4FBIA

Crystal structure of an r46a mutant of the restriction-modification controller protein c.esp1396i (trigonal form)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
76
structure length
75
Chain Sequence
SFLLKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSANLTIKSLELIMKGLEVSDVVFFEMLIKEILKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription
molecule keywords Regulatory protein
total genus 35
structure length 75
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4fbiA00
1DW9A 1R63A 3O9XA 3JXBC 2O49A 1ZZ8A 2PE5A 2MEZA 1LMB3 2ICTA 2IVBA 3F51A 1CQTA 2BNMA 3CLCA 3RZZA 4I8TA 1JFTA 4Z5CA 1GT0C 1BDHA 2L49A 2O4AA 1PRVA 2OFYA 5K98B 4PU8A 3BD1A 1ZZ7A 3OQMA 2R63A 4MCTA 4X4GA 2BNNA 2KEKA 1ZUGA 1LQCA 3F6WA 2XI8A 2GRMA 1X2LA 1Y9QA 4IVZA 3ZHIA 4YG4A 3KJXA 3KZ3A 2LYPA 4X4BA 4Z59A 2XCJA 1RZRA 1B0NA 3ZKCA 3KXAA 3BS3A 2CROA 1PRUA 1HF0A 3U3WA 4IWRA 1QQAA 3QYXA 3GN5A 3LFPA 3F52A 3FMYA 1ZZCA 4PU7A 1IC8A 2IUOA 4JQDA 2IV1A 2LYQA 4YARA 2PPXA 2MQKA 3B7HA 4X4DA 3OQOA 2LYJA 1WH8A 2WIUB 2AWIA 1ZS4A 4GHJA 4Z5HA 3H5TA 2KPJA 1ZZ9A 2B5AA 3GBFA 4J1WA 2D5VA 1EFAA 3DNVB 1AU7A 1ZPQA 3G7DA 3OQNA 2AXZA 1E3OC 1VPWA 1YSEA 2L8NA 1RZRD 2AXVA 3QQ6A 2OR1L 3SCHA 3HZIB 1O4XA 2PUDA 2KEJA 4PU3C 3BDNA 1WIZA 2AW6A 1UXDA 2PUCA 1NEQA 4FBIA 2PUGA 2PUBA 1PRAA 2CSFA 3UFDA 2JCGA 4YG1A 3TRBA 1RPEL 2IVQA 4X4EA 3QWGA 1NERA 2O38A 2AUWA 3R1FA 4Z5DA 4X4FA 4I6RA 1OSLA 2LYLA 3CECA 2LYKA 4JCXA 3EUSA 4GQMA 3MLFA 1POUA 3OMTA 3L1PA 1S7EA 3PXPA 2GRLA 1X57A 2XSDC 2FJRA 4I6UA 3FYAA 2HINA 1Y7YA 3G5GA 2PUEA 1JFSA 1LLIA 1QP0A 4X4IA 1PERL 1OCTC 1SQ8A 1WETA 2AXUA 1UXCA 2XIUA 4OB4A 3SCFA 1QP7A 1JH9A 2LYSA 4PU4C 3LISA 2EWTA 4YG7B 4X4CA 3OP9A 2PIJA 1PNRA 4IA8A 4YBAA 1LCCA 2IU7A 1ZAYA 3VK0A 3JXDL 1LCDA 1UTXA 5A7LA 1ZVVA 4MCXA 2PUFA 3CROL 2BNOA 1ADRA 4J1XA 3GN5B 4X4HA 2XJ3A 3FYMA 2IVGA 3IVPA 3S8QA 1QPZA 2WUSR 2BJCA 2EF8A 1QP4A 2JVLA 4I6TA 2KEIA 4F8DA 3D1NI 1JWLA 2GZUA 4JCYA 2LYRA 2ICPA 2LCVA 1CJGA 1XWRA 1ZZ6A 1QQBA 2H8RA 3ZHMA 3JXCL 1DWKA 4Z58A 1R69A 2R1JL 1L1MA 1RZSA 2KZ8A 3QF3A 4NDWA 3SCGA 2EBYA 2HSGA 1ZZBA 4O8BA 4Y42A 2PUAA 1BDIA 1WH6A 2A6CA 4FN3A 1RIOA
