4EZIA

Crystal structure of a putative hydrolase (lpg1103) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.15 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
371
Chain Sequence
EKLVNYIALGEFSRETAEIALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIASGLVAMPIHPVGQVGIISYQHGTRFERNDVPSRNNEKNYIYLAAYGNSAGYMTVMPDYLGLGDNELTLHPYVQAETLASSSIDMLFAAKELANRLHYPISDKLYLAGYSEGGFSTIVMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEPGPRATAYLAYFFYSLQTYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEILQALPQDPLLIFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYAGAEMAYHSFRKYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (lpg1103) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 1.15 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Unknown function
total genus 124
structure length 371
sequence length 371
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.160 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4eziA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eziA01
3FAKA 2VJBA 3UMJA 3I1YA 2ZJ7A 1EK2A 4FOLA 2PX6A 2XUFA 2XUAA 5E4YA 1MJ5A 4MYDA 2XMSA 3M81A 2I03A 2ZYHA 5LZ2A 1UFOA 2GYUA 2HU7A 5CURA 4QEKA 3BIWA 4OU5A 2BJHA 3DJYA 1XZJA 1DWOA 2QOEA 5ALOA 4FMPA 5A71A 2AXEA 3R41A 5LZ9A 1CUSA 3DOHA 3R0VA 1YB7A 3PF9A 3DNMA 4LHEA 4B82A 5ALDA 1YA8A 2ECFA 4JUIA 3KWJA 4FBLA 4KE8A 2WLSA 4NMWA 4BP8A 3WZLA 3CCBA 2QJWA 1CUGA 1XQWA 1ZGBA 2WIKA 1IZ8A 1BN6A 4HVTA 1ZD5A 1L7RA 2V9ZA 3GZJA 4FDMA 3RM3A 1VJ5A 1ZGCA 1H2ZA 2ACEA 1AMNA 4H0CA 2ONCA 5EIEA 3CXUA 2BAGA 1CUIA 1TKRA 4MWSA 5CH5A 5AOCA 5HZGA 2XQFA 2WIGA 6YASA 2PBLA 3VDXA 4ZV7A 1AKNA 2DCMA 1JI3A 2OCGA 3GBSA 1ZD4A 2HHAA 5AKIA 4ETWA 2ZVDA 1DWQA 2V98A 1MX5A 4NZZA 3ICVA 1WPRA 3O9VA 1C4XA 4B7ZA 4QDXA 2OAGA 5AOAA 1OILA 3FYUA 2WILA 4W1RA 3W9BA 5BOVA 3HI4A 5I9IA 1CRLA 2QMQA 2DHEA 3C43A 3C87A 4AZ3A 3FYUB 5CXUA 5CTAA 1H2XA 4EY7A 