYR A;  2YUS A;  2DA2 A;  5K7H A;  1HCR A;  1UXD A;  1IV6 A;  1RZR A;  2PUB A;  3M3Y J;  2KDZ A;  2DMU A;  3BR0 A;  2Y30 A;  1SQ8 A;  2DN0 A;  1ZZ6 A;  2E2H J;  2CUF A;  3OSG A;  4D5F A;  5BNG A;  2R93 J;  4FN3 A;  3BR3 A;  2CJJ A;  4LOC A;  2JA6 J;  3SFI A;  2BNM A;  5IYB J;  5IPA A;  4MIM A;  3QQA A;  2IVG A;  4V2G A;  3BTI A;  1LE8 B;  4MCT A;  1ORK A;  4M3D A;  5HOD A;  3HDD A;  3M4O J;  2M0C A;  2IVB A;  2LK2 A;  4B4C A;  2AUW A;  4I6T A;  1E3O C;  3GN5 B;  3OP9 A;  3BR5 A;  1AHD P;  1ZK8 A;  3HOX J;  2Y2Z A;  5EZG A;  1FIP A;  1QVT A;  1MBF A;  5IYC J;  3JRH A;  1JTY A;  3KXA A;  4JX6 A;  4YAR A;  1CJG A;  1QP0 A;  3LNQ A;  4PU7 A;  2LY9 A;  3RZD J;  1Q1V A;  1WH8 A;  3UFD A;  5J1U A;  1UHS A;  1LCD A;  1R69 A;  3GN5 A;  3KJX A;  4D7N A;  5F08 A;  2AXU A;  3QYX A;  2OPT A;  5EG0 B;  5EZH A;  1H8A C;  5GP9 A;  3JRG A;  1OCT C;  4IHX A;  2ECB A;  2LYK A;  1QP4 A;  3GTL J;  1PER L;  5F0C A;  2DA4 A;  1JKO C;  3BR2 A;  3L1P A;  2GZU A;  5J1Y A;  1AKH A;  1ADR A;  5E3L A;  1ZPQ A;  4CYC B;  1ZR2 A;  1LLI A;  3FMY A;  4FCY A;  1WH7 A;  5EG0 A;  3F0C A;  1ETK A;  2LP0 A;  1WH6 A;  5IP6 A;  1I50 J;  1D5Y A;  4IA8 A;  3HOU J;  3G1M A;  3MLF A;  2L8N A;  2PUC A;  1T33 A;  5EYR A;  4X4D A;  4FTH A;  3DNV B;  2PUD A;  2NVY J;  1RKW A;  2DJN A;  5FKN A;  2QF7 A;  2O8K A;  2CQQ A;  1POU A;  1BA5 A;  1X57 A;  4X4C A;  1WGX A;  4C2M J;  1IJW C;  1MH4 A;  4Z5D A;  3HZI B;  2PUF A;  4QSH A;  4A3L J;  1POG A;  2L7M P;  3JR9 A;  2H8R A;  2XJ3 A;  2L7Z A;  3GBF A;  2R5Z B;  2HXO A;  3DCF A;  3HOV J;  2TRT A;  2HDD A;  1F36 A;  4A3I J;  3B7H A;  3R1F A;  1JFT A;  2XPV A;  3BR1 A;  2XPW A;  5FLM J;  3GTG J;  5JLW A;  3TP0 A;  3Q0U A;  1CQT A;  1NER A;  4X1E A;  2R5Z A;  3JRA A;  1U9O A;  1O4X A;  2PPX A;  4A3M J;  2EZK A;  3BQY A;  1X2N A;  3I4M J;  3S1N J;  4Y42 A;  4EEF G;  2VUM J;  2LFB A;  3IVP A;  4B3A A;  1QPZ A;  5F27 A;  3OQN A;  1NK3 P;  2BNN A;  4YG7 B;  3S2H J;  2EH3 A;  4JX5 A;  2GM4 A;  3I4N J;  4I6U A;  3TRB A;  2XGC A;  4JP0 A;  4A3E J;  2JA7 J;  3BDN A;  3HM5 A;  1MBE A;  1UXC A;  2JK3 A;  1JT0 A;  4C3H J;  1DU0 A;  3GTQ J;  2R1J L;  1B72 B;  4RDU A;  1DW9 A;  3S1M J;  1R9T J;  2JN6 A;  4Z5H A;  2EQR A;  1JKQ C;  2ID3 A;  2O4A A;  1U78 A;  3IV5 A;  2EZL A;  2X6O A;  4J19 A;  1QRY A;  5DS9 A;  1VF9 A;  3HB9 A;  3CDL A;  3OQO A;  2PUA A;  4D7M A;  2XB5 A;  3ZQG A;  3FK7 A;  4M3E A;  4A3K J;  3IH4 A;  1NEQ A;  2MEZ A;  1QQA A;  2LYJ A;  3F6W A;  3ZHM A;  3RKQ A;  3S2D J;  1IRZ A;  1JTX A;  1XG1 A;  3U3W A;  4M6V A;  2HSG A;  5K98 B;  2FJ1 A;  2HI3 A;  1DWK A;  4M3B A;  4X4I A;  4J1W A;  2R7Z J;  2O7O A;  3NAU A;  1R63 A;  1PRV A;  2KEI A;  3ZQF A;  2WIU B;  3OIO A;  1ZZ8 A;  1HOM A;  5IP9 J;  1BDI A;  2WB1 N;  5C4X J;  1IDY A;  1JUM A;  1JT6 A;  4XID A;  3LFP A;  3MN2 A;  4GHJ A;  2KZ8 A;  2DA5 A;  4YG1 A;  4JQD A;  4S0H B;  1K61 A;  1TC3 C;  1NK2 P;  1HDD C;  5GPC A;  1B8I B;  3BTL A;  3JXD L;  4A3G J;  2EF8 A;  3G5G A;  2DMT A;  3BD1 A;  3ZOB A;  2ECC A;  5F0F A;  3SJM A;  3EUS A;  1GV5 A;  3G7D A;  3MKL A;  2MGQ A;  3B6A A;  2LYL A;  4O8B A;  2HXI A;  1ZVV A;  4I76 A;  2LR8 A;  4I6Z A;  1RZS A;  1I3Q J;  2M2E A;  3W6V A;  4IVZ A;  2DA3 A;  1SAN A;  1B8I A;  2KPJ A;  1HDP A;  3A01 B;  3G1O A;  4IHY A;  1ETV A;  5M3M J;  5M5Y J;  3HOY J;  2ELK A;  2P81 A;  1AKH B;  2XI8 A;  2X48 A;  3LSG A;  1XS9 A;  1MBG A;  5J1R A;  1Z0X A;  1ZR4 A;  4B1R A;  4A3D J;  3PO2 J;  3SCH A;  3CQZ J;  3LIS A;  1VPW A;  1TWF J;  1U8B A;  3A01 A;  2X9D A;  1UTX A;  3HKZ N;  1MNM C;  3SDG A;  1RZR D;  3PM1 A;  2W48 A;  2DA6 A;  3TED A;  2MW8 A;  1LMB 3;  1RPE L;  1LQC A;  1I6H J;  2Y9Z A;  1LCC A;  5E3M A;  1RIO A;  4YBA A;  2G0E A;  3RQI A;  2VPR A;  5FLV A;  1ZZ7 A;  2EZH A;  2IV1 A;  3HGY A;  3BQZ A;  1A6I A;  3GTO J;  2LYR A;  3FKI J; 
#chains in the Genus database with same CATH topology
 1FSE A;  4YFX F;  5ILS A;  2GIV A;  3FBI B;  1BR1 A;  2KRF A;  2FD5 A;  4B43 A;  1R5H A;  3DKY A;  3G71 I;  3J7A Y;  4D9J A;  3FMR A;  4GYG A;  4XLF A;  3BG3 A;  2LD5 A;  3GTM J;  1YW9 A;  2GWR A;  1ACI A;  2DT6 A;  2H1K A;  1A31 A;  2FOW A;  5B5E C;  4GFB A;  3ZQL A;  3VWB A;  2Y31 A;  2OCE A;  4F55 A;  2PXF A;  4AIK A;  3VOD A;  3F8B A;  1EA3 A;  3CMA I;  3KYC B;  1XGO A;  2LCV A;  2HYF A;  2BW3 B;  4PJN A;  2R5Y B;  1N78 A;  2X51 A;  3WU0 A;  5L3B A;  2NNN A;  2HKO A;  3ZQC A;  2LY1 A;  3LQQ A;  3W2V A;  5AIQ A;  5M3F J;  2VN2 A;  2QKM B;  3HXL A;  3PFY A;  2NVX J;  5E1Z B;  1FTZ A;  3WTV C;  1Y8Q B;  4GQM A;  2GRM A;  3HEF A;  1SFU A;  1JUS A;  2XIU A;  3NWS A;  2E1N A;  4BH9 A;  1ZLK A;  3GUD A;  4F91 B;  3NRO A;  1NTC A;  5HOO A;  3CRO L;  3LQR A;  3GFL A;  1PUF A;  4KIF A;  3EUK L;  4DYC A;  3N4M A;  2EIN H;  3WGG A;  4M6Y A;  4JX4 A;  1BOA A;  2HOT A;  5F0H A;  1QZY A;  2XAH A;  1FOK A;  1W0U A;  2D5V A;  5KHD A;  3K6G A;  4HLY A;  2JMW A;  3S32 A;  5EDN A;  1ZQ3 P;  4V2F A;  1B59 A;  2DBB A;  2JPC A;  3CMY A;  3FX3 A;  4NC8 A;  4J01 A;  4PFO A;  3GTP J;  1RNL A;  4K2E A;  2KZV A;  1BJA A;  3QOP A;  4UHT A;  2MBF A;  2H1L A;  3O9X A;  5JVG F;  1N75 A;  2M30 A;  2DOA A;  4HA8 A;  1NH3 A;  3D5S C;  3EET A;  4UUS A;  3QOW A;  2ZXJ A;  1E3P A;  2K9Q A;  4M72 A;  3U1K A;  1ERD A;  1YE9 A;  2X6X A;  2G9W A;  2BGC A;  3I64 A;  4P55 A;  1WPK A;  5FFX A;  2N8G A;  3BTC A;  1SFO J;  2V6E A;  2M7B A;  3P9K A;  2QLZ A;  5J40 A;  4U0W A;  2LF7 A;  5LGU A;  3CCJ I;  4I99 C;  2OQG A;  4GGG A;  1O3Q A;  