3ZHIA

N-terminal domain of the ci repressor from bacteriophage tp901-1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
KTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSAYVASVQSPDQNRIYLLAKTLGVSEAWLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the N-Terminal Domain of the Lactococcal Bacteriophage Tp901-1 Ci Repressor to its Target DNA: A Crystallography, Small Angle Scattering, and Nuclear Magnetic Resonance Study.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Transcription
molecule keywords CI
total genus 25
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3zhiA00
4PU7A 1JH9A 1HF0A 3R1FA 3QWGA 2OFYA 4PU3C 4I6RA 3QQ6A 4YBAA 3GBFA 1PRUA 4YG7B 2HINA 2LYSA 3KZ3A 2LYKA 2PUEA 2EF8A 4X4CA 3RZZA 4JCYA 1QQBA 2AW6A 2XJ3A 3CECA 3ZHIA 2PIJA 2LYRA 1UXCA 3D1NI 2IVBA 2JCGA 1ADRA 4X4HA 1RZSA 1LQCA 1WH8A 3OMTA 4MCTA 4NDWA 3O9XA 1IC8A 2KEIA 3PXPA 4I8TA 3BD1A 2LYLA 3IVPA 2BNMA 4I6TA 4X4GA 1YSEA 4JCXA 3FYMA 2CSFA 1ZS4A 2KPJA 4PU8A 4Z5CA 2EBYA 1E3OC 4GHJA 1EFAA 2AWIA 4OB4A 1NEQA 1ZZ8A 2L49A 2PUFA 4IWRA 3ZHMA 2IVGA 3ZKCA 2HSGA 1QPZA 3OQMA 2MEZA 3H5TA 1WETA 2PUDA 3JXBC 1O4XA 1PERL 2H8RA 1ZZBA 3HZIB 2XCJA 3SCGA 4YG1A 4YG4A 1OSLA 1OCTC 3CLCA 2GRLA 3B7HA 2AXVA 1VPWA 4X4BA 4YARA 1CQTA 2JVLA 3VK0A 3FYAA 1POUA 3L1PA 4FN3A 3S8QA 3KXAA 3CROL 2AXUA 1NERA 1QP4A 2A6CA 3EUSA 2KEJA 3UFDA 2LYPA 2O49A 1QP0A 1SQ8A 3LISA 4X4IA 2OR1L 4O8BA 2IV1A 3FMYA 3QYXA 1ZVVA 3GN5A 3F51A 2BJCA 4IA8A 1X57A 4MCXA 3U3WA 3OQNA 4GQMA 3BDNA 1UTXA 3F6WA 3SCHA 3G5GA 1ZZCA 1JFTA 2GZUA 2PUGA 1DWKA 2KEKA 2D5VA 2PUBA 2AUWA 4J1WA 1ZAYA 1ZPQA 5A7LA 2IU7A 2O38A 3QF3A 3SCFA 4Z5DA 3MLFA 1B0NA 2L8NA 4Z59A 1BDIA 1WH6A 2FJRA 2IVQA 3TRBA 1ZZ9A 1RZRA 2BNOA 2MQKA 1Y9QA 5K98B 2XI8A 1BDHA 1CJGA 2LCVA 1X2LA 2EWTA 4J1XA 3JXCL 4JQDA 1L1MA 2ICTA 4I6UA 2LYQA 1XWRA 2WIUB 3BS3A 4Y42A 4Z58A 2R1JL 1LCDA 2PPXA 2B5AA 2XIUA 4IVZA 1QP7A 1DW9A 3F52A 2LYJA 1ZZ6A 1RPEL 1JWLA 1ZZ7A 1S7EA 3OP9A 1GT0C 1AU7A 3GN5B 3DNVB 3LFPA 2ICPA 2IUOA 4FBIA 4X4EA 2XSDC 1JFSA 1PNRA 1RIOA 1LMB3 2KZ8A 4X4FA 1RZRD 2AXZA 3JXDL 2PUCA 1WIZA 1QQAA 1PRVA 1LLIA 1R63A 2O4AA 2CROA 2WUSR 1ZUGA 3G7DA 4Z5HA 4X4DA 1PRAA 4PU4C 2R63A 2GRMA 1R69A 3OQOA 1LCCA 3KJXA 1UXDA 1Y7YA 2PE5A 2BNNA 4F8DA 2PUAA
