2CROA

Structure of phage 434 cro protein at 2.35 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of phage 434 Cro protein at 2.35 A resolution.
pubmed doi rcsb
source organism Phage 434
molecule tags Gene regulating protein
molecule keywords REGULATORY PROTEIN CRO
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1988-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2croA00
4OB4A 4MCTA 2ICPA 2ICTA 1QPZA 2L49A 2XI8A 3OMTA 4IWRA 4I6TA 4YARA 3G5GA 2O49A 1Y7YA 1JWLA 2PUEA 2XCJA 1O4XA 2KZ8A 2MQKA 3BD1A 3BS3A 2AXUA 1RZRA 2LYPA 1RZSA 1ZZ9A 1OCTC 2WUSR 4IA8A 2CSFA 2GRLA 4Z5DA 4I6UA 3DNVB 2LYLA 1XWRA 1PRAA 1YSEA 2BNNA 1OSLA 1AU7A 1ZZ6A 3OQOA 2LYRA 2AXZA 3B7HA 4Z58A 1WETA 3F6WA 2R63A 2AUWA 4X4BA 2EF8A 2PUAA 4IVZA 3RZZA 4PU3C 3SCHA 3JXDL 2R1JL 1QP0A 3KXAA 2LYJA 4FN3A 3OQMA 3UFDA 1JFTA 1WH6A 1ZZ8A 4J1XA 3ZHIA 3O9XA 3QYXA 3IVPA 3LISA 4Z5HA 2KEJA 4JQDA 4NDWA 1ZPQA 2BJCA 3OQNA 1JFSA 3OP9A 2KEIA 3GN5A 3D1NI 1UXDA 2AWIA 1ZS4A 2AW6A 2IUOA 2IV1A 2GRMA 1X57A 4PU7A 4F8DA 2MEZA 3L1PA 1B0NA 3GBFA 4PU4C 2PUGA 2KPJA 4FBIA 1WH8A 1ZZCA 3SCFA 4YG4A 1QP7A 2LYKA 1PRVA 2GZUA 3QQ6A 2AXVA 3CROL 2EWTA 1BDHA 1ZUGA 5A7LA 2O4AA 1NEQA 4I8TA 4YG7B 3LFPA 3MLFA 2B5AA 2PUBA 1LQCA 2O38A 1PRUA 1GT0C 1R69A 1Y9QA 3QF3A 3SCGA 2OFYA 3PXPA 3R1FA 4MCXA 1RZRD 2LCVA 3TRBA 1ZVVA 4JCXA 1PERL 2CROA 2IVBA 4YG1A 3CLCA 3JXBC 1UTXA 2XJ3A 1R63A 2PE5A 1RPEL 2IU7A 2HINA 3H5TA 1BDIA 2BNOA 2XIUA 2XSDC 4X4IA 1E3OC 1JH9A 1QQBA 4X4CA 5K98B 3ZHMA 1LCDA 2LYSA 4I6RA 3VK0A 1QP4A 4Z5CA 2L8NA 1L1MA 2HSGA 1QQAA 2A6CA 1HF0A 4GHJA 1DW9A 3F51A 1ZZBA 2IVQA 3BDNA 1PNRA 1S7EA 4PU8A 4X4EA 1WIZA 1UXCA 4X4DA 1EFAA 1LCCA 4X4HA 3HZIB 3EUSA 3FYAA 2JCGA 4GQMA 4Y42A 2PIJA 4YBAA 3GN5B 3G7DA 2KEKA 3S8QA 1VPWA 2H8RA 2FJRA 1IC8A 3JXCL 2LYQA 3F52A 1CQTA 3KZ3A 3FYMA 3CECA 2JVLA 1SQ8A 4O8BA 4X4GA 2D5VA 2OR1L 1RIOA 2PUDA 4Z59A 1CJGA 3ZKCA 1LMB3 2IVGA 2PPXA 3KJXA 4JCYA 3FMYA 1DWKA 1X2LA 1ZZ7A 2BNMA 4X4FA 1ZAYA 1LLIA 4J1WA 2PUCA 1POUA 1NERA 2WIUB 3QWGA 2PUFA 1ADRA 3U3WA 2EBYA
chains in the Genus database with same CATH superfamily