5A7GA 4N8DA 4I4CA 4OB7A 3LS2A 3JYHA 4KE6A 5ALXA 4WDQA 2OGSA 3G0IA 1QGED 3AIKA 1J07A 4PW0A 4BDSA 4C89A 1X2BA 2ROQA 4RE6A 3N0TA 3QM1A 3STVA 3BWXA 2OG1A 1THGA 4Q1VA 4G8CA 5JASA 3H2KA 2HU5A 5CT8A 4J0DA 4OSEA 5FPPA 2J3QA 4FWBA 3R3UA 5JZBA 1JMKC 1XZAA 2PSFA 4X6YA 3WL7A 4PF1A 5AKEA 4PV7A 5HCUA 1W4LA 4IH4A 5ALYA 5HQ3A 4Y2SA 3W04A 2JGKA 4HS9A 1ZOIA 5YASA 2WUGA 3I2KA 5HQ3B 4JYPA 5DLPA 3H2JA 3HJUA 1DQYA 1DX6A 4BAZA 2UZ0A 2WTMA 4BCBA 1R88A 1P0MA 4BTLA 1QO7A 1L7AA 1H22A 3A6ZA 3ANSA 2XUOA 3D2AA 2QT9A 1DT5A 4WFKA 4G8DA 2QTBA 1G4HA 4BATA 3WJ1A 4BAUA 5JD4A 5A2GA 4FNMA 5ALKA 3IIIA 1UK6A 4P93A 4C87A 4B9AA 1AX9A 4LYEA 4X6XA 7YASA 2Z8ZA 2GBFA 2ZYSA 4MWTA 5HFNA 4I3FA 3WKAA 4Y7DA 4TGLA 2WJ6A 4CG1A 4YPVA 1P0QA 1CUHA 4CG3A 3O4IA 4N5HX 3OPMA 4C01A 3QVMA 4F0JA 2VEOA 5HK8A 1CUEA 4Y2TA 1B41A 1IVYA 4Y2VA 1FFDA 5A6VA 5JANA 5T4HA 2OCLA 3AIOA 5T4BA 3ZLVA 3IUNA 2WFLA 4Y2QA 3D2CA 1VA4A 4ZV9A 2HFKA 4B81A 2DSNA 1N8SA 2I3DA 2WFLB 3TEJA 2HDWA 3H19A 1UKBA 1XZBA 3EQ8A 3FSGA 4BCCA 3H18A 1FFAA 5AKKA 3C6BA 4BTVA 3U1TA 5JADA 1XQXA 3O9MA 3IUJA 1MNAA 3AZPA 4GEGA 2FJ0A 2XUGA 5ALGA 1GKLA 4QA9A 3V1MA 3HACA 4DMKA 3VKFA 2X76A 1XZEA 3V1KA 4YASA 1CUXA 4IHAA 2DHDA 2RONA 5CH3A 3QITA 4F5ZA 3R3ZA 1YSCA 2BUAA 1EINA 1ZICA 5JATA 5HF8A 5DYYA 3G0GA 4OPMA 1LPMA 3I6YA 4XJVA 1GPNA 1XZMA 3BF7A 1K4YA 2YYSA 4FHZA 5AI0A 1KEZA 2XMCA 2HL6A 3C6YA 5LLSA 1JMYA 4W1PA 5EIHA 3QPDA 3IVMA 5ALMA 4M0EA 3F8SA 4BAGA 2BUBA 1XKLA 4PNZA 2Z5GA 2HA6A 2XI4A 3OTQA 4U2GA 2GBGA 5SYMA 2VAVA 1XRPA 2O2IA 1TCBA 2PVSA 2XUKA 3RKSA 1BRTA 4EY5A 4QDUA 2DQZA 1L7QA 1B6GA 3M3DA 5EHXA 4AO6A 2JGLA 4Q3OA 3VVMA 3WK5A 3IBTA 3ED1A 1PV1A 4KAAA 4QDOA 1WHTA 3BJMA 2XQJA 5SYNA 3W2TA 1WOMA 4WFJA 1EDBA 2BGRA 3WKCA 1BEZA 3WWCA 1QIGA 1ZIXA 3IULA 2AJBA 1ISPA 1GXSA 2C7BA 3AILA 5E4JA 1GGVA 4OB8A 4M0MA 3L1HA 2QXUA 3E0XA 2RI6A 4OU4A 1XLUA 4MEAA 3ZLUA 4NS4A 5ALUA 4J0GA 2WKWA 4QWWA 1IMJA 3I2GA 3ZLTA 3SWWA 5AI9A 