chains in the Genus database with same CATH superfamily
3QWGA 1QB2A 3QQ6A 2L1PA 4YBAA 3GBFA 3GZDA 3KZ3A 1QQBA 2PIJA 3OKZA 1IC8A 3PXPA 4I8TA 2LYLA 3A9XA 3TELA 4OBMA 2CSFA 2PXFA 2EBYA 4GHJA 2AWIA 1NEQA 3M9LA 4DE9A 5GAHi 1ZZ8A 4DE8A 2IVGA 2HSGA 2BNNA 1QPZA 2PUDA 1PERL 1ZZBA 2XXQA 2GRLA 3B7HA 3QOXA 2XXPA 4ER5A 1VPWA 2JVLA 2HCNA 1POUA 3GZDC 3G0TA 2O49A 1SQ8A 3LISA 5DT2A 2OR1L 4O8BA 3GN5A 4Q2JA 3U3WA 3OQNA 1DWKA 2AUWA 4J1WA 1ZAYA 5A7LA 4Z59A 3PE5A 2IVQA 1ZZ9A 2MQKA 5K98B 2XI8A 2XXAA 3ME5A 1CJGA 4J1XA 1XWRA 4Y42A 2PPXA 4EKGA 3F52A 1ZZ7A 1GT0C 3GN5B 2ICPA 2PXUA 1RZRD 3A9YA 2PUCA 3JXDL 2O4AA 2CROA 2WUSR 2MXDA 1PRAA 2GRMA 1R69A 3KJXA 1UXDA 2PE5A 2D5VA 2PUAA 4ER0A 3GZCA 2OFYA 1PRUA 2PUEA 3ZHIA 3D1NI 2IVBA 2JCGA 1RZSA 3GUUA 2JQEA 3TEPA 3IVPA 4I6TA 2BNMA 4JCXA 3FYMA 2J7WA 4PU8A 2PXEA 1E3OC 2L49A 2PUFA 5DTQA 3ZKCA 5DRYA 2PXVA 1O4XA 2H8RA 2PXDA 3DM5A 3HZIB 3UWPA 2XCJA 4YG4A 1OCTC 3CLCA 2PXPA 3S8QA 3KXAA 3CROL 3R09A 2AXUA 1NERA 2KEJA 4X4IA 3OWQA 5DTMA 4IA8A 1UTXA 2PUGA 2KEKA 1DULA 1ZPQA 1B0NA 1QZXA 2L8NA 4HRAA 1BDIA 1WH6A 1Y9QA 3VWSA 2LCVA 2LLVA 2EWTA 2ICTA 5GAGi 1LCDA 3QFIA 2XIUA 2B5AA 2PXQA 3DNVB 4X4EA 2IUOA 4FBIA 1PNRA 1LMB3 2KZ8A 4X4FA 1WIZA 1QQAA 1R63A 3G7DA 4PU4C 2R63A 3QOWA 2ODRD 5DSXA 3OQOA 1LCCA 3A9ZA 1QP0A 1HF0A 4YG7B 2LYSA 4X4CA 2XJ3A 2LYRA 1ADRA 1WH8A 3OMTA 4NDWA 3O9XA 2KEIA 2HCSA 4EZIA 2LNMA 5DRTA 4X4GA 4ER3A 4EKIA 4Z5CA 3NROA 4OB4A 2M4HA 2HFZA 4IWRA 3OQMA 2MEZA 1WETA 2FFHA 3SCGA 4YG1A 1OSLA 3SR4A 2AXVA 1CQTA 3VK0A 3FYAA 3L1PA 4FN3A 2LLWA 2A6CA 3EUSA 2LYPA 3KL4A 2IV1A 3FMYA 2BJCA 3MEJA 4MCXA 3LQXA 4GQMA 3BDNA 3F6WA 3G5GA 1ZZCA 2YBDA 2GZUA 1JFTA 2PUBA 2IU7A 3SCFA 3QF3A 4Z5DA 3MLFA 5DTRA 2FJRA 2J7UA 2BNOA 1NW3A 1HQ1A 1L1MA 4I6UA 2LYQA 4Z58A 2PXKA 2LYJA 1ZZ6A 3OP9A 3NXHA 3LFPA 1JFSA 2XSDC 1RIOA 2AXZA 1LLIA 3SX0A 4ER6A 1ZUGA 4Z5HA 3TFLA 4PU7A 1JH9A 3R1FA 4PU3C 4I6RA 2HINA 2LYKA 4JCYA 2EF8A 3RZZA 2AW6A 3CECA 