1UXCA

Fructose repressor dna-binding domain, nmr, minimized structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the DNA-binding domain of the fructose repressor from Escherichia coli by 1H and 15N NMR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords FRUCTOSE REPRESSOR
total genus 13
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1996-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1uxcA00
2PIJA 3BDNA 4JCYA 4IWRA 4X4IA 3QYXA 1X57A 3EUSA 4X4HA 2PUCA 1WIZA 3HZIB 2KZ8A 3B7HA 2IVQA 2KEIA 1LLIA 1RPEL 3JXCL 3KJXA 4YG7B 1ZUGA 4F8DA 3ZHMA 2LYJA 1RZRD 4X4BA 2IVBA 2WUSR 4MCXA 3FYMA 1ADRA 2OR1L 1ZZ8A 3QQ6A 2XCJA 3ZHIA 2AUWA 2KEKA 4JCXA 2XIUA 3KZ3A 1LMB3 1PRVA 2OFYA 5A7LA 2R63A 1ZZ6A 1L1MA 4I8TA 2AXZA 1ZS4A 3O9XA 1YSEA 1QQAA 1BDIA 3GBFA 3QF3A 3DNVB 3U3WA 4X4GA 1RZRA 1GT0C 4GQMA 3BS3A 1QP0A 2CROA 1RZSA 3BD1A 3F51A 3GN5A 1CJGA 3IVPA 2PUAA 4FN3A 1ZZ9A 4YG4A 1LCCA 3D1NI 3GN5B 4YARA 1QP7A 1QP4A 4OB4A 1EFAA 2R1JL 3CECA 2XJ3A 3OP9A 3OQOA 2O49A 2MQKA 2HINA 2KPJA 1DW9A 1B0NA 3OMTA 2CSFA 2EWTA 1DWKA 1JFSA 4Z5DA 3L1PA 1PRAA 4X4CA 2PUGA 1RIOA 2BNOA 2B5AA 3G7DA 3SCFA 4FBIA 1WETA 1ZPQA 2AW6A 3QWGA 2PE5A 2O4AA 2JVLA 1Y9QA 3SCGA 2HSGA 1JFTA 1JWLA 1UXDA 1O4XA 3F52A 2PUDA 3CLCA 1R69A 3KXAA 1ZZBA 2GRLA 1OSLA 2PUBA 1NERA 1SQ8A 2LCVA 1X2LA 4O8BA 3ZKCA 2O38A 4PU7A 3R1FA 2EF8A 3LISA 2BNMA 2H8RA 3PXPA 2JCGA 2GZUA 2WIUB 1JH9A 2BJCA 2XI8A 1VPWA 4MCTA 2LYKA 2A6CA 2EBYA 3CROL 2L49A 3UFDA 4I6RA 1ZZCA 2MEZA 4I6UA 2AXVA 2IUOA 3MLFA 4Z5HA 5K98B 1E3OC 1AU7A 2KEJA 3OQMA 4J1XA 4X4FA 3FYAA 4Z59A 3RZZA 4IA8A 1LCDA 2PUEA 1PERL 2ICPA 1LQCA 3OQNA 4X4EA 4Z58A 1R63A 1OCTC 2IVGA 3VK0A 1WH6A 4PU8A 2LYRA 1UTXA 2GRMA 2LYLA 3JXDL 3LFPA 2L8NA 2LYSA 2ICTA 3F6WA 4Z5CA 3G5GA 1BDHA 3TRBA 4NDWA 4PU3C 3JXBC 1QQBA 1UXCA 1IC8A 4J1WA 1QPZA 1XWRA 1ZAYA 2PUFA 1HF0A 2AXUA 4GHJA 3FMYA 4YG1A 4X4DA 1WH8A 1Y7YA 4IVZA 3SCHA 1ZVVA 4PU4C 1NEQA 4Y42A 1PNRA 1ZZ7A 2AWIA 2FJRA 4JQDA 2XSDC 2IV1A 1S7EA 2IU7A 1CQTA 4I6TA 4YBAA 2PPXA 3S8QA 2LYPA 2D5VA 1POUA 1PRUA 3H5TA 2LYQA 2BNNA
