1UXCA

Fructose repressor dna-binding domain, nmr, minimized structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords FRUCTOSE REPRESSOR
publication title Three-dimensional structure of the DNA-binding domain of the fructose repressor from Escherichia coli by 1H and 15N NMR.
pubmed doi rcsb
source organism Escherichia coli
total genus 13
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1996-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1uxcA00
3F51A 1IC8A 2PE5A 2AWIA 3L1PA 4Z5HA 5A7LA 1ZAYA 2IV1A 3G5GA 2L8NA 2PUFA 1PRAA 4YG1A 1ZZ7A 2PUEA 4PU7A 1OSLA 1L1MA 1DWKA 3OQMA 2BNOA 3F52A 3GBFA 2AUWA 1WH8A 3TRBA 3IVPA 5K98B 2O49A 4I6TA 1BDIA 1ZZ8A 2GRLA 3FYMA 1RZSA 3F6WA 3BS3A 2JCGA 3O9XA 1NERA 1YSEA 2WUSR 1ZS4A 3SCGA 2H8RA 2LYLA 3OP9A 3QF3A 4X4HA 3ZKCA 1S7EA 4FN3A 4JQDA 4YG4A 1QP4A 1PNRA 4PU8A 3BDNA 3R1FA 3ZHMA 1B0NA 2KPJA 3CECA 4GQMA 1PRVA 2A6CA 2LYKA 2OR1L 1R69A 2EWTA 2O4AA 2KZ8A 1PERL 2KEKA 2PUDA 1QP0A 4I6UA 1JH9A 4MCXA 1WETA 2AXUA 2XJ3A 3SCHA 2PUBA 2AXVA 1JFTA 3KXAA 3OQOA 2WIUB 1X57A 4YARA 2IVQA 4X4FA 3SCFA 4X4EA 2OFYA 4OB4A 2IVBA 1Y7YA 2L49A 4X4BA 3G7DA 1ZZ9A 1JFSA 4NDWA 1OCTC 4Z59A 4X4CA 1RPEL 1LLIA 4Y42A 2MQKA 3FMYA 2XSDC 3OQNA 2BJCA 2LCVA 3DNVB 1VPWA 1UTXA 3ZHIA 2BNNA 3QWGA 3VK0A 1LCCA 2R63A 1SQ8A 2CROA 4Z5DA 4IVZA 4I6RA 3GN5B 1RIOA 4Z58A 3S8QA 1UXCA 1UXDA 2GZUA 2IUOA 3D1NI 3U3WA 2IVGA 1HF0A 2HSGA 3JXDL 2LYRA 1E3OC 2GRMA 3OMTA 3CROL 2PUCA 1ZPQA 1PRUA 4MCTA 2R1JL 1DW9A 2XCJA 3KZ3A 3CLCA 2IU7A 3B7HA 2CSFA 3MLFA 4X4GA 3EUSA 4PU3C 4I8TA 3HZIB 2XIUA 2KEIA 3KJXA 2FJRA 1ZZCA 2KEJA 4JCYA 2AXZA 2XI8A 4PU4C 4Z5CA 2JVLA 2LYSA 3JXCL 3H5TA 4J1WA 4X4IA 1QQAA 1LQCA 2BNMA 2ICTA 2MEZA 3JXBC 2D5VA 4JCXA 1BDHA 1EFAA 1ZUGA 1ZZBA 3FYAA 1QQBA 1X2LA 1RZRD 1XWRA 1RZRA 2PUAA 1POUA 2LYJA 1Y9QA 2HINA 1NEQA 4X4DA 3UFDA 4O8BA 4YG7B 2ICPA 3RZZA 1QPZA 1ZZ6A 2EBYA 2PPXA 3LISA 2O38A 1LCDA 1CJGA 4GHJA 4J1XA 1O4XA 1GT0C 4IA8A 4IWRA 2PUGA 4F8DA 4YBAA 1LMB3 1WIZA 2EF8A 3GN5A 3QYXA 1ZVVA 1CQTA 1ADRA 3PXPA 4FBIA 1AU7A 1JWLA 3QQ6A 2B5AA 2LYPA 1WH6A 1R63A 2PIJA 2AW6A 3BD1A 1QP7A 2LYQA 3LFPA