1UXCA 3NDBB 4WVLA 4MCTA 1LQCA 4X4HA 3NZLA 4ER7A 3BD1A 1MFQC 4EQZA 1YSEA 1U2ZA 5JUWA 1ZS4A 2KPJA 1EFAA 2PXTA 3ZHMA 3H5TA 2PXBA 3JXBC 4X4BA 4YARA 2PXLA 2V3CC 4EK9A 3ZPXA 1QP4A 3UFDA 3QYXA 1ZVVA 3F51A 1X57A 3SCHA 2VEOA 2O38A 1RZRA 1BDHA 1X2LA 3JXCL 4JQDA 2WIUB 3BS3A 2R1JL 4IVZA 1QP7A 1DW9A 1RPEL 1JWLA 1S7EA 1AU7A 1PRVA 4X4DA 1Y7YA 3TRBA 4F8DA
chains in the Genus database with same CATH topology
4PU7A 1JH9A 1HF0A 3R1FA 3QWGA 2OFYA 4PU3C 4I6RA 3QQ6A 4YBAA 3GBFA 1PRUA 4YG7B 2HINA 2LYSA 3KZ3A 2LYKA 2PUEA 2EF8A 4X4CA 3RZZA 4JCYA 1QQBA 2AW6A 2XJ3A 3CECA 3ZHIA 2PIJA 2LYRA 1UXCA 3D1NI 2IVBA 2JCGA 1ADRA 4X4HA 1RZSA 1LQCA 1WH8A 3OMTA 4MCTA 4NDWA 3O9XA 1IC8A 2KEIA 3PXPA 4I8TA 3BD1A 2LYLA 3IVPA 2BNMA 4I6TA 4X4GA 1YSEA 4JCXA 3FYMA 2CSFA 1ZS4A 2KPJA 4PU8A 4Z5CA 2EBYA 1E3OC 4GHJA 1EFAA 2AWIA 4OB4A 1NEQA 1ZZ8A 2L49A 2PUFA 4IWRA 3ZHMA 2IVGA 3ZKCA 2HSGA 1QPZA 3OQMA 2MEZA 3H5TA 1WETA 2PUDA 3JXBC 1O4XA 1PERL 2H8RA 1ZZBA 3HZIB 2XCJA 3SCGA 4YG1A 4YG4A 1OSLA 1OCTC 3CLCA 2GRLA 3B7HA 2AXVA 1VPWA 4X4BA 4YARA 1CQTA 2JVLA 3VK0A 3FYAA 1POUA 3L1PA 4FN3A 3S8QA 3KXAA 3CROL 2AXUA 1NERA 1QP4A 2A6CA 3EUSA 2KEJA 3UFDA 2LYPA 2O49A 1QP0A 1SQ8A 3LISA 4X4IA 2OR1L 4O8BA 2IV1A 3FMYA 3QYXA 1ZVVA 3GN5A 3F51A 2BJCA 4IA8A 1X57A 4MCXA 3U3WA 3OQNA 4GQMA 3BDNA 1UTXA 3F6WA 3SCHA 3G5GA 1ZZCA 1JFTA 2GZUA 2PUGA 1DWKA 2KEKA 2D5VA 2PUBA 2AUWA 4J1WA 1ZAYA 1ZPQA 5A7LA 2IU7A 2O38A 3QF3A 3SCFA 4Z5DA 3MLFA 1B0NA 2L8NA 4Z59A 1BDIA 1WH6A 2FJRA 2IVQA 3TRBA 1ZZ9A 1RZRA 2BNOA 2MQKA 1Y9QA 5K98B 2XI8A 1BDHA 1CJGA 2LCVA 1X2LA 2EWTA 4J1XA 3JXCL 4JQDA 1L1MA 2ICTA 4I6UA 2LYQA 1XWRA 2WIUB 3BS3A 4Y42A 4Z58A 2R1JL 1LCDA 2PPXA 2B5AA 2XIUA 4IVZA 1QP7A 1DW9A 3F52A 2LYJA 1ZZ6A 1RPEL 1JWLA 1ZZ7A 1S7EA 3OP9A 1GT0C 1AU7A 3GN5B 3DNVB 3LFPA 2ICPA 2IUOA 4FBIA 4X4EA 2XSDC 1JFSA 1PNRA 1RIOA 1LMB3 2KZ8A 4X4FA 1RZRD 2AXZA 3JXDL 2PUCA 1WIZA 1QQAA 1PRVA 1LLIA 1R63A 2O4AA 2CROA 2WUSR 1ZUGA 3G7DA 4Z5HA 4X4DA 1PRAA 4PU4C 2R63A 2GRMA 1R69A 3OQOA 1LCCA 3KJXA 1UXDA 1Y7YA 2PE5A 2BNNA 4F8DA 2PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PU7 