3LFU A;  2L5Q A;  3FMQ A;  5IYD J;  4AVZ A;  5FRN A;  3GF2 A;  2XXQ A;  2YBD A;  1HSJ A;  2XKO A;  1P92 A;  2DU9 A;  3KFW X;  3IKT A;  1R4M B;  1UAA A;  1BOB A;  2XV4 S;  4I6R A;  5F04 A;  5L3D A;  1O3T A;  3WHB A;  4NB5 A;  3LSI A;  2KRC A;  2R7O A;  4IHS A;  3BZK A;  4YFK F;  6PAX A;  5BS6 A;  3CCM I;  4BS9 A;  2W85 A;  4BEH B;  4L5E A;  4C2U A;  2COM A;  1Y8R B;  2EBY A;  3PUF A;  1V5G A;  1ZLJ A;  2HTJ A;  2PBI A;  5DD4 A;  1OYI A;  3O3K A;  2GXA A;  1IDZ A;  2FFH A;  4JYK A;  3JW4 A;  1JHF A;  2CFO A;  1UB9 A;  1MSF C;  2JWT A;  1ZRF A;  1BN5 A;  2VI6 A;  1XSX A;  1BR4 A;  4Y7N J;  2ELH A;  2Q8K A;  1SFK A;  3QOD A;  1JJ6 C;  2PJR B;  2FUG 2;  1QQB A;  2JA2 A;  3R0J A;  3I55 I;  3UNG C;  3JXB C;  1GXQ A;  1ZKG A;  2FA5 A;  1LKX A;  3A1Y A;  2O38 A;  5IOY A;  4PFP A;  2HQN A;  3EYI A;  2HQ5 A;  1ZZC A;  3V7R A;  4RGR A;  2B63 J;  3AG2 H;  4HX8 A;  1X2L A;  3ZQQ A;  1L1M A;  2K40 A;  2XPU A;  2YR2 A;  2X1C A;  4Y52 J;  1VQ4 I;  3E5X A;  4PU3 C;  3MEJ A;  1ZZB A;  4RGU A;  1TWH J;  1SVO A;  3LSP A;  2R7Q A;  1I1G A;  2K5C A;  1GLN A;  4UV8 A;  4YIF A;  1LFB A;  1B4A A;  2BJC A;  3QP6 A;  4IKF A;  5HS9 A;  4Q2J A;  4BBR J;  4M9Z A;  3ZMU A;  4G12 A;  4MTE A;  1JJ8 C;  2X6Y A;  2IPQ X;  2W1O A;  3F52 A;  2V9P A;  5EEH A;  1RIO H;  4A3F J;  1TNS A;  4XK4 A;  2ZNZ A;  4YIR X;  3GZD C;  1EFA A;  1BC8 C;  1JGS A;  1T38 A;  1B9M A;  4F7Z A;  2AWI A;  2ACJ A;  3OYA A;  5DTQ A;  2LLK A;  4XKV A;  3Q9V A;  1ZZ9 A;  4PJL A;  1Y1V J;  3QPS A;  3LMM A;  3CCS I;  3JXC L;  1OJL A;  5GPA A;  2Y0S N;  4NNJ A;  2NS7 A;  2LYQ A;  2WWY A;  2O0Y A;  5HVQ C;  2IT0 A;  3M07 A;  2VJJ A;  4XR6 A;  2FU4 A;  3AFH A;  4XSX F;  2QM3 A;  3J81 Z;  1DPU A;  1OCP A;  2YU9 J;  4ZH4 F;  4QTR A;  3VK0 A;  1HW5 A;  1FWZ A;  2E19 A;  1MBK A;  3HRM A;  2DAO A;  2O9L A;  1I5Z A;  4OWR B;  3VYR B;  5B1A H;  4PZJ A;  3CC4 I;  1A5J A;  1FEX A;  3S93 A;  3PL8 A;  1SMY F;  3HBL A;  1TP4 A;  4NHJ A;  5CLS A;  2XRL A;  3JTH A;  4PCQ A;  3S1R J;  1ODD A;  3I71 A;  1HLV A;  4CDG A;  1JKR C;  3KEY A;  4TV7 A;  3H5T A;  1JHH A;  3AAF A;  2R7S A;  2IS2 A;  3NDB B;  4M9S A;  4LIV A;  1KZH A;  2LNB A;  1ITY A;  2FBH A;  2P5K A;  2Q2E A;  5D8K B;  2ZFW A;  2CSF A;  5DYM A;  3VYS B;  4CCL A;  1X1P A;  1S9H A;  4KT5 C;  5D5U B;  3HKZ A;  1WET A;  2IS6 A;  3KIO A;  2FQ3 A;  2MXD A;  3PIP F;  1AU7 A;  4UY8 I;  1BIB A;  1F4K A;  2FJR A;  4MQ9 F;  5H2F C;  1X3U A;  2UZK A;  1E17 A;  2ZB9 A;  5H6Q A;  5D8L B;  1B72 A;  3VDX A;  1ZG3 A;  3LOC A;  2LTP A;  3FK6 A;  3GZC A;  2NVQ J;  1YQA A;  3HJE A;  4G9Y A;  4Z5C A;  3MCZ A;  5FKL A;  3VSL A;  1SMT A;  1EF4 A;  2VXZ A;  2BHY A;  3TP3 A;  4J00 A;  2F5C A;  3GTJ J;  1XWR A;  1G3T A;  1BBY A;  3RIR A;  3JRD A;  3JAM K;  2DMP A;  2HYJ A;  3DP7 A;  5JI6 A;  4F92 B;  2R7R A;  4DYR A;  1HCR A;  1OLT A;  4YG2 F;  4BE2 A;  4HF1 A;  4HNU A;  1U6G A;  2MD5 A;  3RJP A;  1VQO I;  1N25 A;  3WTX C;  1SD7 A;  3OSG A;  1B6A A;  2R93 J;  3A0H C;  2K85 A;  3MD2 A;  1T8I A;  2JA6 J;  2GA1 A;  5IYB J;  2RGV A;  3HHG A;  2PXQ A;  3BPX A;  4UNO A;  2LLW A;  1FP2 A;  1LE8 B;  2P5V A;  4M3D A;  4DBQ A;  5TJJ A;  2V9V A;  2F4I A;  1RC9 A;  1PJR A;  1PYV A;  2LK2 A;  2WAD A;  2AUW A;  1E3O C;  3GN5 B;  1WJD A;  3GFI A;  1XCV A;  3HOX J;  4U88 A;  4YII A;  2ZFU A;  3QU3 A;  5E8G A;  1MBF A;  1ZG5 A;  3WE2 A;  1JTY A;  2JQ7 A;  3RI4 A;  1PDN C;  3ZPL A;  4XSZ F;  4YAR A;  1QP0 A;  3HC7 A;  1J5Y A;  2KPM A;  2LY9 A;  3KYD B;  2Y69 H;  3H3Z A;  3OYB A;  5J1U A;  3A9Y A;  2AXU A;  2OPT A;  2XVC A;  3FWE A;  3MAJ A;  5D4S A;  3JRG A;  1X1C A;  2ECB A;  3U21 A;  3HTS B;  2CV1 A;  4KN7 X;  2B7E A;  4AM3 A;  2WY8 Q;  4EM2 A;  2CO5 A;  1AKH A;  4LG0 B;  5E3L A;  2MLG A;  3QYE A;  2CG4 A;  1ETK A;  5J8F A;  1U0J A;  2MC3 A;  3FXM A;  3ULQ B;  3HOU J;  1W7P B;  3U9G A;  2MH2 A;  1T33 A;  3S3N A;  4X4D A;  4OMY A;  1OIS A;  2PUD A;  2OAZ A;  2DJN A;  2PX9 A;  4RM2 A;  3OIP A;  1EH8 A;  4BU2 A;  4O5V A;  1Z9C A;  1X57 A;  4UXN A;  4C2M J;  5CYV A;  2CUJ A;  1ZYR F;  1S72 I;  3OYG A;  3CCE I;  1A6Q A;  4A0Z A;  4RB0 A;  4QSH A;  3LA3 A;  3JR9 A;  3HRU A;  2DFE A;  5J6X A;  3GBF A;  1KU2 A;  5BQT A;  3OYC A;  2EK5 A;  1F36 A;  4YEJ A;  4Y33 A;  3CCV I;  2XPW A;  4II2 A;  5JLW A;  3BZ6 A;  3O6B B;  3L2Q A;  3IHU A;  2ZBK A;  2IW5 A;  2BHZ A;  3MZH A;  3V7S A;  2EA4 A;  1U9O A;  2H27 A;  2BW3 A;  5CKT A;  5CVR A;  2PPX A;  2EV6 A;  2EZK A;  3BQY A;  3I4M J;  3S1N J;  2VUM J;  2OQR A;  1QPZ A;  4GO1 A;  4BXU A;  5HS8 A;  3H9Q A;  3A9X A;  4JX5 A;  2RNG A;  1DPR A;  4HNT A;  5DM6 F;  2YX7 A;  4I6U A;  3TRB A;  3OYH A;  3RKY A;  1W7P D;  4AU7 A;  2JA7 J;  3SFZ A;  1MBE A;  3VOE A;  1O3S A;  1NHA A;  3K2Z A;  3M1E A;  3V8J A;  2KIU A;  5K5Q A;  1MZB A;  2KIF A;  1YW7 A;  2JK3 A;  3G4S I;  3E3V A;  1JT0 A;  1VZ0 A;  2VQH A;  1DU0 A;  4ER3 A;  1DW9 A;  1P4W A;  4OMZ A;  5FFZ A;  4JQF A;  2BXZ A;  2ID3 A;  4HDV A;  1JE8 A;  1R36 A;  1FYM A;  4ENM A;  2X6O A;  2STW A;  4GYI A;  2YX4 A;  4BE1 A;  2XB5 A;  2FNA A;  1QZE A;  2D1H A;  3ERM A;  1QZX A;  3CP2 A;  2NXN B;  4BYY A;  3CDH A;  3OV8 A;  1JTX A;  1XG1 A;  3S2D J;  1UZC A;  1FYL A;  2PXE A;  3LWF A;  2BE5 F;  1M1E B;  1ZH5 A;  1OCZ H;  5BPD A;  1HA8 A;  2V6C A;  2A07 F;  3K4B A;  4YRV A;  5IT9 K;  2O7O A;  1WHU A;  1KA8 A;  3ZMZ A;  2KEI A;  3ZQF A;  3Q5F A;  3GEZ A;  1ZZ8 A;  3KP3 A;  1J0R A;  1BDI A;  2VE8 A;  5E8I A;  3NRV A;  2CV0 A;  3K4L A;  2VBW A;  3SR4 