chains in the Genus database with same CATH superfamily
3BDNA 4IWRA 1X57A 3MEJA 3DM5A 4X4HA 2XXQA 2KEIA 1RPEL 3KJXA 1ZUGA 3ZHMA 4X4BA 2WUSR 1ADRA 3QQ6A 3ZHIA 2PXDA 3TFLA 1LMB3 1PRVA 1L1MA 3O9XA 3GBFA 3QF3A 3DNVB 1RZRA 3BS3A 3VWSA 1CJGA 4FN3A 4OB4A 1EFAA 4EKGA 3OP9A 4X4CA 3NROA 3SCFA 3QWGA 2PE5A 2O4AA 3SCGA 2YBDA 3CLCA 3UWPA 2O38A 2GZUA 2WIUB 4ER3A 1VPWA 3KL4A 2VEOA 2PXLA 5K98B 4DE8A 4Z59A 2PUEA 4IA8A 4Z58A 1R63A 4PU8A 3JXDL 2L8NA 2LYSA 3GZCA 3JXBC 4J1WA 2PXVA 4OBMA 1XWRA 1ZAYA 5DTMA 3ME5A 2FJRA 4JQDA 2XSDC 2IU7A 1CQTA 3NDBB 4EQZA 2D5VA 3QOXA 3GUUA 4X4IA 1DULA 3OKZA 3QYXA 2LNMA 2J7WA 1U2ZA 1RZRD 2IVBA 2XIUA 3KZ3A 5A7LA 2AXZA 4X4GA 1RZSA 2PUAA 4YG4A 3GN5B 2PXEA 4ER7A 3CECA 2O49A 1B0NA 2LLWA 1JFSA 2BNOA 2AW6A 2PUDA 1R69A 3TEPA 2PXTA 1NERA 2PXQA 4O8BA 4PU7A 3LISA 4ER5A 2H8RA 2PXUA 3M9LA 2A6CA 3CROL 3ZPXA 3UFDA 1ZZCA 2MEZA 2HCSA 2IUOA 1AU7A 4J1XA 4X4FA 3RZZA 3GZDA 1PERL 3NZLA 1LQCA 4X4EA 2LYRA 2LYLA 1BDHA 1MFQC 3TRBA 4NDWA 1UXCA 2PUFA 3FMYA 1NEQA 1ZZ7A 1S7EA 2HFZA 4HRAA 5GAHi 4YBAA 3S8QA 1PRUA 4YG1A 2BNNA 2J7UA 2PIJA 4JCYA 3HZIB 2KZ8A 3JXCL 4YG7B 4ER6A 4F8DA 2LYJA 1ZZ8A 2XCJA 4JCXA 2OFYA 2R63A 1ZZ6A 4I8TA 1ZS4A 1QQAA 1BDIA 1GT0C 1QP0A 2CROA 2HCNA 3BD1A 3GN5A 1LCCA 5DSXA 3D1NI 1QP4A 2R1JL 2XJ3A 3OQOA 3OMTA 2KPJA 1DW9A 2EWTA 3SR4A 4Z5DA 3L1PA 2PUGA 2B5AA 1WETA 1ZPQA 2JVLA 1Y9QA 4WVLA 2HSGA 1JFTA 3F52A 1OSLA 1ZZBA 1SQ8A 1X2LA 3ZKCA 3A9XA 3NXHA 5DRTA 3PXPA 2JCGA 1JH9A 2XI8A 4ER0A 3GZDC 2LYKA 2EBYA 2L49A 4I6RA 4I6UA 3TELA 2AXVA 3MLFA 4Z5HA 1LCDA 2M4HA 1QB2A 2IVGA 3VK0A 2XXPA 1UTXA 2GRMA 3LFPA 2ICTA 4Z5CA 3G5GA 4PU3C 2FFHA 1QQBA 1IC8A 1QPZA 1HF0A 2AXUA 3QOWA 4IVZA 1NW3A 4EK9A 1ZVVA 4Y42A 1PNRA 2AWIA 2IV1A 2L1PA 3G0TA 2LYPA 4EKIA 2PXBA 2XXAA 3EUSA 2PUCA 1WIZA 3B7HA 1LLIA 2IVQA 2PXPA 2PXKA 2LLVA 1HQ1A 4MCXA 3FYMA 2OR1L 5DT2A 2AUWA 2KEKA 2V3CC 3QFIA 5DTQA 1YSEA 3U3WA 4GQMA 3LQXA 3R09A 3F51A 3IVPA 1ZZ9A 4YARA 1QP7A 3SX0A 4EZIA 1QZXA 2ODRD 2MQKA 2HINA 2CSFA 1DWKA 1PRAA 1RIOA 5JUWA 3G7DA 4FBIA 5GAGi 1JWLA 1UXDA 1O4XA 3KXAA 2GRLA 2PUBA 5DTRA 5DRYA 4DE9A 2LCVA 3R1FA 2EF8A 2BNMA 2BJCA 4MCTA 1E3OC 2KEJA 3OQMA 3FYAA 3A9YA 3OWQA 2ICPA 3OQNA 1OCTC 4Q2JA 1WH6A 3F6WA 4GHJA 4X4DA 1WH8A 1Y7YA 3SCHA 4PU4C 2JQEA 2MXDA 3PE5A 4I6TA 2PPXA 2PXFA 1POUA 3H5TA 3A9ZA 2LYQA