A;  1JH9 A;  1HF0 A;  3R1F A;  3QWG A;  2OFY A;  4PU3 C;  4I6R A;  3QQ6 A;  4YBA A;  3GBF A;  1PRU A;  4YG7 B;  2HIN A;  2LYS A;  3KZ3 A;  2LYK A;  2PUE A;  2EF8 A;  4X4C A;  3RZZ A;  4JCY A;  1QQB A;  2AW6 A;  2XJ3 A;  3CEC A;  3ZHI A;  2PIJ A;  2LYR A;  1UXC A;  3D1N I;  2IVB A;  2JCG A;  1ADR A;  4X4H A;  1RZS A;  1LQC A;  1WH8 A;  3OMT A;  4MCT A;  4NDW A;  3O9X A;  1IC8 A;  2KEI A;  3PXP A;  4I8T A;  3BD1 A;  2LYL A;  3IVP A;  2BNM A;  4I6T A;  4X4G A;  1YSE A;  4JCX A;  3FYM A;  2CSF A;  1ZS4 A;  2KPJ A;  4PU8 A;  4Z5C A;  2EBY A;  1E3O C;  4GHJ A;  1EFA A;  2AWI A;  4OB4 A;  1NEQ A;  1ZZ8 A;  2L49 A;  2PUF A;  4IWR A;  3ZHM A;  2IVG A;  3ZKC A;  2HSG A;  1QPZ A;  3OQM A;  2MEZ A;  3H5T A;  1WET A;  2PUD A;  3JXB C;  1O4X A;  1PER L;  2H8R A;  1ZZB A;  3HZI B;  2XCJ A;  3SCG A;  4YG1 A;  4YG4 A;  1OSL A;  1OCT C;  3CLC A;  2GRL A;  3B7H A;  2AXV A;  1VPW A;  4X4B A;  4YAR A;  1CQT A;  2JVL A;  3VK0 A;  3FYA A;  1POU A;  3L1P A;  4FN3 A;  3S8Q A;  3KXA A;  3CRO L;  2AXU A;  1NER A;  1QP4 A;  2A6C A;  3EUS A;  2KEJ A;  3UFD A;  2LYP A;  2O49 A;  1QP0 A;  1SQ8 A;  3LIS A;  4X4I A;  2OR1 L;  4O8B A;  2IV1 A;  3FMY A;  3QYX A;  1ZVV A;  3GN5 A;  3F51 A;  2BJC A;  4IA8 A;  1X57 A;  4MCX A;  3U3W A;  3OQN A;  4GQM A;  3BDN A;  1UTX A;  3F6W A;  3SCH A;  3G5G A;  1ZZC A;  1JFT A;  2GZU A;  2PUG A;  1DWK A;  2KEK A;  2D5V A;  2PUB A;  2AUW A;  4J1W A;  1ZAY A;  1ZPQ A;  5A7L A;  2IU7 A;  2O38 A;  3QF3 A;  3SCF A;  4Z5D A;  3MLF A;  1B0N A;  2L8N A;  4Z59 A;  1BDI A;  1WH6 A;  2FJR A;  2IVQ A;  3TRB A;  1ZZ9 A;  1RZR A;  2BNO A;  2MQK A;  1Y9Q A;  5K98 B;  2XI8 A;  1BDH A;  1CJG A;  2LCV A;  1X2L A;  2EWT A;  4J1X A;  3JXC L;  4JQD A;  1L1M A;  2ICT A;  4I6U A;  2LYQ A;  1XWR A;  2WIU B;  3BS3 A;  4Y42 A;  4Z58 A;  2R1J L;  1LCD A;  2PPX A;  2B5A A;  2XIU A;  4IVZ A;  1QP7 A;  1DW9 A;  3F52 A;  2LYJ A;  1ZZ6 A;  1RPE L;  1JWL A;  1ZZ7 A;  1S7E A;  3OP9 A;  1GT0 C;  1AU7 A;  3GN5 B;  3DNV B;  3LFP A;  2ICP A;  2IUO A;  4FBI A;  4X4E A;  2XSD C;  1JFS A;  