2CROA

Structure of phage 434 cro protein at 2.35 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of phage 434 Cro protein at 2.35 A resolution.
pubmed doi rcsb
source organism Phage 434
molecule tags Gene regulating protein
molecule keywords REGULATORY PROTEIN CRO
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1988-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2croA00
5K98B 3F52A 2EF8A 1O4XA 3S8QA 1NEQA 2O4AA 3QWGA 3ZHMA 1ZZBA 2AXVA 1X2LA 1LQCA 2JVLA 2BNNA 3TRBA 2PUFA 1ZUGA 4OB4A 1QP0A 4MCXA 2PIJA 2HSGA 4J1XA 4Z5HA 2R1JL 3U3WA 1CJGA 2R63A 2PPXA 2JCGA 2LYKA 4NDWA 1DWKA 3UFDA 1IC8A 2IVGA 2AXZA 4JCYA 3CLCA 2PUAA 3PXPA 4PU3C 3CROL 4Z5DA 3F51A 4Z58A 1ADRA 2EWTA 2WUSR 3BD1A 1L1MA 1SQ8A 2XI8A 1RIOA 1S7EA 2L8NA 3ZHIA 3JXCL 3ZKCA 2PUDA 2AWIA 1LMB3 1YSEA 3OQMA 1ZZCA 2XJ3A 3JXBC 1NERA 3JXDL 2LYRA 3VK0A 4IA8A 4PU8A 3BS3A 2PUGA 2L49A 1JFSA 1JWLA 4YBAA 2EBYA 4JQDA 1ZZ7A 1WH8A 3QQ6A 4F8DA 2AXUA 1QPZA 3GBFA 1R63A 1RZSA 2BNOA 2LYJA 2KEIA 1HF0A 4I6TA 1ZZ6A 2PE5A 4O8BA 4MCTA 2LYPA 1RZRD 2AW6A 2KPJA 3FMYA 3RZZA 2H8RA 1Y9QA 2BJCA 3GN5B 1QP7A 2GZUA 3L1PA 1UXCA 2ICPA 4FN3A 5A7LA 3DNVB 3SCFA 2MQKA 3FYAA 2D5VA 1PNRA 2FJRA 3HZIB 2A6CA 1B0NA 1UTXA 1Y7YA 1DW9A 2IU7A 2LCVA 4X4BA 3QYXA 3GN5A 3H5TA 4X4IA 2IUOA 4GHJA 4Y42A 3G5GA 2XSDC 1JH9A 1RPEL 1OSLA 1ZZ9A 3KZ3A 3SCGA 4X4GA 3SCHA 1PRVA 2GRLA 1BDIA 2B5AA 1LCDA 3O9XA 3BDNA 2CROA 3KJXA 2HINA 3MLFA 4X4CA 4PU7A 4YG4A 4X4HA 3OMTA 2O38A 2BNMA 1CQTA 2XIUA 1POUA 4I6UA 3F6WA 4YG1A 2LYSA 2XCJA 1JFTA 2MEZA 1ZZ8A 2WIUB 4YARA 4X4EA 3FYMA 1WIZA 1WETA 3QF3A 1OCTC 1R69A 2GRMA 3LFPA 4PU4C 1ZAYA 2PUCA 4Z5CA 4JCXA 3IVPA 2PUBA 1E3OC 2OR1L 2AUWA 2IVBA 1PRUA 3EUSA 3R1FA 1AU7A 1RZRA 1XWRA 1ZVVA 3CECA 4Z59A 1LLIA 4GQMA 4YG7B 1EFAA 1WH6A 2ICTA 2IVQA 2CSFA 4X4FA 2OFYA 3D1NI 1ZS4A 2O49A 4X4DA 4IVZA 4J1WA 1X57A 4FBIA 2LYQA 1ZPQA 1PERL 3B7HA 1GT0C 1QQAA 2IV1A 4I8TA 1PRAA 4IWRA 1BDHA 2LYLA 1QQBA 4I6RA 3KXAA 1QP4A 2KEJA 1VPWA 2KEKA 3LISA 3G7DA 1LCCA 3OQNA 3OP9A 1UXDA 3OQOA 2PUEA 2KZ8A
chains in the Genus database with same CATH superfamily
