3KL4A

Recognition of a signal peptide by the signal recognition particle
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
431
structure length
412
Chain Sequence
GLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition 54 kDa protein
publication title Recognition of a signal peptide by the signal recognition particle.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 116
structure length 412
sequence length 431
ec nomenclature ec 3.6.5.4: Signal-recognition-particle GTPase.
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 3kl4A03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kl4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kl4A02
1TPZA 2QAGC 4ASUA 1WMSA 1FUKA 2AL7A 4XSGA 3HPQA 3B82A 1G8GA 2BCGY 5H68A 1G18A 2HF9A 5FPKA 2O8FA 3T15A 4CIDA 1XPUA 3U44B 4RZUA 1KO8A 2QRZA 4Q02A 4Z1MD 2NO7A 2LWIA 2QTHA 4CEJB 1CF4A 4DJTA 1NY6A 2IYXA 3RS7A 4LBVA 4NDZA 1YR9A 4GRAA 5FOWA 4Q4LA 2ZI6A 5CITA 1CJVC 5FPTA 4GMXA 3K53A 4PSKA 4KSBA 3VHXA 4V0NA 1QBKC 4QBGB 4A4DA 3BH7A 3K0EA 3G0HA 2PEZA 2ERXA 4LHZA 2PXDA 2PXVA 4LWZA 4PPNA 4Q4HA 2PX3A 3UPUA 1DTSA 3L0PA 3MWLA 3T5DA 1OFUX 1D9XA 2CVHA 3BAFA 3PJRA 1HQYE 3ZZTA 1W4RA 5F9HA 3MD0A 2IHBA 4AYWA 1SVKA 1VHTA 1X1SA 3U7GA 4KFTA 4BZQA 4QHTA 4QRHA 1EFTA 1XXHB 2ZJAA 4EPWA 2C95A 3G82C 3IBGA 4KAXA 3AVYA 4LK2A 2D2EA 2WOOA 4OQMA 4LJ7A 2ECKA 2OILA 1E96A 2Q0HA 3CNNA 1R10A 2OBMA 2ODWA 4BWYA 2PXLA 1OSNA 1ZM9A 2BJVA 1BMFA 1Z83A 3THWB 2ZQ5A 4QC2A 2QAGB 4PQFA 4AKHA 1G3MA 4Q1BA 1E32A 3DZ8A 2VEDA 4LRWA 2VP4A 5DN6A 1G8FA 4G0NA 2JDID 4JS0A 3BRWD 3B13B 2IUTA 1V5WA 3EPKA 5JS7A 2BEJA 4C0QC 2BM1A 2O8BB 3VKWA 4GNKA 3SI7A 2DWPA 2QM7A 4WZBE 3KJGA 3X1ZA 2AXPA 2QORA 3W5IA 3PFIA 4EPXA 2NOAA 3WMGA 1JR3A 1F60A 1U9IC 1UAAA 3SJBA 4TMWA 1BS1A 3WBJA 1SXJE 4BFZA 4A82A 2P67A 2ZRAA 4KFRA 3EG5A 3SBEA 3LNCA 3LXXA 3PUVA 3ADKA 2H18A 2KI5A 3RRMA 1M7GA 1OJLA 721PA 4N1AA 5JHGB 3TW8B 2YWEA 3D3QA 2RGNA 1VG0B 2ATVA 3TKLA 4CYMA 4B35A 2Q3HA 2HV8A 1D8TA 4ESVA 2F1RA 1JXOA 2PJZA 3IHWA 2AWNA 3S1AA 4YDSA 1DELA 3QY0A 3A36A 4OJQA 4M22A 4WXPA 4M4SA 2F7SA 1Z22A 1GUAA 2HLDD 4UNNA 2DFLA 3NBZC 3GLGE 5JSZB 2VQSA 1M1YE 1N2CE 5E7JA 1RZ3A 1Q1ZA 1Q22A 2HXYA 4V0OA 2QPTA 5JWHA 2CVFA 4RCZA 1N6PA 1IBRA 4ZKDA 1XX6A 3EASA 3HU2A 2EU8A 4TLEA 1KYIA 2LCFA 2X19A 4FIDA 4IHQA 3D8BA 2IA5A 3R7WB 4E5UA 1RIFA 3Q85A 5TMPA 2DCUA 5CK4A 3AKCA 3WYAA 5F98A 3H84A 1G7SA 3AEZA 1N6LA 5A4JA 2ZSBA 3HP1A 1LFDB 1WRBA 1NJGA 1XD2A 1R5BA 3IQWA 3FKSD 1UM8A 2CNWD 1PUJA 2NPIA 4L15A 5HTKA 3RAPR 4BZPA 1EWQA 1E98A 1T5LA 4DLZA 4PC6A 1UBEA 5BW8A 5FI1B 1FX0B 1GTVA 2JJ2A 4IEIA 1JAHA 5GADl 1IXZA 2YC4C 3CH4B 1VG1A 4HZIA 1COWD 2B92A 3QKSA 4LSGA 3A37A 4XH9B 5TARA 2QGZA 2IWHA 2Z6VA 2PT7A 3DMNA 4PXAA 1IJEA 3A4NA 2FZLA 1ZU4A 2YKGA 4KO8A 4PHTA 1JJ7A 1V43A 4MRSA 5LB4A 1II8A 1CBUA 4WVFA 4B74A 2C9OA 3AB3A 4I4LA 4MGZR 1GSIA 2OBNA 4EFMA 2O8DA 4A6PA 1E2DA 4HAZA 3TUJC 3F0TA 1KJYA 5KSPA 5JLJA 2ODEA 2NG1A 2VL7A 2O5VA 3SOPA 3RHFA 2PH1A 1D2NA 2PX0A 1RYHA 3T1VA 4DIDA 2RGBA 4TTPA 1E2MA 1TQDA 3KUDA 2P5SA 3QEJA 4D81A 1A7JA 2AWOA 1ZRHA 3ICQB 4GT1A 1A1VA 4IXMA 1VKJA 4L16A 4IDOA 2ZM5A 1KDOA 3I3SR 2WKRA 5KUTA 1OFHA 3MUFA 5DLQC 3GLIB 5E4FA 2GILA 4TTQA 2ZUBA 3PG5A 2YHSA 4BFXA 3AUXA 1EFHA 5IF9A 3O8CA 1XEWY 2ZS8A 4DLRA 2GJSA 3Q7PA 4ZCIA 2FNAA 3K1JA 3QKRA 1KZ7B 4DSTA 4LJ4A 5C18A 1JB1A 3QOFA 2W2VA 5L8VA 2J7PA 1NN0A 1RFLA 1T9HA 3ZS9A 4PAQA 5CDFE 4DLWA 1HTWA 4HLCA 3WRXC 1GP2A 2R65A 2G0TA 5EZ5A 2F3TA 3K9NA 4MITA 2FG5A 1YZGA 5IHPA 1NVUQ 1T3HA 4XJXA 4PPFA 5GJWC 4OI2A 5JS8A 2O0HA 2ZS9A 2V4ZA 1KZGB 2IEZA 1L4UA 4NZYA 4KSCA 1CJTC 3I5YA 3MRSA 3ZVLA 2D7DA 4RD2A 1LY1A 4HDCA 2P3SA 3AGPA 3SJAA 2GXSA 1GNPA 3SYLA 1AQUA 4LGMA 2NTYC 4PC1A 1AN0A 3CH5A 4M0LA 4KVAA 2O8EA 3AKYA 2IEYA 1IOZA 5A5GA 2ZSDA 3BB1A 2CCGA 3B1ZA 4GL2A 2FE4A 2ZSFA 4Q1EA 2JAQA 4TLAA 2QTVB 3BS4A 1XPOA 3QG1A 1R0ZA 1UPTA 2PZFA 2JEOA 3TH5A 2ZUCA 2GHIA 1IHUA 3ZS8A 1SHZA 3NVAA 1RPZA 1Z5ZA 4LBYA 3A6PC 2PMKA 1ZNYA 4EJSB 4B47A 1FP7A 2KJQA 4KCGA 1NG1A 4P32A 3SQXA 2FFHA 2NO9A 1NSFA 1JAIA 5JWOA 4L9SA 4IXNA 5FPYA 1UEIA 1KKLA 2ZJOA 1TQ6A 5CYPA 1NMZA 3VX3A 1GAJA 3EZ2A 4HLUC 4OJKA 1DBSA 2PZGA 3KXLA 4V03A 4YMUA 2W6JD 1TEXA 3UMSA 2BIFA 2D06A 5JI3E 4MA4A 2NQ2C 4MRRA 5JCZA 1KDRA 1PVOA 4A1FA 4Q9IA 1ZM4A 3GEHA 3ETLA 3X1DA 4KFSA 4E22A 1E4VA 1G5TA 2PCLA 3PUZA 2IYVA 1VMAA 1GZSA 1VHLA 3FDIA 2GWHA 1G8PA 1MFQC 1XTRA 5CM9C 1KNXA 1EK0A 1J8YF 1XEXB 1HQCA 2BMDA 4QGFA 1FZQA 4GMDA 1MR3F 2GDJA 2ZVPX 4NCNA 3H4MA 2GVZC 3VR6A 5G53C 4C30A 2ONKA 5GVSA 4CEHB 1NMYA 3EC1A 4YXWA 5KYKA 4LYFA 3IEVA 3UG7A 1H8HD 3OEHA 4QGGA 1N6KA 4D25A 1Q3HA 2F3RA 1NBMA 2AD1A 2E9SA 3HR7A 1Z6AA 4A2QA 2SHKA 1KI3A 2JASA 1W2HA 1TUEA 3HWSA 3WMFA 1MABB 4BLTA 3SYNA 4BFYA 3THXB 4BRWA 5HKKD 3EPJA 3GJ6A 1VCNA 1Q12A 2J3EA 3I61A 4BLPA 2GEUA 2IYRA 4I1UA 2DY1A 2B8TA 1WXQA 2J1LA 1E1RD 1P9WA 1UKYA 2J45A 1CR2A 4NTZA 3LH5A 2QPOA 4A0GA 3O47A 2ZE5A 3T1QA 2WWYA 4YMVA 4HUTA 3THYB 2C04A 2B8WA 5EJEA 4A8JA 1N6IA 4Q1CA 3GJ7A 1PV4A 3K0AB 4JMPA 1ESMA 2XXAB 3GLIE 2VP2A 4NYJR 4Q03A 3PEWA 3GLHA 2OESA 1T0JB 1G6HA 2ORWA 2JLUA 5GJBA 1EESA 3P20A 2ORVA 3NH6A 4DLYA 3RABA 1WF3A 2HCJB 