3ZHIA

N-terminal domain of the ci repressor from bacteriophage tp901-1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
KTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSAYVASVQSPDQNRIYLLAKTLGVSEAWLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the N-Terminal Domain of the Lactococcal Bacteriophage Tp901-1 Ci Repressor to its Target DNA: A Crystallography, Small Angle Scattering, and Nuclear Magnetic Resonance Study.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Transcription
molecule keywords CI
total genus 25
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3zhiA00
3OQMA 1IC8A 1HF0A 3BS3A 1LMB3 3EUSA 2XI8A 3CROL 3B7HA 1ZZ7A 4MCTA 4IWRA 1RZRD 3GBFA 1O4XA 4PU7A 3OQNA 2EBYA 4Z5DA 2IVQA 1RIOA 3OMTA 1UTXA 2OR1L 1CQTA 2R1JL 2LYKA 4PU8A 4GQMA 1QQBA 2JVLA 4X4EA 1L1MA 1X2LA 4J1XA 1QP7A 2H8RA 4YBAA 1WETA 2XIUA 2PUCA 2GRMA 3H5TA 4X4DA 1PERL 1OCTC 4Z58A 1QQAA 1XWRA 2ICTA 2AXVA 3D1NI 4I6TA 2BNOA 3DNVB 4YG7B 1ZZ6A 2CSFA 3MLFA 1ADRA 1QP4A 2IVGA 1JH9A 3JXDL 3IVPA 5K98B 4PU3C 2IUOA 1AU7A 2LYLA 1LCCA 3KZ3A 2IVBA 1S7EA 4O8BA 4YG1A 2D5VA 2LYSA 1PRUA 4I8TA 2O4AA 2B5AA 2ICPA 4I6UA 3F51A 3G5GA 3FYAA 1R63A 4GHJA 4X4FA 1ZVVA 3G7DA 1JWLA 3UFDA 1RZSA 3VK0A 4NDWA 3LISA 2PUDA 3SCHA 4FN3A 4IVZA 1E3OC 2MEZA 3O9XA 2R63A 2BJCA 2PUFA 2LYRA 4YARA 3U3WA 1UXDA 2LYQA 2L49A 3L1PA 2HSGA 2GRLA 4PU4C 2BNMA 2PPXA 4X4CA 2PUBA 1WH8A 3QWGA 2KZ8A 1RPEL 4X4BA 4X4IA 1RZRA 2KEJA 3ZKCA 2AXZA 3R1FA 3CECA 3HZIB 4J1WA 2PIJA 1ZPQA 1ZZ9A 3RZZA 2LYJA 2WIUB 1BDHA 3JXBC 2PUAA 3CLCA 1ZAYA 1B0NA 3LFPA 1Y7YA 1WH6A 1GT0C 3PXPA 1POUA 3OP9A 4X4GA 1PRVA 2XJ3A 3KXAA 1VPWA 4JCYA 3SCGA 3FMYA 3TRBA 1LLIA 1LQCA 2AXUA 2GZUA 4YG4A 1CJGA 2PUEA 2IU7A 2O38A 1ZUGA 1Y9QA 2O49A 4Z5CA 3F6WA 4MCXA 2L8NA 2WUSR 1EFAA 2AWIA 1JFSA 1NEQA 4Z5HA 3JXCL 2IV1A 3BD1A 1PNRA 1QPZA 3S8QA 4Z59A 2LYPA 2AUWA 4X4HA 3ZHMA 1ZZ8A 3QQ6A 4Y42A 2EF8A 3GN5B 3QYXA 2LCVA 1SQ8A 2EWTA 4F8DA 1OSLA 2MQKA 2XCJA 1WIZA 2XSDC 1ZZCA 2FJRA 1X57A 2KPJA 2CROA 4IA8A 3SCFA 2PUGA 2JCGA 2KEIA 1UXCA 4JQDA 2PE5A 1DWKA 2A6CA 5A7LA 3OQOA 3F52A 2BNNA 1R69A 1LCDA 1PRAA 4I6RA 1ZZBA 4OB4A 1DW9A 4JCXA 3ZHIA 4FBIA 2KEKA 3KJXA 1QP0A 2HINA 1ZS4A 1JFTA 1NERA 3QF3A 2AW6A 1BDIA 3GN5A 3FYMA 2OFYA 1YSEA 3BDNA