chains in the Genus database with same CATH superfamily
3TELA 3JXBC 2MEZA 1LMB3 2BNMA 5DTRA 4I8TA 1JFTA 2PXFA 1PRVA 3PE5A 2R63A 4Q2JA 3VWSA 2KEKA 1LQCA 3F6WA 4IVZA 1Y9QA 2LYPA 1B0NA 3KXAA 1PRUA 1HF0A 3U3WA 3LFPA 2IUOA 4JQDA 2PPXA 3B7HA 2HCNA 4DE8A 4GHJA 3H5TA 3LQXA 2B5AA 4J1WA 4ER6A 1AU7A 4ER7A 1ZPQA 3G7DA 3NZLA 3TEPA 3GZDC 2JQEA 2AW6A 4FBIA 4YG1A 4X4EA 2O38A 2AUWA 3G0TA 4I6RA 4ER3A 3L1PA 3FYAA 1OCTC 3NDBB 2XIUA 3QFIA 4X4CA 3OP9A 4ER5A 1LCDA 3JXDL 1UTXA 1ZVVA 3CROL 3GN5B 3FYMA 1QPZA 2EF8A 4HRAA 4F8DA 2LCVA 2HSGA 2PUAA 3ZKCA 1DW9A 1R63A 2VEOA 2O49A 2HCSA 1CQTA 3CLCA 2FFHA 2L49A 3BD1A 1ZZ7A 3UWPA 4MCTA 4OBMA 2MXDA 4YG4A 3ZHIA 1QZXA 2XCJA 2XXPA 2YBDA 4IWRA 3SX0A 1ZZCA 2IV1A 2LYQA 1WH8A 1ZS4A 2PXTA 4Z5HA 1EFAA 2L8NA 1RZRD 3QQ6A 3SCHA 2KEJA 4PU3C 1WIZA 1PRAA 3ZPXA 3UFDA 2JCGA 1RPEL 5GAGi 3QWGA 4Z5DA 4X4FA 3CECA 3NXHA 3PXPA 2GRLA 2FJRA 4I6UA 1Y7YA 3A9YA 2PXVA 2PXLA 4EKIA 2LNMA 4OB4A 1QP7A 2LYSA 3LISA 1PNRA 4YBAA 1ZAYA 2J7WA 5A7LA 4MCXA 4J1XA 4X4HA 2XJ3A 3IVPA 2WUSR 2BJCA 4EQZA 4I6TA 3D1NI 3GZCA 2GZUA 2LLVA 2PXPA 3ZHMA 2PXDA 2KZ8A 1BDIA 1RIOA 3GZDA 1ZZ8A 2ICTA 2IVBA 3NROA 3RZZA 4Z5CA 1BDHA 2OFYA 5K98B 4PU8A 3OQMA 5DSXA 1ZUGA 2XI8A 4EZIA 4X4BA 3KZ3A 4Z59A 1RZRA 3BS3A 2CROA 3QYXA 3F52A 5DRYA 4YARA 1QB2A 2M4HA 2KPJA 2D5VA 3SR4A 4EKGA 1E3OC 3OQNA 2AXZA 2AXVA 2OR1L 1WH6A 1O4XA 3BDNA 1UXDA 2PUBA 2CSFA 3TRBA 2IVQA 1OSLA 3R1FA 2LYLA 2J7UA 2LYKA 3R09A 1S7EA 1X57A 3A9ZA 2XSDC 3DM5A 2HINA 5GAHi 2PUEA 5DT2A 3GUUA 1JFSA 2LLWA 1LLIA 1WETA 1SQ8A 3SCFA 5DTMA 3M9LA 2PIJA 4IA8A 1LCCA 2PXQA 1HQ1A 2PUFA 1ADRA 3S8QA 5DTQA 1QP4A 2JVLA 2KEIA 4ER0A 1CJGA 2H8RA 1ZZ6A 1U2ZA 1L1MA 1RZSA 2XXQA 3QF3A 4NDWA 3SCGA 2EBYA 4Y42A 2A6CA 4FN3A 3O9XA 2PE5A 3F51A 4EK9A 1GT0C 2O4AA 2PXEA 4X4GA 2BNNA 2GRMA 1X2LA 3KJXA 2ODRD 3TFLA 2PXKA 4WVLA 1QQAA 3GN5A 2L1PA 2PXUA 3FMYA 2XXAA 4PU7A 1IC8A 2MQKA 4X4DA 2LYJA 2WIUB 2AWIA 1ZZ9A 3GBFA 3DNVB 1VPWA 1YSEA 3HZIB 2PUDA 2V3CC 2PUCA 1NEQA 2PUGA 1DULA 1NERA 4JCXA 3EUSA 4GQMA 3MLFA 1POUA 3OMTA 2PXBA 3ME5A 3G5GA 1QP0A 4X4IA 1PERL 2AXUA 1UXCA 1JH9A 4PU4C 2EWTA 4YG7B 2IU7A 3VK0A 2HFZA 3QOXA 5JUWA 5DRTA 2BNOA 3QOWA 2IVGA 3OWQA 3MEJA 3A9XA 1JWLA 3OKZA 4JCYA 2LYRA 2ICPA 1QQBA 1XWRA 3JXCL 1NW3A 1DWKA 1MFQC 4Z58A 1R69A 2R1JL 4O8BA 1ZZBA 3KL4A 4DE9A 3OQOA