chains in the Genus database with same CATH superfamily
3F51A 3VWSA 1PRAA 5GAGi 3OQMA 3TRBA 3GZCA 2LNMA 2WUSR 5DSXA 1S7EA 1QP4A 3CECA 2PXKA 4GQMA 4DE8A 2KEKA 2PUDA 1QP0A 4MCXA 3SCHA 2PUBA 3PE5A 3SCFA 2IVBA 4X4BA 1U2ZA 4NDWA 2M4HA 2BJCA 4EK9A 4IVZA 4EQZA 2GZUA 3U3WA 3JXDL 3OMTA 4MCTA 3CLCA 3A9YA 3MLFA 3QOWA 4EKGA 2FJRA 4Z5CA 2JVLA 3OKZA 4J1WA 1LQCA 3FYAA 1X2LA 1RZRD 1RZRA 3QOXA 1POUA 5DTQA 3UFDA 4YG7B 1QPZA 2EBYA 4ER7A 1CJGA 4F8DA 3PXPA 4FBIA 1JWLA 4PU8A 2LYQA 1IC8A 2PE5A 2L8NA 2PUEA 1MFQC 4PU7A 1L1MA 1HQ1A 2BNOA 2YBDA 4HRAA 3GBFA 5K98B 3FYMA 1RZSA 3F6WA 3BS3A 2PXPA 1YSEA 3DM5A 2H8RA 4FN3A 4YG4A 1PNRA 3GZDC 2EWTA 5DRYA 1WETA 2AXUA 4YARA 4X4EA 1Y7YA 3G7DA 3FMYA 1VPWA 2LCVA 2HCNA 2BNNA 1RIOA 4I6RA 3GN5B 3D1NI 5DRTA 1E3OC 3ME5A 1ZPQA 1DW9A 2XCJA 2PXVA 2PXDA 3EUSA 1ZZCA 2AXZA 4PU4C 3JXCL 3JXBC 3TEPA 2D5VA 1NW3A 1ZUGA 1QQBA 1XWRA 2PXBA 1Y9QA 2HINA 4X4DA 1ZZ6A 3LISA 2LLVA 2O38A 1LCDA 3LQXA 4GHJA 1O4XA 4IA8A 4IWRA 2PUGA 1LMB3 1WIZA 2EF8A 1ZVVA 2LYPA 4ER5A 1R63A 3QFIA 4ER0A 2AWIA 3UWPA 3L1PA 4Z5HA 1ZAYA 2IV1A 3G5GA 2PUFA 4YG1A 1ZZ7A 3A9XA 3KL4A 3GZDA 3F52A 2AUWA 1WH8A 3IVPA 4I6TA 2JCGA 4OBMA 1ZS4A 3M9LA 3QF3A 4JQDA 5DTRA 1B0NA 1R69A 1JH9A 1JFTA 3KXAA 2WIUB 2IVQA 5DT2A 2V3CC 2OFYA 4OB4A 2L49A 2MXDA 1RPEL 4DE9A 4Y42A 2MQKA 2VEOA 2XSDC 3DNVB 3NROA 3SR4A 1UTXA 3ZHIA 3NDBB 3VK0A 4Z5DA 2CROA 3TFLA 3ZPXA 2PXLA 4Z58A 2IUOA 2IVGA 2LYRA 2J7WA 2XXQA 2GRMA 5JUWA 2PXTA 2PUCA 1PRUA 3KZ3A 4ER3A 2IU7A 4I8TA 2XXPA 2XIUA 1DULA 2LYSA 4X4IA 2MEZA 2ICTA 3OWQA 4JCXA 1BDHA 1EFAA 2PUAA 5GAHi 2L1PA 2ICPA 3RZZA 2PPXA 3R09A 1GT0C 1QZXA 4ER6A 3GN5A 3QYXA 3NXHA 2PXQA 4EZIA 3QQ6A 2B5AA 3G0TA 1WH6A 2PIJA 3BD1A 3GUUA 3LFPA 5A7LA 1OSLA 1DWKA 4EKIA 2JQEA 2O49A 1BDIA 1ZZ8A 2GRLA 3O9XA 1NERA 2HCSA 3SCGA 2LYLA 3OP9A 4X4HA 3ZKCA 3BDNA 4Q2JA 2PXEA 3R1FA 3ZHMA 2KPJA 1PRVA 2A6CA 2LYKA 2OR1L 2O4AA 2KZ8A 1PERL 2XXAA 4I6UA 2XJ3A 2AXVA 3OQOA 1X57A 4X4FA 1ZZ9A 1JFSA 1OCTC 4Z59A 4X4CA 2HFZA 3TELA 1LLIA 2J7UA 3OQNA 3A9ZA 3QWGA 1LCCA 2ODRD 2R63A 1SQ8A 3S8QA 1UXCA 1UXDA 1HF0A 2HSGA 3CROL 2R1JL 3SX0A 3MEJA 2CSFA 4X4GA 4PU3C 3HZIB 4WVLA 2KEIA 3KJXA 2KEJA 4JCYA 2XI8A 3H5TA 1QQAA 2BNMA 5DTMA 1ZZBA 2FFHA 2LYJA 3NZLA 1NEQA 2LLWA 4O8BA 4J1XA 4YBAA 1CQTA 1ADRA 1QB2A 1AU7A 2PXUA 2PXFA 3B7HA 2AW6A 1QP7A
