3KL4A

Recognition of a signal peptide by the signal recognition particle
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
431
structure length
412
Chain Sequence
GLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Signal recognition 54 kDa protein
publication title Recognition of a signal peptide by the signal recognition particle.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 116
structure length 412
sequence length 431
ec nomenclature ec 3.6.5.4: Signal-recognition-particle GTPase.
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 3kl4A03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kl4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kl4A02
1XJ0A 2GAAA 1KAGA 1M8PA 3VKWA 2ERYA 1XNJA 1OT3A 1YRAA 1E1RA 2R6DA 2XNDA 3FPAA 3DO6A 2VL7A 1Y3AA 2ODBA 2ZRAA 4B3CA 4D80A 2CHQA 4DBLC 3MGCA 3Q9LA 2C8VA 3IQXA 1AQUA 1RFLA 2IL1A 3RS0A 1ELOA 2Q3FA 3BJIC 3QSYA 4QJ5A 1NLZA 1W36B 2YVUA 3DOFA 1QHYA 4G01B 3OZXA 5KU1A 1W4BA 4EQ6B 3IBYA 3M6AA 4HSEA 4B34A 4ZI2A 1Z0DA 2FGKA 3R7WA 3X1YA 4Q18A 4XVUA 2Z43A 2ZI5A 4Q4AB 3DPUA 1R0XA 2ORVA 5KPDA 3NKVA 4AY2A 1SZPA 2WKPA 2ZSAA 4DXAA 4U7DA 1MABB 1NVWQ 3RS2A 3E2IA 4FMBB 1ONBA 3EIEA 1W2GA 2ZRCA 3K70C 1OE0A 1E2JA 3QXCA 1EX6A 1KZ7B 1S8FA 1G18A 3LX5A 3OIYA 5LD2C 1ZM9A 2BWJA 2YWEA 2ZVQX 3PITA 1JQLB 1KY2A 2BKUA 3I8SA 4V0LA 1NSFA 2ZJZA 3M0EA 5KDOA 3B82A 2BBWA 3GJ4A 2P6UA 2ZSDA 2O0HA 1GL9B 4PHTA 1KSGA 5J4KA 2WTUA 2G1KA 3ZVLA 3SJBA 1KZGB 2F9LA 3U2QA 4CZ2A 2D4HA 1YZLA 2V4ZA 4RCZA 2A5JA 4KBFA 3K70D 3EC2A 4HB3A 3IEVA 3K0FA 3KQNA 3NH9A 1OIXA 1GVNB 2IC5A 4BFXA 4QNMA 3EW9A 4A15A 2IS4A 2WWWA 2BKEA 1AZSC 3BFKA 1UBEA 1A5TA 5FR1A 5GVSA 2RAPA 3BH6A 4G3XA 2GZAA 3HPQA 4IXNA 1FNNA 5KNBA 2VP5A 3SBEA 5JCPA 4S2EA 3TW4A 2XOKD 5JFGA 3A1UA 4QJ4A 4MKIA 4CVNA 3HYRA 2V55B 3NC0C 1ZVQA 2BMFA 5CDFA 4N0DA 4PC3A 5GJCA 1GL7A 3IHLA 2ZU0C 4DT1A 3FMOB 5CJPA 2FNAA 2QPTA 2J41A 1E94E 1V43A 3BH0A 3WRXC 4D2IA 1ZC3A 2NZ8A 3K0CA 4Q00A 3FB4A 1CU1A 3DKVA 4IVQA 5CITA 2C2HA 4BLTA 3W5IA 2EU8A 5FOSA 4DLTA 1OIVA 3UWOA 3LW8A 3I3SR 4F4IA 3U61B 4QGFA 1YZQA 2ERXA 4BFSA 1OYYA 5EP4A 4QGHA 4OK3A 3IPXA 2FJUA 3N70A 1JBKA 2XXAA 2IYSA 1F6BA 2QZ4A 2XSZA 1TEXA 4Q02A 3ADBA 3OIWA 3U3MA 4LHVA 1W5SA 3RDPA 2FFAA 2YV5A 4IFBA 3ZD7A 1US8A 3B1XA 1B23P 3NH6A 1JEDA 4HB2A 2V6IA 5DHFA 3EZ9A 4BFZA 2ZITA 3TSWA 4UNNA 3AUYA 4PTLA 2RKOA 2VF7A 1G5TA 3CF2A 4BUJA 3CX7A 4I4LA 5KNCA 1CR0A 2PXDA 3U4QB 2GF9A 1P3JA 2ZI7A 4ZDWA 2GBLC 2OCAA 2F3TA 3ECCA 4ZKEA 2GEUA 1Q21A 5K8IA 3LA6A 4LHWA 4MGYR 2QGZA 1I2DA 2RGNA 4XTRA 3VR2A 4IEEA 4QM7A 3PUWA 1PJRA 3RWMB 4CW7A 4BLSA 1T3LA 5JJIA 1W49A 3KFVA 4LHZA 1XTQA 2O8CA 1GL6A 1ZP6A 2GCPA 2XJ9A 2PCLA 3LRPA 4FD2A 2VSXA 3T1QA 1OFTA 1ZUNB 4A8JC 5KHOC 1AIPA 4PPFA 4NCNA 1N6IA 4V0ME 3SQWA 2XTMA 3N2IA 3CNLA 3NIBA 3ZH9B 3N2EA 3E1SA 1AQYA 3OFND 4MYTA 4R71A 2VQSA 4KV9A 4PR0A 1TQDA 2BEKA 3C15C 1G41A 5DLQC 1KJWA 4CEJB 3T1TA 1ZIPA 3QIAA 1Z6TA 1XRJA 1ZD9A 4JLOA 4JLJA 4JLMA 4D4JA 4TL9A 3EZFA 4KODA 2DYKA 3PV0A 4IVPA 2J0UB 3C16C 4MKHA 4H1UA 4W5WA 5ANRB 4AWXA 3AVTA 2E1RA 4NHOA 2JQEA 2WSMA 3CF6R 1D6JA 4Q4JA 3W6OA 4CEIA 1E9EA 1LF0A 4G5QA 5FL7D 3BERA 2P65A 4HZUA 5HZHA 1X1SA 3TAUA 2JLYA 3W8NA 1NNEA 2V1UA 3CBQA 5GJWC 1BYIA 1R6BX 2GJ8A 3QXSA 2O8FB 3H86A 3SYKA 1YZGA 4FWTA 4P3YA 4ZDKA 1GITA 4ZDIA 3ZLJA 1KO5A 1LB1B 5B58C 4QHYA 1Z2CA 1G4UR 2IYLD 5EE1A 2RGAA 3ZQ6A 4DWJA 4F4JA 1DBSA 1N6NA 5J5CA 2NMVA 3AVOA 2EFCB 5UKDA 3HR8A 1KDRA 2DFTA 1OFHA 2ODNA 2ZJAA 3RVBA 4MYUA 3MJHA 3LBNA 3TVDA 1N3BA 3BBPA 2E9SA 4NDZA 4RZXA 1OXVA 2FZLA 3L8ZA 2WJVA 1IN6A 5J40A 1Z6XA 4EFNA 2RGXA 2WIBA 4BFTA 4TLEA 5JS7A 1IY0A 4P31A 1G3IA 4TT3D 2AR7A 4PZYA 3FHOA 3UIEA 4HUQA 3FMPB 2VSOA 4AK9A 2NOAA 4NYJR 3WMFA 3PG5A 4KYUA 2CK3D 3K9NA 5HE8A 2O52A 3QJYA 4P4SA 5AR1A 3KX2A 3K53A 1OXXK 4NCKA 2BVNA 2HCJB 3RAPR 3K0AA 5FOVA 5HR5A 2QT0A 3R7WB 4Q9IA 4PPGA 1ESNA 1PUJA 2ORWA 2WKRA 3MD0A 3RC3A 1LF5A 4U5XA 1G4AE 4M53A 1LVGA 3BGWA 3B7GA 3DM9B 4JVMA 4GP7A 3VMFA 3GD7A 1CR4A 4TTPA 4LYJA 2G83A 4LV8B 2WAYA 1WMSA 3L2OB 2D06A 4HAXA 3TQCA 2DHRA 1JEEA 1T91A 2BJWA 2PMKA 3A1TA 1G291 3PXGA 4BLRA 3K8YA 4TYYA 5FFMA 3AGPA 1II0A 2B21A 2BDTA 1XBTA 4M9QA 3CKLA 3IHWA 4OQFA 2PEYA 2WM9B 1KJYA 2W2VA 3BC1A 3SQXA 4JLKA 1IQPA 4TN1A 1KNQA 1EFRD 1II8A 4RY2A 4YDHB 4TQ9A 1RRCA 3WHKA 3VR1A 1IXRC 2MSDB 3P27A 2WPDA 1X8KA 1ZAKA 2FPLA 3ND9A 1M1YE 4X8LA 2ZYVX 4JYBA 5FPHA 1NLFA 1Z8FA 3K0FB 5DN6A 3PUZA 3MG9A 5FH9A 3ZVMA 4HLQB 2XOKA 3AF3A 4C30A 3VX4A 3ICEA 2WSSD 2GHIA 4B2LA 1CRPA 4HI0E 1VCMA 1X8JA 1AGPA 4DSUA 3NHBA 4I1SA 4N0EA 2X2EA 2XB2A 1LS6A 2PMDA 2Q3MA 4NYMR 5GVRA 8OHMA 3KKPA 4MITA 4DJTA 2I3BA 2FGJA 1S9DA 3HWSA 5ELXA 5TB5A 3RABA 1A7JA 1E6CA 1UPTA 2BMDA 1RYFA 3QPUA 4LJ8A 5HCNA 1FX0A 3C14C 2R6GA 3ZGXA 1NMZA 5HE9A 2HXSA 3F8TA 1E2HA 2RB4A 4OJKA 5TY0A 2MMGA 1N5KA 2CL7X 3UKDA 4BZXA 4DT1B 4Q03A 1XXHE 5KYKA 5L3QA 1FMLA 2IBMA 4WXPA 1NKSA 3LBHA 4D81A 1D2EA 1NJGA 4DLVA 4RSGA 2GA8A 3ZVRA 5IF9A 3BFXA 1Q1EA 4LJAA 3VX3A 4US1R 1QHHA 5F9HA 4GOKA 3SYNA 5KNDA 4WW0A 5EXTA 2YJTD 1NY6A 2XXAB 3ZS8A 4DUGD 3VR4A 3QKRA 3VNUA 1KIMA 1G6HA 3AF0A 5DE3A 2OE2A 3DHWC 1US8B 1KK1A 4IRUB 2X1VA 2Z6VA 