3KL4A

Recognition of a signal peptide by the signal recognition particle
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
431
structure length
412
Chain Sequence
GLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a signal peptide by the signal recognition particle.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Signal recognition 54 kDa protein
total genus 116
structure length 412
sequence length 431
ec nomenclature ec 3.6.5.4: Signal-recognition-particle GTPase.
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 3kl4A03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kl4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kl4A02
5IDVA 1EK0A 1E9AA 3WP0A 2BV3A 2OFOA 1XEXB 3PXGA 2NTYC 1XCMA 4DIDA 2W2VA 1E69A 4C2TA 3CWQA 5AUNB 4N0EA 1Q12A 2ZE8A 4PX9A 3T1OA 4DRZA 4QNRA 1C4OA 3R8FA 2WBLC 2ZJOA 3DMDA 3H86A 3GLHA 2H5EA 3U2QA 3X2SA 3J81k 3TQCA 3ZVNA 3SFZA 1L2TA 3PEWA 4RKFA 3CW2A 3N2EA 1ZCBA 3LX5A 1Z8FA 3N2IA 3NDPA 4F4IA 1AJEA 2YJTD 1GUAA 2QZ4A 4DLYA 1P4SA 1J8MF 1MH1A 3LH5A 4M1TA 4B47A 4CT5A 1W44A 5AJWA 2FWRA 5E7MA 4C0JA 3TW8B 4A0HA 5EXPA 4PPFA 2IW3A 2X2FA 3W3AA 5FOXA 5CITA 1DVRA 3BORA 1P9NA 4JLNA 1SVKA 1CKEA 2YNMA 2UZIR 2ZEJA 3QBVA 3QF4B 2TMKA 4WOPA 4DXAA 4IFEA 4JKYA 5FUXA 4JVSB 4AI6A 2YVUA 1SVWA 3B1VA 4TL6A 3WBKA 4Q66C 4KV9A 5HCNA 3LW8A 1RRFA 2C99A 3SN6A 3I5XA 3C16C 2WOJA 1HYQA 2PZGA 1XDBA 1G16A 3NBXX 2EFDB 4MRNA 1JR3E 4Q4LA 3AUXA 4NYMR 4JT4A 4X8MA 1TTTA 3PG5A 5EXTA 3PJRA 5FBLB 3GLFE 1W4AA 4DSOA 3RNLA 1CP2A 1IM2A 5CB8A 3E2IA 4OQMA 1G3MA 3LA6A 4PZLA 3QF4A 1LNZA 2A30A 4W9MC 2PXBA 1D2NA 1NN3A 2RB4A 4A9AA 1JBKA 1K8RA 3QXSA 5KHOC 2G0NA 1ZU5A 2CCJA 1JQJC 3KFVA 1ZJ6A 1BYIA 3U3OA 3P1JA 3W8RA 4ZIRB 4GMXA 3TUIC 5EJEA 1OH5A 1JXOA 3BB4A 4H1VA 2CVFA 2WSSD 2PZFA 3SJCA 4M53A 4TQAA 3E5HA 4LHYA 1Q1QA 3B82A 4B6EA 1Z0DA 2EFHB 3CLVA 3X1WA 4BLTA 4BUJA 4DUGA 4FMDF 3T06B 4DDWA 4L16A 4HDQB 3U3KA 2NZ8A 2DFNA 1Q3HA 3FVQA 4BFUA 2QTHA 2G1KA 5JMTA 4D0GA 5AWFC 1WXQA 2QPAA 4WZ6A 1FMLA 3AVQA 2R9VA 3QF7A 4BFYA 1OKKA 1KZ7B 1E32A 2FSFA 4RD3A 4I1SA 2RHDA 4D4LA 2BEKA 4EFNA 1ZM4A 8OHMA 3UWOA 2BBTA 4C3ZA 1R6BX 3U7HB 1IJFA 3Q72A 2GCOB 4E03A 2NG1A 3CPHA 3Q7QA 3AKCA 3UK6A 1ZUHA 1RJ9A 1VYUA 3DM5A 1W2GA 3K0CA 1GVNB 3WYAA 3JZAA 2ZIAA 3A58B 1KYIA 2REXB 4A92A 2D7CA 4PAMA 1XJ0A 2R44A 3QKSB 1DELA 4UXJA 5EE3A 3VHLB 3K0AA 3AKDA 3D3QA 1N6LA 3GQBA 4HLQB 3W8NA 3QUSA 2PXFA 1XTRA 2ODEA 1P2UA 1AS0A 1QHHA 2JCSA 4MQBA 2JASA 4HSEA 2CHVA 3CR8A 1HURA 3K0EA 821PA 5HZKA 1H8EA 2WJVA 2EFCB 2V55B 1KZGB 1E9DA 2XEXA 4GOXA 2QPOA 1I4DD 4FMBB 2LWIA 1IJEA 2HT6A 4URZR 5K8IA 1KI3A 1E9CA 3AP2A 1GNRA 1TMKA 2CK3A 4C0AC 2ORWA 1N0VC 4RSGA 4TYNA 3R9XA 1M2OB 2H18A 3SEAA 3RSOA 2HEIA 2O8FB 1AA9A 2CEAA 4TLCA 5EP2A 4GFDA 1U0HC 3EPJA 3HU2A 2WJHA 2AKAB 2HLDA 3AF4A 4OQLA 1G5PA 4YXWA 3BFXA 2PH1A 1G7TA 4CEHA 4WXRA 1UKEA 1G3RA 2C96A 2QGNA 4A0GA 1T6NA 5HR5A 1GM5A 3LW7A 1GL9B 3CF0A 4TQ9A 4Q9LA 3AVVA 3MWJA 2NPFA 1XPOA 4N1AA 5H70A 3I1FA 1E2QA 3I32A 3BB1A 3VU9B 2DWQA 2WKQA 5F98A 4AKGA 4F7WA 1YRAA 4LWZA 4E09A 3F8TA 1LW7A 3X1XA 4CEHB 3UMSA 3VR5A 4DHEA 1OXSC 1DAKA 1GZSA 1NI3A 1ZUNB 4Q4JB 3LD9A 1UDWA 5H68A 2QP3A 2WJYA 2C04A 1W5SA 1CJKC 1XFAA 1RZ3A 4KU4A 5AJYA 3QEOA 3QXXA 1OIVA 3CNLA 4Q4HB 4M21A 2IYQA 2V1UA 1R5OA 5HTKA 3CRMA 5KDLA 4A2PA 1XJCA 2OCAA 3DKPA 4R2IA 3T1QA 4AD8A 2R8RA 4B3DA 3R9WA 1S3SA 4RZUA 2ZQ5A 2DFKB 2Q0HA 3B1XA 3MWYW 5EQTA 2C78A 2H7VA 2QP4A 3ZVLA 4TL9A 2FNAA 4Z8XA 1F48A 1QBKC 4JVMA 3HPRA 4AYXA 3VTKA 2D3WA 4U00A 3E70C 1KDTA 4PFSA 1W47A 3B1ZA 1G8HA 1AN0A 4PSVA 3PEYA 2H17A 2K5UA 1XCGB 1A7JA 4GRAA 1TQ4A 1YZQA 4NHOA 2YWFA 1S1CA 3PUWA 2HT1A 4XTRA 2VHUA 4YQFA 1TEXA 2DYKA 2QP9X 1SVIA 2GBLC 4QHTA 3AGQA 4ASUD 4L5BA 4WAUA 4BRWA 3Q3JB 3ICEA 3OEEA 2RGCA 4QHSA 2WHXA 4UNRA 5CK5A 4LX0A 1YVDA 3SYNA 1CIPA 1G6OA 2R6FA 2ANCA 1EWQA 4OHWA 4DLXA 4KHZA 3H4MA 4WBSA 3K70B 4JL5A 1KDOA 2WWWA 2ZE5A 1VYVA 5AK0A 5FUYA 2R6CA 3NVAA 5ANRB 3EPHA 3MWLA 4KLZA 2VPPA 3WP1B 2JJ1D 3PUZA 4AK9A 3QXCA 1IAQA 1UADA 4Q18A 3U7FB 3TKLA 3GJ0A 1S8FA 2GXAA 4PHTA 2D74A 3KTAB 3DZDA 1Q1BA 4EUNA 1XEXA 3MCAA 2CJWA 1U8ZA 1XNJA 1ONBA 221PA 2ZS9A 1AZTA 2VL7A 1J90A 1U2RA 1WB9A 1EFRA 1VECA 1G3UA 3QI2A 4P4SA 1SKYB 1R8QA 1VG0B 3H84A 3PENA 2FZ4A 1OHHA 3DO6A 2F3TA 5CLLA 3U3JA 3KB1A 4G0NA 1IXZA 2Z83A 4C0HA 3ZLJA 1II8B 3BH7A 3KL4A 3B78A 1GRRA 3BK7A 1XRJA 4Q47A 2IHYA 3UWKA 4OI0A 3SQXA 2FEOA 5TDHA 5KUTA 1IHUA 3C5CA 3LVRE 421PA 5AUOB 3ICQB 4FWIB 4HUTA 2RGNC 3AVOA 2B7BA 2XAUA 1OXVA 2IUSA 1HTWA 2PXUA 4V0OA 5SZIA 2WTUA 2IUUA 3M1IA 4HAXA 1X8LA 3TJZA 5ELXA 4W5HA 4AYWA 1RYHA 1B0UA 5AUPB 3X1YA 3AF3A 2IS4A 3R8CA 4QGGA 3ZZ0A 2FDCA 3RWMB 3T5DA 1KY2A 4OI1A 2EQBA 2HXSA 3FTQA 1ZIOA 2OBMA 3EZFA 4Q1BA 2Z43A 2VHTA 4JVLA 3AH8A 2ZRMA 3NHBA 2Q3MA 1K5DA 2JEOA 4V0MA 4TQUS 1KI7A 3KJHA 1PLJA 2NO1A 2XTZA 2VP2A 4Q7LA 3WMGA 5F9FA 2I1QA 2F43A 1QHIA 4QBHA 2BKUA 4NONA 2KE5A 2FPLA 2W0MA 1FP6A 4C7OB 1ZC3A 4IFBA 3FMPB 2O8CB 1ELOA 1OIXA 4D26A 3U4QA 4Q9IA 4DBLC 3AVYA 2B92A 2WSSA 1FW6A 2OBLA 4DIEA 4YDHB 1P5ZB 1GRNA 1HEIA 4KAXA 3TVTA 4TL7A 2B7CA 3V9PA 3THWA 1TNDA 4U5XA 4KSCA 3B2EA 4DVGA 1S1MA 1YZLA 2HXYA 3GJ7A 