3ZPXA 2ICTA 4HRAA 2HCNA 4I6TA 3G5GA 2KZ8A 3BD1A 2LNMA 1ZZ9A 2WUSR 1PRAA 1ZZ6A 1WETA 2LYRA 2XXQA 3F6WA 4PU3C 4EQZA 3SCHA 3JXDL 5DTMA 1ZZ8A 5DRYA 4Z5HA 4JQDA 3LQXA 1ZPQA 1JFSA 3GN5A 2AWIA 3NDBB 2IV1A 1X57A 5JUWA 4OBMA 1B0NA 3GBFA 1WH8A 3NZLA 1PRVA 3CROL 1BDHA 4I8TA 2PUBA 2O38A 3TFLA 1R69A 2HFZA 3SCGA 2LCVA 2CROA 1UTXA 1RPEL 4EKIA 4EKGA 2XSDC 1QP4A 3QOXA 1HF0A 1DW9A 1ZZBA 1S7EA 4X4EA 1WIZA 4WVLA 1EFAA 4X4HA 2JCGA 4Y42A 2PIJA 3GN5B 4EZIA 3A9XA 2FJRA 2V3CC 4O8BA 1SQ8A 2D5VA 2OR1L 3OWQA 4JCYA 1DWKA 1X2LA 1ZAYA 4J1WA 2PUFA 3OKZA 4OB4A 4MCTA 2ICPA 1QPZA 2L49A 5GAGi 2XI8A 4YARA 1JWLA 2MQKA 3TEPA 2LYPA 3PE5A 4IA8A 2CSFA 4Z5DA 1XWRA 3GZDC 2BNNA 1OSLA 1AU7A 2EF8A 4IVZA 3KXAA 4FN3A 3OQMA 1JFTA 4J1XA 2FFHA 3QYXA 3MEJA 2KEJA 4NDWA 2HCSA 3OP9A 2KEIA 3D1NI 3VWSA 2AW6A 2IUOA 3QFIA 1ZZCA 3SCFA 3QQ6A 1DULA 2XXPA 5DRTA 1LQCA 1PRUA 4MCXA 3R1FA 3GZDA 4JCXA 3JXBC 1QZXA 2PE5A 1BDIA 1E3OC 1JH9A 4I6RA 3VK0A 1HQ1A 2PUAA 2L8NA 3ME5A 2IVQA 2PXQA 2PXVA 1UXCA 4X4DA 1LCCA 3EUSA 1VPWA 2KEKA 2VEOA 1IC8A 2XXAA 3FYMA 1RIOA 1NW3A 2PPXA 3GZCA 2MXDA 4ER7A 4X4FA 2PUCA 5DTRA 3QWGA 1ADRA 5DT2A 2LLWA 2PUEA 2XCJA 1O4XA 3BS3A 1RZRA 1OCTC 2GRLA 4I6UA 3OQOA 2AXZA 4Z58A 2R63A 3RZZA 2J7UA 2YBDA 3UFDA 1WH6A 3ZHIA 1QB2A 3LISA 4ER3A 1UXDA 1ZS4A 4PU7A 4F8DA 2PXBA 2PXPA 4PU4C 2PUGA 2KPJA 3A9YA 4FBIA 2LYKA 2GZUA 3A9ZA 1ZUGA 5A7LA 3LFPA 2M4HA 3TRBA 2PXDA 1PERL 5DTQA 4YG1A 3CLCA 2IU7A 3R09A 2XIUA 3TELA 5K98B 2PXKA 2LYSA 2PXUA 1QQAA 2A6CA 3BDNA 1PNRA 2PXFA 4YBAA 3G7DA 3S8QA 3NROA 1CQTA 2PXLA 3CECA 2JVLA 4X4GA 4DE9A 4Z59A 2IVGA 4ER6A 2J7WA 3KJXA 1ZZ7A 4DE8A 2EBYA 5DSXA 4ER0A 3OMTA 4IWRA 2PXEA 2O49A 1Y7YA 2L1PA 2AXUA 1RZSA 3QOWA 3DNVB 2LYLA 1YSEA 3B7HA 4X4BA 2AUWA 4EK9A 2R1JL 1QP0A 2LYJA 3O9XA 2LLVA 3IVPA 5GAHi 2BJCA 3OQNA 2ODRD 2GRMA 2MEZA 3L1PA 3DM5A 4YG4A 1QP7A 2AXVA 2EWTA 2O4AA 1NEQA 4YG7B 3MLFA 4ER5A 2B5AA 3KL4A 1GT0C 1Y9QA 3QF3A 2OFYA 3PXPA 1RZRD 1ZVVA 2IVBA 2XJ3A 1R63A 2HINA 3H5TA 2BNOA 4X4IA 1QQBA 4X4CA 3ZHMA 1LCDA 4Q2JA 3GUUA 3UWPA 4Z5CA 1L1MA 2HSGA 4GHJA 3F51A 3SX0A 3M9LA 4PU8A 2PXTA 3HZIB 3FYAA 3G0TA 4GQMA 2H8RA 3JXCL 2LYQA 3F52A 2JQEA 3KZ3A 1MFQC 2PUDA 1CJGA 1U2ZA 3ZKCA 1LMB3 3NXHA 3FMYA 2BNMA 3SR4A 1LLIA 1POUA 1NERA 2WIUB 3U3WA