chains in the Genus database with same CATH topology
1DW9A 1R63A 3O9XA 3JXBC 2O49A 1ZZ8A 2PE5A 2MEZA 1LMB3 2ICTA 2IVBA 3F51A 1CQTA 2BNMA 3CLCA 3RZZA 4I8TA 1JFTA 4Z5CA 1GT0C 1BDHA 2L49A 2O4AA 1PRVA 2OFYA 5K98B 4PU8A 3BD1A 1ZZ7A 3OQMA 2R63A 4MCTA 4X4GA 2BNNA 2KEKA 1ZUGA 1LQCA 3F6WA 2XI8A 2GRMA 1X2LA 1Y9QA 4IVZA 3ZHIA 4YG4A 3KJXA 3KZ3A 2LYPA 4X4BA 4Z59A 2XCJA 1RZRA 1B0NA 3ZKCA 3KXAA 3BS3A 2CROA 1PRUA 1HF0A 3U3WA 4IWRA 1QQAA 3QYXA 3GN5A 3LFPA 3F52A 3FMYA 1ZZCA 4PU7A 1IC8A 2IUOA 4JQDA 2IV1A 2LYQA 4YARA 2PPXA 2MQKA 3B7HA 4X4DA 3OQOA 2LYJA 1WH8A 2WIUB 2AWIA 1ZS4A 4GHJA 4Z5HA 3H5TA 2KPJA 1ZZ9A 2B5AA 3GBFA 4J1WA 2D5VA 1EFAA 3DNVB 1AU7A 1ZPQA 3G7DA 3OQNA 2AXZA 1E3OC 1VPWA 1YSEA 2L8NA 1RZRD 2AXVA 3QQ6A 2OR1L 3SCHA 3HZIB 1O4XA 2PUDA 2KEJA 4PU3C 3BDNA 1WIZA 2AW6A 1UXDA 2PUCA 1NEQA 4FBIA 2PUGA 2PUBA 1PRAA 2CSFA 3UFDA 2JCGA 4YG1A 3TRBA 1RPEL 2IVQA 4X4EA 3QWGA 1NERA 2O38A 2AUWA 3R1FA 4Z5DA 4X4FA 4I6RA 1OSLA 2LYLA 3CECA 2LYKA 4JCXA 3EUSA 4GQMA 3MLFA 1POUA 3OMTA 3L1PA 1S7EA 3PXPA 2GRLA 1X57A 2XSDC 2FJRA 4I6UA 3FYAA 2HINA 1Y7YA 3G5GA 2PUEA 1JFSA 1LLIA 1QP0A 4X4IA 1PERL 1OCTC 1SQ8A 1WETA 2AXUA 1UXCA 2XIUA 4OB4A 3SCFA 1QP7A 1JH9A 2LYSA 4PU4C 3LISA 2EWTA 4YG7B 4X4CA 3OP9A 2PIJA 1PNRA 4IA8A 4YBAA 1LCCA 2IU7A 1ZAYA 3VK0A 3JXDL 1LCDA 1UTXA 5A7LA 1ZVVA 4MCXA 2PUFA 3CROL 2BNOA 1ADRA 4J1XA 3GN5B 4X4HA 2XJ3A 3FYMA 2IVGA 3IVPA 3S8QA 1QPZA 2WUSR 2BJCA 2EF8A 1QP4A 2JVLA 4I6TA 2KEIA 4F8DA 3D1NI 1JWLA 2GZUA 4JCYA 2LYRA 2ICPA 2LCVA 1CJGA 1XWRA 1ZZ6A 1QQBA 2H8RA 3ZHMA 3JXCL 1DWKA 4Z58A 1R69A 2R1JL 1L1MA 1RZSA 2KZ8A 3QF3A 4NDWA 3SCGA 2EBYA 2HSGA 1ZZBA 4O8BA 4Y42A 2PUAA 1BDIA 1WH6A 2A6CA 4FN3A 1RIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DW9 A;  1R63 A;  3O9X A;  3JXB C;  2O49 A;  1ZZ8 A;  2PE5 A;  