A;  2V4J C;  2J5P A;  4QWQ A;  4XID A;  2AXL A;  1SVM A;  3BLY A;  4KIC A;  2Z3Y A;  4XLP F;  4Y13 A;  2NVU B;  1NK2 P;  1HDD C;  3HIF A;  2VQC A;  5F0F A;  3RCO A;  1GV5 A;  3BJO A;  1EH6 A;  4R1H A;  2LYL A;  4O8B A;  2HXI A;  5JR3 A;  1MDM B;  4I76 A;  3J7Y J;  1I3Q J;  2KMU A;  2FF4 A;  4RGS A;  3QOX A;  4RM3 A;  2LMD A;  1SAN A;  2Y0S A;  2YSR A;  3G1O A;  2P81 A;  5LLQ A;  5FLX K;  1ZAO A;  2HEO A;  4I0A A;  4F93 B;  4IQ4 A;  1Z0X A;  3QP5 A;  5J1R A;  1ZR4 A;  4B1R A;  4B3X A;  1BM9 A;  2DDA A;  1EV7 A;  1HQ1 A;  4KNY A;  1FC3 A;  2M7A A;  2VBY A;  3GFM A;  3LIS A;  1WWX A;  2VT2 A;  3KP5 A;  2VC0 A;  4S04 A;  1I27 A;  2MW8 A;  2ZXW H;  1LMB 3;  3WTS C;  1XCB A;  2IGK A;  2HKX A;  3CTA A;  1A35 A;  1LCC A;  2V79 A;  2PXB A;  2KJB A;  1PP8 F;  3RQI A;  2V1N A;  3PQK A;  5BOX A;  5FLV A;  1KU7 A;  1ZZ7 A;  2STT A;  3E6B A;  3HGY A;  4Y17 A;  3GTO J;  2OTJ I;  3SZG A;  4FBI A;  1J9I A;  1W1W E;  5EEA A;  1Q1H A;  1VQL I;  1CF7 A;  5C44 J;  1QU3 A;  3IP4 B;  4DE8 A;  2ID6 A;  3ZP5 A;  1W0T A;  1OPC A;  4Z59 A;  4CCN A;  3K69 A;  2LKS A;  3PE5 A;  3I5U A;  3EYY A;  2NNY A;  1I1S A;  2DJI A;  3PSF A;  2EIK H;  5LFA A;  4HST A;  5A2Q Z;  4L9T A;  3KP4 A;  4ANJ A;  4IRG A;  2Z33 A;  2GIZ A;  2ZXI A;  3J7A O;  2RNJ A;  2D45 A;  4Z2Y A;  2P5L C;  1TWC J;  4X0G A;  2NS0 A;  5DD8 A;  1OCR H;  1YJN I;  4RLQ A;  3SQN A;  4HF0 A;  2IAI A;  5ERI A;  4ZTJ A;  1OSL A;  1XPX A;  2CQN A;  2VC1 A;  4NUB A;  2KIQ A;  2PUG A;  2FNP A;  1V5E A;  1XC5 A;  3BTJ A;  3TO6 A;  2R92 J;  2HVS A;  3DQV C;  4DZJ A;  1YFH A;  2HTS A;  2VL8 A;  2Z9O A;  3I0T A;  1QPI A;  3FMS A;  2E2J J;  2ZKZ A;  2CS3 A;  4JCY A;  2HZT A;  3PFI A;  4EGY A;  1YJ9 I;  2JCG A;  4OAZ A;  5FGM A;  1BIA A;  1P4X A;  2KL4 A;  1R1T A;  4RB2 C;  2PXL A;  3EUH C;  3ZQH A;  5K7F A;  1ETQ A;  1XSV A;  4CCO A;  4HSR A;  1TWA J;  2GXG A;  4HLX A;  4ZYE A;  3SCF A;  4A0Y A;  5C3E J;  2BOL A;  1O3R A;  2E1O A;  4G6D A;  4HQM A;  3TMO A;  4RMN A;  2KZG A;  4OIN F;  1LB2 A;  2H94 A;  1BDH A;  3OKZ A;  3FXK A;  2IA1 A;  4XOT A;  3E1S A;  1Z21 A;  1ETX A;  4KA4 A;  3E97 A;  4JCX A;  1JWL A;  3O8H A;  2JVH A;  1FX7 A;  2OA4 A;  3GBG A;  4YG4 A;  4G7Z F;  2PXP A;  3FDY A;  3K1P A;  3WU2 C;  4E7I A;  2NYX A;  4D1Q A;  2PFB A;  1PUE E;  1VQ6 I;  1FY7 A;  1MBJ A;  3LSK A;  1X2M A;  2VB6 A;  4QPO A;  1R5G A;  3BG5 A;  4OOI A;  2XF5 A;  1BJZ A;  2R63 A;  5FKK A;  4ZDP A;  3E5Q A;  1LJ9 A;  3H3V K;  3ASN H;  3OMY A;  3JRB A;  1K4S A;  3BS3 A;  3OL4 A;  1Z91 A;  3CUO A;  3CCY A;  3BRO A;  4X4F A;  3A03 A;  4CZC A;  1R6R A;  2LYC A;  1Z7U A;  2DOD A;  1MIJ A;  3KCC A;  2JVL A;  4X6A J;  3V8K A;  3K4K A;  4E7K A;  2E34 A;  5J3L A;  1LQ1 A;  1HBX G;  4FE7 A;  2IA0 A;  2F6C A;  3QAH A;  2JTV A;  3ECH A;  4FIS A;  1RET A;  2M4K A;  4EJW A;  3S17 J;  3ML6 A;  3JRE A;  1R49 A;  4J1X A;  4RBO A;  1BI0 A;  2FMY A;  2RAE A;  1I6X A;  1P7I A;  4PDK A;  3JRC A;  2K3F A;  3L00 A;  5B66 C;  3AG1 H;  2IVQ A;  3FIW A;  2RVC A;  3ZRG A;  4BDY A;  1S8N A;  2EFO A;  4HBL A;  1IN5 A;  2ZME B;  1S7E A;  1APL C;  4F8D A;  1W5S A;  2W25 A;  1YIT I;  2IUO A;  5FKO A;  2GOX B;  1YG2 A;  1RI7 A;  3BJ6 A;  3MZ8 A;  2HOS A;  2IS4 A;  1LE8 A;  4XIC A;  1Y1W J;  4ITV A;  3CF2 A;  5JLX A;  3D0S A;  1YHQ I;  1IC8 A;  3ABL H;  1WJF A;  1ETO A;  4E7S A;  2JA8 J;  1HXD A;  4IX7 A;  3SEZ A;  4B47 A;  3HRT A;  2GAU A;  3F8N A;  2L9V A;  2ZSI B;  2EA2 A;  1G2H A;  4GDF A;  4RAF A;  1SVL A;  2VKD A;  3WHC A;  1ZUG A;  4RGX A;  1VQ8 I;  2E36 A;  2ZC2 A;  5GTH C;  2JA5 J;  3VSK A;  4BXF A;  5BMZ A;  2R0Q C;  2ICT A;  4A0X A;  4D5C A;  2VJ5 A;  3KZY A;  2O03 A;  4EKI A;  3JTG A;  3OYL A;  3C2B A;  1TQM A;  4XLE A;  3WU1 B;  2V3C C;  5DUK A;  2EV5 A;  2V1X A;  3AKZ A;  1SD6 A;  5CVU A;  1PP7 U;  2K9N A;  2AHQ A;  3MVP A;  4KMU X;  4DQ2 A;  5H6R A;  4U0Y A;  3A9Z A;  4GRI A;  1PNR A;  2WTE A;  3H5A A;  1P7J A;  1YRN A;  2DMQ A;  2XF6 A;  3JRF A;  1VQK I;  1W7P A;  4IRH A;  4HOB A;  2R7U A;  2X6W A;  1TNT A;  3I4P A;  1JH9 A;  3A2K A;  5HLT A;  1Y7Y A;  2FX0 A;  4IZZ A;  2DXI A;  4KFC A;  2WBM A;  4ENJ A;  1TQI A;  3CC7 I;  3HSE A;  5TRD A;  5D6F A;  4PU4 C;  1TQP A;  5D5X B;  4HRI A;  4DZP A;  4WX9 A;  1BW5 A;  1QZZ A;  1FNN A;  4Y4R A;  3FXJ A;  4ZYH A;  3GX4 X;  3QF3 A;  5EGO B;  1MMD A;  4BHB A;  3W3C A;  1BW6 A;  5LGT A;  4KIG A;  3HPH A;  2VKV A;  1IV8 A;  1FIA A;  1PRA A;  2LG4 A;  1WVR A;  3MEX A;  1DUL A;  3KX2 A;  4O6J A;  4AIJ A;  4G94 A;  3T5X A;  2DA7 A;  2DTZ A;  1WJ5 A;  2DK8 A;  5K5R A;  3A02 A;  5C4J J;  5CPR B;  2QYO A;  4XLA A;  1W5T A;  4AC0 A;  3GLL A;  2EWT A;  3WGH A;  2ODR D;  1SEU A;  2VIX A;  1MMS A;  1RR7 A;  1P4A A;  3ESW B;  5KVR A;  2ZJQ F;  1VQ9 I;  1JGG A;  2YS9 A;  3NEU A;  3X2Q H;  2VXD A;  5F1J A;  1Y9Q A;  4WXC A;  1LEB A;  2IXS A;  2NVT J;  1IGN A;  3NWT A;  4E7L A;  9ANT A;  3S8P A;  2BY3 A;  4KIB A;  1AOY A;  2JUC A;  1HQC A;  3E6D A;  2WV0 A;  1IUY A;  3I9V 2;  3RKW A;  3TQN A;  2CYY A;  1IXC A;  4BAY A;  3S8Q A;  5K7H A;  1K78 B;  1IF1 A;  3LAP A;  2DMU A;  2CMP A;  3BR0 A;  3D5R C;  2K27 A;  2XC7 A;  1ZZ6 A;  3WTY C;  4HV5 A;  4U7B A;  3ZR8 X;  2BBY A;  5DTR A;  1YS7 A;  3ABM H;  2EFN A;  1Z6R A;  3HTU A;  5IPA A;  2KKO A;  4MIM A;  3QQA A;  3J80 Z;  2IVG A;  1NW3 A;  1ORK A;  1J2X A;  3ASO H;  1ZRC A;  3ZMT A;  4WVL A;  2L02 A;  3GZN B;  3ZMD A;  3OYF A;  3P5J A;  4FT8 A;  1AHD P;  5GAD J;  1IXS B;  3SXY A;  3TGN A;  1CJG A;  4JX6 