chains in the Genus database with same CATH topology
2PIJA 3BDNA 4JCYA 4IWRA 4X4IA 3QYXA 1X57A 3EUSA 4X4HA 2PUCA 1WIZA 3HZIB 2KZ8A 3B7HA 2IVQA 2KEIA 1LLIA 1RPEL 3JXCL 3KJXA 4YG7B 1ZUGA 4F8DA 3ZHMA 2LYJA 1RZRD 4X4BA 2IVBA 2WUSR 4MCXA 3FYMA 1ADRA 2OR1L 1ZZ8A 3QQ6A 2XCJA 3ZHIA 2AUWA 2KEKA 4JCXA 2XIUA 3KZ3A 1LMB3 1PRVA 2OFYA 5A7LA 2R63A 1ZZ6A 1L1MA 4I8TA 2AXZA 1ZS4A 3O9XA 1YSEA 1QQAA 1BDIA 3GBFA 3QF3A 3DNVB 3U3WA 4X4GA 1RZRA 1GT0C 4GQMA 3BS3A 1QP0A 2CROA 1RZSA 3BD1A 3F51A 3GN5A 1CJGA 3IVPA 2PUAA 4FN3A 1ZZ9A 4YG4A 1LCCA 3D1NI 3GN5B 4YARA 1QP7A 1QP4A 4OB4A 1EFAA 2R1JL 3CECA 2XJ3A 3OP9A 3OQOA 2O49A 2MQKA 2HINA 2KPJA 1DW9A 1B0NA 3OMTA 2CSFA 2EWTA 1DWKA 1JFSA 4Z5DA 3L1PA 1PRAA 4X4CA 2PUGA 1RIOA 2BNOA 2B5AA 3G7DA 3SCFA 4FBIA 1WETA 1ZPQA 2AW6A 3QWGA 2PE5A 2O4AA 2JVLA 1Y9QA 3SCGA 2HSGA 1JFTA 1JWLA 1UXDA 1O4XA 3F52A 2PUDA 3CLCA 1R69A 3KXAA 1ZZBA 2GRLA 1OSLA 2PUBA 1NERA 1SQ8A 2LCVA 1X2LA 4O8BA 3ZKCA 2O38A 4PU7A 3R1FA 2EF8A 3LISA 2BNMA 2H8RA 3PXPA 2JCGA 2GZUA 2WIUB 1JH9A 2BJCA 2XI8A 1VPWA 4MCTA 2LYKA 2A6CA 2EBYA 3CROL 2L49A 3UFDA 4I6RA 1ZZCA 2MEZA 4I6UA 2AXVA 2IUOA 3MLFA 4Z5HA 5K98B 1E3OC 1AU7A 2KEJA 3OQMA 4J1XA 4X4FA 3FYAA 4Z59A 3RZZA 4IA8A 1LCDA 2PUEA 1PERL 2ICPA 1LQCA 3OQNA 4X4EA 4Z58A 1R63A 1OCTC 2IVGA 3VK0A 1WH6A 4PU8A 2LYRA 1UTXA 2GRMA 2LYLA 3JXDL 3LFPA 2L8NA 2LYSA 2ICTA 3F6WA 4Z5CA 3G5GA 1BDHA 3TRBA 4NDWA 4PU3C 3JXBC 1QQBA 1UXCA 1IC8A 4J1WA 1QPZA 1XWRA 1ZAYA 2PUFA 1HF0A 2AXUA 4GHJA 3FMYA 4YG1A 4X4DA 1WH8A 1Y7YA 4IVZA 3SCHA 1ZVVA 4PU4C 1NEQA 4Y42A 1PNRA 1ZZ7A 2AWIA 2FJRA 4JQDA 2XSDC 2IV1A 1S7EA 2IU7A 1CQTA 4I6TA 4YBAA 2PPXA 3S8QA 2LYPA 2D5VA 1POUA 1PRUA 3H5TA 2LYQA 2BNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIJ A;  3BDN A;  4JCY A;  4IWR A;  4X4I A;  3QYX A;  1X57 A;  3EUS A;  4X4H A;  2PUC A;  1WIZ A;  3HZI B;  