3KL4A

Recognition of a signal peptide by the signal recognition particle
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
431
structure length
412
Chain Sequence
b'GLENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILGMGDIESILEKVKGLLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition 54 kDa protein
publication title Recognition of a signal peptide by the signal recognition particle.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 116
structure length 412
sequence length 431
ec nomenclature ec 3.6.5.4: Signal-recognition-particle GTPase.
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 3kl4A03
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kl4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kl4A02
1CJTC 2JJ1D 2NO6A 4KO8A 3HU1A 1H8HD 1S3SA 2ZI4A 4JL6A 3BFXA 1JPNA 5JWHA 3ZZ0A 2DHRA 1G8YA 2BBWA 4IDQA 4MYCA 1U0JA 3U3OA 3ZIAA 3ZQJA 2GEDA 2GBLC 4TTQA 3RDPA 3L0PA 4OHVA 1XBTA 1A5TA 1HA3A 1RRFA 1YZGA 5DI9A 3HPRA 2X77A 2ZRKA 3TQCA 2EFHB 1N0WA 5EXTA 3SBDA 5LBIA 4K8OA 2FZLA 4LBVA 1IOZA 1QHHA 4V0OA 3AEZA 3OEHD 4OQNA 4RD0A 1M7BA 4A0FA 4AKHA 3PV0A 4B6EA 2QAGC 1VIAA 5KSYA 5SZIA 3OIYA 4NYMR 1OE0A 2VHTA 1MR3F 4GOJA 5DISB 2Q21A 5IT5A 4PHHA 3O47A 2HEIA 2IHYA 1Q1QA 4AYWA 3CRQA 1SXJC 3DDCA 2VHUA 1TF5A 4KI0A 3L0OA 4I4LA 2Z4RA 2F1HA 4OK3A 4LHVA 1FOEB 2ZYUX 2YHSA 4MGZR 4KVGA 2QGZA 3C4JA 2AD5A 4KJZA 5H68A 5KYKA 1RZ3A 4DB4A 3AVYA 2DFKB 1ZNXA 2HT6A 2YZ2A 3QKRA 4EPRA 4QJ3A 3TAUA 2WBLC 3CIOA 4MDEA 1CS4C 1TAGA 2WPDD 3MGCA 4C4PA 5HZKA 3HPQA 3QF4A 2VP4A 1SVKA 4ZDIA 4G0NA 3KQUA 3QNUA 2IYVA 4HATA 3WNDA 5EP3A 2V7QD 4G5GA 2WAYA 521PA 1J90A 2H8KA 4XOIA 1Z28A 4BZXA 1QBKC 4H9GA 5HR5A 1E4YA 3EZ2A 3GD7A 1EWQA 4DCVA 4NBSA 4LC0A 3LBIA 2JJ8A 2ZYVX 3T15A 2LKCA 3DM5A 2RGGA 1G3IA 3BD9A 3LBNA 2RGAA 1FX0A 1KIMA 1UBCA 1KJWA 4DIEA 1FUUA 1SULA 2F9LA 1X1SA 5FPYA 3ICQB 1E98A 4DSOA 4UJ3A 2DWPA 3I8SA 3L0IB 2GXQA 1XPRA 3PEYA 1CKEA 5CITA 3LLMA 1W7AA 1GKUB 1G1MA 4IVQA 5EZ5A 4BRWA 3BIFA 2FJUA 1YZKA 1S9DA 1XNJA 2A5DA 2AK2A 3VX4A 4TMTA 2PEZA 2VIIA 2PXDA 4NCNA 3DKVA 3EXAA 1R5NA 1JR3A 4FMDB 4TTRA 3ADCA 2ZETA 5UKDA 3TGPA 2PMDA 5FI1B 1KDRA 3QXCA 4R2IA 1AQYA 3QXHA 3AGPA 1VG9B 1LS6A 3RAPR 2H17A 1NY5A 3O8CA 3CWQA 1AZTA 2H18A 2GVZC 2XJ9A 3GJXC 3V4FA 5EE9A 3QKRB 5TMPA 1HY3A 3W3ZB 3QF4B 3LQQA 2KE5A 4KFUA 4RCZA 1E2FA 5EP1A 3RHFA 3I73A 3OAAD 4JLJA 5EE1A 4AC9A 4B74A 4Q48A 5CIWA 1CIPA 1E0JA 1U8YA 2YINC 3K9LA 4TQ9A 3BK7A 3LAWA 1TEXA 4KYUA 3QSYA 4XTCS 4TWZA 1WE2A 2A9KA 3I92A 4EAQA 2GF9A 4LPKA 4BFUA 4URVR 4IJMA 1LNZA 4BFZA 2GZAA 2HLDA 4EPVA 5JFGA 3AVTA 3M0EA 4BEJA 5F98A 4PTLA 2MSDB 1D2MA 3N70A 1FX0B 3CRW1 5K8UA 4FD2A 1II0A 3D8BA 4GPTA 1N6RA 4A2PA 3AVOA 3NEYA 4Q9HA 1EFCA 2EYUA 4QHYA 1T8TA 4XH9B 1N0VC 1OH7A 3NTUA 2GK6A 2VSOA 4IW3B 4RD4A 1P6XA 1Y3AA 2A3RA 5EE0A 4C2UA 4TQUS 1NBMD 1KO8A 1PV4A 1F2UA 1GM5A 1AGRA 5ANRB 4RZXA 4TMXA 5JRZA 1OB2A 2V1XA 2V6IA 2ZRNA 2OHFA 1G4UR 4LK2A 4MKIA 3QJYA 1EX7A 2I4IA 4DC9A 4V03A 5L3SA 3U7HB 1Z07A 2XNDD 3BB1A 2XZPA 4M1OA 2XZLA 3LFUA 3ZD7A 3EZFA 1HUQA 3ONWA 5CYOA 2QEQA 2O8EA 1DO2A 5EXSA 2IYYA 2GVDC 3K09A 2FE4A 4Q00A 5J40A 3VMFA 4FMCB 1R6BX 2C5LA 1ZNWA 3BBPA 4G3XA 1YZUA 1J8YF 4L9WA 3CF2A 4QNRA 1J99A 3EAQA 2W2TA 4V0LA 1T4GA 1W0KA 2V55B 3CRRA 4A8JC 3NDPA 2IS6A 1AS2A 2FFHA 3THWA 4LJ5A 2QSZA 2R6GA 3RRZA 1XTQA 4ESHA 1JXOA 4NYJR 3HWSA 1WCV1 3BH6A 1E69A 1G8GA 2R6FA 5AUQA 4EPXA 5FOVA 2BCGY 5E7IA 2BBTA 1E0SA 2J7KA 3EA5A 3ZH9B 3QOFA 3EIHA 3FDIA 1ZD9A 3ASZA 2NOAA 2F55A 5DI3B 2R65A 2QPAA 3LH5A 3LDAA 4M9XA 1DAMA 1GRQA 2HCBA 1KTVA 2WKPA 4K46A 1Z83A 4E03A 4N0EA 2JJ2D 1KSJA 3C41J 1F2UB 5EP4A 3EPLA 1Z6XA 4C2TA 3ZVMA 3AF2A 2CDNA 2VEDA 5L3SB 5G40A 2WJGA 5KO2A 4Q7LA 4D81A 4WZ6A 5DLQC 1GIAA 4O2LA 2IUUA 3TRFA 4BFVA 1TMKA 3NXSA 4DLUA 3CPHA 3IPYA 4II7A 4W5WA 1MH1A 3AKEA 3W90A 3QPWA 4E5UA 2ATVA 2PXVA 2O8EB 1KNXA 4QHTA 4TYNA 1YVDA 4YC7A 1Z3IX 2WZQA 1OXTA 2GJ9A 3MWKA 1UKVY 5DN6A 3PITA 4MYTA 3HU3A 2ZRBA 2JLSA 4OQLA 4QJ4A 3W6OA 4BLOA 4MRPA 4LJ4A 2YC2C 1Q1BA 2ERYA 1L7VC 2V54A 3U5ZB 2FPMA 3AQ4A 4B2IA 4OI0A 3LV8A 5KSOA 3OIVA 3UXMA 4GOKA 2D7CA 2A5FA 2IYQA 4LCBA 4BZQA 1DTSA 3U6BA 4Q03A 5DO9A 1EFRD 1LS1A 2ASEA 1TQDA 3LBHA 4MITA 3WMEA 2FX3A 3KQHA 4AURA 4ASUD 4ZI2A 3OFND 1KMHA 3EIEA 4JBWA 3AP1A 3VR6A 2C99A 4NTZA 2KJQA 2QP3A 3BH7A 3VHXA 1NLFA 4ABYA 1RRCA 3PEUA 1DBSA 1KI3A 1QB2A 4M1MA 1MABA 3EG5A 1GWNA 5JCPA 1EESA 4CEHA 1HEIA 4LYJA 1X8JA 5G3YA 3I1FA 2CK3A 2OFXA 1BOFA 4OK6A 3WYGA 3ZIAD 1KI9A 4C0HA 1P2TA 1BKDR 5G41A 1ODFA 4OHWA 4A1FA 2BDTA 1SKQA 1KNQA 2ZI3A 4JVNA 1PZNA 4TLAA 1QRAA 1DAGA 3KKMA 5FPKA 3OEEA 1W36B 4GBMA 4YMVA 2H16A 2PXUA 1AIPA 4M22A 2ZAMA 1WP9A 2YOFA 4LV6A 2YWEA 4DLYA 3LQXA 1XTJA 3CBQA 4HB0A 5A5GA 3VNVA 5FPHA 2IUSA 2GJSA 2EW1A 4KSBA 1XXHA 1XWIA 4L4UA 1XEXA 4AI6A 2WJVA 4ARZA 4OQFA 1W4CA 4WA7A 3ZQ6A 1SHKA 1XZPA 1NL3A 2XX3A 2Z0MA 3T61A 2EFEB 3RRYA 4QXAA 2HXYA 1HYQA 2OLJA 3NC0C 4I1SA 2PX0A 4FCWA 4TL8A 4NMMA 4URXR 1IN6A 1IY0A 3BFVA 1R10A 2R44A 3VR4A 3FHCB 4AWXA 1KMHB 2BC9A 1ELOA 4Q5IA 3FPAA 5KDLA 5JHGB 4ZCLA 2O8CA 2CNWD 1NI3A 1QVRA 1U81A 4B3XA 3KXKA 4IDOA 4BLRA 2OCPA 2OFOA 3KTAB 1G6OA 2MMCA 1MABB 