chains in the Genus database with same CATH superfamily
1HF0A 1LMB3 2XI8A 3B7HA 3M9LA 1O4XA 3OQNA 2EBYA 4Z5DA 1RIOA 2LYKA 3GZDA 3GZDC 1L1MA 1X2LA 3A9YA 1OCTC 3TELA 4YG7B 3MLFA 2PXQA 4PU3C 2IUOA 3KZ3A 2IVBA 1S7EA 4O8BA 1PRUA 2B5AA 2ICPA 4I6UA 3G5GA 4HRAA 4NDWA 2PUDA 4FN3A 5DTMA 3A9ZA 3U3WA 1UXDA 2LNMA 4X4CA 1QB2A 1WH8A 3NDBB 4ER7A 3QWGA 4X4BA 1ZPQA 4DE9A 3JXBC 3CLCA 4EQZA 1WH6A 2LLWA 4X4GA 1VPWA 4EZIA 1LLIA 2GZUA 4YG4A 2PUEA 2PXVA 3TFLA 4Z5CA 3F6WA 4MCXA 1QPZA 3S8QA 2JQEA 4Z59A 3NXHA 4X4HA 3ZHMA 4ER6A 3QQ6A 1OSLA 2MQKA 3NROA 1WIZA 2FJRA 1DULA 2PUGA 4IA8A 2KEIA 3MEJA 3PE5A 2PXEA 5DRTA 4OB4A 1ZS4A 1NERA 3GN5A 2OFYA 1YSEA 3BS3A 1U2ZA 1RZRD 3KL4A 2IVQA 3SX0A 1QP7A 1WETA 2ICTA 2AXVA 2IVGA 1JH9A 5K98B 2D5VA 2L1PA 2LYSA 2XXAA 3F51A 4GHJA 4X4FA 1ZVVA 1RZSA 3LISA 4DE8A 5JUWA 3VWSA 3O9XA 2L49A 2MXDA 2BNMA 2VEOA 1RPEL 3QOXA 2KEJA 3CECA 2PIJA 1ZZ9A 2WIUB 3ME5A 3PXPA 1PRVA 3FMYA 2AXUA 3TEPA 2IU7A 1EFAA 2IV1A 2AUWA 4Y42A 1CQTA 2EF8A 3GN5B 2XCJA 2XSDC 1X57A 3SCFA 1QZXA 2JCGA 2PE5A 1DWKA 2HCSA 4I6RA 1DW9A 3KJXA 2YBDA 1BDIA 3G0TA 3FYMA 3CROL 1ZZ7A 4MCTA 4IWRA 3GBFA 2OR1L 3QOWA 3OMTA 1UTXA 2R1JL 4PU8A 3QFIA 4GQMA 2H8RA 2V3CC 2PUCA 1HQ1A 3H5TA 1PERL 2J7UA 5DT2A 1XWRA 2BNOA 1ZZ6A 1ADRA 3IVPA 1LCCA 4I8TA 2O4AA 2LLVA 3FYAA 1R63A 3G7DA 3UFDA 3ZPXA 3SCHA 4ER3A 4IVZA 1E3OC 2R63A 2BJCA 2LYRA 2LYQA 4EKGA 2PPXA 2XXQA 4X4IA 2AXZA 3R1FA 4EK9A 4J1WA 2LYJA 2PUAA 2HFZA 1ZAYA 3NZLA 3OP9A 3SCGA 3TRBA 1LQCA 1CJGA 1ZUGA 2L8NA 2WUSR 3JXCL 1PNRA 2LYPA 1NW3A 5DRYA 3LQXA 2LCVA 1SQ8A 3R09A 4F8DA 1ZZCA 2ODRD 2KPJA 2PXKA 5DSXA 4JQDA 3A9XA 3OQOA 2BNNA 1LCDA 1PRAA 4JCXA 4FBIA 1QP0A 1JFTA 3QF3A 2AW6A 3OQMA 1IC8A 2HCNA 3EUSA 4Q2JA 2PXTA 4PU7A 3GUUA 3GZCA 1QQBA 2JVLA 2M4HA 4X4EA 4J1XA 4YBAA 2XIUA 2GRMA 4X4DA 4Z58A 1QQAA 2PXLA 4OBMA 3D1NI 4I6TA 3DNVB 2CSFA 1QP4A 3JXDL 1AU7A 2LYLA 4YG1A 5DTQA 1JWLA 3VK0A 2PXDA 2J7WA 2MEZA 2PUFA 4YARA 3L1PA 2HSGA 2GRLA 