2MEZ A;  1LMB 3;  2ICT A;  2IVB A;  3F51 A;  1CQT A;  2BNM A;  3CLC A;  3RZZ A;  4I8T A;  1JFT A;  4Z5C A;  1GT0 C;  1BDH A;  2L49 A;  2O4A A;  1PRV A;  2OFY A;  5K98 B;  4PU8 A;  3BD1 A;  1ZZ7 A;  3OQM A;  2R63 A;  4MCT A;  4X4G A;  2BNN A;  2KEK A;  1ZUG A;  1LQC A;  3F6W A;  2XI8 A;  2GRM A;  1X2L A;  1Y9Q A;  4IVZ A;  3ZHI A;  4YG4 A;  3KJX A;  3KZ3 A;  2LYP A;  4X4B A;  4Z59 A;  2XCJ A;  1RZR A;  1B0N A;  3ZKC A;  3KXA A;  3BS3 A;  2CRO A;  1PRU A;  1HF0 A;  3U3W A;  4IWR A;  1QQA A;  3QYX A;  3GN5 A;  3LFP A;  3F52 A;  3FMY A;  1ZZC A;  4PU7 A;  1IC8 A;  2IUO A;  4JQD A;  2IV1 A;  2LYQ A;  4YAR A;  2PPX A;  2MQK A;  3B7H A;  4X4D A;  3OQO A;  2LYJ A;  1WH8 A;  2WIU B;  2AWI A;  1ZS4 A;  4GHJ A;  4Z5H A;  3H5T A;  2KPJ A;  1ZZ9 A;  2B5A A;  3GBF A;  4J1W A;  2D5V A;  1EFA A;  3DNV B;  1AU7 A;  1ZPQ A;  3G7D A;  3OQN A;  2AXZ A;  1E3O C;  1VPW A;  1YSE A;  2L8N A;  1RZR D;  2AXV A;  3QQ6 A;  2OR1 L;  3SCH A;  3HZI B;  1O4X A;  2PUD A;  2KEJ A;  4PU3 C;  3BDN A;  1WIZ A;  2AW6 A;  1UXD A;  2PUC A;  1NEQ A;  4FBI A;  2PUG A;  2PUB A;  1PRA A;  2CSF A;  3UFD A;  2JCG A;  4YG1 A;  3TRB A;  1RPE L;  2IVQ A;  4X4E A;  3QWG A;  1NER A;  2O38 A;  2AUW A;  3R1F A;  4Z5D A;  4X4F A;  4I6R A;  1OSL A;  2LYL A;  3CEC A;  2LYK A;  4JCX A;  3EUS A;  4GQM A;  3MLF A;  1POU A;  3OMT A;  3L1P A;  1S7E A;  3PXP A;  2GRL A;  1X57 A;  2XSD C;  2FJR A;  4I6U A;  3FYA A;  2HIN A;  1Y7Y A;  3G5G A;  2PUE A;  1JFS A;  1LLI A;  1QP0 A;  4X4I A;  1PER L;  1OCT C;  1SQ8 A;  1WET A;  2AXU A;  1UXC A;  2XIU A;  4OB4 A;  3SCF A;  1QP7 A;  1JH9 A;  2LYS A;  4PU4 C;  3LIS A;  2EWT A;  4YG7 B;  4X4C A;  3OP9 A;  2PIJ A;  1PNR A;  4IA8 A;  4YBA A;  1LCC A;  2IU7 A;  1ZAY A;  3VK0 A;  3JXD L;  1LCD A;  1UTX A;  5A7L A;  1ZVV A;  4MCX A;  2PUF A;  3CRO L;  2BNO A;  1ADR A;  4J1X A;  3GN5 B;  4X4H A;  2XJ3 A;  3FYM A;  2IVG A;  3IVP A;  3S8Q A;  1QPZ A;  2WUS R;  2BJC A;  2EF8 A;  1QP4 A;  2JVL A;  4I6T A;  2KEI A;  4F8D A;  3D1N I;  1JWL A;  2GZU A;  4JCY A;  2LYR A;  2ICP A;  2LCV A;  1CJG A;  1XWR A;  1ZZ6 A;  1QQB A;  2H8R A;  3ZHM A;  3JXC L;  1DWK A;  4Z58 A;  1R69 A;  2R1J L;  1L1M A;  1RZS A;  2KZ8 A;  3QF3 A;  4NDW A;  3SCG A;  2EBY A;  2HSG A;  1ZZB A;  4O8B A;  4Y42 A;  2PUA A;  1BDI A;  1WH6 A;  2A6C A;  4FN3 A;  1RIO A; 