3LVRE 2LKDA 3EC1A 3I5YA 4CEHB 3ZS9A 1JNYA 4Q18A 4TN1A 2E1RA 3NH9A 4YMTA 1QHXA 4UXJA 5HPYB 4X8MA 2XAUA 4TLEA 4X8HA 5E4FA 4F92B 2CLDX 2OV2A 1FUKA 1UEJA 1UDXA 1VIYA 2CXXA 3TAHA 1N2CE 2FMXA 3IQWA 5E7JA 3AKYA 5FUXA 1BIFA 4GDFA 1TNDA 3IQXA 2ZREA 1GVNB 4DLVA 2WVJA 2JIZD 4M9QA 5JI2E 3PEWA 1GOTA 5DSZA 3A1UA 1DEKA 2KI5A 3GLIA 1T8UA 5K8TA 3MG9A 1NVVR 2Q3MA 5JRJA 2B8WA 3FTQA 2ZRHA 1XXHB 3UK6A 5GVSA 3FHTA 3MWLA 1NVWQ 3HDTA 4D80A 1XEXB 4JLVA 1LTQA 1NJGA 3FHOA 4ARZB 4BZPA 1YE8A 4JMPA 5FUYA 1ZVQA 1OHHD 2FFBA 3SBEA 3WRXC 2HF9A 3GLGA 1JXMA 1UKEA 2HT1A 4RFVA 4CDGA 2ECKA 3ZVNA 3CUEF 1Q21A 3PR1A 2ZANA 1RW4A 2GAAA 1CEEA 2JLQA 3RWOA 1N6OA 1NVXQ 2FSHA 2O8CB 2P2LA 1N5JA 1ZCBA 1KO1A 2PZEA 3AP3A 3BE4A 4D4KA 2QTVB 2W6JD 5DHFA 3CM0A 1QZXA 4YLGA 2H5EA 3B7GA 1CRPA 5C1BA 4AG6A 3UMFA 1W4AA 1ZM4A 1RIFA 3B6EA 2GWHA 2PXBA 4LYAA 3IUYA 2HLDD 3RS4A 2JDIA 3VU9A 1IQPA 3W6PA 2N46A 2Z43A 3FOZA 4DDUA 2Z5FA 2AFHE 2C9CA 4EQ6A 2H7VA 4NYMQ 3W8RA 4Z54A 5EP2A 1UBEA 1M7GA 2ZJ2A 4RFSA 1RJ9B 4LI0A 2O8FA 1ONBA 5K8IA 1ZAKA 2Z6VA 1E79A 3MSXA 2WWFA 1TUIA 1IY1A 1ZD1A 3LXXA 1FNNA 1KK3A 1KO7A 3GLIB 2GCPA 4YXWD 1XTIA 5FFMA 2W6IA 2Q9BA 4WAUA 4LRWA 4LBYA 4MGYR 4N3NA 1IN8A 1NLYA 1OFHA 2DFTA 3HR8A 5FUWA 5IK2A 3WYFA 4KODA 1FMLA 1U8ZA 1LW7A 3UKDA 3CNOA 2C77A 5TY0A 3SJCA 8OHMA 3BFKA 3EPKA 3SZRA 3U7FB 3IGFA 3GLGB 2R6CA 5BWMA 1IY2A 1P72A 4OK5A 2IWRA 2CL6X 4LHYA 1IXRC 1GRRA 3K09C 4RD1A 3CR8A 1E99A 1F3OA 1D9XA 1OXXK 2PMKA 1ESMA 2PZFA 3T5DA 3MRSA 1W0KD 1UF9A 2IK8A 1K5DA 2J5XA 3DHWC 4R2HA 2HV8A 3PFIA 1F5NA 2CE2X 1GKIA 2J59A 2DY1A 2CCGA 2HF8A 3PIRA 4JJZA 3VU9B 4W9MC 1YZQA 4O3MA 3B5JA 3IPXA 2IXGA 2C9OA 5DE3A 4P4UA 4E07A 2AK3A 2WICA 4P4TA 1UADA 3CF6R 3AF4A 5F9HA 1XD2A 2NIPA 4JSTA 4RFSB 2ZRFA 5FTLA 2O8FB 2FNAA 3A1VA 1XEFA 2J0SA 4DHEA 4AY2A 1TQ2A 2V4ZA 4E09A 3HU2A 3LW7A 4Q1BA 1X6VA 2E9SA 4F93B 1QVAA 4PQRA 2UZ3A 4BUJA 3SYKA 1KSGA 1U98A 2W58A 2R6DA 1A2KC 1Z29A 5GADl 1VG8A 1LF0A 5CDFA 2C78A 1IAQA 2B7BA 4Q7JB 4R71A 3KKQA 5FBQB 2VBCA 2IX3A 4NCIA 4TYWA 1IM2A 3DZDA 5HTKA 1ESNA 4JLPA 4PZYA 3GFTA 4M8NE 4A8JA 4D6PA 1XCGB 1P2VA 2PLFA 3MJHA 1E2LA 3EZ6A 1Z0IA 4XVQA 3IBYA 4A82A 4B71A 5KDDA 1W36C 4ESVA 4LYHA 3B9PA 2I3BA 2QQ0A 1Z0JA 3K0AA 3TH5A 4OHXA 2WJIA 1M74A 3UG6A 2PH1A 1OLOA 4UNQA 4OQXA 1SZPA 4M1KA 2EVWX 5FOSA 1NSFA 1QG4A 1TPZA 2CHVA 4PAMA 4V0NA 3RWMB 4ZDJA 3F0TA 5H70A 3Q7PA 721PA 3DPUA 3R8FA 4M1SA 2IF2A 2IW3A 3NEJA 2R2AA 4HAVA 3X1YA 3B9QA 2P0EA 2ZUDA 1GL7A 2RGNA 2VL7A 2MSCB 4PHTA 4YDHB 2AKAB 3BAFA 1OF1A 3K1JA 5SZKB 2BEJA 2WM9B 4HB4A 4TT3A 1KDTA 2CMKA 5AUNB 1COWD 1W44A 4B3FX 4XJXA 3KFXA 4TQAA 2RAPA 5TVKA 2VQSA 1KJZA 1PJRA 2ZSBA 1N3BA 3KZ1E 1Q3TA 3NDBB 3B8HA 4TLCA 4XTRA 3A1SA 3K0SA 2PXPA 4IOLA 2PJRA 1E9RA 2QGNA 4Z1MA 2AXNA 2W0SA 2BBOA 1ZM7A 3K9GA 4PPFA 3X2SA 1E2IA 3QQ5A 2ZS9A 4FI3C 3RANA 1CR2A 1A7JA 2VP5A 3CR7A 4E22A 2CK3D 2XXAB 4C0KA 5GAGi 3AV0B 5JJIA 2LCFA 5JWOA 2PT7A 4L5BA 2CCJA 1ZM9A 2MMGA 3AF3A 4L8GA 4Q7KA 1KAGA 3PUVA 3EX7C 5IDVA 3GJ7A 1XD8A 1NG1A 2UKDA 1WQ1R 3OEED 1XCMA 2OAP1 2D06A 4NYJQ 1J70A 2Z83A 1QG2A 3L8YA 2ZRPA 4HAYA 1UKYA 2PXLA 1JEDA 3HR7A 1FL9A 4D0NA 1FMJA 2FG5A 3CPEA 4P4SB 3TKLA 3MWJA 4JS0A 5CB6A 1GL9B 2EYQA 3PUWA 2D7DA 3PUYA 621PA 1KK1A 1VHTA 4TMZA 4B32A 3LX5A 2F1IA 2QU8A 1G5PA 4LV5B 4PAOA 1IXSB 4AD8A 3NWJA 4UXIA 3A1TA 4V0MA 2YYZA 5C2JB 4DCUA 2JA1A 1IJEA 3R9XA 4LBWA 1E1QD 1OB5A 1KI6A 3RLFA 1OYYA 3FMPB 2G1KA 4HSEA 4TLBA 4G01B 1ZP6A 2OEPA 1NMXA 2O5VA 3CRMA 1SXJD 1KMQA 1RRGA 1LV7A 4DLRA 2ZS7A 1XMSA 2GJKA 5AJXA 1L2TA 4DSNA 4BFYA 2NZJA 4A15A 1JBKA 4LJYA 1XJCA 3B60A 1LFDB 3R8CA 2YNMA 2QL6A 1D8TA 1M34E 4QC2A 5K8LA 5HKKD 2N1BA 2FSGA 3CO5A 3BS4A 2ZI7A 5DNYB 1IONA 1E6CA 1BO6A 3RRMA 1KI8A 2ORWA 3CNNA 3FE2A 3FFAA 4TMWA 3CB4A 4PANA 3N2EA 3U3KA 4C0BA 4TSFA 4DDTA 2QROA 4U7DA 4UXHA 2EWWA 5LD2B 2PX3A 1KOFA 3WHKA 1YR7A 1OFIA 4DUGA 1AK2A 1Q57A 1SXJE 1U90A 2NMVA 1RKBA 2NO1A 3QXSA 4M1YA 2J45A 4MUBA 2JASA 3IBGA 3Q7QA 4PPQA 1AA9A 3QPVA 4B48A 2Q9AA 3AF0A 3SYLA 1ZCAA 2BEKA 3MMPA 5J5CA 3B2EA 1G3QA 3C5HA 1R0XA 1M1YE 4G5RA 2QSYA 3K0FB 4PO8A 1DG1G 5DGXA 5BN5A 3KXLA 2F3TA 4Q4AB 4DEYA 4TL7A 2P6RA 5D3MA 1GITA 1UPTA 1UEIA 2QPOA 1KI6B 1BYIA 3SOPA 3WRYC 2J7PA 1E2PA 2K5UA 4CZ2A 2KWIA 1E1RD 2JDID 1W0JD 4QKQA 5CJ2A 3ADDA 3A1WA 5EE3A 4KBFA 4OQMA 1AN0A 2G3YA 5F2EA 2IYTA 2IA5A 3WBJA 5LB4A 2RKOA 4BGDA 2HUPA 1W4BA 4XWOA 3K70B 4QBHA 2ZE6A 1UBFA 1HE1C 1PUIA 3G82C 1GAJA 3KXIA 2ZPTX 1RFLA 2FFQA 5CLLA 4K81B 2WIAA 5LPNA 5J4KA 1OXUA 3GLFA 4RZ2A 5JMTA 4CIDA 4KFSA 2Q3FA 4DEXA 4MYHA 2W6ID 2D62A 4FCVA 2JLVA 4ZDKA 2XTMA 1JQJC 1M2OB 2CEAA 1YZNA 3B13B 2KBFA 4OYHA 4ON9A 4Z8YA 4B44A 5IK2D 4TZ0A 3W6NA 1N5IA 5BYJA 1AKEA 2P5SA 3TVDA 2F43A 4OI1A 4WIAA 1ZU5A 1Z6TA 3TJZA 1GILA 2EFGA 4Q66C 1HV8A 2ZRDA 3A8TA 4ACBA 1G5RA 5BN3A 3B1XA 1P60A 1WXQA 4NU0A 4B76A 3U61B 3IHWA 1KJYA 1G291 2WWYA 2Q0HA 3K9NA 4F4IA 4IRUB 1XTRA 4KFTA 5FTNA 2YVUA 4XSGA 4ZO4A 1G7SA 4B3DA 1ZMXA 4M0LA 1QHYA 5H1YA 5DI3A 4RKEA 4QM7A 5D3MB 5FTMA 1PLKA 3KQLA 3X1DA 5EJEA 3I32A 3RNLA 3TW4A 1Z0AA 2J46A 3SS8A 3PJRA 3KB2A 1HQ1A 4F91B 2FZ4A 2ZRJA 3GLHE 4OBEA 4WZAE 5F9FA 4PC7A 2JATA 4AKEA 4HDCA 1OIXA 1P9WA 1GSIA 1Z22A 4JIMA 3K0CC 