1PNR A;  1RIO A;  1LMB 3;  2KZ8 A;  4X4F A;  1RZR D;  2AXZ A;  3JXD L;  2PUC A;  1WIZ A;  1QQA A;  1PRV A;  1LLI A;  1R63 A;  2O4A A;  2CRO A;  2WUS R;  1ZUG A;  3G7D A;  4Z5H A;  4X4D A;  1PRA A;  4PU4 C;  2R63 A;  2GRM A;  1R69 A;  3OQO A;  1LCC A;  3KJX A;  1UXD A;  1Y7Y A;  2PE5 A;  2BNN A;  4F8D A;  2PUA A; 
#chains in the Genus database with same CATH topology
 3QWG A;  1QB2 A;  3QQ6 A;  2L1P A;  4YBA A;  3GBF A;  3GZD A;  3KZ3 A;  1QQB A;  2PIJ A;  3OKZ A;  1IC8 A;  3PXP A;  4I8T A;  2LYL A;  3A9X A;  3TEL A;  4OBM A;  2CSF A;  2PXF A;  2EBY A;  4GHJ A;  2AWI A;  1NEQ A;  3M9L A;  4DE9 A;  5GAH i;  1ZZ8 A;  4DE8 A;  2IVG A;  2HSG A;  2BNN A;  1QPZ A;  2PUD A;  1PER L;  1ZZB A;  2XXQ A;  2GRL A;  3B7H A;  3QOX A;  2XXP A;  4ER5 A;  1VPW A;  2JVL A;  2HCN A;  1POU A;  3GZD C;  3G0T A;  2O49 A;  1SQ8 A;  3LIS A;  5DT2 A;  2OR1 L;  4O8B A;  3GN5 A;  4Q2J A;  3U3W A;  3OQN A;  1DWK A;  2AUW A;  4J1W A;  1ZAY A;  5A7L A;  4Z59 A;  3PE5 A;  2IVQ A;  1ZZ9 A;  2MQK A;  5K98 B;  2XI8 A;  2XXA A;  3ME5 A;  1CJG A;  4J1X A;  1XWR A;  4Y42 A;  2PPX A;  4EKG A;  3F52 A;  1ZZ7 A;  1GT0 C;  3GN5 B;  2ICP A;  2PXU A;  1RZR D;  3A9Y A;  2PUC A;  3JXD L;  2O4A A;  2CRO A;  2WUS R;  2MXD A;  1PRA A;  2GRM A;  1R69 A;  3KJX A;  1UXD A;  2PE5 A;  2D5V A;  2PUA A;  4ER0 A;  3GZC A;  2OFY A;  1PRU A;  2PUE A;  3ZHI A;  3D1N I;  2IVB A;  2JCG A;  1RZS A;  3GUU A;  2JQE A;  3TEP A;  3IVP A;  4I6T A;  2BNM A;  4JCX A;  3FYM A;  2J7W A;  4PU8 A;  2PXE A;  1E3O C;  2L49 A;  2PUF A;  5DTQ A;  3ZKC A;  5DRY A;  2PXV A;  1O4X A;  2H8R A;  2PXD A;  3DM5 A;  3HZI B;  3UWP A;  2XCJ A;  4YG4 A;  1OCT C;  3CLC A;  2PXP A;  3S8Q A;  3KXA A;  3CRO L;  3R09 A;  2AXU A;  1NER A;  2KEJ A;  4X4I A;  3OWQ A;  5DTM A;  4IA8 A;  1UTX A;  2PUG A;  2KEK A;  1DUL A;  1ZPQ A;  1B0N A;  1QZX A;  2L8N A;  4HRA A;  1BDI A;  1WH6 A;  1Y9Q A;  3VWS A;  2LCV A;  2LLV A;  2EWT A;  2ICT A;  5GAG i;  1LCD A;  3QFI A;  2XIU A;  2B5A A;  2PXQ A;  3DNV B;  4X4E A;  2IUO A;  4FBI A;  1PNR A;  1LMB 3;  2KZ8 