#chains in the Genus database with same CATH topology
 3TEL A;  3JXB C;  2MEZ A;  1LMB 3;  2BNM A;  5DTR A;  4I8T A;  1JFT A;  2PXF A;  1PRV A;  3PE5 A;  2R63 A;  4Q2J A;  3VWS A;  2KEK A;  1LQC A;  3F6W A;  4IVZ A;  1Y9Q A;  2LYP A;  1B0N A;  3KXA A;  1PRU A;  1HF0 A;  3U3W A;  3LFP A;  2IUO A;  4JQD A;  2PPX A;  3B7H A;  2HCN A;  4DE8 A;  4GHJ A;  3H5T A;  3LQX A;  2B5A A;  4J1W A;  4ER6 A;  1AU7 A;  4ER7 A;  1ZPQ A;  3G7D A;  3NZL A;  3TEP A;  3GZD C;  2JQE A;  2AW6 A;  4FBI A;  4YG1 A;  4X4E A;  2O38 A;  2AUW A;  3G0T A;  4I6R A;  4ER3 A;  3L1P A;  3FYA A;  1OCT C;  3NDB B;  2XIU A;  3QFI A;  4X4C A;  3OP9 A;  4ER5 A;  1LCD A;  3JXD L;  1UTX A;  1ZVV A;  3CRO L;  3GN5 B;  3FYM A;  1QPZ A;  2EF8 A;  4HRA A;  4F8D A;  2LCV A;  2HSG A;  2PUA A;  3ZKC A;  1DW9 A;  1R63 A;  2VEO A;  2O49 A;  2HCS A;  1CQT A;  3CLC A;  2FFH A;  2L49 A;  3BD1 A;  1ZZ7 A;  3UWP A;  4MCT A;  4OBM A;  2MXD A;  4YG4 A;  3ZHI A;  1QZX A;  2XCJ A;  2XXP A;  2YBD A;  4IWR A;  3SX0 A;  1ZZC A;  2IV1 A;  2LYQ A;  1WH8 A;  1ZS4 A;  2PXT A;  4Z5H A;  1EFA A;  2L8N A;  1RZR D;  3QQ6 A;  3SCH A;  2KEJ A;  4PU3 C;  1WIZ A;  1PRA A;  3ZPX A;  3UFD A;  2JCG A;  1RPE L;  5GAG i;  3QWG A;  4Z5D A;  4X4F A;  3CEC A;  3NXH A;  3PXP A;  2GRL A;  2FJR A;  4I6U A;  1Y7Y A;  3A9Y A;  2PXV A;  2PXL A;  4EKI A;  2LNM A;  4OB4 A;  1QP7 A;  2LYS A;  3LIS A;  1PNR A;  4YBA A;  1ZAY A;  2J7W A;  5A7L A;  4MCX A;  4J1X A;  4X4H A;  2XJ3 A;  3IVP A;  2WUS R;  2BJC A;  4EQZ A;  4I6T A;  3D1N I;  3GZC A;  2GZU A;  2LLV A;  2PXP A;  3ZHM A;  2PXD A;  2KZ8 A;  1BDI A;  1RIO A;  3GZD A;  1ZZ8 A;  2ICT A;  2IVB A;  3NRO A;  3RZZ A;  4Z5C A;  1BDH A;  2OFY A;  5K98 B;  4PU8 A;  3OQM A;  5DSX A;  1ZUG A;  2XI8 A;  4EZI A;  4X4B A;  