4BVKA 1HKHA 1Y37A 5I8PA 5JZ9A 4UBKA 2ES4A 4HZGA 4X95A 4U2CA 4E14A 1XRLA 1THTA 4BRZA 5CXXA 1DT3A 4Q3LA 1RP1A 2FUKA 4WJLA 1FFBA 3FYTA 2BFNA 4UBOA 4X71A 2YH2A 4B84A 1CUWA 3C6ZA 2V97A 3STWA 3TGLA 4QLAA 4QE3A 4FLFA 3G0DA 1MT3A 3IA2A 4BP9A 4DYHA 2OGZA 2XLBA 5DYTA 2IX9A 2G63A 5D7BA 4JNCA 2R11A 2WUEA 1Q83A 5KWIA 5JZSA 1A88A 2J4FA 2G4LA 1XLVA 2VF2A 4B9EA 3R3VA 3DD5A 3ZWQA 2VSQA 2WTNA 3AFIA 2E3JA 5CT9A 2FJPA 2XUQA 3DCNA 3KOOA 4B6GA 1MX1A 1OCEA 4AX4A 1E8DA 3HLKA 3NGMA 2CMFA 3LCRA 3WYNA 1BCRA 1NU8A 4W9RA 2XMZA 1R9NA 1XZHA 3D5EA 2PSDA 3DEAA 4IO0A 3PDCA 5D3KA 4B0OA 1ZI6A 5ALPA 4P92A 3LIIA 4U2EA 2V96A 3AIMA 4G5XA 2VJAA 4ZGBA 1UK8A 2WU4A 2EEPA 5LP1A 3KSRA 4UFNA 5JD6A 2XDWA 5FP0A 5C7YA 4JYMA 1UK7A 4GW3A 5KBYA 4UUQA 1QIKA 5LZ7A 4G4JA 2G5PA 1N5MA 3I28A 3L1JA 5AIAA 5JYCA 5T4EA 2VQ6A 1TIBA 4B83A 3DS8A 4K6GA 1W1IA 2QKYA 5EHQA 2Z3ZA 3WLAA 2HU8A 4UFOA 1A8QA 3G9ZA 1ZI9A 3VXKA 2DQYA 3FNBA 3G9XA 1PFQA 4LXHA 1J1IA 2Y6VA 2XQKA 3I2HA 5JAUA 1SFRA 1CQZA 3FLBA 5AH0A 4Y2XA 2JGFA 5DWDA 1QE3A 2QS9A 3CN9A 4ARBA 3GELA 1LPPA 1W75A 5HFAA 3HYSA 1ZIYA 1JKMA 4GHWA 4C88A 3WI7A 1FFEA 5ALRA 1YCDA 1XQYA 3AZOA 1AGYA 3QYJA 1WPXA 3C45A 3QPAA 4PSCA 4A5SA 4DNFA 4UBLA 2HA3A 3EQ7A 4CFSA 3WQHA 1Y7IA 1O6FA 5CRIA 4N8SA 3D3NA 2X5XA 5H3HA 1VLQA 3PUIA 4IH1A 2WIDA 4FTWA 4J03A 1Q0ZA 1QIMA 4J0HA 4CIAA 2VJDA 4QNNA 5IVIA 2XMRA 4CG2A 3H04A 5AM0A 1IUPA 3D0KA 3SC2A 2QUAA 5IVKA 1CUAA 4M0FA 5AICA 1R1DA 5LIPA 4QDTA 5ALIA 3O4HA 5ALSA 4ZRDA 5AM1A 5I7UA 4OYLA 2HA0A 4UHHA 1H2YA 2ZSHA 1E8NA 4AMZA 4WDRA 2DHCA 4LKOA 4TPKA 5EGNA 3V48A 2XLCA 3BDVA 5F4ZA 4Y2YA 2B20A 5T4FA 1XQVA 4ARAA 3Q8WA 1QFMA 1TRHA 1JU3A 4ZREA 2CUTA 2YASA 4X92A 5K3CA 4AN1A 1LPNA 5LZ8A 1XRQA 3K6KA 5AI4A 5EI5A 1J06A 3DQZA 5J3JA 2XQIA 5IVDA 1BS9A 4J7AA 2I3ZA 2WJ4A 3WK9A 5KWJA 1IUNA 1DWPA 1AQLA 2GYWA 3HXKA 3G9UA 4QDZA 4CCWA 1WHSA 1TK3A 3A70A 4BRSA 3AUKA 2K2QB 4TVKA 1XZKA 4P08A 2Y1KA 2WU3A 4J3JA 