2FWRA 4BWYA 4C7OA 3A37A 3BXZA 1E9EA 2C98A 3SEAA 1OIWA 2IYLD 1KI4A 3KB1A 1PLJA 2VHQA 2C95A 1NVVQ 3OESA 3TVTA 2XTNA 3ZZTA 1OIVA 2OFWA 1IN4A 1X86B 1X3SA 2OO7A 3GLFB 4MKHA 4LWZA 3REGA 1N6KA 2FPLA 3TSOA 2QP4A 4LHXA 2VH5R 3GEEA 1RYFA 1U9IA 3FKSD 5JSZA 3SQXA 5KOYA 2O0KA 4NL4H 1I4LD 2X8AA 3KQNA 4GSYA 4RVCA 1NBME 4IOKA 3NBZC 3WP0A 4B3CA 2NG1A 1MO6A 4RJLA 1NY6A 2F43B 2F7SA 4OHYA 5HE8A 2FSIA 5AUPB 4Q4LA 3DKPA 2ZJYA 3BORA 1XP8A 2EWVA 1J7KA 5EXPA 4KXFB 2IYZA 4XD7A 3KL4A 2QM7A 3B1VA 4B2LA 4ILEA 2P67A 4DDVA 1E2NA 3Q85A 1AQUA 121PA 2D2EA 4JYCA 3SU8A 3L2OB 3WNCA 2XB2A 1E4VA 4FIDA 5B64A 1DARA 1P62B 2D3WA 4JLMA 4JT4A 4W7SA 4IFBA 4MH0R 2HXSA 2V9PA 2ZU0C 4MRSA 2QT1A 2RGNC 2VHJA 1IHUA 1DAHA 2YC4C 5JZVA 4MA4A 3QG5A 4PC2A 5FTKA 4HDQB 4UQOA 4C7OB 1S0UA 1LVGA 4BLSA 1YR8A 3EZ7A 4POAA 2TMKA 1E2EA 3DZ8A 3QEOA 4IXNA 4L9SA 2CE7A 4LJ7A 1VYTA 4W5JA 1NP6A 4Y0AA 4PXAA 4Q01A 4CYMA 1F48A 5KUTA 1OKKA 2PEYA 2DYKA 1ZYUA 2XSZD 1G8PA 1FZQA 1MO4A 4US0R 2BWJA 1ZUNB 2A30A 5JSZB 3IIKA 3CWZA 1XB2A 1N6PA 2J0UA 3OF5A 4BFSA 3CX8A 2DFNA 5IRCD 2QP9X 4BFTA 2FDCA 1KDOA 4DB2A 3LA6A 2AD1A 4C0SA 2OUKA 2FV8A 4MRRA 1ZU4A 1J2JA 3TUJC 2QPTA 4DCNA 2GF0A 1CP2A 3QVUA 3U3RA 1R4AA 3Q72A 2QMUA 4OJKA 1GDDA 2CLCX 4O2RA 4EJSB 1S1MA 3EA0A 4Q9KA 4B2PA 4DWJA 2GJ8A 3PUXA 1TF7A 1G3UA 5FH9A 3LRPA 1U0HC 1HH4A 1ZRHA 3EC2A 4MDFA 5FBVB 5B2ZA 4A0RA 3LVQE 5LD2C 1A4RA 1I2DA 4DSTA 2JEOA 3A4LA 4FINA 1F60A 2P6NA 4QOSA 2PXTA 4DIDA 3NC1C 4F7WA 5SZJA 3VHLB 3KTAA 4URZR 3RS7A 3B1ZA 2Y8EA 1X1RA 4HLQB 1AS3A 4JVSB 4Q4JB 5DH9A 4MKGA 4ZKEA 3TK1A 2V1UA 4QG7A 3Q3JB 1Z0DA 1D2EA 1ZUIA 3RC8A 4GI7A 3THYA 5L3QA 3AUXA 2ONKA 1FTNA 3PQCA 6Q21A 5J47A 5FL7A 5CLQA 1TEVA 2PCLA 1T91A 1YZTA 4HI0E 1AGPA 2GHIA 3UIEA 3I4LA 4HAUA 3EPJA 4AKIA 3O8BA 3WMGA 1G19A 2J0UB 2EU8A 3TLXA 4GP7A 3H4MA 2FN4A 1G6HA 1R5OA 2VP9A 4QM6A 1P9RA 1G9XA 3WBKA 4AYTA 5CK4A 3QXXA 4B33A 4TMKA 2FEOA 2WJJA 4G1UC 3K70C 2WHXA 4IDPA 1CJUC 3TR0A 3AGQA 4WOPA 3O8RA 1HTWA 4QL3A 1G7RA 4LZZA 1T9HA 3NIBA 3OHMA 4D2IA 1FW6A 1II8B 2XOKA 4A36A 2QE7A 1UM8A 3LO5A 4TYYA 1PLLA 2QMHA 2G6BA 4P31A 1ZINA 4TSFD 1KI7A 2CVHA 1IJFA 2ZE8A 1Q1ZA 1Z47A 4MGKR 1S3GA 2JJ1A 2XGJA 2OM2A 4JLKA 2GCOA 1H8HA 2CLSA 4N1AA 1YHNA 2J0VA 1KZGB 2QBYA 2GA8A 3EPHA 4BLTA 4EPTA 4G5OA 2P65A 4HAWA 2ERXA 2QUZA 3BERA 3THYB 1VECA 4BE7B 5L3QB 2ANBA 4H1VA 2C2HA 1YKSA 3RS2A 2IS4A 4BFWA 1KSFX 1E2GA 3QENA 3RS3A 3T1TA 2W2XA 3M4YA 2B92A 1RJ9A 1KO4A 2ORVA 2ANCA 1DAKA 4PC1A 1I2MA 3V9PA 3IO5A 3OEHA 5KU1A 4CVNA 2ZU6A 2AHOA 3K8YA 4QRHA 2OSBA 3C5CA 4X8LA 2ODEA 4O0MA 2ZJZA 3E70C 1ZW6A 1PUJA 421PA 1UKZA 4Z8XA 2REBA 2IXFA 3HYTA 4C3ZA 2C9YA 1JR3D 4LBZA 4I81A 2GJAA 3R9IA 3GFPA 3JVUA 2FEMA 1GG2A 3A58B 1RE0A 5DYGA 2WMOB 3EW9A 1CJVC 2G77B 4HYYA 2ZQ5A 4DJTA 1V5WA 4QNMA 1G16A 2ZSFA 4OI4A 4M1TA 2HYIC 4I99A 3BGWA 3P4XA 4KFRA 1WBBA 1QHIA 5DHAA 1SVLA 3NBFA 3R7WA 2FGJA 1S1CA 3F3YA 1R0YA 4HUTA 5CYPA 4JYBA 4OHZA 5L3VA 2CHQA 1OW3B 4I1VA 1NF3A 1JR3E 2GCOB 2JAQA 4BRUA 5FPSA 5GJWC 3S1AA 1AKYA 2XB4A 2Q9CA 1Z0KA 1EX6A 2QBYB 5JS7A 2FGKA 1KKMA 1YR6A 1NN0A 2PT5A 2VLIA 3AVWA 2JGNA 3NBYC 4RKFA 3AUYA 1F2TA 2SHKA 2IC5A 2VYFA 2OT3B 2P3SA 1CRQA 4LC1A 3ZZUA 1A82A 5IHPA 1NIJA 2AFIE 4JLDA 3LWNA 1CR0A 5L8VA 4DLZA 221PA 3KFVA 5BQ5A 3BWDD 4CT4B 5KPDA 3GQBA 3P20A 4PHGA 1WGWA 4NKRA 1N6LA 2FH5B 2OAQ1 5JCZA 1GNQA 1DE0A 1N6NA 2QZ4A 5KNDA 3CONA 5JEEA 4PX9A 1MFQC 2ZROA 2B7CA 1ZNZA 5HZHA 1YU9A 1W5SA 4IFEA 1Q0UA 3V00A 3VTKA 4HZUA 2E87A 3QKSA 3SHFA 3GFOA 4PSAA 4D4JA 5LDDC 2RHDA 4MQBA 3CX7A 4A0HA 1GFIA 3NVAA 4C0AC 1G20E 1SKYE 1P61B 4TZ6A 2PBRA 3CLVA 5CM8B 4BECA 1U9IC 4D4MA 3AVPA 3IIMA 1TF2A 2ZITA 3T12A 1Z08A 3R7WB 3FYHA 4D25A 4B35A 3ZS8A 3FVQA 3THXA 2ZVPX 3H1TA 4P32A 4OKSA 4AYXA 1DG3A 4LUCA 4FXPA 2CL7X 4M9ZA 2YWFA 4WW0A 3S1AB 4A92A 3EASA 3QIAA 3FGNA 4HZIA 4Q47A 2J41A 4NH0A 2BMFA 1G17A 4JVMA 4Q19A 4EJSC 1VG0B 2DFLA 1JAHA 4NPHA 4F4JA 1F2TB 3RSLA 1CJKC 1EK0A 1R2QA 3K0CA 3KUDA 4RD3A 4TL9A 3AVVA 2X2FA 3SE0A 1E9DA 2ZI6A 4PC6A 1Z8FA 3U44A 2X2EA 4NDZA 1S8FA 1S9HA 1VMAA 5AR1A 3SR0A 4BPBA 3A4NA 4IKEA 1I4DD 3QE0A 2PLRA 1CBUA 1U0LA 3SYNA 3SHWA 1ETUA 3NKVA 4XWKA 4LJ9A 5JJKA 1VDZA 2JLWA 1L8QA 1E0AA 4AIIA 1IN7A 2DBYA 4HZUB 1P5ZB 3QKSB 3VR5A 2QMOA 2XXAA 1JB1A 4UNSA 2GDJA 3CZPA 2XZOA 1KAOA 1V43A 2XNDA 1GUAA 4A2WA 4C0QC 1EFHA 2EFCB 1NMZA 2RGXA 3FMIA 2KSQA 1W46A 1DAEA 3ZVLA 3BOSA 1FP6A 5AJVB 2DWQA 2VTKA 4MYUA 1S2MA 1S4QA 2O0JA 1W36D 1XRJA 4O25A 1OFUX 1JJ7A 3P32A 2ZM5A 5DN6D 1NNEA 2VSFA 1DAIA 1W48A 2RB4A 3REFA 3K53A 3THXB 4GL2A 4JJKA 4TTPA 4RZ3A 4C0JA 2QY9A 2GRJA 2IYXA 3B1YA 1C1YA 3FMFA 1A2BA 1OPXA 2PXQA 4JL5A 3WP1B 2O52A 2G0NA 1XZQA 1TX4B 3GLHB 3MJRA 1OH6A 3MCAA 2B8TA 2G83A 3FWYA 1E3MA 2QAJA 3DEFA 1US8A 4P4SA 1KI2A 2ZI5A 2QMEA 4NHOA 5E7MA 2AL7A 3VAAA 2NO0A 1Z6GA 2ORIA 3IKJA 1FFHA 4WVFA 1XFAA 4W5HA 3PXGA 1NN3A 3M1IA 3RS0A 4IHQA 1E2DA 3U44B 2A5YB 1GKYA 3IO3A 2GKSA 1RVDA 2ZAOA 4NZYA 1NIPA 4M1WA 2IYRA 4HLDA 4FMBB 3AKCA 5FR1A 5L3RA 5JS8A 4B43A 1G21E 4GNKA 4KLNA 4DZZA 4YQFA 5KTYA 5LB2A 4RD6A 4HEJA 1XMIA 3P26A 1YRBA 2EFDB 3AVUA 3ZVRA 4JLNA 5AJWA 3KJHA 2VF8A 4PC3A 3SQWA 3GEIA 5B58C 1MT0A 3GJ8A 2HYDA 4A2QA 4S2EA 2A5GA 5GVRA 2WOJA 