4JL5A 1MRSA 3ZDQA 4Y0VA 1L8QA 1N6RA 3CNOA 3JVUA 3TGPA 4QKQA 4H1VA 4FWIB 5F2EA 1XJCA 2D62A 4IXMA 5BW8A 4UJ3A 2WAXA 3LQQA 4BZQA 2GBLA 1W0KD 2C78A 2W2TA 3AF1A 3CWZA 3NEYA 2HJVA 5KUTA 2YC2C 1Q1ZA 1G3RA 3LX8A 2O8CB 4DLZA 5B2ZA 3T1VA 2XB4A 1NN0A 2O0KA 2H16A 2XGJA 5FPTA 2FWRA 4Q66C 4A0FA 1G8FA 1OLOA 2XZPA 3V9PA 5A4JA 2DWOA 3NDPA 1A2BA 4C4PA 1QVAA 1LS1A 2ZI3A 4A8JA 4B33A 5JCZA 3GJ6A 2NQ2C 3QKTA 4P4UA 4HB4A 4WVFA 3UMSA 3B9QA 4WBSA 3TAHA 3ASZA 3IGFA 4DCUA 4LV6A 3Q3JB 2BBSA 4HAYA 5FL7A 3BH7A 2Q9BA 3MCAA 2C9OA 5K8LA 4NCJA 2ZXUA 2ZIAA 4JLDA 4MDEA 1EFHA 3K9GA 2OHFA 4F92B 1K5GA 3OAAD 4NYIR 2PJZA 2VPPA 4M8NE 5DI3A 3TBKA 1AK2A 2DFNA 1Q1BA 4KJZA 2B8WA 1GDDA 2ECKA 3U7EB 2A3RA 4L5BA 4Q4JB 3KKNA 4CEIB 3K0SA 1DE0A 2IYTA 4HZUB 5FOUA 1XMJA 2IS2A 1VCNA 2A5YB 2GETA 1RJ9A 3GQBA 1KMQA 1T8UA 2NPIA 2VH5R 1U90A 4RZ3A 4XTCS 5G53C 1WE2A 2P6RA 1ESMA 2AWOA 4LI0A 1CTQA 1U99A 4C7OA 3HYTA 5BN4A 2BM0A 3SI7A 3PUXA 4XSGA 2I1VB 2W0MA 5EZ5A 1SKYE 3AVYA 5FBQB 1XTIA 4LBZA 3RSLA 4OL0A 1JPJA 3SJAA 4M0LA 2GF0A 4TT3A 3T34A 4F7WA 1SVMA 2Q0HA 2ZAOA 4B73A 4A36A 4PO8A 1E2PA 2YWGA 3Q5EA 2G6BA 3R8CA 1EWRA 5JS8A 1A1VA 3FKQA 2CK3A 2WJGA 3GFOA 5IK2A 5H8WA 1KDPA 4DSNA 2IK8A 1JR6A 2W83A 2J9RA 2J3EA 3AVQA 5CK4A 3B9PA 5C2JB 3FWYA 2GK6A 2G0TA 3KB2A 4I81A 4D25A 2HV8A 5E7IA 2IF2A 2IXFA 1ZYUA 2REXB 2KI5A 4K46A 1XB2A 5FI0B 1CBUA 4LHYA 4P4SB 4UNSA 1M34E 1G7SA 2ZRDA 4IEIA 3P4YA 4W5HA 3K0AB 1RRPA 3MFYA 2QMHA 2CHGA 4L8GA 4V0NA 4ZI3A 3T1OA 1A2KC 2IYWA 5F3WB 4TTRA 2GVDC 3AKCA 2C99A 1GWNA 2FPKA 1AN0A 2ZTSA 1E2KA 2LCFA 3GJXC 4XWKA 4NKRA 1XPOA 1DAIA 1ZBDA 3NBXX 2DWQA 2EFHB 2I1QA 5BN3A 5J4VA 1EFRA 3OESA 1G20E 1C4OA 3QVVA 4UKDA 3ZD6A 1S0UA 2DFKB 5FUYA 1YR8A 2EFEB 1IXSB 1HE1C 1T6NA 2WHXA 3Q85A 1XCGB 3I92A 2CCGA 1XD8A 1EG7A 3K70B 2ASEA 1TQ6A 3TKLA 2IUSA 3I4LA 3AVUA 5LD2B 2WICA 3DMNA 3D6TB 4JJKA 4Q47A 2VHQA 3KB1A 4EPRA 1Z29A 1WXQA 4MKGA 3DVLA 2ZS7A 5KO2A 5AUOB 1XXHA 4TMTA 2WKQA 3PUVA 4Q1CA 2WSSA 4P4TA 2NG1A 2UZIR 3KFXA 2FX3A 5FPYA 1E2DA 5CB6A 4AKIA 1S96A 2BC9A 2IA5A 1DAFA 4PQFA 1MR3F 3OHMA 5C4MA 3B6EA 4ZCLA 4QBGB 5AJXA 3ZYCA 3GLFE 3ETLA 4HEJA 3TH5A 3AKDA 1DADA 4DRZA 1QVRA 3KJGA 5J4YA 1P6XA 3CRVA 5CLLA 1G5RA 1G7TA 1VCIA 4CRWB 3LWNA 2LKCA 4J0QA 2P67A 2W58A 2OO7A 2JGNA 3SU8A 4DKXA 3QEOA 4QHTA 1AKYA 3THXA 2QTVB 1ZCBA 1UEJA 3C41J 4PXAA 1FX0B 2I4IA 2BMEA 4W9MC 2QA5A 1DEKA 3BB4A 3B1YA 3BWDD 4B32A 2W00A 3QPWA 3EXAA 5TV2A 5C46F 4DB4A 1EGAA 4IFEA 5DHAA 4DUGA 1VYVA 5L3QB 2CMKA 3I5XA 1SKQA 1UKZA 3SR0A 3V00A 2ZRBA 2CVHA 2X19A 1VPLA 5KOYA 1GOTA 5CM9C 4E09A 1R0WA 1GNPA 3O8DA 4GZLA 1QHHB 4A0HA 2QQEA 1BYUA 3U3OA 5AJWA 3UMRA 4ERNA 2GXQA 5A5GA 2A2ZA 2QORA 4TTQA 5FI1B 3QKRB 2ZI4A 4ZV4A 2BCJQ 1VG9B 1KHTA 1VDZA 1Q1QA 2OAP1 3QG1A 5FL3A 1E69A 3VR6A 4CDGA 2ZJ2A 4OK5A 4GFDA 1GKIA 2PT5A 2C5LA 3QF4A 2Z4RA 3W9YA 3QG5A 5L3SA 1LNZA 1ZINA 3MWYW 1XZPA 1DOAA 1K5DA 2FF7A 3A1WA 1W0KA 1J7KA 3QXHA 5DGXA 4HDOB 2TMKA 4MUAA 2NZJA 2GJAA 1NVVR 1VECA 4WZAE 3GLHA 4JZKA 4PQRA 2OBMA 2VO1A 2J59A 2YC4C 2F55A 1G8HA 4BLOA 4D4KA 4UNRA 1KNXA 1XEXA 4XWOA 3EWSA 1SVOA 4E07A 2J87A 4NYJQ 2F1JA 2ZR0A 1SULA 1X6VA 3ZS9A 3UPUA 2F9MA 5CIWA 1ZD8A 4LX0A 4PSKA 1JJVA 1RPZA 1T5LA 1Y63A 3PJRA 1M74A 2J0QA 2BBTA 4HLUC 1Q57A 3VQTA 1XWIA 3QE0A 3K1JA 1FNMA 4C0JA 1KO7A 2ATXA 3GJ3A 3EPLA 3AQ4A 4EPVA 2KSQA 4LV5B 1GRQA 4B47A 4A8JB 3J81k 1WBDA 1YZTA 3OAAA 4Q7MB 2YKGA 2FDCA 1VIYA 3SZRA 4JIMA 4JVNA 4DDWA 4PPNA 2GJ9A 1BKDR 1RC8A 2XITA 2CCJA 1FTNA 4RD1A 3QQ5A 4URUR 5GAGi 3WYFA 4BFUA 4PAMA 1SVIA 3VR3A 4R98A 4TZ0A 1YJ5A 1XCPA 2F43A 5FOTA 5EZ6B 1PUIA 5DI3B 1U8ZA 2ZUDA 1CP2A 3DDCA 2X77A 3Q72A 3WBJA 4TQUS 5FUVA 1DARA 1VTKA 3RNLA 1SVKA 4AG5A 3LLMA 2Z4SA 2DFLA 2QNRA 1RJ9B 1PLKA 2ANBA 1E2FA 2G88A 1AM4D 1UF9A 2D2EA 1Z06A 4C7OB 3GEEA 4DLYA 2HYIC 1ZNWA 1FW6A 2HT1A 2C03A 5HKKD 3B78A 2PH1A 4PPQA 1G3QA 1Q3HA 4B76A 1E2IA 1M2OB 1UM8A 5BWMA 1RVDA 2HJGA 5DH9A 1G1MA 1OJLA 4HYYA 4XVRA 3ZVNA 1IHUA 4B43A 2QP3A 4P0TA 4EUNA 3H84A 1P2VA 2JLUA 1CR2A 1KK2A 1GKUB 4PZLA 1KO1A 4XIGS 2IHYA 1CKEA 4AKEA 2VEDA 2JJ2D 1N5JA 3A36A 4URWR 3OIUA 4TYNA 1NRJB 4CEHB 1GKYA 2R9VA 1E96A 1R8QA 2ZE6A 4DLXA 3PR1A 4TQAA 3EPJA 4PANA 4D4LA 3LV8A 1FPMA 4JYCA 4OHYA 1S1CA 2P2LA 4WAUA 4IOLA 4V0KA 4A6PA 1E4YA 2AN9A 3HU2A 3DKPA 3KZ1E 3AP2A 2GNOA 3KKOA 3TK1A 4ASUD 1JECA 4LJ9A 5DISB 3QEJA 5BXQC 3U3RA 3GLFA 4FXPA 1D9ZA 2ZJYA 5BN5A 1UEIA 4IDPA 4B3BA 3UG6A 1SVLA 3TE6A 5IHPA 1OKKD 4ARZB 4B48A 1EXMA 1NY5A 2PXUA 4URYR 3C7KA 5K8TA 2IW3A 3DZDA 3E5HA 4IOJA 4POAA 3AKEA 1KK0A 4PO1A 1KK3A 3B2EA 4LGMA 3LW7A 1E99A 4A4DA 4G5OA 4A2QA 2OFXA 3HDTA 3Q7QA 4MDFA 1R10A 4WZBE 5KPJA 4AG6A 5HZKA 3SN6A 4NH0A 4MQBA 5EUQB 1V5WA 3BB3A 4HLCA 5B64A 1XXHB 1FOEB 4UXIA 2VP6A 3THWA 1R2QA 3X1DA 1E79A 4G0NA 4LJYA 4A2PA 3PCRB 2OUKA 4O0MA 5DI9A 2QBYA 5TMPA 4ZDJA 3L0IB 3KJEA 4EIWA 3OEHD 4TYQA 4XVQA 3THOA 3WYAA 3NWJA 5L3RA 2IUTA 3NC1C 1Z07A 4FCWA 3PQCA 1XEWY 3L8YA 2NO7A 3AF4A 2PZGA 2JLXA 1E2QA 1R5BA 3U60B 4GNKA 1KDTA 4LWZA 3REFA 2BIFA 2FV8A 4P32A 1RRGA 2QP9X 5AUPB 1SGWA 2AK2A 1OSNA 3WXMA 5LBIA 2QT1A 3MJRA 4LCBA 4Q21A 4OBEA 2C96A 3FTQA 3THXB 3GJ5A 2ZYUX 1JQJC 1RIFA 1W4AA 1Z22A 2MSEB 3QVUA 2KBFA 3PIRA 