chains in the Genus database with same CATH topology
4OB4A 4MCTA 2ICPA 2ICTA 1QPZA 2L49A 2XI8A 3OMTA 4IWRA 4I6TA 4YARA 3G5GA 2O49A 1Y7YA 1JWLA 2PUEA 2XCJA 1O4XA 2KZ8A 2MQKA 3BD1A 3BS3A 2AXUA 1RZRA 2LYPA 1RZSA 1ZZ9A 1OCTC 2WUSR 4IA8A 2CSFA 2GRLA 4Z5DA 4I6UA 3DNVB 2LYLA 1XWRA 1PRAA 1YSEA 2BNNA 1OSLA 1AU7A 1ZZ6A 3OQOA 2LYRA 2AXZA 3B7HA 4Z58A 1WETA 3F6WA 2R63A 2AUWA 4X4BA 2EF8A 2PUAA 4IVZA 3RZZA 4PU3C 3SCHA 3JXDL 2R1JL 1QP0A 3KXAA 2LYJA 4FN3A 3OQMA 3UFDA 1JFTA 1WH6A 1ZZ8A 4J1XA 3ZHIA 3O9XA 3QYXA 3IVPA 3LISA 4Z5HA 2KEJA 4JQDA 4NDWA 1ZPQA 2BJCA 3OQNA 1JFSA 3OP9A 2KEIA 3GN5A 3D1NI 1UXDA 2AWIA 1ZS4A 2AW6A 2IUOA 2IV1A 2GRMA 1X57A 4PU7A 4F8DA 2MEZA 3L1PA 1B0NA 3GBFA 4PU4C 2PUGA 2KPJA 4FBIA 1WH8A 1ZZCA 3SCFA 4YG4A 1QP7A 2LYKA 1PRVA 2GZUA 3QQ6A 2AXVA 3CROL 2EWTA 1BDHA 1ZUGA 5A7LA 2O4AA 1NEQA 4I8TA 4YG7B 3LFPA 3MLFA 2B5AA 2PUBA 1LQCA 2O38A 1PRUA 1GT0C 1R69A 1Y9QA 3QF3A 3SCGA 2OFYA 3PXPA 3R1FA 4MCXA 1RZRD 2LCVA 3TRBA 1ZVVA 4JCXA 1PERL 2CROA 2IVBA 4YG1A 3CLCA 3JXBC 1UTXA 2XJ3A 1R63A 2PE5A 1RPEL 2IU7A 2HINA 3H5TA 1BDIA 2BNOA 2XIUA 2XSDC 4X4IA 1E3OC 1JH9A 1QQBA 4X4CA 5K98B 3ZHMA 1LCDA 2LYSA 4I6RA 3VK0A 1QP4A 4Z5CA 2L8NA 1L1MA 2HSGA 1QQAA 2A6CA 1HF0A 4GHJA 1DW9A 3F51A 1ZZBA 2IVQA 3BDNA 1PNRA 1S7EA 4PU8A 4X4EA 1WIZA 1UXCA 4X4DA 1EFAA 1LCCA 4X4HA 3HZIB 3EUSA 3FYAA 2JCGA 4GQMA 4Y42A 2PIJA 4YBAA 3GN5B 3G7DA 2KEKA 3S8QA 1VPWA 2H8RA 2FJRA 1IC8A 3JXCL 2LYQA 3F52A 1CQTA 3KZ3A 3FYMA 3CECA 2JVLA 1SQ8A 4O8BA 4X4GA 2D5VA 2OR1L 1RIOA 2PUDA 4Z59A 1CJGA 3ZKCA 1LMB3 2IVGA 2PPXA 3KJXA 4JCYA 3FMYA 1DWKA 1X2LA 1ZZ7A 2BNMA 4X4FA 1ZAYA 1LLIA 4J1WA 2PUCA 1POUA 1NERA 2WIUB 3QWGA 2PUFA 1ADRA 3U3WA 2EBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB4 A;  4MCT A;  2ICP A;  2ICT A;  1QPZ A;  2L49 A;  2XI8 A;  3OMT A;  4IWR A;  4I6T A;  4YAR A;  3G5G A;  2O49 A;  1Y7Y A;  