2KZ8 A;  3B7H A;  2IVQ A;  2KEI A;  1LLI A;  1RPE L;  3JXC L;  3KJX A;  4YG7 B;  1ZUG A;  4F8D A;  3ZHM A;  2LYJ A;  1RZR D;  4X4B A;  2IVB A;  2WUS R;  4MCX A;  3FYM A;  1ADR A;  2OR1 L;  1ZZ8 A;  3QQ6 A;  2XCJ A;  3ZHI A;  2AUW A;  2KEK A;  4JCX A;  2XIU A;  3KZ3 A;  1LMB 3;  1PRV A;  2OFY A;  5A7L A;  2R63 A;  1ZZ6 A;  1L1M A;  4I8T A;  2AXZ A;  1ZS4 A;  3O9X A;  1YSE A;  1QQA A;  1BDI A;  3GBF A;  3QF3 A;  3DNV B;  3U3W A;  4X4G A;  1RZR A;  1GT0 C;  4GQM A;  3BS3 A;  1QP0 A;  2CRO A;  1RZS A;  3BD1 A;  3F51 A;  3GN5 A;  1CJG A;  3IVP A;  2PUA A;  4FN3 A;  1ZZ9 A;  4YG4 A;  1LCC A;  3D1N I;  3GN5 B;  4YAR A;  1QP7 A;  1QP4 A;  4OB4 A;  1EFA A;  2R1J L;  3CEC A;  2XJ3 A;  3OP9 A;  3OQO A;  2O49 A;  2MQK A;  2HIN A;  2KPJ A;  1DW9 A;  1B0N A;  3OMT A;  2CSF A;  2EWT A;  1DWK A;  1JFS A;  4Z5D A;  3L1P A;  1PRA A;  4X4C A;  2PUG A;  1RIO A;  2BNO A;  2B5A A;  3G7D A;  3SCF A;  4FBI A;  1WET A;  1ZPQ A;  2AW6 A;  3QWG A;  2PE5 A;  2O4A A;  2JVL A;  1Y9Q A;  3SCG A;  2HSG A;  1JFT A;  1JWL A;  1UXD A;  1O4X A;  3F52 A;  2PUD A;  3CLC A;  1R69 A;  3KXA A;  1ZZB A;  2GRL A;  1OSL A;  2PUB A;  1NER A;  1SQ8 A;  2LCV A;  1X2L A;  4O8B A;  3ZKC A;  2O38 A;  4PU7 A;  3R1F A;  2EF8 A;  3LIS A;  2BNM A;  2H8R A;  3PXP A;  2JCG A;  2GZU A;  2WIU B;  1JH9 A;  2BJC A;  2XI8 A;  1VPW A;  4MCT A;  2LYK A;  2A6C A;  2EBY A;  3CRO L;  2L49 A;  3UFD A;  4I6R A;  1ZZC A;  2MEZ A;  4I6U A;  2AXV A;  2IUO A;  3MLF A;  4Z5H A;  5K98 B;  1E3O C;  1AU7 A;  2KEJ A;  3OQM A;  4J1X A;  4X4F A;  3FYA A;  4Z59 A;  3RZZ A;  4IA8 A;  1LCD A;  2PUE A;  1PER L;  2ICP A;  1LQC A;  3OQN A;  4X4E A;  4Z58 A;  1R63 A;  1OCT C;  2IVG A;  3VK0 A;  1WH6 A;  4PU8 A;  2LYR A;  1UTX A;  2GRM A;  2LYL A;  3JXD L;  3LFP A;  2L8N A;  2LYS A;  2ICT A;  3F6W A;  4Z5C A;  3G5G A;  1BDH A;  3TRB A;  4NDW A;  4PU3 C;  3JXB C;  1QQB A;  1UXC A;  1IC8 A;  4J1W A;  1QPZ A;  1XWR A;  1ZAY A;  2PUF A;  1HF0 A;  2AXU A;  4GHJ A;  3FMY A;  4YG1 A;  4X4D A;  1WH8 A;  1Y7Y A;  4IVZ A;  3SCH A;  1ZVV A;  4PU4 C;  1NEQ A;  4Y42 A;  1PNR A;  1ZZ7 A;  2AWI A;  2FJR A;  4JQD A;  2XSD C;  2IV1 A;  1S7E A;  2IU7 A;  1CQT A;  4I6T A;  4YBA A;  2PPX A;  3S8Q A;  2LYP A;  2D5V A;  1POU A;  1PRU A;  3H5T A;  2LYQ A;  2BNN A; 