2IYUA 5AUNB 4AD8A 1FUKA 4R2IA 1VHTA 3AVVA 3GMTA 4LJ6A 1E9CA 4NYIQ 2R2AA 2E87A 2QP4A 2YWFA 4QHSA 3CONA 3CR7A 1U0JA 2EFDB 2PX3A 2P3SA 4PAQA 3DOEA 1JAIA 4HAVA 2ZRKA 4KVGA 3VR5A 4Q4HA 5JHHB 5F9FA 1OPXA 4X8HA 1E2NA 1UKEA 2WWGA 2OM2A 2HEIA 4PC6A 5IT5A 1TQ4A 4BE7B 1UBCA 4C2TA 4RD6A 3BIFA 4BFYA 2VSFA 1ZU5A 3L0OA 4Q9HA 1WRBA 3HPRA 1FL9A 3NVAA 5BYJA 2AXPA 2PBRA 4L16A 2OFOA 3JZMA 2R62A 2ORIA 3K9HA 3QF4B 4DHEA 5L3SB 4C9BA 4H9GA 5FUXA 1TX4B 5IDVA 1G8PA 1OF1A 1AGRA 3EZ6A 2QAGC 3W90A 4M4SA 2QMOA 2CHVA 1KJZA 3TIFA 1PLJA 3GLHB 3LQXA 2C95A 4OHWA 4DCNA 4YXWD 1GILA 1NJFA 3ZZUA 3IEUA 2JLQA 1XEXB 1I4DD 1GSIA 2GRJA 3A37A 3I1FA 2WWYA 4GOJA 4OYHA 4NE2A 2ZI6A 4LYHA 2CLSA 3X1ZA 4MUBA 1JR3D 2YOHA 4XD7D 121PA 2OCYC 4Z54A 2B6HA 2V1XA 5JJKA 1KO4A 3C5HA 3EA5A 1OV4A 4G1UC 4Z8YA 1W47A 3PUYA 4KFSA 1E98A 4GSYA 1Z6AA 4IDHA 1MH1A 1T3HA 1DAEA 1SKYB 3B5JA 5CYPA 2D3WA 4HLUA 4KXFB 5E7JA 2GJSA 4M9ZA 1KAOA 5LDDC 2FFBA 3LNCA 1JXOA 3KQHA 4TLCA 3IIKA 4EPTA 3QBVA 5FBWB 4CT4B 3U6BA 4TMZA 2F7SA 1JR3E 1YHNA 1ZCAA 2J5XA 3BB1A 2XZLA 2IX3A 4RD3A 2F43B 1GTVA 3MUFA 5A0FA 1OXTA 1QHIA 2OEPA 4NPHA 4TSFD 4HB0A 1G7RA 1XD2A 2ZJ8A 4DDUA 4L9SA 2OLKA 4O3MA 1XD9A 1CJMA 2X8AA 1P7CA 2UZ3A 1G17A 2AHOA 4I1OA 1J2JA 4C2UA 1D5CA 2J45A 4NL4H 5EE0A 4E03A 5E3HA 2XJ4A 2OCPA 2NO1A 4LJ7A 4A9AA 1U8YA 1CJKC 5SZIA 1ZNZA 1COWD 2N46A 3SFVA 3U6KA 1ZM3A 1Z0KA 3EIHA 3N5CA 1E0SA 2WJIA 5BYKA 4B71A 3FHTA 4ITRC 4Q19A 4JJZA 721PA 5H70A 1EK0A 2JJ2A 4WA7A 3LD9A 3AP1A 4EPXA 5K8UA 2QGNA 3AB3A 4BFWA 2W6ID 1OB2A 3SC3A 4QC2A 4FCTA 2FH5B 4R2HA 4ABYA 4EDHA 3SFZA 1E1QD 3MLEA 5KSYA 1TAGA 3W3AA 2WOJA 2PJRA 1GFIA 1N6PA 4AI6A 4YMUA 1FZQA 4ASUA 4HAWA 4IJMA 1WF3A 2SHKA 4LRWA 4KSCA 3ZZ0A 3IO3A 2DR3A 1I2MA 2VP0A 1Q0UA 1LY1A 2AXNA 5E95A 1P9NA 1OKKA 4JVSB 5HPYB 2VBCA 2R6FA 3SYLA 1EESA 3ZZTA 1D9XA 1KI7A 4Q7LA 5IRCD 1TADA 3P1JA 2GJKA 2F1HA 4MH0R 1JPNA 3GLFB 4MGZR 4RD2A 2FOLA 4PC7A 3T61A 1DULA 2PT7A 4B2IA 1P2TA 2QAJA 1MO4A 4I99A 4KFRA 1BMFD 2Z0MA 1HQYE 3X1XA 2ZE7A 1I4TD 5AJVB 2W0SA 4JLVA 3IDQA 3U5ZB 2H18A 3B1ZA 1FUUA 2C9YA 3LY5A 4PSAA 4QNRA 1MKYA 1MV5A 4LC0A 5AJYA 2VF8A 4KFTA 4DIEA 2PLFA 2DB3A 1MT0A 1G9XA 3GEIA 3NTUA 3OEHA 1NVVQ 1ZNYA 3H0KA 3MWJA 1MO5A 4Q1AA 3FVQA 4TMWA 3LQRA 2N42A 5CK5A 1HQ1A 1NL3A 1YR9A 1X3SA 2ZM5A 3T5DA 3THWB 1KKLA 2DWPA 2AKAB 1E2LA 2WWFA 5GJVC 3UATA 2QBYB 4OJQA 1D8TA 3EC1A 2VYFA 1K8RA 2ZYTX 3GLIA 3A4NA 1P9RA 3CR8A 2IYVA 1QHXA 5JEDA 5L3VA 2JLRA 1YVDA 4JBXA 1NN5A 1KI8A 3GJ8A 3FKSD 1DPFA 2OLJA 3U3KA 5SZKB 1OH6A 2BMJA 4XWAA 2P5TB 2ZSBA 1XTKA 3PEYA 5FTLA 4F4CA 3T15A 4MA4A 2JLVA 4QXAA 3L43A 2ZRPA 5EP1A 1HH4A 2C77A 3NBFA 3OFNA 2KBEA 1HE8B 5AWFC 2ZE5A 1KI4A 2R6AA 3EPHA 3W8RA 5FBRB 1KY3A 2OV2A 1TQ2A 3SS8A 4UNQA 2GZHA 3PENA 1W1WA 1CR1A 4BPBA 1T5IA 2H57A 1ANKA 1AS0A 2NO9A 1GNRA 3CF0A 3Q7PA 3ZQJA 4Q9JA 1U2RA 2AWNA 4DLUA 3TSOA 1P60A 3H1TA 4Q4HB 1KOFA 1NVUQ 4DDTA 3P32A 3KKQA 1HYQA 821PA 4V02A 1E2GA 4CGZA 3GLHE 4M21A 2GCNA 2BCGY 1SQ5A 2Q9AA 1Z0FA 1G8GA 2OZEA 3CM0A 3FFBA 1R7RA 1IAQA 3HU1A 1TL7C 2A5GA 4YXWA 1YKSA 4AIIA 2EYQA 1PVOA 3MAAC 4KO8A 5B30A 1N5LA 2NO6A 2C9CA 3H2YA 4M1MA 1Q22A 4RD4A 2KWIA 1JR3A 3QUSA 4FCVA 4M22A 4QGGA 4XD7A 1WQ1R 2CE7A 2F3RA 4ON9A 2OILA 1XJQA 4IKEA 5JWOA 3IPYA 2PXFA 4CIDA 2QN6A 1Z6GA 3ADKA 3G5UA 3SHWA 2QAGA 4Q48A 1NN3A 3FFAA 2YZ2A 1RRFA 3MWKA 4QBIA 4C0AC 1KI9A 4YMVA 3U7GA 1TF5A 4GMXA 3TUZC 5DYGA 1E3MA 2WV9A 3A1VA 2RCNA 221PA 4PC1A 1Z5ZA 3VNVA 2IWHA 5KDLA 1C1YA 2B8TA 3QNUA 1GUAA 4FI3C 2PXKA 1VYUA 2F1RA 2CCKA 2ODEA 2QRZA 3RRYA 1UKYA 2OG2A 1T0JB 3DM5A 2RHDA 5FPSA 3TW8B 5JRJA 5SZJA 3I61A 1JJ7A 1IONA 4HUQB 1QDEA 4TSFA 3CRMA 3AVWA 4EFLA 1U8AA 1VCOA 2GILA 2V9PA 3CPJB 2PZFA 2REOA 3KUCA 3GLGE 1DO0A 1NLYA 1FQKA 4FINA 4TMXA 2D7DA 2JLWA 3EIQA 1XPUA 4R9UC 1TTTA 2JA1A 2PL3A 3WMEA 1QRAA 1DS6A 4BECA 3I5YA 1LFDB 1KDOA 1COWA 3O47A 4U00A 1XD2B 3FGNA 4A82A 3DZ8A 3BOSA 1NSTA 1QG2A 3QKUA 2W2XA 4LY6A 4YDSA 3GFTA 1CLUA 3U44A 1HT2E 4B3FX 4YONB 2PXLA 1DG1G 1OHHD 5F98A 3F3YA 3L0PA 4XJXA 3VHXA 4DLSA 2YYZA 2L0XA 2IT1A 1H8ED 1F2UA 1QHGA 2ZR7A 4IDNA 1HQCA 1E1QA 1N0VC 2AFIE 2ZRNA 4W7SA 4YQFA 1R5NA 1KTVA 1II8B 4KAXA 2PXBA 1L2TA 4TLDA 3IIMA 3IO5A 5FOXA 4PFSA 4TYWA 1P61B 3OEED 3RANA 3AEZA 5EP3A 1EFUA 3W6NA 3CUEF 2FG5A 1FTSA 4EPYA 4UXHA 3PEUA 4DIDA 5JI2E 5J4LA 4TL8A 1MO6A 1TU4A 2OAQ1 1NVXQ 1R0ZA 3P4XA 3EPKA 3CB4A 2QL6A 1ZMXA 1P73A 3Q8XB 3EWAA 2K5UA 2H7VA 2QTHA 2ZUCA 3B8HA 3S1AA 5JLJA 4F93B 3D7MA 4TMKA 3KJIA 4LHXA 1RYHA 1ZJ6A 1BMFA 1KO8A 1S9HA 2V54A 4FIDA 2ZROA 2G9NA 3KUDA 4CT5A 1R0YA 2N1BA 3V4FA 2P6NA 4YC7A 2ANCA 2GXSA 2QMEA 1CXZA 1IY2A 2GXUA 2C98A 4RZ2A 421PA 4EKDA 5JSZA 2BJVA 3WP0A 2XSZD 3WHLA 1KMHA 4M1KA 1TUEA 3KTAA 2VIIA 4URVR 1SXJC 2Q21A 1TEVA 2IXGA 5CYOA 1GRNA 2ZEJA 4Q9LA 2OCBA 5JWHA 1P5ZB 1S2MA 3NXSA 4M9SA 1XU4A 2MMCA 5LB4A 3HR7A 1GP2A 5JBQA 2HXYA 2QUZA 1XPRA 2O8EA 5EUMA 1Z63A 3CPEA 4KHZA 4UJ5A 1Z0IA 2AX4A 1RW4A 3BE4A 3B1WA 1ZM2A 1Q12A 3IKJA 4Z1MD 4I1UA 1TUIA 2OBLA 4JVLA 3TSZA 4V0OA 1SXJD 3TMKA 1DAMA 3IUYA 4LBVA 2PXQA 1FP7A 3BORA 1NG1A 1EWQA 2XTZA 4G5SA 1ZIOA 2FZ4A 4RJLA 4RCYA 1UJ2A 4OK6A 3Q5DA 3R8FA 1W0JD 4OHXA 1E0JA 4LPKA 3KQKA 4AKGA 1ZM7A 2IEZA 