1JWL A;  2PUE A;  2XCJ A;  1O4X A;  2KZ8 A;  2MQK A;  3BD1 A;  3BS3 A;  2AXU A;  1RZR A;  2LYP A;  1RZS A;  1ZZ9 A;  1OCT C;  2WUS R;  4IA8 A;  2CSF A;  2GRL A;  4Z5D A;  4I6U A;  3DNV B;  2LYL A;  1XWR A;  1PRA A;  1YSE A;  2BNN A;  1OSL A;  1AU7 A;  1ZZ6 A;  3OQO A;  2LYR A;  2AXZ A;  3B7H A;  4Z58 A;  1WET A;  3F6W A;  2R63 A;  2AUW A;  4X4B A;  2EF8 A;  2PUA A;  4IVZ A;  3RZZ A;  4PU3 C;  3SCH A;  3JXD L;  2R1J L;  1QP0 A;  3KXA A;  2LYJ A;  4FN3 A;  3OQM A;  3UFD A;  1JFT A;  1WH6 A;  1ZZ8 A;  4J1X A;  3ZHI A;  3O9X A;  3QYX A;  3IVP A;  3LIS A;  4Z5H A;  2KEJ A;  4JQD A;  4NDW A;  1ZPQ A;  2BJC A;  3OQN A;  1JFS A;  3OP9 A;  2KEI A;  3GN5 A;  3D1N I;  1UXD A;  2AWI A;  1ZS4 A;  2AW6 A;  2IUO A;  2IV1 A;  2GRM A;  1X57 A;  4PU7 A;  4F8D A;  2MEZ A;  3L1P A;  1B0N A;  3GBF A;  4PU4 C;  2PUG A;  2KPJ A;  4FBI A;  1WH8 A;  1ZZC A;  3SCF A;  4YG4 A;  1QP7 A;  2LYK A;  1PRV A;  2GZU A;  3QQ6 A;  2AXV A;  3CRO L;  2EWT A;  1BDH A;  1ZUG A;  5A7L A;  2O4A A;  1NEQ A;  4I8T A;  4YG7 B;  3LFP A;  3MLF A;  2B5A A;  2PUB A;  1LQC A;  2O38 A;  1PRU A;  1GT0 C;  1R69 A;  1Y9Q A;  3QF3 A;  3SCG A;  2OFY A;  3PXP A;  3R1F A;  4MCX A;  1RZR D;  2LCV A;  3TRB A;  1ZVV A;  4JCX A;  1PER L;  2CRO A;  2IVB A;  4YG1 A;  3CLC A;  3JXB C;  1UTX A;  2XJ3 A;  1R63 A;  2PE5 A;  1RPE L;  2IU7 A;  2HIN A;  3H5T A;  1BDI A;  2BNO A;  2XIU A;  2XSD C;  4X4I A;  1E3O C;  1JH9 A;  1QQB A;  4X4C A;  5K98 B;  3ZHM A;  1LCD A;  2LYS A;  4I6R A;  3VK0 A;  1QP4 A;  4Z5C A;  2L8N A;  1L1M A;  2HSG A;  1QQA A;  2A6C A;  1HF0 A;  4GHJ A;  1DW9 A;  3F51 A;  1ZZB A;  2IVQ A;  3BDN A;  1PNR A;  1S7E A;  4PU8 A;  4X4E A;  1WIZ A;  1UXC A;  4X4D A;  1EFA A;  1LCC A;  4X4H A;  3HZI B;  3EUS A;  3FYA A;  2JCG A;  4GQM A;  4Y42 A;  2PIJ A;  4YBA A;  3GN5 B;  3G7D A;  2KEK A;  3S8Q A;  1VPW A;  2H8R A;  2FJR A;  1IC8 A;  3JXC L;  2LYQ A;  3F52 A;  1CQT A;  3KZ3 A;  3FYM A;  3CEC A;  2JVL A;  1SQ8 A;  4O8B A;  4X4G A;  2D5V A;  2OR1 L;  1RIO A;  2PUD A;  4Z59 A;  1CJG A;  3ZKC A;  1LMB 3;  2IVG A;  2PPX A;  3KJX A;  4JCY A;  3FMY A;  1DWK A;  1X2L A;  1ZZ7 A;  2BNM A;  4X4F A;  1ZAY A;  1LLI A;  4J1W A;  2PUC A;  1POU A;  1NER A;  2WIU B;  3QWG A;  2PUF A;  1ADR A;  3U3W A;  2EBY A; 