5K98B 2EF8A 1O4XA 1X2LA 3TRBA 1QP0A 1NW3A 2PXUA 4EKGA 2JCGA 1IC8A 3UFDA 2IVGA 4Q2JA 3TELA 3CROL 3ZKCA 3QFIA 3OQMA 1NERA 4ER5A 2L49A 4ER0A 4EZIA 1R63A 2LYJA 2KEIA 2PE5A 2H8RA 1QP7A 3A9YA 3L1PA 2PXTA 5A7LA 3SCFA 1PNRA 2FJRA 2LLVA 2PXFA 4EK9A 4EKIA 4X4BA 2IUOA 4GHJA 4ER6A 4WVLA 3SCGA 3SCHA 3PE5A 1LCDA 3BDNA 2YBDA 4PU7A 5DT2A 4YG1A 2LYSA 3FYMA 1WIZA 2PXLA 1OCTC 1R69A 2GRMA 4JCXA 5DTMA 2PUBA 1E3OC 2PXEA 3R1FA 2ICTA 4X4FA 3D1NI 1PERL 1QQAA 2IV1A 2LNMA 1VPWA 2J7WA 2KEKA 3OQNA 3QOWA 3OQOA 2PUEA 5DRTA 3F52A 3S8QA 1NEQA 3QWGA 4OB4A 2PXBA 4MCXA 4Z5HA 4DE9A 5DTRA 1DWKA 2AXZA 3CLCA 2PUAA 4Z5DA 1ADRA 2WUSR 1L1MA 1SQ8A 2XI8A 3ZHIA 1YSEA 1ZZCA 3JXBC 3VK0A 4IA8A 2PUGA 4JQDA 2HCNA 3QQ6A 3GBFA 2BNOA 4I6TA 4EQZA 1ZZ6A 4O8BA 4MCTA 3SX0A 2XXQA 3FMYA 2VEOA 3QOXA 4FN3A 3DNVB 2XXPA 3FYAA 3HZIB 3R09A 1B0NA 2V3CC 1DW9A 3QYXA 4X4IA 1DULA 4Y42A 3ME5A 5DTQA 4X4GA 3VWSA 2GRLA 2L1PA 4OBMA 2B5AA 3KJXA 3GZDA 3OMTA 2O38A 2XIUA 3F6WA 1JFTA 2XXAA 2WIUB 4YARA 4X4EA 1WETA 3TEPA 2IVBA 3EUSA 1RZRA 4Z59A 1LLIA 1ZS4A 2O49A 4X4DA 1X57A 2LYQA 1ZPQA 1QZXA 3NXHA 5JUWA 4IWRA 3NZLA 1QP4A 3LISA 2M4HA 3G7DA 3OP9A 3NDBB 4HRAA 4ER3A 1ZZBA 1LQCA 2JVLA 1ZUGA 2HCSA 2PXDA 2HSGA 3G0TA 4J1XA 1CJGA 2R63A 2PPXA 2LYKA 4NDWA 3UWPA 4JCYA 2JQEA 2ODRD 4Z58A 2EWTA 3GZCA 1RIOA 3JXCL 1LMB3 2XJ3A 3JXDL 3BS3A 1JWLA 4YBAA 2EBYA 1WH8A 5DSXA 2HFZA 1RZRD 2AW6A 1Y9QA 3GN5B 4DE8A 1UTXA 1Y7YA 2IU7A 3GN5A 2XSDC 3OWQA 1U2ZA 3OKZA 1BDIA 3O9XA 2HINA 3MLFA 3SR4A 2BNMA 1CQTA 4I6UA 2XCJA 1ZAYA 4PU4C 4Z5CA 3IVPA 1PRUA 3NROA 3MEJA 3GUUA 1ZVVA 1XWRA 3CECA 1WH6A 2IVQA 2CSFA 2PXKA 3M9LA 4IVZA 4FBIA 5GAHi 4I8TA 1PRAA 1BDHA 2LYLA 1QQBA 4I6RA 2KEJA 5GAGi 2PXVA 2LLWA 2O4AA 3ZHMA 2AXVA 2BNNA 2PUFA 2PIJA 2R1JL 3U3WA 3GZDC 3PXPA 1MFQC 4PU3C 3F51A 3ZPXA 3BD1A 1S7EA 2L8NA 2PUDA 2AWIA 2LYRA 4PU8A 1JFSA 1ZZ7A 4F8DA 2AXUA 1QPZA 1RZSA 1HF0A 2J7UA 3A9ZA 2LYPA 1QB2A 2KPJA 3RZZA 2BJCA 2GZUA 1UXCA 2ICPA 2MQKA 2D5VA 2A6CA 1HQ1A 5DRYA 2LCVA 3H5TA 3DM5A 3G5GA 1JH9A 1RPEL 1OSLA 1ZZ9A 2MXDA 3KZ3A 1PRVA 2CROA 4X4CA 4YG4A 4X4HA 1POUA 2PXPA 2MEZA 1ZZ8A 3QF3A 3LFPA 2PUCA 2OR1L 2AUWA 3LQXA 1AU7A 4GQMA 4YG7B 1EFAA 3A9XA 3KL4A 3TFLA 2OFYA 2PXQA 4J1WA 3B7HA 1GT0C 3KXAA 4ER7A 2FFHA 1LCCA 1UXDA 2KZ8A