1XZQA 5KDDA 4QFMA 3VKGA 1EFCA 3U3JA 2OXRA 1F5NA 2BBOA 1DTSA 1G16A 1QG4A 2OXCA 5L8VA 3NBZC 3TNFA 4MKFA 4WIAA 1YR6A 2JJ1D 2AFHE 1U9IC 4PQYA 1GM5A 1YE8A 3CIOA 4JS0A 4K81B 2JDID 4NBSA 2VP4A 4DCVA 4M2LA 4DB2A 1P72A 1OH8A 2VP9A 3TQFA 4B3XA 2QU8A 1KI1A 2IHBA 4C3ZA 1U0HC 4DC9A 3I72A 4JSTA 3KDSE 3E70C 3BD9A 4BEBA 1E2EA 5FTNA 4DLRA 4Z8XA 1AZTA 4YMWA 3QF7A 4Q1FA 1XMIA 2J7PD 1C9KA 1YQTA 5EP2A 4BRWA 5CIQA 3EZ2A 1FMJA 4GPTA 4D0GA 3C8UA 3A6PC 1IY1A 4C0LA 1WBBA 5D3QA 1S1MA 2D2FA 4X8MA 4YMTA 2ZJOA 1K6MA 3ASYA 2BHRA 3C5CA 3CWQA 4MGKR 4LPSA 3EAQA 4KCGA 2ZRGA 1S3SA 3VHLB 1F2TA 1GG2A 1NP6A 3V4RA 4IDOA 1UADA 1F60A 3ND8A 3GLGA 2X2FA 4OQMA 1U94A 1E9BA 4KYIB 2ONJA 2QQ0A 2B7BA 2B92A 4FN5A 4IOMA 4L9WA 5DIFA 3GFPA 1KSHA 2FMXA 4JLAA 1B0UA 4RD0A 4X8OA 4FMDF 2XTNA 3BAFA 3MMPA 4B2PA 2QAGB 4KSBA 2NO0A 4LYFA 4RFSA 4BFVA 3CNNA 1N6KA 3BS4A 3ONWA 1X1RA 4II7A 4A2WA 4KLNA 2W6JD 3K0EA 2GCOA 2EQBA 3R20A 2VA8A 2O8DA 4NYMQ 2IS6A 4KI0A 1CULC 5JJLA 1S4QA 2J7KA 4D6PA 3FYHA 4OI1A 4GT1A 3EZ7A 2ZETA 2QROA 4BGDA 4JL8A 521PA 4ZIRA 2ZI9A 2ZRHA 3TUJC 2F1IA 4BEJA 1VKJA 3UXMA 1X8LA 4TLBA 4MYHA 4OHVA 2PXVA 1PZNA 3LVQE 4M1SA 1AS2A 1A82A 2QMUA 4EJSC 4HATA 3EX7C 5P21A 4C0SA 1X86B 2Q3HA 3OE7D 5JEEA 3NG1A 1FP6A 1YZUA 3MSXA 2WJJA 3GJ7A 1IJEA 1DAHA 4NP6A 4GP6A 2O0JA 2ZRIA 1ZW6A 1OHHA 3FMFA 3W34A 2Y8EA 4E22A 1XF9A 5B57C 1LV7A 5H68A 1H8EA 3F5FA 3VFDA 1H8HD 2GXAA 1XEFA 4RKFA 4ZKDA 4OI2A 3O8CA 4TWZA 2QRNA 3HJNA 4UQOA 2WPDD 2VHTA 3U44B 4US2R 4L15A 4JBWA 5CLQA 3RC8A 2WWIA 1JNYA 4JT2A 3TLXA 4P33A 1DELA 3ICQB 1U0LA 3OEEA 4A6XA 5DN6D 2A5DA 2CL6X 4GOXA 3AVPA 4JLPA 4PAOA 2JATA 5JHGB 5EXXA 3IQWA 2FSFA 2GTPA 3W3ZB 1F2UB 4MYCA 2HLDD 1U98A 2BM1A 2FA9A 4OQXA 4M9XA 1E0AA 3AP3A 1LTQA 2FEMA 3IIJA 4Q7JB 1N0WA 1N5IA 1W7AA 2EWWA 1HY3A 1NMXA 3SE0A 2PXEA 2WVJA 3B13B 3LFUA 3D3QA 5JZVA 4F38A 3TRFA 1GZSA 1BIFA 1XFAA 2O8BA 1KKMA 1E2MA 1W44A 4D0NA 1JI0A 4GL2A 1G64A 1J99A 1YZNA 2WWXA 2WWHA 2ODWA 1CEEA 4BZPA 4NTZA 1L4UA 1T9HA 2ZYWX 1XMSA 1UFQA 1XP8A 3FE2A 3O8BA 4Q1BA 3RS7A 3S1AB 2DCUA 2AD5A 3THYA 5KSOA 1P9WA 4EPWA 4A0RA 2CE2X 4DCSA 1UBGA 2CJWA 4QM6A 2XAUA 1VHLA 3R9XA 1E0KA 2VRWA 2HYDA 2QPAA 1N6OA 1SVWA 1MFQC 4D4MA 3JZAA 1SHKA 1HUQA 1WA5A 3CX8A 5JSZB 3FMIA 1OXUA 1KMHB 3KTAB 4BWYA 5TARA 2Z83A 5E4FA 3RRZA 1CS4C 1GNQA 4O2RA 1P62B 4M1YA 3WY9A 1E9SA 2RGGA 3U7FB 2IWRA 4Z1MA 4EFMA 3IILA 1G7CA 1M7BA 1MRNA 4ESHA 1SXJA 2ZS9A 4G5RA 3REGA 4TZ6A 4NCIA 4WOPA 1E9FA 1BS1A 2O8EB 1HEIA 1NMYA 3GLIE 4DEYA 2HCBA 3AKYA 5FTMA 3QXJA 3WMGA 4KBGA 1W0JA 3IBGA 3AV0B 1PV4A 1W36C 3VKHA 4M1TA 2WJHA 2HT6A 5SZHB 1QF9A 2GVZC 3A8TA 2V3CC 1IN8A 4M1WA 4TYPA 2GESA 4EAQA 3ZIAD 1CJVC 1OW3B 1RZ3A 4B6EA 3KQUA 3A4LA 4C0BA 3LLUA 4NMMA 2EWVA 2VP2A 4RVCA 4C0HA 1VMAA 1Z08A 3RS3A 4MRNA 2Q9CA 2JJ1A 4K8OA 2JAQA 1A4RA 4BLQA 3SNHA 2JDIA 2UKDA 1ZUHA 2NIPA 3BXZA 4HDCA 1JXMA 2QENA 2GAOA 4XOIA 5HTKA 1W36D 2ZRFA 2ZJ5A 4LYAA 1Z28A 3RS5A 3I73A 2H5EA 1XCMA 4GBMA 4B74A 3AH8A 4ILEA 3L0SA 2DY1A 1G8YA 3EASA 5JMTA 1T3SA 3KXKA 1CF4A 2J7PA 3QXXA 3TR5A 1NKTA 3WYGA 1IN7A 1U9IA 2QY9A 2CLCX 1W2HA 5EQTA 3ZJYA 4B75A 1IM2A 4PC2A 2AKYA 4O2LA 2G1JA 1GIAA 2PXPA 3T06B 4QBHA 3BFVA 1SVSA 5AK0A 3RRMA 4LJ5A 4YLGA 5EXSA 4U02A 2NPFA 3K09C 3T5GA 4KITB 2CL0X 2PCJA 2EVWX 1N25A 1DAKA 1XDBA 3RLFA 2BOVA 3WNDA 2GWHA 4CYMA 4QL3A 2V6JA 3CH5A 4RZUA 4DSOA 5FTJA 1P2SA 1VG0B 2KB0A 2YOFA 4LBWA 5G41A 3EA0A 3P20A 2HDNB 1FQJA 3KL4A 1BH2A 2QI9C 1F2TB 2H17A 1U81A 2A78A 5HKKA 1E32A 1L7VC 3GLGB 4S35A 3NHAA 2FE4A 3AF2A 3GPLA 2A7QA 3AUXA 2W6JA 1IN5A 4MGIR 5H1YA 4B6FA 5IK2D 3B85A 5FOWA 3QKSA 3RWOA 2FSHA 1N2CE 3AVXA 5DYIA 1UDXA 2CLDX 3FHCB 2J0VA 1JAHA 1T4GA 4AURA 4C0KA 4KVAA 3T12A 2VTKA 4GMDA 3CO5A 4RFSB 1ZU4A 4FMDB 1EX7A 4AYXA 3C4JA 4N1AA 2GCOB 1G3MA 5C4GB 3R9WA 1XTSA 3WNBA 1TU3A 3RHFA 2O8DB 3KXIA 2FN4A 2HUPA 3SJZA 2A30A 2ZREA 4KU4A 4GDFA 1R5OA 1KI2A 3DL0A 5EXPA 5M04A 2R8RA 1AKEA 3NDBB 3A58B 4JL6A 1BO6A 3HU3A 3OE7A 4IVRA 4ZIRB 4GI7A 3RSOA 4Y0AA 1JALA 4OKSA 2Z5FA 1KI6A 3FDIA 4GRAA 5KTYA 4PHFA 2G3YA 4C0QC 3CZPA 5G40A 1HV8A 3UMFA 3GEHA 1H65A 1H8HA 4QOSA 3QBTA 2QE7D 3QENA 3SJCA 2CBZA 4KLZA 3ADCA 1AS3A 1Z0JA 3MRSA 5J4HA 3PEWA 3SEAA 1NBMD 4EJSA 5KSZA 2VHJA 1ZRHA 3JVVA 2KJQA 2ZVPX 4LK2A 4UXJA 4AKHA 4TL7A 1VG8A 2RGCA 5TVKA 2ZPTX 1J70A 1J8MF 2J1LA 1ZNXA 2HLDA 3LDAA 4DCTA 4N3NA 4DZZA 3D31A 4IW3B 2FPMA 1IJFA 2R6CA 2RHMA 2D74A 1O87A 2H92A 2OT3B 2V8OA 3NEJA 4MRSA 4PO9A 2IXEA 1R4AA 2YOGA 1HA3A 1E9RA 4FMCF 3VAAA 1UKVY 3VU9A 2FEOA 2QEQA 3LXRA 3RRNA 1WP9A 1XTJA 4PX9A 2VLIA 4ACAA 1G19A 2YHSA 1IN4A 1WDTA 2ONKA 4ESVA 1ETUA 1NBME 1NI3A 2BV3A 2REBA 1W5TA 1T0HB 1DAGA 5HCIA 4DLWA 4PZZA 4Q1EA 2UVQA 3WRYC 1QB2A 2ZJBA 3KJHA 1E9AA 4JT4A 4TLAA 4PHHA 5FUWA 1DO2A 2O8BB 3QOFA 2P0EA 1II9A 1NF3A 5KSPA 2CXXA 4I1VA 4HAZA 4LSGA 4ZO4A 5EJEA 4A0GA 1QBKC 1N6HA 2OFWA 2IYXA 3QPVA 1TNDA 3PEVA 3CRRA 2ZU6A 2OBNA 4V0MA 2VHCA 2CEAA 3P26A 4RKEA 3THYB 5CB8A 3CH4B 1W48A 2CNWD 4B35A 4QJ3A 1JB1A 1QZXA 3CW2A 4PSVA 5G3YA 1Q44A 2CJWB 5DNYB 4V03A 5C18A 2R65A 3AGQA 2PZEA 3L82B 2FFQA 2FU5C 3TJZA 5FPKA 2WIAA 1E9DA 3QY0A 2ZRLA 5D3MA 4ZPXA 2V7QD 2WBLC 4NCHA 1QHSA 2WMOB 2ZS8A 1Z83A 2IYRA 2JLZA 2ZAMA 