1MKYA 1O3YA 4HUQA 2BIFA 3ICEA 1FTSA 1Q22A 4DT1A 5FL3A 1KY2A 4WXPA 3T1OA 1KDPA 1D5CA 1P7CA 5EXXA 4GMDA 3A36A 4R9UC 2BVNA 4KBGA 4TYPA 2WSSA 4IVRA 3SN6A 2QI9C 3ZD6A 2BJWA 1YZLA 1YQTA 3B1WA 3TE6A 3E1SA 1E2HA 2NGRA 4Q1CA 3SC3A 1JALA 2BM0A 4GT1A 4DVGA 4CGZA 3EZ9A 1US8B 3WYAA 5HE9A 1H8EA 1W4RA 2HJVA 5H8WA 1XPUA 2QNRA 3T1VA 4ACAA 4D0LB 5FTJA 3K0EA 3A4MA 1G4AE 3QBVA 1TUEA 3UMSA 2XOKD 4CW7A 1NRJB 4EIWA 2OCBA 1EFRA 4TLDA 1U2RA 4IEIA 2GCNA 3N2IA 1XF9A 4PZZA 3D3QA 1XU4A 3LX8A 4B47A 2JLXA 4PZLA 4ERNA 4ASUA 3OFNA 2AXPA 2GZDA 3AVQA 3K0FA 5B57C 4MUAA 4ZCMA 1NN5A 4A4DA 1XPOA 4Q4AA 1XXHE 2FFAA 1QHGA 4GP6A 2RGBA 5JHHB 3KJIA 5JI3E 3EARA 2ZR9A 2X1VA 2ZUBA 3R9WA 3NG1A 4BFXA 1FQJA 2GETA 1WF3A 5HCIA 2IF0A 1XEWX 3VFDA 3X1ZA 5JLJA 2NPFA 5M04A 1OXVA 1KYIA 1Z06A 2QQEA 4HUQB 5KSZA 3B85A 2F9MA 4GFDA 1X8KA 2B6HA 5J4YA 1G64A 2ZEJA 3C8UA 1IBRA 2XJ4A 3X1XA 4DT1B 3U7GA 2GILA 4S35A 2OXCA 5GJCA 1W5TA 2CCKA 1BYUA 3SJAA 1E9AA 1OFTA 3E2IA 3GCGA 4JT2A 5AJYA 5FOUA 4B75A 4HAXA 3PEVA 1CJMA 4FN5A 4DDWA 2OILA 3SFVA 3EWAA 2AWNA 2OBLA 1VCNA 4IDNA 4UNNA 3M6AA 1EG7A 1XMJA 2ODNA 4NP6A 1AS0A 4PSVA 2MSEB 1U99A 3X1WA 4CT5A 4JBYA 1N25A 3ETLA 1UDWA 2F3RA 3I3SR 821PA 2ZVQX 1RYHA 4LJAA 2ATXA 4WXRA 1E32A 2C03A 2H1LA 4XIGS 3DVLA 4BASA 4D26A 3BH0A 2YWGA 1IXZA 1F6BA 1OSNA 4D0GA 4URWR 4ZI3A 4PO1A 1G3RA 1NSTA 5E3HA 1JI0A 4NYIR 4CEJB 2ZJ8A 3DMNA 5J4VA 3GLIE 5E95A 3DOFA 4JKYA 2CNWA 3JVVA 3P1JA 5TXGA 1NKSA 1DULA 4FMDF 3MAAC 2PXFA 2A78A 1N0UA 2FPKA 2IT1A 4MGIR 3TSZA 3Q9LA 2QTFA 4TL6A 3CPJB 5KPJA 1KO5A 3U4QA 1XTSA 2WWHA 4JVLA 2QA5A 1R8SA 1UJ2A 1D2NA 2EQBA 2RGEA 3TR5A 3JZMA 3SJBA 3MUFA 1XJ0A 3U2QA 4IOJA 2CBZA 5KNBA 3GLGE 3AVXA 3GPLA 4PQYA 3VR2A 2QRZA 4LDJA 5JEDA 1Q12A 2YOHA 2WSMA 2OCAA 1HQCA 1K6MA 2LWIA 2FF7A 3FMOB 3AB3A 3T35A 3VNUA 1Q1EA 1QHHB 4LJ8A 2DCUA 1E79D 1Q3HA 4URUR 4ITRC 2JIZA 3L8ZA 4FCTA 4JL8A 1VKJA 4UNRA 1Z2AA 3CNLA 4IXMA 4Q1DA 2RGCA 2VSXA 1NG9A 4ZCIA 2ZTSA 1OV4A 2OLKA 1CULC 1W49A 3CRVA 2QTHA 3FB4A 1CTQA 1WRBA 5CB8A 2G1JA 3KUCA 1MO3A 2WWGA 3AF1A 3D7MA 1OHHA 3Q5DA 3WNBA 2ZSEA 2PJZA 3KKNA 3JZAA 4U5XA 2JCSA 1RPZA 3IEVA 2FSFA 2D74A 4RSGA 1DAFA 1ZC3A 1CXZA 2BJVA 3PENA 4OL0A 4HB3A 3DL0A 2P6UA 2CL0X 4P3YA 4KLZA 4BQSA 4HLUC 3LXRA 1YR9A 4YMUA 2F1RA 1ZBDA 3GP8A 2KBEA 3AH8A 1MRNA 2JLRA 3P4YA 3VQTA 1AJEA 2ZYTX 2W83A 2W6JA 3U4QB 3G0HA 2GXUA 2HCJB 2RGDA 5BYKA 5EQTA 3QG1A 4DLWA 3TMKA 1P2SA 1VYVA 1E2KA 2RMKA 3QY0A 1HQYE 2XNSA 1Z6AA 4LJ6A 1XCPA 3C7KA 4MRNA 3ZGXA 2UZIR 2O8DA 4DCSA 2ZRMA 3UPUA 3V4RA 4NE2A 4B6FA 2FU5C 5A0FA 1P4SA 1XMVA 4FMCF 1E94E 2YWHA 1T3LA 3TW8B 5KHOC 3QKTA 5IF9A 4H1UA 2CHGA 1B0UA 4C0LA 3W5JA 2JLUA 4BLQA 3HJNA 4AKGA 4YXWA 4EFNA 4M21A 2F6RA 5TARA 4LPSA 1M7HA 3LLUA 1PVOA 4KCGA 3C14C 2REXB 2CVFA 4OI2A 2AWOA 3F5FA 4GMXA 4KAXA 5FI0B 2A5JA 3LD9A 1I4TD 3TUIC 1BMFA 4UKDA 4PSKA 3E5HA 2GNOA 4EPYA 1G41A 2ZRIA 1Z2CA 3O8DA 1NVUQ 4AK9A 2XITA 1TU3A 3C16C 2WTUA 2QM8A 2JQEA 4EJSA 1T6NA 4R7ZA 2QG6A 4QHSA 1TQ4A 1DADA 3NHBA 4Q4HA 2BMJA 3VKGA 3H86A 3RC3A 3IDQA 5CDFE 3QBTA 1SVOA 1WMSA 1E2QA 1ZJ6A 2WIBA 1DVRA 4I1UA 2O8BA 4QJ5A 4Q1FA 4KSCA 2ZR0A 2X19A 4B34A 5BXQC 2GK7A 3KKPA 3GJ4A 4PAQA 4P0TA 1KY3A 2O0HA 4Q4JA 1P75A 2ZIAA 4TT3D 2O8DB 3BB3A 3WY9A 2FA9A 3Q5EA 1SKYB 1E9BA 2NQ2C 5J4HA 4QBGB 2H57A 2QN6A 1SVWA 4WBSA 2VF7A 3AKDA 2ZJOA 3DO6A 3W9YA 4DLXA 1EFTA 1P73A 3HP1A 3WMFA 4Z1MD 1XJQA 4ZV4A 5GJVC 1JECA 2BMEA 1YJ5A 2VO1A 1N6HA 1ZIPA 1KHTA 3B78A 2YOGA 1G8HA 3ND9A 4M53A 4PFSA 2R9VA 1II9A 3RABA 4XSHA 4TYQA 3U6KA 2WAXA 3UG7A 4DCTA 1E96A 3RYTC 2VP0A 4CRWB 2ONJA 2BOVA 3OZXA 1QHNA 1SVMA 3PCRB 4Q7MB 3AM1A 5JBQA 1DELA 1Y63A 3VR3A 1T0JB 2IWHA 4HB2A 2VA8A 1MO5A 1G5TA 1II8A 1U94A 1XTKA 3F8TA 3L43A 3N5CA 4Q4HB 3U60B 4Q9JA 1T0HB 3KJGA 2WSSD 3RVBA 2QRNA 3QVVA 1Z6YA 3OE7A 4I1OA 3RS5A 2IS2A 2O8BB 2OE2A 3THWB 1T5LA 3EWSA 1N6IA 2IYSA 3FFBA 1W1WA 3MFYA 1OYWA 1W47A 1P2UA 4LYFA 1H8ED 4LY6A 1R8QA 2FOLA 4KU4A 2CJWA 1G3MA 3CF0A 3IILA 5HCNA 1D9ZA 1TU4A 1QDEA 2AR7A 1ZUHA 5TDHA 3B82A 1VCMA 3T06B 2RH5A 5B30A 3TQFA 2A7QA 1COWA 4IEEA 4L15A 2ZJBA 4B73A 4RY2A 2RHMA 4URYR 2V6JA 3EIQA 4V0KA 2G0TA 1E2JA 1GRNA 2F1JA 3ZJYA 2OZEA 4MKFA 4EPWA 1KK2A 3AP2A 1X8LA 4HAZA 2WWWA 3NBXX 1LB1B 4OJQA 4GZLA 5EZ6B 4YDSA 3I8XA 3SNHA 1EGAA 1E0KA 2IXEA 2BCJQ 2GESA 1NLZA 2AKYA 4GRAA 4NCJA 3GJ0A 4JBXA 3CH4B 4V02A 3TIFA 1KKLA 2J9RA 3K70D 3LQRA 4V0ME 1CR1A 3WHLA 4A6PA 3RRNA 2J0QA 2XEXA 4GOXA 5TV2A 1FNMA 4PPNA 3IEUA 2HJGA 1RRPA 3GEHA 3ADBA 4D4LA 2AX4A 4UNPA 1Q44A 3OIUA 4F38A 3OIWA 4Q02A 3SI7A 2ODWA 2N42A 1KK0A 2YJTD 2GZHA 2VPPA 1FP7A 2G88A 2P5TB 2GXAA 2WJHA 4Q9LA 2YV5A 3K9HA 2PXEA 4DUGD 3KDSE 2DB3A 4ZPXA 3IIJA 2CJWB 5KDOA 3I61A 1P3JA 1SHZA 1VPLA 2D2FA 1YRAA 3GJ6A 3H0KA 1C9KA 3PUZA 1VG1A 3TUZC 2Z4SA 2C96A 2A2ZA 2WWIA 5A4JA 1XEWY 2ZSDA 5CM9C 4M2LA 5FOWA 5DIFA 1MV5A 2V3CC 2GBLA 5D3QA 2PXKA 1WA5A 3KJEA 4Z51A 3P27A 2NTYC 1HE8B 5FR2A 3RSOA 3VKWA 1L4YA 1E1QA 2WMNB 2WKRA 1RC8A 5P21A 2QAGA 1QF9A 1TL7C 2J3EA 2J7PD 1OJLA 2WKQA 5KNCA 1A1VA 4KYIB 2IS1A 3TNFA 5FBRB 2BHRA 3DOEA 2ZI9A 1GP2A 1M8PA 1VCOA 1GTVA 3UANA 1SXJA 1FQKA 5F3WB 1R7RA 3QEJA 1WDTA 3QF7A 5JWRA 1DOAA 2PZGA 1OH8A 2WWXA 1R5BA 5HKKA 4Q1AA 