chains in the Genus database with same CATH topology
5K98B 3F52A 2EF8A 1O4XA 3S8QA 1NEQA 2O4AA 3QWGA 3ZHMA 1ZZBA 2AXVA 1X2LA 1LQCA 2JVLA 2BNNA 3TRBA 2PUFA 1ZUGA 4OB4A 1QP0A 4MCXA 2PIJA 2HSGA 4J1XA 4Z5HA 2R1JL 3U3WA 1CJGA 2R63A 2PPXA 2JCGA 2LYKA 4NDWA 1DWKA 3UFDA 1IC8A 2IVGA 2AXZA 4JCYA 3CLCA 2PUAA 3PXPA 4PU3C 3CROL 4Z5DA 3F51A 4Z58A 1ADRA 2EWTA 2WUSR 3BD1A 1L1MA 1SQ8A 2XI8A 1RIOA 1S7EA 2L8NA 3ZHIA 3JXCL 3ZKCA 2PUDA 2AWIA 1LMB3 1YSEA 3OQMA 1ZZCA 2XJ3A 3JXBC 1NERA 3JXDL 2LYRA 3VK0A 4IA8A 4PU8A 3BS3A 2PUGA 2L49A 1JFSA 1JWLA 4YBAA 2EBYA 4JQDA 1ZZ7A 1WH8A 3QQ6A 4F8DA 2AXUA 1QPZA 3GBFA 1R63A 1RZSA 2BNOA 2LYJA 2KEIA 1HF0A 4I6TA 1ZZ6A 2PE5A 4O8BA 4MCTA 2LYPA 1RZRD 2AW6A 2KPJA 3FMYA 3RZZA 2H8RA 1Y9QA 2BJCA 3GN5B 1QP7A 2GZUA 3L1PA 1UXCA 2ICPA 4FN3A 5A7LA 3DNVB 3SCFA 2MQKA 3FYAA 2D5VA 1PNRA 2FJRA 3HZIB 2A6CA 1B0NA 1UTXA 1Y7YA 1DW9A 2IU7A 2LCVA 4X4BA 3QYXA 3GN5A 3H5TA 4X4IA 2IUOA 4GHJA 4Y42A 3G5GA 2XSDC 1JH9A 1RPEL 1OSLA 1ZZ9A 3KZ3A 3SCGA 4X4GA 3SCHA 1PRVA 2GRLA 1BDIA 2B5AA 1LCDA 3O9XA 3BDNA 2CROA 3KJXA 2HINA 3MLFA 4X4CA 4PU7A 4YG4A 4X4HA 3OMTA 2O38A 2BNMA 1CQTA 2XIUA 1POUA 4I6UA 3F6WA 4YG1A 2LYSA 2XCJA 1JFTA 2MEZA 1ZZ8A 2WIUB 4YARA 4X4EA 3FYMA 1WIZA 1WETA 3QF3A 1OCTC 1R69A 2GRMA 3LFPA 4PU4C 1ZAYA 2PUCA 4Z5CA 4JCXA 3IVPA 2PUBA 1E3OC 2OR1L 2AUWA 2IVBA 1PRUA 3EUSA 3R1FA 1AU7A 1RZRA 1XWRA 1ZVVA 3CECA 4Z59A 1LLIA 4GQMA 4YG7B 1EFAA 1WH6A 2ICTA 2IVQA 2CSFA 4X4FA 2OFYA 3D1NI 1ZS4A 2O49A 4X4DA 4IVZA 4J1WA 1X57A 4FBIA 2LYQA 1ZPQA 1PERL 3B7HA 1GT0C 1QQAA 2IV1A 4I8TA 1PRAA 4IWRA 1BDHA 2LYLA 1QQBA 4I6RA 3KXAA 1QP4A 2KEJA 1VPWA 2KEKA 3LISA 3G7DA 1LCCA 3OQNA 3OP9A 1UXDA 3OQOA 2PUEA 2KZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K98 B;  3F52 A;  2EF8 A;  1O4X A;  3S8Q A;  1NEQ A;  2O4A A;  3QWG A;  3ZHM A;  1ZZB A;  2AXV A;  1X2L A;  1LQC A;  2JVL A;  