5EE5B 2ZR9A 2KE5A 3MWLA 1FFHA 2GEDA 1G6OA 2C04A 4HAUA 5JI3E 3OIVA 2QSZA 1OFUX 4KFUA 1SXJB 3ZIAA 1S3GA 4WZ6A 1OYWA 3R9IA 4MRPA 3WBKA 621PA 1NIPA 2DBYA 2WJYA 1HURA 1GAJA 4XSHA 5LPNA 2JIZD 3SOPA 3OF5A 5AJZA 4PHGA 3LBIA 2ZE8A 1TF2A 3O8RA 4IDQA 3CZQA 1N0UA 5FBLB 2QG6A 2PX0A 3UK6A 4D0LB 4JLBA 1Z0AA 2QTFA 2XNDD 1L4YA 5GAHi 1E1RD 2YINC 2IS1A 2D7CA 3LAWA 1RKBA 1ZUIA 2F6RA 2HF9A 3EARA 2IYYA 4EQ6A 1J90A 2DPXA 4DSTA 2JLSA 4XH9B 1Z3IX 3CLVA 5DSZA 1E4VA 3UANA 1WB9A 4W5JA 4Q4AA 3A4MA 4QRHA 5EE9A 3GP8A 1Z6YA 1OIWA 1MOZA 3AM1A 3DEFA 2EYUA 4Q1DA 1MO3A 2P5SA 1CJUC 1MABA 2H1LA 4L4UA 2GEVA 2ZRMA 4QGAA 1ZD1A 2JCSA 3B60A 4Q4LA 4UNPA 4B3DA 3UWKA 1AA9A 2G77B 3CRQA 2EFGA 4B44A 3TVTA 2RMKA 4LUCA 2PXTA 2AL7A 3NBYC 3KQLA 5BQ5A 1PLLA 4URXR 5GADl 2QSYA 1YR7A 3GJ0A 4LOAA 2PEZA 4Q01A 4IOKA 2OSBA 2R44A 3KKMA 3H4MA 2O5VA 4JSYA 1TMKA 3KXLA 4LDJA 1KGDA 1HT1E 5FTKA 4AYTA 2GZDA 2Q6TA 1UAAA 4DDVA 3X1WA 3W5JA 3LO5A 2RGEA 5CM8B 3K09A 2CVFA 2J46A 1O3YA 5E7MA 4D26A 2IUUA 1YU9A 2GDJA 2GK7A 4Q7KA 4Q9KA 1TPZA 2PLRA 2ZSFA 1XMVA 4QBFA 4CEHA 1XX6A 4BASA 1ODFA 4Z51A 1UBFA 1Z47A 2EW1A 2VHUA 2RGDA 1G21E 3EG5A 3HP1A 1P75A 4JMPA 3G0HA 3LH5A 3TUIC 3FOZA 1W46A 2A5FA 1I4LD 2W6IA 3QKSB 4LC1A 5FR2A 3I32A 2G0NA 2IF0A 5AUQA 3B1VA 5EE3A 2ZUBA 3BK7A 3K0CC 1KI3A 1J8YF 2WMNB 1OH7A 3UG7A 1IXZA 1DVRA 1QHNA 4HLDA 5CJ2A 4WXRA 5TXGA 3W6PA 5J47A 1W4RA 3PVSA 4URZR 4O25A 4ARZA 2B7CA 2IEYA 1UDWA 1VG1A 4MRVA 4R7ZA 2QE7A 4NU0A 4QG7A 1W4CA 5JWRA 3CRW1 3X2SA 2YNMA 1NBMA 1KI6B 2JASA 2QM8A 4GZMA 3SHFA 2XX3A 1WCV1 2FFHA 2AK3A 1YZKA 5TDHA 2ZQ5A 4HZIA 4TL6A 3SDZA 4ZCMA 2XNSA 4RFVA 4IHQA 1D2NA 2OESA 3BRWD 3WNCA 4HUTA 1G5PA 1P4SA 1F3OA 2NGRA 4EJSB 3QI2A 1IBRA 4D82A 3K9LA 1F48A 1KSJA 1LW7A 4HDQB 1VYTA 1XEWX 2AD1A 3TR0A 2RGBA 4B3GA 2LWIA 5DO9A 1Q3TA 1TF7A 4FW9A 1YRBA 3U4QA 2RGNC 1NG9A 5C1BA 6Q21A 5CDFE 1ZC4A 3M4YA 1E79D 5JRZA 2LKDA 1RE0A 3ADDA 4LJ4A 1DG3A 1Q20A 4ZCIA 4OI0A 4JKIA 4LZZA 3VU9B 1N6LA 2MSCB 3GCGA 2ZRJA 4YMSA 2WOOA 3LVRE 1OFIA 2ZSEA 4FMCB 3F0TA 3T35A 2GKSA 3D8BA 3I8XA 1OH5A 4BQSA 1BOFA 4OHZA 4OQLA 3I62A 1AJEA 1M7GA 1KSFX 4TMVA 4F91B 3FKSA 4Q5IA 4BRUA 3M1IA 1XTRA 1OB5A 4US0R 4NONA 4BLPA 2XEXA 5GJBA 3CX6A 2WZQA 4DEXA 2XZOA 3PFIA 2NTYC 1OXSC 2H8KA 2JJ8A 2FSIA 2CNWA 1HTWA 4M1OA 3GLIB 2IYQA 1M7HA 2ATVA 4AC9A 4CEJA 1CJTC 5G3ZA 1M6NA 5JECA 2HF8A 2IYZA 2QM7A 3SBDA 2JEOA 3CPHA 1G3UA 2FSGA 1VIAA 2RH5A 4OQNA 1IOZA 2V7QA 1ZM4A 4JLNA 3RYTC 4NZYA 1D2MA 1Z2AA 2J0UA 4ACBA 4A1FA 4JBYA 1T8TA 3G82C 1SHZA 1EFTA 1P2UA 3VTKA 1KYIA 2CDNA 4OI4A 1SXJE 3LXXA 5LB2A 4A92A 2BEJA 2J0SA 1R8SA 2YWHA 2O8FA 5D3MB 4CF7A 3RS4A 4AYWA 2QPOA 1WGWA 1GRRA 1CIPA 1CRQA 3WP1B 2ZANA 1NN1A 2JIZA 1NIJA 4DVGA 3A1SA 3DMDA 4E5UA 4G5GA 3U7HB 4LBYA 2A9KA 4MRRA 4JKYA 5FBVB
chains in the Genus database with same CATH superfamily
2AUWA 4C20A 1BFKA 4A0SA 1KRWA 4U5BE 4EKNB 1JG2A 3FH0A 4PJMA 3HDYA 3F5QA 4ZV7A 4H0FA 1QHYA 4G01B 4W4TA 4QATA 1TQHA 2Z43A 3CVVA 2NU9A 3WADA 2R79A 3JATA 1RCUA 1SZPA 1W25A 2VLBA 4DXDA 4FMBB 4YCBA 1Y9AA 3NMIA 3QXCA 2JW5A 2TMVP 3HXOA 1ZM9A 5SV2A 4DR4B 3GJ4A 1AG9A 2O0HA 3VNAA 3ZVLA 1Q74A 3NC4A 2FKAA 2PFKA 1U6HA 1PG5A 4P2BA 3WAJA 2O2DA 3NH9A 5L0GA 1WUYA 4BNWA 3DVQX 3COZA 4Y9RA 5JH7F 1CQIB 3PXBA 1V48A 5A9SA 2QUKA 5K3FA 4UM7A 1ZC3A 4LI3X 3DKVA 4BLTA 1RM4A 5ALIA 1PSDA 2LBPA 3BIOA 4RL4A 2XXAA 4TXJA 4MW7A 5ALDA 4H7EA 4IJVA 4BNTA 1US8A 3UJ7A 2N3ZA 3MLFA 3PL5A 2ZVJA 4BFZA 2H1FA 2MSWA 4EZEA 4OP2A 3LNRA 2ZI7A 3TD9A 3BGSA 3B3JA 2W2KA 2PPVA 3QVKA 1CY4A 3O21A 2XL8A 3VR2A 4YRBA 1K3FA 3Q9NA 2C4UA 5JZBA 2VZ0A 3N1UA 3N2IA 4M1EA 4H54A 2Y1EA 2YLDA 4F9EA 4X1IB 2PU7A 5DX8A 3T1TA 1HLPA 3BJRA 5CD1A 2B8EA 3LCVB 2ZIFA 2RONA 2GFQA 2P79A 3R3SA 1T6ZA 5ANRB 4FC6A 3HJHA 1XCJA 3GNTA 4ZDIA 1TPYA 2FRVA 2PZJA 2B69A 1KDRA 1AY0A 1GO2A 4RIGA 3DBLA 3KZMA 1CETA 3EVEA 4EFNA 2RGXA 3R5HA 3GRZA 1JHDA 1IBMB 4EG0A 1H4SA 1NBEA 3FWHA 3RAPR 3G7DA 4G1MB 3I9OA 1LVGA 3DM9B 1VLHA 4BPRA 4LRUA 2B5WA 1DNPA 5FNZA 3QA3E 1XZBA 3STYA 4Z5HA 1UXGA 4N06A 3QOYA 4DJ9A 4ZMSA 2G9RA 1EFRD 3K6KA 1GCOA 4BQEA 2WPDA 1X8KA 4YX9A 4X8LA 4ZRNA 3KR9A 3RODA 4J16C 4PIPA 3MG9A 1PE0A 3WOVA 4JCYA 4KAJA 3A05A 4B2LA 1X8JA 2CGEA 2LDXA 3VM6A 1T5SA 1UPTA 3MT0A 3ZGXA 5F4ZA 4UASA 4O4IB 5TY0A 3S2IA 4KQMA 2Y1DA 1NRIA 3AFOA 3SSOA 1UBLS 1TDJA 2C3UA 1NJGA 5ALKA 4US1R 1QHHA 2A9OA 1JW9B 4PRKA 1ST6A 5H7XA 4CBVA 4RY9A 2QVGA 1U3VA 3O7WA 3NVKI 1XJCA 5BW8A 1O6GA 4FUQA 4BZQA 5K8JB 1ORIA 3D3WB 5KUTA 1LSSA 1Z17A 4FWVA 1P4RA 5LZ9A 4LVNA 3C3MA 3NOVA 4YALA 2IEAA 2RIRA 2MJLA 4DQXA 4C4PA 4NTFA 4A8JA 3EGDA 1EIZA 1R69A 4H7PA 1YYXA 1G5HA 5I8PA 5AI8A 4GR9A 2Q9BA 5K8LA 1AX9A 3CVYA 4MDEA 5DI3A 2Y6VA 4HNVA 2B8WA 2JFOA 4G4SP 5DEOA 4YRAA 2GLUA 1QPUA 1IU9A 1ESMA 1U99A 4C7OA 4FE4A 3O8OA 5HFNA 4PINA 1GDHA 5JS8A 3LT4A 3CSUA 5H8WA 1KZYC 2W83A 1ILEA 3FWYA 4UOZA 1L4HA 4KOAA 1MRZA 3COPA 2QTZA 1NZJA 2QTNA 1N2JA 5JFOA 4L8GA 1TVKB 5FF9A 1K86A 2FR1A 2HZ8A 1HNNA 3N2GA 4K28A 4OGKA 4ZVRA 3P2KA 1BVHA 1NRWA 4ID3A 3NBXX 3CISA 1XNRB 2FEPA 4DOZA 3D8RA 4R6XA 1IXSB 1XCGB 2Y39A 3HQ4O 3FDQA 3DVAB 3NHMA 4MP8A 5K6AA 1WPGA 3KB1A 3EUEA 4QPZA 1Z5UA 1Z29A 2AMFA 1SOVA 3HE3A 2OZPA 3S2ZA 3DMTA 