4C0KA 3I92A 4L9SA 2N46A 2KBEA 2FSIA 5G3ZA 4BGDA 4B71A 1OFIA 3S1AB 5C4MA 2H1LA 3TGPA 1F5NA 3OIWA 1OSNA 3SBDA 3KX2A 5HE9A 1NIPA 2WPDA 5E3HA 1G17A 1T5LA 2XTNA 4PO8A 1GL6A 2DWOA 2EW1A 1WQ1R 2PT5A 4RZXA 4NL4H 5BW8A 1NKSA 1RRCA 4JLVA 4BZQA 5TVKA 1M1YE 4LHVA 2HLDD 1EX7A 4S35A 1GNQA 4NYJQ 1HA3A 1I2MA 3BS4A 4PHHA 5CK4A 1KTVA 4GBMA 3REFA 1PUIA 4PR0A 2GCPA 2ODNA 4NH0A 2XSZD 4IOJA 4ZCLA 3VNUA 3U6KA 5B2ZA 4YLGA 1HV8A 1R0YA 2QSZA 1JQLB 4IVPA 1HQCA 4LV6A 3K0FA 4M9XA 3W6PA 3WY9A 4Z1MD 1QZXA 2C5LA 3IIJA 4JBWA 2F1IA 4X8HA 4KVAA 4B3XA 5AJZA 1W0JD 3MAAC 4QFMA 2IYXA 5KNDA 3PFIA 2OE2A 5GJCA 3DVLA 2ZJ2A 2L0XA 3GMTA 1P73A 2A5JA 3GLIE 2V6IA 1XD8A 1M7BA 3OHMA 1EFCA 1IY2A 2RGNA 4FCVA 4O2RA 1Z06A 4UKDA 1GITA 3GFOA 4HDCA 2XOKA 5JCZA 1U81A 2P5TB 2QRZA 4LK2A 5LDDC 3LXRA 2OLJA 4A6XA 1I2DA 2OT3B 3PIRA 2FFHA 3NDBB 4HLDA 2Q9CA 3ZJYA 1W2HA 1MO6A 1DAIA 1TUEA 2R62A 4V0KA 4LSGA 4LJYA 3UKDA 521PA 1E9BA 1NF3A 1W0KD 4GOJA 2P6NA 2RGAA 4N3NA 4LJ7A 1E2DA 5TY0A 4Y0AA 2KI5A 1N5KA 4RFSB 4TTQA 5DGXA 4FD2A 1J7KA 2I4IA 3K70D 2ZXUA 5BQ5A 1WDTA 4Q1AA 3K53A 5JFGA 1T3SA 4FWTA 2C9CA 1II0A 1HE8B 2CMKA 3WNCA 1J8YF 1J2JA 2IYSA 5DYGA 5FBWB 3KKPA 3TAUA 2Q9AA 2P67A 4P4UA 3VKWA 1S0UA 2ZR0A 3AEZA 1JI0A 4LJ5A 1Z0FA 1NMXA 2IYLD 1N6IA 1DAMA 1NRJB 3EAQA 2AK3A 4A82A 2NZJA 3SC3A 1UEIA 4LZZA 1FQKA 1DBSA 4QOSA 4DLWA 3C4JA 3EXAA 4GP6A 3HP1A 2OO7A 1HE1C 2NGRA 3PUVA 1JJVA 4AKHA 4K46A 4JYCA 3FWYA 4DZZA 3CKLA 1CJTC 3GLFA 1II9A 1LVGA 2VP6A 3EIEA 1OF1A 4EKDA 3SBEA 5BYKA 1G1MA 2VP0A 5D3MA 1DAEA 1OFTA 2ZRPA 4FN5A 3TR5A 5L3QB 3SFVA 4B75A 3AGPA 5A4JA 2CL0X 1Q20A 5IRCD 3K09C 3RANA 2XZOA 2CBZA 2WMNB 2A5YB 4PQFA 5JWOA 1EFUA 1X1RA 2WKPA 4W7SA 3TSZA 3V4FA 2JLZA 4GOKA 3P32A 2OBNA 3PEVA 2GDJA 3RWOA 5L3RA 3OAAD 1HQYE 1QF9A 2NO7A 2YOHA 3EZ9A 4Q9KA 3A8TA 4II7A 4TLAA 1Z29A 4URWR 1GKUB 1MO3A 4ARZA 3T15A 3VKHA 2ECKA 4B3GA 5EP1A 2C9YA 1JPNA 4QJ5A 1KK0A 1KSGA 1QHSA 4RD6A 2F43B 3D31A 3HR7A 2MSDB 3ZZUA 1L7VC 1MFQC 3T1TA 4ITRC 4YMSA 4B32A 1G41A 1W49A 1ZBDA 2ZRJA 4OHZA 2DY1A 3FFBA 4A2WA 4JBXA 3CRRA 3FHOA 3I62A 2ODBA 4WIAA 3B13B 3RS2A 4RCYA 1NKTA 4FMCF 3QENA 4ZDKA 3QKSA 3JVVA 1TF7A 2CL7X 1E2FA 5B58C 3PUXA 1GIAA 4MGZR 2G1JA 5C46F 2R6DA 4GPTA 3UG7A 3EA0A 2JGNA 3HDTA 1S9HA 1OKKD 1KI6A 3LO5A 1R4AA 2B8WA 1KK1A 3PUYA 1KMHA 1X6VA 1WP9A 5KTYA 3A36A 1E0SA 2MMGA 4ZDWA 2PXVA 3PVSA 2NO6A 3CRW1 4AKIA 1OHHD 2O5VA 2QMOA 2FSHA 5LB2A 4G3XA 1HY3A 1JXMA 3K8YA 2QMUA 2CCGA 2FPMA 4KI0A 3GJ3A 1A2KC 2OAP1 5CDFE 3B7GA 1E0AA 1GRQA 4W5WA 5CJPA 3IEVA 1G20E 4CF7A 3LQRA 4HAUA 1DE0A 3GLHB 5G53C 2JJ2D 2VP5A 4D2IA 3TSOA 2W2XA 3LLUA 1ZUIA 1U90A 2AD1A 3AVUA 4PZYA 1UAAA 2X1VA 3RC8A 5F2EA 1MRNA 1NMZA 2AK2A 2C8VA 2YC2C 4MA4A 2GZDA 4Q1CA 3UATA 1E99A 1G9XA 3VR3A 2AN9A 1XX6A 4PZZA 4QRHA 2GJSA 1YE8A 1ZC4A 2P5SA 3B5JA 4B43A 4D25A 2BJVA 3L82B 2QL6A 3IHWA 1ZM2A 4TL8A 1YZTA 3TAHA 2BVNA 4BFZA 1N0UA 3AVPA 3P4YA 4KFTA 1JAIA 2W00A 3SJBA 3C15C 3L0PA 4BLQA 2J7PA 4L8GA 2RMKA 1WE2A 1OB5A 1E4YA 2QRNA 3THXA 1Z6XA 1Z6YA 2P6UA 5LD2B 5DHAA 2HDNB 1LTQA 3R9IA 2J0UA 4OKSA 3TQFA 2WWYA 3KFXA 1I4LD 2UVQA 3M6AA 5C2JB 2PMDA 3IKJA 5K8UA 1W7AA 3QXJA 5GVRA 4DKXA 3LNCA 4JYBA 2QMHA 1P62B 2CLSA 2A78A 1B23P 1VCIA 2IEYA 1T9HA 2WSMA 2O8BA 1Z2CA 4Q1DA 1W36B 4BFVA 1UFQA 3OESA 4TMWA 3ADCA 1G6HA 5L3VA 1XU4A 1ANKA 1CRPA 3IQWA 2AL7A 5EE0A 1MOZA 5TARA 1NG9A 2ZE7A 3OIUA 2JLWA 2OILA 2QAGB 5GJVC 3LVQE 4CYMA 2IYTA 5G40A 1N6PA 621PA 5FPTA 2FF7A 1BOFA 2FN4A 4YDSA 5L3QA 2HV8A 3LRPA 4M9QA 5M04A 1UDXA 4NKRA 721PA 1XEWX 4E5UA 2ZUCA 3QPVA 5JEDA 2FFBA 5FTJA 1TX4B 5CM9C 2IS1A 1GL7A 4D0LB 3I72A 3CIOA 1PUJA 4FXPA 4Q19A 5CLQA 2QUZA 3KZ1E 2QE7A 2C9OA 3A6PC 3C7KA 4TYYA 2GK7A 2A5DA 1A2BA 4DDTA 1GDDA 4FI3C 3ZIAA 4BLPA 2VIIA 4BQSA 1SGWA 2ZITA 4PC7A 3GLGB 3JZMA 2Q6TA 3EARA 3FMOB 3W6OA 3W3ZB 4LBYA 2FFAA 4CEJA 1ZD8A 4DCTA 4B44A 2OUKA 5FFMA 4EPXA 2XXAB 3LLMA 2IF2A 1LS1A 3OEED 1NVUQ 4LCBA 1G19A 5B64A 3LDAA 5JBQA 2RGXA 1DTSA 3TLXA 4ZKDA 4DDVA 2FJUA 3QKTA 1ZP6A 2BDTA 2YC4C 3ZDQA 1E94E 2P0EA 2VA8A 2ZSDA 3QG5A 1GG2A 2BCJQ 4ERNA 5KO2A 2ZI5A 4M1SA 5AR1A 3B1YA 4HB2A 4LGMA 4OJQA 3K0CC 1W4BA 3TR0A 1CBUA 5EE1A 1SVLA 1US8A 3EC1A 5A5GA 3UXMA 2B6HA 3O47A 3THXB 3ZIAD 1JB1A 2BMFA 3VQTA 4O2LA 1CR0A 2WV9A 4M1OA 4YMVA 1K6MA 4JIMA 1EFRD 2CE7A 1AS2A 4NCIA 1R8SA 4QC2A 4Q7JB 4UNNA 5EUQB 3GLGA 2PCJA 4Q9JA 3UANA 1KO1A 1Z2AA 5CIWA 2O0JA 4CVNA 4BFXA 4PXAA 5F3WB 2ZU0C 1X86B 4TWZA 2C77A 1U9IA 1A82A 1KO8A 1SHKA 1WA5A 4PC1A 2WPDD 1FZQA 2YOFA 3WYFA 2VRWA 1H8HD 4DLZA 3Q9LA 5FL3A 4MUAA 4P31A 2RGBA 4NTZA 5JI3E 3LY5A 1T91A 4KSBA 1KKMA 3PCRB 4Q7KA 3GLFB 4IW3B 4TSFD 3WHLA 3AKEA 2ZSAA 1KGDA 4JSTA 4Q4HA 5EP3A 4AKEA 1E0JA 3G82C 4RKEA 3THWB 4NYIQ 3HYTA 2JAQA 2N1BA 4TT3A 2XTMA 2ZE6A 1E6CA 1KJYA 2YOGA 5FR1A 3T1VA 1EGAA 2AXPA 4ZCIA 1TU4A 5E7IA 2CCKA 5E95A 1W0JA 3L8YA 2JDID 3W5IA 1RIFA 4LI0A 2QAGC 4YC7A 3K09A 2VEDA 5BN5A 4LBWA 2HJVA 3CPJB 3KXLA 2W2TA 3SR0A 1HH4A 4EPVA 2Z4SA 1L4UA 4HZIA 2IWHA 1CR1A 1KSFX 5KSPA 5JS7A 1W36C 3LFUA 4HATA 4HAVA 4UJ5A 2J0QA 4DEYA 2JIZA 2ZS7A 4B73A 5KDOA 1Z0IA 3TBKA 2G77B 2CXXA 4BRUA 1X3SA 2IX3A 4PAQA 1HT2E 1F2TA 1UEJA 4LHWA 2ZI9A 3BRWD 3KKMA 4AG6A 1N3BA 4LPKA 