chains in the Genus database with same CATH topology
3F51A 1IC8A 2PE5A 2AWIA 3L1PA 4Z5HA 5A7LA 1ZAYA 2IV1A 3G5GA 2L8NA 2PUFA 1PRAA 4YG1A 1ZZ7A 2PUEA 4PU7A 1OSLA 1L1MA 1DWKA 3OQMA 2BNOA 3F52A 3GBFA 2AUWA 1WH8A 3TRBA 3IVPA 5K98B 2O49A 4I6TA 1BDIA 1ZZ8A 2GRLA 3FYMA 1RZSA 3F6WA 3BS3A 2JCGA 3O9XA 1NERA 1YSEA 2WUSR 1ZS4A 3SCGA 2H8RA 2LYLA 3OP9A 3QF3A 4X4HA 3ZKCA 1S7EA 4FN3A 4JQDA 4YG4A 1QP4A 1PNRA 4PU8A 3BDNA 3R1FA 3ZHMA 1B0NA 2KPJA 3CECA 4GQMA 1PRVA 2A6CA 2LYKA 2OR1L 1R69A 2EWTA 2O4AA 2KZ8A 1PERL 2KEKA 2PUDA 1QP0A 4I6UA 1JH9A 4MCXA 1WETA 2AXUA 2XJ3A 3SCHA 2PUBA 2AXVA 1JFTA 3KXAA 3OQOA 2WIUB 1X57A 4YARA 2IVQA 4X4FA 3SCFA 4X4EA 2OFYA 4OB4A 2IVBA 1Y7YA 2L49A 4X4BA 3G7DA 1ZZ9A 1JFSA 4NDWA 1OCTC 4Z59A 4X4CA 1RPEL 1LLIA 4Y42A 2MQKA 3FMYA 2XSDC 3OQNA 2BJCA 2LCVA 3DNVB 1VPWA 1UTXA 3ZHIA 2BNNA 3QWGA 3VK0A 1LCCA 2R63A 1SQ8A 2CROA 4Z5DA 4IVZA 4I6RA 3GN5B 1RIOA 4Z58A 3S8QA 1UXCA 1UXDA 2GZUA 2IUOA 3D1NI 3U3WA 2IVGA 1HF0A 2HSGA 3JXDL 2LYRA 1E3OC 2GRMA 3OMTA 3CROL 2PUCA 1ZPQA 1PRUA 4MCTA 2R1JL 1DW9A 2XCJA 3KZ3A 3CLCA 2IU7A 3B7HA 2CSFA 3MLFA 4X4GA 3EUSA 4PU3C 4I8TA 3HZIB 2XIUA 2KEIA 3KJXA 2FJRA 1ZZCA 2KEJA 4JCYA 2AXZA 2XI8A 4PU4C 4Z5CA 2JVLA 2LYSA 3JXCL 3H5TA 4J1WA 4X4IA 1QQAA 1LQCA 2BNMA 2ICTA 2MEZA 3JXBC 2D5VA 4JCXA 1BDHA 1EFAA 1ZUGA 1ZZBA 3FYAA 1QQBA 1X2LA 1RZRD 1XWRA 1RZRA 2PUAA 1POUA 2LYJA 1Y9QA 2HINA 1NEQA 4X4DA 3UFDA 4O8BA 4YG7B 2ICPA 3RZZA 1QPZA 1ZZ6A 2EBYA 2PPXA 3LISA 2O38A 1LCDA 1CJGA 4GHJA 4J1XA 1O4XA 1GT0C 4IA8A 4IWRA 2PUGA 4F8DA 4YBAA 1LMB3 1WIZA 2EF8A 3GN5A 3QYXA 1ZVVA 1CQTA 1ADRA 3PXPA 4FBIA 1AU7A 1JWLA 3QQ6A 2B5AA 2LYPA 1WH6A 1R63A 2PIJA 2AW6A 3BD1A 1QP7A 2LYQA 3LFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F51 A;  1IC8 A;  2PE5 A;  2AWI A;  3L1P A;  4Z5H A;  5A7L A;  1ZAY A;  2IV1 A;  