2BUCA 4LXIA 2QRUA 5KREA 4OCZA 3I2IA 1EHYA 3OG9A 2RAUA 1ODSA 1CUYA 2Q0XA 4WY8A 5FXMA 1R50A 3VJMA 3WWPA 1QLWA 2HADA 1EDEA 1LBTA 4KEAA 4KAFA 2BCEA 4DIUA 4EHBA 1CQWA 1EVQA 3KWFA 3GA7A 5AKHA 1SOMA 3IURA 5K3BA 5A7HA 3QMWA 1TCCA 5DTJA 4F60A 1QIEA 4J0JA 4C4ZA 2HA4A 3M82A 4G1FA 3B12A 3AJAA 1M33A 4U2DA 4Z49A 1CEXA 5A7FA 1QTIA 5CH8A 5AKYA 1RWQA 4X3CA 1EH5A 1YAHA 3QMMA 5CW2A 2I78A 3DKKA 4X93A 3H17A 1DINA 5HK9A 1FJ2A 4OYYA 1Z68A 1UKCA 4CCYA 2AJLI 2O2GA 3ESBA 5AKZA 5D6OA 1HPLA 4DMCA 3TRDA 2PSEA 2WG1A 3WA6A 3R3YA 1J2EA 1ZJ4A 4CCYB 5JAOA 4A16A 2CZQA 2PSJA 1CUUA 3PFBA 2HM7A 4YX9A 4G8BA 1SCIA 3PFCA 4LXGA 4B0PA 1EK1A 4EA6A 1WB4A 2OCKA 2QVBA 3S8YA 2PM8A 5AHXA 3A2NA 2HRQA 4Q3KA 2FX5A 1VKHA 3DL7A 2EDCA 3M83A 4UHFA 1T4MA 4MJ3A 1CPYA 3WK6A 1IZ7A 3IUQA 2XUDA 5AO9A 3WMRA 4QWMA 5ALJA 4MQLA 3FBWA 4W63A 5EHNA 1CUBA 2WHRA 3VVLA 5AK5A 5ESRA 3PI6A 3G8YA 2VTVA 3DDUA 4C4YA 3QPCA 1YA4A 3EQ9A 3BE8A 3FYUC 2Z3WA 1AURA 2XUIA 4H7EA 1XZLA 3JWEA 3AZQA 1GQRA 5FPQA 4BC1A 1MNQA 3F9CA 4FFWA 5LZ4A 1R4ZA 4BZWA 5HKBA 2VJCA 4GECA 1CUVA 2QZPA 4EUSA 4EBBA 3SX4A 3RK4A 3V1NA 1CR6A 4DMHA 3FCYA 3MVEA 1XZFA 4EB0A 2WIJA 1QJ4A 1UWCA 1G42A 4XWGA 3GUUA 2JGMA 3H2GA 4IH9A 5ALZA 4X6UA 5BWCA 2JGJA 2PUHA 2LIPA 2WHPA 2BKLA 3C8DA 1BROA 1BN7A 4BDTA 3WKBA 5HF6A 1XLWA 2RIPA 4G9GA 4FLMA 3VJLA 2B4KA 4AO8A 5AI8A 1HLGA 4FNGA 4HTAA 3H1AA 1U2EA 4OUKX 4GLBA 3WWEA 3I1IA 1JU4A 3I6ZA 5DJ5A 2PL5A 4BE4A 1DQZA 3U0VA 5K3FA 1FFCA 4FFVA 2C0PA 4FLEA 2QM0A 2ZJFA 3GROA 1YR2A 1QZ3A 4L72A 5FV4A 5K3FB 3FVTA 5ALLA 1USWA 5ALHA 1UT6A 1O6GA 1BE0A 1JFRA 1W52X 4BBZA 3DOIA 4KRXA 1YASA 1LPOA 3B5EA 3H0CA 1SC9A 3PE6A 1MAAA 4U2FA 3FCXA 2OXEA 3ESAA 4DGQA 1XROA 5DNVA 2XMQA 1LNSA 1ETHA 2IIVA 1A8UA 4H7DA 4KAJA 4P9NA 1A8SA 4UPDA 3CCCA 3YASA 1MO2A 1E89A 1EX9A 2OGTA 4JEIA 2WJ3A 2R8BA 4KE9A 4UBMA 3HEAA 4EY6A 4DMFA 2X8BA 5AKGA 4DTCA 2VA9A 4INZA 4WY5A 1JT2A 1UXOA 1VZ2A 1ACJA 4GWLA 1YS1X 4X97A 