2BNN A;  3TRB A;  2PUF A;  1ZUG A;  4OB4 A;  1QP0 A;  4MCX A;  2PIJ A;  2HSG A;  4J1X A;  4Z5H A;  2R1J L;  3U3W A;  1CJG A;  2R63 A;  2PPX A;  2JCG A;  2LYK A;  4NDW A;  1DWK A;  3UFD A;  1IC8 A;  2IVG A;  2AXZ A;  4JCY A;  3CLC A;  2PUA A;  3PXP A;  4PU3 C;  3CRO L;  4Z5D A;  3F51 A;  4Z58 A;  1ADR A;  2EWT A;  2WUS R;  3BD1 A;  1L1M A;  1SQ8 A;  2XI8 A;  1RIO A;  1S7E A;  2L8N A;  3ZHI A;  3JXC L;  3ZKC A;  2PUD A;  2AWI A;  1LMB 3;  1YSE A;  3OQM A;  1ZZC A;  2XJ3 A;  3JXB C;  1NER A;  3JXD L;  2LYR A;  3VK0 A;  4IA8 A;  4PU8 A;  3BS3 A;  2PUG A;  2L49 A;  1JFS A;  1JWL A;  4YBA A;  2EBY A;  4JQD A;  1ZZ7 A;  1WH8 A;  3QQ6 A;  4F8D A;  2AXU A;  1QPZ A;  3GBF A;  1R63 A;  1RZS A;  2BNO A;  2LYJ A;  2KEI A;  1HF0 A;  4I6T A;  1ZZ6 A;  2PE5 A;  4O8B A;  4MCT A;  2LYP A;  1RZR D;  2AW6 A;  2KPJ A;  3FMY A;  3RZZ A;  2H8R A;  1Y9Q A;  2BJC A;  3GN5 B;  1QP7 A;  2GZU A;  3L1P A;  1UXC A;  2ICP A;  4FN3 A;  5A7L A;  3DNV B;  3SCF A;  2MQK A;  3FYA A;  2D5V A;  1PNR A;  2FJR A;  3HZI B;  2A6C A;  1B0N A;  1UTX A;  1Y7Y A;  1DW9 A;  2IU7 A;  2LCV A;  4X4B A;  3QYX A;  3GN5 A;  3H5T A;  4X4I A;  2IUO A;  4GHJ A;  4Y42 A;  3G5G A;  2XSD C;  1JH9 A;  1RPE L;  1OSL A;  1ZZ9 A;  3KZ3 A;  3SCG A;  4X4G A;  3SCH A;  1PRV A;  2GRL A;  1BDI A;  2B5A A;  1LCD A;  3O9X A;  3BDN A;  2CRO A;  3KJX A;  2HIN A;  3MLF A;  4X4C A;  4PU7 A;  4YG4 A;  4X4H A;  3OMT A;  2O38 A;  2BNM A;  1CQT A;  2XIU A;  1POU A;  4I6U A;  3F6W A;  4YG1 A;  2LYS A;  2XCJ A;  1JFT A;  2MEZ A;  1ZZ8 A;  2WIU B;  4YAR A;  4X4E A;  3FYM A;  1WIZ A;  1WET A;  3QF3 A;  1OCT C;  1R69 A;  2GRM A;  3LFP A;  4PU4 C;  1ZAY A;  2PUC A;  4Z5C A;  4JCX A;  3IVP A;  2PUB A;  1E3O C;  2OR1 L;  2AUW A;  2IVB A;  1PRU A;  3EUS A;  3R1F A;  1AU7 A;  1RZR A;  1XWR A;  1ZVV A;  3CEC A;  4Z59 A;  1LLI A;  4GQM A;  4YG7 B;  1EFA A;  1WH6 A;  2ICT A;  2IVQ A;  2CSF A;  4X4F A;  2OFY A;  3D1N I;  1ZS4 A;  2O49 A;  4X4D A;  4IVZ A;  4J1W A;  1X57 A;  4FBI A;  2LYQ A;  1ZPQ A;  1PER L;  3B7H A;  1GT0 C;  1QQA A;  2IV1 A;  4I8T A;  1PRA A;  4IWR A;  1BDH A;  2LYL A;  1QQB A;  4I6R A;  3KXA A;  1QP4 A;  2KEJ A;  1VPW A;  2KEK A;  3LIS A;  3G7D A;  1LCC A;  3OQN A;  3OP9 A;  1UXD A;  3OQO A;  2PUE A;  2KZ8 A; 