3G5G A;  2L8N A;  2PUF A;  1PRA A;  4YG1 A;  1ZZ7 A;  2PUE A;  4PU7 A;  1OSL A;  1L1M A;  1DWK A;  3OQM A;  2BNO A;  3F52 A;  3GBF A;  2AUW A;  1WH8 A;  3TRB A;  3IVP A;  5K98 B;  2O49 A;  4I6T A;  1BDI A;  1ZZ8 A;  2GRL A;  3FYM A;  1RZS A;  3F6W A;  3BS3 A;  2JCG A;  3O9X A;  1NER A;  1YSE A;  2WUS R;  1ZS4 A;  3SCG A;  2H8R A;  2LYL A;  3OP9 A;  3QF3 A;  4X4H A;  3ZKC A;  1S7E A;  4FN3 A;  4JQD A;  4YG4 A;  1QP4 A;  1PNR A;  4PU8 A;  3BDN A;  3R1F A;  3ZHM A;  1B0N A;  2KPJ A;  3CEC A;  4GQM A;  1PRV A;  2A6C A;  2LYK A;  2OR1 L;  1R69 A;  2EWT A;  2O4A A;  2KZ8 A;  1PER L;  2KEK A;  2PUD A;  1QP0 A;  4I6U A;  1JH9 A;  4MCX A;  1WET A;  2AXU A;  2XJ3 A;  3SCH A;  2PUB A;  2AXV A;  1JFT A;  3KXA A;  3OQO A;  2WIU B;  1X57 A;  4YAR A;  2IVQ A;  4X4F A;  3SCF A;  4X4E A;  2OFY A;  4OB4 A;  2IVB A;  1Y7Y A;  2L49 A;  4X4B A;  3G7D A;  1ZZ9 A;  1JFS A;  4NDW A;  1OCT C;  4Z59 A;  4X4C A;  1RPE L;  1LLI A;  4Y42 A;  2MQK A;  3FMY A;  2XSD C;  3OQN A;  2BJC A;  2LCV A;  3DNV B;  1VPW A;  1UTX A;  3ZHI A;  2BNN A;  3QWG A;  3VK0 A;  1LCC A;  2R63 A;  1SQ8 A;  2CRO A;  4Z5D A;  4IVZ A;  4I6R A;  3GN5 B;  1RIO A;  4Z58 A;  3S8Q A;  1UXC A;  1UXD A;  2GZU A;  2IUO A;  3D1N I;  3U3W A;  2IVG A;  1HF0 A;  2HSG A;  3JXD L;  2LYR A;  1E3O C;  2GRM A;  3OMT A;  3CRO L;  2PUC A;  1ZPQ A;  1PRU A;  4MCT A;  2R1J L;  1DW9 A;  2XCJ A;  3KZ3 A;  3CLC A;  2IU7 A;  3B7H A;  2CSF A;  3MLF A;  4X4G A;  3EUS A;  4PU3 C;  4I8T A;  3HZI B;  2XIU A;  2KEI A;  3KJX A;  2FJR A;  1ZZC A;  2KEJ A;  4JCY A;  2AXZ A;  2XI8 A;  4PU4 C;  4Z5C A;  2JVL A;  2LYS A;  3JXC L;  3H5T A;  4J1W A;  4X4I A;  1QQA A;  1LQC A;  2BNM A;  2ICT A;  2MEZ A;  3JXB C;  2D5V A;  4JCX A;  1BDH A;  1EFA A;  1ZUG A;  1ZZB A;  3FYA A;  1QQB A;  1X2L A;  1RZR D;  1XWR A;  1RZR A;  2PUA A;  1POU A;  2LYJ A;  1Y9Q A;  2HIN A;  1NEQ A;  4X4D A;  3UFD A;  4O8B A;  4YG7 B;  2ICP A;  3RZZ A;  1QPZ A;  1ZZ6 A;  2EBY A;  2PPX A;  3LIS A;  2O38 A;  1LCD A;  1CJG A;  4GHJ A;  4J1X A;  1O4X A;  1GT0 C;  4IA8 A;  4IWR A;  2PUG A;  4F8D A;  4YBA A;  1LMB 3;  1WIZ A;  2EF8 A;  3GN5 A;  3QYX A;  1ZVV A;  1CQT A;  1ADR A;  3PXP A;  4FBI A;  1AU7 A;  1JWL A;  3QQ6 A;  2B5A A;  2LYP A;  1WH6 A;  1R63 A;  2PIJ A;  2AW6 A;  3BD1 A;  1QP7 A;  2LYQ A;  3LFP A; 