#chains in the Genus database with same CATH topology
 3BDN A;  4IWR A;  1X57 A;  3MEJ A;  3DM5 A;  4X4H A;  2XXQ A;  2KEI A;  1RPE L;  3KJX A;  1ZUG A;  3ZHM A;  4X4B A;  2WUS R;  1ADR A;  3QQ6 A;  3ZHI A;  2PXD A;  3TFL A;  1LMB 3;  1PRV A;  1L1M A;  3O9X A;  3GBF A;  3QF3 A;  3DNV B;  1RZR A;  3BS3 A;  3VWS A;  1CJG A;  4FN3 A;  4OB4 A;  1EFA A;  4EKG A;  3OP9 A;  4X4C A;  3NRO A;  3SCF A;  3QWG A;  2PE5 A;  2O4A A;  3SCG A;  2YBD A;  3CLC A;  3UWP A;  2O38 A;  2GZU A;  2WIU B;  4ER3 A;  1VPW A;  3KL4 A;  2VEO A;  2PXL A;  5K98 B;  4DE8 A;  4Z59 A;  2PUE A;  4IA8 A;  4Z58 A;  1R63 A;  4PU8 A;  3JXD L;  2L8N A;  2LYS A;  3GZC A;  3JXB C;  4J1W A;  2PXV A;  4OBM A;  1XWR A;  1ZAY A;  5DTM A;  3ME5 A;  2FJR A;  4JQD A;  2XSD C;  2IU7 A;  1CQT A;  3NDB B;  4EQZ A;  2D5V A;  3QOX A;  3GUU A;  4X4I A;  1DUL A;  3OKZ A;  3QYX A;  2LNM A;  2J7W A;  1U2Z A;  1RZR D;  2IVB A;  2XIU A;  3KZ3 A;  5A7L A;  2AXZ A;  4X4G A;  1RZS A;  2PUA A;  4YG4 A;  3GN5 B;  2PXE A;  4ER7 A;  3CEC A;  2O49 A;  1B0N A;  2LLW A;  1JFS A;  2BNO A;  2AW6 A;  2PUD A;  1R69 A;  3TEP A;  2PXT A;  1NER A;  2PXQ A;  4O8B A;  4PU7 A;  3LIS A;  4ER5 A;  2H8R A;  2PXU A;  3M9L A;  2A6C A;  3CRO L;  3ZPX A;  3UFD A;  1ZZC A;  2MEZ A;  2HCS A;  2IUO A;  1AU7 A;  4J1X A;  4X4F A;  3RZZ A;  3GZD A;  1PER L;  3NZL A;  1LQC A;  4X4E A;  2LYR A;  2LYL A;  1BDH A;  1MFQ C;  3TRB A;  4NDW A;  1UXC A;  2PUF A;  3FMY A;  1NEQ A;  1ZZ7 A;  1S7E A;  2HFZ A;  4HRA A;  5GAH i;  4YBA A;  3S8Q A;  1PRU A;  4YG1 A;  2BNN A;  2J7U A;  2PIJ A;  4JCY A;  3HZI B;  2KZ8 A;  3JXC L;  4YG7 B;  4ER6 A;  4F8D A;  2LYJ A;  1ZZ8 A;  2XCJ A;  4JCX A;  2OFY A;  2R63 A;  1ZZ6 A;  4I8T A;  1ZS4 A;  1QQA A;  1BDI A;  1GT0 C;  1QP0 A;  2CRO A;  2HCN A;  3BD1 A;  3GN5 