3A8TA 3VR5A 2B21A 1UFQA 2GAOA 3HR8A 3VAAA 1NIPA 3RS2A 2JLXA 3AGQA 1W4AA 1PUIA 1ZINA 2CXXA 2XITA 2DHRA 1NY5A 1X86B 3BGWA 1TU3A 3BIFA 3A4MA 3I8SA 3Q5DA 2WSSD 2WM9B 1W5TA 1GL9B 4TMKA 3MWKA 1ODFA 3LBHA 4FD2A 3GD7A 5TY0A 4DLXA 1G7RA 2FGJA 5TB5A 4MGYR 5B30A 1VIAA 2AFIE 4QNRA 1W49A 5E3HA 1Z0AA 2QMHA 3NEYA 4MH0R 3QBTA 2GBLA 1WCV1 3LA6A 1E1QA 3WNCA 1OYYA 1US8A 4OQLA 4KYUA 3TLXA 4YLGA 1GKIA 2G3YA 4B6FA 1II9A 3RNLA 1X8KA 4IOJA 2D7CA 2WHXA 3NC0C 5C46F 1DADA 2OEPA 2XNSA 2PBRA 3EPHA 2PCJA 2FN4A 3HU3A 3ND9A 3KKPA 1T8TA 3LDAA 2OAQ1 1AKEA 2F9MA 2VP6A 3TUIC 1E9FA 1S4QA 1ZIPA 3DOFA 3Q72A 4UXIA 5F3WB 1F2UB 4DKXA 5DGXA 1X3SA 1W47A 1HA3A 3CB4A 3NBXX 3QQ5A 1Z6XA 3U7HB 1IN8A 4JBWA 4DEXA 4LJ9A 8OHMA 3AVVA 1CU1A 2O8CA 3WYGA 1DULA 1ZNZA 2BOVA 4DEYA 2IXEA 2FSIA 3LWNA 3Q8XB 1XCPA 4LJ5A 4LDJA 1CKEA 5KDOA 4RJLA 4W5JA 2V1XA 5DSZA 4M2LA 4ILEA 4DC9A 3VU9B 4OHYA 2E87A 1W2GA 2IWRA 4NBSA 3OAAD 3PR1A 2WWWA 1Z2CA 3RS4A 4HB3A 4FMCF 1H8EA 4W5HA 4YC7A 2N46A 5DI3B 3MWYW 5FTLA 1J7KA 3U61B 2RH5A 2UZIR 5BN4A 4ZV4A 2ASEA 5A0FA 4OI0A 1CRPA 5P21A 3SS8A 1AZSC 1GITA 5LDDC 4JLPA 1NI3A 3QXXA 2ZJZA 2ZRPA 4KITB 1N5JA 5CM8B 3I62A 4MKFA 1KDTA 3VHLB 4JVMA 2PXBA 3CX6A 3AF0A 2Y8EA 4TMVA 2JIZD 4PHFA 2BKEA 4X8LA 1P61B 2GETA 5L3QB 4NL4H 4F4JA 1UBCA 2HEIA 1KI6B 1TEVA 3LD9A 1FTNA 4CF7A 1UKVY 3B85A 4NYJQ 2ZVQX 3TR0A 4TLDA 2DR3A 4BEJA 2WV9A 4YQFA 3D31A 3G5UA 2PXEA 2RB4A 2AX4A 1KK2A 2C77A 1GNQA 4C0JA 1Q1QA 2GA8A 4U5XA 3HYTA 1WP9A 4G1UC 2OG2A 4ZCLA 5JRJA 4JJZA 2QU8A 5F9FA 2DYKA 3BB4A 4TMTA 1QZXA 2PL3A 2GTPA 1P62B 3WXMA 5AJVB 4BRUA 2FSGA 1MO4A 2CEAA 1G4UR 3AP2A 3IO3A 4QL3A 5L3RA 4E03A 1X8LA 2QA5A 5JCPA 2IS2A 5DNYB 1W36D 4PHGA 3ONWA 5JRZA 4PSAA 3U3KA 4DIEA 5KHOC 2W2XA 4W5WA 3L43A 5B2ZA 1DARA 1NKTA 1HY3A 4HAXA 5FL7D 1XB2A 4DT1A 3ZLJA 2RCNA 1XTIA 1X1RA 4K81B 4LJ8A 2JQEA 2AD5A 1ZCBA 1SXJA 3E1SA 1LTQA 4MYCA 1KAOA 2YYZA 4XWAA 1BIFA 3B2EA 2K5UA 4Z54A 4UNSA 1S1MA 4Q9HA 1NN5A 2MSEB 3OF5A 4YONB 1T91A 2H1LA 3LBIA 4Q4JB 3E70C 5CJ2A 3QXCA 2QY9A 5G41A 1E79D 3DM9B 1JPNA 3U3OA 1D2MA 2CL0X 1UDXA 2OFXA 4DDVA 1S96A 1QHHB 2AFHE 4LHWA 5G3YA 4B75A 4V0LA 2BJWA 2CJWB 4B71A 1UBFA 2IF2A 3FVQA 1QHXA 4L4UA 5JJIA 4G01B 4NP6A 5EP1A 4M1MA 1DG1G 2VBCA 1U98A 2RGEA 3GLGA 3EZFA 3QEOA 3MJHA 5GJVC 2JATA 1ZNWA 4U02A 1J2JA 2I4IA 1OB2A 1Q3TA 4FMDF 4GSYA 4Q66C 2ZU0C 1MT0A 4EPVA 1SVOA 3DMDA 4F7WA 1OFIA 1A5TA 1Z28A 3BFXA 5DI9A 4NHOA 3R8FA 3OFNA 5JBQA 2GF9A 1PLJA 3ZJYA 1S8FA 3KB2A 3VKHA 1CLUA 3NH9A 5J4VA 2JLWA 3EIHA 1W0JA 4TYPA 2N1BA 4DBLC 1P60A 1OKKA 2ZI7A 3AF3A 3VQTA 3SR0A 1D2EA 5IDVA 2FU5C 3U7EB 2A9KA 3P1JA 5FOVA 3C5CA 1G5RA 3UATA 1E4YA 2CK3A 1G7TA 1KJWA 1U99A 2ANCA 4ZI3A 4DCTA 2ZRCA 3U60B 3KKQA 3TSOA 5L3SA 2UVQA 1TADA 3C5HA 1XFAA 4L9WA 4QNMA 2J9RA 2NGRA 1I4TD 3QXSA 3ZQJA 4B73A 1D6JA 3GLFE 2IYZA 2H16A 1P73A 2IC5A 3AVOA 4B43A 5FTMA 1ZD1A 3LW8A 3KQKA 1W1WA 1EWRA 1W36C 4HYYA 3IQXA 3X1YA 2QG6A 4AG6A 3BFKA 2ZYTX 3ADCA 4TSFD 2FSFA 1TNDA 2YOGA 2OAP1 4FN5A 3EZ6A 1AGPA 2E1RA 4MRVA 4BFTA 1IXSB 3RSLA 1SKQA 4N3NA 1UKZA 3GPLA 4BPBA 3TNFA 2VHQA 2VP9A 3UKDA 4IRUB 4HUQB 2RMKA 5FFMA 3K0FB 2EFHB 4JSYA 1SKYE 3ZVRA 2VHTA 3RS3A 1YE8A 2I1VB 4Q4AB 1TL7C 3OEEA 4OQNA 5BYJA 3RWOA 2OBLA 1E2QA 4O25A 2OLJA 4JKIA 1E2PA 4Z8XA 5FI0B 4NCKA 3CW2A 3C4JA 3ZZ0A 5B57C 1G8YA 4PO9A 1P3JA 4JYBA 3MJRA 4EDHA 4OHWA 1N5KA 2WJJA 4Z8YA 2R2AA 3W6OA 1AS3A 2FPLA 3KTAB 4KBFA 5CDFA 4ABYA 5C1BA 1PLLA 521PA 2FFAA 1XJ0A 3E2IA 1DAMA 4RFSA 1K8RA 2BBWA 2EWWA 5FUVA 1ZW6A 1Z0JA 2WWXA 2O8FB 2X2EA 4NONA 1NLZA 4BE7B 5AUPB 4G5RA 2H8KA 2RGGA 3SHWA 4M9QA 2W6IA 2C03A 3I4LA 2ZAMA 4PZYA 5FOSA 4AI6A 3LRPA 4WBSA 5KNCA 2PXPA 3HDTA 1ZUNB 2OCAA 3CWZA 4JSTA 3IDQA 2GCOA 4EPTA 2OSBA 2ZYUX 3F8TA 2NO1A 1HH4A 4PQYA 1CR1A 2WJHA 3V9PA 4Q4HB 4B2LA 4RD0A 1FPMA 1L4YA 2YNMA 1MO5A 3Q5EA 5F2EA 5KSZA 3TSWA 4C7OA 4ZCMA 3J81k 2A2ZA 1KSGA 4NCIA 4LV8B 3QI2A 4NCJA 3RRZA 3AP1A 4AKEA 2RGNC 1OXXK 3K9GA 4M1KA 2D2FA 2GJ9A 3CF6R 4DUGA 1ZC3A 1O87A 4UNRA 4MRPA 4QG7A 2V8OA 5EZ6B 1G6OA 4TZ6A 3NHAA 4R71A 5KNBA 4XD7A 2WTUA 4II7A 2J59A 1ZIOA 5C4GB 1T0HB 3MFYA 1M6NA 2J7PD 4M9ZA 2V6JA 1TU4A 3VR4A 2EFCB 4HLDA 2ZJ2A 4OK6A 2LKCA 5HR5A 2J0SA 4IW3B 1FUUA 2QENA 4KYIB 4M21A 4D0LB 2XZOA 3AVPA 4IVPA 4BGDA 5CYOA 3JVVA 2ZAOA 3GJ4A 3LAWA 2QQEA 2VTKA 1E3MA 2QRNA 1ZBDA 4B3BA 2XJ9A 2BMFA 1VTKA 4P0TA 3HPRA 1KY2A 2A7QA 4PPQA 3SJZA 3QVVA 1SGWA 3LW7A 3ZYCA 4JIMA 1QB2A 1I4LD 1L7VC 3CONA 4MYUA 2BBOA 3PEVA 2EQBA 2QZ4A 1W4CA 4PFSA 1ZD9A 2QSYA 4P4TA 4LX0A 1LF0A 1KHTA 3EXAA 1N6HA 3ZIAD 5KNDA 1T4GA 4MKHA 4EIWA 2RGXA 5IK2D 3GJ8A 2R6FA 1WE2A 2WWIA 2ZTSA 4BECA 2IYLD 2J0UA 4C0LA 4G5OA 5JECA 4JLNA 1TUIA 4I99A 3UIEA 1XTKA 5BN3A 3SZRA 3A1WA 4Z1MA 3U3RA 3A1UA 1FW6A 1Z06A 3CBQA 4LC1A 5EP4A 3S1AB 2QBYA 4EPYA 3C14C 1DOAA 4UXJA 1BYIA 2ZYWX 2FGKA 3IO5A 4HATA 4HAWA 4R9UC 3W8NA 5FR1A 1CR0A 3T12A 1RJ9A 1DE0A 3QBVA 4PC7A 1S2MA 4DLVA 2VF8A 2ZPTX 2ZSEA 2CE7A 3TQFA 2FA9A 1WBBA 3A58B 4M1OA 2XTZA 2WMNB 1XDBA 1VCOA 4Q21A 1L8QA 5K8UA 2R8RA 3AKEA 2XOKA 2XTNA 2IUSA 4OQFA 2G1KA 2AKYA 3GJXC 3SYKA 2HDNB 3QPUA 5KU1A 2X8AA 5J40A 221PA 2XTMA 4KLNA 4NH0A 4Q1AA 5SZJA 2IS4A 3KJEA 4H1VA 4A9AA 4Q00A 2VSXA 4JBYA 