3I5YA 3ND8A 1WGWA 3R7WB 1RKBA 4IEIA 4L4UA 1KAGA 2ZI4A 1R2QA 3A1UA 4PHGA 1CR4A 3KDSE 4ZPXA 3VX3A 1G8FA 4B6FA 1BH2A 1NLFA 1XMVA 2RKOA 3FGNA 1XTQA 3IHLA 3Q5EA 4IXNA 4K8OA 4X8OA 4V0ME 1CU1A 5CJ2A 1W36D 1XP8A 1KDRA 4R71A 1C1YA 1ZMXA 2PX3A 1KKLA 1E9RA 2WICA 4I99A 5JRJA 2F6RA 4Z54A 3T61A 4FW9A 4F38A 3H0KA 1X1SA 1YZUA 4KYIB 4N0DA 5GADl 1G7SA 4R2HA 3AB3A 1NN0A 1U98A 4KO8A 1T0HB 2HCBA 1FFHA 2QTVB 2WAYA 2ZYUX 2J7PD 1N2CE 3GFTA 1ZD1A 5DI3A 5DI9A 2BBWA 2A9KA 3ONWA 4QGFA 3U3RA 1D9XA 1GSIA 4D82A 2Z0MA 2CNWD 1P2VA 4R9UC 1WCV1 5C4GB 1RPZA 2C2HA 4QM7A 2GVDC 4Q1FA 1SZPA 3B1WA 5CYPA 4C30A 1YQTA 2ZRBA 4PO1A 3B60A 3ZS8A 4Q5IA 4EPRA 2I1VB 2OSBA 3QG1A 1FQJA 2F9LA 4XTCS 2ORIA 2EU8A 2FU5C 4BZPA 3CZQA 4F4CA 1T8TA 4KODA 2NO0A 4HLUC 121PA 1BS1A 1G64A 1LF0A 4PQRA 1E98A 1R0XA 1PV4A 1G8GA 2EFEB 2WIBA 3BXZA 3ZGXA 4GDFA 2A3RA 3LV8A 1D6JA 4EPWA 2QNRA 1TL7C 1KJZA 4PC6A 1XPRA 4B33A 1F6BA 2QM8A 2V54A 2VP9A 1M6NA 1IN4A 4NMMA 1XEWY 1O87A 2RGDA 4RZ3A 1Z0AA 2ZROA 4NCKA 2Z4RA 2PZEA 3OF5A 5FL7D 1E79D 3ZH9B 4BLOA 4D4MA 3C14C 2ONKA 2D7DA 1UM8A 3GLHE 4TMTA 5HCIA 1YHNA 2E1RA 3NG1A 1EG7A 2CHGA 4G01B 3W9YA 5AJVB 4V03A 4B3CA 4EAQA 2J5XA 3LQXA 4TTRA 3V00A 2PXKA 4OQXA 5KOYA 2ZSFA 1Q0UA 1D8TA 4A8JA 3GLIB 3AF0A 1BKDR 1ZNZA 1M8PA 1T8UA 1FTNA 3K0SA 4B34A 5DE3A 2GCNA 4EQ6B 4IOLA 4LBVA 4DCVA 2W58A 3RS0A 1ZAKA 2WIAA 4C9BA 1OH7A 2KSQA 3IDQA 1KSHA 1UJ2A 5KU1A 5EXXA 2GILA 3CX7A 1XZPA 3P4XA 3W6NA 1NIJA 1P3JA 1E3MA 1OT3A 5FL7A 4GP7A 1E79A 5FBQB 3NH9A 5DLQC 2GJ9A 2D4HA 2ZYWX 3QJYA 4OK6A 3VX4A 2WZQA 3UPUA 2G3YA 2WVJA 3FE2A 4IDHA 2G0TA 2FSGA 4PPGA 1AKYA 1OFUX 3GFPA 2V1XA 5BN3A 3QKRB 3GPLA 1E2KA 3CO5A 4M9ZA 4UXHA 3WYGA 3EPLA 2ZRIA 1IY1A 2QE7D 3HPQA 5J40A 1JEEA 4RVCA 5J47A 2GF9A 3FFAA 1Q22A 3KXIA 4AG5A 5FPHA 4HLCA 2AXNA 3NBZC 3M4YA 1G291 1OFHA 2ZYTX 2GWHA 4TMVA 3QPWA 2WAXA 4WVFA 2XXAA 2N42A 2GESA 2AD5A 4GNKA 2BC9A 3EZ7A 5J4YA 4Q4AB 2BKEA 4A6PA 3B9PA 2OAQ1 1OYWA 4JLBA 4BZXA 3TE6A 1FNMA 2BMJA 3VU9A 2V6JA 4Q01A 3WNDA 3O8CA 5BYJA 4IKEA 2OXRA 3FMIA 4W5JA 2IT1A 4TLDA 3WBJA 2LCFA 4OK3A 1Z08A 3A1TA 1UKVY 4BFSA 2CHQA 1MV5A 2C95A 3SNHA 5TXGA 1NL3A 3RLFA 4M1MA 1KI1A 3KJGA 4RFSA 3T12A 4DSNA 2ZI3A 2QROA 4M2LA 1NY6A 3KQKA 4US0R 1RFLA 1QVAA 3DZ8A 1W0KA 4CT4B 3U60B 4MKGA 2QM7A 4OBEA 1HQ1A 3UG6A 4XWOA 2J41A 2YYZA 4KCGA 3WNBA 1CF4A 4OHYA 5DISB 1XTJA 4QG7A 2ODWA 3WMFA 2XGJA 4MUBA 2VHQA 2GETA 1N6KA 4ZCMA 2QG6A 2KJQA 3SI7A 3GLIA 4QM6A 3IILA 4JLPA 1Z6TA 1E2GA 4B2PA 1TEVA 4LV8B 3PQCA 2FZLA 3THOA 1VCOA 2IYYA 4V0LA 3K0FB 1H65A 2FG5A 1XZQA 2FOLA 2UZ3A 3F5FA 1J70A 4JLJA 4XIGS 3WRXC 3FYHA 2DFLA 1Z63A 1JALA 4JL6A 3FOZA 5CIQA 1Z28A 1M7HA 2V7QA 2DB3A 5GAGi 1FL9A 1VPLA 2GKSA 3PEUA 1XMJA 4TN1A 4OK5A 4XVUA 3U6BA 1W46A 1E0KA 3FPAA 2FV8A 1TQ6A 1N6NA 3CF2A 2J1LA 4KVGA 4MH0R 5FOSA 3MD0A 3CM0A 2GJKA 1AKEA 4ILEA 3SYKA 4D80A 2VHJA 5KDDA 5FPSA 2QTFA 3N70A 4X8LA 3KQUA 3K9NA 3SQWA 1FUKA 4UXIA 1U8AA 3I8XA 4MDFA 2JQEA 2X19A 5GJBA 1WMSA 1RJ9B 5B30A 4WA7A 1G5RA 3LBHA 1RVDA 2BIFA 1JEDA 4JVNA 1QVRA 1IBRA 3GEIA 4Y0VA 3N5CA 2HYDA 2NPIA 4Q4AA 1CS4C 1OW3B 1ZIPA 1IN5A 2XITA 4P4SB 5FTLA 3FMFA 4LHZA 4TMZA 2V7QD 3SJAA 4B2IA 4D81A 1DG3A 2QORA 1GAJA 5TMPA 1XJQA 3NIBA 4LC1A 4WXPA 4G5QA 1VG1A 2P6RA 5JI2E 1PVOA 2CE2X 2G83A 5GAHi 2P3SA 2R2AA 2PLRA 4KFRA 4LRWA 1ZM3A 1V43A 2ZTSA 4KYUA 3SU8A 5CDFA 4MRVA 3K70C 5JWRA 4A8JB 2IK8A 1SHZA 4IRUB 2H16A 4M8NE 3I73A 1KI2A 1TQDA 1GILA 3CH5A 3BH6A 2IA5A 3NC0C 4D4KA 2V3CC 3CX8A 3AUYA 4TTPA 2ZM5A 1R5BA 3L0OA 3MGCA 4BASA 5IT5A 3QKRA 3MUFA 4MITA 5K8LA 4WZBE 4A36A 4LHXA 4MYTA 2X2EA 1AZSC 1IY0A 2CNWA 1NLYA 4LYFA 2O8DB 5JJIA 4XSGA 1KO4A 4QHYA 2ZI7A 1VKJA 2REBA 4XD7D 4C0SA 5SZHB 2BBSA 2FFQA 2ZJBA 3AKYA 3IIKA 1RC8A 1JJ7A 1VCNA 2OFXA 3ETLA 1F60A 1FUUA 1G8YA 3GJ5A 1LFDB 4TSFA 1QRAA 4LY6A 4Q7MB 2VHCA 4CRWB 2ZETA 1T3HA 1IN8A 2OXCA 4JBYA 2P65A 3IUYA 3EIQA 2BJWA 1G7RA 1IXRC 1P6XA 2ERXA 3FB4A 1E2MA 1W48A 1X8KA 2BM1A 2OFWA 1XB2A 1US8B 3Q7PA 1SVOA 4DCSA 5JEEA 1DARA 2GZAA 3HWSA 1YRBA 2W0SA 4MKFA 4CEIA 2H57A 4NPHA 1WF3A 2JDIA 3H2YA 1FOEB 4O25A 4UNSA 1XTSA 2YWEA 2ZS8A 4EPTA 3MJRA 3SJZA 5EUMA 2AFIE 4PC2A 4DLVA 2F1JA 5JJKA 2PXTA 4ZO4A 3L0SA 3DM9B 2X77A 3QY0A 4P3YA 4EDHA 3FKQA 3QNUA 3KQHA 3CF6R 2QU8A 4J0QA 4MKIA 2EVWX 3LQQA 4I4LA 3CX6A 1Q1EA 1AIPA 2HF8A 3L0IB 3ND9A 5KNBA 1NN1A 1OXXK 1P72A 1P2SA 4LJ8A 1JR6A 2IC5A 4Q9HA 3ZQ6A 1KMHB 1Z47A 3W90A 3B6EA 1GOTA 3FDIA 4U7DA 5LB4A 3RRNA 2E87A 3IIMA 5LD2C 1QB2A 2J3EA 5HPYB 5JCPA 1DAFA 1O3YA 3UMRA 4E22A 2PT7A 4LOAA 1WRBA 2WWGA 1RRGA 3B85A 2EWVA 1KK2A 1C9KA 4IXMA 2NOAA 5KSOA 2ZPTX 4Q48A 1P2TA 1DAGA 2CDNA 3NBYC 4BFTA 2GZHA 2CLDX 4BLSA 1Z07A 1MRSA 3SHWA 1W1WA 4LBZA 3TK1A 4WZAE 3CNNA 4C4PA 5DYIA 3WMEA 4RCZA 3NH6A 2ZREA 1AK2A 2J87A 4TLBA 4ARZB 4HEJA 1CJVC 5IK2A 2IXFA 3ADDA 1H8ED 3MWKA 2QBYB 4PSAA 4B3BA 2PJZA 2AFHE 5BXQC 2XB2A 3P27A 2Q9BA 1UBGA 3HJNA 4I1OA 3GJ4A 4DCNA 3AM1A 3EASA 1VCMA 2FX3A 5KSYA 4HUQA 3TMKA 2ZANA 5TV2A 4JL8A 4TYQA 1F2UA 5C18A 1XWIA 3AF2A 4M22A 3JVUA 3PV0A 1G7CA 3EIHA 3L43A 3L8ZA 1CEEA 4B48A 3QQ5A 4NU0A 1LF5A 5JZVA 3GD7A 4IJMA 4Q02A 4DLUA 4CDGA 1ZVQA 4GL2A 2B21A 4YMUA 4HAYA 4V0NA 2J45A 3WXMA 4OL0A 4RY2A 