A;  1LCC A;  5DSX A;  3D1N I;  1QP4 A;  2R1J L;  2XJ3 A;  3OQO A;  3OMT A;  2KPJ A;  1DW9 A;  2EWT A;  3SR4 A;  4Z5D A;  3L1P A;  2PUG A;  2B5A A;  1WET A;  1ZPQ A;  2JVL A;  1Y9Q A;  4WVL A;  2HSG A;  1JFT A;  3F52 A;  1OSL A;  1ZZB A;  1SQ8 A;  1X2L A;  3ZKC A;  3A9X A;  3NXH A;  5DRT A;  3PXP A;  2JCG A;  1JH9 A;  2XI8 A;  4ER0 A;  3GZD C;  2LYK A;  2EBY A;  2L49 A;  4I6R A;  4I6U A;  3TEL A;  2AXV A;  3MLF A;  4Z5H A;  1LCD A;  2M4H A;  1QB2 A;  2IVG A;  3VK0 A;  2XXP A;  1UTX A;  2GRM A;  3LFP A;  2ICT A;  4Z5C A;  3G5G A;  4PU3 C;  2FFH A;  1QQB A;  1IC8 A;  1QPZ A;  1HF0 A;  2AXU A;  3QOW A;  4IVZ A;  1NW3 A;  4EK9 A;  1ZVV A;  4Y42 A;  1PNR A;  2AWI A;  2IV1 A;  2L1P A;  3G0T A;  2LYP A;  4EKI A;  2PXB A;  2XXA A;  3EUS A;  2PUC A;  1WIZ A;  3B7H A;  1LLI A;  2IVQ A;  2PXP A;  2PXK A;  2LLV A;  1HQ1 A;  4MCX A;  3FYM A;  2OR1 L;  5DT2 A;  2AUW A;  2KEK A;  2V3C C;  3QFI A;  5DTQ A;  1YSE A;  3U3W A;  4GQM A;  3LQX A;  3R09 A;  3F51 A;  3IVP A;  1ZZ9 A;  4YAR A;  1QP7 A;  3SX0 A;  4EZI A;  1QZX A;  2ODR D;  2MQK A;  2HIN A;  2CSF A;  1DWK A;  1PRA A;  1RIO A;  5JUW A;  3G7D A;  4FBI A;  5GAG i;  1JWL A;  1UXD A;  1O4X A;  3KXA A;  2GRL A;  2PUB A;  5DTR A;  5DRY A;  4DE9 A;  2LCV A;  3R1F A;  2EF8 A;  2BNM A;  2BJC A;  4MCT A;  1E3O C;  2KEJ A;  3OQM A;  3FYA A;  3A9Y A;  3OWQ A;  2ICP A;  3OQN A;  1OCT C;  4Q2J A;  1WH6 A;  3F6W A;  4GHJ A;  4X4D A;  1WH8 A;  1Y7Y A;  3SCH A;  4PU4 C;  2JQE A;  2MXD A;  3PE5 A;  4I6T A;  2PPX A;  2PXF A;  1POU A;  3H5T A;  3A9Z A;  2LYQ A; 
#chains in the Genus database with same CATH homology
 2PIJ A;  3BDN A;  4JCY A;  4IWR A;  4X4I A;  3QYX A;  1X57 A;  3EUS A;  4X4H A;  2PUC A;  1WIZ A;  3HZI B;  2KZ8 A;  3B7H A;  2IVQ A;  2KEI A;  1LLI A;  1RPE L;  3JXC L;  3KJX A;  4YG7 B;  1ZUG A;  4F8D A;  3ZHM A;  2LYJ A;  1RZR D;  4X4B A;  2IVB A;  2WUS R;  4MCX A;  3FYM A;  1ADR A;  2OR1 L;  1ZZ8 A;  3QQ6 A;  2XCJ A;  3ZHI A;  2AUW A;  2KEK A;  4JCX A;  2XIU A;  3KZ3 A;  1LMB 3;  1PRV A;  