A;  4X4F A;  1WIZ A;  1QQA A;  1R63 A;  3G7D A;  4PU4 C;  2R63 A;  3QOW A;  2ODR D;  5DSX A;  3OQO A;  1LCC A;  3A9Z A;  1QP0 A;  1HF0 A;  4YG7 B;  2LYS A;  4X4C A;  2XJ3 A;  2LYR A;  1ADR A;  1WH8 A;  3OMT A;  4NDW A;  3O9X A;  2KEI A;  2HCS A;  4EZI A;  2LNM A;  5DRT A;  4X4G A;  4ER3 A;  4EKI A;  4Z5C A;  3NRO A;  4OB4 A;  2M4H A;  2HFZ A;  4IWR A;  3OQM A;  2MEZ A;  1WET A;  2FFH A;  3SCG A;  4YG1 A;  1OSL A;  3SR4 A;  2AXV A;  1CQT A;  3VK0 A;  3FYA A;  3L1P A;  4FN3 A;  2LLW A;  2A6C A;  3EUS A;  2LYP A;  3KL4 A;  2IV1 A;  3FMY A;  2BJC A;  3MEJ A;  4MCX A;  3LQX A;  4GQM A;  3BDN A;  3F6W A;  3G5G A;  1ZZC A;  2YBD A;  2GZU A;  1JFT A;  2PUB A;  2IU7 A;  3SCF A;  3QF3 A;  4Z5D A;  3MLF A;  5DTR A;  2FJR A;  2J7U A;  2BNO A;  1NW3 A;  1HQ1 A;  1L1M A;  4I6U A;  2LYQ A;  4Z58 A;  2PXK A;  2LYJ A;  1ZZ6 A;  3OP9 A;  3NXH A;  3LFP A;  1JFS A;  2XSD C;  1RIO A;  2AXZ A;  1LLI A;  3SX0 A;  4ER6 A;  1ZUG A;  4Z5H A;  3TFL A;  4PU7 A;  1JH9 A;  3R1F A;  4PU3 C;  4I6R A;  2HIN A;  2LYK A;  4JCY A;  2EF8 A;  3RZZ A;  2AW6 A;  3CEC A;  1UXC A;  3NDB B;  4WVL A;  4MCT A;  1LQC A;  4X4H A;  3NZL A;  4ER7 A;  3BD1 A;  1MFQ C;  4EQZ A;  1YSE A;  1U2Z A;  5JUW A;  1ZS4 A;  2KPJ A;  1EFA A;  2PXT A;  3ZHM A;  3H5T A;  2PXB A;  3JXB C;  4X4B A;  4YAR A;  2PXL A;  2V3C C;  4EK9 A;  3ZPX A;  1QP4 A;  3UFD A;  3QYX A;  1ZVV A;  3F51 A;  1X57 A;  3SCH A;  2VEO A;  2O38 A;  1RZR A;  1BDH A;  1X2L A;  3JXC L;  4JQD A;  2WIU B;  3BS3 A;  2R1J L;  4IVZ A;  1QP7 A;  1DW9 A;  1RPE L;  1JWL A;  1S7E A;  1AU7 A;  1PRV A;  4X4D A;  1Y7Y A;  3TRB A;  4F8D A; 
#chains in the Genus database with same CATH homology
 4PU7 A;  1JH9 A;  1HF0 A;  3R1F A;  3QWG A;  2OFY A;  4PU3 C;  4I6R A;  3QQ6 A;  4YBA A;  3GBF A;  1PRU A;  4YG7 B;  2HIN A;  2LYS A;  3KZ3 A;  2LYK A;  2PUE A;  2EF8 A;  4X4C A;  3RZZ A;  4JCY A;  1QQB A;  2AW6 A;  2XJ3 A;  3CEC A;  3ZHI A;  2PIJ A;  2LYR A;  1UXC A;  3D1N I;  2IVB A;  2JCG A;  1ADR A;  4X4H A;  1RZS A;  1LQC A;  1WH8 A;  3OMT A;  4MCT A;  4NDW A;  