4L16A 4LHZA 5CJPA 2BV3A 4N0DA 4QBFA 1UAAA 2ZXUA 3LY5A 1WB9A 4LGMA 2WPDA 1JPJA 4US2R 5J4LA 3LW8A 4NCHA 1KSHA 5G3ZA 1EXMA 1IN5A 3MWYW 4BEBA 3THOA 1SGWA 2V7QA 4DLTA 2C8VA 4ZIRA 2R8RA 3DMDA 2J87A 1TADA 2HDNB 2H92A 4JZKA 3NHAA 3T1QA 3SFZA 4PO9A 4A6XA 4IDHA 3TSWA 2NO7A 2ZRLA 2OESA 5FOXA 1JQLB 1WBDA 4YMWA 3VR1A 1GNRA 2DWOA 3GLFE 1Z63A 3BC1A 4IOMA 2I1VB 4KHZA 2RCNA 2ZE5A 1EWRA 5C4GB 1ZM3A 5JJLA 3UMRA 3CW2A 1W2HA 2NO9A 3HYRA 4A9AA 5AK0A 3BB4A 1ZM2A 4EFLA 1R0ZA 2QAGB 2IEZA 4MRVA 2D4HA 4Y0VA 1E2MA 5BN4A 1E1RA 2IHBA 4LHWA 3QKUA 1CR4A 4DRZA 2BKUA 4RZUA 5EUQB 1TTTA 1W0JA 4G5SA 2DR3A 2QENA 4FW9A 1SXJB 5FBWB 1HT2E 4GZMA 3W34A 3QI2A 1MRSA 2IUTA 1HT1E 5FUVA 2ZJ5A 1D6JA 3GMTA 1GNPA 4QGHA 4U02A 4DXAA 3CZQA 4JKIA 2I1QA 1Z5ZA 1K5GA 2QT0A 5ELXA 1UFQA 3MD0A 3UATA 3W3AA 2IEYA 4QGGA 4CF7A 3D31A 3GJ3A 2OG2A 1ZC4A 1G8FA 3QPUA 4Q9IA 4EUNA 1O87A 2ZRCA 3I5XA 2BKEA 2GTPA 3ZLJA 3R20A 2REOA 4DKXA 5DYIA 4Q1EA 4CEIA 3CH5A 2BM1A 2L0XA 3NH6A 3OAAA 2ZSAA 2Q3HA 4HLUA 1KI1A 4AG5A 4ZIRB 2JLZA 1E9FA 1CLUA 2ODBA 3BJIC 4Q21A 1VTKA 2PL3A 4NYIQ 3ZDQA 1LF5A 2UVQA 5SZHB 2B21A 3GLHA 3PG5A 4XWAA 1BMFD 4M9SA 1FPMA 4XD7D 3UWOA 3KX2A 5AJZA 3QUSA 3T34A 5EUMA 4JLAA 1NMYA 2ZS8A 2G9NA 1E9CA 4RD2A 4FWTA 4PHFA 3A6PC 3ND8A 4PPGA 4C9BA 4EDHA 5C4MA 2OBMA 3SDZA 2BBSA 1CF4A 1NKTA 3FKQA 5GAHi 2VP6A 3D6TB 2R6AA 4FWIB 5BW8A 3LNCA 4JLOA 4LX0A 3IHLA 4JLBA 1NBMA 2W00A 3BRWD 2KB0A 3J81k 5JECA 2PCJA 1N5LA 4EQ6B 3I62A 4NONA 3W5IA 1MOZA 3U7EB 1R0WA 2VHCA 2GEVA 2ZR7A 4P33A 1G18A 4R98A 5C46F 1SQ5A 4HDOB 3VKHA 1DS6A 1XDBA 5FPTA 1XD9A 4B3BA 2DPXA 2Q6TA 3U3JA 1OKKD 2QORA 4RCYA 4BLPA 4TMVA 1N5KA 2VRWA 3ZYCA 4QBIA 1DPFA 3FKSA 1OT3A 4CEIB 1UBGA 1E9SA 4YONB 1NJFA 3CX6A 4HLCA 1BH2A 4YMSA 2ZYWX 1K8RA 2W0MA 3ADKA 3L0SA 4PR0A 1VYUA 1M6NA 2WOOA 1CU1A 2YKGA 3PVSA 3KQKA 4X8OA 1JJVA 1Z0FA 1QHSA 2ZE7A 4A0GA 2C04A 1T5IA 4LSGA 4KV9A 5G53C 5AWFC 4LV8B 3I72A 4G5QA 1P9NA 4US1R 1OH5A 3OE7D 4U00A 2J1LA 1L4UA 1Q20A 3MLEA 1G7TA 1HURA 1S96A 4KITB 3L82B 4QGAA 3DM9B 2NPIA 4J0QA 1OXSC 4XVRA 1VHLA 3UWKA 1ANKA 1AM4D 4LOAA 1U8AA 2JJ2A 1ZIOA 1H65A 5AUOB 1T3HA 4M4SA 5FOTA 1JAIA 1J8MF 1KZ7B 2OCYC 1JEEA 3KKOA 1JR6A 1BS1A 4C30A 2ZUCA 4DLSA 2IBMA 1XD2B 3Q8XB 3C15C 1TQ6A 3QXJA 4EKDA 4WZBE 2VP2A 5FL7D 3TBKA 2R62A 1G7CA 1T3SA 2IL1A 3G5UA 1ZD8A 4PQFA 2IYUA 1SVSA 4DBLC 3ASYA 5KSPA 2OXRA 1XX6A 4DSUA 2XTZA 2XSZA 1ZNYA 2AN9A 4ZKDA 1C4OA 4B3GA 3W8NA 3WXMA 4D82A 1SVIA 1AZSC 2W2VA 4KVAA 2IYWA 3H2YA 3GJ5A 1W2GA 2GEUA 2BMDA 5TB5A 2V8OA 5CIQA 5GJBA 2GAOA 2JLYA 1GL6A 2GXSA 4A8JB 4ZDWA 4QFMA 5CK5A 3T5GA 1VCIA 4QGFA 1KGDA 3VX3A 3CKLA 1GZSA 1DO0A 4JSYA 3ECCA 2OBNA 5EE5B 4XVUA 1EFUA 4NCKA 4UJ5A 4IVPA 2ZRGA 3K0AB 2QE7D 1B23P 3SJZA 2NZ8A 5FBLB 2WV9A 4F4CA 1LY1A 2WJYA 4CEJA 2ZRAA 5C18A 1NN1A 4EFMA 3H84A 3U3MA 2ZJAA
chains in the Genus database with same CATH superfamily
2O2SA 3IDZA 3DNVB 4PJMA 3MJ4A 2XDAA 3VPAA 1QIDA 2UYHA 4JI5B 4MW8A 1G98A 1VHDA 2E4VA 5C7YA 5EVCA 4K8OA 4LBVA 5AK4A 4OQNA 5C1PA 3UVEA 4O2BF 1EJ6A 256BA 4M0MA 3ZWKA 1C29B 4RHXA 2C2WA 3RIMA 3L0OA 4YA6A 4LN1A 3B3AA 1ISPA 3JCUQ 3PQ6A 1P80A 1ZNXA 2YZ2A 2RJOA 1CS4C 3MGCA 5ES3A 5I9TA 2VP4A 4ZDIA 1QTIA 3HJAA 1ADFA 3AHEA 2H8KA 3DC2A 4AJNA 1NHGA 5AK3A 2VJKA 2ZXRA 2WG2A 4Y2YA 4Y7CA 1Y8QA 4NBSA 3WRWA 2IVZA 4AMVA 1MOQA 1IBSA 1X1SA 3AG4C 3IAUA 2AR9A 1W7AA 1YAJA 4L9RA 3C3WA 4ZQHA 4CFSA 2RSEB 2XWBF 1BN6A 2ROQA 1XNHA 1NQOA 3AHDA 5KTMA 2XMPA 4BGVA 2ZDGA 1U7HA 2KC3A 1H2HA 3GL9A 3WJ1A 3KJXA 3NATA 4F9FA 2HKIA 3O95A 1V1JA 3KFLA 3HFGA 2J67A 2CXUA 5L0IA 1V8PA 1KL7A 3UPDA 4MWSA 4Q6WA 1U28A 1QP0A 5JFGA 2QTTA 3E8XA 1FX0B 1TVCA 3QELA 4FD2A 1JIVA 3ETCA 3JQ7A 4A2PA 3PX2A 4M9CA 2BEWB 1YDWA 1OH7A 1NJ5A 5ESDA 5AKHA 1N5MA 2EBHX 4B84A 4RZXA 1OB2A 4YJ2F 2VSQA 4FLFA 1DOZA 3UH0A 1HUQA 1LVHA 4BNHA 3UJHA 4Q00A 1OZFA 1J8YF 5FXMA 5AI9A 3N24A 4NYJR 4B6QA 3BD7A 4KQFA 3NT2A 1G20B 1OYVA 1QK4A 2Y05A 2YMQA 5FYQA 4B46A 4K46A 2HWUA 4FBMA 2Q3CA 5AP9A 3MZ0A 1KYWA 3L6EA 4ZU6X 2IPOA 3V9AA 1GIAA 4O2LA 2B82A 2YL7A 4QHTA 4YC7A 4B82A 1OXTA 4D0RA 1FU7A 2VWQA 2REQA 4KV7A 5IJAA 3IHKA 2GYVA 2XBMA 4HEHA 3ZDAA 1XQYA 1F7VA 4O4IA 2KJQA 5B3LA 1E6LA 5H5JA 1NV9A 1J2EA 2XYRA 1KI3A 4M1MA 1GWNA 1HEIA 2IZ1A 3Q7GA 3EYWA 1UZNA 3OT4A 4TX1A 3TLKA 4QXQA 2HNBA 3KKZA 4C20A 1EUYA 3UJPA 4GBMA 2CMDA 2VJMA 5CCDA 3NLLA 1T2VA 2EERA 1HLDA 2IUSA 5DGTA 3A6EA 4G67A 1Y5RA 2OXEA 2WYHA 5C8XA 3M1CB 4ARZA 1W4CA 3HI6A 4LGCA 3VZRA 2X7JA 4M8KA 4HRXA 4DNFA 4YRQA 2WFMA 5BUZA 1T2NA 4JT9A 1J4AA 3GG2A 2CNWD 3PL1A 5I4CA 4M3NA 2OFOA 3DWWA 3UJNA 4ZAWA 3ZDYB 4X8MA 4NBTA 1RT9A 1CZKA 1QUEA 3IQWA 3V7WA 1KYTA 2VH1A 1ADJA 3R40A 4GDFA 4WK6A 4FOSA 4BCDA 3MG9A 3NKLA 3FTQA 2OGZA 1QF6A 2YQZA 5GV8A 3FHTA 1W87A 2H9IA 5J3JA 4JMPA 2ZJ3A 4J0FA 1ADYA 2QW1A 3PR1A 3KBBA 2PSEA 4RIGA 1UCFA 1MTZA 1E3JA 1NVXQ 3GN2A 3AP3A 3JVEA 2VPTA 4YLGA 3OPMA 4Q3BA 1CEQA 2PXBA 4MW6A 2R8BA 3OQBA 2VFAA 1TFUA 2J5RA 2E5FA 2IXAA 3HDQA 2O8FA 2C2ZA 1ZHYA 1ADCA 2WQZA 4KIGA 1HE1A 3AFHA 1FXUA 1OZAA 5EJFA 4MGYR 3EN0A 1Y1RA 1IN8A 4UULA 4ZANA 1L7BA 3BFKA 1WXWA 1IY2A 2IWRA 3KU1A 3WL6A 3HGQA 5K0FA 4EO9A 4H2DA 2PH7A 3M89A 3IEXA 3JAWA 2A8YA 3FNQA 2J5XA 4LTDA 3AR7A 2HF8A 2JFYA 