2OFY A;  5A7L A;  2R63 A;  1ZZ6 A;  1L1M A;  4I8T A;  2AXZ A;  1ZS4 A;  3O9X A;  1YSE A;  1QQA A;  1BDI A;  3GBF A;  3QF3 A;  3DNV B;  3U3W A;  4X4G A;  1RZR A;  1GT0 C;  4GQM A;  3BS3 A;  1QP0 A;  2CRO A;  1RZS A;  3BD1 A;  3F51 A;  3GN5 A;  1CJG A;  3IVP A;  2PUA A;  4FN3 A;  1ZZ9 A;  4YG4 A;  1LCC A;  3D1N I;  3GN5 B;  4YAR A;  1QP7 A;  1QP4 A;  4OB4 A;  1EFA A;  2R1J L;  3CEC A;  2XJ3 A;  3OP9 A;  3OQO A;  2O49 A;  2MQK A;  2HIN A;  2KPJ A;  1DW9 A;  1B0N A;  3OMT A;  2CSF A;  2EWT A;  1DWK A;  1JFS A;  4Z5D A;  3L1P A;  1PRA A;  4X4C A;  2PUG A;  1RIO A;  2BNO A;  2B5A A;  3G7D A;  3SCF A;  4FBI A;  1WET A;  1ZPQ A;  2AW6 A;  3QWG A;  2PE5 A;  2O4A A;  2JVL A;  1Y9Q A;  3SCG A;  2HSG A;  1JFT A;  1JWL A;  1UXD A;  1O4X A;  3F52 A;  2PUD A;  3CLC A;  1R69 A;  3KXA A;  1ZZB A;  2GRL A;  1OSL A;  2PUB A;  1NER A;  1SQ8 A;  2LCV A;  1X2L A;  4O8B A;  3ZKC A;  2O38 A;  4PU7 A;  3R1F A;  2EF8 A;  3LIS A;  2BNM A;  2H8R A;  3PXP A;  2JCG A;  2GZU A;  2WIU B;  1JH9 A;  2BJC A;  2XI8 A;  1VPW A;  4MCT A;  2LYK A;  2A6C A;  2EBY A;  3CRO L;  2L49 A;  3UFD A;  4I6R A;  1ZZC A;  2MEZ A;  4I6U A;  2AXV A;  2IUO A;  3MLF A;  4Z5H A;  5K98 B;  1E3O C;  1AU7 A;  2KEJ A;  3OQM A;  4J1X A;  4X4F A;  3FYA A;  4Z59 A;  3RZZ A;  4IA8 A;  1LCD A;  2PUE A;  1PER L;  2ICP A;  1LQC A;  3OQN A;  4X4E A;  4Z58 A;  1R63 A;  1OCT C;  2IVG A;  3VK0 A;  1WH6 A;  4PU8 A;  2LYR A;  1UTX A;  2GRM A;  2LYL A;  3JXD L;  3LFP A;  2L8N A;  2LYS A;  2ICT A;  3F6W A;  4Z5C A;  3G5G A;  1BDH A;  3TRB A;  4NDW A;  4PU3 C;  3JXB C;  1QQB A;  1UXC A;  1IC8 A;  4J1W A;  1QPZ A;  1XWR A;  1ZAY A;  2PUF A;  1HF0 A;  2AXU A;  4GHJ A;  3FMY A;  4YG1 A;  4X4D A;  1WH8 A;  1Y7Y A;  4IVZ A;  3SCH A;  1ZVV A;  4PU4 C;  1NEQ A;  4Y42 A;  1PNR A;  1ZZ7 A;  2AWI A;  2FJR A;  4JQD A;  2XSD C;  2IV1 A;  1S7E A;  2IU7 A;  1CQT A;  4I6T A;  4YBA A;  2PPX A;  3S8Q A;  2LYP A;  2D5V A;  1POU A;  1PRU A;  3H5T A;  2LYQ A;  2BNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...