1F0NA 3WJ2A 4ZWNA 4GXNA 1VA5A 1R9MA 3WWDA 2C0QA 1XZGA 4Y2PA 2W22A 2YXPX 1UOOA 1TAHA 2D5LA 3F97A 3UUEA 3I6MA 1H2WA 1U4NA 1WCYA 3CN7A 5AK3A 1BU8A 3V1LA 3ESCA 3H2IA 1C7IA 5FLKA 4G4IA 4BYMA 3OOSA 2HIHA 4LYDA 3RARA 1DU4A 4GI1A 5CBKA 3WIOA 1BEEA 2RGUA 3GFFA 4W1SA 4EY8A 1XKTA 4ITVA 5AI5A 1HQDA 1I6WA 1LBSA 3HRHA 1CLEA 4DSAA 4ROTA 1DTEA 1H23A 4PQEA 4Q34A 3G9TA 2PU7A 2DR0A 2C5GA 2B9VA 1QOZA 4E11A 3I2FA 4DSZA 3Q0TA 4J0IA 5AKXA 4UHEA 4Y2UA 4L0CA 2WM2A 3T52A 5ALEA 3KXPA 4FKBA 4H7KA 2OCIA 3K2IA 3FWHA 1EDDA 1MX9A 4BB0A 5HF5A 1AC5A 3RLIA 3H2HA 2HA5A 2H7YA 4BVLA 2QUBA 5ALTA 3BXPA 3O4JA 3R3WA 1QIFA 2HRRA 1U8EA 5A62A 5IKXA 3T4UA 4ZXFA 3DYIA 3E3AA 4FBMA 1QIDA 1TQHA 3E1GA 1KU0A 2PSHA 1S8OA 1CUFA 4GBGA 1CV2A 1T2NA 3P2MA 3WZMA 4LIPD 2GBIA 4KJXA 4AO7A 1KU6A 2J4CA 2O7RA 4XIIA 1EB8A 4DLNA 2C58A 2CKMA 1VXOA 2DFPA 1BCSA 1XZCA 2RHWA 2JEYA 1LPAB 1ORWA 4MEBA 1SCQA 4V2IA 4AZ0A 2Y2VA 4RPCA 2G5TA 2VT7A 2ZYRA 3K9BA 3ESDA 1X70A 4A23A 4AQDA 3DL4A 3D2BA 4D9JA 5DYWA 3B3QA 1ODTC 4H77A 2VT6A 1YB6A 5ALWA 1MAHA 1WB5A 3STXA 3F96A 3H1BA 1K5PA 4U2BA 5C8VA 5AK4A 4HRXA 3FOBA 1AZWA 4UHCA 5FOQA 3A2LA 4L3WA 4WCVA 2WIFA 2WUFA 2PUJA 1LPSA 1Q0RA 3FLEA 1R3DA 2ZJ6A 4Y2RA 3BDIA 1EI9A 4BVJA 1GZ7A 4X7BA 5E2IA 1XZDA 2XUHA 2XMDA 4PSUA 3W05A 1F8UA 1UOPA 3G0CA 5ALQA 3VISA 1DX4A 1CVLA 2XT0A 5D3ZA 3QZUA 4AB1A 3W06A 5HKAA 4BZZA 4BC0A 2WFMA 5ISMA 3G02A 1LGYA 1UZAA 2Y6UA 2IITA 2H7CA 1LLFA 3D4LA 5JARA 4H7JA 4AMYA 3O95A 4MYSA 4G4GA 3STYA 5C8XA 1W76A 2ZSIA 4RGYA 1QTRA 2J3DA 4DM7A 3PICA 2JF0A 2OLEA 3BF8A 3FLAA 4CIBA 4HXGA 1QO9A 3WYDA 3WWOA 3IDAA 2H7XA 4XX1A 4G9EA 5FRDA 5K3AA 5JAHA 5K3EA 2O7VA 5DNWA 4N8EA 1TCAA 3NOXA 4KACA 3D59A 3MUNA 3MGAA 1CUDA 3ICWA 1YS2X 3SK0A 4K6KA 4AXBA 5HF9A 5IH7A 1OXMA 2W6CX 4HXEB 3F98A 4N5IX 2WFZA 2XUJA 2H1IA 3A2MA 2NW6A 3LP5A 2WUDA 1D07A 5JALA 1IUOA 4NVRA 1XFDA 3HZOA 1CUCA 5CT6A 5C8ZA 4Q82A 3C8HA 1UK9A 4EZIA 2C5FA 2CJPA 3DYVA 