3KL4A

Recognition of a signal peptide by the signal recognition particle
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
431
structure length
412
Chain Sequence
GLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a signal peptide by the signal recognition particle.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Signal recognition 54 kDa protein
total genus 116
structure length 412
sequence length 431
ec nomenclature ec 3.6.5.4: Signal-recognition-particle GTPase.
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 3kl4A03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kl4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kl4A02
2IXFA 4HLQB 4F93B 3R9IA 1ZBDA 1M74A 4PZZA 3KKNA 1JJ7A 4PO9A 5KNCA 4C0JA 3Q9LA 5DN6D 3T34A 3L8YA 1TQ6A 3CRMA 2GZDA 1G6HA 2D3WA 4MGIR 1DADA 1AGPA 1S8FA 2V7QA 3EZ6A 1RPZA 1Z07A 2MMGA 4GP6A 3RLFA 4I1VA 4PZYA 4Z54A 5FUYA 3P1JA 2FA9A 3BH6A 5E7IA 2O8FA 2FMXA 1DAHA 2R6FA 4LUCA 2D7DA 3S1AB 3CF2A 1E96A 4X8OA 3KDSE 4TYYA 4GP7A 4O0MA 1BKDR 1COWD 1P2SA 1DAFA 5GAHi 2WWFA 4ESVA 2C8VA 2I1VB 1S9DA 3KKMA 1JQJC 1P3JA 3C41J 4PC6A 3W8NA 2FSIA 2IYLD 4HB4A 2JLYA 1Z6AA 5KUTA 4I1SA 1OH5A 1GTVA 3DHWC 3CBQA 5FOSA 2Z6VA 2ZRPA 5KSPA 1W7AA 3KJEA 3E2IA 1KI2A 2IL1A 3BGWA 4B44A 5BN3A 1XJQA 4LBZA 4EPVA 2ZJYA 3TKLA 1WBDA 2FV8A 4H1UA 1G7CA 1OF1A 1KMHB 1FFHA 3MLEA 5G40A 1XCPA 4CEHA 4Q7LA 3L0OA 4TLEA 4TMVA 5DI3A 5LDDC 1G3IA 1X8JA 2GJSA 4HAVA 1ZM9A 5FL3A 4A9AA 1P2VA 5L3VA 2PXKA 3Q5DA 4D2IA 2MMCA 4M9SA 3W90A 3ZS9A 1LB1B 2H18A 4QOSA 1LFDB 1LF5A 3PXGA 4WOPA 4DLWA 3GJ4A 1JXOA 1CR0A 2BIFA 4NBSA 1CJMA 1BOFA 4DIDA 3CX8A 2V9PA 4FIDA 2J87A 3AF4A 5IT5A 3K0SA 2WJGA 4DDUA 4XVUA 4PC1A 2IBMA 2IHBA 4AIIA 2ZJAA 2ZJ5A 2QMOA 3J81k 1G6OA 4PPQA 1P2TA 3GLHA 2JDID 1IY2A 4JBYA 5K8LA 3FKQA 3EASA 2XZOA 2W6JD 2I4IA 1P2UA 3K70C 5D3MA 3PUZA 2FEMA 5L3QA 2BBOA 2EVWX 2WWYA 2J5XA 4HAYA 4CZ2A 1N0WA 4B47A 3OAAD 3QVVA 2E87A 3G0HA 2O52A 1FOEB 2HLDD 3AV0B 2BVNA 1RVDA 4B2LA 2RGNC 4LV5B 3EIHA 2J0VA 2PLFA 3EIEA 2A7QA 4CRWB 4C0SA 3C5HA 5GJWC 3TH5A 2QSYA 4A1FA 1UPTA 2A2ZA 2ZRHA 4OHWA 2JJ8A 4A0FA 3ZDQA 1G3UA 1XTSA 3ND9A 1KY2A 4B3DA 1SVKA 2AK2A 4OQFA 4PPGA 1LNZA 2JJ1A 2P3SA 4Q4AA 4URUR 2H5EA 2JDIA 2PH1A 4F91B 3LY5A 1MABA 2OAP1 4TLBA 4TWZA 3ICEA 1ZU4A 2ZR9A 4PSAA 4OI0A 1JR3E 4CEIB 5F98A 2QT1A 2ZU6A 1E1RD 2RKOA 4RKFA 3M6AA 4HYYA 2A9KA 4X8MA 1EWRA 2ZYUX 4U00A 3U61B 3MWLA 4WBSA 1E2QA 5IK2D 3ZJYA 3S1AA 4ZDWA 3Q7QA 4Q19A 2BV3A 3QPUA 2V6IA 2YINC 3A1UA 3U60B 4JVNA 3HPQA 5F3WB 1Z6TA 3E70C 2ZR7A 4ZV4A 1HTWA 2OHFA 2XSZD 5CJ2A 4UNQA 1WMSA 3I61A 1MO4A 4CEIA 4NH0A 3BAFA 5CYPA 4RCYA 3FMIA 2JLZA 2HV8A 5EUQB 4KCGA 4C7OA 1T3LA 2ZRLA 3CH5A 4LJ4A 4QL3A 1FMJA 3TVDA 3CLVA 5DO9A 2IYZA 4DHEA 1P9RA 3LW8A 4OKSA 1FQKA 3ZZUA 5K8TA 2QPAA 2QMEA 3Q5EA 5AUQA 5L3RA 2J46A 3PEVA 4TSFD 5FPHA 2D74A 3X1WA 2H8KA 2FNAA 4BFXA 1XFAA 1UDXA 2CMKA 5HZHA 1Z5ZA 2ZIAA 2QQ0A 2XZLA 5AWFC 2G1KA 5J40A 1MOZA 2KJQA 2WWIA 3WRYC 5JLJA 4XIGS 5EP4A 1IN7A 1G7RA 2IF0A 3R8FA 4CVNA 1E1RA 1VCNA 3OEEA 2FFAA 2FSHA 1J70A 2AX4A 4C0HA 1NKSA 4ILEA 3VR2A 1NIJA 3UMFA 1N6PA 4UNRA 3B1XA 3MG9A 3QKSA 2ERYA 2IS6A 1N6LA 4JL5A 1TUIA 4FMDF 4YONB 1NY6A 4Q03A 1EFTA 1US8A 4M9ZA 4YLGA 4ERNA 2GCPA 3SI7A 1GG2A 4HDCA 4QBHA 1YJ5A 4YXWD 3F5FA 1OH6A 5LB4A 2F3TA 4L9WA 4EFLA 4KYUA 4QFMA 1Q3HA 1OKKA 3AGPA 1T5LA 1W47A 1JR3A 3PJRA 3QOFA 5K8IA 1SZPA 4JS0A 1L7VC 1KKMA 3L0IB 4V02A 1K6MA 5J4HA 2OCYC 3OEED 3REFA 2PZFA 1FNNA 2C9CA 2AWNA 1OIWA 3BC1A 3FPAA 3B1ZA 4M9XA 4PSKA 3T5DA 4IXNA 3WXMA 2XEXA 1QG2A 2DB3A 4CEHB 2PL3A 1AS2A 3T15A 2G0TA 1C4OA 3O47A 2WKPA 1W2GA 1M6NA 4XD7A 3LFUA 3BS4A 3D8BA 4TYPA 2YZ2A 2GXQA 2RAPA 2YOHA 4PFSA 3D31A 5FI0B 4B32A 3F3YA 2J1LA 2VP9A 3RRZA 2ZSBA 4YMSA 4KAXA 1MH1A 121PA 2JA1A 1E2HA 1KGDA 1US8B 4US1R 4BFUA 3THOA 2AKYA 1ZU5A 4RKEA 1SVLA 3MGCA 1L2TA 1RFLA 4PHHA 1NVUQ 4EQ6B 4AKIA 1P9WA 1ZIOA 3FDIA 4JLPA 3TR0A 2O0HA 1P5ZB 1TU3A 4YXWA 2BMJA 2ZRAA 5FUVA 4RD0A 1W4RA 4ZDIA 2FF7A 3TW4A 4EJSA 3V4RA 3IPYA 3ADKA 4BLSA 5TXGA 2CHQA 2ZRNA 3OEHD 4BLOA 3NC0C 3CZPA 4CDGA 2B8WA 1JR3D 3TUIC 2PX3A 5FTMA 4BLQA 2YWHA 4HB3A 4YMTA 1S3SA 2GK6A 3DOEA 2FSFA 2ECKA 3VR3A 2MSCB 3MRSA 3SFVA 2XNSA 4QXAA 1TMKA 2GNOA 3I4LA 5CM8B 4JJZA 2P6UA 2F7SA 4G5SA 4KFRA 3SBDA 4AYXA 2GJKA 1PLJA 4EUNA 4OJQA 2KBFA 2DWPA 2BC9A 1E9SA 5DHFA 3SS8A 3QVUA 3EW9A 3BH7A 3K0CC 4MQBA 3UXMA 5BN5A 1E2KA 2GWHA 1E94E 1JECA 4ARZA 3DKVA 3ASZA 4IOKA 4M1SA 3DEFA 3W3AA 4BFTA 1P62B 1IY1A 3EPKA 4B3CA 2ZJZA 3LDAA 3EG5A 4IKEA 4UXIA 5JCZA 3ADBA 1E2GA 1WXQA 3NXSA 3CWZA 1JBKA 4D6PA 3CPJB 1MRSA 2IWHA 1AK2A 4A2QA 3CIOA 4OK3A 4DXAA 221PA 3EC1A 3GJ3A 3V00A 2ZITA 2FE4A 3ZIAD 2WWGA 2GJ9A 3AP2A 3PV0A 3I5XA 3A6PC 1U0LA 1DPFA 2W58A 3PENA 4Q7MB 4DUGA 4G3XA 1ANKA 3NVAA 4BZPA 1E9AA 4CYMA 4JMPA 3NG1A 3AKDA 1GVNB 4S2EA 1HUQA 1F2TA 1GNPA 1NJGA 3CNLA 5JEDA 3GLIB 4QM6A 1G8GA 4DJTA 4ZDJA 1XCMA 1NBMA 3LAWA 1E9FA 2AHOA 4FWIB 4LJAA 3U3JA 4PZLA 2ODBA 5CLQA 2KSQA 5JI2E 2QPOA 3NWJA 2RH5A 4KU4A 3ZD7A 4D80A 4LX0A 2CVFA 3QBTA 3B1WA 5H8WA 4LJ6A 2JCSA 1MKYA 4C3ZA 2ZI7A 1ZVQA 4LPKA 1RYHA 4EIWA 4HI0E 1II9A 1MRNA 4B73A 1J2JA 3ZIAA 3ADCA 1N6OA 1NI3A 