3V48A 4P4TA 3FTCA 5FPYA 3QVXA 1S96A 1GPAA 2AUNA 4N3BA 3I2FA 3IL2A 3GLFE 1U1IA 2PSJA 4DAOA 2Z3WA 1Q15A 3IVAA 2ZIZA 2LKCA 2OO7A 2AEJA 3IQ6A 3O31A 1TZMA 5IABA 5E2AA 5AW7A 4AF6A 2O49A 2XVMA 3BILA 3UHAA 1UCFA 2J9XB 1AV6A 4FFVA 3FFWA 4BNXA 4OJMX 3ZI4A 3UMRA 4GGMX 1WH6A 1Q1QA 3GBVA 2DQZA 1C3OB 1W0KA 3BWMA 1NVVR 2WAMA 2HPAA 2F55A 3OZAA 3UPUA 4X00A 2Q00A 1NOJA 2XKJE 5EHNA 1U7PA 2ATXA 1O6CA 2FPOA 2I9PA 2YKGA 3LY9A 5JOQA 1RC8A 2XF2A 4BBAA 3ZGLA 4CQLB 3SXKA 2JIBA 2FAXA 1F0PA 3TLAA 3K5PA 4AP5A 1M34A 2OKUA 3GQBB 1DJOA 4A6EA 4AVYA 4YCMA 4OVKA 2HT1A 3EG9B 2XY4A 3RJ9A 3LC2O 4ER0A 4ROTA 4U39A 1K7FB 2VWQA 2JIDA 4EUEA 2BE7A 4GWLA 3ZWKA 2BUBA 4D4LA 3IBTA 1FPMA 1O0SA 4WAUA 2VYNA 1Z6PA 1W94A 1PJLA 4CNBA 4URYR 4KBYA 3AKEA 4NQRA 5H59A 1AHHA 1O2DA 1BWRA 5AM4A 3GFQA 4N6OA 3PCRB 1ZJYA 2H1CA 1OW6A 4RTSA 2FUG1 1J7JA 3IKTA 4MZDA 4JIOA 3SHOA 3T41A 3K4PA 3HBFA 1Y48E 4NFSA 3UMYA 5CA1B 4M8SA 2E87A 2VT7A 1N9GA 3FWKA 5IYZA 5KAMA 5AP9A 1IBLB 5JPIA 2WWGA 4RVNA 1TVEA 4PR3A 4C2TA 1A5ZA 1ZU5A 5CXUA 4X7PA 1V1MA 2K7ZA 2WTXA 4MTGA 4RVSA 2DFDA 4KXVA 2OFYA 4YP7A 2Y0CA 3H5IA 5EZYA 2XWJI 4LYHA 1ES9A 4MUBA 1ISIA 3DMGA 4IO1A 3U17A 5JCJD 4LVCA 2YUTA 3NUGA 2KSFA 1X94A 4DWOA 4G9EA 3RC7A 1DAEA 1IW7F 4UAUA 4UTZA 4FT2A 4IR7A 3NYLA 3L8CA 2GRAA 2G62A 3IIKA 1RRKA 2R5NA 4CT4B 3O94A 2W43A 4QULA 1PQ4A 2F7SA 3O6VA 3FZNA 5A0FA 1WEHA 2WG1A 4OIQF 3FSGA 3R7DA 2C54A 2A58A 3V97A 3PQ8A 1E3OC 2WJIA 1MB2A 4MPDA 3KMIA 4UMFA 3LM8A 1EI9A 1UFBA 3U0CA 3MLEA 3QYFA 4EY6A 2WOJA 1N6PA 1IHYA 4JQZA 1Z18A 1AK9A 4HAWA 3OJLA 4IJMA 4MS3B 1LKZA 2DR3A 3L77A 4JVSB 5IRCD 5MN4A 1GQAA 2IH4A 4B2IA 1P2TA 1N9KA 2XOEA 1U9YA 1A96A 4UDNA 4JLVA 2Q50A 1MV5A 1QE3A 2FUCA 2LK4A 2C29D 1ZZCA 1ZNYA 2WD7B 3IUMA 1PD0A 1NXTA 5AO9A 1NXVA 3IVXA 1X3SA 4EA7A 5H3LA 2X1HA 1MC5A 5A7HA 3S8YA 2ZYTX 3FKSD 5SZKB 2P5TB 5AVUA 1O1YA 2EAUA 4MUKA 4A26A 4U8GA 2Y3BA 3I9JA 1Y3DE 4FZVA 1X7ZB 3CZ9A 4MKZA 4BX3A 3LGAA 3B6IA 3PEEA 4JUIA 3EVZA 5FBRB 3UHFA 4PBRA 2B4RO 3D2CA 1VK5A 4JWKA 4RLSA 4UPVA 1UMDB 4F06A 2AF3C 1YUBA 5BOSB 1V3VA 4BS9A 3EF3A 4V02A 4D43A 4CDYA 2WM8A 1QONA 2NTNA 1Z7BA 4L6CA 3MBOA 1PVOA 2OGUA 3ZJ4A 2QX9A 4DV2B 3JSAA 3MB5A 3FYTA 2QW0X 2PXFA 3T1HB 1FTYA 1NN3A 1K5PA 1QO0A 5LZ7A 4GMXA 4X94A 3CLSD 4D42A 7MHTA 5K3OA 5LA6A 3LKVA 4BQRA 3CY6A 4IGGA 3W6UA 4DA4A 2VXBA 3BULA 3KUCA 2O4UX 4RLFA 4R9UC 3PTLA 3RVPA 1QRAA 4LERA 1LFDB 2V5VA 1XZAA 2MYNA 4NEQA 4OHCA 2I4TA 3WLLA 4BCCA 3TWOA 4FLEA 3L0PA 1LPEA 1SFRA 1F2UA 1CQWA 3ESRA 2KX7A 2XAAA 3OEED 5IAJA 3AEZA 4CIXA 4CU2A 2FG5A 1GT91 1KP9A 4CLEA 1T9DA 1E58A 2OAQ1 3P4XA 5A6BA 2H1IA 4LRSB 5HS6A 2PRJA 4FIDA 3BDVA 2ANCA 1XDWA 1G5FA 5L9AA 3UW1A 5JAUA 1IBKB 5JISA 4IDGA 4JR2A 1I3MA 4MPTA 4BIIA 2PKEA 1DKNA 3DR5A 1JEJA 2AWYA 4RJLA 5AM5A 4E6PA 5BYBA 2WU0A 3VPFA 3MMNA 4NCXA 1XZQA 3AU9A 5KYYB 1G16A 1KNYA 1N77A 3AQCA 5JR3A 3E27A 1I3NA 2CLKB 1NXPA 2VP4A 2QLBA 1ODKA 3P5SA 5FTNA 1HLDA 2J7PD 1NONA 3ZE6A 4NBWA 3PFKA 1P81A 3QU7A 3N2YA 2CDQA 1S1MA 4XPIA 2I2AA 2XYGA 2DHQA 2BHRA 2UYCA 3NWPA 2ZRGA 1S3SA 1M8FA 4FU0A 2B5OA 1S4MA 1XLWA 1P5HA 2FMXA 5LL6P 4B2PA 1L4MA 2VJQA 3ZXUB 4BG0A 5L4SA 3INGA 5ALVA 1VE3A 1GUBA 1KBQA 1TUBA 5A7GA 1WPQA 4Y98A 4JSRA 3FYHA 1DMRA 4CIPA 3QFSA 4BEJA 1GG5A 1PHRA 1UPAA 3H05A 2QMUA 4LXIA 1FFWA 1SF8A 3JXEA 3OE7D 5CA0B 1GKKA 3MSXA 1RSZA 4GLJA 2WJJA 3L84A 3MTAA 4DV3B 4DMLA 1BRTA 3UAXA 1Z75A 4WMLA 3F5FA 1H8HD 3R0IA 3DHNA 3Q8MA 1P6UA 3O8CA 5GONA 2HU8A 1XRRA 4JBWA 4KX3A 1NHWA 1OLSA 4P33A 1DTWA 4ALLA 1M1NB 2GTPA 3B5EA 1PNQA 1U98A 1E0AA 3NGLA 3TQRA 3IIJA 4DR5B 1Y1SA 3SE0A 3IVRA 1VIMA 2A1UA 3BXPA 2B20A 3OX4A 5IXJA 1FXWA 3A6FA 3EQLF 4KR2A 2FF5A 1OA0A 3TEPA 3RUFA 1J99A 3H16A 2WWHA 2J48A 2ZYWX 3TQQA 4CIAA 1XP8A 1PL0A 3MERA 4FNAA 3E22B 1RKQA 4IHJA 2VRWA 1AO3A 1SHKA 5JC1A 3DR3A 1C7FA 1EMDA 3ZY6A 2CNOA 3PJDA 5IXYA 2VAMA 3TGWA 4MV1A 1FS5A 1RYYA 1VPEA 1SEVA 1JA9A 3B9RA 1CJVC 3LLUA 2VP2A 4RVCA 4C0HA 2YCBA 4IG4A 3JRTA 3OTOB 3NJ8A 3SNHA 2NIPA 1BCSB 4I5EA 4LYAA 4QXMA 1Z28A 2V0CA 4AL4A 4P80A 1KXZA 1T3SA 5J2UA 4XWJA 2C00A 3RRFA 3AIOA 3TOCA 1UG7A 2QUBA 1ONOA 1UODA 3T3HA 2C1XA 2G1JA 2VDJA 3QMVA 3INYA 1LK0A 1MJHA 3R7CA 4UAVA 4C2BA 4MZXA 4GBJA 2R97A 1RAEA 1L7NA 5TGDA 4RPKA 2AQKA 3RC9A 2W9XA 5AOBA 2Z8XA 3DHVA 5EHXA 2PUFA 3T12A 2VTKA 3GOHA 1INLA 4QYIA 3PXAA 2YW9A 4KN9S 256BA 1SH7A 2R8RA 4ALJA 2ZRQA 3PDIA 4GI7A 1BDJA 2AFIB 2HV7A 3K94A 4HTAA 1XCLA 2QE7D 3SJCA 2E85A 3JVVA 2ZVPX 3U3ZA 3LDAA 1Z15A 3VOTA 3OM8A 4P53A 3CN7A 5FAXA 2RG7A 2XUZA 4ACAA 1I80A 4I66A 1O6ZA 2KEJA 4S1WA 2UVQA 3P9YA 1K66A 1QB2A 2ZJBA 1CEYA 3NAQA 3TRHA 5LM3A 1UK8A 2QRJA 3CVJA 1C30B 5EJEA 3QUCA 2IYXA 2GPJA 2OBNA 4U7JA 5AVWA 5K4HA 3LX4A 4B35A 2I76A 3CW2A 1MIOB 4ND2A 3PFFA 4EDFA 2ISCA 5FPKA 3ZV5A 3Q40A 4JFRA 2JLZA 2Q7XA 4BRSA 3VO2A 3GEBA 4WNCA 5HK9A 3CNHA 2HQSA 4G2TA 3GLUA 2Q5FA 2QD3A 4ZI7A 2O7SA 1GAJA 2BFCA 3G7UA 1PNVA 3DJNB 5D91A 3E03A 3O8RA 3D8SA 4D0LB 3TLMA 2OQIA 2Z1MA 4J0EA 1ZUIA 1GRCA 1V25A 3JAWB 4EKYA 4ZOLB 1I5NA 3PXUA 4S0XA 2D4AA 2ZRMA 4HNQA 3RV4A 4HD8A 3CJTA 3RUAA 4LHEA 1SIWA 2GHQA 4CV3A 1E20A 3AI2A 5ARCA 5JS6A 2B5VA 2C3PA 2GZDA 5P8WA 2EX1A 2RGEA 4PQEA 1J5EB 1RXEA 5EJAA 1M2WA 4Q9KA 1GZ4A 