#chains in the Genus database with same CATH topology
 3ZPX A;  2ICT A;  4HRA A;  2HCN A;  4I6T A;  3G5G A;  2KZ8 A;  3BD1 A;  2LNM A;  1ZZ9 A;  2WUS R;  1PRA A;  1ZZ6 A;  1WET A;  2LYR A;  2XXQ A;  3F6W A;  4PU3 C;  4EQZ A;  3SCH A;  3JXD L;  5DTM A;  1ZZ8 A;  5DRY A;  4Z5H A;  4JQD A;  3LQX A;  1ZPQ A;  1JFS A;  3GN5 A;  2AWI A;  3NDB B;  2IV1 A;  1X57 A;  5JUW A;  4OBM A;  1B0N A;  3GBF A;  1WH8 A;  3NZL A;  1PRV A;  3CRO L;  1BDH A;  4I8T A;  2PUB A;  2O38 A;  3TFL A;  1R69 A;  2HFZ A;  3SCG A;  2LCV A;  2CRO A;  1UTX A;  1RPE L;  4EKI A;  4EKG A;  2XSD C;  1QP4 A;  3QOX A;  1HF0 A;  1DW9 A;  1ZZB A;  1S7E A;  4X4E A;  1WIZ A;  4WVL A;  1EFA A;  4X4H A;  2JCG A;  4Y42 A;  2PIJ A;  3GN5 B;  4EZI A;  3A9X A;  2FJR A;  2V3C C;  4O8B A;  1SQ8 A;  2D5V A;  2OR1 L;  3OWQ A;  4JCY A;  1DWK A;  1X2L A;  1ZAY A;  4J1W A;  2PUF A;  3OKZ A;  4OB4 A;  4MCT A;  2ICP A;  1QPZ A;  2L49 A;  5GAG i;  2XI8 A;  4YAR A;  1JWL A;  2MQK A;  3TEP A;  2LYP A;  3PE5 A;  4IA8 A;  2CSF A;  4Z5D A;  1XWR A;  3GZD C;  2BNN A;  1OSL A;  1AU7 A;  2EF8 A;  4IVZ A;  3KXA A;  4FN3 A;  3OQM A;  1JFT A;  4J1X A;  2FFH A;  3QYX A;  3MEJ A;  2KEJ A;  4NDW A;  2HCS A;  3OP9 A;  2KEI A;  3D1N I;  3VWS A;  2AW6 A;  2IUO A;  3QFI A;  1ZZC A;  3SCF A;  3QQ6 A;  1DUL A;  2XXP A;  5DRT A;  1LQC A;  1PRU A;  4MCX A;  3R1F A;  3GZD A;  4JCX A;  3JXB C;  1QZX A;  2PE5 A;  1BDI A;  1E3O C;  1JH9 A;  4I6R A;  3VK0 A;  1HQ1 A;  2PUA A;  2L8N A;  3ME5 A;  2IVQ A;  2PXQ A;  2PXV A;  1UXC A;  4X4D A;  1LCC A;  3EUS A;  1VPW A;  2KEK A;  2VEO A;  1IC8 A;  2XXA A;  3FYM A;  1RIO A;  1NW3 A;  2PPX A;  3GZC A;  2MXD A;  4ER7 A;  4X4F A;  2PUC A;  5DTR A;  3QWG A;  1ADR A;  5DT2 A;  2LLW A;  2PUE A;  2XCJ A;  1O4X A;  3BS3 A;  1RZR A;  1OCT C;  2GRL A;  4I6U