1KIMA 5CM8B 1MO4A 2IS6A 2GVZC 3TRFA 4GZMA 4RD1A 1DO2A 2LKCA 4HAZA 4LYHA 4OHVA 3AVTA 3REGA 4HAWA 1P9RA 4TZ6A 1YR9A 3Q85A 4EFMA 5J4HA 4BPBA 1Q1ZA 3T5GA 2R6GA 3AV0B 4KXFB 3TH5A 3PITA 4F4JA 2WWHA 1W4CA 1R0WA 1QHXA 2WJJA 3QEJA 3A1SA 4RD0A 4I1VA 5G41A 3ZYCA 3B9QA 4CGZA 3V4RA 1LV7A 2QENA 4QL3A 4Q03A 2PL3A 4C0QC 4TLEA 2RAPA 4MYHA 4MGIR 3B8HA 4B35A 4IDPA 4GT1A 1AQUA 1QDEA 1IOZA 2GRJA 3DEFA 2A5FA 3HU1A 3Q5DA 4HLUA 5DO9A 2ZJ8A 1NLZA 1A4RA 3U61B 3T34A 1YR8A 1ZNWA 2RCNA 1F3OA 4HYYA 1Z0JA 4C0BA 2YHSA 3QSYA 1GKIA 2H92A 4P0TA 4NCHA 3ZD7A 1QHHB 2ASEA 4Q1EA 5DSZA 4RD2A 1IXSB 1OB2A 2BWJA 4FINA 3RABA 2GEUA 1R10A 3GEHA 5LBIA 4B3FX 3K9GA 5HKKD 1PLLA 3CRQA 1GFIA 1S96A 3CBQA 4IEEA 1H8HA 2EWWA 2DR3A 3BERA 2GJAA 1OPXA 1P75A 3KKNA 4AC9A 1FTSA 1EXMA 1Z6AA 2AWOA 2ZR7A 2O8EB 1SKQA 2J59A 2ZRGA 3VR1A 1VYTA 5AUQA 4NCJA 2ZRAA 5JJLA 3C8UA 4A8JC 2AHOA 4G5RA 2V4ZA 4DEXA 3I8SA 2XOKD 4PHFA 1CRQA 2HF9A 2WM9B 3BGWA 1UKYA 4TT3D 4DWJA 3RS7A 1L8QA 5IF9A 2PXEA 1AGPA 1RRPA 4C2UA 2IXEA 2PX0A 4CIDA 4YMWA 3IEUA 3MRSA 4DLSA 1RYFA 1SXJD 3NXSA 4NZYA 4I1UA 4JSYA 2FGJA 1TU3A 3SHFA 1NVWQ 2OZEA 2VF8A 2F55A 1L4YA 1KY3A 2GAAA 4OYHA 3A37A 4EIWA 4NDZA 2JLQA 1QG4A 2J46A 3U3MA 2XJ4A 3VR6A 4H1UA 1CR2A 1NSFA 1OJLA 1P61B 4P33A 3KB2A 2JJ1A 3KTAA 4BEBA 3ZQJA 1BMFA 5DN6D 3QKUA 4FMCB 1GP2A 1EX6A 2DWPA 2IYRA 2OLKA 1OH6A 4ON9A 2O8BB 2DCUA 1RW4A 1JECA 4UNPA 4HZUB 4IVQA 4MRPA 3GJ6A 2WMOB 3DDCA 2ZJZA 4QGHA 3HR8A 5P21A 3W34A 1E1RA 3S1AA 2JLYA 3OAAA 1DS6A 3FKSA 3TNFA 1ETUA 2ZUDA 2E9SA 3UMFA 1D5CA 3L2OB 2Q21A 3QOFA 4OJKA 1K5GA 1VDZA 5E4FA 2DFTA 5HE8A 5K8TA 5SZJA 3EC2A 4QNMA 3BAFA 4PSKA 1KOFA 2YWHA 5TB5A 1RE0A 4KBFA 4BEJA 4LYJA 4KFUA 3X1DA 2QEQA 1LB1B 2BMDA 4XD7A 1XTIA 2JA1A 2BMEA 2GXSA 1SVMA 1S9DA 2Y8EA 2O8DA 1BMFD 1ZM7A 2R6AA 4OHXA 1NY5A 4K81B 1M34E 2EFGA 4H9GA 5JLJA 2F3RA 3FHTA 1Q57A 2PCLA 4D0NA 2VTKA 3Q8XB 2GNOA 2WWFA 1P60A 1YJ5A 1KI4A 1N5JA 2ZJ5A 1VIYA 1ZU4A 3LX8A 1ZNYA 5FBVB 1W5TA 3GLGE 1NVVR 3A1WA 3QVUA 5BN4A 4F93B 1BO6A 4G5GA 1HUQA 1VG8A 1KO5A 3AP3A 3BOSA 3QIAA 5JHGB 5SZKB 2JJ8A 2D62A 3F0TA 3A4MA 3KUDA 4FCTA 1Q3TA 1T4GA 4ZDIA 2J9RA 2D06A 2OCBA 2ZRNA 3EG5A 1WBBA 4URVR 4WW0A 1S4QA 3DMNA 4LC0A 4CZ2A 4BWYA 3EW9A 5EE9A 1Z6GA 4URUR 3RSLA 2VLIA 3IO5A 1F2TB 5HZHA 2XNSA 1NVVQ 2BOVA 3SS8A 1AS3A 1JAHA 1G8PA 5B57C 2QMEA 3OIYA 2JATA 3A1VA 4MRSA 2PXDA 2ZJAA 1KO7A 1Z3IX 3AF1A 3KKQA 2BHRA 1UBCA 4JJKA 1E1QD 4I81A 1SXJE 4IDNA 2AR7A 2W6IA 4P4TA 1XD2A 3RS5A 3BFVA 3EX7C 1U94A 2ERYA 2P2LA 2A5GA 1FX0B 2EYUA 3OZXA 4TZ0A 2IL1A 3KQLA 2ZUBA 1BIFA 3MG9A 2NIPA 1D2MA 2ZAOA 5JSZB 1V5WA 4NYIR 2JLVA 2ZRCA 4TMXA 1NBMD 3DPUA 2IYWA 2XNDA 5DI3B 3RS4A 4IVRA 1WBDA 1SVSA 2PMKA 2JJ2A 2WKRA 4A0FA 3OEHA 2DHRA 4URXR 2I3BA 4B74A 2ZU6A 5FPYA 4ZV4A 2YZ2A 1T0JB 1UBEA 3O8BA 1E1QA 5FTNA 3VHXA 4YMTA 3D6TB 1KMQA 2ZRKA 4XSHA 4ACAA 3LWNA 5IHPA 2O8EA 4EJSB 3ECCA 2QI9C 4JT2A 4LJ9A 4A0RA 2NQ2C 3M0EA 1JR3D 1G18A 4JS0A 2O0KA 1Q21A 1YZKA 2ZYVX 2F1RA 3THYA 4OQFA 1MO5A 1DPFA 2GF0A 1VIAA 1VMAA 5FH9A 1ESNA 3DL0A 3NEJA 3ZZTA 4ABYA 1E2NA 1VHLA 2JLSA 5FTKA 3EPKA 1SULA 4LJ4A 2FPKA 2PXPA 4F92B 1OLOA 3CONA 1E2HA 1YZNA 3U7GA 2AWNA 2LKDA 2YV5A 5EXSA 5GVSA 2PLFA 4KJZA 5DHFA 4QBIA 5JECA 4PANA 1KNXA 3OE7A 3IPYA 4XWKA 4JLMA 5L3SA 1AGRA 1G3IA 4PAOA 4LJAA 1M74A 1NJFA 3RRYA 2OV2A 4JLOA 2HCJB 3MLEA 2J0VA 5FOUA 1AQYA 2VO1A 4JKIA 1GKYA 3DKVA 2C03A 4UQOA 4Z51A 4JZKA 4HB3A 4QBGB 2FA9A 1T5IA 2FH5B 3EWAA 2JLUA 2QN6A 4ZI2A 3AVWA 4HDOB 5KSZA 1XD9A 1CTQA 1ZD9A 3CUEF 3QBTA 3I4LA 5DH9A 2IUTA 4A15A 5KPJA 1E2IA 1COWA 1NVXQ 3K9HA 1M7GA 2ATVA 3GJ8A 3OFND 2ZRDA 1MR3F 4POAA 1IQPA 4CW7A 5AJXA 2MMCA 4AWXA 4TYWA 2OM2A 3BB3A 1E9FA 4C0LA 1XMSA 2REOA 1QHGA 2EYQA 1ZNXA 3KXKA 3AQ4A 1P9WA 4RD4A 2GXUA 5J5CA 4E07A 4OQNA 2Z6VA 5FOVA 3G0HA 2A7QA 3C41J 3VNVA 1HT1E 4DCUA 3TSWA 2G9NA 1X8JA 2QT1A 3FHCB 1TF2A 3BJIC 3C5HA 5FI1B 1OH8A 1PJRA 3EA5A 4FCWA 5DN6A 1U0JA 3E1SA 3G5UA 3QPUA 3QE0A 1KHTA 3O8RA 5KNCA 2PBRA 4NP6A 1G4UR 4HUQB 4LV5B 4DDUA 1E9SA 2Q3FA 2QQEA 1QHNA 5KPDA 1IONA 3U4QB 1COWD 3DOEA 1ODFA 4PC3A 1XMIA 3ADKA 1DAHA 2VSXA 4PQYA 1UF9A 4Q00A 3EWSA 3VR2A 4F91B 1GWNA 4GI7A 3MFYA 3SDZA 3TVDA 2QGZA 3NC1C 2B8TA 2F7SA 4Q21A 2VQSA 1XXHE 4LUCA 1E4VA 1SXJA 1ZRHA 2F9MA 5FBRB 2WWIA 1OV4A 2MSEB 3NKVA 3SYLA 4AYTA 3IQXA 1E96A 4QJ3A 4D4JA 4RZ2A 1DG1G 1NBME 4M1WA 2GHIA 4LPSA 1VHTA 5GJWC 3W5JA 3O8DA 3CR7A 4R98A 4XWAA 4P32A 4Z8YA 1OYYA 3R7WA 3SE0A 4ACBA 2UKDA 2PEZA 3BE4A 4MDEA 1LY1A 2WWXA 4NYJR 1CJMA 4DB4A 2A2ZA 1E9EA 1OE0A 2WOOA 5D3MB 4B76A 1E2JA 3MMPA 4U02A 3H1TA 4HZUA 1FMJA 4EFLA 2PEYA 4HB4A 4EPYA 2ONJA 2ZRFA 4JLDA 2GA8A 2YWGA 1Y63A 5JHHB 5JSZA 2GEDA 3U44A 4ZI3A 4IOKA 2VYFA 3U7EB 4G5OA 3U5ZB 2RGGA 2PJRA 3RC3A 2CJWB 2QAJA 2XZLA 4AY2A 5H1YA 1R7RA 1T3LA 2Q3HA 1D9ZA 4B2LA 4M4SA 2G6BA 3CRVA 4FIDA 4A1FA 1U8YA 1XD2B 4PPNA 5EE5B 3AP1A 4DSUA 3DOFA 5DNYB 4DSTA 4V02A 5DIFA 1LS6A 2W83A 2VH5R 1DOAA 2JIZD 2PXLA 2KBFA 2QY9A 4C7OA 4QKQA 2IYVA 1CXZA 2JLRA 1XPUA 1OIWA 2D2FA 3NBFA 3A4NA 1KK3A 4MRRA 5UKDA 2J0SA 2IS2A 3ZS9A 1OXTA 4DT1A 5BWMA 1NSTA 4PO9A 2YKGA 2R65A 2HUPA 1BYUA 5E7JA 1PLKA 2ZAMA 2OHFA 3P20A 3BWDD 4MKHA 3KQNA 3OIVA 2W6ID 3IBYA 2IHBA 1N25A 