#chains in the Genus database with same CATH topology
 3F51 A;  3VWS A;  1PRA A;  5GAG i;  3OQM A;  3TRB A;  3GZC A;  2LNM A;  2WUS R;  5DSX A;  1S7E A;  1QP4 A;  3CEC A;  2PXK A;  4GQM A;  4DE8 A;  2KEK A;  2PUD A;  1QP0 A;  4MCX A;  3SCH A;  2PUB A;  3PE5 A;  3SCF A;  2IVB A;  4X4B A;  1U2Z A;  4NDW A;  2M4H A;  2BJC A;  4EK9 A;  4IVZ A;  4EQZ A;  2GZU A;  3U3W A;  3JXD L;  3OMT A;  4MCT A;  3CLC A;  3A9Y A;  3MLF A;  3QOW A;  4EKG A;  2FJR A;  4Z5C A;  2JVL A;  3OKZ A;  4J1W A;  1LQC A;  3FYA A;  1X2L A;  1RZR D;  1RZR A;  3QOX A;  1POU A;  5DTQ A;  3UFD A;  4YG7 B;  1QPZ A;  2EBY A;  4ER7 A;  1CJG A;  4F8D A;  3PXP A;  4FBI A;  1JWL A;  4PU8 A;  2LYQ A;  1IC8 A;  2PE5 A;  2L8N A;  2PUE A;  1MFQ C;  4PU7 A;  1L1M A;  1HQ1 A;  2BNO A;  2YBD A;  4HRA A;  3GBF A;  5K98 B;  3FYM A;  1RZS A;  3F6W A;  3BS3 A;  2PXP A;  1YSE A;  3DM5 A;  2H8R A;  4FN3 A;  4YG4 A;  1PNR A;  3GZD C;  2EWT A;  5DRY A;  1WET A;  2AXU A;  4YAR A;  4X4E A;  1Y7Y A;  3G7D A;  3FMY A;  1VPW A;  2LCV A;  2HCN A;  2BNN A;  1RIO A;  4I6R A;  3GN5 B;  3D1N I;  5DRT A;  1E3O C;  3ME5 A;  1ZPQ A;  1DW9 A;  2XCJ A;  2PXV A;  2PXD A;  3EUS A;  1ZZC A;  2AXZ A;  4PU4 C;  3JXC L;  3JXB C;  3TEP A;  2D5V A;  1NW3 A;  1ZUG A;  1QQB A;  1XWR A;  2PXB A;  1Y9Q A;  2HIN A;  4X4D A;  1ZZ6 A;  3LIS A;  2LLV A;  2O38 A;  1LCD A;  3LQX A;  4GHJ A;  1O4X A;  4IA8 A;  4IWR A;  2PUG A;  1LMB 3;  1WIZ A;  2EF8 A;  1ZVV A;  2LYP A;  4ER5 A;  1R63 A;  3QFI A;  4ER0 A;  2AWI A;  3UWP A;  3L1P A;  4Z5H A;  1ZAY A;  2IV1 A;  3G5G A;  2PUF A;  4YG1 A;  1ZZ7 A;  3A9X A;  3KL4 A;  3GZD A;  3F52 A;  2AUW A;  1WH8 A;  3IVP A;  4I6T A;  2JCG A;  4OBM A;  1ZS4 A;  3M9L A;  3QF3 A;  4JQD A;  5DTR A;  1B0N A;  1R69 A;  1JH9 A;  1JFT A;  3KXA A;  