4PZPA 5LMNB 5BXYA 4HDKA 4HWRA 3OE1A 1EFLA 3M7IA 4R81A 1ZI9A 3JD4A 3AY0A 4WACA 5HTOA 4KL8S 3WMRA 4CM7A 1OH7A 3WGHA 3BWYA 1L4FA 2WTEA 4ZHSA 1LLIA 4MV8A 2PUCA 4IIJB 2EGGA 1U8EA 3KZOA 2I7DA 1N36B 4QPDA 3HNPA 3T99A 3WNCA 2XSEA 3LFPA 3QW2A 4EJSB 3QI2A 1LW7A 5ADVA 4FLFA 1U3FA 2RGNC 1NUUA 5C1BA 5CDFE 3UTDA 4MV6A 3I01M 1ISPA 3ZWQA 2ZSEA 1TYDE 1XZNA 4BQSA 5BWNA 5CCXA 1KYYA 4P6VF 1YQ9A 4G1CA 4PF1A 1DBRA 3FSJX 1OOEA 2WZQA 3ZK9A 5H9WA 1HTWA 1RC0A 2WUFA 4KKVA 4ZT3A 4ZQCB 2XVAA 1G2PA 4QD3A 2Z3VA 3LSYA 1JV2B 1NHGA 1K8XB 4JBYA 1XVAA 2HDWA 3F78A 2V5AA 3ON5A 1U31A 1A41A 3TLYA 3UXYA 3ZC3A 3W2EA 3TDKA 2H1SA 4CF7A 1NC1A 1LDGA 2XLHA 3WE7A 2JIZA 3D2LA 4IQFA 3C7AA 4M7OA 4LBYA 5AVQA 2XNDA 3OLQA 1D03A 2ODBA 2ZRAA 4OM7A 2XTAA 1OWPA 3R6GA 1RFLA 2AH5A 5F5FA 5C80A 4ZAGA 4GEKA 1QORA 5KU1A 1YDEA 5ENDA 3O3MB 4X3CA 3QRWA 2IYPA 5BUSA 1KJJA 2PLAA 2WG2A 5LQSA 3OP4A 2VG8A 4TYMA 1U3GA 5F2OA 3GZDA 3EIEA 4FGJA 4KQ6A 1UBKS 3M2TA 3RVKA 2FWJA 4JURI 1V4VA 3T3IA 1WD7A 1MTOA 3D8NA 4GXRA 4F3KA 3A6ZA 3IDZA 3E7DA 4RHUA 4RAQA 3EIWA 2XCUA 3OTHA 4C0XA 1AZSC 3HPQA 5JAOA 1RWQA 3P9XA 3A1UA 3L93A 3FYUB 3HYRA 4YO7A 1P91A 1YJBA 3FB4A 2JVIA 3W5IA 1EINA 4D44A 5CFQA 2O9JA 5TJHA 4EARA 2IXTA 4NXMB 3PFCA 3QU9A 1PVVA 1Q0HA 4LSWA 4RIFA 4JK3A 3U8VA 2VF7A 2I4MA 3U7QB 4H0NA 2BEWA 4YRPA 5K8IA 4IEEA 4Z2YA 5ALWA 1EE9A 1P29A 1SCKA 4FD2A 3T9AA 2Q4OA 3I6YA 4BLWA 3DVRX 1N6IA 3SQWA 1WSDA 4ZVMA 3AG3C 2Z98A 4W1SA 4KV9A 5LQCA 4JLJA 2A9PA 2OAGA 3MBGA 1WABA 4R1LA 3O3OB 2HF2A 3EJNA 3CF6R 4RD9A 3GLKA 3W8NA 5GJWC 2GJ8A 2O8FB 1UWVA 3ESYA 4NBKA 2EC5A 1JHVA 4ITUA 1GZDA 2IYLD 4F6RA 1KA9H 2CFOA 2ZOSA 4JUFA 2J7WA 5DNEA 1PJ4A 2ERCA 3MINA 4IUBS 1OXVA 1Z4NA 3X1JA 5J40A 4WKNA 1FSSA 5LYJF 1CUEA 2YFYA 3JXDL 3FUUA 4BVAA 4BMNA 1WHTA 1I3LA 3K53A 3RC3A 4U5XA 5HMMA 1SA0B 4TTPA 2XLEA 4Y2QA 1JMYA 1JEEA 2FSPA 4N9QA 3F1LA 5K7SA 3PVCA 2WWRA 3JPWA 3DAFA 2W2VA 4GS5A 4JLKA 4TN1A 6PFKA 5KC9A 4IJ5A 3PKZA 3RIHA 4Q37A 4ALIA 3E5RA 1EWKA 1L7DA 2WNIA 3IKVA 4JXKA 5HDBB 4LJ8A 2QTVA 1RYFA 1H4VB 3I1IA 2V6FA 2QM0A 2P9FA 3F8TA 2RB4A 5EGYA 2YN4A 4G24A 3OQIA 1DXHA 4GOKA 5KNDA 2HSQA 3TQOA 3QWAA 2RBKA 4RW0A 2G1PA 1H23A 2Q8QA 1B8VA 5LIRA 4S04A 3KLNA 5DEIA 3IMEA 5AVOA 1D2GA 3F47A 1SOWA 1ZRSA 3NEYA 1HQDA 5I47A 3R7FA 1CWUA 4MVSA 1V5FA 3T1VA 1V7ZA 4Q66C 4G5HA 3V9PA 3ZR4B 2FWBA 2HO5A 2HADA 2XUOA 4P4UA 5KOJB 1OFGA 2ADMA 3K1HA 4TXMA 2G04A 4EFDA 3PPVA 2VCEA 1DE0A 2IYTA 3WGLA 5C35A 2A5YB 2IW1A 1TLFA 1XG5A 3WR5A 2NV0A 1YZAA 3D6VA 1LKXA 3ICOA 1M76A 2VF5X 2OCXA 3VJRA 1JPJA 4M0LA 2ZCVA 3K1ZA 4IZHA 2YRXA 2YWGA 1A1VA 3ENZA 3QE3A 4XLPF 5K0FA 1GTL1 1WWKA 5KQSA 4NESA 4JENA 2AJBA 4LHYA 1L7PA 1BGXT 2GVDC 5LUBA 5CBPA 3GLRA 4H08A 2Y1KA 5IMBA 1RCTE 4XWKA 2DBZA 3C39A 3JYHA 1ZBDA 3K0HA 3F3KA 3QU4A 4O4HF 1HE1C 3ANXA 5GGYA 3FAKA 1O5TA 1U9JA 4AIRA 1Q7EA 3ZU5A 4YROA 1QUFA 2QYHA 1XXHA 1M5UA 2HJRA 4EBBA 3TELA 4DVZA 1E3TA 1JRAA 3WIEA 1T6IA 3W9UA 3AB7A 4BAZA 3C1TA 3OOJA 1WCIA 2YL1A 5IBPA 2E0IA 2LPMA 3B1YA 5L45A 4DB4A 1N2EA 2O54A 5BT8A 3RO7A 4LDZA 1AV7A 3M4NA 5IC5A 3C43A 5KOYA 4E09A 3TBHA 3WJ7A 5HF5A 4J0CA 2BCJQ 3US6A 4YJ3F 4UFPA 1JLMA 4M99A 1DOAA 1K5DA 2FF7A 1MNEA 2Y93A 3OCYA 4NCBA 3PHJA 1NI5A 3L7NA 4NDNE 1SYQA 4WZZA 1HFKA 2J0QA 4HLUC 1KS9A 4R68A 3KH2A 1E3QA 5JCOA 1W5BA 1C9DB 1BAPA 3W2IA 4DR3B 3PC8C 2CCJA 1DDIA 4YWQA 1H05A 4CBEA 3W7BA 1S01A 3OJEA 1GZVA 3PFGA 5IG2A 2Z8YM 5A7LA 5DVWA 2Y4NA 1ZZ7A 4YJWA 2FJPA 1SPXA 4I4IA 4BMDA 1FW6A 2C03A 4FEGA 2EPNA 1J8VA 1QR2A 3KB6A 3E15A 2CV0A 1RCFA 1M9NA 1GKUB 1JLLA 1GQYA 5ES4B 1ZGGA 4BQFA 3FI0A 4KNWA 3DWWA 3OIUA 4O79A 3KAJA 1YS4A 2WIKA 1R8QA 2ZE6A 3H9EO 5T4EA 1M56C 3M70A 2XMGA 2DE0X 4YRIA 4V0KA 1E4YA 4PYNA 3KZ1E 1C02A 1OGYA 4LWQA 4KYVA 4LJ9A 4A0QA 1Z5OA 4Z9HA 5G4LA 1NFRA 1NBBA 5DNCA 3EIXA 2JZCA 2PFSA 4J1SA 4XAQA 2W11A 1KK3A 2CVZA 4NS1A 1V5WA 4R0NA 2AOUB 3WKCA 2HMYB 2AVKA 1RZRA 2ZBRA 4O8ZA 5L3RA 1GG8A 2Q7OE 1IE3A 4DJDC 2VRNA 5TF4A 4YRJA 4DMHA 1SAYA 1KR2A 3MJRA 1NX9A 4EG7A 1OCEA 4Z59A 1H2WA 3GJ5A 5LWHA 1Z4JA 2AZDA 5A2QA 4I36A 4N7BA 3ZWBA 2I2FA 3CONA 4M0EA 1QGYA 3JQBA 3JQEA 4KIGA 5E4JA 1T9GS 1TQ4A 1UBCA 4RTNA 4UBIA 4U9IS 2GM3A 5KREA 2WABA 5A9TA 4M0MA 4ZJPA 3BL8A 4M4SA 1OY1A 4H7KA 3ID6C 2BJCA 1JT9A 3VZPA 1XEXB 2IOQA 1GSIA 2WWYA 4GOJA 3AXSA 4DV5B 1KY5A 2AUMA 3H8SA 5TQ0A 5JJKA 1RLTA 2RKBA 1W47A 3TW8A 1NQ5A 2Y66A 3ZCUA 3AERA 4UE6A 3A9WA 4LRYA 5LDDC 2PLWA 4KZPA 4D0RA 4DG5A 1JR3E 4G1FA 1GTVA 2OEPA 4HB0A 4UTVA 1F17A 1A72A 3V32A 2RGRA 2GJ4A 4C2UA 1JQKA 1QPGA 4Z9IA 3PRJA 3EIHA 1E0SA 1EK0A 4YARA 4RPHA 4TVKA 4MIEA 1P1BA 4YUVA 4H3VA 1VOTA 4WXHA 1O3UA 2BHTA 2R1VB 3EVBA 4BNKA 5HW0A 4JGGA 3WLQA 5D84A 3PTZA 3D2BA 3N28A 1XZHA 1Q0UA 2ID4A 1HETA 5AVTA 2UZ4A 5HPYB 4Q7LA 3MTEA 2R5WA 2YY6A 1FF9A 3W8EA 5BQIA 4GP9A 3BFJA 1WSAA 3GY0A 3GELA 5LQRA 3EXFA 3IDQA 4XPWA 5AJYA 4WLOA 4PLGA 3GEIA 3OEHA 3SC4A 4DBZA 1NL3A 3BTOA 1UDCA 2AKAB 2O4AA 2IY9A 3T9CA 2V7PA 1V1RB 4JBXA 2CMGA 4C7VA 1AHIA 2GN2A 3ACCA 2QNBA 3ANNA 1K9SA 1TAHA 3T15A 2DZDA 2G40A 2A59A 4MA4A 1DIRA 3TW6A 1HNWB 1KI4A 2I4RA 1CR6A 5DTRA 2OV2A 5CB4A 3VTZA 4HDSA 1BXZA 4BNLA 4J0DA 1A7UA 4FD3A 2AWNA 5EJ8A 4MW4A 5JD5A 1NXOA 4C43A 5TGTA 3K6SB 