3O9X A;  1IC8 A;  2KEI A;  3PXP A;  4I8T A;  3BD1 A;  2LYL A;  3IVP A;  2BNM A;  4I6T A;  4X4G A;  1YSE A;  4JCX A;  3FYM A;  2CSF A;  1ZS4 A;  2KPJ A;  4PU8 A;  4Z5C A;  2EBY A;  1E3O C;  4GHJ A;  1EFA A;  2AWI A;  4OB4 A;  1NEQ A;  1ZZ8 A;  2L49 A;  2PUF A;  4IWR A;  3ZHM A;  2IVG A;  3ZKC A;  2HSG A;  1QPZ A;  3OQM A;  2MEZ A;  3H5T A;  1WET A;  2PUD A;  3JXB C;  1O4X A;  1PER L;  2H8R A;  1ZZB A;  3HZI B;  2XCJ A;  3SCG A;  4YG1 A;  4YG4 A;  1OSL A;  1OCT C;  3CLC A;  2GRL A;  3B7H A;  2AXV A;  1VPW A;  4X4B A;  4YAR A;  1CQT A;  2JVL A;  3VK0 A;  3FYA A;  1POU A;  3L1P A;  4FN3 A;  3S8Q A;  3KXA A;  3CRO L;  2AXU A;  1NER A;  1QP4 A;  2A6C A;  3EUS A;  2KEJ A;  3UFD A;  2LYP A;  2O49 A;  1QP0 A;  1SQ8 A;  3LIS A;  4X4I A;  2OR1 L;  4O8B A;  2IV1 A;  3FMY A;  3QYX A;  1ZVV A;  3GN5 A;  3F51 A;  2BJC A;  4IA8 A;  1X57 A;  4MCX A;  3U3W A;  3OQN A;  4GQM A;  3BDN A;  1UTX A;  3F6W A;  3SCH A;  3G5G A;  1ZZC A;  1JFT A;  2GZU A;  2PUG A;  1DWK A;  2KEK A;  2D5V A;  2PUB A;  2AUW A;  4J1W A;  1ZAY A;  1ZPQ A;  5A7L A;  2IU7 A;  2O38 A;  3QF3 A;  3SCF A;  4Z5D A;  3MLF A;  1B0N A;  2L8N A;  4Z59 A;  1BDI A;  1WH6 A;  2FJR A;  2IVQ A;  3TRB A;  1ZZ9 A;  1RZR A;  2BNO A;  2MQK A;  1Y9Q A;  5K98 B;  2XI8 A;  1BDH A;  1CJG A;  2LCV A;  1X2L A;  2EWT A;  4J1X A;  3JXC L;  4JQD A;  1L1M A;  2ICT A;  4I6U A;  2LYQ A;  1XWR A;  2WIU B;  3BS3 A;  4Y42 A;  4Z58 A;  2R1J L;  1LCD A;  2PPX A;  2B5A A;  2XIU A;  4IVZ A;  1QP7 A;  1DW9 A;  3F52 A;  2LYJ A;  1ZZ6 A;  1RPE L;  1JWL A;  1ZZ7 A;  1S7E A;  3OP9 A;  1GT0 C;  1AU7 A;  3GN5 B;  3DNV B;  3LFP A;  2ICP A;  2IUO A;  4FBI A;  4X4E A;  2XSD C;  1JFS A;  1PNR A;  1RIO A;  1LMB 3;  2KZ8 A;  4X4F A;  1RZR D;  2AXZ A;  3JXD L;  2PUC A;  1WIZ A;  1QQA A;  1PRV A;  1LLI A;  1R63 A;  2O4A A;  2CRO A;  2WUS R;  1ZUG A;  3G7D A;  4Z5H A;  4X4D A;  1PRA A;  4PU4 C;  2R63 A;  2GRM A;  1R69 A;  3OQO A;  1LCC A;  3KJX A;  1UXD A;  1Y7Y A;  2PE5 A;  2BNN A;  4F8D A;  2PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...