3R20A 4K8OA 4AYXA 2BHRA 4MGIR 1XD2B 4CT4B 3NDPA 4M1YA 4LJYA 4Q18A 1CS4C 1XEFA 4Y0AA 2D4HA 2BEKA 1XXHE 3SFZA 3B7GA 2IUUA 2VHJA 4RCYA 1CJKC 3GFTA 4G5SA 2JDIA 1YZQA 4XTCS 3SC3A 4EJSC 2R6GA 1R7RA 1HUQA 1E2FA 3QKSB 1IJFA 3SHFA 1NLYA 1QHYA 1AM4D 3AH8A 2DWQA 2WBLC 1U2RA 1T8UA 3EIQA 3EZ7A 3ZGXA 4ZI2A 3L0IB 2ZJBA 2D62A 4PAOA 4U00A 3MCAA 3QSYA 5J4LA 5HZHA 2CL7X 2I1QA 4B6EA 2GEDA 2WJVA 1II8B 4L5BA 2C99A 1OXSC 1GL6A 4NPHA 1ZJ6A 1GL7A 3AQ4A 3OE7D 1OV4A 4AC9A 2O8DB 3CX7A 4QJ4A 4DCVA 1R6BX 2WPDD 3O8BA 4JLJA 3U4QA 1KI2A 1VYUA 3RVBA 1F48A 2AN9A 1JPJA 3AF4A 4YDHB 3QXJA 1UDWA 4V0MA 1ZU5A 2VSFA 1P2VA 4OHXA 1E9SA 3TE6A 4HB0A 3C16C 1Z29A 2JA1A 1U8YA 1G8HA 2ZI5A 1A2KC 4M8NE 3ZH9B 4D0GA 2CDNA 2R9VA 2RGAA 3NBFA 1Z63A 3BORA 3D7MA 5B64A 4QM7A 1P2SA 4H9GA 5EE9A 1EFRD 5LB2A 2GK7A 1OXUA 1Z0FA 2ZREA 1P6XA 1N0WA 1SZPA 2F6RA 2Q3FA 1OH7A 2JLRA 2F43A 1GILA 3B8HA 2YWGA 1IY0A 1KSFX 2AHOA 2ZRIA 2J0QA 3QKRB 1MH1A 1G4AE 4KU4A 2AR7A 3N2EA 1P9NA 1F6BA 2FSHA 2W2TA 2HLDA 2EVWX 1FNMA 1YRAA 4D2IA 1W46A 1YKSA 3KJIA 3FHTA 1XWIA 4RFVA 2DB3A 1II0A 2V7QD 2ZI3A 3A1VA 3IPXA 1IQPA 4XSHA 2PJRA 4ARZA 4OK5A 4CVNA 5JI2E 1KK3A 3L82B 4HAYA 2V3CC 4U7DA 4PZZA 4LHVA 2ONJA 1OIVA 4FCWA 2TMKA 4DCSA 5KOYA 1G64A 4FCVA 5LD2B 1J70A 3QKUA 1KJZA 1S1CA 2H17A 2XJ4A 2EWVA 2J5XA 2ZYVX 3LX5A 3RRYA 4YMTA 2Z83A 4DCUA 2O8EB 2CLCX 4XOIA 4XWOA 2HJVA 3SQWA 4M9SA 3AF2A 4P33A 3OIVA 4POAA 2ANBA 2QMUA 3FKSA 1RRFA 2CNWA 2AK3A 1K5DA 1E2NA 3K0CA 2WJYA 5EUMA 4KHZA 2AKAB 5FBVB 1JR6A 1DAEA 1N0UA 4IDNA 3TBKA 2ODBA 1KI9A 2JCSA 1COWA 4X8OA 1XBTA 3BJIC 3PEYA 3CRRA 2JLVA 4JVNA 4ZPXA 4PPGA 1CTQA 1HV8A 2B7BA 2RHDA 1GVNB 2GEVA 4HLUA 2CE2X 5DYGA 1W5SA 4NYIQ 1R5OA 1DO2A 4PZLA 3SDZA 4P4SA 3W8RA 1YZKA 3C8UA 2JJ8A 2XSZD 1I2MA 3PENA 1M34E 1SVWA 1JNYA 1OB5A 1N3BA 3AUYA 2HYIC 2QGNA 4DB2A 5B58C 2F55A 3VR3A 2XNDD 3IEUA 1CP2A 1E94E 4O3MA 5BN5A 4FWTA 4WW0A 3W34A 1JQJC 4D4LA 1Q57A 2QE7D 5AJZA 2OT3B 1W0KA 2EFEB 3QUSA 4Y0VA 4DLTA 1Z3IX 4A8JC 3CM0A 2ZE7A 2B7CA 2J7KA 3EPLA 2FF7A 2QP3A 2G83A 1F2TA 1RRPA 5H8WA 4UKDA 2DFKB 3GJ3A 2O0JA 4AK9A 1YQTA 1T5IA 1IN6A 2A30A 5FPSA 4RD4A 3EWSA 4FMBB 1QVRA 2ZU6A 2ZRGA 4ZDWA 4M1WA 1LB1B 1IY1A 3T1TA 3K09A 3AVQA 3VX4A 1NN3A 1KSJA 2WZQA 3OIWA 4TQUS 2R62A 3VR1A 2BMEA 2GKSA 4MRNA 5EXPA 4JLVA 3REGA 2OXCA 1GRQA 2A5GA 3UMFA 4BLOA 4ITRC 2FFQA 3X2SA 1UEJA 2VPPA 3X1XA 3KXKA 3QF4A 3QNUA 4DSNA 3T61A 2QAJA 1VYVA 3EX7C 4BFVA 1IXRC 5JMTA 2FPKA 1J8MF 1OPXA 4C0HA 2RKOA 4DSOA 3B1YA 4MYHA 3LX8A 4TYNA 1E0AA 2YOHA 3BH6A 3WHLA 4BLQA 4RD6A 3I92A 1Y63A 1E9RA 4A8JB 4GBMA 1KO7A 3WNBA 3CPHA 1ZC4A 2ODNA 4HAUA 1M74A 2FEMA 2ZR0A 3IIKA 3P26A 1NVVR 1MRNA 3NDBB 4PO8A 1JBKA 1G41A 3GLHB 3BH0A 4P31A 2WWFA 3ADDA 1CXZA 2GZDA 2GAAA 3PCRB 2GJKA 1SVIA 4F38A 2NZJA 2IYSA 5DYIA 4B2PA 3FB4A 1DG3A 1ZCAA 4A15A 1XMJA 2EFGA 3PUYA 3NG1A 4OHVA 2ZEJA 4S2EA 5GVRA 2F1HA 1KMQA 4GZMA 1ESNA 5FBRB 3V4RA 5GAGi 4JBXA 1HEIA 3GLFA 2JLQA 3KKOA 2ZRDA 5TDHA 1GKYA 1WQ1R 1XJCA 2ZJ5A 1IY2A 1N5IA 4D4MA 5CB6A 3KJHA 2C5LA 3KFVA 3U3JA 3VR2A 3KL4A 3LQXA 1OHHD 3N70A 3K8YA 4QHSA 3SE0A 1E9BA 4IKEA 5BQ5A 1P4SA 1KNQA 1FP6A 1FOEB 4RVCA 1QVAA 1US8B 2GXUA 2BM0A 4OHZA 4B33A 2VO1A 1OLOA 4TQ9A 4RKFA 1Z6YA 2GNOA 5SZHB 4Q1DA 3A1SA 1E0JA 2HUPA 3OESA 4NKRA 2IS6A 4P4UA 4X8HA 1H8HA 3ECCA 3NIBA 3IGFA 2OO7A 1C9KA 4NE2A 1G3UA 2PLFA 1GIAA 4PAMA 3T35A 3U6BA 4ZIRA 3TJZA 1VECA 4ESHA 4JLOA 1E0KA 3GJ5A 4Q48A 1GDDA 3B9PA 3E5HA 2WIBA 2ZI9A 4TT3D 1XJQA 1KI7A 3IKJA 2O8CB 1E2EA 5HKKA 2YINC 1CJMA 4BFWA 5FH9A 5EP2A 1G16A 1U8ZA 4LOAA 4CZ2A 2JJ1A 2XZLA 3AKDA 1TX4B 1E1RA 4V0KA 3PIRA 1AK2A 4CRWB 2ZJYA 4PANA 3PEUA 2ZR9A 2XGJA 4D0NA 2PXUA 3NTUA 3NBYC 4PC2A 1NLFA 4EQ6A 4C0SA 4AY2A 1U0JA 2ZIAA 3PITA 3KKMA 4ASUD 1JQLB 2OXRA 2OV2A 1DPFA 1LW7A 4A2PA 1BYUA 2AXNA 4WA7A 1Z8FA 1DS6A 1R0XA 3FMOB 5CIWA 1JI0A 2I3BA 1IN5A 1AQYA 1Z08A 4JLKA 2GK6A 1B23P 2PLRA 4AKIA 2FDCA 3IHLA 4QGAA 2X77A 4LYAA 2A5JA 5D3MA 4E07A 5EE3A 2QUZA 5K8LA 4QGHA 5EXSA 5HE8A 1N25A 2NPFA 2REBA 4Q9LA 3ZQ6A 5EXXA 3RS0A 4F92B 5E7IA 3L0OA 1LNZA 1SVMA 3DKVA 3TRFA 1NVVQ 2ZR7A 2WSSA 1FMLA 3TQCA 5CJPA 4LYHA 1R4AA 2ZRKA 3TAHA 4DHEA 1WBDA 1CULC 2VA8A 3RSOA 4GOKA 5FUWA 3AVUA 4IEEA 3QKTA 5TV2A 2QI9C 4UNPA 2UZ3A 3CLVA 5TXGA 4IVQA 4R98A 3TIFA 2WWGA 4B3CA 5C2JB 2N42A 3BWDD 3CZPA 2HT6A 4CT5A 1BMFD 3BFVA 1SVLA 1CIPA 3UG6A 4TZ0A 3RLFA 5DN6D 5ELXA 3ASYA 2GXQA 5DIFA 1XPRA 2QSZA 4JZKA 2RGDA 3QG5A 2ZRJA 2MSCB 2P5TB 2YVUA 4N0EA 4DT1B 4JT4A 2W58A 1SXJB 3PVSA 4JT2A 1XZQA 1BH2A 1KMHA 1SVSA 3OIYA 3TVTA 3X1WA 3IPYA 1JXMA 3GEEA 1TQ2A 1MO3A 4DDWA 1SQ5A 4HAVA 4C0AC 1JR3D 2IS1A 3U3MA 1GFIA 1YVDA 2FPMA 4X8MA 3SNHA 1JJVA 1G20E 2OE2A 4FXPA 2OFWA 1Q21A 1N6NA 2GZHA 5C4MA 2DPXA 4KODA 1QRAA 2EFDB 5HCIA 3UMRA 1L2TA 2IBMA 3AV0B 5SZIA 3B78A 1UJ2A 2ZJ8A 3IILA 1HE1C 1XNJA 4HZUA 1DAHA 3GFOA 4Q47A 1XRJA 3DOEA 4G5GA 1FQJA 2V6IA 3OAAA 5JZVA 4CEIA 1KIMA 3BD9A 4IDHA 3LFUA 1QG4A 2QN6A 1CEEA 1FMJA 2Q3MA 2KBFA 3RANA 3GLGB 1S9HA 5HPYB 3U44A 2P65A 2G6BA 3VNVA 3BE4A 4CEJA 1P75A 4Q7MB 2A78A 121PA 2OLKA 4XTRA 5EE5B 4BFSA 5BWMA 2BWJA 4TQAA 4DDUA 3WHKA 5EE1A 4AD8A 4D26A 4B3GA 2LKDA 1T3SA 2BV3A 4Q7LA 4EKDA 2VP0A 1RRGA 2MMCA 4GI7A 