3NWJA 1ZYUA 5FUVA 1DO0A 1YKSA 3ASZA 3CNOA 2QA5A 2O52A 5JRZA 2ORVA 4O3MA 3LXXA 4RFVA 3RHFA 2IF0A 5L8VA 1TADA 3KKOA 1YU9A 2OG2A 1KI6B 4EJSA 3BD9A 1MKYA 2QT0A 1XXHB 4DC9A 4XH9B 3RVBA 4L15A 1Z0KA 5EZ6B 2GJ8A 4NCNA 3AVXA 1TPZA 2XB4A 3BH0A 5EP4A 1KNQA 4IDQA 3QVVA 3ASYA 4BLRA 1KSJA 2WJIA 1D2EA 3ZVMA 1A1VA 3PR1A 5FI0B 4AURA 1XBTA 3TIFA 2OESA 1Y3AA 5FR2A 4DT1B 1KI9A 3IGFA 1XCPA 4JLKA 1FPMA 4IDOA 4GMDA 5JWHA 4G5SA 1NG1A 4EQ6A 2JLXA 1DULA 1FX0A 1E2PA 2YINC 4UNQA 4RJLA 1XXHA 3VAAA 2FE4A 4NBSA 2ZSEA 4UJ3A 4XVRA 5JS8A 2AKYA 4Q4JA 4CEIB 1G21E 2RHMA 5FOTA 3IPXA 3P26A 1MABB 2HYIC 3IBGA 1IN6A 1P7CA 2IXGA 3GJXC 1NBMA 2OCYC 3K0AB 3LBNA 3U44B 2O0HA 1E1RD 3NHAA 1EESA 5KYKA 1S2MA 3FKSD 3BIFA 1UKZA 2ZVPX 2ATXA 4OI2A 2NMVA 2BBOA 2VBCA 2V9PA 4KITB 4PTLA 3ADBA 2O8FA 4M1YA 1N5LA 3VFDA 1DEKA 3RDPA 3WRYC 3TW4A 1G5TA 2AX4A 3KUCA 4ESHA 4US1R 1NNEA 1G4AE 2VP4A 5G3YA 4HB0A 1CULC 1JR3A 3LAWA 4O0MA 1XF9A 1Q44A 4S2EA 4MYUA 1YR6A 1SXJB 2FEMA 2QBYA 4D6PA 3GP8A 1J99A 2H8KA 1PZNA 1QHYA 2XZPA 1JPJA 5A0FA 3EZ6A 4ZKEA 3ZVRA 5IK2D 3CWZA 4LJ6A 2DPXA 2BM0A 3IO3A 1TUIA 1MABA 1FNNA 2ZJYA 4ZDJA 3OE7D 4KBGA 2F1HA 4Z1MA 2IEZA 3TUJC 2XX3A 3MSXA 5H8WA 1A5TA 2G88A 3D7MA 1Z83A 3GEEA 3I3SR 2SHKA 5FPKA 2GAOA 2KWIA 4M0LA 2GXQA 5D3QA 2PXQA 1N6RA 4JLAA 4NE2A 4EJSC 4XVQA 1N6HA 4PPQA 4BECA 4OI4A 4MYCA 4YONB 2IWRA 1NN5A 4LDJA 3TUZC 4JMPA 3K1JA 1CJUC 3NTUA 4A4DA 4DUGD 2GEVA 2ZRHA 5FTMA 5CB6A 1II8A 3T35A 1JNYA 1GTVA 1EFHA 2OEPA 4ASUA 1XEFA 3VKGA 4MGYR 1VG9B 2ZR9A 2ZVQX 3BBPA 4QJ4A 5J4KA 2ANBA 4QXAA 3SZRA 3ZD6A 1NJGA 4JJZA 2J7KA 4KLNA 4TYPA 2QAGA 4US2R 4L9WA 1TQ2A 3VR4A 5LPNA 2X8AA 1TAGA 5CYOA 2KB0A 1AM4D 4R7ZA 4AIIA 4M9SA 2W6JA 1IN7A 4ZIRA 4DB2A 3DHWC 3LBIA 2WJGA 2BCGY 2RH5A 3BFKA 4FMDB 1OXUA 2QPTA 2CVHA 3I61A 1N6OA 1CLUA 3CZPA 2FGKA 2XNDD 1E2LA 4QGAA 1UPTA 5FUWA 1ZINA 1NMYA 3OEHD 5L3SB 5C1BA 1DADA 4DLTA 1W4RA 4LYAA 5HKKA 3UIEA 3SOPA 2VSOA 2J0UB 2ZI6A 1G3QA 3RRMA 3MJHA 2VSFA 1KDPA 1KJWA 2XJ9A 3CH4B 2IYZA 2OCPA 5FOWA 3RRZA 4ESVA 1E2EA 3KJIA 2CK3D 4DJTA 1F2UB 4GSYA 4IOMA 1N0WA 1KAOA 1R0ZA 3QXHA 1Z5ZA 2W6JD 3BC1A 2HJGA 2GK6A 2FMXA 4MGKR 1EFTA 4YXWD 1YR7A 1FP7A 1I4TD 2VF7A 1ZM9A 3NEYA 2XSZA 4TMKA 4DLRA 1MT0A 4A2QA 2GCOA 1XTKA 1SXJC 2ZSBA 4M1KA 2D2EA 2O8CA 1TF5A 2DBYA 5J4VA 1U0LA 2GBLA 1KI8A 3RS3A 4KFSA 4XOIA 3CPEA 4G1UC 4GZLA 3WHKA 1GNPA 3RAPR 2GTPA 1N5IA 2QSYA 2V8OA 2NO9A 1U9IC 1VTKA 2MSCB 2ZRLA 3K9LA 3KJEA 3R20A 3HYRA 1Z22A 2IYUA 1SQ5A 2C98A 1S3GA 2RGEA 1R5NA 1UBFA 1SKYE 2CLCX 2CL6X 3THYB 4BFWA 1ESMA 3F3YA 1ZCAA 3GCGA 3X1ZA 4URYR 3D8BA 2BEJA 5F9HA 3HU3A 3OFNA 4BE7B 3EZ2A 4HI0E 1YZGA 3A4LA 1NP6A 4IHQA 5EZ5A 2Z5FA 4NYMQ 3RYTC 4XJXA 1ZW6A 1QG2A 2QQ0A 3CB4A 3VMFA 5J4LA 2IBMA 4CEJB 6Q21A 4QBFA 1U99A 1EWRA
chains in the Genus database with same CATH superfamily
2ZK7A 3CGWA 1A8PA 5JE8A 4NFHA 1JRLA 2FN7A 4OHCA 2BV3A 5DK6A 4TGLA 3P2YA 4IV5A 3PXGA 5JUWA 1E6LA 1Y9EA 1CNEA 2NTYC 3Q9NA 4LHSA 4NPCA 4CU2A 2P9HA 1AVOB 1BEEA 2G8LA 4GI1A 4UM5A 2IEIA 3PE3A 5CNMA 3K72B 1P39A 4QNRA 4IGFA 4OB8A 2WAAA 1WATA 1RYBA 1TKAA 2H65A 2ZJOA 4H77A 1MDFA 1RXUA 1OMOA 3GLHA 2EATA 4AU1A 2EAUA 2W6QA 3AFMA 3U2QA 1X1BA 3B1JA 4RO0A 4KLCA 1L2TA 3SFZA 2I6SA 3TQCA 1NTOA 1ZGJA 1ZCBA 1H5NA 2D13A 2FG6C 1Z62A 2QVYX 1GQAA 1TT5A 2R5NA 3B51X 4QJBA 2YJTD 1GUAA 2HFKA 2QZ4A 1JKJA 2TYSB 1J8MF 4MI1A 3QYAA 4HQKA 2HKIA 5AJWA 5K3FB 3TW8B 5CITA 4PPFA 1ZQ1A 5GP1A 1JF8A 3GT3A 1YB5A 4LOIA 3IVRA 1SVKA 4E3WA 2UZIR 4DXAA 1C1DB 2WV7A 1H94A 4FEYA 3SXPA 3ZNPA 1QKJA 2XE7A 4FJ1A 2QTAA 1FLNA 2WHPA 4TL6A 4MJ7A 3BF7A 3TLEA 4DV3B 4Q66C 1CPYA 2AT1A 1LDGA 3I5XA 3C6YA 1BX3A 1QCZA 5AXCA 1YRQA 1JQ5A 2PZGA 4X1KB 3NBXX 3KP1A 1SUFA 1JR3E 2UVPA 1ZW2A 2EDAA 2JK0A 2VTEA 2H2FA 4IJQA 2FHPA 3TB4A 5KKCA 1FYEA 3H8JA 1BOOA 5EXTA 2OCKA 4X91A 3O4VA 3RB8A 1JG6A 2R1UA 4D79A 4X6XA 2QMQA 3GLFE 1XQYA 3P0FA 5JP7A 1CP2A 4OD5A 3TX6A 3E2IA 4UHKA 3W1EA 2MSNA 3ZR4B 1XAHA 2EKDA 2E4AA 2QNIA 4LY3A 3NNNA 1LNZA 1KE2A 1RQ7A 4ENRA 2X9QA 2RB4A 3V3TA 1CZUA 4A9AA 3G0DA 4U1RA 3ZCVA 2HW8A 2G0NA 4GXNA 3UUFA 1V54C 2PXHA 3SYRA 3OQMA 1TT7A 3IDAA 3U3OA 3OT1B 4U6NA 4EHIA 5T3WA 1RWXA 3TW8A 4ZIRB 4GMXA 5FWYA 1JXOA 5JS5A 2CVFA 2GAFA 2G76A 4O4HB 4DV7B 4PE5B 3SJCA 4TQAA 4QGSA 1Q1QA 3B82A 4YRGA 1OQCA 1UK8A 4TWAA 4B3HA 3T06B 3H19A 1RLUA 3KLNA 2XB6A 2JCYA 2ECPA 1Z8HA 2QTHA 1DX6A 2G1KA 5J2UB 4DY6A 1X1CA 2GDZA 3QHQA 2HHLA 3FCUB 2AQIA 4YR7A 3NHUA 1ES9A 4WZ6A 5JYBA 4EZIA 1D03A 1D8AA 1YC2A 3QF7A 2HLHA 4BFYA 4GKJB 4X92A 3KKLA 2R25B 2YZGA 1QO0A 1TM7E 1WDMA 5EXDA 1A8UA 3Q10A 8OHMA 2JGMA 5JAOA 3FVTA 3CLKA 3DXZA 2BBTA 4QICA 4X1YB 1CUDA 1R6BX 3MELA 5AOVA 3UHAA 3Q72A 4E03A 4MQ9F 4R8VA 3CPHA 1M8GA 3AKCA 1ZW3A 3R5SA 5CX1A 2XQIA 5TPWA 3LWDA 1DWKA 4IILA 4ENPA 1VYUA 3O8QB 4MTOA 3JRNA 3UFXA 1GVNB 4PWZA 3DLCA 3ZE7A 4XYGA 3WYAA 1Z39A 4NQZA 2QTRA 4E4TA 4J3FA 3PEEA 3A58B 1ENOA 3MOIA 3ROFA 4EK9A 3AIMA 2REXB 4GM1A 2O49A 1C7QA 2D7CA 2DE0X 2XMPA 4PAMA 4YXFA 5EIEA 2R44A 1VJGA 2W8BB 5KU7A 4HDNB 3K0AA 5KNBD 3D3QA 4MV9A 1KGSA 3W8NA 1XKQA 3QUSA 2PXFA 1PYGA 4TKZA 5GTDA 1P2UA 1J25A 1VKHA 4MVZA 3F6CA 3JVIA 4HSEA 3CR8A 4I08A 1HURA 4MVJP 821PA 4Y6QA 3TCXB 5BQGA 