2FFHA 4PU4C 4ER0A 2PUBA 2KZ8A 1RZRA 3ZKCA 3HZIB 5GAHi 3RZZA 1BDHA 4ER5A 1B0NA 3LFPA 3OWQA 1Y7YA 1GT0C 1POUA 2XJ3A 2PXUA 3KXAA 4JCYA 1MFQC 2O38A 1Y9QA 2O49A 2AWIA 1JFSA 1NEQA 4Z5HA 2XXPA 5GAGi 3BD1A 1ZZ8A 3QYXA 2EWTA 2PXPA 3UWPA 3SR4A 2CROA 3OKZA 1UXCA 2A6CA 5A7LA 2PXBA 3F52A 1R69A 3DM5A 4WVLA 1ZZBA 3ZHIA 4EKIA 2KEKA 2HINA 5DTRA 2PXFA 3BDNA
chains in the Genus database with same CATH topology
3OQMA 1IC8A 1HF0A 3BS3A 1LMB3 3EUSA 2XI8A 3CROL 3B7HA 1ZZ7A 4MCTA 4IWRA 1RZRD 3GBFA 1O4XA 4PU7A 3OQNA 2EBYA 4Z5DA 2IVQA 1RIOA 3OMTA 1UTXA 2OR1L 1CQTA 2R1JL 2LYKA 4PU8A 4GQMA 1QQBA 2JVLA 4X4EA 1L1MA 1X2LA 4J1XA 1QP7A 2H8RA 4YBAA 1WETA 2XIUA 2PUCA 2GRMA 3H5TA 4X4DA 1PERL 1OCTC 4Z58A 1QQAA 1XWRA 2ICTA 2AXVA 3D1NI 4I6TA 2BNOA 3DNVB 4YG7B 1ZZ6A 2CSFA 3MLFA 1ADRA 1QP4A 2IVGA 1JH9A 3JXDL 3IVPA 5K98B 4PU3C 2IUOA 1AU7A 2LYLA 1LCCA 3KZ3A 2IVBA 1S7EA 4O8BA 4YG1A 2D5VA 2LYSA 1PRUA 4I8TA 2O4AA 2B5AA 2ICPA 4I6UA 3F51A 3G5GA 3FYAA 1R63A 4GHJA 4X4FA 1ZVVA 3G7DA 1JWLA 3UFDA 1RZSA 3VK0A 4NDWA 3LISA 2PUDA 3SCHA 4FN3A 4IVZA 1E3OC 2MEZA 3O9XA 2R63A 2BJCA 2PUFA 2LYRA 4YARA 3U3WA 1UXDA 2LYQA 2L49A 3L1PA 2HSGA 2GRLA 4PU4C 2BNMA 2PPXA 4X4CA 2PUBA 1WH8A 3QWGA 2KZ8A 1RPEL 4X4BA 4X4IA 1RZRA 2KEJA 3ZKCA 2AXZA 3R1FA 3CECA 3HZIB 4J1WA 2PIJA 1ZPQA 1ZZ9A 3RZZA 2LYJA 2WIUB 1BDHA 3JXBC 2PUAA 3CLCA 1ZAYA 1B0NA 3LFPA 1Y7YA 1WH6A 1GT0C 3PXPA 1POUA 3OP9A 4X4GA 1PRVA 2XJ3A 3KXAA 1VPWA 4JCYA 3SCGA 3FMYA 3TRBA 1LLIA 1LQCA 2AXUA 2GZUA 4YG4A 1CJGA 2PUEA 2IU7A 2O38A 1ZUGA 1Y9QA 2O49A 4Z5CA 3F6WA 4MCXA 2L8NA 2WUSR 1EFAA 2AWIA 1JFSA 1NEQA 4Z5HA 3JXCL 2IV1A 3BD1A 1PNRA 1QPZA 3S8QA 4Z59A 2LYPA 2AUWA 4X4HA 3ZHMA 1ZZ8A 3QQ6A 4Y42A 2EF8A 3GN5B 3QYXA 2LCVA 1SQ8A 2EWTA 4F8DA 1OSLA 2MQKA 2XCJA 1WIZA 2XSDC 1ZZCA 2FJRA 1X57A 2KPJA 2CROA 4IA8A 3SCFA 2PUGA 2JCGA 2KEIA 1UXCA 4JQDA 2PE5A 1DWKA 2A6CA 5A7LA 3OQOA 3F52A 2BNNA 1R69A 1LCDA 1PRAA 4I6RA 1ZZBA 4OB4A 1DW9A 4JCXA 3ZHIA 4FBIA 2KEKA 3KJXA 1QP0A 2HINA 1ZS4A 1JFTA 1NERA 3QF3A 2AW6A 1BDIA 3GN5A 3FYMA 2OFYA 1YSEA 3BDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OQM