4LPSA 4Z51A 3QJYA 3KDSE 2EW1A 4EFNA 4LY6A 1R8SA 3T5GA 1AS2A 4AKGA 3CF0A 3MAAC 4I1SA 1R2QA 2WICA 1ELOA 4WIAA 4C2TA 1XU4A 1PLKA 3EA0A 2HJGA 1YRBA 1IM2A 2Q21A 2G9NA 4D4JA 1XXHA 3NKVA 1P7CA 3PQCA 2DFTA 3BB3A 2H7VA 2OZEA 1DEKA 5L3SB 3M6AA 2CHQA 2W83A 1Z6GA 1E9AA 2R6DA 2QM8A 1FTSA 2YOFA 3W9YA 2Z0MA 4B3FX 1Z6TA 1GKUB 3THWA 1PZNA 2QAGA 1R8QA 4HEJA 3UWOA 1NG9A 5K8IA 3RS5A 4OKSA 3W3AA 1OXVA 1RVDA 2JJ2D 4CDGA 5FL7A 4ACAA 6Q21A 3C15C 2JLZA 5CIQA 2O8BA 2A3RA 2D3WA 4QBFA 4EFLA 3KQHA 4JL5A 4C2UA 4JL6A 2FV8A 2FOLA 2HCBA 1BO6A 4O2RA 3RDPA 3A4LA 5IT5A 1G9XA 2IXFA 2V55B 3B60A 4BLRA 3PUWA 4HLQB 4KI0A 2XOKD 1RKBA 1RRCA 1YR6A 1E79A 1XF9A 2H5EA 1B0UA 5AJWA 2BCJQ 1EFUA 2IYYA 1NF3A 2IYUA 4XIGS 4LJ6A 1LF5A 1LV7A 1KAGA 2QPAA 2ZRBA 1P2UA 1P72A 4MYTA 4TN1A 1DAIA 3KKNA 4JVSB 4JLDA 4A0RA 2GJ8A 3TGPA 1M8PA 3TMKA 1ZP6A 3EAQA 1F3OA 1U8AA 1E9DA 4A0HA 4I1VA 4J0QA 4PX9A 1TAGA 1Q1BA 2WIAA 2FX3A 4RFSB 5L3VA 4LHYA 2VIIA 4Q1FA 1YHNA 4QOSA 4EUNA 1HURA 1U81A 2J0VA 2H57A 4C0BA 4PHHA 2F1IA 1MOZA 2PXKA 2OCBA 3DEFA 3DVLA 3LLUA 1A4RA 4PO1A 2QMOA 3W5JA 5BYKA 4ZDJA 4G3XA 4URZR 4A0FA 1VG9B 3AVWA 5JSZA 3VTKA 621PA 3FMFA 1I4DD 3REFA 4K46A 2GCOB 3M4YA 1AIPA 2D74A 1GOTA 4LYJA 1ZUHA 1HT2E 3CX8A 2CL6X 3ZZUA 2GF0A 1U9IA 3R7WA 1LS1A 4C7OB 4RD3A 3AF1A 1EXMA 2C96A 4AYTA 1F5NA 2A5YB 2BVNA 2F1JA 3BXZA 2Q6TA 1OXTA 4GP6A 2PZEA 5FOTA 4LV5B 4EAQA 821PA 3PV0A 1ZVQA 1KO4A 5FBQB 3U2QA 3HYRA 1KTVA 2PEYA 4LCBA 3UXMA 4LZZA 1FX0A 1GNRA 4MKIA 5UKDA 5JWRA 2XX3A 4RKEA 1E2GA 4TSFA 4HI0E 4FMCB 4RZ2A 1QG2A 4BLSA 2WOJA 2QNRA 5FUXA 1XP8A 4MGKR 4F4CA 4JYCA 4JKYA 4FINA 1ZMXA 2X1VA 5FBWB 2BBTA 2OM2A 2NMVA 2HXSA 4QHYA 1EX6A 3KUCA 4OK3A 3CPEA 4M53A 1LS6A 4AIIA 3FMIA 3ZD7A 3H0KA 4Q9KA 2WKQA 1RW4A 4NYMR 3VMFA 5D3QA 3B1XA 4TL8A 3H86A 2FWRA 2WJGA 1NMXA 1XEWX 5KPJA 2QMEA 4GOXA 1N6OA 4TL6A 4BUJA 4IDQA 1E9CA 2A5DA 2CCJA 1RE0A 4YMWA 3IIJA 4QBHA 3IBYA 1C1YA 2C78A 4XVQA 1EFCA 1MV5A 2Q9CA 2WAXA 1OIXA 2WVJA 1Q1EA 4KFUA 3PXGA 4TMXA 3H1TA 3GLIA 2HF8A 2J0UB 5KDLA 2BC9A 4KV9A 1Z0IA 1WDTA 1NVWQ 2FH5B 2YC2C 3FFAA 4PSVA 1YR8A 5DISB 1IONA 4TYWA 2ORIA 3WP1B 1DAKA 4LPKA 2CCKA 1P5ZB 3N5CA 4YXWD 1KGDA 2ZETA 2QBYB 2FMXA 3ND8A 4URXR 4NYIR 4IDPA 3OEHD 2YWHA 1XCGB 3LQQA 3TR5A 4IOLA 4P3YA 3TVDA 1NBMD 4FW9A 1OH8A 1Q20A 1RJ9B 3FMPB 3LQRA 1W4BA 1U0LA 3A1TA 2ATXA 3DPUA 2ZRMA 3C7KA 3F5FA 4OL0A 1D9ZA 3BERA 1OF1A 3V4FA 3CF2A 3L0SA 4F91B 1YJ5A 1VIYA 2J87A 3W3ZB 3AP3A 4LJAA 4QJ3A 1BOFA 1ZYUA 5LD2C 2RAPA 2GXAA 4DZZA 2P0EA 1W0KD 4UQOA 1XD8A 5AUQA 4DCNA 5ANRB 1LVGA 3IIMA 3NWJA 1E2IA 4HDOB 3B9QA 2ZITA 3WRYC 3OZXA 3QF7A 3JZAA 4ACBA 3KQUA 2QROA 1W44A 2ZRHA 3FTQA 3L8YA 2GESA 1HT1E 5FTNA 4CGZA 4TL9A 4DB4A 5AUNB 3KQLA 2DFNA 2RGCA 3M1IA 1G3RA 1CJUC 4R2HA 4JL8A 1OE0A 3CR8A 1ZUIA 4RZ3A 3GFPA 1N0VC 4EJSA 5FBLB 2OCPA 5DO9A 2KBEA 421PA 4Q7JB 4HSEA 2PMDA 1G291 3CRVA 3LVRE 3HU1A 4A92A 2JLYA 4M1TA 4DWJA 4WAUA 4WZ6A 5JJLA 3ICEA 5LBIA 1P2TA 3O8RA 2IK8A 1DAGA 5LPNA 4B3DA 5EQTA 2OCYC 4BASA 4C0KA 1KOFA 4FMDB 2WAYA 3HJNA 3I72A 3OIUA 3FE2A 2C98A 3MLEA 4JJKA 4Q5IA 4R7ZA 4LHXA 1UADA 2GJAA 1TF2A 2IHYA 1XZPA 5FTJA 5BXQC 3CPJB 3CR7A 1WGWA 1OT3A 4B34A 3U4QB 4BQSA 4XWKA 1NKSA 4PC3A 4UNQA 2REXB 4WOPA 1MKYA 4MQBA 3ZIAA 5AUOB 1OH5A 2J41A 4TLBA 2O52A 2BBSA 4US1R 1NVXQ 5IK2A 4C9BA 1JR3E 1XEXA 5DHAA 2Q9BA 1E1QD 4NYMQ 3O8DA 4Q19A 3K0CC 1XMIA 1CRQA 3LV8A 4US2R 3QVUA 3EIEA 1UF9A 2MSDB 4BFUA 4CEHA 2NO6A 4NCHA 3ZD6A 5E95A 1IN7A 1O3YA 1XMVA 2O0KA 1G3IA 1OW3B 2ZANA 2F43B 3K9LA 3QE0A 5CLQA 1G1MA 3FPAA 4S35A 3CKLA 4O2LA 3JZMA 3K9HA 4B3XA 4D6PA 3Q7QA 4A2WA 1QHSA 1DVRA 3B1WA 2C9YA 4HDQB 4AURA 3QPWA 2IYTA 2YWFA 4O0MA 1KI4A 4RSGA 1TMKA 1MABA 4KVGA 4ARZB 4MDFA 5JHHB 4PQRA 1I2DA 3SN6A 3UANA 3THXA 4OYHA 5EE0A 4W7SA 1SHKA 4IFEA 1H65A 1RYFA 2B6HA 5HZKA 5JJKA 1G21E 1M7BA 3RC8A 2FEOA 2XZPA 4US0R 1KI8A 2VP5A 1OFTA 3CWQA 4QFMA 4ZDKA 5J5CA 2IYQA 4GZLA 4QJ5A 4OI1A 2QP9X 4Q01A 3ZVMA 3R9XA 5M04A 5KSYA 1JEDA 1A82A 1ZD8A 2KE5A 3B1VA 3T1OA 4LBZA 4OI4A 1CR4A 4DSUA 5J4KA 2ZRFA 2IF0A 1IAQA 2CLSA 1W36B 1G7CA 1T6NA 2GZAA 3P27A 1NNEA 1H8ED 1S0UA 3THYA 3B5JA 5FTKA 2Q9AA 2PXQA 1Z07A 1ZM7A 2IXGA 4RY2A 3CUEF 2ZE6A 1DO0A 1KI1A 3K0AA 1S9DA 3UWKA 2CBZA 3VFDA 2XXAA 4B44A 2XAUA 4QBIA 1HYQA 4ERNA 4URVR 5JFGA 3LLMA 1NP6A 2DBYA 3K09C 4R2IA 1MO6A 2V1UA 2VLIA 3W6NA 3FYHA 3N2IA 3MMPA 3MWJA 3D6TB 5CB8A 3TUZC 1QHGA 1IN4A 4URWR 2NO0A 1Y3AA 3BBPA 1OYWA 2GCPA 4P4SB 4Q7KA 4KLZA 1AKYA 1NL3A 2JJ1D 2QTFA 3OE7A 3FOZA 5AWFC 2WPDA 3RC3A 4HB2A 3AVTA 1K6MA 2OHFA 1GM5A 3KXIA 1E99A 3JVUA 3TSZA 3SFVA 4CW7A 1MRSA 3NXSA 2IX3A 2OFOA 2W00A 3W6PA 2MMGA 1EX7A 2ZROA 3I1FA 1G5PA 4XVRA 5FR2A 1KO5A 1R0WA 2GBLC 3MSXA 3OHMA 4JLMA 2QL6A 2IL1A 2ZE8A 4TTRA 3KB1A 3KFXA 5JEDA 1EFRA 1F2TB 4NU0A 4QXAA 3SJCA 2KB0A 4NMMA 4WXRA 3K70D 4LUCA 1KK0A 2ZSAA 2BMJA 4ZDIA 2W0SA 4L8GA 5EP3A 3FHCB 3KX2A 2NIPA 2CHGA 4DDTA 1SXJD 1JEEA 1YZNA 1F2UA 2CLDX 2W0MA 2REOA 1NN1A 1D5CA 3QIAA 4FCTA 1PJRA 3QENA 5E7MA 1YR7A 3FGNA 1FQKA 2V7QA 1VG8A 1HE8B 4UJ5A 1U94A 2WWHA 5AJYA 5HCNA 1KO1A 3Q3JB 1WB9A 2GCNA 3DO6A 4FWIB 3R9WA 3NHBA 2W6JA 1YZUA 1G19A 3QF4B 3QPVA 4JLAA 1P9RA 1KK1A 3I32A 3RRNA 2EYUA 1YZTA 3CIOA 3DZDA 