A;  2QQ9 A;  3CUQ B;  4XMY A;  3LNQ A;  1Q1V A;  3KYL A;  1WH8 A;  2BYV E;  3KJX A;  3CCU I;  1R58 A;  4BQA A;  2J7W A;  5EG0 B;  3DBL B;  1OCT C;  4IHX A;  2IS1 A;  4ER6 A;  1LUJ B;  3V7C A;  1PER L;  3LAJ A;  3BR2 A;  3GZD A;  5H20 A;  2OUM A;  4FCY A;  2ZO4 A;  4KJZ A;  2IJL A;  2XAU A;  2LP0 A;  2HNH A;  2DLL A;  3TL4 X;  3W2A A;  1O7L A;  4U87 A;  1D5Y A;  3GFJ A;  5ILV A;  1I39 A;  4FET A;  2XF7 A;  3PNV A;  1G4D A;  1UEL B;  4I2O A;  5LRS A;  4L9J A;  1U5T B;  2CQQ A;  2EPF A;  3BP8 A;  1G3W A;  3MZY A;  4HYE A;  3GWZ A;  1WGX A;  2JQE A;  5KAI C;  1T6S A;  3NXH A;  1MH4 A;  2X0L A;  4P5O A;  4Z5D A;  3HZI B;  1X1A A;  3FKJ A;  4XN0 A;  2IRF G;  2QWW A;  4HPQ A;  3SZT A;  5F1R A;  2XKP A;  3CJR B;  4A3L J;  1P6R A;  2XJ3 A;  2L7Z A;  1R5I D;  1MJ9 A;  1MKM A;  4ZC3 A;  3R1F A;  3TDU C;  2QVO A;  1XDU A;  1D1B A;  2XPV A;  1ZG1 A;  3BR1 A;  3GTG J;  2MH9 A;  1FOW A;  1BC7 C;  3TP0 A;  3Q0U A;  1GXP A;  1MMG A;  4X1E A;  3JSP A;  2R5Z A;  2DTR A;  3RDI A;  2FXA A;  2MAB A;  4G8X A;  4XL9 A;  4KDP A;  3KPH A;  1E2X A;  2WAQ A;  4Y42 A;  4EEF G;  1R7J A;  4B3A A;  1V54 H;  3OQN A;  4ZDO A;  4WF2 A;  3I59 B;  1HW2 A;  2BNN A;  3L2U A;  3QYB A;  3UWP A;  4BJT A;  1BR2 A;  2GM4 A;  3I4N J;  1FZP B;  2QQ8 A;  4A3E J;  1DUX C;  3BDN A;  3HM5 A;  4HZF A;  3OR1 C;  3HUG B;  3OYN A;  5E20 A;  2L54 A;  3DLA A;  3PQJ A;  2LH9 A;  2MLK A;  1D0Y A;  2GA2 A;  2JN6 A;  2E5Z A;  3QWL A;  2EQR A;  4H4K C;  3F6O A;  4NQW B;  2PI0 A;  2O4A A;  2JZY A;  1U78 A;  2M4G A;  3GYH X;  4HV6 A;  3W2W A;  5LEK A;  4J19 A;  2R7X A;  4LGW A;  3AG3 H;  4D7M A;  3ZQG A;  4WK8 F;  4A3K J;  3IH4 A;  4M9X A;  3T8T A;  1NEQ A;  1MGT A;  5K5O A;  2MEZ A;  3KL4 A;  5ICG A;  3IRR A;  2LYJ A;  1IRZ A;  2KIS A;  3WE3 A;  4BHP A;  1BI2 A;  4M6V A;  4G6T B;  1YTY A;  1FMW A;  1HKQ A;  5K98 B;  2HI3 A;  3AL0 B;  4BE0 A;  4RB3 C;  3J7Z I;  1DWK A;  4J1W A;  2P7V B;  2R7Z J;  3CP8 A;  2ICW G;  3DU5 A;  3FHN A;  2DPD A;  1XMA A;  1OQY A;  5J4Y A;  4MEY F;  5F64 A;  4C2T A;  4A5N A;  1SAU A;  1SD5 A;  2Z99 A;  3N05 A;  2OJE D;  4PGH A;  5C4X J;  4PUS A;  2LNM A;  2JSP A;  1JT6 A;  4IL6 C;  5D4R A;  3MN2 A;  4JQD A;  1TC3 C;  1EKE A;  4IF4 A;  2HCN A;  3BTL A;  3JXD L;  3S3M A;  4EV0 A;  3G5G A;  5J8C A;  3SJM A;  1S6L A;  2VOO A;  5FRM A;  3CF5 F;  2V26 A;  2XAG A;  3B6A A;  3OYE A;  1ZVV A;  5D5W B;  3BY6 A;  3W6V A;  2HOE A;  3ZN0 A;  1B8I A;  2KPJ A;  3K70 D;  1LDK B;  4A12 A;  3A01 B;  3KZI C;  3T0Y A;  4IHY A;  5M3M J;  3C3W A;  3F8C A;  3OS0 A;  2E60 A;  2XI8 A;  2X48 A;  3LSG A;  1S29 A;  1MBG A;  3P9C A;  3CJT B;  3U1D A;  4A3D J;  1Y0U A;  3DTI A;  1C0W A;  3CQZ J;  3PO2 J;  3SCH A;  1TWF J;  1U8B A;  3TEL A;  4ESF A;  2X9D A;  4A6D A;  1UTX A;  1MFQ C;  3V8L A;  3TO9 A;  5DCF A;  3F6V A;  3HYI A;  3I58 A;  3SDG A;  3PM1 A;  1XGS A;  2W48 A;  3CO6 C;  1MNM C;  2R7V A;  1RZR D;  1RPE L;  2L1P A;  2BY0 A;  1RIO A;  3GO5 A;  4YBA A;  1YJW I;  3FXR A;  2QBY A;  2A69 F;  3E0J B;  2FBK A;  2G0E A;  4BL0 B;  4EJU A;  3OOP A;  3L2C A;  3G6E I;  1YIO A;  3H5N A;  2VPR A;  5E1W A;  3KP6 A;  2EZH A;  4ENN A;  2HVR A;  2M8E A;  4HG2 A;  2IV1 A;  4RA2 A;  3VYT B;  2LYR A;  4XLC A;  2BZT A;  5AON A;  2IGO A;  4IHV A;  2G7U A;  3QQ6 A;  4NDL A;  1RUN A;  4YEL A;  5IP7 J;  3LSR A;  4XLH A;  3GTK J;  2I10 A;  4C3I J;  2TDX A;  3R60 A;  2KP6 A;  1FOX A;  5DRT A;  2ZME C;  1MBH A;  1YLF A;  3ELK A;  2IP2 A;  3SDB A;  3TW6 A;  2AQF A;  2OD5 A;  3S14 J;  1U2Z A;  5LHI A;  4ENK A;  3NZL A;  1G3S A;  2Z16 A;  2UXX A;  2WUS R;  2IGM A;  2K86 A;  3QPT A;  3HPG A;  1YX5 A;  2MG4 A;  3HGG A;  3BZC A;  4RB1 A;  3A0B C;  3RPU D;  2KDO A;  1S5L C;  2Z2S B;  1WRJ A;  1YOV B;  3CEC A;  1LDD A;  1SFX A;  3LSH A;  3H92 A;  4IVN A;  4E7H A;  3VYU B;  1PUF B;  2O49 A;  2R5Y A;  2XGD A;  3FM5 A;  2AW6 A;  2LF8 A;  2PEX A;  1TTY A;  3MMY B;  4MNU A;  1MH3 A;  2EFP A;  1ZRD A;  1YYV A;  2DYR H;  2NOG A;  4IQJ A;  2DQL A;  1IUF A;  4A2U A;  4AYB N;  1FMV A;  3DBR B;  4XQF A;  3IH2 A;  2H6C A;  3G3Z A;  3ZHI A;  2OR1 L;  2HOA A;  2ISZ A;  2H6B A;  3F72 A;  4LIT A;  5FRO A;  3S1Q J;  2EIM H;  2AS5 F;  3GUU A;  4W1U A;  4UVA A;  2QGU A;  4H0E A;  3DXJ F;  1GVD A;  5DV5 A;  4HNV A;  3DM5 A;  2ME0 A;  1B1B A;  3EPZ A;  3QPH A;  3HRS A;  3OWQ A;  5HNH A;  4PU8 A;  5FKM A;  1ZGW A;  2ELJ A;  4M3G A;  3WTZ A;  2ZJR F;  1QO0 D;  3L7W A;  4Y15 A;  3TDZ C;  4UUS B;  2V1U A;  2NOJ B;  1Z67 A;  4II3 A;  3E6C C;  1FTT A;  2XCJ A;  2LSO A;  2QQB A;  3CZ6 A;  2K9S A;  3RPQ A;  4B48 A;  1RKT A;  2LVS A;  3KEQ A;  2E1M B;  4IXA A;  2UUZ A;  3BR6 A;  3IH3 A;  1IAW A;  1FJL A;  4BNC A;  3Q0V A;  3FYM A;  1ZGJ A;  3ERE D;  5ICC A;  1MW7 A;  2M3A A;  2QZ8 A;  2E1C A;  5GTI C;  2W4S A;  1UMQ A;  5M5X J;  4XN3 A;  2DPU A;  3DF8 A;  2Y9Y A;  2L4A A;  1WH5 A;  1ULY A;  2QSF X;  3R09 A;  2I5U A;  3IAM 2;  2D2W A;  2Z1D A;  1UG0 A;  2DFF A;  5JVT A;  1TT5 B;  2OV7 A;  4ABZ A;  3H0G J;  1JKP C;  2HIN A;  4M73 A;  4C3J J;  1X3Z B;  1J75 A;  2CGP A;  2X85 A;  3O8G A;  4LJZ F;  5E3N A;  2HGC A;  5DTM A;  1Z3X A;  4R8H A;  2P0W A;  1MMN A;  1T56 A;  2HFZ A;  2CW8 A;  3GVA A;  4XBF A;  1KYZ A;  1TWG J;  2YPR A;  2OFY A;  4OAY A;  2Y0M A;  4XRS G;  5CVI A;  4D0P A;  3J81 K;  1U2W A;  3D1N I;  2PXK A;  1H89 C;  4DOZ A;  4Q4Z F;  2DT7 B;  4HX4 A;  5DTD A;  4IHW A;  2DA1 A;  4XOR A;  2KJC A;  3KE2 A;  2ZNY A;  1IRX A;  1KON A;  1A36 A;  1LDJ A;  5TIS C;  4N0B A;  