1ZD8A 1UBEA 4KLNA 4BZXA 4PO1A 1CEEA 3TLXA 3QE0A 4KLZA 3H0KA 3HPRA 1Z83A 1XD9A 4EQ6A 2XNDA 4A6XA 4LJ7A 4W5JA 2Q9BA 3F8TA 3LQXA 4D0GA 2JATA 2ZS9A 1J99A 2HXSA 1KI6A 4GMDA 4DLUA 3BH0A 2RGEA 4R7ZA 4YMWA 4OK6A 3AF0A 5B64A 2WOJA 3K9LA 1VG0B 3K0FA 4BPBA 2QZ4A 4B3BA 4CIDA 3WY9A 1VPLA 4TMXA 5UKDA 4A2PA 4Z1MD 1SXJD 1TX4B 4MKFA 1D2NA 2HF8A 4W9MC 4JLJA 1JEDA 4TTQA 4NPHA 4DUGD 2X77A 4HEJA 3L82B 1Z6XA 5CB6A 5JRZA 3A37A 2WJHA 3DVLA 4Q01A 4P0TA 3RSOA 5EP1A 5TARA 5JJIA 1DAKA 2HF9A 4DVGA 2F6RA 1P72A 2QT0A 2B6HA 2JLRA 4L4UA 3CNNA 1N0VC 2CLDX 4Y0VA 4AKGA 5C2JB 4DDVA 1NRJB 3E5HA 3AGQA 4QRHA 3A1TA 5LPNA 2YYZA 1BMFA 1HQYE 4Z8XA 1VTKA 1K5GA 1ZM4A 4AYTA 4RSGA 1E2PA 2O8BB 1E9BA 1JNYA 3BB1A 5KNBA 5JHGB 4GOXA 3ADDA 2XXAA 3GJ7A 2IW3A 2BOVA 4PHFA 1TEXA 2O8CA 4B76A 4PC2A 1V43A 4D4LA 1JAHA 5SZKB 1KO5A 2QPTA 3W6OA 2ODNA 2ZTSA 4NCNA 4OHYA 2ATVA 4B48A 2B92A 4FCVA 2JJ2A 2JEOA 5AUOB 1JALA 2V55B 5AJXA 1DAIA 2KWIA 1YZNA 2B7BA 3IEUA 5CYOA 2W2VA 4Q02A 3KQHA 2P0EA 1N6NA 1P75A 3OIYA 4TN1A 1EESA 4D25A 1OE0A 3MJHA 3HR7A 3NDPA 5KO2A 3LW7A 1OPXA 1YZTA 5FOVA 1FUKA 3EXAA 4D4MA 2QRNA 2WOOA 2VSOA 2YOFA 4S35A 4HLCA 5HZKA 2DBYA 4D4JA 4Y0AA 4F7WA 2ORWA 1XJCA 3I3SR 1P6XA 1ONBA 2AD1A 3GJXC 3LNCA 3OE7A 4ZIRA 1VCIA 2P6NA 1GFIA 2ZI4A 1W44A 3CWQA 3ASYA 4WIAA 2GJAA 3MWYW 3AVWA 3UMRA 1S96A 4V0MA 4NMMA 3R9XA 1L8QA 1XB2A 2OFOA 4XWAA 1DOAA 2H92A 4FD2A 1VCOA 2C98A 1XXHE 4YQFA 3EPLA 5TVKA 3VFDA 4CW7A 3AVYA 2VIIA 1E9DA 3TBKA 4IHQA 2XTZA 1JR6A 1VHTA 3T1OA 4GMXA 4LYFA 2QNRA 2G88A 4Q9IA 1O87A 2D2EA 4OQMA 3IQXA 2G77B 1GP2A 1G8FA 2A5DA 3RANA 2J9RA 1N6HA 2IYVA 3PR1A 3RC8A 2ODEA 1E2IA 2WICA 3GLGB 4JZKA 5FH9A 4ARZB 3W34A 5IK2A 2Z5FA 2YJTD 4AWXA 1AZTA 1T0HB 2RMKA 5GJBA 3A36A 4TL7A 3AUYA 5M04A 1N2CE 1IN4A 2REXB 1W46A 3U6KA 5CIQA 1E2LA 3CKLA 2NOAA 4PANA 3W9YA 3FB4A 1HT2E 3P27A 2WJVA 1KK0A 1TNDA 4ZO4A 4LJ5A 1G8HA 4RVCA 3AVQA 3QXHA 1U8AA 3VQTA 3WBJA 1RRCA 1NNEA 3THYA 1QF9A 4KO8A 4IDHA 4JVLA 3GLIE 3QSYA 3FMOB 2OBMA 2ZE8A 1E2FA 3NH6A 2FGJA 4OI4A 2YC4C 1T91A 3K09A 1XJ0A 4AURA 2NZ8A 1M34E 1QHGA 2GHIA 1X8LA 4I4LA 3SFZA 3O8BA 8OHMA 3K70B 3REGA 4DEXA 4PC3A 1XTIA 1CJUC 1T0JB 3AKEA 3B1VA 4U5XA 2HCBA 1XRJA 1MO5A 4KI0A 4BLPA 1TUEA 2BCJQ 1A2BA 2QBYB 1G19A 4OHZA 2OAQ1 4B35A 1Z2AA 1A5TA 5DH9A 5GJCA 2FEOA 3A1WA 4MKHA 3GLHB 2C96A 1UEIA 1NG9A 1W49A 2WMNB 1Z06A 1E79D 2CVHA 5J4YA 1D9ZA 1J8YF 1NJFA 1XPUA 3LD9A 4PPNA 5JFGA 2ZRIA 1PLLA 2GF0A 1CXZA 2FPKA 3KKQA 4I1OA 2BBSA 1VG9B 2NQ2C 4JLVA 3NBYC 3AUXA 4C30A 4HAXA 2XTMA 1F48A 1N6KA 3WMGA 4L16A 4QGGA 2ZM5A 2GBLC 2A3RA 4MRRA 3O8DA 2O8BA 3AP1A 4JJKA 2ZU0C 2R62A 3KL4A 4URXR 1CBUA 1XMSA 2FPMA 2N42A 1UEJA 5EXPA 1G1MA 1XTRA 2XZPA 4IDPA 3DM5A 1VDZA 4EAQA 4CT5A 3D6TB 2IUTA 1N25A 4DSOA 3CPEA 1OXXK 3VAAA 5C18A 1Q20A 4Q1DA 1RZ3A 4W5HA 3ZVMA 1CJTC 4UNNA 1TL7C 2VHJA 3KB1A 1RJ9B 5E7MA 4ON9A 4IEEA 1EWQA 2CLCX 2V1XA 5BYKA 4AI6A 4FWTA 1Q22A 1OKKD 4BFYA 4IRUB 5G53C 3NC1C 2ZYTX 5JCPA 1SQ5A 4I81A 2GZAA 2G0NA 1NP6A 2GCOA 2XJ9A 1ZD1A 4JIMA 4TT3A 2GILA 4BFZA 4E22A 1BIFA 3ZS8A 4JKIA 1H8HD 4V0LA 4B2PA 1XX6A 2C9OA 1R5OA 2CDNA 2R6AA 4G5OA 1ETUA 3L8ZA 2J7KA 2X19A 2QBYA 3GPLA 4A36A 1KJYA 1XEXB 4DLRA 1SULA 2W6IA 3EA0A 1U81A 3RHFA 3OFND 3TRFA 2FG5A 1QVRA 1XPRA 2VHCA 1R5NA 3B9PA 5JECA 3VU9A 5EE0A 3X1YA 4MKGA 4BFSA 2YWGA 1RE0A 4IW3B 1KDPA 2CXXA 3GEHA 4IOLA 4MYHA 4PXAA 1II0A 3U3KA 1YRAA 4M9QA 3V9PA 4IDQA 2OG2A 2A5JA 3BK7A 3GJ8A 4QJ5A 2ZRMA 2JIZD 1NMYA 3CX7A 2YKGA 4ZKDA 1RRGA 1S4QA 1KMHA 3T1QA 3U5ZB 2GXUA 1CS4C 1XCGB 2PLRA 1Z08A 2JLXA 5EXXA 2IF2A 4EJSC 3VTKA 2BBTA 1E69A 2FPLA 1EGAA 3TUZC 4HSEA 5KSZA 4IOJA 4KITB 4DCTA 2NZJA 2W6ID 2WWHA 4TYWA 3L43A 2AXPA 2V8OA 2ZJOA 2NPIA 3GEEA 5CJPA 1MO3A 5LD2C 1DVRA 1I4LD 4Q9KA 4DB2A 3X1DA 3LVRE 4UNPA 2PX0A 3UIEA 4NDZA 3C4JA 3T12A 1UF9A 1T4GA 4HDOB 3OHMA 1W5SA 2VQSA 3RWOA 2F1IA 4PAMA 5EXSA 4E03A 1OH8A 2L0XA 5JEEA 4WZ6A 2JIZA 2FOLA 1X86B 3JVUA 1LW7A 4QHTA 2IX3A 1YZLA 1QHYA 2FZLA 4V0OA 3U2QA 2Q9AA 1G291 2C9YA 4URYR 2PXTA 5E95A 3LO5A 1OFUX 2JGNA 1JB1A 4QGFA 4Q4AB 1W36D 1ESNA 4G5RA 3LBIA 3PCRB 1ZC3A 1ELOA 1UAAA 1N5KA 3AF3A 1A4RA 3QXXA 1Q1BA 1TF7A 1X1SA 4LBVA 3Q8XB 4P4SB 4OQLA 1U8ZA 1ZNYA 1ZUIA 3T06B 3ND8A 1PLKA 2F55A 3I32A 3PUVA 4G5GA 1BH2A 1W48A 2ZEJA 2AXNA 2HUPA 1Z63A 2HJGA 4JT4A 4NZYA 1WE2A 2G83A 1XEXA 4RZ2A 1WB9A 1YVDA 4TL9A 5BQ5A 1AN0A 4EPTA 3B78A 1CR4A 1JJVA 2QY9A 3OF5A 4PAOA 4GBMA 1CRQA 3FMPB 2D7CA 5JSZB 1HQCA 3SQWA 5B57C 4JLNA 4UJ5A 4C2TA 3SHFA 1AIPA 1XEWY 2AR7A 2J41A 2WKRA 4K8OA 3FKSD 4Q1BA 4X8LA 4DEYA 1NBMD 2I3BA 4DLVA 2FU5C 1WP9A 4ZCLA 3T1VA 1UKZA 5AUPB 3FWYA 1NVWQ 1LVGA 2VPPA 2ONJA 3IQWA 4WZAE 1T3HA 4QHSA 4E07A 3AM1A 3GD7A 3MUFA 1OFTA 1HH4A 3LX8A 4YDHB 2D4HA 1OB5A 1Q21A 4P33A 5AJZA 2CE2X 2NO0A 2VP6A 4LOAA 1Q0UA 1R2QA 2OEPA 4Z51A 3D3QA 2AKAB 4QGAA 4R9UC 3DPUA 5JJKA 1ZYUA 3TK1A 5KTYA 3U4QA 2GBLA 5GADl 5DLQC 5KNDA 4DCNA 4D81A 4DC9A 2H16A 1G7SA 3FKSA 4P3YA 4IEIA 1CKEA 1SVMA 3GJ5A 5IRCD 2HYDA 3X1ZA 1KI8A 3GEIA 3Q7PA 4M1TA 3UK6A 3HP1A 3HDTA 3ZVNA 4XVRA 1IOZA 3DZDA 2JJ2D 1Z0KA 4Q7JB 1VYUA 1BS1A 2G1JA 3L0PA 2VTKA 1TF5A 5JBQA 2WTUA 5IHPA 1F5NA 4MRPA 2XJ4A 4EPXA 3VR6A 1T5IA 2FJUA 2OILA 4M53A 