4KWIA 2QJOA 2WJVA 3L06A 4D9NA 1JZQA 4YJ2A 2V55B 4Y2RA 5EAIA 3V7UA 4L07A 5K8IA 1PL8A 3ZDAA 1NQ5A 3NOXA 1RXCA 1WR8A 1EFAA 2Z30A 1TIBA 1DC5A 2XYGA 2K2QB 1PP4A 4YO8A 3TLKA 3OE5A 4IM7A 5ARDA 1KA9H 4J0KA 3RYFB 3R9XA 4Z2AA 4QTZA 4KW7A 3BMNA 1EFPA 4R68A 2PPXA 1N2JA 2Y39A 2QMZA 1QGDA 3VSAA 3TXAA 2AKAB 4KIJA 3UNXA 1OBHA 2OK7A 4IS3A 4MS1B 4QBTA 3GNLA 4FJ2A 1VE1A 4I8IA 1JFTA 1VJTA 1Y5MA 1YONA 2CDRA 2PH1A 1XQWA 3AB8A 2BDUA 1YWGO 1G3RA 3H2JA 1UK9A 4R41A 2ZBDA 1T6NA 4MGEA 1F9EA 1IPHA 2GCEA 1PZHA 4DG9A 4DBQA 1WEKA 1XWJA 2Y0CA 3ONDA 3WRXA 1N36B 4TLMB 2XCOA 4P7JA 3DDHA 3LCMA 3O74A 4Q9LA 4X1IB 4RYLA 1ZMOA 4BQPA 2PLWA 3BQ9A 4GW3A 3O1LA 3I1FA 4KLAA 2I8CA 4KO1S 4JUCA 5L7TA 2JAPA 4L5YA 3I32A 1K7SN 4LG1A 1XRMA 4Q1VA 3U7JA 4B4OA 2DWQA 1UZLA 1I1HA 2WKQA 3JD0A 4XJVA 3HYSA 1YRAA 5F98A 3U19A 5IH3A 3JQAA 3OMTA 1QNFA 1SWWA 3PQEA 2IIPA 4JOQA 4V3BA 1NE2A 2IHZA 1Y8QB 2Z6UA 4YJWA 3UMSA 3VR5A 2FYTA 2Y4NA 4DHEA 1JHDA 4MINA 3U4MA 4XVCA 4EMTA 3U62A 1ZUNB 4F3RA 1JHXA 1V8ZA 3LD9A 2UZ1A 3H2KA 1PERL 3KVYA 3BD1A 2AA3A 3BMNB 3CG0A 1FUIA 1O2DA 1W5SA 4QBKA 1CEQA 3WZMA 4Q16A 1VL0A 2BGWA 1XFAA 1SF8A 1RZ3A 4XKJA 4KU4A 5AJYA 3QEOA 1HO3A 1ZISA 3CNLA 4Q4HB 4Q37A 4YCBA 2V1UA 3RVOA 5LQJA 3RKUA 1YCFA 4UNIA 3RYHA 3A6ZA 2J3KA 1BDMA 4JKVA 1U28C 3SXZA 1XJCA 2HJRA 4KDEA 4A2PA 4RXTA 1L7CA 2ZQ5A 1OR3A 3EXFA 3GGSA 3L8EA 5EQTA 3B48A 1Z7GA 3NMIA 2CXPA 2M32A 3FLEA 3NROA 5A6BA 2F1OA 2H7VA 2V3WA 4O33A 3OPQA 5E2IA 2JKYA 3U13A 4DM4A 5K0LA 4W1PA 1JI3A 2O2ZA 1SHJA 3VTKA 1JLLA 4FOPA 5BUZA 3AFOA 2NTJA 4MQ4A 4JNKA 1Q7BA 3WG7C 4G0XA 1KP3A 1AN0A 5IG2A 4GLFA 4KEAA 2H17A 4L0QA 1XCGB 2XEDA 1YCDA 2CUZA 4MP6A 4UFPA 1FNCA 1TQ4A 1OSLA 2ET6A 2YWFA 3GRKA 3IJPA 2KQ9A 4GM4A 4BUCA 5E3AA 3UH1A 1RRKA 1L5MA 4DARA 2PZMA 4YUYA 2DYKA 3AL0C 4BDSA 4F9EA 1K6EA 4QHTA 3AHGA 3AGQA 2HR1A 4L5BA 1Z4KA 4QHSA 2WFAA 2WHXA 1MA0A 4BC0A 1ZZ6A 1YVDA 2ZIUB 4LDAA 2GZ1A 4YG7B 4J90A 3NIFB 4J6FA 4GSLA 4DLXA 1BCSB 3Q6MA 2PJUA 5ERGB 5C5IA 2AZMA 3K70B 3PP8A 2WWWA 5EUBA 1V8DA 1N92A 3C0KA 3E8XA 1IY9A 4JIOA 1CG6A 4RS4A 2RCYA 1EK6A 2VH2A 4YCAA 2WAOA 5AK0A 3F6YA 3MWLA 4P5EA 2VPPA 5ANRB 2NT3A 4WBXC 3T5TA 1IAQA 3SXYA 4Q18A 1MQAA 2VJLA 3GJ0A 1S8FA 4ZJYA 1B1AA 2EPLX 2EGGA 3OFJA 3AUUA 3KTAB 4PHTA 4XM2A 4J32B 4BNIA 2I7DA 2FR1A 4I46A 4EUNA 4B5LA 3KJNA 5T1DB 1XNJA 3CLUC 1WSWA 2O1EA 3W5DA 2AFIA 2BR5A 3U4AA 4F5WA 2EKBA 3N0WA 4L8VA 5AKEA 3OPNA 2IU4A 2I54A 3AF6A 3TKAA 3C4VA 1JHUA 2DWCA 3KL2A 4B8WA 1R8QA 2G3VA 2R6JA 3U37A 4MCXA 5BNWA 1Z6ZA 1GZ4A 4F1WA 4P0TA 5CYGA 4PICA 3RFVA 4OINF 3L02A 3LY8A 4B45A 5M5BA 4CKXA 3W4IA 2QZ9A 3NAZA 1VXOA 2FOXA 1CETA 3UWPA 3P4UA 3FDJA 5H5JA 3X1MA 1II8B 4ER5A 4G0YA 4I7EA 4YYZA 4DPLA 1FFEA 4X85A 4Q47A 2VF2A 3NYLA 4OB6A 3L4KA 1IHUA 3C5CA 4FWIB 4F96A 1J0EA 2LE0A 3AVOA 1EP3B 1M0TA 2RDMA 1L8LA 3K6JA 2V59A 4PO3X 4MNTA 5DCWA 3M1IA 3J7AC 4LEIA 4HAXA 4HY3A 3RVMA 5EHZA 5ELXA 2O14A 4W5HA 2I3GA 3W79A 3O8OB 1OCCC 2JGFA 4OGWA 1K06A 1SKUA 4K88A 3FKJA 4RENA 5LQAA 3RYLA 2ZXWC 2O2XA 3WS7A 4YVFA 3JXCL 3RS9A 1M8JA 3WIOA 4S12A 3PUIA 3R7DA 4GX5A 4S3MA 5LXTA 1KY2A 4OI1A 1ZIOA 2OBMA 3EZFA 4Q1BA 4CKYA 2VHTA 1NM5A 1EM6A 1W6UA 3B7WA 1FDIA 3KLOA 4JASB 4QYXA 3NHBA 2MHRA 3P9SA 2DEUA 1XT6A 1PSDA 4DOZA 1PLJA 1RM4A 2QJWA 4BMYA 2NO1A 3FPSA 4GRDA 2VP2A 1QYXA 5EESA 3VA7A 2VYND 2I1QA 1JE0A 1Z2OX 1E20A 2NXNA 3DFKA 1QPUA 3NATA 1WXHA 2HJHA 2AFHA 2BKUA 2KE5A 2ZULA 1YOVA 2FPLA 2HQBA 2Y93A 3MJ4A 4B4DA 1ZC3A 1M1NB 4DSAA 3DL4A 3NJRA 4XIJA 3UB3A 2O8CB 3O84A 3SQNA 3O3NB 5JZOA 3K66A 1OIXA 2FZEA 4ZODA 1RXVA 3AVYA 4K87A 4XGKA 4EGJA 1J2YA 3QYFA 5F33A 4YDHB 2YICA 1TUBA 3U5TA 2OCCC 1V11A 5J5VA 1FTWA 2WVHA 4P9TA 1JWAB 2Q0XA 3OA0A 4NE9A 2H85A 1H23A 1JGTA 1L1RA 2JW5A 1TNDA 2W8ZA 2YH2A 3C3CA 3CFYA 3MXTA 4KSCA 3FBWA 4U5XA 3T9BA 2HXYA 4K9DA 4R8LA 1O95D 5J59A 3WGMA 8ABPA 2OGUA 2JD0A 2N46A 3FB1A 5TS2A 1AB6A 4B71A 4WD3A 2PD4A 5C4MA 2H1LA 3TGPA 3OIWA 2E6KA 3N6RA 2O7QA 3MYYA 3MT9A 2EG9A 2OR3A 3EDCA 3KX2A 2QD1A 5IDQA 4HWRA 4OATA 1LFAA 5DU2A 4PO8A 3OT5A 5JLIA 2P41A 3TB6A 4B31A 2VPIA 1GL6A 3AHJA 5KJ1A 1WQ1R 1U3FA 1RM3A 3HWWA 2JFQA 3TCNA 1CFJA 2QSUA 1KS9A 2OM6A 4FZRA 1OFVA 1RRCA 4X97A 3T6KA 5TVKA 1M1YE 4LHVA 4QIHA 2HLDD 4RK1A 3U48A 1JLRA 2J9FA 2WTXA 1GNQA 3EVEA 1HA3A 2Q2VA 3H2BA 3MF4A 4Q7CA 2AJDA 2B2NA 3B7HA 1BZYA 4GX1A 1XU9A 1MPXA 1XFDA 2JI6A 1PUIA 3JRXA 4N49A 3ES9A 4PR0A 3QZCA 3JQRA 3LHFA 2FTKE 1R00A 4IOJA 1NF2A 4ZCLA 3LJKA 2W4MA 4MLDA 3Q6NA 1DX4A 3CLTC 5FJIA 1Z5VA 2C2MA 2WTEA 5A9SA 5A04A 1R0YA 2QSZA 3AI2A 3WY9A 4LV6A 1TTTA 3HDJA 3K0FA 4EKWA 4M9XA 1UJ6A 2R7AA 4X8HA 5FA6A 4ZCQA 1T8RA 3O4JA 2OHHA 3G59A 3P97A 2P4HX 4X20B 5AJZA 1IOLA 3G9QA 3ZXUB 3NM5A 4C3UA 1QGZA 4K9LA 1Y1PA 3Q41A 3WGQA 1E7SA 3DVLA 1QE3A 1CY6A 1J1IA 1MN6A 1WZCA 2A5JA 2P9FA 2QLMA 2WYIA 3EN0A 2HSDA 4LYGA 3UVEA 3GVIA 2IH5A 1KVQA 4YJHB 1ZLXA 1IW7F 4UTZA 2Y1OA 4E5KA 2CXHA 3G2KA 2A8YA 1RKVA 3ZHXA 3LYUA 1QKIA 4O2RA 2ZT6A 2UZ4A 3QBJA 3JCUQ 3FCOA 2A9JA 3SQLA 1R6AA 3I9OA 2H1OA 2XMGA 1NUAA 2P5TB 1LLFA 1BN6A 3KUKA 3LWZA 4LK2A 5I5GA 3ZEAA 5COMA 4GR4A 1I2DA 3UFDA 3NDBB 4HLDA 5I9SA 2H7CA 1AKQA 2RIRA 1VFNA 5KHAA 1TQ8A 2R62A 2M6KA 4LJYA 1AQ6A 4OIFA 4KI2A 5GINE 2JIBA 