3WNDA 3VU9A 1HQ1A 1ANKA 2Z4RA 4N0DA 3WP0A 4TL7A 2C2HA 4KXFB 2QQ0A 5FUYA 3RWMB 4B48A 5J47A 1AS0A 4E09A 1Z47A 3P4XA 2XB4A 5DI3A 1Z2AA 4KBGA 4V0ME 5GAHi 3CNOA 1VCMA 4PTLA 3I73A 2VF7A 5FOXA 4ZKEA 1E0SA 3TAUA 4DRZA 5SZKB 3EC2A 1FL9A 1NSTA 1M2OB 3WMEA 2WSMA 1X6VA 3BK7A 2DWOA 2L0XA 2XEXA 3LY5A 5L3QA 5JEEA 3OFND 4MDEA 1KI6A 4D82A 2HYDA 1QHNA 2KWIA 1UBGA 3CZQA 3SBDA 4TYYA 1A2BA 5G40A 1W0JD 2XSZA 2A5FA 4IOKA 3WYFA 1OKKD 1E69A 2FFBA 3ASZA 4BEBA 5FL3A 1KKMA 3Q9LA 5DHFA 1ZNXA 3GLFB 4GDFA 1TF5A 3ZDQA 4EPRA 2XNDA 1E2KA 1TQ4A 3KZ1E 2G88A 2CK3D 1R0YA 5KO2A 1NIJA 4GOJA 2ZXUA 1E2HA 3EARA 3CO5A 4LV6A 2QE7A 4D4KA 2AK2A 2P6NA 2GVDC 3GJ0A 2BKUA 3BOSA 1QHIA 3LO5A 3NEJA 2YZ2A 3LVQE 4LC0A 4KJZA 1KSHA 2WKPA 5CK5A 2QP4A 3B6EA 4TMZA 5IRCD 2G1JA 1W7AA 1XTQA 1G17A 3H2YA 1SKYB 4LBWA 1NRJB 3RYTC 3PUXA 5GJCA 3T34A 1QF9A 3P32A 1S3GA 4G5QA 2OUKA 3T06B 4DVGA 4IJMA 5FOUA 3K70C 1OIWA 1E6CA 1W48A 5AJXA 3ZVNA 2FZ4A 1VDZA 3GMTA 1ZM2A 4FI3C 3AVXA 1E9EA 4TWZA 1SXJC 4ZIRB 4I1OA 3WY9A 3VKGA 1TTTA 3U6KA 1BKDR 2PT5A 2P6UA 3CRQA 4Q4JA 4MKGA 3EZ9A 3I5XA 1M7HA 1AJEA 4LI0A 3L2OB 1WA5A 4XVUA 4GP7A 3V00A 3OEED 1K5GA 1QDEA 1ZM3A 1QHHA 4W9MC 3K0SA 1YU9A 2GRJA 1KY3A 5FPHA 4MUAA 1NBME 1VPLA 1G3QA 2CJWA 4PR0A 4URYR 2X2FA 3TW4A 2PXTA 4QKQA 1OH6A 1GG2A 4MUBA 3EW9A 3BC1A 4GFDA 4QM6A 1T3LA 2VHCA 5DE3A 3TK1A 1RC8A 3L8ZA 4EQ6B 5K8TA 3MGCA 3DM5A 5KSOA 1YZLA 3P4YA 5AR1A 5TVKA 1GRRA 5KDDA 4BZXA 3DKPA 2G0NA 4Q9JA 4YMSA 2IYWA 2G77B 2ZI4A 4A36A 4JLBA 4C3ZA 2CMKA 2R44A 4C4PA 3EWAA 1X8JA 4B2IA 2QEQA 1E2LA 1Q44A 3MG9A 4F93B 4WZAE 5KTYA 1N5LA 4DLSA 2W6ID 3THOA 2BDTA 1N6RA 1GWNA 1VYTA 1VCIA 1Z0DA 1ZAKA 5D3MB 4AG5A 4RD1A 3K70B 4H1UA 1JALA 3CNLA 3GP8A 5AK0A 3CRW1 4ON9A 4A6XA 2C9CA 1TF7A 2R6AA 4IOMA 4M9XA 5H70A 2UKDA 2Z5FA 3UK6A 1NJFA 1U0HC 5H1YA 2P6RA 2KSQA 5J4YA 3GLHE 1GRNA 3GQBA 1Z0KA 2VH5R 3DL0A 2WJIA 4HB4A 5EXTA 1AA9A 4OQXA 4DXAA 3F3YA 2EYQA 5G3ZA 2WMOB 1OHHA 2Z43A 2H92A 1AGRA 2FJUA 3QXHA 3DHWC 1XD9A 4DUGD 5J4HA 4DLUA 3AM1A 2VRWA 2JGNA 4URUR 2V54A 3SU8A 5KPDA 2VSOA 5DH9A 1J90A 4IFBA 2IW3A 4RZXA 4IVRA 2QT0A 3FFBA 1JECA 2V9PA 2ZS7A 1S3SA 4F4IA 2ZUDA 4UXHA 4XD7D 4AWXA 3WBKA 4ZO4A 4I81A 1DAFA 2ZRNA 2YJTD 1EG7A 3I8XA 3LBNA 4V02A 1E2JA 1ONBA 2VYFA 1XTJA 4OBEA 2Z4SA 3CRMA 4TYQA 3NC1C 2R6CA 1C4OA 3KQNA 1SULA 3GEIA 4JVLA 2ERYA 1FFHA 3R9IA 2J46A 4HUQA 2IT1A 1XCMA 2RHMA 3GCGA 1KMHB 2ZRLA 2C8VA 2F9LA 2VHUA 3K0FA 1AZTA 3SEAA 1R5NA 2JIZA 2JLSA 1ETUA 1FNNA 2XB2A 4TT3A 2PXFA 4Q4AA 1Q0UA 1KDPA 1XMSA 2QT1A 3DDCA 4UJ3A 3VNUA 3LXRA 3M0EA 1XTSA 5CLLA 3U5ZB 3R8CA 4M1SA 2P2LA 2YV5A 3FHOA 5EUQB 3FWYA 3FKQA 4D80A 4B76A 3EA5A 3IUYA 1EGAA 3U7FB 2HT1A 3W90A 4TLCA 4HZUB 5HE9A 1U90A 3C41J 3KTAA 2NZ8A 1J99A 4GPTA 1UKEA 4B32A 4CEIB 2CHVA 3ADBA
chains in the Genus database with same CATH superfamily
1TPZA 1LSJA 2HU5A 2OK8A 3QU7A 2XEDA 5D92A 2HU2A 3T5TA 3OY7A 4UASA 4BDSA 2CD9A 4HGPA 2MHRA 2FAXA 1N8SA 1RZSA 1UJ5A 3D0RA 1DBRA 5CTJA 3T5DA 3UPTA 1TM7E 3ZZTA 3MXOA 4XEHA 1Y6QA 4LK2A 5E3IA 3HXMA 3QVGA 3DD1A 2FPSA 2O50A 4ND4A 4W6QA 1RRMA 4FYXA 3UA3A 4DLAA 4PVCA 4R31A 3DZ8A 2EERA 5JOQA 5DNVA 2JDID 4QECA 1V5WA 4G07A 2HWXA 1KFCB 1FCJA 2ZBQA 1OC4A 3HSYA 3D0QA 3UJBA 5A6VA 5JJCA 2NOAA 5BMVF 4EHBA 4P35A 3VR5H 3FRIA 4EGJA 2J9ZB 4LECA 2O3QA 4Q16A 2ZRAA 4KFRA 1R4MA 3NT4A 1UKCA 3NUZA 3ZDAA 3OZIA 3UK0A 1ZZBA 1D4FA 1YRWA 2Q3HA 1IK4A 4TPKA 1V47A 4XIYA 2FN3A 1PJ4A 1V6SA 1UOPA 2Z2XA 1Q22A 2HXYA 4H3HB 4HDMB 5I9SA 3R7WB 2EWTA 3JD0A 4ZEWA 1FQWA 4K3UA 2KEJA 3P9IA 1ZA1A 4I9FA 5EMKA 4DREA 2A0WA 5JH7B 3FX2A 1K4MA 3BZWA 3NM5A 5D5QA 2IWHA 4Q9DA 2YKGA 3OBBA 2ASRA 1Y9AA 4PZ0A 2Q1WA 4EFMA 2VN8A 2F8MA 2NXCA 4HDAA 5HBGA 1VHWA 3C3KA 3ZK8A 5AESA 3DD5A 2ZM5A 1XKLA 4F71A 3R3UA 4TTQA 2ZUBA 1OLUB 3K1JA 3WGNA 4LJ4A 5JE8A 4TMYA 2XRYA 1KR2A 4XJXA 5I48A 2ZOSA 4BB6A 1ZK0A 2XBLA 3C18A 2C7GA 5CD1A 3OT5A 3WO1A 4ENWA 3O3OB 4PC1A 2IEYA 2QX9A 4Q1EA 2NU8B 1YQDA 3A6PC 2DPGA 1T34A 2XCIA 4B47A 5D5HA 1NG1A 2ZXEA 1IY9A 3BWEA 2GBCA 4K9DA 1D6MA 2CWWA 4F5YA 2D06A 2H07A 3SZUA 1P2BA 4Z86A 1FMWA 3ETHA 4ZYUA 2QI9F 2D5IA 4LXTA 1VMAA 2GWHA 4L1KA 5CA1A 1XEXB 3OWXA 2K87A 2DERA 1EFDN 5G53C 3ZGZA 4YXWA 1D2GA 4L9RA 1OSLA 3PX3A 1M6VB 1U8FO 4ZALA 1D1CA 1V8PA 4AAYA 2E9SA 4A2QA 3JTEA 5JAQA 2F67A 1TUEA 3WNVA 1N3IA 4BRWA 3QUQA 3GJ6A 1LZKA 1PFWA 3M4XA 1ZYRF 1SUPA 3R9XB 3LH5A 2MXDA 4YP9A 2BELA 3FN4A 2C04A 3GARA 2ZTHA 2AG5A 2OC9A 1YA7O 4NYJR 1USKA 1X74A 3SKVA 1W0CA 2ORVA 3UWDA 1RMTA 3GW8A 4LVUA 4DLYA 3RABA 5JIBA 1W4AA 1HDYA 1KYTA 3D2CA 2YFHA 3BIFA 1G5FA 2WSSD 4GVPA 2OPBA 4GSKA 1ODFA 4C87A 3AR9A 5F35A 5C8YA 4KPUB 1Z0AA 2ZIUB 4NLLA 4S0XA 1FRFS 4KYUA 3CUSA 3AL2A 4QPJC 4ZJYA 4FESA 1PP4A 4CI9A 3VISA 3TUIC 3I05A 2AG0A 3QLVA 3TBHA 1K98A 3LKZA 3ZQ4A 5GP1A 1Z6XA 3RR2A 4DEXA 2ZM6B 2J5KA 2XS8A 2ZVJA 1UFKA 1LJLA 2EP8A 5HRAA 3AR7A 2EC5A 1QFXA 4WGFA 5IF3A 1TCAA 4J6EA 4JLPA 1L9XA 3QXXA 1N5JA 5NLLA 1R88A 3B9BA 2O6HA 1BS2A 4NL4H 4ZHQB 4HVLA 4CF7A 1Q3KA 2YHUA 3BDNA 3TR0A 1L7QA 4TLDA 2GKGA 5DCLA 3PXCX 2FK7A 2I1WA 3HYTA 1WP9A 3U9LA 4G1UC 3BSFA 3DDZX 1T36A 2GTPA 4BRUA 2FSGA 5C0OE 2WB7A 4RVHA 1PVVA 3GPIA 3L43A 1EVQA 3TTVA 4IHKA 4Z4CA 4O1MA 1LTQA 