2IEYA 2VRWA 4Q4JB 1XWIA 3P20A 2QL6A 1DS6A 4RD2A 4OYHA 1FL9A 1DBSA 1HE8B 4V0KA 5A0FA 1PV4A 1NG1A 3V4FA 1IXZA 1SVOA 5BW8A 1FX0A 1SVWA 3RRMA 1ZNWA 2QTVB 2CHGA 1Z6YA 1XTJA 1KSHA 3CR8A 3GJ0A 4QNRA 4TT3D 2GAOA 3T35A 3RAPR 3QY0A 2XITA 3QF4B 1OXUA 5DI9A 4XH9B 4BUJA 3THXA 4Q1EA 4TLDA 3IPXA 4LBYA 3KQKA 2CEAA 4LYAA 1UBCA 2NIPA 3C7KA 4LZZA 1D5CA 1QHIA 1P9NA 1QHHB 3OZXA 4DT1B 1I2DA 2DY1A 1KMQA 1G3QA 1VKJA 1Z3IX 1G5TA 3SQXA 1COWA 2X2EA 2P6RA 1IXSB 1QB2A 3A4NA 4PAQA 3UWOA 3ZZTA 821PA 4JLBA 1E2DA 4JLOA 3ZYCA 2YV5A 3EAQA 3EZFA 3BRWD 4XTCS 4BECA 2VF8A 3K0CA 2ASEA 5G3ZA 3MWJA 5DE3A 4B6EA 3SN6A 3MFYA 3OESA 4C2UA 3U7EB 3W5IA 4HDQB 2V7QD 4LJ9A 1DO0A 5TDHA 1FTSA 2ZUBA 1ZD9A 1IHUA 4M0LA 4O2RA 4TQAA 4BLTA 5GVRA 2RHMA 2QE7D 4B71A 2LWIA 5JS7A 2EU8A 2HXYA 4BE7B 3B9QA 1GM5A 1GZSA 4KJZA 4M1OA 5FPSA 1U9IC 3UANA 1KK2A 1R7RA 1Z0DA 3B60A 3ZZ0A 4C0QC 4AG5A 2K5UA 1ZNZA 1G18A 1Z0AA 1OSNA 2FWRA 3H4MA 3F0TA 4LRWA 5KYKA 3FHTA 3UKDA 2BMDA 4HLUC 5FTKA 2XB2A 4HLUA 4NCKA 4NONA 4OHXA 3VMFA 2RB4A 2WIAA 2CK3D 4M21A 4Q47A 5HCNA 3HYTA 4GL2A 4NHOA 4OQNA 2OXRA 2D06A 2ZJ8A 2P5SA 1KSJA 2W2TA 3SOPA 4FINA 1E0KA 3GMTA 4G0NA 5CK5A 2PXQA 3CONA 1ZINA 1CTQA 1L4YA 3BERA 1PUJA 1CJVC 3C16C 5EXTA 1AQYA 1GL9B 4XSGA 1A2KC 3PEYA 2FZ4A 4EJSB 4ZI3A 1KDTA 2WMOB 2ZSEA 5AJWA 2ZRJA 5LB2A 2P5TB 3BIFA 3RRNA 4B2IA 3T5GA 2LKCA 1E1QD 2OUKA 1W4BA 4DLSA 1LS6A 2Y8EA 5FOTA 2EQBA 1N5LA 3RC3A 1EFHA 2WSMA 1NN3A 3VHLB 3A8TA 3JVVA 4GOJA 1SVIA 1G4UR 3TIFA 5KSOA 2ERXA 4BLRA 2Q6TA 2GCOB 5FBRB 3GLGE 4NTZA 3KTAA 5EUMA 1DAMA 2FGKA 1XD2A 2W6JA 5FL7D 5J4KA 1AS3A 4L8GA 3C14C 1MR3F 2NO9A 5FOUA 4DIEA 3O8CA 1YKSA 4D26A 3TVTA 3CUEF 3K70D 1F2UB 4EDHA 4TTPA 3QKRB 1KNQA 4BRWA 1TF2A 4LC1A 5J4LA 2ZANA 2NO6A 3VX3A 1UJ2A 1EFCA 1GILA 4KHZA 5KPDA 3LQQA 2OLJA 2VHUA 1IXRC 1G3MA 1OT3A 2XB4A 4FXPA 2IT1A 2UZIR 3DZ8A 2EYUA 2W83A 1KYIA 4MGKR 4Q1FA 3CO5A 1KJWA 4DSTA 3AVXA 1BMFD 5CDFE 2QM8A 4DCSA 4JSYA 1TTTA 2BMEA 1YU9A 3JZAA 4G01B 4ZCMA 1B23P 4DWJA 1W4CA 3UG7A 4PSVA 4RFSA 1G9XA 1G7TA 5EP2A 4ACBA 4XSHA 4QG7A 2BMFA 1XXHA 2Q21A 2H1LA 1KAGA 2ZI5A 3JZMA 4F4CA 1YE8A 2ZI9A 3HU3A 4RCZA 4TL8A 1I2MA 1IM2A 4X8HA 4LYHA 1NMZA 2ANCA 2PT7A 2Z0MA 3RS3A 4TSFA 2ZQ5A 3T61A 1KI7A 4G5QA 2IYUA 3LBHA 4BRUA 1P60A 1FTNA 5AR1A 4P4UA 4PHTA 3QUSA 5E4FA 3RS7A 1UDWA 1G8YA 2XOKA 4MDEA 1AQUA 1MO6A 2QN6A 3VNUA 1OFHA 1FUUA 3BB4A 1VMAA 1H65A 2DFKB 2ZAOA 4XWKA 3NDBB 2CL6X 4AKEA 4IDOA 4PPFA 1NVXQ 5HKKD 4RY2A 2JLVA 3WNBA 2C2HA 1B0UA 2O8EA 4IVPA 3AVTA 1A7JA 5KDDA 1WRBA 3AKCA 3M0EA 4GSYA 2YVUA 3AF2A 2JLWA 1QBKC 2ZAMA 3FMFA 3HR8A 4C7OB 3LX5A 4LYJA 2IUUA 4EPWA 2RGDA 3WYGA 4Q4HB 1RYFA 1LTQA 1SXJE 2NO7A 4A0RA 2ZETA 1ZNXA 2FSGA 4Q9HA 3ZGXA 1W1WA 1Y63A 1FX0B 1JAIA 3SR0A 3B85A 5HE8A 1E9RA 3N5CA 3RS5A 2UVQA 5GVSA 1NN0A 2NO1A 1W36C 2NMVA 3PEWA 4OK5A 2ZVQX 1E0AA 1ODFA 5IDVA 5A5GA 2WBLC 1MV5A 1AJEA 1C9KA 1G5RA 2JQEA 3NIBA 3A1VA 2J0SA 1E4VA 1E9CA 1Q3TA 4M4SA 3X2SA 1R0ZA 2H17A 4H9GA 2C99A 3WMFA 3FGNA 4BEJA 3X1XA 1T6NA 4MRNA 1ZCBA 3P32A 1E2NA 3WNDA 1QZXA 3K09C 4LC0A 4XJXA 3SE0A 4BASA 5FUWA 1OB2A 2WAYA 3P4YA 4M1MA 3TAUA 5HPYB 1GUAA 1ZRHA 3GCGA 1HQ1A 1T3SA 2OESA 3BORA 4B34A 1J8MF 1UM8A 2QTHA 1WCV1 4KVGA 5KU1A 4B6FA 3H1TA 4QM7A 3DMDA 4Q5IA 4HB0A 5DHAA 1KO1A 2J7PA 1U9IA 1V5WA 1A1VA 5DYIA 2IK8A 1N3BA 3G82C 2OM2A 3HJNA 4DT1A 4IVQA 5A4JA 4IVRA 4KV9A 4Q9JA 4HZUA 3UPUA 1GAJA 1HEIA 3N2IA 4ZIRB 1XZQA 4B3GA 5BWMA 3VU9B 1NSTA 3QG5A 3ECCA 4IOMA 1Y3AA 2WSSD 3R7WA 2BEKA 3PFIA 4UNSA 1XD2B 4D0NA 3M1IA 4Q18A 3ZVLA 3AH8A 1KJZA 3IKJA 3LLUA 1GKUB 1BYUA 2IS4A 4DRZA 1N5JA 2D2FA 3KB2A 4KBFA 4Q9LA 4XVQA 3KJGA 2EW1A 3AB3A 1T8UA 4HAZA 1KNXA 3A4LA 2PXDA 2G6BA 4FW9A 2AD5A 3DOFA 1E2EA 4HLDA 1T8TA 3KJIA 1WA5A 4P31A 4B75A 2O8DA 2W00A 2RGGA 2ZUCA 1NF3A 2WIBA 3GQBA 2W0MA 2WVJA 4WW0A 4TZ6A 3BFXA 1FZQA 1GDDA 4E09A 2ATXA 1TU4A 2G3YA 4J0QA 3WBKA 1U8YA 5JJLA 4PR0A 3GLFE 3DMNA 2CNWA 4Q7KA 3B6EA 1KK1A 1T9HA 4POAA 3IEVA 3GLFA 1GRNA 2IXEA 2C04A 3NEJA 1SXJB 1M2OB 1SKYB 4QBIA 2PEZA 1ZM2A 1II8A 1M1YE 2Z4SA 2V6JA 1NMXA 2J45A 3PQCA 1KOFA 2KI5A 4XTRA 3Q85A 4JBXA 4P32A 3UATA 3CR7A 1R5BA 4YDSA 4DLYA 1W0KA 2VSXA 3A1SA 1D2MA 4WA7A 2GVZC 1D9XA 1X3SA 4RZ3A 3ZH9B 3FHOA 2J0QA 1M7GA 1WGWA 2YC2C 4A6PA 1R0WA 3EZ2A 3IUYA 2WJJA 4BGDA 2GJ8A 1M7HA 2ZSAA 3OAAA 1XEFA 3SHWA 5H1YA 1PZNA 2YOGA 3U7FB 1JPNA 3VX4A 1R4AA 1NL3A 2QENA 1D2EA 3R20A 5EE5B 5SZHB 4A8JA 2N46A 1QHXA 2QP3A 3EARA 4GPTA 5KDOA 2FDCA 1KTVA 3LVQE 3MJRA 4N3NA 3N70A 4N0EA 4C0LA 2PXVA 4LPSA 4Q21A 2QE7A 3RS0A 1F2TB 4K81B 2PXFA 2EFEB 3NBZC 5HCIA 3SYLA 1OLOA 2IC5A 1X6VA 2R6GA 2VHTA 5K8UA 3MMPA 3SYKA 1G21E 4JKYA 4ITRC 2XOKD 3WNCA 1G20E 1OFIA 1E2JA 1UFQA 4OJKA 2DR3A 1VG1A 3QI2A 2CBZA 1A82A 5GAGi 1LY1A 2P65A 4EPRA 2EFCB 3TE6A 2JLUA 2QGNA 1WBBA 3IIKA 1ZM7A 2CCJA 4GRAA 4KSBA 1DO2A 4KSCA 1E0SA 1KSGA 4BEBA 5CB8A 4CEJB 4MRVA 1Q1QA 4XWOA 2X1VA 3IILA 4FI3C 1XEWX 1D8TA 1Z0IA 2C95A 1RC8A 3L2OB 4DLXA 5J4VA 5C46F 4JLKA 4RD3A 4TMZA 4HATA 1VIYA 1VHLA 4LGMA 4TQ9A 2F43B 4HAWA 2PXPA 3I1FA 1DG3A 3EPJA 2XNDD 1AKYA 1JEEA 4OHVA 4JLMA 5EZ6B 2OO7A 2JLQA 4LWZA 3K53A 4MITA 1VYVA 1R0XA 4RFSB 3TSOA 1RIFA 4LCBA 4MYTA 2OCBA 4QBFA 5JWOA 3OIUA 5CDFA 4DBLC 5J5CA 1CU1A 1OIVA 3NEYA 1FW6A 1II8B 4URVR 1SXJA 3TJZA 1GIAA 1S9HA 2Q3MA 2ZRFA 2QA5A 3OE7D 4B3FX 1X1RA 1MFQC 4QBGB 2CL7X 5FFMA 3SBEA 3QPWA 2CL0X 2ZS8A 3NBXX 1SKYE 2HT6A 4LJYA 4W5WA 4NYIR 5FOWA 2OCPA 1D6JA 3HU2A 3THXB 3VKGA 2IS1A 4IXMA 1UKYA 2B8TA 2G9NA 2DFNA 2REOA 5TV2A 3U3OA 3FFBA 4A8JB 4TYNA 3VNVA 4R2HA 2N1BA 1E32A 1IBRA 4NE2A 1N0UA 2QEQA 2RCNA 5JWHA 6Q21A 3CH4B 2NG1A 1GWNA 1QHNA 3PUWA 3BXZA 1KY3A 2ZS7A 3ZLJA 1G4AE 4EFMA 5CLLA 4JBWA 3PUYA 3BE4A 4LV8B 4Q1AA 2ZE5A 1ZIPA 4OI2A 5E7JA 5JSZA 2OBNA 3U44A 2AK3A 4GZLA 4ABYA 1FNMA 3SU8A 2AL7A 2GCNA 3QKUA 1QRAA 4RD4A 1IAQA 5AUNB 1ZUHA 1LF0A 2ZPTX 1HE1C 2XTNA 3BFVA 3KXLA 1CR1A 2ORVA 5H68A 2OE2A 4RJLA 3FOZA 4Z8YA 3KQUA 2V54A 4UXJA 3BB3A 2A5FA 5DIFA 4NP6A 3WP0A 4AC9A 1AKEA 4BFVA 4ASUD 4B33A 5IF9A 3K9HA 4ZKEA 1KIMA 4IDNA 4BFWA 2OZEA 3U4QB 3BBPA 1AS0A 4R2IA 1W0JA 1ZW6A 1E98A 4FMDB 1YR8A 5SZIA 3PG5A 5DI3B 1YQTA 2P2LA 2C03A 1KDOA 3BOSA 3K9GA 3PVSA 2XGJA 2VP5A 1CLUA 3FTQA 3RABA 1SVSA 3VKWA 3GFPA 4YMVA 3CM0A 4Q00A 3C5CA 5FL7A 3VKHA 4LHYA 3THWA 1OXTA 1CF4A 4U02A 1IN5A 5TB5A 2O8DB 1J7KA 1P73A 3K0FB 2PJZA 1KO8A 2HLDA 3TUJC 4DSNA 2R6CA 4US2R 1Q12A 4GT1A 1J90A 1G3RA 1R6BX 3RS2A 4NCJA 1ZAKA 2GF9A 2F1JA 2GETA 4NKRA 2QG6A 5D3QA 1AZSC 4QGHA 4A2WA 3GLGA 3EPHA 3LV8A 1NLFA 3I5YA 4DB4A 4JL6A 4MUBA 4CT4B 3AEZA 2KB0A 5FR2A 5F9HA 2OT3B 3FE2A 3TMKA 2CCGA 1F60A 3ETLA 1NN1A 2ZJ2A 2ZI3A 2X8AA 1KO4A 3QBVA 4HUQB 4PQFA 1TPZA 3AQ4A 4G1UC 4PHGA 4OI1A 1IN6A 3K0AB 2BM1A 5BYJA 2GA8A 1S2MA 4Q4HA 2REBA 1KI9A 3Q3JB 2VP2A 2DCUA 2LCFA 3KFVA 1GSIA 1QHSA 3OEHA 4F92B 1E2MA 1HURA 3OIVA 4HZIA 3VR1A 2HT1A 1NY5A 4FMCF 1IJFA 1VECA 3GLHE 3DM9B 1UBGA 2IYYA 3RWMB 1OH7A 2QP4A 3GJ6A 3GP8A 5HR5A 4CF7A 2V3CC 1Z28A 3P4XA 2Q9CA 4TLAA 3KKPA 5DN6A 1E9EA 1F3OA 3D7MA 3SJAA 1KI1A 3AKYA 2PXLA 1P61B 2VA8A 5AK0A 1HV8A 2R65A 3VR5A 1P7CA 1IY0A 4YMUA 1OV4A 5KHOC 2VYFA 1JPJA 5ANRB 1S1CA 4AY2A 5C4MA 2BWJA 1GOTA 2Z4RA 2GDJA 4YC7A 5HKKA 1H8HA 2ZRDA 3VHXA 1ZUNB 2VF7A 2WM9B 2DWQA 1IQPA 2GESA 1OHHA 4KODA 1SHZA 2J0UA 1TQ2A 2WZQA 3IIMA 3QENA 4TMWA 3SZRA 4DLZA 3NKVA 3Q72A 1KAOA 4F4IA 4TMKA 3H2YA 2OXCA 2HCJB 2DYKA 1QDEA 3LQRA 2WSSA 4R98A 5B58C 5L3SB 2PXUA 5F2EA 3IIJA 1S3GA 4NL4H 2GEDA 3AVOA 1GITA 3I8XA 2ZYWX 1Z0JA 4UXHA 1KDRA 4W7SA 2XAUA 2EFGA 1Q44A 1GRRA 1OXVA 3KQNA 2PMKA 4L5BA 4XOIA 2GTPA 3M4YA 1VIAA 3IHWA 4FN5A 3CB4A 2ZJBA 2C78A 3I8SA 1M7BA 1XP8A 4F4JA 2FN4A 2CJWA 1YHNA 1FPMA 2WKQA 4K46A 2PBRA 4EPYA 2H57A 3KZ1E 4O2LA 4RD1A 1YR9A 3O8RA 2Z43A 4O3MA 3AVUA 1F2UA 1YZGA 3WRXC 2ZSFA 3ZVRA 4JVMA 4D4KA 2PT5A 3E1SA 4MGYR 521PA 5EE3A 1Q57A 2R44A 1KK3A 2PEYA 3OFNA 4FCTA 1WF3A 5P21A 2B21A 4F38A 5L3QB 1U0JA 4JLAA 3K0EA 4IJMA 1UKVY 4EFNA 1NN5A 1RKBA 1EK0A 2MSDB 3SC3A 3AVPA 1ESMA 2CNWD 2F1HA 1LS1A 1M8PA 2RHDA 3U3MA 5AJYA 1DARA 5FBQB 3EZ7A 1E3MA 2IHYA 1GKIA 4M2LA 4MYUA 4DKXA 5LBIA 4V0NA 1CJKC 2XXAB 1G64A 2AFHE 2EWWA 2CE7A 3DDCA 1FMLA 3PITA 1ZC4A 3QG1A 1RJ9A 1E4YA 1RRFA 3UMSA 3WYFA 421PA 5FBVB 1DAEA 2W2XA 2HDNB 4V03A 5FR1A 1JI0A 4URWR 2CJWB 1RRPA 4I1UA 2LKDA 3LWNA 2RGNA 3BWDD 5FBWB 4ZDKA 1XD8A 4A0HA 5B30A 5FTJA 2RGAA 1E99A 3QEOA 5JRJA 3LLMA 2A78A 1Z6GA 4QHYA 4URZR 1P4SA 5GJVC 2QU8A 4DCUA 4DLTA 1U2RA 2IUSA 4KYIB 4OBEA 3RS4A 1HY3A 4A4DA 2OV2A 1TADA 2PMDA 4NYJQ 3MCAA 4GZMA 5ELXA 1PVOA 1AM4D 3QNUA 3GFTA 4ASUA 2KE5A 3CPHA 3EX7C 3EWAA 5FPYA 5JWRA 2F1RA 1RW4A 2ZRBA 2Z83A 2ZUDA 5DGXA 3B13B 4M8NE 2Q0HA 1KI6B 1Z2CA 2O0KA 1DEKA 2J0UB 1UBFA 2IYRA 1KZ7B 4PO8A 1EX6A 1W0KD 1CP2A 4LHVA 2W0SA 2ZRKA 3QKSB 4LI0A 5KDLA 3TQCA 2QSZA 3KFXA 4LV6A 2WWXA 1ZCAA 4KFTA 1TQ4A 2VP0A 2UZ3A 4CEJA 4A8JC 5EE1A 3I72A 4QNMA 2VHQA 4Q1CA 2V4ZA 3RRYA 3TR5A 3WMEA 3PEUA 3CRQA 4N0DA 2HYIC 4HB2A 2C5LA 4GOKA 3RYTC 3G5UA 4MUAA 5BN4A 4PC7A 3ONWA 2BEJA 1CULC 2QMHA 3QQ5A 5L8VA 5FTNA 4PQYA 2PXBA 1EFRA 2IYTA 1KHTA 4NU0A 2EWVA 4HAUA 3A4MA 3SNHA 3DKPA 4ZI2A 3PIRA 1ZMXA 3MAAC 3W6PA 3WYAA 2JLSA 3SJCA 2YHSA 3W5JA 4B3XA 4ZCIA 5KSYA 3NHBA 3B5JA 1NVVR 2A5YB 2OCAA 4TZ0A 1Z29A 2QAGC 2QROA 1OW3B 3K0AA 5F9FA 2VO1A 2QAGB 4WZBE 3I73A 4TLCA 2C77A 2BM0A 4FCWA 4M1WA 1EG7A 3AVVA 5B2ZA 4MA4A 2CCKA 4TMTA 2IS2A 2CLSA 1UKEA 1G8PA 2F3RA 2ZREA 3PUXA 4GDFA 4LDJA 5EQTA 4JVSB 2WPDA 5TY0A 3AF1A 4I99A 4CGZA 1NVVQ 2QGZA 3NTUA 3CRVA 1C1YA 5BXQC 1R10A 3CX6A 1W36B 1YRBA 4QC2A 1N5IA 3ZQ6A 2JASA 4C0BA 2CHVA 1XBTA 3QXCA 4PQRA 1PUIA 3MWKA 4ACAA 1OIXA 5EE9A 1G5PA 1HYQA 3THWB 2BHRA 5EZ5A 1K5DA 1I4DD 3MSXA 4L15A 3R8CA 4MGZR 1MT0A 1U90A 4AG6A 4IFBA 4EKDA 1OHHD 2J7PD 3KXIA 1EFRD 1ZJ6A 3KUCA 5FI1B 3ZQJA 5DYGA 3BFKA 1R8QA 5DISB 4JYCA 5JZVA 3VR4A 1YZUA 4M1YA 2ZI6A 4A15A 2VBCA 1EX7A 3RNLA 1XPOA 1DG1G 4KXFB 1U0HC 621PA 5SZJA 1XDBA 3KJHA 3QF4A 3B1YA 2AWOA 2HEIA 2BDTA 4RZXA 5J47A 1QG4A 3DO6A 4RFVA 2RGCA 5HTKA 3FHCB 3RSLA 3LXXA 3QEJA 1NIPA 2AFIE 3K1JA 5CM9C 1E6CA 5D3MB 2WAXA 2NPFA 1FP7A 1E79A 2DHRA 2JAQA 3U7HB 3QIAA 1XMIA 2WPDD 2QM7A 4MRSA 2ODWA 3B82A 2QQEA 1W5TA 5AJVB 5LD2B 4AYWA 4LHXA 4PX9A 2F9MA 4JSTA 1SHKA 1BYIA 4P4TA 5KPJA 2ZVPX 1OJLA 2EYQA 1I4TD 1XXHB 2A30A 2PZGA 5E3HA 1JXMA 4AKHA 1ZM3A 2BJVA 3NH9A 2IYSA 2R6DA 2VLIA 1TQDA 2VL7A 4KBGA 2OBLA 3W8RA 1N6IA 4A0GA 1W0JD 1YR7A 4NYIQ 