4GOJA 2FLVA 2P6NA 4ETIA 4LJ7A 1E2DA 5F12A 3R2PA 2KI5A 3IP5A 3BRSA 4FD2A 3HJFA 3AR9A 3EXIB 2W6PA 4B7CA 2C0QA 2NQ8A 1IRXA 5EWLB 3PTLA 1ORHA 1II0A 2HI0A 5KTNA 1SUEA 2CYDA 2XADA 5FBWB 4CHTA 4YRNA 1JDPA 1ZI9A 3K1YA 3D6HA 4YJHA 3WIVA 1S0UA 2IY9A 3AJDA 4OOEA 5FO1A 5I4CA 3U9JA 2ERCA 2JH8A 1FRNA 3AEZA 1MVOA 2C88A 1NMXA 2IYLD 4P9FA 1PUXA 4IARA 1WW8A 2F62A 2VDQB 1NRJB 2VWQA 1USWA 4L3OA 2H63A 1MJHA 2J32A 1B1CA 4MMYB 4CBVA 1DBSA 1NR1A 4NJMA 4QOSA 3HH8A 3P2MA 1YDFA 1F20A 1RBMA 4UE3S 4ZP1A 3HP1A 4U2DA 2BJCA 3KTFA 1JJVA 2MSKA 5DLYA 3FWYA 1PNVA 5DM60 1KC3A 3EIEA 1OF1A 4RTRA 3L7LA 4ZVRA 1YJGA 5BYKA 2I9KA 1OR2A 1V9LA 1DAEA 1OFTA 3LF1A 4EWLA 5HGXA 1T5DX 3KWFA 3QLVC 4DHWA 3AGPA 3RK0A 1Q20A 2VHEA 5EQFA 2VK4A 3K09C 3T7CA 4EJ0A 4PRYA 4CM5A 3PB3A 4Q82A 2XZOA 4A8TA 4MVJD 1M2WA 1X1RA 1M56C 2QLTA 3EPPA 4W7SA 1XA0A 3V4FA 4AROA 2JLZA 2D6FA 4K2AA 3LRXA 3M49A 4KMRA 2QRVA 2AR0A 1P7ZA 1QBGA 1WVMA 5HX7A 3BILA 2NSLA 4IJJA 3OAAD 3ZZUA 1MUUA 4G5FA 4MUXA 5T3YA 1C4XA 4Q9KA 1HK7A 3FCXA 5E4JA 4LMAA 4DJFC 1OVMA 3M79A 4TLAA 4URWR 1OLUB 4ZI7B 3L1HA 1Q92A 2BFOA 3COYA 2IKSA 4C2BA 3VKHA 2ECKA 1R9JA 1YD7A 2C9YA 2RHRA 5TMBA 4QJ5A 5HUQA 1V11B 1C9NA 3EIFA 4Q3AA 1U1IA 3JR7A 3I2JA 3KD2A 3ZZ1A 1DKNA 4ZD6A 1UZUA 3C3AA 3BK1A 2A4MA 3C39A 3D5TA 3F3SA 1NPDA 1M5TA 1ZBDA 1BGWA 3KVRA 4N6HA 4FAPB 2DY1A 3E61A 3WLOA 4DE5A 5L9AA 4J7AA 3S8YA 5HS6A 1Z37A 6PFKA 4Q4CA 4P3NA 1Y6FA 2HFZA 3VVCA 4WBNB 1Z5WA 4OM7A 4S1WA 1FA9A 4RCYA 2CKMA 3JQ8B 2L6HA 3QENA 3JVVA 1TF7A 1QX4A 2V96A 2CL7X 3C3PA 2YQZA 3GLUA 2ASRA 3IC5A 1LCDA 5AC5A 1HLGA 4ANJA 3C98A 3PUXA 3Q3GE 1P7VA 4MGZR 2YXNA 4GPTA 3EA0A 3QVMA 4C05A 4EO7A 2ZDGA 3T9OA 4RXMA 1SOUA 4QREA 4JWKA 1KI6A 5EIBC 4CM6A 4Z5HA 4LAFA 3ZDCA 2ICTA 4JXZA 4CTMA 2R7TA 1KMHA 5KTYA 4R1MA 1DXOA 1YSCA 1ZA1A 2OGSA 2NO6A 2YL2A 1OHHD 3H2VA 3IAEA 3VUEA 4PNPA 1KZYC 2JS7A 2QMOA 2FSHA 4TS3A 3T3IA 2IBTA 1LTKA 4TPKA 4G3XA 3KQQA 5FAXA 3QVTA 2DJIA 1Z5NA 3MGGA 1TVMA 1NQXA 1O97D 3SSMA 2WIKA 1V96A 4Y0NA 1EI9A 4LISA 3GJ3A 4X20A 2OAP1 1NHGA 5CDFE 1MORA 1Z0ZA 5HIJA 4W5WA 2M6SA 5CJPA 3R75A 2OAGA 3HWX1 4CF7A 4HAUA 2MYNA 3ESYA 3GLHB 5G53C 2XVZA 2PD6A 1KQOA 3T7TA 3JATB 2UXDB 3MINB 1DMRA 2W2XA 1ODKA 2ONZA 3R7LA 3V2GA 5C53B 4OREX 1Z33A 1EIZA 5BSMA 3JQ8A 3AVUA 1UAAA 4KQJA 4MR9B 1WPQA 2R1ZA 5AW5A 2XUFA 3RC8A 4M0CA 2FLWA 4JI6B 1WMEA 2B3TA 3U56A 4MSUA 3DAHA 2AK2A 2QN3A 3DHYA 1PX2A 4AJNA 1GJRA 4PSDA 3A2KA 3VJKA 5KQSA 4KRFA 4Q1CA 3UATA 1YQEA 3ZGVA 2AN9A 4RPKA 2AJTA 1IJKA 1KU2A 2GJSA 3WTBA 3P0HA 1UANA 1CPRA 4K9QA 3B5JA 2CNDA 3OQVA 4B43A 3DDOA 2BJVA 3N05A 3I76A 1DV1A 4L8FA 1YS9A 3M2TA 3ZWDA 1YIOA 1FTGA 4TM8A 2P1DA 4TL8A 5ALGA 1GZ5A 4XWYA 4MR7B 3ZKCA 1JDTA 4JTAB 3AVPA 5C37A 1JAIA 5ALOA 2W00A 4MI6A 3HXLA 2PUJA 4G0VA 4BLQA 1NQAO 2GO7A 4L8GA 1QVZA 4RF3A 1S05A 4C6RA 4FYWA 1OB5A 2VJNA 1CD5A 3OOYA 1WU8A 3ZJ4A 1SXPA 5LD2B 1OWLA 3Q1KA 2VRCA 2VWGA 3WZLA 3DBOB 4TSKA 1L7AA 2DUNA 5D00A 1LTQA 1Y6DA 2FUNB 4MUMA 1U8TA 3VYTB 4CS8A 5JC8A 3BIJA 1USIA 5BOSB 2LYJA 1QVVA 1P0CA 1PQUA 5F1YA 1V6CA 2HWKA 5C2JB 1W7AA 4JI1B 5EPUA 5A7GA 4G97A 4ZU6X 2J8WA 1CUXA 2H07A 5C5CA 2QU7A 5LOVA 1PJQA 3EXG1 3SIRA 2JAUA 3U1VA 1P62B 4JZYA 3ROPA 4ZRNA 4LA4A 3SKVA 1PV2A 6NULA 3RYCA 1SZJG 4CS7A 2PA0A 3QSGA 5AM5A 2WSMA 3OX2A 2O8BA 1Z2CA 2ZXRA 3LHDA 1A27A 1WBJB 2GERA 4BFVA 1SVNA 4NNOA 4TMWA 3NYWA 1G6HA 4YP5A 4QYWA 1GTJ1 3ZIDA 3MJCA 5EE0A 1P5HA 3QVXA 5DVZA 2BZGA 2ZE7A 1NG9A 3NDIA 4MJLA 1MNAA 4YRKA 1T2EA 1JDUA 2QAGB 1OBFO 3CCBA 3E3MA 5GJVC 3BBLA 2V6MA 3M3PA 4CYMA 5A3JA 2AQ8A 1RAGA 5G40A 3TFOA 4RJJA 621PA 3D1NI 5BNFA 3RIGA 4F5ZA 2IEAA 1KETA 2HV8A 3L9WA 4QQFA 3KB8A 4U7WA 2FW9A 4AUMA 3JSEO 721PA 5M04A 4E5UA 1PVVA 2HBYA 2QVCA 2WMYA 3O0TA 3I9V6 4NENA 1T2NA 1QUEA 4OQDA 5CM9C 5FTJA 3VPCA 3T0IA 1AA6A 4KR6A 4D0LB 4Q19A 5FJJA 5AI6A 5EMNA 5HFAA 4C3OB 3KZ1E 3F9CA 2E4WA 2GPAA 4C43A 3NYMA 4O5AA 4QOHA 2OHOA 1J49A 2GK7A 2A5DA 3ODPA 4XDHA 5ADHA 2AFHB 3UUEA 3LDGA 1VP9A 2X5KO 5EZQA 4BLPA 1YBFA 3U0VA 2ISCA 3NIWA 2A6PA 4G67A 3FA2A 4TKUA 1C3LA 2FFAA 3AKZA 4HJXA 1ZD8A 4LF9B 1Q6ZA 1B8PA 2OUKA 3BL5A 1HDZA 4HFJA 3ATPA 4WFKA 1X14A 1XSEA 4V1CI 2DH6A 3TJ5A 1NVUQ 1PDWA 1CVIA 1A3CA 2VCHA 5B64A 4BIMA 1IZ8A 1T2DA 3GIWA 1SZIA 4QOJA 5HKLA 1U2EA 4P3KA 3EEYA 3PRJA 1KDYA 4ZTZB 1WOYA 4J0DA 4EG8A 3KQYA 2TSYB 2VA8A 4E6EA 4KR2A 5K8VA 4GE3A 3C6BA 2CUKA 3AJAA 2R0QC 3QG5A 3S2EA 2G1AA 3AFHA 2BCJQ 3AESA 4OBWA 5KO2A 3A9SA 3HJAA 4OJQA 1SC9A 4TXJA 3I23A 1EFPB 1O6CA 2FW6A 3K0CC 3K1IA 4RMIA 2NM0A 3NP7A 2NUPB 3QFSA 1SVLA 3I6QA 5DF1A 4WK2B 3Q8KA 3T3HA 3ZWKA 4U7TB 2XUQA 2W6MA 2Q5EA 3DH0A 3KOUA 3OU7A 4MVQA 3A31A 3PSHA 2VC2B 2C29D 2JL1A 4IIJA 3ZIAD 5CVUA 3DOCA 1T8WA 3PEFA 4ESOA 5DTRA 4MQFA 4RY8A 3F7MA 1JEYB 3MUOA 3A9XA 5IM4A 4NCIA 4UNNA 3UJ8A 1JAFA 1XRNA 2WFZA 2XGOA 4QEDA 1VGQA 4I2VA 3KAJA 2PCJA 4Q9JA 4RESA 3UANA 1Z2AA 1U6HA 5I8PA 3QLJA 2PHZA 3IBSA 2ZU0C 3IOCA 1DBWA 1YFKA 4BNZA 3RUFA 1D0IA 4ZO7A 3RFYA 1XKXA 1KO8A 3EZNA 3H6HA 1R4NB 1WA5A 4PC1A 4FKBA 2WPDD 1VXRA 2QX6A 3DDSA 3LVBA 4G09A 4XZ3A 4DCMA 2AOUB 2AW3A 5DM2A 4EYKA 5KINB 3LP5A 1YMQA 2ZIZA 2RGBA 4P53A 1CRZA 4KR9A 1C41A 4FHZA 5CCEA 4KSBA 1NPTO 1KKMA 4UFOA 4XQ9A 2YZ7A 