#chains in the Genus database with same CATH topology
 5K98 B;  2EF8 A;  1O4X A;  1X2L A;  3TRB A;  1QP0 A;  1NW3 A;  2PXU A;  4EKG A;  2JCG A;  1IC8 A;  3UFD A;  2IVG A;  4Q2J A;  3TEL A;  3CRO L;  3ZKC A;  3QFI A;  3OQM A;  1NER A;  4ER5 A;  2L49 A;  4ER0 A;  4EZI A;  1R63 A;  2LYJ A;  2KEI A;  2PE5 A;  2H8R A;  1QP7 A;  3A9Y A;  3L1P A;  2PXT A;  5A7L A;  3SCF A;  1PNR A;  2FJR A;  2LLV A;  2PXF A;  4EK9 A;  4EKI A;  4X4B A;  2IUO A;  4GHJ A;  4ER6 A;  4WVL A;  3SCG A;  3SCH A;  3PE5 A;  1LCD A;  3BDN A;  2YBD A;  4PU7 A;  5DT2 A;  4YG1 A;  2LYS A;  3FYM A;  1WIZ A;  2PXL A;  1OCT C;  1R69 A;  2GRM A;  4JCX A;  5DTM A;  2PUB A;  1E3O C;  2PXE A;  3R1F A;  2ICT A;  4X4F A;  3D1N I;  1PER L;  1QQA A;  2IV1 A;  2LNM A;  1VPW A;  2J7W A;  2KEK A;  3OQN A;  3QOW A;  3OQO A;  2PUE A;  5DRT A;  3F52 A;  3S8Q A;  1NEQ A;  3QWG A;  4OB4 A;  2PXB A;  4MCX A;  4Z5H A;  4DE9 A;  5DTR A;  1DWK A;  2AXZ A;  3CLC A;  2PUA A;  4Z5D A;  1ADR A;  2WUS R;  1L1M A;  1SQ8 A;  2XI8 A;  3ZHI A;  1YSE A;  1ZZC A;  3JXB C;  3VK0 A;  4IA8 A;  2PUG A;  4JQD A;  2HCN A;  3QQ6 A;  3GBF A;  2BNO A;  4I6T A;  4EQZ A;  1ZZ6 A;  4O8B A;  4MCT A;  3SX0 A;  2XXQ A;  3FMY A;  2VEO A;  3QOX A;  4FN3 A;  3DNV B;  2XXP A;  3FYA A;  3HZI B;  3R09 A;  1B0N A;  2V3C C;  1DW9 A;  3QYX A;  4X4I A;  1DUL A;  4Y42 A;  3ME5 A;  5DTQ A;  4X4G A;  3VWS A;  2GRL A;  2L1P A;  4OBM A;  2B5A A;  3KJX A;  3GZD A;  3OMT A;  2O38 A;  2XIU A;  3F6W A;  1JFT A;  2XXA A;  2WIU B;  4YAR A;  4X4E A;  1WET A;  3TEP A;  2IVB A;  3EUS A;  1RZR A;  4Z59 A;  1LLI A;  1ZS4 A;  2O49 A;  4X4D A;  1X57 A;  2LYQ A;  1ZPQ A;  1QZX A;  3NXH A;  5JUW A;  4IWR A;  3NZL A;  1QP4 A;  3LIS A;  2M4H A;  3G7D A;  3OP9 A;  3NDB B;  4HRA A;  4ER3 A;  1ZZB A;  1LQC A;  2JVL A;  1ZUG