A;  3OQO A;  2AXZ A;  4Z58 A;  2R63 A;  3RZZ A;  2J7U A;  2YBD A;  3UFD A;  1WH6 A;  3ZHI A;  1QB2 A;  3LIS A;  4ER3 A;  1UXD A;  1ZS4 A;  4PU7 A;  4F8D A;  2PXB A;  2PXP A;  4PU4 C;  2PUG A;  2KPJ A;  3A9Y A;  4FBI A;  2LYK A;  2GZU A;  3A9Z A;  1ZUG A;  5A7L A;  3LFP A;  2M4H A;  3TRB A;  2PXD A;  1PER L;  5DTQ A;  4YG1 A;  3CLC A;  2IU7 A;  3R09 A;  2XIU A;  3TEL A;  5K98 B;  2PXK A;  2LYS A;  2PXU A;  1QQA A;  2A6C A;  3BDN A;  1PNR A;  2PXF A;  4YBA A;  3G7D A;  3S8Q A;  3NRO A;  1CQT A;  2PXL A;  3CEC A;  2JVL A;  4X4G A;  4DE9 A;  4Z59 A;  2IVG A;  4ER6 A;  2J7W A;  3KJX A;  1ZZ7 A;  4DE8 A;  2EBY A;  5DSX A;  4ER0 A;  3OMT A;  4IWR A;  2PXE A;  2O49 A;  1Y7Y A;  2L1P A;  2AXU A;  1RZS A;  3QOW A;  3DNV B;  2LYL A;  1YSE A;  3B7H A;  4X4B A;  2AUW A;  4EK9 A;  2R1J L;  1QP0 A;  2LYJ A;  3O9X A;  2LLV A;  3IVP A;  5GAH i;  2BJC A;  3OQN A;  2ODR D;  2GRM A;  2MEZ A;  3L1P A;  3DM5 A;  4YG4 A;  1QP7 A;  2AXV A;  2EWT A;  2O4A A;  1NEQ A;  4YG7 B;  3MLF A;  4ER5 A;  2B5A A;  3KL4 A;  1GT0 C;  1Y9Q A;  3QF3 A;  2OFY A;  3PXP A;  1RZR D;  1ZVV A;  2IVB A;  2XJ3 A;  1R63 A;  2HIN A;  3H5T A;  2BNO A;  4X4I A;  1QQB A;  4X4C A;  3ZHM A;  1LCD A;  4Q2J A;  3GUU A;  3UWP A;  4Z5C A;  1L1M A;  2HSG A;  4GHJ A;  3F51 A;  3SX0 A;  3M9L A;  4PU8 A;  2PXT A;  3HZI B;  3FYA A;  3G0T A;  4GQM A;  2H8R A;  3JXC L;  2LYQ A;  3F52 A;  2JQE A;  3KZ3 A;  1MFQ C;  2PUD A;  1CJG A;  1U2Z A;  3ZKC A;  1LMB 3;  3NXH A;  3FMY A;  2BNM A;  3SR4 A;  1LLI A;  1POU A;  1NER A;  2WIU B;  3U3W A; 
#chains in the Genus database with same CATH homology
 4OB4 A;  4MCT A;  2ICP A;  2ICT A;  1QPZ A;  2L49 A;  2XI8 A;  3OMT A;  4IWR A;  4I6T A;  4YAR A;  3G5G A;  2O49 A;  1Y7Y A;  1JWL A;  2PUE A;  2XCJ A;  1O4X A;  2KZ8 A;  2MQK A;  3BD1 A;  3BS3 A;  2AXU A;  1RZR A;  2LYP A;  1RZS A;  1ZZ9 A;  1OCT C;  2WUS R;  4IA8 A;  2CSF A;  2GRL A;  4Z5D A;  4I6U A;  3DNV B;  2LYL A;  1XWR A;  1PRA A;  1YSE A;  2BNN A;  1OSL A;  1AU7 A;  1ZZ6 A;  3OQO A;  2LYR