4MKIA 1Q1EA 1R0YA 3MD0A 3SJZA 1KZGB 4HZUB 3GLIA 1KI3A 1E0JA 2FFQA 4NYJR 5DSZA 1FP6A 1G16A 1NLZA 1ZP6A 2RGBA 3CZQA 5FTLA 1DTSA 1KKLA 3QPVA 2BBWA 1XTQA 4IFEA 2GXAA 4RZUA 3SEAA 3HWSA 2XSZA 4MDFA 2J59A 3N2EA 1OYWA 1SKQA 4RD6A 1YR6A 2QP9X 2VSFA 4BWYA 2DWOA 4WXPA 3A58B 3KQLA 5FUXA 3KTAB 2B7CA 1OXSC 4C0AC 1EXMA 3U7GA 2ZR0A 2OSBA 4LHWA 3IHLA 1GL6A 5FPKA 1GKYA 1PJRA 1OYYA 5G41A 4FMBB 5C4GB 5JHHB 2OLKA 2O8FB 2JJ1D 4A92A 4UKDA 2ZROA 4N1AA 1NLYA 4US0R 4TTRA 3WP1B 4GI7A 1CR2A 2GVDC 3KX2A 2ONKA 2CK3A 3SJBA 2ZE7A 1MABB 2QI9C 3IO5A 2IA5A 3FVQA 3UWKA 3K9NA 3IBGA 2QMUA 2X2FA 1WDTA 3CRRA 3SYNA 4H1VA 1IONA 2WHXA 4U7DA 4WXRA 2O8EB 1AA9A 2BJWA 4O25A 3ICQB 4MYCA 1HT1E 4KVAA 4TYQA 3THYB 4UJ3A 1U98A 2YNMA 4OQXA 3ZD6A 3NHAA 5FOXA 3U6BA 2NTYC 3B7GA 1Z0FA 3B8HA 2O0JA 4C0KA 5TMPA 1QVAA 2BKUA 2WWWA 3DL0A 4LY6A 2GK7A 4QKQA 2I1QA 2ZRCA 4NCIA 1CRPA 4HUQA 3BJIC 3T1TA 1S1MA 5CK4A 1TEVA 4Q4JA 1Z47A 1TAGA 2ZE6A 4FMCB 2IYXA 5G3YA 1E1QA 2YWFA 3TAHA 3TW8B 3C15C 2FX3A 1U94A 2E1RA 3B2EA 4WAUA 3L0SA 4HUTA 1XZPA 5JI3E 2GKSA 2QORA 1IN8A 2QTFA 1N6RA 1DULA 4BQSA 2E9SA 2WJIA 4XD7D 4D82A 3W6NA 2QAJA 3IBYA 1K8RA 2XX3A 3FYHA 1F6BA 3CRW1 3SDZA 3KKOA 5FPTA 2R9VA 1NSFA 3U3RA 4Q66C 2A5GA 3NBFA 3TNFA 3CF6R 4LSGA 1XF9A 3GLFB 4R71A 2WV9A 1AGRA 2FFHA 4V0ME 2J3EA 5JS8A 4M1KA 4GFDA 2EFDB 5EP3A 4UQOA 3WHLA 2OFWA 1U99A 1UADA 1Z22A 2NGRA 3RVBA 1XMVA 1NKTA 3LXRA 4Z1MA 1YZQA 4JL8A 3EWSA 2ZYVX 3QKRA 5KOYA 4AD8A 2ZSDA 4Q4LA 5CIWA 4QJ3A 3EIQA 4WVFA 3K8YA 3H84A 2ORIA 2GEVA 5FBLB 2DPXA 1S0UA 2TMKA 4M22A 1IJEA 1VCMA 1Q1ZA 3BD9A 3AP3A 4OL0A 2UKDA 721PA 3FFAA 4Q48A 4QJ4A 3GFOA 2YWEA 2WJYA 4GNKA 3U44B 2SHKA 4TQUS 2GRJA 1XTKA 1SGWA 1JQLB 4A82A 4DZZA 2PXEA 2O5VA 3KUDA 4KFUA 3QXJA 5C1BA 2VP4A 5EJEA 4L9SA 1GNQA 3QXSA 2PZEA 1KO7A 2PCJA 1KSFX 2O8CB 2QUZA 5JMTA 3I62A 1CIPA 1SXJC 4NCHA 4DDWA 2BKEA 3C8UA 4JLDA 1DAGA 1DELA 4MH0R 3R7WB 2BCGY 4JT2A 3I92A 4D0LB 4P4SA 3CNOA 2D62A 2RGXA 1EFUA 1BO6A 2H7VA 4LJ8A 3EZ9A 1YZKA 5CITA 2IXGA 4II7A 1W4AA 3CW2A 3TSZA 1H8ED 1HA3A 4NYMQ 2PJRA 3R9WA 2MSEB 3OIWA 4JYBA 2DFTA 2DFLA 4E5UA 4B43A 1O3YA 4AK9A 1W2HA 2FH5B 3EA5A 3TSWA 4C9BA 3TGPA 5L3SA 2GZHA 1KI4A 1XU4A 2V1UA 3QF7A 4C4PA 3EC2A 2ZRGA 3KXKA 2Q3FA 4B74A 2IYQA 3WHKA 2VEDA 1XNJA 3QJYA 3IO3A 2PCLA 4TL6A 4NYMR 3UG6A 2F43A 2KBEA 2QRZA 3CF0A 2IYWA 3LBNA 4LHZA 4KFSA 1Z8FA 2GAAA 1X8KA 3HU1A 3QKTA 5DNYB 3IDQA 3RDPA 2R8RA 3HYRA 1R8SA 3LH5A 4DDTA 1G41A 4ESHA 1WQ1R 2IEZA 2Q3HA 2QAGA 3LRPA 2EFHB 3IGFA 3H86A 4LK2A 2IWRA 4DSUA 1GL7A 4LBWA 1DE0A 3P26A 2GEUA 1XMJA 2VH5R 4ZPXA 1G17A 2HJVA 1VYTA 5H70A 3LA6A 4PTLA 2ANBA 4DCVA 1GNRA 1VG8A 2FFBA 2AN9A 2R2AA 2OFXA 1GRQA 2P67A 1L4UA 1QHHA 5HE9A 2ZXUA 1NBME 1FQJA 2GXSA 3W3ZB 1LV7A 4BZQA 1H8EA 3TQFA 2F9LA
chains in the Genus database with same CATH superfamily
4HLQB 4F93B 4F2DA 3HCAA 1M74A 1YVIA 3KKNA 1GTRA 1EAMA 5DN6D 1PD0A 3L8YA 4KIWA 2UU9B 1KVRA 1BDBA 2HIAA 1Q7EA 1P8AA 3RAEC 2XSEA 3FAJA 1DADA 1AGPA 2JGFA 2IVFA 3D2BA 4H18A 4U9UA 1KYWA 1YFJA 4JROA 5AI4A 4K9OA 1Z07A 4FFRA 4YACA 3BJRA 1WDKA 2BONA 2OK8A 3ML1A 4I1VA 4Z54A 3DVAA 3GN2A 4HWPA 4KN9S 4IGAA 1GZDA 1SVUA 2FA9A 2EKPA 1Z4KA 3TLAA 4EVQA 1SKMA 5CFLA 1BKSB 3AONB 4K6HA 3TJ5A 4KMSA 3NUQA 4G9GA 5JZOA 5H7XA 3KJXA 5FD8A 5KTNA 2D7DA 4TYYA 5E0KB 4O0MA 2C3PA 4Q7QA 3WWOA 2Y9MB 1P2SA 1DAFA 3FW1A 5GAHi 3KYIB 2YHIB 2RH8A 3OLYA 2JHGA 1YZHA 5JZ9A 3TGWA 1I2BA 3ZWAA 4NBKA 1JQJC 1P3JA 3C41J 3W8NA 2XZDA 4NX2A 2QRQA 3G4ZA 3AUUA 3ZX4A 1WULS 3DHWC 1LJ8A 5FOSA 4B8WA 1C9MA 2VDLB 4IYRA 1V8DA 2W4MA 4DC0A 1TM4E 1T1SA 1JG6A 4DE5A 4AS1A 4L27A 1WO8A 3TJRA 4O4IF 5ILQA 2C31A 2I4RA 3QJGA 4II3A 2HA2A 3IJEB 4X1IB 1OF1A 1KMHB 1T5DX 3HNOA 5G40A 1XCPA 3V1NA 4Q7LA 3OCXA 4D3YA 4QUEA 2WRZA 4U6QA 5LL6P 3C70A 4G0VA 3CCCA 4UEQA 4BTVA 2V7EA 4YRSA 5FL3A 4A9AA 5D92A 5L3VA 1E64A 2PXKA 2EX0A 2JH8A 3AETB 4QBFA 4U6NA 5EIBD 3ENZA 3PDCA 1ECPA 2UXCB 1U0SY 4YCDA 3EHNA 1L5YA 4HEAJ 1DFGA 1LFDB 4Y2YA 2D1SA 1GVHA 2K2QB 4KQ6A 1FXWF 3OZTA 1T6XA 3DV9A 4K0KB 1IRXA 4U7FA 2AH5A 4XPYA 1JXOA 3TB4A 4CJXA 5BMVA 1SXQA 1VP9A 4NBSA 1CJMA 1ZHYA 1U3FA 4BNLA 4JJGA 2J87A 2NN3C 3D3WA 4K9LA 2WJGA 4DDUA 4LF9B 4JCHA 4PC1A 1KS2A 1NNI1 1ZVMA 1L3IA 1ZW3A 2OU6A 2IHBA 2HRRA 1B26A 4IQ8A 5DWQA 3WB0A 2OBBA 4XPIB 1BHSA 4IIXA 2L18A 3T4RA 3CUUA 1W6UA 3WQQA 1VKOA 2RK3A 2BEWA 3K5PA 3PZBA 3OI7A 5IJZA 2ZJ3A 3GLHA 1IY2A 1VXOA 3UV3A 5K8LA 1PJTA 4MUGA 4XJVA 3EASA 4GGOA 1DKNA 3QWAA 4QNNA 1M6WA 4CIBA 2HM7A 4CF5A 3O4VA 4EAAA 4B81A 2CKDA 5DS6A 2VT7A 3OE4A 2WWYA 5FV7A 1C8KA 1ZZCA 1CIJA 1U8UA 3Q7IA 4EA9A 4EZBA 2XCRB 5KKCA 2HLDD 2RBKA 2XKAA 3PPWA 4O2AF 4Y7DA 2CNNA 4PU3C 1QYWA 4BMNA 4CETA 4OIRF 4PRZA 3MAJA 2J0VA 5KX5A 4Q3OA 4NAUA 3O8LA 4C0SA 5GJWC 5LM3A 3AJAA 5G4LA 1JBEA 1MB9A 2VPIA 3CLTC 3ETNA 3C6XA 3EGIA 1T4CB 4U6SA 3WJ7A 1T0IA 1KY2A 3ZDQA 1SVKA 5KQPA 2WG1A 4OQFA 1K63A 2R8XA 3GBFA 4Q4AA 1GGQA 1TFUA 3X2QC 1T13A 1L5LA 2JDIA 5JFOA 5C1IA 4W4TA 1MABA 2YWXA 5EKDA 2H1FA 4MS3A 1THTA 1V26A 5C32A 6ADHA 4CEIB 1ZS4A 1WUTA 1Y3CE 5F98A 2HNKA 4YXFA 1FYEA 3OIGA 2Q5HA 3FM9A 2VA9A 2YY6A 3W5AA 4HYYA 2P4SA 1MRZA 1Y8CA 4X8MA 3QMVA 4IDGA 1EWRA 2XRHA 1CE8B 4U00A 1D8AA 4PZAA 