2WIU B;  2IVQ A;  5DT2 A;  2V3C C;  2OFY A;  4OB4 A;  2L49 A;  2MXD A;  1RPE L;  4DE9 A;  4Y42 A;  2MQK A;  2VEO A;  2XSD C;  3DNV B;  3NRO A;  3SR4 A;  1UTX A;  3ZHI A;  3NDB B;  3VK0 A;  4Z5D A;  2CRO A;  3TFL A;  3ZPX A;  2PXL A;  4Z58 A;  2IUO A;  2IVG A;  2LYR A;  2J7W A;  2XXQ A;  2GRM A;  5JUW A;  2PXT A;  2PUC A;  1PRU A;  3KZ3 A;  4ER3 A;  2IU7 A;  4I8T A;  2XXP A;  2XIU A;  1DUL A;  2LYS A;  4X4I A;  2MEZ A;  2ICT A;  3OWQ A;  4JCX A;  1BDH A;  1EFA A;  2PUA A;  5GAH i;  2L1P A;  2ICP A;  3RZZ A;  2PPX A;  3R09 A;  1GT0 C;  1QZX A;  4ER6 A;  3GN5 A;  3QYX A;  3NXH A;  2PXQ A;  4EZI A;  3QQ6 A;  2B5A A;  3G0T A;  1WH6 A;  2PIJ A;  3BD1 A;  3GUU A;  3LFP A;  5A7L A;  1OSL A;  1DWK A;  4EKI A;  2JQE A;  2O49 A;  1BDI A;  1ZZ8 A;  2GRL A;  3O9X A;  1NER A;  2HCS A;  3SCG A;  2LYL A;  3OP9 A;  4X4H A;  3ZKC A;  3BDN A;  4Q2J A;  2PXE A;  3R1F A;  3ZHM A;  2KPJ A;  1PRV A;  2A6C A;  2LYK A;  2OR1 L;  2O4A A;  2KZ8 A;  1PER L;  2XXA A;  4I6U A;  2XJ3 A;  2AXV A;  3OQO A;  1X57 A;  4X4F A;  1ZZ9 A;  1JFS A;  1OCT C;  4Z59 A;  4X4C A;  2HFZ A;  3TEL A;  1LLI A;  2J7U A;  3OQN A;  3A9Z A;  3QWG A;  1LCC A;  2ODR D;  2R63 A;  1SQ8 A;  3S8Q A;  1UXC A;  1UXD A;  1HF0 A;  2HSG A;  3CRO L;  2R1J L;  3SX0 A;  3MEJ A;  2CSF A;  4X4G A;  4PU3 C;  3HZI B;  4WVL A;  2KEI A;  3KJX A;  2KEJ A;  4JCY A;  2XI8 A;  3H5T A;  1QQA A;  2BNM A;  5DTM A;  1ZZB A;  2FFH A;  2LYJ A;  3NZL A;  1NEQ A;  2LLW A;  4O8B A;  4J1X A;  4YBA A;  1CQT A;  1ADR A;  1QB2 A;  1AU7 A;  2PXU A;  2PXF A;  3B7H A;  2AW6 A;  1QP7 A; 
#chains in the Genus database with same CATH homology
 3F51 A;  1IC8 A;  2PE5 A;  2AWI A;  3L1P A;  4Z5H A;  5A7L A;  1ZAY A;  2IV1 A;  3G5G A;  2L8N A;  2PUF A;  1PRA A;  4YG1 A;  1ZZ7 A;  2PUE A;  4PU7 A;  1OSL A;  1L1M A;  1DWK A;  3OQM A;  2BNO A;  3F52 A;  3GBF A;  2AUW A;  1WH8 A;  3TRB A;  3IVP A;  5K98 B;  2O49 A;  4I6T A;  1BDI A;  1ZZ8 A;  2GRL A;  3FYM A;  1RZS A;  3F6W A;  3BS3 A;  2JCG A;  3O9X A;  1NER A;  1YSE A;  2WUS R;  