A;  2AXZ A;  3B7H A;  4Z58 A;  1WET A;  3F6W A;  2R63 A;  2AUW A;  4X4B A;  2EF8 A;  2PUA A;  4IVZ A;  3RZZ A;  4PU3 C;  3SCH A;  3JXD L;  2R1J L;  1QP0 A;  3KXA A;  2LYJ A;  4FN3 A;  3OQM A;  3UFD A;  1JFT A;  1WH6 A;  1ZZ8 A;  4J1X A;  3ZHI A;  3O9X A;  3QYX A;  3IVP A;  3LIS A;  4Z5H A;  2KEJ A;  4JQD A;  4NDW A;  1ZPQ A;  2BJC A;  3OQN A;  1JFS A;  3OP9 A;  2KEI A;  3GN5 A;  3D1N I;  1UXD A;  2AWI A;  1ZS4 A;  2AW6 A;  2IUO A;  2IV1 A;  2GRM A;  1X57 A;  4PU7 A;  4F8D A;  2MEZ A;  3L1P A;  1B0N A;  3GBF A;  4PU4 C;  2PUG A;  2KPJ A;  4FBI A;  1WH8 A;  1ZZC A;  3SCF A;  4YG4 A;  1QP7 A;  2LYK A;  1PRV A;  2GZU A;  3QQ6 A;  2AXV A;  3CRO L;  2EWT A;  1BDH A;  1ZUG A;  5A7L A;  2O4A A;  1NEQ A;  4I8T A;  4YG7 B;  3LFP A;  3MLF A;  2B5A A;  2PUB A;  1LQC A;  2O38 A;  1PRU A;  1GT0 C;  1R69 A;  1Y9Q A;  3QF3 A;  3SCG A;  2OFY A;  3PXP A;  3R1F A;  4MCX A;  1RZR D;  2LCV A;  3TRB A;  1ZVV A;  4JCX A;  1PER L;  2CRO A;  2IVB A;  4YG1 A;  3CLC A;  3JXB C;  1UTX A;  2XJ3 A;  1R63 A;  2PE5 A;  1RPE L;  2IU7 A;  2HIN A;  3H5T A;  1BDI A;  2BNO A;  2XIU A;  2XSD C;  4X4I A;  1E3O C;  1JH9 A;  1QQB A;  4X4C A;  5K98 B;  3ZHM A;  1LCD A;  2LYS A;  4I6R A;  3VK0 A;  1QP4 A;  4Z5C A;  2L8N A;  1L1M A;  2HSG A;  1QQA A;  2A6C A;  1HF0 A;  4GHJ A;  1DW9 A;  3F51 A;  1ZZB A;  2IVQ A;  3BDN A;  1PNR A;  1S7E A;  4PU8 A;  4X4E A;  1WIZ A;  1UXC A;  4X4D A;  1EFA A;  1LCC A;  4X4H A;  3HZI B;  3EUS A;  3FYA A;  2JCG A;  4GQM A;  4Y42 A;  2PIJ A;  4YBA A;  3GN5 B;  3G7D A;  2KEK A;  3S8Q A;  1VPW A;  2H8R A;  2FJR A;  1IC8 A;  3JXC L;  2LYQ A;  3F52 A;  1CQT A;  3KZ3 A;  3FYM A;  3CEC A;  2JVL A;  1SQ8 A;  4O8B A;  4X4G A;  2D5V A;  2OR1 L;  1RIO A;  2PUD A;  4Z59 A;  1CJG A;  3ZKC A;  1LMB 3;  2IVG A;  2PPX A;  3KJX A;  4JCY A;  3FMY A;  1DWK A;  1X2L A;  1ZZ7 A;  2BNM A;  4X4F A;  1ZAY A;  1LLI A;  4J1W A;  2PUC A;  1POU A;  1NER A;  2WIU B;  3QWG A;  2PUF A;  1ADR A;  3U3W A;  2EBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...