3ROXA 3MWLA 1HQDA 4R84A 2PJDA 4OHFA 5IJ9B 1E2QA 5KOHB 4F1JA 3D1VA 1FTGA 1KH1A 2ZQZA 2ZW9A 3ONNA 3Q7QA 4JB2A 2BV3A 4Q19A 3PYMA 2H06A 3DOIA 3PNPA 2YINC 7REQA 3PHIA 4QZVA 4JGIA 4KHPB 3TZHA 1TKAA 1TZJA 3SXZA 1FTYA 3MTJA 1HXHA 3N0RA 1Z56C 1BCRA 5LWQA 3AF6A 3DEJA 4AS2A 1HTWA 4R9NA 4R68A 5KVCA 4UNQA 1WMSA 1MO4A 5BXYA 4NH0A 3PU6A 4UPDA 4TM8A 3BAFA 4UCXA 1ISGA 2Z58A 3FMIA 2JLZA 2HV8A 2X8LA 5EUQB 4A0FA 3W2VA 1O03A 2XB8A 3CH5A 5I4KA 1UJNA 3OZIA 5CX4A 4G7OF 2GNPA 3RVZA 1FDWA 4NK5A 1EK1A 4GUAA 4JYPA 4O4LB 3LOQA 4ZREA 3RTCA 2FQQA 1Y5LA 9ATCA 3NYQA 4R3NA 3IR7A 4N8SA 3AQBA 5K8TA 4E1BA 2QMEA 3Q5EA 1DQPA 1LRJA 2F2TA 5L3RA 2A0UA 2LQGA 3ER9A 3FOWA 2VVTA 1J06A 4K9KA 1L4HA 2H8KA 5FFNA 4I55F 3C2QA 1YI0A 4IQFA 1QQTA 5E33A 5I47A 5HZHA 2L6FA 5ALPA 3ZWOA 2XZLA 1KR2A 1SRRA 2KJQA 2WWIA 1O5HA 3TDNA 4ID9A 1NQ5A 5EP4A 1Z5OA 2IF0A 3EXEA 5FAXA 4C0WA 1Y3DE 3AEUA 4EHIA 4LGYA 1Q92A 3OEEA 3ZG1A 2FFAA 3HMKA 1T2AA 2FSHA 3FCUB 2G4VA 2NPOA 2XDYA 3CUKA 3M4BA 1UMKA 4G8CA 4OP2A 3AUSA 4NBLA 3CXRA 3MG9A 3SVZA 3KOWA 3QKSA 3L7OA 2ERYA 2G3KA 4XYMA 2IS6A 4E2WA 1SBQA 1E4OA 5IJ9A 4D8TA 1UWKA 5KOIA 1OZAA 1QP8A 4UBIA 5TF4A 3ABMC 1US8A 4NAVA 4YLGA 2ZAIA 1X7YA 2GCPA 3SI7A 1GG2A 2F1OA 3KTDA 1N8NA 5EHZA 1ZCZA 1OH6A 1K08A 4BB5A 1SCIA 3E9QA 4K6OA 1GQYA 4EFLA 3D9QX 4QFMA 3HU5A 2IBFA 3AGPA 1EPUA 1PX0A 1W47A 1ADRA 1EZ1A 1I4ZA 1ML3A 1XMPA 2I78A 4JTDB 1N75A 2IZ5A 3DNPA 3NHWA 4HX5A 4HS9A 4JS0A 5BSRA 3V1UA 3KYDA 3KQWA 2C3OA 1CHNA 4OO3A 1K6MA 2WJ4A 3LE8A 2QUJA 4QTUB 1LK7A 4EO7A 1RZRA 1T6UA 2XUGA 1NR1A 1VLHA 1C3OA 3FPAA 4M9XA 2QZSA 5KQMA 1CNMA 3VO8A 4IXNA 2Q4RA 3WXMA 8ABPA 1P6QA 1C3XA 2XLVA 1LUAA 3T15A 5FUQA 1ZA2A 1OW7A 1ZOSA 1C4OA 1J1ZA 2WKPA 3PDJA 5EJGA 4YMGA 4Y18A 2VSQA 3NZEA 3LFUA 4XVCA 3E4CA 2AJBA 2BE9A 4I9FA 4TYPA 3UM9A 2X86A 1T9BA 2R7MA 5IFKA 3RQFA 4KR2A 2Q2VA 3D31A 4FK8A 3NHUA 1OGIA 2Q1UA 1BDJB 4KB5A 4ZEWA 1P7VA 4YRIA 3RRZA 4DJFC 3RK4A 2ZSBA 4IDCA 1SCDA 5GPGB 4YV2A 1FU7A 4R69A 2JA1A 4D3XA 4UOEA 1VJ1A 3A3PA 3VKUA 3E3MA 2R7WA 3ORSA 1H42A 3AESB 1MX3A 4RKEA 3THOA 3UAOA 3MOGA 4M1ZA 3ROQA 2FZVA 4AJNA 2OC9A 4AFNA 4IWBA 2OP0A 1DTWB 3ZY3A 3ZDCA 3OPYB 3NTXA 1XZKA 5CYFA 2PUVA 3FPKA 3IV6A 1NXOA 5DBEX 2O0HA 4MYRA 5AKEA 5HRUA 1MG0A 3VDMA 4MXDA 1V1RA 4YXWA 4K6MA 2ZRAA 3Q7LA 3GM1A 1F3LA 5IM4F 1PGOA 3SGLA 3V4RA 2FJ0A 1F7UA 3ADKA 3TD6A 5K0GA 2QSUA 3OEHD 2TS1A 4CDGA 1KJIA 2ATEA 4ER5A 2DKFA 3NC0C 4P3KA 1H5QA 3EIFA 4PPYA 4PJNA 3TUIC 2PX3A 2AT1A 3MOIA 4LRUA 1MA3A 3RW9A 1XMQB 4PZPA 3OE1A 1QGUA 1JMVA 3VR6D 1KMMA 2W4BA 5ECYA 1QP0A 3SX4A 3S28A 1E83A 1I30A 4MP6A 3WK7A 1X7XB 1ECGA 3VR3A 3DVSX 3VZQA 2ODRD 3G6KA 2MSCB 1FDIA 4PYJA 4B8ZA 2HB6A 3ZCQA 5F78A 1UC5B 2WUVA 4MVJP 4PK4A 1HOXA 1Y81A 2R5FA 3F96A 1IOVA 3AEQA 2A6HF 4UHEA 2A1DD 1EDEA 1VK5A 4DMCA 1QJCA 4KFRA 3JV7A 1K06A 4DJJA 2GJKA 1PLJA 4EF6A 3KDAA 3O26A 1N2XA 2ZG6A 3F8SA 2DWPA 2Z6QA 1YRHA 3CZ5A 3HL4A 4CLHA 4EY5A 1E9SA 4IVNA 1ZUGA 1C0IA 3QVUA 5IEBA 3QBEA 4MQBA 4YAUA 2W9YA 2GWHA 1LI7A 4JYZA 4ARZA 1Y0BA 3RE1A 5MDHA 5AK6A 1GTG1 1E7YA 4BO7A 2AXZA 1JIUA 1VKZA 2ZJZA 4B3CA 3UH1A 2EZ9A 5JS5A 2MJLA 3JQGA 3QFTA 4YCAA 3DHVA 3MLBA 4M60A 1AUXA 1KU6A 1VL0A 2D5CA 3GCDA 4Q3NA 4UXIA 1WXQA 3NW9A 1BVUA 3MX3A 2CNOA 3MXOA 4YP9A 3UXYA 4BWGA 1MRSA 1UBHS 2ZBPA 3G0CA 4F5WA 3AY3A 5LWHA 3H9UA 3ZNNA 3A6LA 4DXAA 3SSMA 5DXJA 3EC1A 5COBA 4CLXA 5A69A 4EHHA 4BAGA 4CSAC 1IULA 3ZIAD 1O95D 2WWGA 4EQZA 2Q49A 2RHGB 3PV0A 2G8NA 1DPFA 2W58A 4Q7MB 4G3XA 4QLBA 1RAIA 1PFKA 3HUDA 4R1OA 3JALA 4BZPA 5H59A 4ZYTA 5LQAA 5DTEA 5HS6A 5ABPA 3LPNA 3NG1A 3AKDA 1GVNB 3PC7A 3JRTA 2V0CA 4JMPA 4QUBA 4DRYA 5AHOA 3F7MA 1F2TA 4WK6A 3WGNA 1NJGA 3CNLA 3GLIB 1ZZEA 4P0PB 1HYEA 4H1HA 4DJTA 2D00A 3AR3A 1L0BA 1VE6A 1NBMA 3U3JA 1E9FA 2VKTA 3ISTA 1N57A 1ZN2A 3FIJA 4XCQA 5CLQA 3WGJA 5JI2E 2ZBEA 2QPOA 5CDHA 4JLWA 3ZEIA 4QODA 4QI2A 1S7CA 2JVKA 4BKPA 4YCBA 1VPVA 3QBTA 3B1WA 3WIBA 3E8XA 1E7MA 4LJ6A 5IVHA 4C3ZA 2ZI7A 1G5QA 2JI8A 1C7IA 2Y1CA 4HGRA 4EIWA 4HI0E 1MRNA 1G4US 3HRKA 1U11A 5IDYA 1N6OA 2WTNA 1ZD8A 4KLNA 3CZ4A 5EKUA 3P0EA 4F86A 1AD2A 2XEDA 3QE0A 1U5AA 1ENZA 2DLDA 4TOIA 4AZSA 3H0KA 2HQRA 3HPRA 3GN5A 3LKBA 4MRAA 3UPTA 3D7LA 2GN6A 4EQ6A 4LJ7A 1Q16A 5NLLA 2XS8A 2VG8A 4W5JA 3LQXA 5EERA 3MIZA 4HK4A 2JATA 4DMGA 3F98A 4GMDA 3IS3A 3BH0A 3PFFA 3A9CA 4L85A 4AW9A 3HHEA 3AR6A 2WOJA 3DDSA 3K9LA 2QZ4A 4NPAA 2I3AA 1F8XA 1EP3B 2HFKA 2PSHA 3UHOA 4A2PA 1TX4B 2Z2YA 1GTJ1 1R9GA 1IZ7A 1UBNA 4X1OA 1D2NA 1QWSA 4O5OA 3U2MA 4CMCA 2EKQA 1PDOA 1G1AA 3OX4A 4JLJA 1Y8RA 3IV7A 4NPHA 3EA4A 1OBHA 1VPEA 1Z6XA 3L82B 2DVMA 4J75A 3RVRA 3Q1LA 5HUJA 2BEUB 2WJHA 3DVLA 1I3KA 3GUVA 4Q01A 4P0TA 1MF7A 2OD7A 1Q6YA 2XRFA 2R05A 1AQ6A 2YRWA 3HVKA 2I2DA 3M81A 1MMAA 1DI0A 1O7JA 1DXOA 1XALA 2NXJA 1N0VC 1RR6A 4L4UA 1ZISA 2CLDX 4WE3A 3PXAA 4YHBA 3U1BA 3STHA 2YV4A 1VBFA 2V7WA 2YZKA 4YVFA 5ADUS 2B36A 2C29D 4WOCA 1K5GA 1ZM4A 3DCNA 4KVFA 5KEIA 1Y6DA 3BB1A 3U0CA 5KNBA 1SKAA 2WYHA 5GTDA 3RG8A 2H52A 3P0HA 5JHGB 2YS6A 3W2EA 2XXAA 3GUCA 1QLWA 1RXUA 1TEXA 4PHFA 1Y1SA 1XYGA 1XZAA 3G5MA 2W5UA 2XL8A 1V43A 5HIJA 3UAVA 2YYYA 2Q1TA 5MN6A 1XDWA 3E15A 4PNZA 1DCMA 2YCLA 5U4XA 1L7XA 3FXHA 3BE8A 3OTQA 4RZSA 1O4WA 5AVYA 