5CXQA 1BIFA 1DRKA 3IQHX 4J75A 2C00A 1JG2A 1SG6A 2WLTA 3QXCA 4RIIA 4YAUA 1S96A 4YJHA 2GARA 3IVXA 1DGQA 1N2CA 3UB4A 2JJMA 1DB3A 1ZNWA 5LQAA 1LNQA 3BGVA 3L0DA 1OPRA 3JRNA 1FTQA 3NW9A 4J0GA 3IERA 5ENVA 2DQKA 3N05A 1LPMA 2PSFA 4EI2A 1HGXA 2XI4A 1KP9A 1X1CA 3DEIA 4EUKB 1R0KA 2GH1A 3I2JA 4KFCA 3V6LA 5JMOA 2IYZA 4E46A 3C5VA 1UC5B 4I8TA 1K4KA 3IQXA 3KD3A 4O2BA 2YOGA 4HNQA 4BFTA 1J2RA 3G1TA 2VF4X 3PQ7A 3PFWO 4LJRA 3UV3A 4MW7A 1ENYA 3F7NA 1HL7A 4MTLA 5BYJA 2ZBUA 4DA8A 4NCKA 4OREX 3T5MA 3ZZ0A 1NMQA 3ML1A 2F1OA 1Z34A 3MJRA 4WJLA 2OXFA 5I3ZA 3VGPA 2GZ2A 5C1BA 3E2IA 3QELB 1T4DA 3O26A 3L8JA 3H1AA 5I8WA 2VZ0A 5KINB 4BE7B 2PTHA 3BD1A 1GZ3A 2X2OA 2C03A 5FOSA 4EI8A 1JLKA 2N9UA 1GTMA 5BMOA 5KNCA 3L7NA 2X0RA 2NO1A 1MC5A 4RD0A 4LQDA 3KETA 3ZIDA 2H3EA 2VSYA 4LV8B 3HEAA 1NFRA 3AP1A 3PE3A 1PEYA 1ZC3A 1IWBB 1NUUA 2V8OA 1NFQA 1SQGA 4PLZA 4C07A 1IC8A 1JSLA 1KWKA 4U9HS 1UOQA 1A5ZA 2HBRA 2VJOA 2ZJ2A 3KUUA 5FHRA 1W8IA 5HR5A 4IW3B 3VUFA 2PSDA 1I2BA 2KSFA 2VTKA 2XJ9A 4OIPF 1OY1A 2LK4A 5M5BA 4PYKA 3ZYCA 1ILWA 1BD3A 2XYRA 2NN3C 1SWWA 2ORYA 1XU9A 3V97A 4E5PA 3HUUA 2REQA 1H9BA 2D5LA 2BH9A 4I14A 5JQGA 4I99A 3PDCA 5BN3A 3D02A 4MTFA 3ACCA 3HJBA 1MQSA 3WHPA 3W8NA 3QBVA 3ZD8A 3ENKA 3F1KA 3SX2A 2B61A 1I4WA 3Q3GE 3RAEC 2DAPA 5ES3A 2RC5A 3LOQA 3F3MA 2VQ6A 3SYKA 5KU1A 4KN5A 5J40A 5J2UA 4WOKA 1XD2B 1C17M 4INOA 1K63A 1ZQ9A 3AILA 1U0NA 5DLEA 5T3UA 2WBLC 3RVJA 1QSPA 5F3DA 1D0YA 3ZIUA 5DQZA 3L6CA 2AXVA 4AO7A 1RQGA 1GL7A 4HQFA 1OV4A 3AEUA 4D9KA 2R7RA 2QRMA 4RDCA 3U4QA 2VFAA 4NBNA 3EQ8A 3VTFA 4OHXA 4FQ7A 3IBSA 4CUJA 4RMIA 3IMFA 3IODA 3PC7A 4DSZA 5ALGA 1HDRA 2M6LA 5CNMA 1Q0LA 2V3CC 1EE9A 2PGOA 3DC7A 1G64A 4L6IA 3H5AA 4RHFA 4F4DA 3T7CA 4QFCA 4X4GA 1R9GA 4L27A 1D2RA 3AJRA 3HXLA 3N24A 3OKFA 3AF2A 1X1DA 3FKSA 2VUIB 1WXHA 2WJYA 4NE9A 5BXYA 4BN4A 1C7QA 4B8WA 1QAQA 4I1RA 3WKDA 1PGOA 3O7WA 2NZ2A 3W8RA 3JRWA 1W85B 2P2GA 3HQ4O 1SHJA 2HIHA 1RAAA 1XZJA 5H5JA 4F45A 4LY0A 1JQJC 1VBNA 1R4NA 2EKPA 4DDHA 2DFKB 1EQ2A 4DJFC 1VE3A 3QU4A 3K09A 4DQLA 5I5EA 3VR1A 5LQSA 2GN8A 3BL8A 2OXCA 4QT0A 1H4VB 4F7DA 4C3EA 1ZH4A 2HQOA 5ALZA 1G2PA 3CSDA 5BMVB 4KMMA 1IXRC 1T5BA 3UJHA 1WHSB 2YR0A 1QLJA 3A4VA 4TYNA 2YRFA 1DUVG 1OAOC 3HFSA 1NW5A 1JFVA 4CKXA 1DG9A 2FMKA 5EMLA 3HP4A 1M2OA 5KWIA 4LF7B 4F38A 1REQB 2R1ZA 1KQPA 5C4IA 1JR8A 3S1SA 1XAHA 2ZJ5A 3ICOA 4ZCPA 3GG9A 3EQZA 1UQRA 1P4SA 3DZJA 4RVCA 4ZOBA 1QVAA 2XE8A 3FHDA 2VP3A 1BXRA 3R76A 1M10A 4DHWA 4U1RA 5HGJA 4CLXA 4P4UA 5LIRA 1NGSA 2PLFA 1AE1A 1TYZA 5ARCA 3EF3A 2BONA 1I6LA 2IYFA 1XJQA 3P9KA 2YINC 5FH9A 1T2FA 3UGTA 4CDYA 3Q6MA 4CRWB 3JQGA 3P9PA 1CV2A 4D0NA 3CX3A 4AY2A 2O5EA 5D1NA 3KKMA 2QAIA 4RCVA 4F11A 4G37A 2FWJA 2OYRA 5KYVA 1BW9A 1QRDA 4D8YA 2YV4A 2ZCJA 2X77A 1K04A 1O5IA 4GGPA 3RS0A 4W9RA 4EFDA 4CKBB 1SPXA 4WLNA 1I7PA 5D87A 2X2PA 4N5DA 1W29A 5HRUA 1E59A 3CLVA 4PYRA 3PD7A 4M46A 1FQOA 1NQVA 1PZEA 3TD6A 1MU0A 2HA3A 3L7BA 2W58A 3V32A 1SFRA 4QFDA 4TRJA 1SVSA 1UWKA 3DXZA 1L3CA 4KNYA 1YI1A 5CFZA 3GU3A 1UOEA 1JR3D 5FT9A 1FVFA 1BX3A 4XCQA 1HNNA 5A5EA 1IB6A 3BSSA 1W9HA 2QTNA 5SZIA 3L9WA 4HZUA 4ARCA 2V6IA 3FNIA 4IDHA 2AR0A 4H54A 3RANA 3SC2A 5E6UA 5JYCA 3SYRA 3BE4A 3TW6A 2A78A 3STWA 4W1QA 3FWPA 4F4UA 5C1OA 2CLHB 3BDIA 1ZIXA 2VDMB 2XZDA 2X15A 4LWOA 3TPZA 3MAAC 1WW8A 2PZJA 4C2TA 1KF0A 1PLKA 1IM2A 3G6KA 1XTVA 2NSLA 3JYLA 3RYHA 2FZWA 3UWOA 3HXKA 3K20A 1OXVA 1KDVA 3VPAA 4ACAA 2R5WA 3MWEB 3WGTA 1NNUA 2D3WA 1BROA 3F46A 2YHAA 3FUTA 3T7RA 4BP8A 1L7EA 3JXCL 4N6OA 1NJ5A 3H11A 3N8NA 2PFDA 4JU9A 4JGGA 4KIWA 1E79A 1XF9A 1F1MA 2V9ZA 1M0SA 2IVGA 4ZRDA 3AFOA 2X7JA 1ORHA 5CH3A 4YASA 4E2FA 5AH0A 4LHYA 4K9OA 2JGJA 1EZ4A 4J4HA 3G88A 3ITDA 3PNYA 1C02A 1U81A 2UYOA 5DW3A 1XU7A 5FI3A 4A0FA 3OA1A 2ICAA 3PDIB 3HACA 4KRFA 2R00A 1TYCA 3GRAA 1HE3A 2UZ0A 4EUHA 1TEZA 2VS1A 4TV8F 1KVQA 4GP6A 1PFKA 3DE1X 4P54A 4Z0TA 1QZTA 4Z9JA 1MVNA 5ESDA 3JY6A 4Y6GB 3A7DA 3GDOA 1GT91 5FUXA 2IGTA 4R1UA 4JKYA 1SXQA 1ZMXA 4B3IA 1DOZA 1XZIA 1O5TA 2CYCA 4IGFA 3B1XA 2JAOA 1N6OA 1RHJA 3UNXA 4K86A 1AD2A 4GE3A 4BLVA 3UW1A 4CBVA 5ISMA 1GG9A 5LUBA 3CIFA 5BVHA 3SD7A 5C3UA 4M63A 1NXWA 4CLEA 1GZ7A 5ALOA 4AG3A 3A1TA 1UJBA 2IDZA 3RI3A 5K3DA 4JASB 4IGEA 1DRWA 1KWGA 2JI7A 2CWDA 3GVHA 2GXAA 2H1VA 2QLBA 1LPAB 2GTIA 2L1PA 4QUGA 2QNBA 3C45A 4EJSA 1GPKA 2Z04A 1YYXA 2P0NA 2ZBGA 1A97A 2RC6A 3NFYA 4WZ6A 5LYJA 4CNBA 3WRXA 2WAYA 4LHXA 2Y1EA 5J43A 3A2KA 2IXOA 4FX5A 4BQSA 1XYVA 2FW8A 1N1GA 3FSRA 1BDIA 1Q91A 4US1R 1E1QD 3E35A 4PU7A 4R2WA 4BFUA 4QG3A 4UMFA 4XX1A 1YONA 2WFLA 1OW3B 5CLQA 1YS4A 3IHUA 3A11A 3CKLA 1UWLA 3PXPA 3PP8A 1WS6A 5IJZA 2P3OA 4MHOA 5DMHA 5L0GA 2BTEA 1TMKA 5JHHB 2J0EA 1U3FA 4C21A 1SHKA 2B6HA 3AL0C 4Q4ZF 4MAAA 2VP5A 4QFMA 2C84A 4RXTA 5M04A 5KSYA 2KE5A 3NB0A 4LBZA 1CUSA 2ZRFA 1RBYA 2Q9AA 2XMQA 1X2LA 5IT9A 1LFAA 2DB4A 5DNEA 4URVR 1JKJB 1JDZA 1EYZA 4HV4A 3RIHA 4BQIA 1EP9A 3MWJA 4PF1A 1HMPA 3RSZA 3K16A 3CLRD 4ZYYA 4DQXA 2XQGA 3A28A 2IH5A 5GV8A 3JRTA 2GBLC 5JSUA 4JLMA 1AN9A 4QXAA 1KK0A 4ZVSA 3BFPA 4DDTA 2REOA 5E7MA 3QENA 5IJ9A 5C7LO 1XSEA 1NQUA 4O1IA 2W4MA 3R9WA 3UMCA 2GZSA 3GRCA 2C3UA 3LWBA 4M7PA 2YCLA 3KCNA 2EJVA 5KTNA 1XROA 1YE5A 1Z2AA 4Z4HA 1UDRA 