2QW0X 5BRAA 3OU7A 1M6VA 2WICA 4B8ZA 5FTLA 1QDLB 1JWBB 1OZ0A 2Z56A 1JDNA 2Z9CA 1YL6A 3BSWA 2W58A 2R6DA 4FR0A 1WB5A 1GQ2A 3US6A 2F59A 2VBCA 1P33A 1XCGB 4O2AF 5H80A 2VRNA 2ZDHA 1TCBA 2Z5VA 5CT8A 2NUPA 4O29A 5HKAA 2C0PA 3NMKA 1ISJA 1GD1O 3V32A 2CMKA 5LOVF 2OENG 3CZRA 3R74A 1S7ZA 4ZVLA 5CFQA 4YRNA 2Q1TA 4Q7EA 1JAXA 3JD3A 5AGFA 3PD0A 4XUDA 4P9NA 1N4AA 3AF3A 4L8GA 4MQUA 1GPKA 3FGZA 1OI3A 4ZAZA 1E5VA 2I54A 1PGJA 1WL8A 2XCOA 2GNPA 4Z4QA 3CPEA 1NI4A 4CDMA 4W1PA 2NUAA 2NUBA 1HTTA 1UK9A 1IJEA 4L57A 1E1QD 3MWDB 5DBHX 4H0CA 4KE7A 3PNYA 4BEWA 1HDEA 5CT5A 2X0IA 1YC2A 2QL6A 1X8XA 2XCLA 1MA0A 1LBSA 3SZLA 4CDNA 5LQJA 4GOOD 3OTOB 5MHTA 2O54A 3FIUA 1L4HA 3DKAA 3E7PA 1C0IA 3MQ4A 3IAS6 4B48A 3PC6A 1KR2A 1G3QA 3BDNA 5LIRA 3S9OA 1CC1S 2CZQA 5JC8A 3OD5A 4Q4AB 4X6UA 3HKCB 1CD5A 3PICA 5EE3A 2H9YA 5F5FA 1PUIA 1ULZA 3D3WA 4DXDA 2XTMA 5B2EA 3A27A 2HSZA 4EJ6A 1N5IA 2I3DA 4OI1A 4Q66C 4Z4HA 4B76A 3IHWA 4IUCS 4D8WA 3H4IA 4QXMA 2VXYA 2B5AA 1WSAA 1NLMA 3RC2A 3UJCA 1UT5A 4RKEA 3G0DA 4XYGA 5B6IA 3X1DA 5KYUB 1FFGA 1NF2A 4OBEA 5F9FA 2VDWA 2IYLD 2OEXA 1SC3A 4YT2A 1E2BA 4Z5HA 2FPLA 2QP4A 3JX9A 3H13A 1R1DA 1YJGA 1Z3CA 5DK4A 2JGRA 3AEXA 3S40A 3AJAA 1S01A 4I08A 2WKSA 1H0KA 3L2OB 1UIMA 1JL3A 5KTKA 4KL8S 5EPEA 3RUEA 3EZNA 4GGOA 3R5XA 3KSRA 4CKWA 4MA4A 5TEVA 1VL0A 3T6KA 3T6GB 1ACJA 3KSAC 6CHYA 4EB8A 1ZUNB 3OQ6A 4BFSA 5HIMA 4AZSA 4DB2A 3LA6A 4C0SA 4C3BA 4QARA 3U3RA 5FJJA 5GONF 4HX5A 4EJSB 1J07A 4DWJA 1E5LA 5C0OE 1G3UA 2C5AA 5HUHA 3EC2A 1LLIA 3F9CA 3MERA 4FINA 2P6NA 5KOHA 5IDXA 4JGGA 1N2JA 3HA7A 1U7WA 1FLVA 4U9HS 4CM1A 3JWHA 2HPVA 2O2IA 3O8BA 4H4EA 1G19A 4O1MA 2YR0A 1R9JA 1H7IA 3ED1A 4LTMA 1I3NA 4AYTA 4D6YA 1WXEA 1XMPA 1A50B 3GFBA 5C5IA 3O8RA 4ZMRA 4NAHA 2JFZA 3NIBA 1Y9JA 1SBQA 4P31A 3Q98A 4JITA 1HL3A 1X3LA 2CLSA 2ADMA 4D02A 1YZFA 4BLTA 4HAWA 2R6JA 3PQ7A 1AU9A 2QD2A 3LL7A 1KSFX 5BURA 3UAWA 4EHFA 2Y0PA 1CB7A 1G8AA 3O26A 1TFRA 5D6OA 3II6X 3C5CA 1TO1E 1JXQA 1ZW6A 4BVEA 4LBZA 2G63A 2CLKB 5FOQA 3ZHXA 1NMSA 3O1IC 2ZQ5A 1C14A 2HYIC 4GC9A 4KO2S 5E2AA 1SVLA 3R7WA 3ONFA 4Y30A 1TD9A 2NN3C 2PUAA 2IW1A 4F4BA 3KHTA 3T5BA 3FROA 3QJ5A 3QU9A 2P3SA 3FYMA 5AK6A 4C6TB 3U5SA 3I04A 3WFZA 3ESBA 4I1IA 4JJ7A 3CONA 3QNWA 4C89A 1D2CA 2ZROA 4QTZA 3OVMA 3ELDA 3PWZA 1ZD3A 4LRQA 4ND1A 2Y39A 3NVAA 1HDXA 5BN1A 4H35A 3AR9A 3AVPA 4E5SA 5AW8A 3OURA 3UFXB 1QFJA 1U0GA 5JAHA 6NULA 2J41A 3P45A 4S1WA 3RNOA 4FFNA 1J1UA 1Z4QA 2OECA 5DYNA 3JYHA 1VDZA 4S1TA 3FHLA 3QKSB 3TWOA 3DR3A 3ZQKA 3TIGA 4A16A 1P0QA 4CLXA 1W46A 1OFUX 1YDEA 4I50B 5DN6D 4RM3A 4OQDA 4D5EA 4AUKA 2CXQA 1E6MA 2PMEA 2Z98A 4TUYF 1EK5A 1PFKA 1B1AA 3DEFA 1US8A 4EGSA 2D0OB 5MFPA 2F62A 4NBUA 1VJ1A 2CMGA 1WWKA 4QTYA 1DC4A 4G1MB 4RV4A 2HIGA 1FCJA 3G9QA 4RD6A 3P26A 3GEIA 4I19A 1J23A 2BIFA 4HBZA 1IRIA 3ZW8A 1TAHA 1WZNA 1H2AS 1P7CA 2R48A 1AGXA 2EOAA 1V71A 3HFSA 5H8WA 3GEDA 3T1VA 4YV7A 3ENQA 3I2KA 3QBVA 3LOPA 1EFRA 2GCNA 3DBLA 2QLMA 2AXPA 3AVQA 3TZHA 1TKAA 2J4DA 1E3OC 4NDNE 4U7HA 3BF8A 1KRWA 3D2CA 4LW8A 2O4AA 2PRJA 5JLJA 4ZT3A 2X3YA 1B1CA 4GFDA 1VKRA 4RA9B 2XJ4A 3TPFA 4P38A 3M3HA 1OTHA 1BYUA 3WL8A 4Z86A 4HGNA 5K6AC 1VB3A 1CJMA 1PNTA 4EKNB 2VF2A 2EPNA 4LCEA 4DA6A 1EG7A 4Y6LA 3CE9A 4CT5A 1Z5NA 821PA 2VZ0A 4Z7JA 1NU8A 2A0XA 3KDPA 1N2CA 4GZ6A 4BO5A 3RPEA 2FPPB 2CXNA 4JGIA 2JCVA 4MGIR 2GFHA 2APJA 1QYWA 4ZA2A 3PC8C 1L7PA 3U4QA 4Y18A 2QRKA 4UVDA 2V3WA 2PH3A 2WIUB 5IX8A 4Y1EA 1J9GA 2FF7A 4LJ8A 2O2JA 4Y1RB 5T8KC 2BRUA 3M6VA 1ZVJA 1FEZA 3AF5A 1O4XA 1R6DA 3H7AA 4LDRA 4Q1DA 2RGCA 2VSXA 4WECA 3FB4A 2WHYA 5FT9A 3TSCA 1N7HA 2I22A 3ACCA 2E89A 2ZSEA 1KU0A 3LBYA 2D74A 1TKNA 5KCMA 4HDAA 2CJPA 4JURI 5CAEB 4CCWA 2E3JA 3QMWA 3RSQA 2X1MA 3ZV7A 4L3OA 4MMXB 1VYVA 1Y8QB 2O3RA 1RIOA 1T3LA 3JQCA 5KAPA 4H1UA 1NTRA 3STVA 3OTIA 5FWDA 4YAKA 1BDJB 5I4BA 3F46A 3F5FA 5EHXA 3WA7A 5L0JA 3GUZA 2VHEA 1EVQA 2Q00A 2R0QC 4Q4HA 1E77A 4EVSA 1EGMB 3VDXA 1J21A 1F5SA 2GK7A 2G3KA 4N47A 3R5TA 4WEOA 4JROA 5E38A 1SVWA 2A4KA 2VK1A 1H93A 2ZJOA 3OPXA 4HFFB 2BMEA 1BRTA 5BWCA 3IBSA 5AH0A 4PFSA 4XSHA 1Y37A 4DCTA 4FTWA 5IN4A 3OT1B 2AYXA 3AM1A 4RVHA 2HLHA 4EB3A 2GEBA 1Z4OA 5CA0A 4OUDB 2QRNA 5LZ5A 1XXLA 1XTBA 3MFYA 1XP5A 5LXTF 4YAWA 2RHJA 3EMBA 2ZUVA 1TAQA 4QE3A 5TDHA 3KMIA 3QYAA 1EM8B 1GRNA 4MOWA 3C8HA 4XKJA 3BEHA 4WFJA 3AYXB 4ZOQI 3WHNA 3H5IA 3OUUA 1BE6A 3FZNA 3A31A 3OWOA 4YHBA 4CTKA 1K88A 3RJTA 4XX0B 2PWAA 3CNHA 4X95A 3TOXA 5CD1A 2FQXA 2BH2A 3ADBA 3I1YA 4UNPA 4V2UA 4HFMA 3UMKA 4WE3A 2PL9A 1XZEA 3I9NA 1FU4A 4FX5A 5L4SA 4FIZA 1OWMA 4ZPXA 2V4MA 3GJ6A 2G04A 3KPUA 2FOIA 1P5RA 4HQLA 1VJGA 2HFKA 2IZ6A 1UODA 4BFLA 1P1IA 4E5VA 1L4YA 4LE2A 1S4MA 4M1QA 4IIEA 4PCUA 2Q6LA 4PIVA 1L1EA 3KC2A 3GN5B 4CCYA 3L8JA 3I9V6 1EMDA 1Z2NX 1XELA 2W4QA 3RF6A 1LJLA 4RDAA 5HRCA 3VV3A 1GSAA 1T36B 1QR6A 3RT9A 2NWQA 2HV6A 4U7JA 4IDHA 2NO7A 5H4GA 3VR1A 2WR8A 1DJOA 2I1VB 4ZHQB 1W2HA 4FGJA 2IEZA 1NXSA 2YHIB 2OFPA 2PXHA 3C70A 2X2PA 4YAUA 2IUTA 3DAOA 2CF6A 4QGHA 3CZQA 1E3IA 3A04A 3UATA 3D31A 4FFWA 4U5FE 5C31A 4MS3B 2OWDA 1G8FA 4MUKA 1B8NA 1C2YA 4GXQA 3KHSA 4FS3A 3I4UA 2Q3HA 1KI1A 3EGIA 5IF3A 2B21A 1WB4A 4JB0A 2I15A 4OGKA 5BQIA 4LMAA 4C9BA 3FKQA 2DHQA 1BFKA 1TJ3A 3QLVA 3J81k 4NONA 