4B48A 2B92A 4QAQA 2JEOA 1L4MA 3L6DA 2CYDA 2TMGA 3GN5B 5JG7A 5A6KA 4N5IX 4HE8D 3UB2A 3L5OA 4RIEA 3UJDA 4UCWA 2JFQA 3L8IA 1DAIA 2VDOB 1ODLA 1GU7A 1VE5A 2OWEA 5KTOA 5CYOA 4IIHA 4MLDA 4R0NA 3VKFA 4CMIB 3R6LA 4Q02A 5LSAA 2P0EA 2FP4B 3JQAA 1N6NA 4RPIA 1JIXA 2Z8XA 5BMVB 2OGZA 1GUFA 4D25A 3D2LA 3MJHA 2E5LB 5JXHA 1EWTA 2EEPA 4P93A 5FOVA 5U1PA 4CKCA 1FMCA 1QLHA 2AEJA 2QRNA 4FLEA 2AR0A 4CS8C 2YOFA 4RVDA 4ED9A 2ZUUA 4HLCA 4HGZA 2WF9A 3GO4A 4D4JA 3G2MA 2IZOA 3VWSA 4UW9A 4E31A 1EA7A 3GJXC 3RC1A 4YB8A 1VCIA 3MYRA 3DL4A 2P6NA 3Q8KA 3FGPA 1RKEA 3LDGA 1VA5A 2XB9A 4DAEA 4XFKA 4JU8A 4KZPA 3SEZA 5DM60 3LDFA 4KUEA 1ZOOA 1GNSA 3Q7GA 4Z4HA 3CN7A 3UMRA 5IWCA 1S96A 3G8DA 3M5CA 2QX6A 3I6IA 4V0MA 4NMMA 5F3RA 2QN7A 2ERCA 3SF0A 1KPHA 4I4TF 3OC6A 5EYPB 1HFJA 3WLLA 3ZY4A 1KFCB 1XXHE 2HMSA 1M8KA 2BE7A 3WGQA 4CW7A 2CXRA 3VHQA 5ESWA 2PUFA 3X1OA 1T6QA 5JSQA 1QPGA 1XVIA 2XTZA 3KWMA 2ODTX 4X4BA 1XKQA 1Z45A 2DT5A 4NS1A 5C37A 1PJLA 2BZSA 2G88A 1O87A 2D2EA 1MC5A 2PS9A 2YMMA 3ESAA 3FDJA 3IQXA 1RC0A 3P97A 1G8FA 2DX7A 2ROQA 3Q87B 3MS2A 2VUUA 3PR1A 4M1QA 4UC0A 3KVYA 2ODEA 4YX9A 2IZZA 2PMCA 3VNRA 5A6BA 2JRLA 3EDOA 3G9ZA 3L8HA 1IQRA 3KEQA 3PLRA 4QDTA 4AVYA 1OI3A 5HBRA 2JPDA 4Z1OA 1Z6ZA 3UJ3X 3NKEA 1AZTA 1IM8A 4TLMB 1T0HB 3K9BA 3T3DA 4NNPA 4KGXA 1N4AA 3S2EA 1C0KA 2V96A 3IDAA 4BO5A 3CKLA 3R2PA 1CQWA 1BS9A 3TYXA 2JH3A 4RY9A 3TN7A 4ZJUA 4FSHA 1EVLA 2Z6AA 2C2KA 3UUEA 3UJNA 3D3KA 3H3FA 4WY8A 3QXHA 3VQTA 2XYGA 2VB6A 5FYQA 2PMEA 1QF9A 3BCRA 4KO8A 1V0JA 4JVLA 3EYAA 5KQRA 3GLIE 5EPUA 4C05A 3M9WA 2BHTA 1WJGA 3EISA 4CL0A 3W9SA 2XLDA 1RAAA 3CUTA 5E2AA 1PV2A 2FGJA 2WD7A 5CJJA 3FZQA 3K09A 3K73O 4BPMA 3SC2B 3JAMA 3LT1A 3AGTA 1POWA 3RVYA 1M34E 4H4DA 3N5KA 4CBVA 2GASA 4MR9B 3ZW7A 1QV7A 3SFZA 2J9YB 2VUHB 5EJAA 1I1NA 4N3BA 3WGUA 2A1IA 4UPEA 8OHMA 3WSTA 2PIJA 4DEXA 3FNQA 2PRZA 2B7LA 2JZOA 4NIMA 1V5FA 3RPEA 2Q6KA 4BLPA 3FCOA 1DBPA 1RKXA 3VK0A 1FSPA 3LYUA 2GPWA 2XECA 1WUKS 3L8GA 4EHDA 2HMYB 1ZYRF 3A1WA 2XYQA 3GLHB 1QFSA 2C96A 3ACBA 4M8IA 4EZIA 4MI3A 1NG9A 2WMNB 1OZ0A 3MUEA 1RWKA 1J8YF 1DNPA 2FAXA 3GFSA 3RUFA 3G2JA 3LHFA 4PPNA 4YGXB 4G1VA 5A3QA 5JFGA 1ENOA 5HKLA 4K7BA 2C7BA 4I1OA 2NQ2C 1XSEA 2BFFA 4DQVA 4IDDA 2XTMA 1F48A 3O95A 1N6KA 4JSRA 5F1PA 4RUKA 4ETWA 1ISFA 2GBLC 5DX1A 3N2LA 3O8DA 4D41A 1YARO 1KKUA 4OFXA 1AKNA 3GDGA 1FFEA 1Y6RA 3WVNA 1XELA 2XDAA 2G1AA 1AO3A 3LC2O 1Z15A 3KQTA 3DD1A 4PAWA 4Z4QA 2MINA 3AEKB 3DT6A 3TSCA 3UMYA 1UEJA 4BKQA 5EXPA 4YL1A 3D5TA 2XZPA 1JP7A 4LDKA 1CUFA 1XWJA 1G63A 2XKBA 4IDPA 3X1KA 2A3NA 4UBOA 2NYAA 4CMEA 4UQLA 4QOEA 1CCWA 1GT0C 3CPEA 3K9QO 3WX0A 1KIFA 1DRJA 3GRFA 3I09A 1X57A 1Q20A 1VRVA 5C18A 2BM9A 1KYXA 3O1LA 4W5HA 4MGEA 2WU4A 1MW9X 2AOXA 3IEXA 4UNNA 5E7MA 3KB1A 4TS3A 4ON9A 5EZQA 2XIJA 1G55A 4N3CA 4YIHA 3BKXA 3WLMA 1R0KA 4C5AA 1Q22A 3ZNOA 1OKKD 5BQ3A 1QF7A 5G53C 3HK2A 1VHQA 2IYOA 3O90A 4HNVA 3HJFA 5JCPA 1S2NA 2ILTA 1ZS9A 1NP6A 3NRBA 3B36A 3IA7A 4I81A 2YHIA 4X91A 1IC6A 1R9NA 3VTAA 1RQNA 1IHPA 1EIZA 1MFPA 1MG5A 4FFPA 4GRDA 4B2PA 4NTFA 5ERYA 1SD2A 3TW8A 1AKRA 3ATPA 2VXYA 1ZCFA 2CDNA 3GNLA 4FFSA 2QTNA 1NU9C 3NYJA 1OLSA 2I6UA 2ZSHA 4RTKA 1UJ4A 1PUXA 2J9VA 2X19A 3DL7A 2IY7A 3DVAB 4RHFA 4U2CA 1HZJA 4WZBA 4DV3B 4A36A 4JAVC 1XEXB 3QFRA 4KAFA 4G0QA 4R9RA 3KQSA 4UDYX 2R8BA 4G0XA 3EA0A 2PSJA 4EF5A 3ET4A 3RHFA 1CEQA 2Z57A 1JSRA 4DKJA 1IOWA 2VHCA 2FLVA 4R0VA 1TCCA 2NZVG 3R1IA 2GN2A 4LY9A 4BVJA 4OJMX 4V0RA 3VU9A 2H1OA 1ADYA 3JXEA 3DCYA 1KNYA 2YIJA 1RE0A 4IW3B 2GZUA 4MKGA 4P08A 4MYHA 5B3KA 4HNQA 1II0A 5IN4A 2FW7A 4KWIA 1V4AA 3NV9A 4HS4A 3GJ8A 4UVHA 3JQQA 3U4HA 3CX7A 2JIZD 4O8ZA 1JTEA 2B4YA 2J3HA 4E32A 2WE7A 4E11A 3T1QA 1S4QA 2GYVA 4XGNA 2GD1O 1E1DA 3LY8A 3MQFA 3T3MB 3NHZA 3U1TA 3ZDFA 1XCGB 2RB5A 2DM6A 4Z0TA 5KWSA 4KR7A 1XRPA 1MMDA 3M9XA 1XWRA 2GB4A 3JS5A 1E69A 5A0TA 5IAAA 2YMLA 1O6ZA 3RUEA 4P9NA 3RJ9A 1A04A 1PW5A 5H3HA 2HTEA 2WWHA 3LWZA 4NLLA 4P3PA 2ZJOA 1YJ8A 3GEEA 2Q46A 3M49A 4P5DA 4E5PA 1BX1A 4H6XA 3SXPA 3HJGA 1TAUA 1CZKA 2ZZKA 2JHFA 4CM3A 2TMVP 4DB2A 1OTXA 3X1DA 1DPGA 4L6IA 4UNPA 4IAQA 3ZU2A 2VASA 2QKYA 3T12A 5KNCD 1JR2A 3OHMA 4KBYA 1W5SA 2O8VA 5DHTA 4ENRA 1KDZA 3AYZB 1TIBA 2L0XA 4WZ6A 1T01A 5JEEA 2HHLA 3WWCA 1QIJA 3EAGA 1LW7A 5FTWA 5A7HA 4BBJA 4P2BA 2ZIGA 1YZLA 4NBWA 3KSMA 3OG9A 4X3PA 1QHYA 4BWFB 2FZLA 1W30A 1X1BA 4V0OA 3QEBZ 2Q9AA 3C18A 2C9YA 2WUFA 4URYR 3FLBA 2PXTA 2W2PA 5JAHA 1VMIA 4ER9A 1KJJA 1ADJA 1YJGA 1OFUX 1HLFA 1JB1A 1KBQA 1THGA 3BDIA 4Q4AB 1JEJA 1APCA 4G5RA 5I51A 2P62A 2NAFA 3LBIA 1M2GA 2ZYRA 1YAJA 5F1KA 1ZC3A 2HSJA 3FHDA 3GAFA 3ZKWB 1N5KA 1ZJZA 2OCGA 1JB9A 3EK2A 1JHPA 1IPHA 2AC7A 1Q1BA 1TF7A 2G28A 4LBVA 5K0LA 3UWDA 4GE0A 3JQCA 1ZJJA 4UM5A 1E0DA 3HN2A 1MAWA 1NZEA 1COZA 2BEVB 1FVFA 1IUOA 4YP1A 3T06B 4JEAA 2BGKA 3OQOA 3DD5A 3E7PA 3I32A 3UXHA 4MINA 5A4DA 5L7TA 5JV5A 1UPFA 4YAKA 3U7JA 1JG7A 4ARCA 3EWNA 1BH2A 3L1JA 1FYFA 4RD9A 5DNVA 3TLBA 4BEWA 5I7OA 2AXNA 2HUPA 4EK9A 4OB4A 2HJGA 1QLEC 2HA7A 3W7AA 1JOGA 2G83A 1XEXA 5TPZA 4RZ2A 3SDSA 3W2IA 4RANA 3B78A 3O94A 4PAOA 3AOEC 1SPBS 2EP7A 4F46A 4CMJA 4GBMA 5JSZB 1C1XB 5HQ3B 2VUTA 4JLNA 3W6ZA 4Z9HA 2VNJA 1AVTA 2P2CA 3KYJB 1O8BA 1AIPA 1K6XA 