A;  1IC8 A;  1HF0 A;  3BS3 A;  1LMB 3;  3EUS A;  2XI8 A;  3CRO L;  3B7H A;  1ZZ7 A;  4MCT A;  4IWR A;  1RZR D;  3GBF A;  1O4X A;  4PU7 A;  3OQN A;  2EBY A;  4Z5D A;  2IVQ A;  1RIO A;  3OMT A;  1UTX A;  2OR1 L;  1CQT A;  2R1J L;  2LYK A;  4PU8 A;  4GQM A;  1QQB A;  2JVL A;  4X4E A;  1L1M A;  1X2L A;  4J1X A;  1QP7 A;  2H8R A;  4YBA A;  1WET A;  2XIU A;  2PUC A;  2GRM A;  3H5T A;  4X4D A;  1PER L;  1OCT C;  4Z58 A;  1QQA A;  1XWR A;  2ICT A;  2AXV A;  3D1N I;  4I6T A;  2BNO A;  3DNV B;  4YG7 B;  1ZZ6 A;  2CSF A;  3MLF A;  1ADR A;  1QP4 A;  2IVG A;  1JH9 A;  3JXD L;  3IVP A;  5K98 B;  4PU3 C;  2IUO A;  1AU7 A;  2LYL A;  1LCC A;  3KZ3 A;  2IVB A;  1S7E A;  4O8B A;  4YG1 A;  2D5V A;  2LYS A;  1PRU A;  4I8T A;  2O4A A;  2B5A A;  2ICP A;  4I6U A;  3F51 A;  3G5G A;  3FYA A;  1R63 A;  4GHJ A;  4X4F A;  1ZVV A;  3G7D A;  1JWL A;  3UFD A;  1RZS A;  3VK0 A;  4NDW A;  3LIS A;  2PUD A;  3SCH A;  4FN3 A;  4IVZ A;  1E3O C;  2MEZ A;  3O9X A;  2R63 A;  2BJC A;  2PUF A;  2LYR A;  4YAR A;  3U3W A;  1UXD A;  2LYQ A;  2L49 A;  3L1P A;  2HSG A;  2GRL A;  4PU4 C;  2BNM A;  2PPX A;  4X4C A;  2PUB A;  1WH8 A;  3QWG A;  2KZ8 A;  1RPE L;  4X4B A;  4X4I A;  1RZR A;  2KEJ A;  3ZKC A;  2AXZ A;  3R1F A;  3CEC A;  3HZI B;  4J1W A;  2PIJ A;  1ZPQ A;  1ZZ9 A;  3RZZ A;  2LYJ A;  2WIU B;  1BDH A;  3JXB C;  2PUA A;  3CLC A;  1ZAY A;  1B0N A;  3LFP A;  1Y7Y A;  1WH6 A;  1GT0 C;  3PXP A;  1POU A;  3OP9 A;  4X4G A;  1PRV A;  2XJ3 A;  3KXA A;  1VPW A;  4JCY A;  3SCG A;  3FMY A;  3TRB A;  1LLI A;  1LQC A;  2AXU A;  2GZU A;  4YG4 A;  1CJG A;  2PUE A;  2IU7 A;  2O38 A;  1ZUG A;  1Y9Q A;  2O49 A;  4Z5C A;  3F6W A;  4MCX A;  2L8N A;  2WUS R;  1EFA A;  2AWI A;  1JFS A;  1NEQ A;  4Z5H A;  3JXC L;  2IV1 A;  3BD1 A;  1PNR A;  1QPZ A;  3S8Q A;  4Z59 A;  2LYP A;  2AUW A;  4X4H A;  3ZHM A;  1ZZ8 A;  3QQ6 A;  4Y42 A;  2EF8 A;  3GN5 B;  3QYX A;  2LCV A;  1SQ8 A;  2EWT A;  4F8D A;  1OSL A;  2MQK A;  2XCJ A;  1WIZ A;  2XSD C;  1ZZC A;  2FJR A;  1X57 A;  2KPJ A;  2CRO A;  4IA8 A;  3SCF A;  2PUG A;  2JCG A;  