3JSAA 1Z7GA 1ADRA 1P91A 3GBPA 5FA5A 4WJZA 1T1SA 5EYPA 3QUBA 4RFLA 1NSTA 2VNIA 13PKA 4F56A 1Z8HA 2AUMA 1S01A 1UBHS 1SRRA 4EPRA 2H59A 1QFSA 3EARA 3IJPA 4FCCA 1SUEA 2NU9B 2GSDA 5CCDA 2JZCA 3ZE2B 1ZEMA 4KJZA 1N32B 1L4HA 3HKCB 3RYTC 1G5HA 5GJCA 1Y9EA 5ER9A 2HCNA 5E9AA 1QQTA 1UODA 2Q6LA 3VKGA 3E5RA 4I6UA 1X19A 4GP7A 2Y4OA 3IQGX 4B31A 3N6VA 3BC1A 1XUOA 4YCLA 1OFVA 5EWJA 3L8ZA 4EQ6B 3EEQA 5KDDA 2UZ1B 2ATEA 2IYWA 5AW7A 3OTHA 4C3ZA 4RBNA 3EWAA 4WFJA 4KIJA 1EUDB 4OIMA 1JALA 3NHZA 1N0HA 3WB9A 2AEFA 1U0HC 1GAWA 8AT1A 2ZWMA 4OQXA 2BFMA 4PGFA 4ZEMA 4YV2A 3KYDA 4B17A 3UQZA 4UUOA 4RZHA 5BY2A 1HL3A 3JRMO 3NTLA 3SG0A 5F7XA 1FDRA 1E2JA 3V46A 2X6RA 4JI5B 3S9OA 3K0FA 4IY1A 3CKYA 2PV0A 1Q0UA 3VNUA 3U5ZB 3B53X 5FO0A 3FBWA 3IS3A 3EA5A 3R6LA 5KNDD 3C41J 1CGOA 2IZOA 4ASUA 4AFNA 1HLFA 4AF7A 1T2EA 3T15A 4Y2YA 1TFRA 4J03A 4RZUA 5I7AA 4CBEA 2NO7A 2LWIA 4L4SA 3QWAA 3LQ4A 4O6NA 3V6MA 4YYEA 1ZLYA 2I9KA 2GD0A 4RYLA 1NQXA 2G6TA 5E7QA 2PXVA 1OFUX 4U5GA 2ZJAA 2C9DA 4F8JA 5JAMA 2VWQA 2A0XA 4AUKA 5K4HA 4O4HA 2O8BB 3L34A 4BO7A 3LKBA 1XQ9A 4BAGA 1UAAA 4LOKA 4GPEA 2UYHA 1D8TA 3JT1A 5EJ7A 2Q5HA 3MT0A 4DRYA 4KX3A 4OXKA 5LBTA 2BFBA 3TOMA 4E18A 4DOZA 4BO6A 2CUNA 4HD8A 1YL6A 3T9FA 4RADA 3VSEA 3UK1A 1LPSA 1TC1A 3TRKA 2XL8A 5AJTA 5CK4A 3AKCA 5P8WA 3O9ZA 3TQQA 3L5OA 1LFDB 2K4MA 5A4KA 4JEBA 3FYTA 1E98A 4I4TA 1KY5A 2QYTA 4G63A 3FXAA 3LOUA 5DGTA 3A4NA 4PYNA 3H5OA 1RPEL 2VPXA 1YQ9A 2P0YA 2XUGA 3AB3A 4OF4A 3MTIA 4F9FA 3JQBA 4J0JA 2WW8A 4TMFA 4H08A 4RSRA 3B3FA 4TUYF 3P94A 1KDOA 3DAFA 1UZAA 4EYGA 4IYRA 2GILA 2YHSA 1H94A 4XEFA 3HTKC 4J1QA 4ZCIA 2DUMA 1MB9A 1KZ7B 1HDGO 1N0IA 5C18A 1AHHA 5CDFE 4LZNA 3CVWA 3R5JA 4R1PA 4RD2A 3UK7A 3CH7A 4HH1A 4MKXA 2DT8A 1CPQA 5CT8A 5E1DA 1OMOA 2BZGA 4GL2A 3ZWQA 1SM4A 2WINI 2GPSA 2QTVB 2KW5A 1KDYA 4H1HA 3K66A 3RTCA 3SMQA 3TNDA 1L5SA 2OXEA 1J1IA 3PUHA 1YT5A 4EBKA 4Z2AA 4C3UA 3GY0A 4IXNA 1NMZA 2YWCA 4UBNA 3TDKA 2VQDA 3FOCA 3I2KA 4G23A 1B42A 1GFWA 3KSBC 2HZBA 1G5TA 3G79A 1EUCB 2Q29A 3OC6A 3NBKA 2YN2A 1L5KA 3TD2A 2LE0A 1XRLA 3H4MA 5CH8A 4UREA 1PV2A 5AMXA 3UXYA 1MJ5A 1XZKA 3GCZA 3QHPA 2C5SA 5GIPE 4H15A 1ISJA 1Z6AA 1R00A 3OOJA 2GPAA 2H00A 4IQGA 4QRDA 3EUWA 3G0TA 1ZL2A 4BMNA 4M0UA 1FNCA 1DX6A 1RPNA 1HORA 4PXSA 4Q9NA 3WMWA 2HD4A 3THYB 2J5QA 1CF2O 1N6IA 3EBLA 4OFBA 3RVSA 1T13A 4HNGA 4ZVMA 4DA6A 1L5GB 4LYEA 3GGCA 1G8AA 4G1CA 2JLXA 3RS2A 3EEYA 3COWA 4RMGA 4PZAA 1ZZ6A 2F8LA 1JYSA 3PUIA 4XUCA 3LHKA 5JPIA 3I6YA 4MLCA 4NC9A 1JHRA 3KVYA 4MW0A 1LJ8A 3UNGC 2X86A 4MH0R 3LA6A 1WCV1 1A7DA 1IPHA 4R8KA 4TV8B 1JIKA 2IIPA 4IOJA 2H2GA 4L5CA 2DX7A 5IUNC 1CQTA 5ALUA 3KKPA 2PA3A 3AG5A 4ETWA 1F2UB 3TCKA 1EK1A 3QQ5A 4C6SA 3GT4A 4RJTA 3KSRA 3KELA 3KT6A 3NHFA 3C39A 2IWRA 4YC7A 5DI3B 1OREA 2ASEA 3PXBA 4K3VA 1GITA 2E4WA 2JD2A 3LHSA 3VHLB 2Y8EA 3HP7A 4RM3A 1Z15A 4TM7A 1N2IA 3N28A 3B85A 1SKBA 1LX6A 3H16A 2DYKA 1E5DA 1UXJA 1A88A 2R1JL 4E03A 5PNTA 2HSBA 4KDEA 3G7DA 3UHPA 4UNSA 5J2TF 2AKEA 3IP9A 2QY9A 5G41A 5AVTA 1ZS4A 5AM5A 1V5GA 5NULA 1VFPA 1FDVA 2PL5A 4L4YA 1E3JA 4EOGA 1JX6A 3KKLA 3I34X 5B4UA 4RUKA 4MWEA 5SY9A 3EIHA 4K1LA 2HBZA 3IVRA 1D0VA 1PFUA 3T9OA 4QDKA 2B1IA 3CPSA 3P1JA 1G5RA 3ND6A 1UDBA 2WTNA 2WZLA 2UVQA 3ZHOA 2RGRA 1XMXA 2B9VA 3W5UA 5TEVA 1J4AA 4OV6B 1CB7A 1V37A 5ALLA 4PN3A 4TSFD 4YRLA 3DMYA 2AE2A 3PGKA 4P8RA 2CMDA 2HEGA 2HA6A 1KZHA 3X44A 2C9MA 3P9XA 3RHZA 4JJAA 3LCCA 4Q39A 3ZVRA 4E32A 4MQFB 4QU0A 4W8GA 3FXHA 1KYZA 1QGDA 3I6ZA 4KBFA 4RQTA 1XJ0A 4Q4CA 1P17A 3RAFC 4HPWA 4O2AA 3A04A 3O83A 3SSNA 3QFSA 3ZV7A 4ME6A 1QVZA 2OSBA 4Q4HB 4N65A 3PYXA 4JYZA 4I3GA 4ZAFA 1A7AA 1KSGA 3T95A 5HF6A 1U63A 3ILYA 2WY2D 4FFMA 1WAMA 1VRCA 4U7GA 3VYRB 2J59A 2ACEA 2VPWA 4JGBA 2FWNA 5AXAA 3VR4A 3OZ7A 3MMZA 3RLIA 1FUUA 4KYIB 3C48A 4PGHA 1LSSA 3ZJ5A 1XAJA 1VTKA 1UINA 1PJTA 4E21A 1CUVA 2QSYA 1LF0A 3ZCXA 1RRKA 1YMUA 3B6JA 2V7VA 2ZTSA 3DBOB 3LQKA 1JW9B 2C2XA 3S1AB 4ZVNA 1LQTA 2FEKA 2Q3LA 3KE8A 3NALA 3WWCA 2O8NA 1VIVA 5COQA 4W1RA 1DEAA 3A70A 4Y18A 5HG0A 3EFOB 1LW6E 5BW6B 4NH0A 4A9AA 4JBYA 2FSPA 4UCWA 1C0EA 1CS4C 4G97A 5K99A 1NFOA 2JDIA 3SC3A 1JKIA 3TLCA 5HFJA 4F85A 4YRNA 5TQ2A 4CS8C 5JS2A 1EI7A 5HZHA 4B6EA 1G66A 1TCUA 4RX1A 1SUWA 4AC9A 1B0NA 2WPDD 1W96A 1HQDA 3PD1A 4YAWA 1U8YA 3ZH9B 1CJBA 1QCDA 3B8HA 1MG0A 3BXOA 3BMCB 2XWJI 5FI5A 5JYEA 3K32A 2NTNA 1W46A 3ZWXA 1XWIA 1II0A 3UF0A 2P41A 4JB2A 1KJZA 1XHLA 2FQYA 4MTOA 1P31A 5DM0A 1LC3A 2AN3A 2HLNA 2DWUA 3JALB 3QMMA 3RSHA 3CT4A 5I9IA 1YGYA 4AULA 5LQMA 2DXIA 1MEOA 4JC8A 3NUGA 2HHHB 3B1FA 2GEVA 4M1EA 2CE2X 4P4SA 2J0XA 3ZHVA 1E20A 3EVAA 2R7QA 1Z3IX 5CUQA 4KXUA 2K2QB 4A8JC 3WAQA 2J7KA 2E1PA 3S8QA 1F2TA 2QUHA 1YR1A 3V80A 1T5IA 1L8XA 4P6IC 2EARA 4ALLA 3A0UA 1TQHA 2JIOA 2WZQA 4OTZA 4HJXA 5KYYB 1WIZA 6REQA 2B1GA 1UEJA 4DSNA 4B1FA 3T61A 2L2QA 1UK6A 4GM4A 1EFKA 1MB4A 4C4AA 2QD5A 2D0OB 3KWJA 3T7AA 1XC7A 1GLVA 2JVKA 3NVMB 3P26A 3LLKA 1KETA 5A3RA 1JBKA 1G41A 4FFWA 4BMVA 4N41A 3GX1A 5DYIA 3NYJA 2EKLA 4IMPA 4LIPD 1ESNA 4J29A 4R2XA 1OHHD 1EFLA 1RI4A 3SYTA 2FWBA 1YIAA 3ICWA 1RLUA 3EGCA 1X2EA 2BM0A 2DBRA 3I53A 1Y1RA 1WU7A 1AKQA 4DQKA 3UYKA 3TJZA 3O4GA 4HFMA 1E0KA 1BE1A 3LUJA 3ZNPA 4KQHA 3HCBA 1H1TA 