4I09 A;  1HF0 A;  5FJ8 J;  3WG7 H;  2XUB A;  1K78 A;  2BNO A;  1U9N A;  2R7W A;  4BEH A;  4A93 J;  1QP7 A;  4W97 A;  3K4C A;  3PNT A;  1AWC A;  4IOC F;  2ZSH B;  1UG2 A;  2PG4 A;  3R6S A;  4NDW A;  1V55 H;  2OBP A;  4CCM A;  2GLO A;  3UKG A;  3QYF A;  2CU7 A;  4GCV A;  5EJC A;  2ETH A;  3I56 I;  3C18 A;  2Y48 A;  3CME I;  1TW2 A;  2PJR A;  1SFE A;  4MCX A;  1O7F A;  4XRS A;  3F51 A;  4IPA A;  4QLC U;  4EGZ A;  1KQ9 A;  1YSE A;  1GHC A;  3ZGK A;  4XRF A;  2O6G E;  3CUQ A;  1WQ2 A;  3KET A;  4OIO F;  5CVV A;  4A69 C;  2XAS A;  1HW1 A;  4ZDL A;  5KK1 A;  3G1L A;  1VQN I;  1HKS A;  2EB7 A;  3B6C A;  1RES A;  3HOZ J;  1P2F A;  1BL0 A;  2F48 A;  5IY5 H;  1F43 A;  4ON0 A;  5IT3 A;  3CUQ C;  1RZ4 A;  2LKX A;  2VKE A;  1KYW A;  3M9L A;  1IO2 A;  1WJE A;  2XGE A;  2L9R A;  4N4O B;  4KT6 A;  5HDG A;  4AUX A;  2PIJ A;  1VND A;  1HC8 A;  2A6E F;  2JSC A;  2KEJ A;  2JUG A;  2R7T A;  3BJA A;  3VPR A;  4UB6 C;  1T0F A;  1E3H A;  3EUH A;  3CES A;  3DPU A;  3H35 A;  3ABT A;  1U3E M;  4X4E A;  4BXX J;  1FSH A;  4AD9 A;  4ZYG A;  2D1V A;  3OOU A;  4UUV A;  3EUA A;  4G7H F;  3K0L A;  2R4G A;  4N9H A;  3DBH B;  1FP1 D;  1GV2 A;  2VKH A;  3SEQ A;  2XRN A;  2L7F P;  3CLQ A;  2DMN A;  1T0F C;  1X4P A;  5ICF A;  1BI1 A;  2CRG A;  2JRM A;  5E79 C;  4WWC A;  3CLC A;  2JJ7 A;  1UST A;  2J5O A;  3S2W A;  1U5T C;  1IG7 A;  4FHT A;  2RV8 A;  4CA0 A;  2W7N A;  1Z77 A;  2EIJ H;  3FXQ A;  1XMK A;  1R1V A;  2L9S A;  4NC6 A;  4BJ6 C;  2HR3 A;  3PO3 J;  3IWF A;  3M1C A;  4ZYA A;  3SHF A;  3MKZ A;  1ZAY A;  4A3C J;  2M9H A;  3V4G A;  4DBR A;  2W84 A;  1DDN A;  1D8K A;  3PXP A;  1A04 A;  4ZZD A;  1N77 A;  2XSJ C;  1L3L A;  1S7A A;  2OZU A;  1K4T A;  4B09 A;  2CQ7 A;  2W24 A;  4C30 A;  4LD5 A;  3CMM A;  3TW7 A;  4FE4 A;  3HUG A;  2HYG D;  5E3O A;  3WGI A;  4Y3O A;  1R4N B;  3QRF F;  2MSY A;  4NQW A;  2IEK A;  2XXA A;  1WKM A;  5E18 F;  2M8G X;  3MFK A;  4OIP F;  4L0Z B;  2O3F A;  2P6T A;  3S16 J;  4ZTF A;  1W36 D;  1QHH D;  3OR2 C;  1VQ5 I;  4Q5S F;  3DKW A;  5E17 F;  5ICE A;  3FHZ A;  1ZHF A;  2B9S A;  2WAQ N;  1XSD A;  3HSF A;  3IKV A;  3K70 C;  2F5V A;  3CCL I;  2MFZ A;  4I01 A;  1RZR A;  3SX0 A;  2YUS A;  2DA2 A;  1UXD A;  1IV6 A;  3M3Y J;  3ZMS A;  2MD0 A;  4KIT B;  2LRE A;  2R7F A;  4XKB A;  5DEQ A;  1BI3 A;  2DN0 A;  4M71 A;  1XMX A;  4CSW A;  3G73 A;  2E2H J;  4DE9 A;  3GZ5 A;  1G8X A;  2CUF A;  4IRI A;  4FN3 A;  2CJJ A;  4LOC A;  4JBA A;  2ZJ2 A;  2BNM A;  1Z7L A;  1LNW A;  2FEZ A;  3AL0 C;  4KYW A;  3GZ6 A;  1LPQ A;  2IVB A;  4NC7 A;  4B4C A;  3F8M A;  2HCS A;  1LVA A;  3BR5 A;  3P7N A;  3TKY A;  1ZK8 A;  2Y2Z A;  5EZG A;  1FIP A;  1QVT A;  1X4O A;  2KIM A;  5JHU A;  3JRH A;  3MKY B;  1RRJ A;  3KXA A;  1D1A A;  5TGT A;  2M1B A;  4O3M A;  4PU7 A;  4AYB A;  2A5W A;  3ZXS A;  3GN5 A;  1MND A;  5F08 A;  3QYX A;  1S7O A;  5EZH A;  1LEA A;  5GP9 A;  5LEJ A;  1H8A C;  1QP4 A;  2GZW A;  4L9N A;  3WOD F;  4E4H A;  2LYK A;  5F0C A;  2DA4 A;  1JKO C;  4LIU A;  5KNL A;  2VOD A;  3GCM A;  2XAQ A;  5DRY A;  2DK5 A;  1ADR A;  3RPU A;  3GLX A;  3H5R A;  1G59 A;  1ZPQ A;  4CYC B;  1QBJ A;  3ZQ7 A;  3FMY A;  2CSO A;  4BHC A;  1FLI A;  1YO5 C;  1T08 B;  4E7J A;  5IP6 A;  4HF2 A;  1WH6 A;  1IN4 A;  1I50 J;  4I02 A;  3SZP A;  4IA8 A;  4CCK A;  3MLF A;  3H0D A;  2RN7 A;  4UVC A;  5F6F A;  2RQP A;  4LG0 A;  4FTH A;  3PJR A;  4GXO A;  3C2G A;  2GXB A;  1W5C C;  2EJR A;  5FO5 A;  2VJ4 A;  2O8K A;  4ZJZ A;  1POU A;  2EWN A;  1BA5 A;  3H1C A;  2M5W A;  1KGS A;  1GVJ A;  4FAS D;  3OYM A;  1IJW C;  5E1X A;  5L3E A;  2PUF A;  1IZ1 A;  1TT0 A;  4EVI A;  1POG A;  2E35 A;  2L7M P;  3KLN A;  2DOE A;  5ED4 A;  3DCF A;  3JAM Z;  2VEO A;  1D1C A;  2TRT A;  4A3I J;  3B7H A;  4BQN A;  1JFT A;  3GXO A;  4EJO A;  4AVP A;  5GAG J;  3DEE A;  1IRF A;  3IC7 A;  2P8T A;  4DIQ A;  4CUG A;  1U8R A;  5DT2 A;  3R0A A;  3COA C;  4E6K G;  3JRA A;  4QPQ A;  3FXL A;  4L5J A;  1O4X A;  4CH7 A;  2HDC A;  2JPB A;  2WAF A;  2ZXH A;  1USS A;  4S05 A;  3ME5 A;  1X2N A;  4XON A;  5HNF A;  2LFB A;  2PN6 A;  3BOQ A;  2MA3 A;  3BDD A;  1X19 A;  5F27 A;  2ESH A;  1SC7 A;  1NK3 P;  4YG7 B;  3ZPX A;  1T2K A;  2K4B A;  2XAF A;  5DDG A;  1EJ9 A;  2DOF A;  5D6E A;  1E0E A;  2K9L A;  1UXC A;  4I98 B;  3TEP A;  2X1D A;  4L9V A;  5B3S H;  2R1J L;  3GTQ J;  4EKG A;  3DTK A;  4RDU A;  4FX4 A;  4LMY A;  4Z5H A;  1QA6 A;  3IRQ A;  3S3O A;  1JKQ C;  2GQQ A;  3V42 A;  3I54 A;  4LLG F;  1UHM A;  3IV5 A;  2EZL A;  3KP7 A;  1WJB A;  1QRY A;  2F5D A;  5DS9 A;  3CDL A;  3ONQ A;  3OQO A;  2PUA A;  1WSU A;  4M3E A;  1ZGA A;  2FSW A;  4XLN F;  2P6S A;  1QQA A;  2HWV A;  3ZHM A;  1X3W B;  3RKQ A;  5LD2 C;  1TL8 A;  2ZCW A;  1F1Z A;  4DJA A;  1Z1D A;  2FJ1 A;  5LRR A;  2K9M A;  2L01 A;  4CIC A;  3OWT A;  3DPL C;  2V9K A;  4M3B A;  5CQG A;  3TO7 A;  1ZN2 A;  3BPV A;  2XDV A;  3WTU C;  2ESN A;  3FM3 A;  2F5F A;  3BC8 A;  5A2Q K;  2EV0 A;  3CD6 I;  2WIU B;  1QQI A;  2LKP A;  3OIO A;  4OU0 A;  1HOM A;  5IP9 J;  3OS1 A;  4LLL A;  3OY9 A;  2JVG A;  2WAE A;  1JUM A;  3Q9S A;  3JSO A;  3W6J B;  2J7U A;  2DA5 A;  4S0H B;  1K61 A;  4DGW B;  5GPC A;  4EM0 B;  2E1M C;  3H9G A;  2EF8 A;  3BD1 A;  2VQG A;  3ZOB A;  2ECC A;  2K02 A;  2L2O A;  4UB8 C;  3G7D A;  3MKL A;  1XX5 A;  2MGQ A;  1D8J A;  1JXS A;  1XGN A;  4I6Z A;  3K10 A;  1IW7 F;  1RZS A;  5HDK A;  2P4W A;  2LLV A;  2M2E A;  1KU3 A;  4IVZ A;  3A4C A;  2DA3 A;  4EJV A;  3CO7 C;  3RTR A;  1XTA A;  1HDP A;  4L5I A;  1LFP A;  1ETV A;  