1ZS4 A;  3SCG A;  2H8R A;  2LYL A;  3OP9 A;  3QF3 A;  4X4H A;  3ZKC A;  1S7E A;  4FN3 A;  4JQD A;  4YG4 A;  1QP4 A;  1PNR A;  4PU8 A;  3BDN A;  3R1F A;  3ZHM A;  1B0N A;  2KPJ A;  3CEC A;  4GQM A;  1PRV A;  2A6C A;  2LYK A;  2OR1 L;  1R69 A;  2EWT A;  2O4A A;  2KZ8 A;  1PER L;  2KEK A;  2PUD A;  1QP0 A;  4I6U A;  1JH9 A;  4MCX A;  1WET A;  2AXU A;  2XJ3 A;  3SCH A;  2PUB A;  2AXV A;  1JFT A;  3KXA A;  3OQO A;  2WIU B;  1X57 A;  4YAR A;  2IVQ A;  4X4F A;  3SCF A;  4X4E A;  2OFY A;  4OB4 A;  2IVB A;  1Y7Y A;  2L49 A;  4X4B A;  3G7D A;  1ZZ9 A;  1JFS A;  4NDW A;  1OCT C;  4Z59 A;  4X4C A;  1RPE L;  1LLI A;  4Y42 A;  2MQK A;  3FMY A;  2XSD C;  3OQN A;  2BJC A;  2LCV A;  3DNV B;  1VPW A;  1UTX A;  3ZHI A;  2BNN A;  3QWG A;  3VK0 A;  1LCC A;  2R63 A;  1SQ8 A;  2CRO A;  4Z5D A;  4IVZ A;  4I6R A;  3GN5 B;  1RIO A;  4Z58 A;  3S8Q A;  1UXC A;  1UXD A;  2GZU A;  2IUO A;  3D1N I;  3U3W A;  2IVG A;  1HF0 A;  2HSG A;  3JXD L;  2LYR A;  1E3O C;  2GRM A;  3OMT A;  3CRO L;  2PUC A;  1ZPQ A;  1PRU A;  4MCT A;  2R1J L;  1DW9 A;  2XCJ A;  3KZ3 A;  3CLC A;  2IU7 A;  3B7H A;  2CSF A;  3MLF A;  4X4G A;  3EUS A;  4PU3 C;  4I8T A;  3HZI B;  2XIU A;  2KEI A;  3KJX A;  2FJR A;  1ZZC A;  2KEJ A;  4JCY A;  2AXZ A;  2XI8 A;  4PU4 C;  4Z5C A;  2JVL A;  2LYS A;  3JXC L;  3H5T A;  4J1W A;  4X4I A;  1QQA A;  1LQC A;  2BNM A;  2ICT A;  2MEZ A;  3JXB C;  2D5V A;  4JCX A;  1BDH A;  1EFA A;  1ZUG A;  1ZZB A;  3FYA A;  1QQB A;  1X2L A;  1RZR D;  1XWR A;  1RZR A;  2PUA A;  1POU A;  2LYJ A;  1Y9Q A;  2HIN A;  1NEQ A;  4X4D A;  3UFD A;  4O8B A;  4YG7 B;  2ICP A;  3RZZ A;  1QPZ A;  1ZZ6 A;  2EBY A;  2PPX A;  3LIS A;  2O38 A;  1LCD A;  1CJG A;  4GHJ A;  4J1X A;  1O4X A;  1GT0 C;  4IA8 A;  4IWR A;  2PUG A;  4F8D A;  4YBA A;  1LMB 3;  1WIZ A;  2EF8 A;  3GN5 A;  3QYX A;  1ZVV A;  1CQT A;  1ADR A;  3PXP A;  4FBI A;  1AU7 A;  1JWL A;  3QQ6 A;  2B5A A;  2LYP A;  1WH6 A;  1R63 A;  2PIJ A;  2AW6 A;  3BD1 A;  1QP7 A;  2LYQ A;  3LFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...