3IKJA 2O8CB 5K3BA 3ZZNA 3H5WA 1EX9A 2A59A 4PANA 3LJKA 1S8OA 3SZ3A 4GGOA 3HYLA 1NW6A 2PXUA 3DDHA 4PC2A 4EKYA 4BATA 4AZWA 2HWKA 1ZH6A 4TUYB 3C3WA 3KPJA 3VSCA 5HE8A 3TZ6A 3NO4A 4PGAA 1Y5MA 2WSSA 3A9VA 3ZCUA 4UMVA 2I03A 1DOHA 1KOLA 4PFPA 4ENRA 1T43A 2VA8A 5FP0A 4MW2A 3U62A 4K1OA 3EDMA 3AINA 1QNFA 3BGDA 4IVQA 2ZXWC 5JASA 3UCXA 4WY8A 1LTKA 2CYDA 4BBPA 1PR3A 5F7ZA 1XPRA 2N3ZA 4JT2A 3PHIA 1KMHA 3X1WA 5BUZA 1ZK2A 3MYIA 2IM8A 3PLRA 4FDVA 2JGIA 5LZ8A 1SQ5A 4HAVA 5KMGA 3QI7A 4XUDA 3P2JA 4X65B 1N6NA 2VJDA 1TVKA 3ABOB 4HDRB 2AWCA 4UHFA 5BSVA 4L74A 3O1JC 4MVUA 3RQEA 5BRNA 5CLHA 3U44A 2GBGA 3VNVA 2HHAA 3OFSA 4HBGA 4HEA6 4D26A 3FRJA 5C8DA 4OM8A 5A62A 2WLSA 4FYHA 1GQOA 4BC0A 3VSDA 2V7EA 1D1BA 1A7UA 4V2UA 4RESA 1P7CA 4KGXA 2DZDA 3JXBC 3M6AA 2CHQA 2W83A 3ZKWB 1SC6A 2XXQA 4ZP1A 4AMVA 4OYRA 4F3KA 4GG1A 3OCYA 5B6JA 4QBFA 1A76A 4C2UA 3RDPA 3T52A 2IXFA 5DTMA 1VZ2A 4KI0A 5C37A 4CMEC 1Y1PA 3UCFA 1VL0A 2IYYA 1P1RA 1J0BA 4UEQA 3RYIA 4MYTA 1CC1S 3C6XA 5A4AA 5FCLA 2AG1A 2P9CA 3B5EA 4Q1FA 2OOKA 3ZKAA 5KUTA 2PXKA 4PO1A 4NDAA 2XAAA 4WERA 3C70A 3IQZA 4FE4A 3EGXB 3M4YA 3JQ8B 5BO5A 4LYJA 3AK4A 4XGRA 1DCTA 2XIUA 2W48A 3UXEA 4CIHA 3OCVA 4RD3A 1EXMA 3R7NA 2YJ5A 3AY6A 5F7OA 3HBNA 3OY2A 3A0RB 3V2GA 3CQ9A 2Z58A 2X3UA 2XX3A 1W87A 5K4AA 4CMAA 4CCYA 2QNRA 5AI6A 2BNNA 2OKGA 2NMVA 4LERA 4U7JA 3T41A 4ZVPA 4G5YA 2JCGA 1S3IA 2G67A 4ITVA 3H05A 5BYBA 5K3SA 1LPPA 3AG4C 1HFJA 3ZE0B 2QMEA 1IQRA 3K30A 3MAJA 4QBHA 3WWYA 2IXBA 3DE5X 4POOA 4UM8B 1LBHA 3LS2A 1DDGA 4IG9A 3H3XA 1P2FA 5K6TA 4Q15A 2ZUTA 4HN4B 4ZWNA 4Z4IA 4C5BA 1U89A 1I6WA 4LJAA 2EAUA 4EG8A 4DBRA 1ZO8A 5J2TB 3V3TA 2OEVA 1Y5NA 5K7SA 5ALKA 1LVGA 4IIUA 5GINE 4OIFA 3QVKA 1ODLA 1TOAA 2ZRHA 3FTQA 1IHYA 4TL9A 5F4ZA 1SU7A 1CJUC 1JKFA 2ECOA 1KAEA 1QG0A 2CW0F 2R1VA 5JJLA 1L1FA 2X5JO 1JEYB 3NTVA 1AGXA 3LLIA 5BP7A 5HKAA 3HZIB 3LGAA 2J3IA 2REXB 3KQOA 1ISMA 4TTAA 2LQGA 2AG8A 5D85A 1J2TA 3RTGA 2GNAA 1CRQA 3LV8A 3TZCA 5EHNA 2NO6A 1T9ZA 3TELA 2MYSA 2OKUA 1QP0A 2FRDA 3JARB 1AGYA 1KS9A 3CJRA 3BWVA 2NACA 2YWFA 3GCDA 4O0MA 3IX7A 3S44A 3F2IA 5EWLA 2LCHA 1C1HA 3E0XA 4OI1A 4O29A 1FFGA 3PKZA 3K05A 1G7CA 3GVIA 4MLZA 1XQWA 2PXQA 1YUBA 2UYCA 1LC0A 4NV0A 4NBUA 3U3DA 3DMRA 1NE2A 3QYPA 1E66A 5AW9A 4YAIA 1NL3A 5M34A 2F17A 4JJFA 1BMTA 1XVVA 2B6NA 2Y2UA 5IBCA 3I1FA 1RABA 4XVRA 1ZN8A 1JUDA 3TINA 4GKKB 3HB5X 1GSOA 3IUPA 3KX2A 2CHGA 5LLTA 3WGQA 1I1OA 3Q7LA 5L53A 4YH1A 4CI0B 4C88A 4YV7A 3MNFA 3DDSA 5D00A 3RRNA 4FDAA 2X8LA 2O06A 3P9RA 3RWMB 3CEXA 5J47A 2MINB 1DX9A 4EF6A 3HBJA 2OQMA 5JV5A 5CH5A 1V4NA 5BSRA 4GRIA 2ZB2A 5JNLA 3F8WA 5BNIA 1UBLS 1VRVA 1I4ZA 1IOWA 1UBOS 5CBPA 1BU8A 1ZCZA 1TKAA 3FNGA 3LUDA 1RIIA 3V4PB 3Q9LA 3ABKC 4J90A 1GJRA 2HV9A 2JGDB 2IVFA 2O23A 1RPJA 2TMVP 3R0QA 3NHRA 5JT1A 2JGRA 4TMZA 3ZH2A 5H83A 1D7OA 1DKUA 2CUKA 4DVZA 5FOUA 3K70C 4L5IA 1R6UA 2XLWA 3GMTA 3MYYA 1LCDA 3CB2A 3OZSA 5K0TA 3C6MA 3Q7SA 2J9WA 3V00A 3UUWA 1WB4A 3NYRA 3QWHA 3KOXA 4PR0A 4QKQA 1R69A 4F3NA 4G4GA 1RC8A 4BQOA 2G77B 4IIJF 1MHTA 1X8JA 4F93B 4AZ0B 3HKKA 2W6ID 3JW8A 3GM1A 4GKJB 1EVYA 2HWWA 2CL5A 3A32A 4MYRA 3U4HA 4LRUA 4YCSA 4L07A 2C2MA 3ZDYB 4ALJA 3R3YA 4FJ0A 2P9EA 3F3YA 4MR8A 4RORA 3UJDA 3KVVA 4GKVA 3SU8A 4BN5A 1U7WA 2ETXA 1ZFNA 2ZS7A 4KO1S 4CTNA 4UXHA 1B1AA 2XD4A 2QPLA 5L6LB 2Z3ZA 2XH8A 3HM2A 4G0YA 4D3FA 4MX8A 2JLSA 4NENB 2RE8A 5E9WA 5AM0A 3DDCA 1RQLA 3JQ9A 2YV5A 3MBIA 3PHF2 2O5RA 4P7FA 4ZANA 2DFPA 3SR3A 1UKEA 1PWEA 4IARA 2CHVA 3ZU3A 4NICA 3PQFA 2GAIA 3TTTA 2ZI6A 4LMAA 5IC5A 4PJNA 1ZUNA 3VHXA 4DA4A 4LHZA 3N2LA 1W4RA 3WKCA 2WDPA 1X1SA 5G0SA 4I3HA 1L3BA 2D2EA 4N82A 4HYQA 1LVHA 2PUAA 3TOLA 3PEFA 4L0CA 2JAUA 1Z83A 4JLWA 3E9QA 3X1ZA 1H2YA 5DF1A 4YR9A 1JR3A 2I8LA 2H4ZA 4N0QA 4TVOA 2ZJ1A 5I8PA 2FRXA 2EP7A 4N1AA 3N2YA 2LNDA 4IA8A 1NULA 1WNFA 2LCIA 5IKMA 4JA2A 3LLVA 1DBPA 3FGOA 3MPUA 1GGJA 5KJCA 3SEZA 1YFJA 4E5NA 2F8SA 1GL3A 3QY0A 2L9JA 4FYIA 2VT6A 2F7SA 3GLGE 3ZHIA 2P9TA 2ZZKA 4JUBA 5KYUB 4MQLA 1XX6A 4TLEA 4IJ5A 1HLGA 2WJPA 5TMPA 5BNZA 3VI4B 1Y3DE 3RVDA 5E33A 4DLZA 4K03A 4HKTA 4KZKA 2GRUA 1C50A 4C5CA 3IUBA 4H4EA 1Z74A 1II8A 4B4WA 3AJ8A 5AVKA 3ZDDA 2NG1A 2PH1A 4S0ZA 3T1VA 1FFDA 4EP1A 3ZGYA 2P4SA 2AF4C 1A7JA 2IEAA 3AC0A 4X84A 3OQ1A 3IHKA 1Q6YA 1YBHA 4U6NA 4QI0A 4KUGA 5IHXA 2G4LA 4DSTA 3DH0A 3QOFA 1RFLA 3CEAA 3WLEA 4BYMA 3U39A 1RC0A 1L4UA 5FPPA 5JISA 1BWQA 5C8VA 2BNMA 3IA7A 4CE6A 5B3JA 4LGMA 1CUCA 3EGDB 3O7MA 1AMUA 2ZSFA 3P0FA 1TB4A 2IEGA 3ZS8A 1ZNYA 3BXHA 2WWTA 4RZSA 2A0KA 1I3LA 2PVCA 4HVTA 1ISHA 3L18A 4AZVA 4FS3A 1HYGA 4DMFA 3C6KA 3L6DA 4L2IA 1KJNA 2AVNA 1KP2A 4P7BA 1V2HE 2IYVA 2G70A 4CFYA 1XTRA 3CF4G 3ZTMA 1EK0A 1CPYA 3BJZA 5AIAA 2BMDA 2COUA 2PQ6A 3NMJA 4M9RA 2AD1A 4C7KA 2XCUA 5IAOA 1JHUA 1ACMA 2H9YA 4IUDS 2X5XA 1DWUA 1ZD2P 3NKLA 4CMIA 1K88A 2IYRA 4AECA 2XT6A 2J45A 4HEAJ 5DTIA 2WU3A 1GAEO 5EJEA 3PA6A 5CT5A 4ZZ2A 3A25A 3K0AB 5AK4A 1L5HA 1NYRA 2C2GA 4Q03A 4KO2S 2CZQA 2JLUA 4WN9B 1EHCA 1PUIA 1ZINA 1FTWA 3BA1A 4OVKA 3Q5DA 4S1PA 9ABPA 4EWLA 3ORHA 5B7GA 3A6DA 4EB0A 1QAOA 1VIAA 3K72B 2AFIE 4UUBA 3NEYA 1ML3A 4KYVA 3SOZA 1E1QA 3U9SA 3MZ0A 3EPHA 3UV6A 1BCRB 1IM5A 1T8TA 3EDCA 4K9QA 2IQ5A 5DRTA 2IX9A 1JDVA 3ZKCA