5K1Y A;  3HOY J;  2PQ8 A;  1MDM A;  2ZJP F;  1XS9 A;  1P9Q C;  4LFU A;  4KMF A;  4OIQ F;  1MJB A;  4PSX A;  5LBQ A;  5JHF A;  2PXV A;  4Q48 A;  5L3C A;  3TED A;  1Y6I A;  4LLN A;  2DDB A;  1LQC A;  1I6H J;  1STZ A;  2Y9Z A;  4I7H A;  5E3M A;  3NQO A;  2DQR A;  1HST A;  2OC6 A;  2HS5 A;  1Y39 A;  1CF7 B;  3RSN A;  1Z05 A;  3UR3 C;  1I3A A;  5EEG A;  3FKI J;  2RC4 A;  1TZL A;  4MEX F;  3FF5 A;  3E7L A;  3OQM A;  1GUU A;  3TBI A;  4X4G A;  3OIQ A;  5K7Z A;  2XRO A;  1K6O A;  4BDZ A;  3LL7 A;  2FQ4 A;  3QU6 A;  4E7Z A;  1O57 A;  1R00 A;  4LK1 F;  3VEP A;  4XKC A;  3DV8 A;  2K4J A;  1IN6 A;  1K6Y A;  1DP3 A;  2E7W A;  4B44 A;  2GRL A;  4BBS J;  3HOT A;  1YI2 I;  4N4N B;  3EDP A;  5IT9 Z;  3B02 A;  2DFI A;  2FOK A;  3HOS A;  3ZKC A;  2AXZ A;  4CYD A;  2Z5U A;  2DI3 A;  3DKX A;  2LDU A;  2JT1 A;  1VI0 A;  1YS6 A;  2XSD C;  1QGP A;  2HFH A;  1VQ7 I;  5DSX A;  2ADU A;  4DNC A;  2EZI A;  4MO7 A;  2W57 A;  3H36 A;  1JUP A;  2QCO A;  4EK9 A;  1K83 J;  1OYW A;  2HPM A;  1W4M A;  4LG3 A;  2XAJ A;  3DFG A;  2B5A A;  4XRM A;  3DEW A;  3PNY A;  2MQK A;  1FBU A;  3KP2 A;  4ESB A;  2WB1 A;  4X4H A;  1XB4 A;  5HDN A;  1ENH A;  2BY2 A;  3OL3 A;  2A3S A;  2LBF B;  2ISY A;  1K79 A;  2Q1Z B;  3REO A;  3WG9 A;  1ONV A;  4DW6 A;  3HL2 A;  2R7D A;  2P7C B;  2TCT A;  4Z6Y A;  2L9N A;  3JRI A;  5FLX Z;  1OKR A;  4ER7 A;  2CUZ A;  4C9Y A;  3M8F A;  1WZ2 A;  5B1B H;  2HQA A;  1DU6 A;  1REP C;  2Y75 A;  3C7J A;  4BKX A;  1J7K A;  4FQG A;  3LST A;  1X1D A;  4CZZ A;  3HG9 A;  3RZZ A;  1UCR A;  2IGN A;  1WIZ A;  4Z58 A;  3BCB A;  2ME6 A;  2BY1 A;  4ZYD A;  3FBN B;  3IUO A;  3HZJ A;  4MFD A;  4BY1 J;  4MLO A;  2H09 A;  1UHW A;  1L0O C;  1W36 C;  3HOW J;  2C6Y A;  4RS8 A;  2AXV A;  3LSJ A;  3SCG A;  3FXU A;  3K2A A;  2CW0 F;  2F4M B;  1Z6T A;  2L4M A;  5D5V B;  3K4M A;  1KU9 A;  5DCM B;  2E71 A;  2KEK A;  2BVM A;  1LFU P;  2H8W A;  2FML A;  5EF6 A;  2AXT C;  3R61 A;  1H9G A;  2F2E A;  3ZQI A;  1CGP A;  1D0Z A;  5J4V A;  2WC2 A;  3PIO F;  2R3S A;  1NG6 A;  3PUB A;  3RQ4 A;  4EQQ A;  2CRO A;  2OZ6 A;  3N97 A;  2KT0 A;  3BWG A;  3ABK H;  3H9J A;  3RYR A;  5BPI A;  2HZD A;  3QWG A;  4AID A;  2EBI A;  1FT9 A;  2E2I J;  3ZCO A;  1VTN C;  2JRT A;  5J47 A;  4L0Y B;  3E5U A;  2CFX A;  3G2B A;  4V19 K;  2DT5 A;  3CJN A;  4A3B J;  2PUE A;  4KUM A;  2WY7 Q;  1DQU A;  2HQR A;  2M34 A;  1V3F A;  3JCU C;  3RYP A;  2QKL B;  4KIS A;  1J09 A;  4CGZ A;  4IJA A;  4IWR A;  4G7O F;  4E70 A;  2NRA C;  4UV9 A;  2VON A;  3TFL A;  4PJM A;  1YIJ I;  1QHG A;  5HLG A;  1T98 A;  3B73 A;  4HQE A;  2FRH A;  1RPW A;  2M4H A;  3M8E A;  3NAR A;  4WXD A;  4G6Q A;  5GAH J;  3Q3S A;  5JFR A;  2VPL A;  3E6M A;  3I53 A;  3K4J A;  3LA2 A;  3FIS A;  2PMZ N;  5GAG i;  2ZME A;  1AA7 A;  2L7K A;  3KZ3 A;  2DW4 A;  2OCC H;  4RAZ A;  1R22 A;  4BY7 J;  4XOP A;  1XD7 A;  4ZZL A;  4MTD A;  3CCQ I;  1PRU A;  4M3F A;  4MQV A;  1B0N A;  2QSG X;  2L0K A;  3VB2 A;  5M5W J;  2OU2 A;  3OYI A;  2NAZ A;  3FXO A;  1WI9 A;  4EQZ A;  4A3J J;  1X1B A;  1JFS A;  3BT9 A;  4PJJ A;  3RZO J;  2CQK A;  1GDT A;  3OSF A;  3C1D A;  2PLY A;  5HLI A;  1MMA A;  1YRN B;  3K7A J;  5AIP A;  3FZV A;  3OS2 A;  4HDU A;  2PE5 A;  5GAE J;  1FYK A;  1ZS4 A;  3HHH A;  4EMS A;  1D5V A;  1ON2 A;  1ETW A;  4MFE A;  4CYC A;  2CUE A;  2A68 F;  1FOY A;  2EIL H;  2COB A;  2LYS A;  5JUW A;  4IEJ A;  3HSR A;  4LB5 A;  1ETY A;  2V1D A;  4DYQ A;  2VQL A;  3QOE A;  1D3Y A;  2VJI A;  4U7D A;  4NBQ A;  2NS8 A;  4B8X A;  5KAF C;  2LYP A;  3BG9 A;  2A61 A;  1IN7 A;  1SD4 A;  2CW7 A;  2HPI A;  3W6K B;  4IOA F;  3Q0W A;  2CQX A;  1F9N A;  3T8R A;  3TOA A;  4I8T A;  2XB0 X;  3IAS 2;  3J80 K;  2A6T A;  1NG7 A;  2IU7 A;  4P9F A;  2QEX I;  1OCC H;  4LK0 F;  2LRD A;  4AWX B;  4WCG A;  1Z3Y A;  2PXU A;  2WV1 A;  2G7H A;  2IBD A;  3IL2 A;  4PJ0 C;  3L2R A;  4MGR A;  4N9I A;  1LVK A;  5EGO A;  2A6C A;  1VFC A;  4OIR F;  5IOZ A;  1Y56 A;  4OB4 A;  3ZMV A;  1XN7 A;  2OF7 A;  2F5E A;  4ASN A;  2LY2 A;  3O2P E;  5ILU A;  2AO9 A;  1MSE C;  2A6H F;  4QIW N;  4RAG A;  2KHM A;  1OFC X;  4UUT A;  3ECO A;  4M74 A;  1TLH B;  4CO8 A;  2I8D A;  3MKW B;  2A5Y B;  1VQM I;  4PK4 A;  1ZTR A;  1VQP I;  2KLO A;  4BQQ A;  2QA4 I;  1QNT A;  5A7L A;  2GBY A;  1DP7 P;  2AQE A;  1X58 A;  1B9N A;  5KCM A;  4F3Q A;  1GT0 C;  3QFI A;  2CH0 A;  2V7F A;  2L3D A;  3KLO A;  1J59 A;  1QVU A;  4XM3 A;  3DEU A;  2X1E A;  4BQO A;  4FX0 A;  1T39 A;  4HX7 A;  3QPL A;  2ICP A;  2L49 A;  3OMT A;  1H88 C;  2MC4 A;  4X4B A;  1D0X A;  2EFQ A;  2QSH X;  1WI3 A;  1ZAR A;  4PGG A;  2O61 A;  5FD5 A;  4Q47 A;  3S15 J;  3FYA A;  4HRA A;  1WCM J;  2Q0O A;  2BV6 A;  3GME A;  2PUB A;  2FE3 A;  2E7X A;  2KDZ A;  2OTL I;  3CJQ B;  2K7L A;  4EZI A;  1SQ8 A;  2Y30 A;  3DU6 A;  3LSM A;  3K1N A;  2UV1 A;  2RKH A;  2O5R A;  2XGX A;  2KRH A;  4XKW A;  2EFW A;  4D5F A;  5BNG A;  4EAT A;  3BR3 A;  4RLF A;  1TW3 A;  4HW0 A;  3RKX A;  1DGW Y;  3SFI A;  4P96 A;  2KFD A;  4MCT A;  3H3U A;  4V2G A;  3BTI A;  2E5N A;  5HOD A;  1MNE A;  3HDD A;  1V5F A;  5LHG A;  4ER0 A;  1F5T A;  5HLH A;  2M0C A;  3M4O J;  4I6T A;  1PVE A;  3OP9 A;  3LQX A;  2UXN A;  1FBS A;  3MWM A;  1H0M A;  1WJA A;  5IYC J;  2VBZ A;  1IN8 A;  4JOM A;  4EJT A;  3RZD J;  3WTW C;  2RQQ A;  2PMU A;  3UFD A;  1UHS A;  2XXP A;  1R69 A;  1LCD A;  3L9F A;  4D7N A;  4BUP A;  2QQA A;  4PSW A;  1KQ0 A;  3CDI A;  3GTL J;  1ON1 A;  2DYS H;  3L1P A;  2GZU A;  2RDP A;  2RRE A;  5J1Y A;  2BXY A;  4JK1 X;  3L2V