1MOZA 2GEVA 4J30B 4BAZA 2AFRA 3HA2A 3DDNA 1YBHA 2ZBVA 2RJNA 2PVCA 4NIMA 2PIAA 4C22A 3FKSA 1AKWA 1UBGA 4L6IA 2YJZA 1GO2A 1P2BA 2G82A 3U17A 2HA7A 2C04A 4PWYA 1LGYA 3CLRD 3ABZA 4MINA 5AWFC 4HN9A 2EKDA 2DQYA 2J1LA 3WICA 4EF4A 3DNPA 2EWTA 3OQHA 1WXDA 4JBNA 1J8MF 4JJ4A 1M6VB 1SFRA 4WZBE 2W45A 2BZSA 3QE3A 4KRXA 4ZQEA 3PDMP 3FTNA 3USES 2FB9A 1POXA 4G8BA 5BV2P 4NJOA 4K0RA 4DV0B 3SHQA 4MIEA 1I3KA 3CJRA 4NXNB 3VZDA 5DYYA 1Q0KA 2IZ7A 3LM8A 3RTGA 3DVAA 4EFMA 4C4ZA 1PZXA 2RH8A 1DV2A 4FGWA 5TMDA 2CNNA 4IDQA 4X1OA 4N6NA 1GNTA 1A5TA 3MRXA 3HPRA 3ANYB 2I4MA 5SZIA 1SU7A 4RWZA 3CZAA 1G2PA 2FR1A 2DTXA 2QG9A 1BWPA 2HFIA 4CUZA 4CL3A 4TS1A 1O97D 4B4OA 4R8VA 4NU6A 2ALJA 2DT5A 4F2WA 5CLIA 4MP3A 3KQUA 1ND6A 4Y2VA 1PYGA 3WNDA 5ARDA 1T2UA 2FWAA 4Q3OA 5CB4F 3GNQA 5CJJA 2PWPA 1QBKC 5BUOA 4MROA 2PUCA 3GP3A 2QZ9A 4D43A 2B5WA 1HMPA 1SBTA 1FX0A 4WWHA 1MXHA 3HLYA 1RAAA 2BEWA 3ICQB 4YASA 1VBFA 5AKJA 5KNDD 1NYRA 2VIIA 5M29A 4CM9D 5UKDA 4X00A 2NSGA 3A0UA 1RM5A 1RKCA 5BR4A 1XWWA 3OAAD 2R8YA 2E4YA 1NZJA 5KTNA 3I92A 5K0GA 5LZ2A 1N2IA 3H05A 5LQCA 1OTXA 1PP4A 2NVOA 4WLVA 2PO5A 3F6BX 1G20A 4AO6A 4LQLA 1BG6A 2QSUA 1J42A 4FYWA 4IM7A 3DPIA 2AUNA 1EX7A 4KW7A 3ADPA 5CG1A 3D3WB 1UFOA 3EZFA 4KWEA 2IYYA 3K09A 2POQX 1KFBB 1Z88A 3ETNA 1T4GA 4UHKA 4Q12A 3NDPA 1IN1A 2G1UA 2X86A 4RSRA 1P1KA 1JHVA 2BCGY 2JZCA 2F55A 1JQ3A 3T38A 4N6CA 4RULA 1DAMA 2WKPA 4I2NA 3PNBA 3F7NA 1XZAA 2JJ2D 4YRDA 1W59A 3C41J 3SHOA 5TF0A 1XQXA 5DLQC 3TRFA 2IUUA 1TMKA 3SEFA 4I7EA 5DB4A 2E5WA 3GZTB 4MVQA 1Z68A 3MRTA 1EYZA 4MRPA 3CXUA 2E6KA 3MQ2A 3OIVA 4GOKA 4WJKB 2OHHA 4DSAA 3O9ZA 1JLRA 2OV1A 3U6BA 1H5UA 4MZDA 1IM5A 2Y0BA 3PYXA 4AURA 3UFBA 2GPYA 1M6HA 2VBGA 1J22A 3GXBA 1LPEA 4DVZA 5DP2A 1LI7A 4CKWB 1RQ7A 4LYJA 3WYCA 1QVZA 5TQVA 4J1XA 2YRFA 5G41A 4QPNA 3OBBA 3NZEA 4OXYA 1W36B 3FMSA 3NYRA 1TOAA 2WMDA 4DLYA 5IPFA 4L75A 5FPHA 2EW1A 5CXXA 4HDKB 3WXBA 4Z9HA 2O2CA 4EIYA 1TAUA 1SHKA 2XKBA 4X84A 1T6XA 1DNPA 7MDHA 2R44A 1XZHA 3R5JA 3ILSA 2AUTA 1N34B 2EKQA 3LVRE 3LUDA 3ZS9A 2E1RA 1QHXA 3LCCA 1GPBA 3CCFA 2NACA 2YJ3A 1DCKA 4MYDA 2OV2A 5SYAA 2FR8C 2CXXA 2CVZA 1UMCB 1M5UA 1SO8A 2XOXA 2JIZD 3PEWA 4GKBA 3QX9A 1WLSA 4N06A 2FFRA 4RDCA 5GVSA 4JLVA 4BZPA 1NOKA 3RSZA 3JRNA 4CN9A 3OQJA 5SY4A 2L1PA 3OY2A 2QTVB 2NYVA 3CU5A 1PRVA 3TXAA 2Z43A 1Q7CA 4CMCA 3LX6A 2VUUA 1X7ZB 4Q93A 5D87A 4OP3A 4YUWA 2WWFA 1TUIA 1KO7A 3GLIB 2W6IA 2XV1A 2R7NA 3NORA 1YFLA 3TW6A 2CGEA 4FN4A 4GECA 4O4LB 3WRVA 3R0VA 1K63A 1I6KA 2XI8A 4BMXA 5AOVA 5TT1A 4GPBA 2V45A 4IMIB 1S05A 5CEEA 1VOTA 2TECE 2YVQA 3FHJA 1RRMA 3AOEA 1A7DA 1VP9A 2JCYA 3PIRA 4PU8A 2OB2A 2O2XA 3ITKA 4EYKA 3ZU5A 3KYIB 1XD2A 4Y2RA 3AR3A 5I9BA 4ZOAA 4RDIA 4IWNA 1ODIA 1ZXBA 4Q1BA 3INGA 2E9SA 4F93B 1ZL0A 2UZ3A 1KSGA 1EBFA 1V16B 2UUPA 4RORA 4PYKA 3HB1A 1ZN2A 3HJHA 1ADRA 2XWQA 5L3ZA 3MJHA 3R5SA 3D0RA 1Y7LA 3ZY6A 5JXJA 3RB8A 1YUBA 5BV8A 4Y2JA 3GPIA 4RF3A 1UQRA 1TK9A 4OFXA 5J2UB 4EG8A 5EZSA 2IIPA 4WKGA 3UJ9A 4H7EA 3WK7A 2AKAB 2PXAA 2XECA 3T9BA 2HHLA 1KJZA 1Q3TA 3NDBB 3DLTA 5E8RA 1VKZA 3I23A 2FEPA 4AY6A 1NXPA 4FZ5A 4JIGA 2BBOA 3QQ5A 1U6KA 1DEHA 4BV9A 4OJNA 1Z0UA 1WJGA 3ZWBA 1XTUA 1WQ1R 4RTQA 2LV8A 3ID6C 1W75A 1MRZA 1CT9A 1G5IA 3G2LA 4OXNA 3PUWA 1XQ9A 2QTMA 4N3AA 2F1IA 2C92A 3H3JA 1DIRA 2B0JA 1WB6A 4HXYA 1EI7A 1YBAA 3BK2A 4JFRA 3HKCA 2IEAA 4YUAA 4ENRA 3ZGLA 2OORC 4X65B 4R05A 4UU0A 3RBVA 1RRGA 2VBFA 2GJKA 4NQRA 3TTUA 1WPQA 4QC2A 2FEAA 1MX9A 4P4GA 1L7CA 4C0BA 1Z16A 2D13A 4YRFA 3RODA 1SXJE 5DNDA 1AKRA 1U90A 3EE6A 4X0RA 5I3ZA 2JASA 1ZXLA 3QPVA 1DOVA 3TJ6A 3DBLB 3UCFA 5H9VA 4X4HA 3C5HA 4EK9A 2VZEA 3N0XA 1U0OC 4ZEXA 3PZBA 2GZ2A 2IIBA 4FKBA 2HJ9A 5KYUA 4TM7A 1CHDA 4BXOB 3SGLA 1UBFA 3G82C 1YZ3A 5LPNA 2ES4A 2HWKA 3CVUA 5A6KA 2FF5A 2O6HA 2Q3FA 3VPHA 4OFBA 1DRKA 4P22A 3GLKA 2CEAA 1SCDA 4GH5A 5BYJA 1F9EA 4EJ0A 4IDDA 1FIUA 2EGUA 5D2CA 1Y9ZA 2DVMA 1R00A 4ZO4A 3Q8MA 2BC5A 1ZMXA 3PA8A 3QE9Y 3K6JA 1OILA 3SIRA 3PXAA 3KB2A 3J06A 3HSKA 4IY1A 3IQCA 4ULWA 1OVMA 1Z22A 1U6IA 1JDZA 2HA0A 1PLJA 3QQPA 4F8YA 2VUTA 4LFCB 3MPUA 4MUGA 3BGVA 1ZUNA 1ZICA 5KOYA 1I4LD 2C7OA 4A27A 3KQNA 4RJLA 1NY6A 4DQXA 2DB4A 4LY3A 1TR2A 1J7KA 4JZYA 3WO0A 3EZXA 2QM7A 1N33B 3U26A 1EH5A 2WTXA 5HRUA 1WCYA 1RZVA 1UWLA 3IULA 2XUHA 4QECA 2ZU0C 2W6PA 2QT1A 5JZVA 4HDQB 2CHFA 3H0EA 1GGFA 2F90A 4BLSA 2RBEA 3DTVD 3QEOA 4L9SA 2CE7A 3U7IA 1KMIY 2JD3A 4I5GA 4A3SA 4WN3A 4YRLA 3L1JA 4JAVC 3OPYB 5IRCD 2G9ZA 4BFTA 2X5JO 3V8EA 3TUJC 2GF0A 1JR2A 2OBFA 4ZYWA 3WQHA 5JNUA 4X85A 2AW6A 4TKLA 3KEGA 1VBNA 4YK7A 3GGGA 3PE5A 3FYUC 3RKUA 4F0JA 4RTNA 3JXCL 5ALTA 3KTAA 5ARCA 4DSZA 3TK1A 3GP5A 1JTEA 1FTNA 4AZVA 3DKRA 4BJ6A 3L0BA 4XB1A 3RYCB 1AGPA 2XUPA 2VT2A 3TLXA 3ECSA 2JZNA 4LMBA 2BHTA 2VWPA 3MB5A 1P4RA 4KQMA 2WHXA 5I9SA 1YQXA 2JJMA 2R60A 2A0WA 3T3IA 1YL5A 3BM5A 1NC1A 1U2GC 3GEMA 4M63A 2ZE8A 2ZT7A 5IH7A 4PWZA 4YJKA 2H1FA 2J0VA 4DQVA 1LPPA 4JP3A 2C57A 4D92A 3PPVA 3DTTA 1X7HA 1I2MA 4C6TA 4G0PA 5AW5A 3FOOA 4EA8A 3D4LA 5BW6B 3DE3X 421PA 4MV3A 2WZFA 1Q5PA 5AW0A 5BOVA 4WCDA 3DAFA 1N7GA 3IXMA 1OBFO 4I1MA 4YP9A 3ZDDA 2I2AA 3PA6A 4I1VA 4ZCRA 5HVNA 5JYEA 3T3PB 1RM4A 4C7VA 4IZ6A 1V3UA 2JI8A 5ITWA 1RPAA 221PA 3GRUA 1FP2A 1N6NA 