A;  2HCS A;  2PXD A;  2HSG A;  3G0T A;  4J1X A;  1CJG A;  2R63 A;  2PPX A;  2LYK A;  4NDW A;  3UWP A;  4JCY A;  2JQE A;  2ODR D;  4Z58 A;  2EWT A;  3GZC A;  1RIO A;  3JXC L;  1LMB 3;  2XJ3 A;  3JXD L;  3BS3 A;  1JWL A;  4YBA A;  2EBY A;  1WH8 A;  5DSX A;  2HFZ A;  1RZR D;  2AW6 A;  1Y9Q A;  3GN5 B;  4DE8 A;  1UTX A;  1Y7Y A;  2IU7 A;  3GN5 A;  2XSD C;  3OWQ A;  1U2Z A;  3OKZ A;  1BDI A;  3O9X A;  2HIN A;  3MLF A;  3SR4 A;  2BNM A;  1CQT A;  4I6U A;  2XCJ A;  1ZAY A;  4PU4 C;  4Z5C A;  3IVP A;  1PRU A;  3NRO A;  3MEJ A;  3GUU A;  1ZVV A;  1XWR A;  3CEC A;  1WH6 A;  2IVQ A;  2CSF A;  2PXK A;  3M9L A;  4IVZ A;  4FBI A;  5GAH i;  4I8T A;  1PRA A;  1BDH A;  2LYL A;  1QQB A;  4I6R A;  2KEJ A;  5GAG i;  2PXV A;  2LLW A;  2O4A A;  3ZHM A;  2AXV A;  2BNN A;  2PUF A;  2PIJ A;  2R1J L;  3U3W A;  3GZD C;  3PXP A;  1MFQ C;  4PU3 C;  3F51 A;  3ZPX A;  3BD1 A;  1S7E A;  2L8N A;  2PUD A;  2AWI A;  2LYR A;  4PU8 A;  1JFS A;  1ZZ7 A;  4F8D A;  2AXU A;  1QPZ A;  1RZS A;  1HF0 A;  2J7U A;  3A9Z A;  2LYP A;  1QB2 A;  2KPJ A;  3RZZ A;  2BJC A;  2GZU A;  1UXC A;  2ICP A;  2MQK A;  2D5V A;  2A6C A;  1HQ1 A;  5DRY A;  2LCV A;  3H5T A;  3DM5 A;  3G5G A;  1JH9 A;  1RPE L;  1OSL A;  1ZZ9 A;  2MXD A;  3KZ3 A;  1PRV A;  2CRO A;  4X4C A;  4YG4 A;  4X4H A;  1POU A;  2PXP A;  2MEZ A;  1ZZ8 A;  3QF3 A;  3LFP A;  2PUC A;  2OR1 L;  2AUW A;  3LQX A;  1AU7 A;  4GQM A;  4YG7 B;  1EFA A;  3A9X A;  3KL4 A;  3TFL A;  2OFY A;  2PXQ A;  4J1W A;  3B7H A;  1GT0 C;  3KXA A;  4ER7 A;  2FFH A;  1LCC A;  1UXD A;  2KZ8 A; 
#chains in the Genus database with same CATH homology
 5K98 B;  3F52 A;  2EF8 A;  1O4X A;  3S8Q A;  1NEQ A;  2O4A A;  3QWG A;  3ZHM A;  1ZZB A;  2AXV A;  1X2L A;  1LQC A;  2JVL A;  2BNN A;  3TRB A;  2PUF A;  1ZUG A;  4OB4 A;  1QP0 A;  4MCX A;  2PIJ A;  2HSG A;  4J1X A;  4Z5H A;  2R1J L;  3U3W A;  1CJG A;  2R63 A;  2PPX A;  2JCG A;  2LYK A;  4NDW A;  1DWK A;  3UFD A;  1IC8 A;  2IVG A;  2AXZ A;  4JCY A;  3CLC A;  2PUA A;  3PXP A;  4PU3 C;  3CRO L;  4Z5D