2KEI A;  1UXC A;  4JQD A;  2PE5 A;  1DWK A;  2A6C A;  5A7L A;  3OQO A;  3F52 A;  2BNN A;  1R69 A;  1LCD A;  1PRA A;  4I6R A;  1ZZB A;  4OB4 A;  1DW9 A;  4JCX A;  3ZHI A;  4FBI A;  2KEK A;  3KJX A;  1QP0 A;  2HIN A;  1ZS4 A;  1JFT A;  1NER A;  3QF3 A;  2AW6 A;  1BDI A;  3GN5 A;  3FYM A;  2OFY A;  1YSE A;  3BDN A; 
#chains in the Genus database with same CATH topology
 1HF0 A;  1LMB 3;  2XI8 A;  3B7H A;  3M9L A;  1O4X A;  3OQN A;  2EBY A;  4Z5D A;  1RIO A;  2LYK A;  3GZD A;  3GZD C;  1L1M A;  1X2L A;  3A9Y A;  1OCT C;  3TEL A;  4YG7 B;  3MLF A;  2PXQ A;  4PU3 C;  2IUO A;  3KZ3 A;  2IVB A;  1S7E A;  4O8B A;  1PRU A;  2B5A A;  2ICP A;  4I6U A;  3G5G A;  4HRA A;  4NDW A;  2PUD A;  4FN3 A;  5DTM A;  3A9Z A;  3U3W A;  1UXD A;  2LNM A;  4X4C A;  1QB2 A;  1WH8 A;  3NDB B;  4ER7 A;  3QWG A;  4X4B A;  1ZPQ A;  4DE9 A;  3JXB C;  3CLC A;  4EQZ A;  1WH6 A;  2LLW A;  4X4G A;  1VPW A;  4EZI A;  1LLI A;  2GZU A;  4YG4 A;  2PUE A;  2PXV A;  3TFL A;  4Z5C A;  3F6W A;  4MCX A;  1QPZ A;  3S8Q A;  2JQE A;  4Z59 A;  3NXH A;  4X4H A;  3ZHM A;  4ER6 A;  3QQ6 A;  1OSL A;  2MQK A;  3NRO A;  1WIZ A;  2FJR A;  1DUL A;  2PUG A;  4IA8 A;  2KEI A;  3MEJ A;  3PE5 A;  2PXE A;  5DRT A;  4OB4 A;  1ZS4 A;  1NER A;  3GN5 A;  2OFY A;  1YSE A;  3BS3 A;  1U2Z A;  1RZR D;  3KL4 A;  2IVQ A;  3SX0 A;  1QP7 A;  1WET A;  2ICT A;  2AXV A;  2IVG A;  1JH9 A;  5K98 B;  2D5V A;  2L1P A;  2LYS A;  2XXA A;  3F51 A;  4GHJ A;  4X4F A;  1ZVV A;  1RZS A;  3LIS A;  4DE8 A;  5JUW A;  3VWS A;  3O9X A;  2L49 A;  2MXD A;  2BNM A;  2VEO A;  1RPE L;  3QOX A;  2KEJ A;  3CEC A;  2PIJ A;  1ZZ9 A;  2WIU B;  3ME5 A;  3PXP A;  1PRV A;  3FMY A;  2AXU A;  3TEP A;  2IU7 A;  1EFA A;  2IV1 A;  2AUW A;  4Y42 A;  1CQT A;  2EF8 A;  3GN5 B;  2XCJ A;  2XSD C;  1X57 A;  3SCF A;  1QZX A;  2JCG A;  2PE5 A;  1DWK A;  2HCS A;  4I6R A;  1DW9 A;  3KJX A;  2YBD A;  1BDI A;  3G0T A;  3FYM A;  3CRO L;  1ZZ7 A;  4MCT A;  4IWR A;  3GBF A;  2OR1 L;  3QOW A;  3OMT A;  1UTX A;  2R1J L;  4PU8 A;  3QFI A;  4GQM A;  2H8R A;  2V3C C;  2PUC A;  1HQ1 