A;  1ZR2 A;  1LLI A;  1WH7 A;  5EG0 A;  3F0C A;  1G3Y A;  2XIG A;  2CWE A;  1EH7 A;  4L18 B;  3G1M A;  2L8N A;  2PUC A;  3K9T A;  3VFZ A;  5EYR A;  4CHU A;  2VBX A;  3LA7 A;  3DNV B;  2NVY J;  1RKW A;  4BJ5 C;  5FKN A;  2QF7 A;  4A5M A;  4LB6 B;  4ER5 A;  1R71 A;  3L09 A;  4X4C A;  2HU9 A;  4KN4 X;  2BEO A;  3EQL F;  3I3L A;  3K4N A;  3WTT C;  2VAS A;  3VWS A;  4P1W A;  2M0M A;  5L3F A;  2H8R A;  1U5T A;  2R5Z B;  2HXO A;  3HOV J;  1HKT A;  2HDD A;  4UVB A;  5FLM J;  3M8J A;  2HVQ A;  2B0L A;  4EM1 A;  1CQT A;  2GOM A;  1NER A;  1R23 A;  5HS7 A;  4MHG A;  3DPT A;  4IO9 F;  1QB2 A;  4BAC A;  3F22 A;  2DCE A;  4R79 A;  1JI8 A;  3DWL E;  4A3M J;  2Q2E B;  3ABU A;  4XNF A;  1ZRE A;  2BVL A;  3IVP A;  1OMI A;  2VLA A;  3G0T A;  3P9I A;  2PMH A;  3T1B A;  5FB2 A;  1OCO H;  2FBI A;  3S2H J;  2DO7 A;  2EH3 A;  4WXH A;  2XGC A;  3D5L A;  3LFK A;  4JP0 A;  2A05 A;  1IXR C;  2UWM A;  4F52 A;  2CV2 A;  3GW2 A;  3I59 A;  1MJA A;  4C3H J;  2PXD A;  1B72 B;  3IWZ A;  1FPQ A;  1T95 A;  3CCR I;  1R9T J;  3S1M J;  2LBF A;  2QEN A;  1Y0N A;  2W00 A;  1YW8 A;  4CCJ A;  4RAY A;  1UJ8 A;  1RR8 C;  1VF9 A;  3HB9 A;  1QPM A;  1FBQ A;  2K3P A;  3FK7 A;  2X4H A;  5LGN A;  1IRG A;  4OBM A;  3C2H A;  2PMZ A;  3ISP A;  3L2W A;  2DFH A;  3F6W A;  5LHH A;  1G6N A;  3MQ0 A;  3U3W A;  3OYK A;  2WA0 A;  3ROU A;  2HSG A;  3F23 A;  4M6X A;  1MD0 A;  1S3J A;  5CVJ A;  4X4I A;  1V4R A;  2IVM A;  2W82 A;  1SAX A;  3NAU A;  5FD6 A;  3CC2 I;  5GAH i;  1ZEL A;  1R63 A;  1PRV A;  3CLO A;  2WB1 N;  4HEA 2;  2QUF A;  4IHT A;  1UFM A;  1IDY A;  3F3X A;  5CJ9 A;  3F21 A;  2M45 A;  4A6E A;  5DCM A;  3SYT A;  5L3G A;  3LFP A;  4YG1 A;  5CQE A;  1RUO A;  1KQ8 A;  2KZ8 A;  2LOO A;  4GHJ A;  3BG7 A;  3R4K A;  2VT3 A;  1B8I B;  4P9U A;  4A3G J;  1TBX A;  2DMT A;  1YX3 A;  3EUS A;  1XDS A;  1H9T A;  4HAM A;  2PJP A;  2O8X A;  3M9A A;  3U2R A;  2LR8 A;  2IA2 A;  3M7G A;  4I0B A;  3BG6 A;  3TOB A;  2PXT A;  5M5Y J;  2ELK A;  3F9K A;  2F4O B;  2HDW A;  4AIH A;  4YFN F;  3KEO A;  5DUI A;  2VE9 A;  3KZZ A;  1AKH B;  3DLL F;  1OR7 A;  2M87 A;  2QBY B;  1DGR M;  1VPW A;  1XGM A;  3A01 A;  2VOP A;  3AG4 H;  2LC2 A;  3HKZ N;  5DM7 F;  2YU3 A;  3PSI A;  2DA6 A;  3ZN1 A;  3K1M A;  1WJC A;  2XHK A;  2MYS A;  3DTE A;  4CXF A;  2KQR A;  3OYJ A;  3F8F A;  1K7A A;  3BCA A;  1WFX A;  1OR7 C;  4ESJ A;  1OYY A;  4ETS A;  4BGD A;  3BQZ A;  1A6I A;  1R1U A;  3OYD A;  4U0V A; 
#chains in the Genus database with same CATH homology
 3OQM A;  3E7L A;  1GUU A;  2FD5 A;  4IHV A;  4X4G A;  3QQ6 A;  4NDL A;  5K7Z A;  5EEA A;  5IP7 J;  3LSR A;  5C44 J;  2FQ4 A;  3GTK J;  2I10 A;  2ID6 A;  4C3I J;  3BG3 A;  2LD5 A;  1W0T A;  3GTM J;  2H1K A;  4Z59 A;  2GRL A;  4GFB A;  3ZQL A;  2Y31 A;  4BBS J;  1MBH A;  3TW6 A;  3S14 J;  3ZKC A;  2AXZ A;  2LCV A;  2R5Y B;  1VI0 A;  2WUS R;  2XSD C;  1TWC J;  2MG4 A;  3HGG A;  3ZQC A;  5M3F J;  2IAI A;  1OSL A;  3CEC A;  2EZI A;  4MO7 A;  1JUP A;  2NVX J;  1FTZ A;  1PUF B;  2PUG A;  2QCO A;  2O49 A;  2R5Y A;  2XGD A;  4GQM A;  2GRM A;  2AW6 A;  3HEF A;  1XC5 A;  3BTJ A;  2R92 J;  1K83 J;  1MH3 A;  4DZJ A;  1JUS A;  2XIU A;  1QPI A;  2NOG A;  2B5A A;  4XRM A;  3DEW A;  2E2J J;  1NTC A;  1IUF A;  2MQK A;  4X4H A;  4JCY A;  4AYB N;  3CRO L;  1ENH A;  1PUF A;  2JCG A;  3IH2 A;  4DYC A;  4DW6 A;  3ZHI A;  2OR1 L;  2HOA A;  2TCT A;  4JX4 A;  2HOT A;  3ZQH A;  5F0H A;  3JRI A;  3S1Q J;  5K7F A;  1ETQ A;  4W1U A;  1W0U A;  2D5V A;  1GVD A;  1TWA J;  4HNV A;  2ME0 A;  2JMW A;  5EDN A;  1ZQ3 P;  4PU8 A;  3SCF A;  4V2F A;  5FKM A;  5C3E J;  2E1O A;  1ZGW A;  4M3G A;  1DU6 A;  4FBI A;  3CMY A;  4BKX A;  3GTP J;  1BDH A;  4UUS B;  3RZZ A;  1FTT A;  2XCJ A;  2K9S A;  1WIZ A;  3O9X A;  4Z58 A;  1ETX A;  1RKT A;  2LVS A;  2ME6 A;  4JCX A;  1JWL A;  3O8H A;  4BY1 J;  3GBG A;  4MFD A;  4MLO A;  3BR6 A;  3IH3 A;  1FJL A;  3FYM A;  4YG4 A;  3Q0V A;  4UUS A;  3HOW J;  2K9Q A;  2AXV A;  1MBJ A;  3LSJ A;  1X2M A;  3K2A A;  3SCG A;  1UMQ A;  5M5X J;  2Y9Y A;  3BG5 A;  2KEK A;  1LFU P;  1WPK A;  2N8G A;  3BTC A;  1WH5 A;  1BJZ A;  1SFO J;  5EF6 A;  2R63 A;  5FKK A;  3ZQI A;  3H3V K;  4ABZ A;  3JRB A;  3BS3 A;  3H0G J;  1JKP C;  5IYD J;  2HIN A;  3CCY A;  4C3J J;  2CRO A;  4X4F A;  3A03 A;  3O8G A;  5E3N A;  2KT0 A;  3QWG A;  4I6R A;  2EBI A;  1T56 A;  5F04 A;  2E2I J;  2JVL A;  3WHB A;  4X6A J;  2OFY A;  1TWG J;  5J3L A;  4A3B J;  4FE7 A;  4XRS G;  2PUE A;  4FIS A;  1RET A;  3D1N I;  3S17 J;  1H89 C;  4L5E A;  2M34 A;  3JRE A;  2EBY A;  5DTD A;  4RBO A;  4IHW A;  2DA1 A;  4J1X A;  1IDZ A;  2RAE A;  4JYK A;  1P7I A;  1HF0 A;  5FJ8 J;  3JRC A;  1MSF C;  2JWT A;  4IWR A;  2BNO A;  1U9N A;  2VI6 A;  2IVQ A;  4A93 J;  1QP7 A;  4W97 A;  3FIW A;  4Y7N J;  1JJ6 C;  1QQB A;  1S7E A;  1UG2 A;  3JXB C;  1APL C;  4F8D A;  4NDW A;  1ZKG A;  2IUO A;  1RPW A;  5FKO A;  3UKG A;  2GLO A;  2O38 A;  2CU7 A;  3NAR A;  5IOY A;  3Q3S A;  2HQ5 A;  1ZZC A;  2HOS A;  1LE8 A;  2B63 J;  3FIS A;  4XIC A;  2PMZ N;  1Y1W J;  1X2L A;  5JLX A;  3KZ3 A;  1IC8 A;  1L1M A;  4BY7 J;  4MCX A;  1ETO A;  4XRS A;  2JA8 J;  3F51 A;  1PRU A;  4M3F A;  2K40 A;  1YSE A;  2XPU A;  4Y52 J;  1B0N A;  4PU3 C;  1G2H A;  3WHC A;  1ZUG A;  1ZZB A;  1TWH J;  2L0K A;  5M5W J;  4A69 C;  3LSP A;  2JA5 J;  4A3J J;  2BJC A;  1LFB A;  3G1L A;  1JFS A;  2R0Q C;  3B6C A;  3BT9 A;  4BBR J;  3RZO J;  2ICT A;  1RES A;  3OSF A;  1GDT A;  4D5C A;  1JJ8 C;  4G12 A;  1BL0 A;  3K7A J;  1YRN B;  