4MQMA 3X3HA 5AP9A 1X2EA 4XVCA 4KRYA 2ACKA 1EXWA 4IQ4A 2HA7A 4UHBA 5JIBA 3NWOA 2XUPA 3HSSA 3L1IA 3R3XA 1W6RA 1Y7HA 4DNPA 2OQVA 4RE5A 2C4HA 1VOTA 1JJFA 5CMLA 1MTZA 3PF8A 2JEZA 1E66A 4E46A 1NX9A 2JGEA 1QFSA 5AM3A 2XMBA 5E4TA 3WK7A 1MPXA 5AIBA 2RHTA 5LKAA 1ODCA 2CB9A 1UKAA 3FVRA 2AJCA 3WL8A 2PU5A 5ALNA 4B85A 5DNUA 3WKDA 4Q05A 3VJKA 3S2ZA 2VATA 2JIDA 3ZV7A 4DNOA 2JGIA 3AINA 4HXFB 3OC0A 5C81A 2XQGA 4Y9SA 3I2JA 4KYVA 4X85A 3C6XA 1AUOA 1N5RA 4BCDA 3E4DA 4X90A 3W9UA 3DKRA 1SCKA 1GQSA 5AK6A 1EA5A 3BL8A 1QIHA 4Y2JA 1E8MA 1CUJA 1G5FA 4JH0A 1CIJA 3C70A 3OM8A 4MXDA 3C5WP 1U65A 1LZKA 3C5VA 4X91A 5LKRA 3EBLA 2B61A 3KD2A 2ORYA 1GKKA 2D0DA 1EVEA 5ALFA 1GPKA 1F6WA 1K8QA 3NUZA 2PKYX 4H18A 4OD0A 1UOQA 4OB6A 1ACLA 3JW8A 1HL7A 5IVHA 5CT5A 3F67A 3G7NA 4S0XA 2WSLA 1JJBA 2WG2A 3V9AA 4AN0A 1ZD3A 3STTA 5K3DA 1ZI8A 1EB9A 3QBJA 2QJRA 2VAXA 4CI9A 4PO3X 5BV7A 5AJHA 4UBJA 1HBJA 3QMVA 2H9YA 1HDEA 2GBCA 2GYVA 4F21A 2WHPB 3HC7A 3WL5A 2PPLA 2XB6A 4B80A 4HAIA 1XRRA 5EIAA 2GZSA 1P0IA 4ZI5A 3O4GA 1QIJA 4W1QA 5JAPA 3WL6A 3ANTA 4KR0A 2Z8XA 3N2ZB 1ZD2P 3DLTA 1RYYA 5JD5A 4J0CA 1NU6A 1FSSA 4E15A 1CFJA 3ZPXA 1WB6A 4RNCA 3IUMA 1MN6A 5EFZA 4PSDA 2HA2A 4QLOA 4DNQA 1GT6A 2OAEA 3LIPA 1VZ3A 5FKJA 3LLCA 1PJAA 4O08A 5FUMA 3QH4A 5ALVA 2EDAA 1XRMA 5LYYA 1QONA 3D7RA 5AM4A 1XRNA 1XZIA 5BWBA 1F0PA 2WG0A 5EHZA 3PUHA 4X00A 3BJRA 5AOBA 1E3QA 4QZVA 1C7JA 1K63A 3ZI7A 1ZJ5A 5AKJA 4J0KA 1N1MA 1YAJA 4HRYA 3WKEA 5AI6A 2WQZA 4KE7A 2P8SA 2Y2UA 3HABA 3OURA 5AM5A 2QR5A 3O0DA 2HFJA 2OPHA 1VE7A 4UBIA 4BE9A 3G0BA 3BIXA 4L9AA 3STUA 1Q84A 4UBNA 4UFPA 4H7FA 4C4XA 5FDFA 3KDAA 1VE6A 1MU0A 5K5EA 2JBWA 4H7IA 1P0PA 4K6HA 3TJMA 1VXRA 3IB3A 1CUZA 4UHDA 3WK4A 1A7UA 2QXTA 1LZLA 2CBGA 1E5TA 4K5QA 2XMGA 1ORVA 4I19A 5AKLA 3MUOA 4K2AA 4GDMA 5AM2A 4X94A 3R40A 4C6HA 1WM1A 1JJIA 4H35A 1LPBB 3WIBA 1G66A 3UUFA 2GZRA 2WHQA 1GPLA 5DTIA 5CT4A 2XE4A 3ILSA 3EF3A 3WA7A 3FSGD 2AJDA 2CEKA 2ZYIA 4H7HA 4WFIA 4YK7A 1QIIA 5LZ5A 2O2HA 3WK8A 3EIOA 4EY4A 2OQIA 2AJ8A 2BGNA 1K6EA