4D9JA 2O7NA 2ZBFA 4M46A 4KO8A 5CAEA 3JYOA 3JQFA 5B3KA 1WQ1R 4P3OA 1E5LA 3LL4A 3OCJA 1TB4A 1TM2A 2QAGA 4C0AC 4W99A 1MAAA 2V6GA 2FDXA 4HX9A 1C1YA 3GFRA 3QNUA 3CEHA 1IDOA 1FY2A 4RV9A 5K3BA 3PNMA 4DA8A 5JRJA 5SZJA 4UW9A 2PYIA 4HUQB 3AVWA 1C7IA 1ZOPA 5D7BA 2D7DA 2FN8A 3VO1A 5AIBA 3AOGA 1TTTA 4RA9B 1TZKA 2LR0A 5AJTA 5JY1A 2OORA 3DZ8A 3Q3VA 4I1OB 1YARO 2VH3A 3FOBA 3OQ6A 3HB0A 1UDRA 2EIMC 4JJEA 2P3LA 1DG1G 4CLXA 2QVLA 3LYAA 5ECYA 3TAXA 1H8ED 3D64A 2ZR7A 1ADYA 3CROL 2BFEB 1NATA 4KAXA 2PXBA 4JI8B 4DZTA 3RANA 3ZTTA 3DDNA 3BMNB 4WJ0A 2YIMA 5I9LA 4MVUA 1S2OA 4N5IX 1ZRNA 5L0IA 3S1AA 5JLJA 3D7MA 4TMKA 2B37A 2IE0A 4I08A 1BMFA 2BTQB 4UPEA 3POVA 1M67A 2N1BA 4EKDA 3EBPA 1Q0QA 2Q21A 1ST3A 3RREA 4B79A 4M9SA 1VZ2A 1DP4A 3T7CA 4UJ5A 3FPHA 3FROA 6ABPA 3Q41A 2PXQA 1E0JA 2RFLA 5GGXA 4LJLA 5GAJA 4KXYA 3UYKA 3UW3A 5L8VA 3QLTA 5LXTA 2C9ZA 2I91A 1C7RA 1EGHA 4E2ZA 1YAUO 2DULA 4PG8A 5LP6F 1ZN9A 3VH1A 4HGQA 3KTOA 3VSDA 1MPTA 4Z7QB 2H3HA 1NOKA 3F3MA 3WWCA 4IDOA 4CETA 1VL2A 1XLVA 3GFPA 3ROGA 3TNLA 4C07A 2PUWA 1N6KA 4GX1A 2HDHA 2VA8A 1WCYA 1TA4A 2IS6A 3OPQA 3R76A 1JMVA 2B1QA 2QROA 2HFKA 2PR2A 4LA4A 1G55A 1C9EA 1DBIA 4RGQA 1PZNA 3GODA 2G7ZA 1Q1AA 3PIDA 2R4QA 4NP6A 4K05A 2WUVA 4MW5A 2LP4A 2OY0A 3ZQVA 3EOAI 3HJNA 2AXQA 3LEOA 5HRUA 3RC8A 3K6BA 4RDIA 2X7XA 2VJBA 3IQWA 5CJJA 3T9BA 4PG6A 1NMXA 3GFVA 1FUEA 2PD6A 3PQ5A 4MICA 1BIFA 1XTBA 1W44A 3W8DA 1W8IA 3EQZA 4NTZA 1T9HA 3KJQA 5K99A 4MVXA 4CUJA 3BHMA 3O9VA 4YG1A 1BA2A 4DA0A 2LP4Y 1VL8A 4BU1A 5AFSA 4UE3S 3OWHA 2ZWOA 1LQUA 1ORHA 3FPKA 4RAOA 1QF9A 1NRXA 4HGZA 2Q0XA 3KWJA 4BCBA 1RZ3A 5HZGA 5D5PA 3U3DA 5ITWA 1W36D 4HDNB 4DTIA 1K88A 4UUQA 2FN7A 3PHLA 3RS5A 3QX7A 3MGAA 1V11B 4I50B 5GP1A 4ZICA 3GFGA 4BO8A 3PGA1 1EA8A 1ULZA 2G82A 4X4EA 3WYGA 4W8OA 2AKYA 5AKXA 3TL6A 3UK0A 1T9CA 5KKAA 3GRAA 4KITB 2CL0X 2GWHA 4CYMA 2CXSA 4DSOA 5T3UA 1FTWA 1V45E 4ZCTA 4HG2A 4QE3A 1AURA 2DHCA 5D2CA 2EBHX 3FMYA 2AN1A 1EFPB 1CERA 4FFBB 1UDXA 3MELA 3KUUA 4FT4A 4HQOA 3SYTA 4OXIA 4R2MA 3I0NA 4CQNA 1TU3A 1KI2A 1K7SN 4DMFA 5HFJA 5B55A 1Z68A 3VYRB 3MTJA 1JALA 2Z5FA 3T7DA 1KVUA 5D3ZA 1A9OA 5KTYA 2WWTA 2AYZA 4ZJYA 3VUEA 1NPTO 3ADCA 3X0DA 4AKHA 2PUTA 3Q3EA 3W8IA 4Z5CA 2RGCA 2BE5F 3HR4A 1N92A 1QIMA 2R25B 4N3NA 1AKVA 3AZPA 4GM4A 5A5DA 2C5SA 1UKVY 4JUCA 2IODA 3JD0A 2REQA 1POUA 1NI3A 4XR4A 2GSDA 1B6TA 1ZVKA 1D0IA 4I6RA 5AYVA 3RH3A 4AO7A 4UE2A 4JT4A 4NULA 4J0JA 4P3PA 2NUBA 4O4LA 3W4YA 4AJ4A 1N6HA 1M73E 1WKBA 1X87A 3KTFA 4YMLA 2ZJFA 2FG7C 4QYWA 2CJWB 2HRQA 3MQFA 5IUJC 1UXKA 2FW9A 3UWMA 2ROQA 4DYDA 2WIAA 1E9DA 4BO3A 3TJ6A 2IYRA 5FRDA 2HSZA 5C8XA 2KE5A 1G6OA 1NIPA 2RSEB 3NANA 1Z82A 3QOXA 2J5KA 2JLAA 3RSZA 3ZGOA 1YB6A 2JJQA 1NW7A 2ZTMA 1Y1QA 5F76A 1BXRB 3DYIA 5GAHi 3BZBA 2HF9A 1Z3IX 2A57A 1XRMA 3OC0A 4NBRA 3TLBA 4GKAA 2HU5A 4KO1S 4XQ0A 5HDQA 3GHHA 5A1JA 4ZCPA 2O23A 4JOSA 4HQFA 3FKJA 3UWKA 2QUJA 4JJ7A 2QN3A 3ZKWA 1DINA 2RMKA 4JV5B 5DB4A 2PTHA 5BQ5A 4AZ3A 3GARA 4ZZ3A 3EE6A 3VOSA 3KXLA 2IU3A 1J1UA 2CY0A 1IHOA 3TZLA 3K09A 1H94A 2JI8A 1LDMA 1IOVA 5B7NA 4O63O 1D4ZA 2ZBGA 1Y7HA 1GCGA 4BASA 3DV9A 1G21E 1Y4DE 3QVYA 1KF0A 4LC1A 1EBBA 2VTBA 1NF9A 5FR2A 1K97A 3EUSA 3P97A 1CUXA 3TL2A 3I5UA 1N2SA 3BK7A 3PE3A 1IXZA 1PQYA 2GN0A 2YVAA 4IWNA 5J47A 1VMIA 1BMTA 3BUSA 4S1PA 2SKEA 1RM0A 1JEOA 3RI3A 1NVDA 4KREA 3TYXA 2OESA 1SC6A 3HS3A 1UPUA 4P84A 3TR0A 1KBZA 4OQEA 5DO9A 3ANYB 3AHEA 3QVGB 2DMRA 2VUSA 3VU9B 1JB9A 5DTIA 3WYEA 1BOFA 1QF6A 1G8XA 4YCLA 1OB5A 1MGPA 5HKAA 4J90A 2OVBA 2H8KA 1IUOA 4HN9A 3GLIB 3KZ3A 1SG6A 2OSVA 2QM7A 1U2TA 3VWSA 4PSDA 2VNJA 4H1TA 1GGEA 4NZYA 8LDHA 1CV2A 3VTKA 4IY1A 4OI4A 4K1XA 3DFZA 1YC5A 4V2IA 3CKKA 1CRQA 3FVTA 4J91A 1DC3A 3HRKA 3U7HB 2HCRA 4Q2JA 1M8PA 4EW1A 4ARCA 4XFJA 3ANTA 2IL1A 1CRZA 2A9JA 3OZXA 1W4BA 3SIWA 2OHJA 3DFKA 2Q45A 1LPNA 1J49A 4ZOAA 5KMGB 3PXDA 2X2OA 4OAQA 3RFTA 4MW9A 1R0XA 5BUQA 3N0WA 4ESEA 1TK3A 1XN1A 4S24A 2FPGA 3K1AB 4CM6A 2ZRCA 3B0UX 4CX9A 5DLEA 4LSZA 2GK4A 1IPFA 4A8PA 1FDWA 2R00C 1NNI1 3WB0A 3EC2A 1RYEA 1JSXA 4BFXA 4PRYA 1EAMA 4CQJA 4AUEA 4I8TA 5TC4A 3QMMA 5GVSA 2G8LA 2GZAA 3T7AA 3SR4A 3JSEO 1N1GA 3K6JA 3N6RA 1AH2A 4S2EA 4M88A 4PC3A 1FK8A 4EHNA 5KOHB 5BVGA 3VJKA 4DT1A 2FNAA 3SSNA 2P2YA 4UHHA 5A62A 2DG2A 5L0JA 2X4GA 1SIOA 3OZFA 3STWA 3U09A 3D0KA 1Z7YA 4XGIA 3EUFA 4M7RA 4P7GA 4AW9A 1CUAA 3OIWA 4EYOA 1W5SA 2PSDA 4IJ6A 2DUWA 4OATA 2H7YA 1YD7A 5I48A 4L4YA 2NADA 4GXQA 1SXIA 5BW6B 1G5TA 3U4QB 4F8EA 1YB7A 4ZKEA 1I2DA 2X0CA 1XROA 3PNYA 3OIFA 2PCLA 4ZPJA 3WGTA 1JVNA 3NJRA 3ACDA 3RVRA 4LOLA 5DXJA 2VQSA 3CMCO 3RYLA 1U8XX 4U4AA 3E81A 4CJOA 3PV0A 4TTJA 2IXPA 1KVSA 3H5NA 3ML1A 4D4NA 4AZSA 2C07A 1RWKA 2XA2A 5KNLA 4ZDKA 3OG9A 3ZQ6A 5CDTA 2F8SA 3ELUA 3L46A 3G4ZA 3PI7A 2PWBA 1BU5A 5IDWA 4AJIA 1XZ8A 3SSMA 1Q2XA 3EZIA 3INTA 3UC9A 3WMFA 4KYUA 2CK3D 4P4SA 4TKUA 1UP7A 2E4XA 4Q24A 3H6GA 4YDQA 1ESNA 2H7XA 4RM3A 3T6GB 3WYBA 3VMFA 1U80A 1Y8RB 4NCAA 2FUEA 4HAXA 4TYYA 3V8NA 2HREA 3AR9A 3SC6A 4FDLA 1X92A 1IQPA 2X0KA 1II8A 5AXAA 4QTUB 3UH0A 2LDBA 1YE3A 1PGOA 4D5EA 3IQDB 4WLFA 3UBTA 5AJUA 3ZI7A 3NHRA 3T95A 2J6IA 2J3KA 4HI0E 1AGPA 3WO0A 4DCJA 3ITNA 5KWEA 4D9CA 4MVWA 5GVRA 1S9DA 3QH4A 3RTDA 3KOYA