1B6SA 2DUNA 3MEQA 3JQBC 3QKSA 2ODPA 4PSAA 4D4JA 3ETGA 2B9VA 5CDHA 5CM8B 3IAAA 2N75A 3FYAA 4PU4C 2RK4A 1LNQA 1YI0A 3Q4GA 3CBGA 3ZOZA 4MS4A 1NAIA 4NPHA 2R6HA 4X1IB 4MMYB 1JG4A 2RH9B 4L22A 3KHKA 5ED4A 1U02A 2FN3A 3GQBB 1CEXA 1NX6A 2PLRA 3W78A 4GVLA 3WBFA 4V1CB 2QVBA 1SQFA 4XFDA 4A2WA 5I01A 2JC3A 1FP6A 1L1MA 4C4TA 1A9RA 1DAIA 4C0JA 2B6NA 1KDYA 5J5AA 2P2GA 3FWYA 4CT0A 9ABPA 5E7MA 1T8PA 2XCRB 1QGDA 2NQTA 1FFHA 1PR3A 3M1IA 3HB4X 4UPEA 1UZAA 2DSNA 4HLDA 2MYUA 4HEJA 2UYYA 2EFDB 3PUKA 3TMYA 5AJWA 3C3AA 3G02A 4OSEA 3CGGA 4CHGA 4RA9A 3FPJA 1VYKA 3CVYA 2W2OA 5JT4A 2J3IA 1KDPA 3RG2A 4TYPA 1YQTA 1XKQA 2H5LA 5T4BA 1E2HA 4DVGA 3WYAA 2X1HA 3OQVA 1L4LA 2RDMA 1TUEA 4CW7A 2XRZA 4Q24A 1K0UA 4ASUA 2FPPA 3NROA 3V1NA 4ZCMA 1P7PA 2FW8A 5FA6A 2AN5A 2RGBA 4EYGA 3KJIA 4FBGA 2X1VA 5COMA 2HF7A 1JW9B 5MGBA 3IHUA 1KYIA 1RWOA 1Z06A 3WGTA 2HO5A 4Y1RA 1PJAA 1IPHA 4EX6A 1E60A 3KU4A 1RM0A 4YN3A 1A97A 1A9YA 4QEKA 4KLCA 1DV1A 1AUXA 4GS5A 3H65A 3PXCX 2R7LA 2LYSA 3QRWA 4MUIA 3R2JA 3ADOA 3DVAB 1RQRA 5CAEA 2JEYA 2AIRA 5IKPA 2B2NA 4Q1VA 1K7CA 4H1HA 4Q82A 2Y3HA 4RO0A 1WN0A 3X1KA 3D1LA 3ZG6A 1FFCA 1MFPA 5FP0A 5AW6A 2QJWA 3ZWIA 1N3IA 4PRZA 3ABLC 3K2QA 1BDJA 4Z3KA 3RBXA 4KQ9A 3M1YA 1WRBA 2G1JA 2WT8A 4G25A 3AY0A 5JCXA 3BRSA 4U2DA 2FSFA 4H6VA 2P6UA 1R0CA 2OCKA 4E6PA 3LWBA 4IA8A 1ZBDA 4PK4A 1XVAA 2JLRA 3DGFC 2HCJB 2RGDA 3TMKA 3UHAA 4K86A 2BFCA 5JS6A 3UPUA 1HX7A 2ZULA 2B37A 3JATA 5AK5A 4YXWA 4W7IA 3E9VA 2FOXA 3LD9A 4EI7A 1Y33E 5KX5F 4PSKA 4EPYA 1GGJA 3OT1A 1FSSA 3HDYA 4E0HA 1NVUQ 4LF4B 2W42A 3EWNA 1WV1A 4OUDA 2QJTA 1DVRA 2VTDA 1SG9A 3PZRA 2NXNA 4DMCA 4FLEA 3S3TA 5FCLA 4P0TA 3SZGA 2YWAA 4M0DA 1Y6ZA 1YVIA 4RL6A 2Q7OE 4M9UA 1JQEA 2Q0QA 1EM8A 1SD1A 1JKIA 2PJUA 3RHSA 1NUSA 3D3JA 1DXOA 2BGWA 1A3CA 1KFCB 2ETVA 3BULA 4N9WA 1XA0A 1U1IA 1OQAA 4YO7A 1T9ZA 3V2UA 1IZ8A 4XX0A 5FF9A 2I9PA 4DGQA 3OE7A 3FLAA 2EF8A 1O8BA 2IYSA 4PINA 3WYBA 5L7TA 3HDGA 1P2UA 4DC1A 4G0MA 2FOLA 1SRQA 4ARCA 2X6RA 5EQFA 3TNJA 1UINA 5B30A 4PFKA 1MPTA 2V6JA 3BZWA 4PBSA 2Y2UA 3FNGA 5HQTA 3BJZA 3EMDA 4KVZA 4ZI7F 2YIJA 2EJVA 3NYWA 5JXGA 2EBYA 2BTQB 1XRLA 5CP8A 4PYRA 3ERCA 4PXSA 4YUYA 1DC7A 5U4QA 3ZK9A 5JO9A 4KRFA 4HNRA 5B3JA 1CR1A 2JCBA 3GN5A 4GOXA 3EDQA 3OIUA 2W5UA 2YJTD 3BT7A 4NV1A 1TKCA 3EZIA 1T36A 2J3DA 1SHZA 2D2FA 4WKBA 3WGOA 4TGLA 4EHDA 2FUKA 3H8SA 2ZSDA 4KC9A 4M8LA 2GPSA 4MV7A 4ZHQA 3EEFA 1KAEA 4JWTA 5EQJB 2YHIA 3FSJX 1R3DA 1F4PA 1V5IA 1M8PA 3ZIBA 3GDFA 2EQAA 1A71A 2PZKA 3QMMA 3DO5A 5IAJA 2JLBA 5C4IA 3H11B 2HWXA 1RVV1 2WWXA 1I7DA 2HA4A 1ZPDA 4QBFA 4MS3A 3N74A 4RGQA 4W1QA 1SC6A 4EGQA 2VWHA 4NCHA 2HFZA 1S8NA 2WRZA 4KGZA 2Y1XA 5ELMA 1GHTA 2BFMA 3KVVA 3V4ZA 3E9MA 3DYVA 1WTCA 2A88A 4JZKA 4P35A 3KWJA 3EPRA 3GWLA 2FYTA 4MV0A 5CPFA 2PZMA 1A9ZA 1JQLB 3BXEA 2ZE5A 2FY8A 2XHZA 2FUG6 3F3MA 1CLEA 1L3PA 2D4HA 2GAIA 3DAPA 3OX3A 1TTTA 2BSQA 3NHSA 2JH9A 5FUVA 1PSWA 3BHJA 1P77A 4DXAA 3A9RA 3FR7A 2V9ZA 2QT0A 2IEYA 2RKBA 2GN8A 1O87A 3ABIA 1D1SA 4WKCA 3TG8A 2O05A 4GE0A 4HLUA 4ZIRB 4AG5A 4C1NA 2J9VA 2ODBA 2OK8A 3ZDQA 1TQHA 5E1OA 1XMXA 2ZGVA 1EEXB 3P9XA 1Z33A 1E9CA 1EU1A 3ZWYA 3C8GA 3GJSA 2PGIA 3HY6A 1V95A 1EXWA 2KB0A 1SQ5A 1XD9A 2D6FA 3H5RA 1VPVA 3O4GA 4QBIA 3SF8B 3G5TA 2HPAA 4YONB 5CYGA 3LTNC 1BH2A 3ADKA 1PV3A 3ZXYA 1U80A 4LV8B 4G5QA 3GPCA 3DWGA 5L51A 1Q6YA 1A7EA 4QGAA 3UWKA 4MVJA 1IL0A 1IPEA 5CI8A 2VATA 3EUFA 4BNDB 4G89A 5KTOA 1XD2B 4BMZA 3N39C 3BJRA 3F71A 1WDWB 4EKDA 2Z8YA 1AKMA 1XV5A 5B55A 1SVSA 3ASYA 1R6UA 1TCCA 4CL2A 2WNIA 3F6PA 2D5CA 2GAOA 4HZGA 1PL8A 1IDOA 3JWEA 4CR7A 4UDYX 3AHIA 4G37A 3ECCA 3D3EA 3I45A 5C7OO 1B23P 3O9MA 4F4CA 3EGXB 1ZCFA 4DBVO 4YTEA 1H9CA 1Q95A 4MPJA 3L84A 1PTKA 1AMOA 2CXSA 2G17A 3OTQA 2QX9A 1ACMA 3ZIAA 4TTQA 4N8SA 5LL6P 4E3WA 4XFJA 1LKZA 3OSZA 4A0FA 4YL1A 5F7JA 2FZEA 2IHYA 3NEPX 4TV8B 4MWCA 2OCCC 5L95A 1AUEA 2Z4RA 4OK3A 2YHSA 3LUBA 5CLHA 4IX9A 4QJ3A 3LS2A 5IY5C 4G1VA 3JYLA 1DXHA 3P9QA 1J90A 3IR6A 3K35A 3FUVA 2G70A 2J3QA 3LT0A 2J9BA 3GD7A 5THXA 4LC0A 2JJ8A 2X5OA 5IH3A 4XGNA 1SC4A 2J32A 1MC8A 5FPYA 1DC6A 2I2DA 2QYTA 4RLFA 3I8SA 3WIDA 1V4AA 4Z9YA 1MIOA 2PEZA 5B5SA 1BR2A 2GAJA 2H17A 4CMKA 2GVZC 3UA4A 2H06A 1HY3A 2ZYDA 7ADHA 1TUBA 1E2FA 4G4SP 1AQJA 2YINC 1WUTA 1KH1A 3OHPA 5K8UA 4DR3B 3OTGA 1PS9A 4LA4A 4ZZ2A 2PRSA 1Z5PA 3ORFA 2ET6A 2OHFA 5KYNA 5IBRA 3W4KA 4Z0HO 3P9CA 3HB5X 1HQKA 4H7JA 4G7HF 1JG6A 2GVDC 2XXJA 4P6IC 4LRUA 3BBPA 1DEXA 1DEOA 1XALA 1ORYA 3GVIA 3P9YA 3MFQA 4KSYA 3UZUA 3HNJA 3ZH9B 4M7OA 4MVSA 3EQZA 3ZE8A 2OXIA 4JNCA 4M9XA 2AG5A 5M5BA 5ALWA 1NNLA 2PL5A 1OCRC 2GCEA 4O8CA 3AF2A 1J97A 2QVLA 1VSUA 2C3YA 2I3GA 2ECFA 2H3EA 1EKXA 2IHUA 3LC2O 4NICA 4MQLA 2PQ0A 1XG5A 4BLOA 2EKLA 3A2MA 3QVLA 4HDKA 5DOZA 3RSFA 2C9DA 1RI1A 1U3WA 1EFRD 3EODA 1YE5A 4Z58A 1MB9A 2O7VA 1VB5A 4RENA 5JCPA 4HKTA 3EJWA 3I1FA 1LCDA 4YJFB 3IQHX 2ZI3A 3L1MA 1PZNA 3CCBA 1UMCA 3NKDA 3E27A 2EBUA 2X0NA 3RH3A 1E59A 3CBQA 5LDHA 1A5SB 1FNDA 4X66B 2JFOA 4KN6A 1I3OA 4AI6A 3CVOA 4WA7A 2EFEB 4EUHA 2PX0A 4R68A 3FPCA 4NE9A 1P0FA 4BYGA 1N7IA 5JHGB 4A1OA 4JU8A 2OCPA 2QTVA 3KTAB 3EC1A 4KZKA 4WTOA 4UXJA 3TYXA 1JJFA 5CDUA 2A9JA 3IX7A 3B1KA 3DFZA 3ZLVA 1BIFA 2V74B 3G88A 1X7ZA 2JGDA 3CSDA