A;  3H5T A;  1PER L;  2J7U A;  5DT2 A;  1XWR A;  2BNO A;  1ZZ6 A;  1ADR A;  3IVP A;  1LCC A;  4I8T A;  2O4A A;  2LLV A;  3FYA A;  1R63 A;  3G7D A;  3UFD A;  3ZPX A;  3SCH A;  4ER3 A;  4IVZ A;  1E3O C;  2R63 A;  2BJC A;  2LYR A;  2LYQ A;  4EKG A;  2PPX A;  2XXQ A;  4X4I A;  2AXZ A;  3R1F A;  4EK9 A;  4J1W A;  2LYJ A;  2PUA A;  2HFZ A;  1ZAY A;  3NZL A;  3OP9 A;  3SCG A;  3TRB A;  1LQC A;  1CJG A;  1ZUG A;  2L8N A;  2WUS R;  3JXC L;  1PNR A;  2LYP A;  1NW3 A;  5DRY A;  3LQX A;  2LCV A;  1SQ8 A;  3R09 A;  4F8D A;  1ZZC A;  2ODR D;  2KPJ A;  2PXK A;  5DSX A;  4JQD A;  3A9X A;  3OQO A;  2BNN A;  1LCD A;  1PRA A;  4JCX A;  4FBI A;  1QP0 A;  1JFT A;  3QF3 A;  2AW6 A;  3OQM A;  1IC8 A;  2HCN A;  3EUS A;  4Q2J A;  2PXT A;  4PU7 A;  3GUU A;  3GZC A;  1QQB A;  2JVL A;  2M4H A;  4X4E A;  4J1X A;  4YBA A;  2XIU A;  2GRM A;  4X4D A;  4Z58 A;  1QQA A;  2PXL A;  4OBM A;  3D1N I;  4I6T A;  3DNV B;  2CSF A;  1QP4 A;  3JXD L;  1AU7 A;  2LYL A;  4YG1 A;  5DTQ A;  1JWL A;  3VK0 A;  2PXD A;  2J7W A;  2MEZ A;  2PUF A;  4YAR A;  3L1P A;  2HSG A;  2GRL A;  2FFH A;  4PU4 C;  4ER0 A;  2PUB A;  2KZ8 A;  1RZR A;  3ZKC A;  3HZI B;  5GAH i;  3RZZ A;  1BDH A;  4ER5 A;  1B0N A;  3LFP A;  3OWQ A;  1Y7Y A;  1GT0 C;  1POU A;  2XJ3 A;  2PXU A;  3KXA A;  4JCY A;  1MFQ C;  2O38 A;  1Y9Q A;  2O49 A;  2AWI A;  1JFS A;  1NEQ A;  4Z5H A;  2XXP A;  5GAG i;  3BD1 A;  1ZZ8 A;  3QYX A;  2EWT A;  2PXP A;  3UWP A;  3SR4 A;  2CRO A;  3OKZ A;  1UXC A;  2A6C A;  5A7L A;  2PXB A;  3F52 A;  1R69 A;  3DM5 A;  4WVL A;  1ZZB A;  3ZHI A;  4EKI A;  2KEK A;  2HIN A;  5DTR A;  2PXF A;  3BDN A; 
#chains in the Genus database with same CATH homology
 3OQM A;  1IC8 A;  1HF0 A;  3BS3 A;  1LMB 3;  3EUS A;  2XI8 A;  3CRO L;  3B7H A;  1ZZ7 A;  4MCT A;  4IWR A;  1RZR D;  3GBF A;  1O4X A;  4PU7 A;  3OQN A;  2EBY A;  4Z5D A;  2IVQ A;  1RIO A;  3OMT A;  1UTX A;  2OR1 L;  1CQT A;  2R1J L;  2LYK A;  4PU8 A;  4GQM A;  1QQB A;  2JVL A;  4X4E A;  1L1M A;  1X2L A;  4J1X A;  1QP7 A;  2H8R A;  4YBA A;  1WET A;  2XIU A;  2PUC A;  