3KZ3 A;  4Z59 A;  1RZR A;  3BS3 A;  2CRO A;  3QYX A;  3F52 A;  5DRY A;  4YAR A;  1QB2 A;  2M4H A;  2KPJ A;  2D5V A;  3SR4 A;  4EKG A;  1E3O C;  3OQN A;  2AXZ A;  2AXV A;  2OR1 L;  1WH6 A;  1O4X A;  3BDN A;  1UXD A;  2PUB A;  2CSF A;  3TRB A;  2IVQ A;  1OSL A;  3R1F A;  2LYL A;  2J7U A;  2LYK A;  3R09 A;  1S7E A;  1X57 A;  3A9Z A;  2XSD C;  3DM5 A;  2HIN A;  5GAH i;  2PUE A;  5DT2 A;  3GUU A;  1JFS A;  2LLW A;  1LLI A;  1WET A;  1SQ8 A;  3SCF A;  5DTM A;  3M9L A;  2PIJ A;  4IA8 A;  1LCC A;  2PXQ A;  1HQ1 A;  2PUF A;  1ADR A;  3S8Q A;  5DTQ A;  1QP4 A;  2JVL A;  2KEI A;  4ER0 A;  1CJG A;  2H8R A;  1ZZ6 A;  1U2Z A;  1L1M A;  1RZS A;  2XXQ A;  3QF3 A;  4NDW A;  3SCG A;  2EBY A;  4Y42 A;  2A6C A;  4FN3 A;  3O9X A;  2PE5 A;  3F51 A;  4EK9 A;  1GT0 C;  2O4A A;  2PXE A;  4X4G A;  2BNN A;  2GRM A;  1X2L A;  3KJX A;  2ODR D;  3TFL A;  2PXK A;  4WVL A;  1QQA A;  3GN5 A;  2L1P A;  2PXU A;  3FMY A;  2XXA A;  4PU7 A;  1IC8 A;  2MQK A;  4X4D A;  2LYJ A;  2WIU B;  2AWI A;  1ZZ9 A;  3GBF A;  3DNV B;  1VPW A;  1YSE A;  3HZI B;  2PUD A;  2V3C C;  2PUC A;  1NEQ A;  2PUG A;  1DUL A;  1NER A;  4JCX A;  3EUS A;  4GQM A;  3MLF A;  1POU A;  3OMT A;  2PXB A;  3ME5 A;  3G5G A;  1QP0 A;  4X4I A;  1PER L;  2AXU A;  1UXC A;  1JH9 A;  4PU4 C;  2EWT A;  4YG7 B;  2IU7 A;  3VK0 A;  2HFZ A;  3QOX A;  5JUW A;  5DRT A;  2BNO A;  3QOW A;  2IVG A;  3OWQ A;  3MEJ A;  3A9X A;  1JWL A;  3OKZ A;  4JCY A;  2LYR A;  2ICP A;  1QQB A;  1XWR A;  3JXC L;  1NW3 A;  1DWK A;  1MFQ C;  4Z58 A;  1R69 A;  2R1J L;  4O8B A;  1ZZB A;  3KL4 A;  4DE9 A;  3OQO A; 
#chains in the Genus database with same CATH homology
 1DW9 A;  1R63 A;  3O9X A;  3JXB C;  2O49 A;  1ZZ8 A;  2PE5 A;  2MEZ A;  1LMB 3;  2ICT A;  2IVB A;  3F51 A;  1CQT A;  2BNM A;  3CLC A;  3RZZ A;  4I8T A;  1JFT A;  4Z5C A;  1GT0 C;  1BDH A;  2L49 A;  2O4A A;  1PRV A;  2OFY A;  5K98 B;  4PU8 A;  3BD1 A;  1ZZ7 A;  3OQM A;  2R63 A;  4MCT A;  4X4G A;  2BNN A;  2KEK A;  1ZUG A;  1LQC A;  3F6W A;  2XI8 A;  2GRM A;  1X2L A;  1Y9Q A;  4IVZ A;  3ZHI A;  4YG4 A;  3KJX A;  3KZ3 A;  2LYP A;  4X4B A;  4Z59 A;  2XCJ A;  1RZR A;  1B0N A;  3ZKC A;  3KXA A;  3BS3 A;  2CRO A;  1PRU A;  1HF0 A;  3U3W A;  4IWR A;  1QQA A;  3QYX A;  3GN5 A;  3LFP A;  3F52 A;  3FMY A;  1ZZC A;  4PU7 A;  1IC8 A;  2IUO A;  4JQD A;  2IV1 A;  2LYQ A;  4YAR A;  2PPX A;  2MQK A;  3B7H A;  4X4D A;  3OQO A;  2LYJ A;  1WH8 A;  2WIU B;  2AWI A;  1ZS4 A;  4GHJ A;  4Z5H A;  3H5T A;  2KPJ A;  1ZZ9 A;  2B5A A;  3GBF A;  4J1W A;  2D5V A;  1EFA A;  3DNV B;  1AU7 A;  1ZPQ A;  3G7D A;  3OQN A;  2AXZ A;  1E3O C;  1VPW A;  1YSE A;  2L8N A;  1RZR D;  2AXV A;  3QQ6 A;  2OR1 L;  3SCH A;  3HZI B;  1O4X A;  2PUD A;  2KEJ A;  4PU3 C;  3BDN A;  1WIZ A;  2AW6 A;  1UXD A;  2PUC A;  1NEQ A;  4FBI A;  2PUG A;  2PUB A;  1PRA A;  2CSF A;  3UFD A;  2JCG A;  4YG1 A;  3TRB A;  1RPE L;  2IVQ A;  4X4E A;  3QWG A;  1NER A;  2O38 A;  2AUW A;  3R1F A;  4Z5D A;  4X4F A;  4I6R A;  1OSL A;  2LYL A;  3CEC A;  2LYK A;  4JCX A;  3EUS A;  4GQM A;  3MLF A;  1POU A;  3OMT A;  3L1P A;  1S7E A;  3PXP A;  2GRL A;  1X57 A;  2XSD C;  2FJR A;  4I6U A;  3FYA A;  2HIN A;  1Y7Y A;  3G5G A;  2PUE A;  1JFS A;  1LLI A;  1QP0 A;  4X4I A;  1PER L;  1OCT C;  1SQ8 A;  1WET A;  2AXU A;  1UXC A;  2XIU A;  4OB4 A;  3SCF A;  1QP7 A;  1JH9 A;  2LYS A;  4PU4 C;  3LIS A;  2EWT A;  4YG7 B;  4X4C A;  3OP9 A;  2PIJ A;  1PNR A;  4IA8 A;  4YBA A;  1LCC A;  2IU7 A;  1ZAY A;  3VK0 A;  3JXD L;  1LCD A;  1UTX A;  5A7L A;  1ZVV A;  4MCX A;  2PUF A;  3CRO L;  2BNO A;  1ADR A;  4J1X A;  3GN5 B;  4X4H A;  2XJ3 A;  3FYM A;  2IVG A;  3IVP A;  3S8Q A;  1QPZ A;  2WUS R;  2BJC A;  2EF8 A;  1QP4 A;  2JVL A;  4I6T A;  2KEI A;  4F8D A;  3D1N I;  1JWL A;  2GZU A;  4JCY A;  2LYR A;  2ICP A;  2LCV A;  1CJG A;  1XWR A;  1ZZ6 A;  1QQB A;  2H8R A;  3ZHM A;  3JXC L;  1DWK A;  4Z58 A;  1R69 A;  2R1J L;  1L1M A;  1RZS A;  2KZ8 A;  3QF3 A;  4NDW A;  3SCG A;  2EBY A;  2HSG A;  1ZZB A;  4O8B A;  4Y42 A;  2PUA A;  1BDI A;  1WH6 A;  2A6C A;  4FN3 A;  1RIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...