5J47A 4IW3B 4TSFD 1MLDA 3AKEA 3I1YA 4DYDA 4KO2S 1T8PA 4CKWA 4TTAA 1D2CA 1XDGA 1KGDA 3DUWA 3QVKA 4AKEA 3W4KA 3IQ5A 3UOWA 1XRLA 2HSEA 3AZOA 4HH4A 3HSKA 2JGEA 3M9WA 5BWCA 3BL8A 3EUWA 1VIMA 3DYVA 1EUCB 2ZE6A 3AQBA 4J1QA 4LMPA 3PA8A 2NXWA 1ZUNA 4P83A 1F2VA 1QH0A 5E7IA 2NQTA 4EUKA 2CCKA 4RC9A 2IV1A 1HYHA 3EODA 5EWJA 5IJ9A 2ABWA 4Z5CA 3AJ8A 3M4CA 5U4XA 2R96A 2UDPA 1EGQA 4LBWA 5KYVA 1XCLA 4GQBA 5CDHA 1OY1A 2HJVA 3VR6D 1HH4A 1C3XA 4S0XA 3LT5A 3H5NA 1P18A 4Z7QB 5B3JC 5LMNB 5KSPA 4D3XA 4FGLA 4HAVA 2CYCA 5B7GA 1AQNA 3QYJA 4B73A 4NMWA 4GQAA 2PVSA 3ESCA 2I99A 1HDXA 3IOYA 4P4NA 2WC1A 4YJ3B 3KV1A 3FYSA 4NFLA 4KR7A 5FWAA 3GN2A 4CMCA 2D1YA 3K6KA 4WOKA 1MX5A 3ISJA 4Q7QA 2ZI9A 4MVCA 5IZCC 1Y5LA 3WG9A 1HQDA 4H4DA 3H5VA 1LCIA 3VXKA 2IHKA 4DQ0A 2B0HA 3HA3A 3ESAA 3WGLA 4EOGA 1R2QA 3NANA 3KDSE 2PH3A 4XQ0A 4YAKA 3KETA 3X2SA 4PZ0A 2H3EA 1HMDA 1XTQA 3PUKA 4HADA 4KQKA 3ETNA 5CRIA 3TKYA 1XP8A 2DU8A 1C1YA 4I99A 2WICA 1XNRB 2BFFA 3LT2A 1KJ9A 1TQGA 1QP4A 2PIDA 2VSYA 1R63A 4EGAA 5BW6B 1X1SA 2BLNA 2C2ZA 2Z9CA 3I37X 4M38A 4YRPA 5GADl 3I2GA 3CC8A 4KO8A 2GBFA 2HCBA 4ZDJA 3QU5A 2O9XA 1N2CE 5MF6A 2EPKX 2BC5A 1IJBA 1WCIB 3GQBB 2OYRA 3QVWA 3YASA 1HDGO 3GT0A 1D9XA 1E64A 1GSIA 3H4IA 1EK2A 4QODA 4NQRA 3NDRA 5ECDA 3T7DA 4M0FA 1ZHWA 2O7RA 1JBQA 1EP9A 5K9ZA 2CNWD 3PIDA 4GYYA 1F8UA 1LLUA 1P2VA 1MNEA 3M6LA 1Q5PA 1K9VF 4EHDA 1D1AA 3KXDA 5LDGA 5C3UA 3WDSA 2FP3A 4FDMA 4YQYA 1GARA 3S8MA 4GYKA 2XB9A 1NJ1A 4E46A 2ZDHA 5A4FS 1PD1A 1UOPA 2Y1XA 2XM0A 3KJFA 3QVJA 3ZS8A 4ND7A 1VSQA 2MCFA 2Q7DA 1CY8A 2YWJA 2RHTA 3TIVA 4HV4A 3M33A 5EYPA 3W2FA 1FQJA 2F9LA 3WAQA 3OT4A 3GWZA 5K5EA 4XTCS 3TG8A 1PNQA 3BWMA 4GMGA 1RKEB 2LBPA 1QK5A 4MS4A 4MUGA 4MJ3A 4JI7B 4KODA 4KHPB 3AG1C 4HLUC 1G64A 4U0JA 4YRRA 3QPAA 1ORSC 2HK6A 2PG3A 3KYDB 2ADOA 1F12A 4RPJA 3AQIA 3BXZA 5ALNA 1ONSA 5AVOA 5IT4A 2EPMX 3LV8A 1CUAA 1D6JA 5BVGA 5BQHA 4DV4B 4PC6A 4U4AA 4B46A 1BROA 1EHYA 1GAWA 1V1RB 1UDRA 2AS0A 4H6PA 5IS2A 2BGIA 1CEXA 1QPBA 2PWBA 2N1MA 2B1IA 4P3PA 2ZROA 5JD5A 2R7QA 3OF5A 4ZZIA 1Q7TA 3G5TA 2VPXA 5FL7D 1NNI1 4WY2A 3ZH9B 4BGIA 4CMEA 4E6PA 5CA1A 4TMTA 4X71A 5HCIA 2GN8A 3FLMA 3AEQB 4FBGA 4MQFB 5ER9A 3B3GA 3ZI4A 4WT7A 5JJCA 3H5AA 4MB0A 1RJEA 3NGXA 3EJWA 3HB1A 1E6EA 3D6NB 1O8BA 2AFRA 3G8BA 2YL1A 5AJVB 3V9AA 3Q8LA 1O94A 1FVFA 4OQXA 4AX8A 5K0IA 1Q0UA 3HVKA 2JBAA 3P9ZA 4N0PA 4OXYA 1ZNZA 4MPJA 1AZWA 4YHBA 1E3WB 1MOPA 2YBDA 5DE3A 1MAWA 3CHYA 5DWDA 3A9CA 4IOLA 1T3TA 3LFTA 3A7DA 5C8DA 5CFPA 4IY1A 1VLTA 3K6SB 4EG4A 3BMOB 3IDQA 2B82A 4J1SA 2BFMA 3BXEA 4NMXB 4PLGA 2HINA 1IM8A 1UJ2A 5E6RA 5HG0A 5KU1A 4B6PA 1XZPA 2IDZA 4WEOA 3PGA1 4CM4B 3HO8A 3QELB 1MXHA 3N74A 3W6NA 4NBVA 1P3JA 3QX8A 1OT3A 4LXIA 4NBWA 4U5BE 4GP7A 5FBQB 4PS0A 1T6ZA 3M6VA 4J16A 4RAQA 2D4HA 4YCLA 1FTQA 4CIHA 3D7LA 1C9EA 1ZZ8A 2WZQA 1GY8A 3ZW9A 3FE2A 2WHRA 4L6CA 3E9QA 3ZC4A 4PPGA 2KMLA 5T64A 1P1CA 2NX2A 4UHCA 4CG3A 2PGDA 1UG7A 1PV1A 4EA6A 2GRLA 5BN3A 3QKRB 1QG0A 1Z38A 4YA6A 4P5DA 5FLKA 4UXHA 1VYIA 1ARZA 1EAMA 2AR9A 4EJMA 5BT9A 4AP9A 1EFVA 4ROTA 3TSCA 1MP0A 1M57C 1A50B 1QNLA 2B5OA 4UMFA 1JR8A 2AXNA 2QLJA 1KFKB 5DHSA 3Q3IA 4B9EA 4OJMX 3QWAA 2GWHA 2R02A 1DWOA 5B55A 1I1NA 3QVLA 1KVUA 2XXAA 3P9NA 4XW2A 1FFYA 2GESA 4BXOB 1NC3A 2UZAA 3C5VA 3FPCA 1B76A 4TN5A 3L8MA 2SNIE 4JJ8A 2BC9A 3RWBA 4M37A 2GSWA 3QMVA 4Q4AB 2BKEA 3W9SA 1N4AA 4A6PA 5ADVA 1YZ3A 3GDOA 4JP1A 4BZXA 1X7GA 3TE6A 3CZ6A 2C5FA 2DI3A 3B8EA 4Q01A 1C0PA 1PJLA 1CF9A 5JYCA 1NXVA 3ZDFA 2J9UA 2CGEA 2HWYA 3TZBA 4ALJA 3WBJA 1R1DA 1CYDA 1Z08A 4UMVA 5FCDA 3WV5A 4CT0A 4MI3A 4UBKA 3JQAB 3E5RA 5JVDF 3UJ6A 2QS9A 2IKQA 4EDFA 4Y2GA 1SXHA 2GZSA 3FNIA 3IAM6 1NL3A 4EFDA 1TTPB 3DZCA 2RSLA 1YZVA 2IEGA 4BKRA 4DSNA 1M0WA 1W29A 1ZN9A 2EP5A 2QROA 4JCHA 4M2LA 1NY6A 1PFUA 4JJEA 2R6R1 3WIBA 4US0R 3FLAA 2QJTA 2PYDA 5C0OE 1MAHA 1H4SA 4N48A 4WJ0A 3DOIA 3HB4X 2GPNA 2OUIA 3O4GA 5SYNA 1X0XA 4FDTA 4OBEA 1JPVA 3GD5A 3TMAA 5K0CA 1LX6A 3S4YA 4KCGA 2Q1UA 1WCXA 2F8MA 2FPWA 2WHPB 4RABA 9ABPA 5DT9A 4QG7A 1I0ZA 4FGWA 3DVSX 2GB4A 3ANXA 3CZCA 3MUEA 1N77A 2JK1A 1KP2A 4FGKA 1P80A 5AW0A 5HJ5A 1N6KA 1YBVA 1WWKA 2QG6A 2WMDA 3KK0A 1YACA 4ODIA 4OO3A 4F21A 1ZH8A 3GLIA 5KYXB 1XCJA 2L6FA 2XLHA 1U9ZA 1MZVA 2IW1A 3PQCA 3RTBA 5BR7A 2AVDA 3C3DA 4IINA 3AR8A 3P94A 1X38A 3THOA 4YAGA 4DLKA 3QEKA 2MHCA 3O75A 4PG4A 3T7JA 2WKWA 4DLLA 4RGQA 1FMWA 3ZNNA 4RA6A 2FG5A 2FOLA 2UZ3A 3BRWA 4K28A 4XIGS 2P6PA 4O3FA 2I7CA 2C0CA 3MPOA 4FU0A 1AO0A 1BXGA 2IXDA 4O2BF 2A14A 4EG1A 2DLDA 3PT5A 1RHKA 3TQIA 2V7QA 1WOMA 5ITZA 4PPYA 4O4HA 2Y3BA 1E86A 3KG2A 3W7AA 2DX7A 2IYAA 4O2BB 3HHEA 1T3GA 3FPAA 3CF2A 1TQ6A 1N6NA 1QH1A 2B4TO 3KVOA 1C4WA 3MD0A 1V4AA 1T5BA 4C7JA 4YN0B 1E6KA 1USVA 2ZB4A 4R2JA 3ZI7A 5FPSA 2FWPA 3N70A 3CINA 4AFNA 3KQUA 1FUKA 5FBHA 2QZZA 3I8XA 2I7VA 4INPA 3ZQKA 2X19A 1BW9B 3MW8A 3I09A 5B30A 1JDSA 1QHFA 2OSVA 2ZATA 3HRIA 3LCJA 1Z34A 2P3QA 1PR6A 4K6HA 4NRDA 3OTIA 4XCXA 1WETA 2GUWA 2UUHA 3JQ7A 5AKHA 4LXHA 3J80A 4R54A 3KWMA 1UIMA 3FAJA 3DZJA 3RYIA 5DNUA 3N5CA 3NMKA 2HYDA 5KNCH 1OW3B 4N6GA 3H99A 1CPQA 1ZGZA 2OG1A 5HK8A 1G8KA 1HRDA 3DC2A 3GXBA 4JU8A 2JRCA 4NPAA 1E7QA 4P4SB 4TMZA 5FTLA 3S5JA 4ZHQA 2R7XA 1DG3A