2GRM A;  3H5T A;  4X4D A;  1PER L;  1OCT C;  4Z58 A;  1QQA A;  1XWR A;  2ICT A;  2AXV A;  3D1N I;  4I6T A;  2BNO A;  3DNV B;  4YG7 B;  1ZZ6 A;  2CSF A;  3MLF A;  1ADR A;  1QP4 A;  2IVG A;  1JH9 A;  3JXD L;  3IVP A;  5K98 B;  4PU3 C;  2IUO A;  1AU7 A;  2LYL A;  1LCC A;  3KZ3 A;  2IVB A;  1S7E A;  4O8B A;  4YG1 A;  2D5V A;  2LYS A;  1PRU A;  4I8T A;  2O4A A;  2B5A A;  2ICP A;  4I6U A;  3F51 A;  3G5G A;  3FYA A;  1R63 A;  4GHJ A;  4X4F A;  1ZVV A;  3G7D A;  1JWL A;  3UFD A;  1RZS A;  3VK0 A;  4NDW A;  3LIS A;  2PUD A;  3SCH A;  4FN3 A;  4IVZ A;  1E3O C;  2MEZ A;  3O9X A;  2R63 A;  2BJC A;  2PUF A;  2LYR A;  4YAR A;  3U3W A;  1UXD A;  2LYQ A;  2L49 A;  3L1P A;  2HSG A;  2GRL A;  4PU4 C;  2BNM A;  2PPX A;  4X4C A;  2PUB A;  1WH8 A;  3QWG A;  2KZ8 A;  1RPE L;  4X4B A;  4X4I A;  1RZR A;  2KEJ A;  3ZKC A;  2AXZ A;  3R1F A;  3CEC A;  3HZI B;  4J1W A;  2PIJ A;  1ZPQ A;  1ZZ9 A;  3RZZ A;  2LYJ A;  2WIU B;  1BDH A;  3JXB C;  2PUA A;  3CLC A;  1ZAY A;  1B0N A;  3LFP A;  1Y7Y A;  1WH6 A;  1GT0 C;  3PXP A;  1POU A;  3OP9 A;  4X4G A;  1PRV A;  2XJ3 A;  3KXA A;  1VPW A;  4JCY A;  3SCG A;  3FMY A;  3TRB A;  1LLI A;  1LQC A;  2AXU A;  2GZU A;  4YG4 A;  1CJG A;  2PUE A;  2IU7 A;  2O38 A;  1ZUG A;  1Y9Q A;  2O49 A;  4Z5C A;  3F6W A;  4MCX A;  2L8N A;  2WUS R;  1EFA A;  2AWI A;  1JFS A;  1NEQ A;  4Z5H A;  3JXC L;  2IV1 A;  3BD1 A;  1PNR A;  1QPZ A;  3S8Q A;  4Z59 A;  2LYP A;  2AUW A;  4X4H A;  3ZHM A;  1ZZ8 A;  3QQ6 A;  4Y42 A;  2EF8 A;  3GN5 B;  3QYX A;  2LCV A;  1SQ8 A;  2EWT A;  4F8D A;  1OSL A;  2MQK A;  2XCJ A;  1WIZ A;  2XSD C;  1ZZC A;  2FJR A;  1X57 A;  2KPJ A;  2CRO A;  4IA8 A;  3SCF A;  2PUG A;  2JCG A;  2KEI A;  1UXC A;  4JQD A;  2PE5 A;  1DWK A;  2A6C A;  5A7L A;  3OQO A;  3F52 A;  2BNN A;  1R69 A;  1LCD A;  1PRA A;  4I6R A;  1ZZB A;  4OB4 A;  1DW9 A;  4JCX A;  3ZHI A;  4FBI A;  2KEK A;  3KJX A;  1QP0 A;  2HIN A;  1ZS4 A;  1JFT A;  1NER A;  3QF3 A;  2AW6 A;  1BDI A;  3GN5 A;  3FYM A;  2OFY A;  1YSE A;  3BDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...