3HOZ J;  2PE5 A;  1F43 A;  3C2B A;  3F52 A;  1ZS4 A;  4A3F J;  4XK4 A;  1EFA A;  2LKX A;  2VKE A;  1ETW A;  4MFE A;  4CYC A;  2XGE A;  2K9N A;  2AHQ A;  2L9R A;  2CUE A;  3MVP A;  2AWI A;  1PNR A;  4AUX A;  2PIJ A;  2COB A;  2LYS A;  1P7J A;  1YRN A;  2DMQ A;  4IEJ A;  1VND A;  3JRF A;  1ETY A;  2LLK A;  4DYQ A;  2KEJ A;  1ZZ9 A;  1Y1V J;  3QPS A;  3VPR A;  3JXC L;  2NS8 A;  1OJL A;  2LYP A;  1JH9 A;  5GPA A;  2Y0S N;  3BG9 A;  1Y7Y A;  2NS7 A;  2FX0 A;  2LYQ A;  4X4E A;  4BXX J;  3OOU A;  3Q0W A;  2CQX A;  4I8T A;  2XB0 X;  1OCP A;  2YU9 J;  1GV2 A;  4QTR A;  4PU4 C;  3VK0 A;  2L7F P;  2DMN A;  2E19 A;  1MBK A;  4DZP A;  1BW5 A;  3CLC A;  2CRG A;  2O9L A;  2IU7 A;  2JJ7 A;  3QF3 A;  5EGO B;  1A5J A;  1IG7 A;  1FEX A;  3HBL A;  1Z77 A;  1BW6 A;  2XRL A;  2VKV A;  1JKR C;  3S1R J;  1FIA A;  1HLV A;  2WV1 A;  1PRA A;  2IBD A;  3PO3 J;  3H5T A;  5EGO A;  2A6C A;  1VFC A;  1ZAY A;  5IOZ A;  1ITY A;  4OB4 A;  2DA7 A;  2DTZ A;  4A3C J;  2OF7 A;  2M9H A;  2CSF A;  2AO9 A;  1MSE C;  3A02 A;  5C4J J;  4QIW N;  1OFC X;  3PXP A;  4UUT A;  4AC0 A;  2EWT A;  1WET A;  1AU7 A;  1ZTR A;  1RR7 A;  2FJR A;  5A7L A;  2GBY A;  3TW7 A;  1JGG A;  2YS9 A;  4FE4 A;  5F1J A;  1X58 A;  2ZB9 A;  5E3O A;  1GT0 C;  1Y9Q A;  2NVT J;  1B72 A;  3LOC A;  2LTP A;  2MSY A;  3FK6 A;  1QVU A;  2IEK A;  1IGN A;  2NVQ J;  4Z5C A;  2M8G X;  5FKL A;  9ANT A;  1EF4 A;  3QPL A;  3S16 J;  2ICP A;  3TP3 A;  2L49 A;  3OMT A;  3GTJ J;  1H88 C;  1XWR A;  4X4B A;  1WI3 A;  3JRD A;  2WAQ N;  2DMP A;  2HYJ A;  3S15 J;  3FYA A;  1WCM J;  3S8Q A;  4DYR A;  2YUS A;  2DA2 A;  5K7H A;  1HCR A;  1UXD A;  1IV6 A;  1RZR A;  2PUB A;  3M3Y J;  2KDZ A;  2DMU A;  3BR0 A;  2Y30 A;  1SQ8 A;  2DN0 A;  1ZZ6 A;  2E2H J;  2CUF A;  3OSG A;  4D5F A;  5BNG A;  2R93 J;  4FN3 A;  3BR3 A;  2CJJ A;  4LOC A;  2JA6 J;  3SFI A;  2BNM A;  5IYB J;  5IPA A;  4MIM A;  3QQA A;  2IVG A;  4V2G A;  3BTI A;  1LE8 B;  4MCT A;  1ORK A;  4M3D A;  5HOD A;  3HDD A;  3M4O J;  2M0C A;  2IVB A;  2LK2 A;  4B4C A;  2AUW A;  4I6T A;  1E3O C;  3GN5 B;  3OP9 A;  3BR5 A;  1AHD P;  1ZK8 A;  3HOX J;  2Y2Z A;  5EZG A;  1FIP A;  1QVT A;  1MBF A;  5IYC J;  3JRH A;  1JTY A;  3KXA A;  4JX6 A;  4YAR A;  1CJG A;  1QP0 A;  3LNQ A;  4PU7 A;  2LY9 A;  3RZD J;  1Q1V A;  1WH8 A;  3UFD A;  5J1U A;  1UHS A;  1LCD A;  1R69 A;  3GN5 A;  3KJX A;  4D7N A;  5F08 A;  2AXU A;  3QYX A;  2OPT A;  5EG0 B;  5EZH A;  1H8A C;  5GP9 A;  3JRG A;  1OCT C;  4IHX A;  2ECB A;  2LYK A;  1QP4 A;  3GTL J;  1PER L;  5F0C A;  2DA4 A;  1JKO C;  3BR2 A;  3L1P A;  2GZU A;  5J1Y A;  1AKH A;  1ADR A;  5E3L A;  1ZPQ A;  4CYC B;  1ZR2 A;  1LLI A;  3FMY A;  4FCY A;  1WH7 A;  5EG0 A;  3F0C A;  1ETK A;  2LP0 A;  1WH6 A;  5IP6 A;  1I50 J;  1D5Y A;  4IA8 A;  3HOU J;  3G1M A;  3MLF A;  2L8N A;  2PUC A;  1T33 A;  5EYR A;  4X4D A;  4FTH A;  3DNV B;  2PUD A;  2NVY J;  1RKW A;  2DJN A;  5FKN A;  2QF7 A;  2O8K A;  2CQQ A;  1POU A;  1BA5 A;  1X57 A;  4X4C A;  1WGX A;  4C2M J;  1IJW C;  1MH4 A;  4Z5D A;  3HZI B;  2PUF A;  4QSH A;  4A3L J;  1POG A;  2L7M P;  3JR9 A;  2H8R A;  2XJ3 A;  2L7Z A;  3GBF A;  2R5Z B;  2HXO A;  3DCF A;  3HOV J;  2TRT A;  2HDD A;  1F36 A;  4A3I J;  3B7H A;  3R1F A;  1JFT A;  2XPV A;  3BR1 A;  2XPW A;  5FLM J;  3GTG J;  5JLW A;  3TP0 A;  3Q0U A;  1CQT A;  1NER A;  4X1E A;  2R5Z A;  3JRA A;  1U9O A;  1O4X A;  2PPX A;  4A3M J;  2EZK A;  3BQY A;  1X2N A;  3I4M J;  3S1N J;  4Y42 A;  4EEF G;  2VUM J;  2LFB A;  3IVP A;  4B3A A;  1QPZ A;  5F27 A;  3OQN A;  1NK3 P;  2BNN A;  4YG7 B;  3S2H J;  2EH3 A;  4JX5 A;  2GM4 A;  3I4N J;  4I6U A;  3TRB A;  2XGC A;  4JP0 A;  4A3E J;  2JA7 J;  3BDN A;  3HM5 A;  1MBE A;  1UXC A;  2JK3 A;  1JT0 A;  4C3H J;  1DU0 A;  3GTQ J;  2R1J L;  1B72 B;  4RDU A;  1DW9 A;  3S1M J;  1R9T J;  2JN6 A;  4Z5H A;  2EQR A;  1JKQ C;  2ID3 A;  2O4A A;  1U78 A;  3IV5 A;  2EZL A;  2X6O A;  4J19 A;  1QRY A;  5DS9 A;  1VF9 A;  3HB9 A;  3CDL A;  3OQO A;  2PUA A;  4D7M A;  2XB5 A;  3ZQG A;  3FK7 A;  4M3E A;  4A3K J;  3IH4 A;  1NEQ A;  2MEZ A;  1QQA A;  2LYJ A;  3F6W A;  3ZHM A;  3RKQ A;  3S2D J;  1IRZ A;  1JTX A;  1XG1 A;  3U3W A;  4M6V A;  2HSG A;  5K98 B;  2FJ1 A;  2HI3 A;  1DWK A;  4M3B A;  4X4I A;  4J1W A;  2R7Z J;  2O7O A;  3NAU A;  1R63 A;  1PRV A;  2KEI A;  3ZQF A;  2WIU B;  3OIO A;  1ZZ8 A;  1HOM A;  5IP9 J;  1BDI A;  2WB1 N;  5C4X J;  1IDY A;  1JUM A;  1JT6 A;  4XID A;  3LFP A;  3MN2 A;  4GHJ A;  2KZ8 A;  2DA5 A;  4YG1 A;  4JQD A;  4S0H B;  1K61 A;  1TC3 C;  1NK2 P;  1HDD C;  5GPC A;  1B8I B;  3BTL A;  3JXD L;  4A3G J;  2EF8 A;  3G5G A;  2DMT A;  3BD1 A;  3ZOB A;  2ECC A;  5F0F A;  3SJM A;  3EUS A;  1GV5 A;  3G7D A;  3MKL A;  2MGQ A;  3B6A A;  2LYL A;  4O8B A;  2HXI A;  1ZVV A;  4I76 A;  2LR8 A;  4I6Z A;  1RZS A;  1I3Q J;  2M2E A;  3W6V A;  4IVZ A;  2DA3 A;  1SAN A;  1B8I A;  2KPJ A;  1HDP A;  3A01 B;  3G1O A;  4IHY A;  1ETV A;  5M3M J;  5M5Y J;  3HOY J;  2ELK A;  2P81 A;  1AKH B;  2XI8 A;  2X48 A;  3LSG A;  1XS9 A;  1MBG A;  5J1R A;  1Z0X A;  1ZR4 A;  4B1R A;  4A3D J;  3PO2 J;  3SCH A;  3CQZ J;  3LIS A;  1VPW A;  1TWF J;  1U8B A;  3A01 A;  2X9D A;  1UTX A;  3HKZ N;  1MNM C;  3SDG A;  1RZR D;  3PM1 A;  2W48 A;  2DA6 A;  3TED A;  2MW8 A;  1LMB 3;  1RPE L;  1LQC A;  1I6H J;  2Y9Z A;  1LCC A;  5E3M A;  1RIO A;  4YBA A;  2G0E A;  3RQI A;  2VPR A;  5FLV A;  1ZZ7 A;  2EZH A;  2IV1 A;  3HGY A;  3BQZ A;  1A6I A;  3GTO J;  2LYR A;  3FKI J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...