A;  3F51 A;  4Z58 A;  1ADR A;  2EWT A;  2WUS R;  3BD1 A;  1L1M A;  1SQ8 A;  2XI8 A;  1RIO A;  1S7E A;  2L8N A;  3ZHI A;  3JXC L;  3ZKC A;  2PUD A;  2AWI A;  1LMB 3;  1YSE A;  3OQM A;  1ZZC A;  2XJ3 A;  3JXB C;  1NER A;  3JXD L;  2LYR A;  3VK0 A;  4IA8 A;  4PU8 A;  3BS3 A;  2PUG A;  2L49 A;  1JFS A;  1JWL A;  4YBA A;  2EBY A;  4JQD A;  1ZZ7 A;  1WH8 A;  3QQ6 A;  4F8D A;  2AXU A;  1QPZ A;  3GBF A;  1R63 A;  1RZS A;  2BNO A;  2LYJ A;  2KEI A;  1HF0 A;  4I6T A;  1ZZ6 A;  2PE5 A;  4O8B A;  4MCT A;  2LYP A;  1RZR D;  2AW6 A;  2KPJ A;  3FMY A;  3RZZ A;  2H8R A;  1Y9Q A;  2BJC A;  3GN5 B;  1QP7 A;  2GZU A;  3L1P A;  1UXC A;  2ICP A;  4FN3 A;  5A7L A;  3DNV B;  3SCF A;  2MQK A;  3FYA A;  2D5V A;  1PNR A;  2FJR A;  3HZI B;  2A6C A;  1B0N A;  1UTX A;  1Y7Y A;  1DW9 A;  2IU7 A;  2LCV A;  4X4B A;  3QYX A;  3GN5 A;  3H5T A;  4X4I A;  2IUO A;  4GHJ A;  4Y42 A;  3G5G A;  2XSD C;  1JH9 A;  1RPE L;  1OSL A;  1ZZ9 A;  3KZ3 A;  3SCG A;  4X4G A;  3SCH A;  1PRV A;  2GRL A;  1BDI A;  2B5A A;  1LCD A;  3O9X A;  3BDN A;  2CRO A;  3KJX A;  2HIN A;  3MLF A;  4X4C A;  4PU7 A;  4YG4 A;  4X4H A;  3OMT A;  2O38 A;  2BNM A;  1CQT A;  2XIU A;  1POU A;  4I6U A;  3F6W A;  4YG1 A;  2LYS A;  2XCJ A;  1JFT A;  2MEZ A;  1ZZ8 A;  2WIU B;  4YAR A;  4X4E A;  3FYM A;  1WIZ A;  1WET A;  3QF3 A;  1OCT C;  1R69 A;  2GRM A;  3LFP A;  4PU4 C;  1ZAY A;  2PUC A;  4Z5C A;  4JCX A;  3IVP A;  2PUB A;  1E3O C;  2OR1 L;  2AUW A;  2IVB A;  1PRU A;  3EUS A;  3R1F A;  1AU7 A;  1RZR A;  1XWR A;  1ZVV A;  3CEC A;  4Z59 A;  1LLI A;  4GQM A;  4YG7 B;  1EFA A;  1WH6 A;  2ICT A;  2IVQ A;  2CSF A;  4X4F A;  2OFY A;  3D1N I;  1ZS4 A;  2O49 A;  4X4D A;  4IVZ A;  4J1W A;  1X57 A;  4FBI A;  2LYQ A;  1ZPQ A;  1PER L;  3B7H A;  1GT0 C;  1QQA A;  2IV1 A;  4I8T A;  1PRA A;  4IWR A;  1BDH A;  2LYL A;  1QQB A;  4I6R A;  3KXA A;  1QP4 A;  2KEJ A;  1VPW A;  2KEK A;  3LIS A;  3G7D A;  1LCC A;  3OQN A;  3OP9 A;  1UXD A;  3OQO A;  2PUE A;  2KZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...