1XEWY 2AR7A 2GZ3A 4N0QA 4X8LA 2YJ4A 5EIOA 2O0MA 3KS9A 3KUKA 1KBOA 7MHTA 1I1OA 4IDBA 1ZX1A 1UKZA 5AUPB 4EHPA 4LRXA 3ZI0A 3D7RA 4HYEA 1CUYA 4IJ6A 1LVGA 2VPPA 3VPFA 3FNIA 2YX1A 4YDRA 5CVJA 5LUBA 3N2KB 4Y2VA 1T3HA 3LC1O 1BDMA 3A2MA 4J90A 4OF4A 1UQRA 4PLYA 3LX8A 1U2QA 1AB6A 2VPZA 5AD1A 2LLWA 2GX6A 2WIJA 4MV8A 1YJQA 4KQHA 4BMDA 1B0ZA 3ERCA 1X15A 4IILA 2C2WA 4N12A 3ZCVA 3DMYA 2XA2A 3N7UA 1U2ZA 4Y9SA 1Q0UA 2BISA 3WTBA 1D4ZA 3AIIA 1C3LA 4GPZA 2J8ZA 4XQ1A 2QW1A 1KDVA 1SR8A 5LLSA 2I7CA 4WI1A 3UMHA 1EFVA 3TK1A 1S3FA 2GBLA 4C22A 5CT5A 5KI6A 4BEVA 5BSWA 2FKAA 1Z18A 1EWYA 4LGVA 2DH6A 2PZKA 3ZWIA 2D3TA 1A1SA 1A2OA 1BVYF 4IV0A 4PFJA 4MVRA 3KPHA 1IDOA 2J3IA 1CKEA 2PQ2A 4IEIA 2PO7A 4CU2A 5HM8A 1JRAA 3GEIA 2AW6A 2HJSA 3NCTA 4K05A 2RGWA 4M1TA 5K0NA 4WK4B 2OV3A 3UK6A 5LP6A 1XTPA 1GV0A 3PFBA 3N2ZB 1VOTA 4XVRA 2X42A 1XR3A 1JKFA 2PFSA 3GJQA 3GYGA 3VKVA 3SXUA 1N34B 2D8AA 2BELA 3UJHA 1TF5A 4F4DA 1UBMS 4NNOA 3DXJF 1LE4A 1I4OA 1KZ4A 4H16A 4YP0A 5EJMA 4KMOA 4RVSA 1T5IA 2FJUA 3HB5X 1QQBA 2OILA 3H11B 1DV2A 2P75A 4IAOA 4J7YA 2VRWA 3G8YA 4Q4JB 3TZEA 3TZQA 3ZG6A 5T57A 1C7JA 3PC4A 4TMYA 1C9YA 2A0YA 16PKA 4RD2A 4OYHA 1PV4A 3QLVC 3KR9A 3OSUA 5BRAA 4BPRA 1IXZA 1SVOA 1PL6A 3JYYA 1POXA 3IRVA 3IMCA 2I3DA 3QTTA 4X1KB 3BPSA 3WKBA 3CTPA 4YUYA 1QPZA 1C17M 3K33A 1KSHA 3GJ0A 3LUFA 1XHLA 2OBXA 2Y05A 3QY0A 2XITA 3JD1A 3QF4B 2ZPAA 5DI9A 2VYVD 1YMVA 1W4LA 3UJBA 4R6XA 2PL1A 3U62A 1LSOA 4LZOA 1YVUA 3IPXA 4LBYA 2CCYA 3CKYA 3GJRA 4Q1EA 1UAYA 4XDGA 4RA6B 3WO1A 3Q15C 3H9EO 3GOHA 4U8HA 5ICGA 1P9NA 2LYJA 3OZXA 4DT1B 2QVXX 5LQCA 2NU7B 3FTCA 2J08A 5DM2A 1Z3IX 5A4AA 2R66A 2NSFA 3DBIA 2GGSA 4FYHA 1TJ3A 2BTOA 4U2FA 4CM1A 2P6RA 3FPCA 1B2RA 3R0QA 3ZZTA 4CV3A 1E2UA 1E2DA 4MQEA 3ZYCA 3EGOA 2Q3EA 3E5MA 3EZFA 1H2YA 4BECA 2AR9A 5K0ZA 4Z2AA 3DW1X 1V4VA 4I08A 2R97A 2GM4A 1XVTA 4L6AA 4RMJA 5DE3A 3SP1A 2WD8A 5BY2A 2R8PA 3FZYA 1NLXA 1X7WB 2XLOA 4DOZA 2J3QA 3I9V6 1IL0A 3W5IA 3KZ3A 1DO0A 1Q83A 2NZYA 4O2RA 1ZD9A 3EYWA 3V5XA 2Q0SA 3CSSA 5DRTA 4EABA 3C8MA 5FDFA 3ROGA 1SEVA 3C8DA 1GXSB 2AE1A 3PT5A 1VMKA 2LWIA 4L0CA 4QQNA 5JS7A 1SXGA 2EU8A 4HNRA 3O3NB 1CQIB 4Y6RA 4PEVA 3B9QA 4CUJA 3KT3A 4X4CA 2BTQA 1C30A 3DE7X 4HVTA 5FPSA 2PKRA 4HUJA 1U9IC 4I7EA 4YAEA 1UK9A 2FK7A 3UANA 1U7XA 4CXMA 4LF8B 4C0QC 3D6FA 1KH2A 4NEGA 4K28A 5TPWA 4AG5A 1ZNZA 1G18A 3HC7A 5KYKA 4LRWA 2VQEB 1JFRA 1PG2A 2P78A 3D8TA 1WEHA 4NOKA 4W7IA 2LE0A 2VH1A 5COAA 1Z8DA 4I50F 2VDMB 3JQ9A 4G85A 3UKDA 1U9CA 3FY4A 4LRTB 4NCKA 2OYSA 1X1CA 4TUYB 5L95A 1BR4A 3RK1A 3BMOB 4GMKA 4JOBA 3HYTA 4BC0A 5EUCA 5JE8A 2X76A 5IG2A 2D06A 2ZJ8A 2P5SA 1AKTA 3RKRA 4KWTA 3TG8A 1YOVA 3WAJA 1RKEB 2OYRA 1WW3A 2WFMA 4I1RA 2IW1A 1E66A 3ZCTA 2PXQA 1T5HX 2BJCA 2PFDA 1ZINA 2JRCA 4MWDA 3JCZA 1L4YA 1X2BA 2AI1A 1PUJA 3BERA 2I80A 3OQJA 2EC5A 3HFRA 4Q15A 3TOLA 3EUFA 2AXEA 3OPMA 2XRZA 4HX2A 3PEYA 5I9LA 4EJSB 4Y6OA 1ZXLA 1WVMA 1I2ZA 4MX8A 3WS7A 4C4AA 3HCCA 3HS3A 1RQRA 4L5IA 5AJWA 3PHCA 4MVCA 2FPGB 4D8VA 2P5TB 5CFNA 3BIFA 3T5GA 4X61A 1O6BA 2VRBA 2OUKA 4IFIA 1I94B 2GFIA 4Z4IA 3ZHQA 4DLSA 1KXJA 4B83A 2Y8EA 5FOTA 1ULHA 1KY5A 1MEEA 2A0BA 1N7IA 1X1TA 1NN3A 2WZBA 256BA 3G0OA 3JVVA 4GOJA 3W8IA 1SVIA 4OBXA 1MT3A 4DE9A 2UV8A 1ZKDA 4BLRA 2PLAA 2GD0A 3EXHC 5FBRB 3UK2A 2QR5A 4NTZA 4DVJA 5JRDS 2BMWA 4IRUA 2C7QA 1PRUA 2A9JA 5EUMA 3GARA 5J4KA 2W6JA 4L8GA 4DR2B 4G0WA 1R12A 4D26A 2HCNA 1FVOA 2X58A 4CR6A 1T4BA 4EDHA 1I4EB 2WF7A 3AUKA 3QKRB 3HBAA 4XKJA 2HWWA 1ECLA 1XLVA 4LC1A 2OJED 2PBEA 1ZIXA 4CS9C 2OFYA 1GILA 3USZA 5KPDA 2OLJA 2PPLA 1OT3A 4XWGA 1WG8A 4FXPA 1C3VA 2RBEA 3FSEA 3QU4A 4FGUA 3BWMA 4OXYA 4YJFA 5IXSA 1DUSA 1DIOB 3EODA 1M6VA 3E6AA 1JR8A 1NMQA 4KTTE 4MGKR 4Q1FA 4X54A 4BQEA 1THZA 4IHAA 5DWDA 4J8PA 2EEZA 4Q37A 1JHYA 4TKLA 3TLGA 1P9OA 4U0KA 1G2QA 4AKSA 2BMEA 2HMTA 3N3AC 5HIMA 3JZAA 5IM5A 5JBNA 4ZCMA 3Q7TA 1A88A 1NI4B 1W4CA 5E6SA 4PSVA 4Z0NA 1G7TA 2A88A 2Z09A 2BF7A 3QV1A 1I4WA 2H1LA 1KAGA 2ALJA 2ZI5A 2VNIA 3P2MA 1SBNE 3A0RB 3T4XA 5HW0A 2W42A 4WN9A 3ENNA 2MYTA 2GM9A 3RCBA 1YE8A 2ZI9A 3L7DA 1O6GA 4EGSA 2JFFA 1J8FA 2HDOA 3VVMA 2JAXA 3UOAB 1GFSA 3L9XA 3UMIA 4LYHA 1EHCA 1MQ9A 4J2HA 1QG6A 3OOJA 2Z0MA 4BVHA 4HV4A 3OQBA 3EH1A 4INAA 4TSFA 2HF2A 3O03A 4JTCB 4MTFA 2FSPA 2A6CA 2TMYA 3A31A 4ZI7B 4B2YA 5COFA 3FCCA 5AR1A 2CXPA 3P5SA 3QUSA 4RXMA 3NANA 5E4FA 4QJIA 1UDWA 3EQ9A 2O23A 3N2NA 2XOKA 2XCUA 1PO7A 3HXPA 4HFMA 4LMAA 2RHJA 4FM9A 2AKEA 1JKMA 3WGKA 2L8NA 1PZFA 2EKBA 2PHZA 1OFHA 1FUUA 2ZTUA 3BAZA 3QUQA 3RC9A 3WRYA 1B68A 1VMAA 2HLPA 6ABPA 3H8JA 3GJTA 4EHKA 1FFGA 2CL6X 2O1XA 4IDOA 2WZCA 4MUNA 4UE6A 4XQEA 4AKEA 4RY2A 3VR0A 3OPQA 2ICTA 4PG7A 2CUKA 2O8EA 4IVPA 2BGUA 5CYGA 3SSOA 3ANNA 2XDQB 4G7ZF 5JTTA 9LDTA 2BZ1A 3AKCA 4XAQA 2WD9A 1V96A 5I7HA 1TUBB 2ID4A 4CV1A 3H9BA 1QBKC 4XQ9A 3ZU4A 1GQ2A 2BFCB 4MVZA 1PR1A 4RSHA 2ETSA 1LTQA 5B58T 4F4FA 2CXTA 3BDVA 3SCGA 4EP1A 1G6KA 3K3PA 4LK3A 4OUKX 4H7KA 3LCCA 3DE4X 4D9FA 1C03A 1L3BA 3DLTA 1LTHR 2HU5A 4ZVQA 3EMVA 2CYAA 5GQSA 1AUVA 2AZMA 2UVQA 3IEIA 2WB7A 1H4TA 1NN0A 4M9UA 4OQZA 5GVSA 4H31A 1U28A 2BKAA 3PEWA 3B71A 4YLYA 2YVLA 1GTMA 5L0DA 3T0FA 2WBLC 1HY5A 1C9KA 1CD5A 1G5RA 3F3SA 3NIBA 1E4VA 1E9CA