chains in the Genus database with same CATH superfamily
2ZSAA 2M6LA 2DTXA 2W6JA 3BJZA 1JHZA 4KJZA 1CSEE 1QKIA 4WK6A 5FEUA 1OT5A 3WMWA 2H2WA 4N0DA 1BKSB 4GP6A 5H81A 1E2GA 5J59A 1OD6A 2J48A 4R4JA 1W35A 3EMKA 2HNBA 2A33A 3EDYA 4AMVA 1T9HA 1D6NA 4YWJA 5BQ5A 1OUMA 3TB6A 2RB4A 3CRZA 2PX6A 1W5SA 2XUAA 2PKXA 2XUFA 3AVOA 1OYWA 2I6SA 3AHJA 4QYIB 4B4UA 2GPNA 3TLAA 3FYCA 5FTLA 2BFCB 2O0LA 3GT3A 4PSKA 4KP7A 4ARZB 1QHXA 2A1IA 5CFNA 3M81A 3FFTA 2NPFA 2ZYHA 1UFOA 4BJ6A 1EX7A 1ZDMA 1RXIA 2YV1A 1DELA 3NM5A 4PYRA 5CURA 2HBZA 3AESB 3QXSA 3DGEC 5EY5B 2Y4OA 1NR5A 4GVXA 4Z4HA 4JR0A 1HQ1A 3BIWA 4ASUD 5HOQA 1E6CA 5KYNA 2BJHA 4KR7A 5F77A 1VMDA 1NVMB 1ZLYA 5EVJA 1X8XA 4P3PA 3ZV3A 5JWOA 4HT3B 4LJAA 2FGJA 3EOZA 1MBZA 1GZDA 2OBXA 4FW8A 3PC3A 3FPAA 1H8ED 4ZGWA 4YJGA 5ALOA 1S2OA 1K4MA 1U2DC 4PICA 2AXEA 2AZ4A 4FKZA 1YHZA 3TMYA 4MQ6A 1CUSA 1QDEA 1L0BA 1MQ9A 3OQBA 1YB7A 1Y9AA 4QOSA 1KI9A 2W83A 1RRFA 3U3KA 4DANA 3DNMA 1THMA 1D2MA 4RFVA 2ATVA 1T9DA 3QFCA 1ZMRA 2IYWA 2VDPB 4KN5A 2FZ5A 4PAOA 3REQB 1E5XA 3GMDA 1DQSA 1YA8A 2XXPA 2FUEA 1OFUX 2OFPA 1USVA 1YACA 4JUIA 3IQGX 3KWJA 1N5KA 4KE8A 5DX8A 5C9ZA 2CDNA 4BP8A 1ZBQA 4PE5B 2QJWA 4AL4A 1FUKA 2R4UA 3GJSA 5LQCA 1XWRA 2RAFA 1BC5A 3PFNA 1ZLXA 3KSBC 2RJOA 2Y68A 3BCUA 1JPJA 4ZP1A 3AVTA 1EFLA 4GZMA 1PJTA 5HG0A 1ZCJA 2JK1A 3PUXA 4K0RA 4X1KB 3PKZA 3T9CA 3CR7A 4XGQA 2GHTA 1ZGCA 5LA6B 2X1LA 1AMNA 4FN5A 4H0CA 3HSYA 4ZC8A 3TI9A 5F9MA 1L1RA 2WP0A 3CQ9A 4JN6B 5EIEA 1T13A 1OQAA 2BAGA 4HDNB 4Q1DA 1CUIA 1TKRA 2R66A 3N6XA 3CA8A 3DR3A 4JFAA 1GEGA 1C3VA 2AFIB 2VRWA 2WIGA 1CNEA 2VPWA 1KZ9A 4Y0AA 5CUQA 4DVJA 4E7PA 2F1KA 3ONVA 2OCGA 4L8VA 5DGCA 1U0RA 1YIDA 3DAHA 3ZWPA 4AY2A 3AJDA 4JFRA 3GLFE 2EVWX 3I58A 3W1WA 5EMKA 4CV0A 2DBVO 4ETWA 5CLJA 1W6UA 4KLNA 5AXBA 2O8FB 1OV4A 1NUUA 3M6MD 5ES4B 2V98A 2WWXA 2EWVA 3GGDA 4QT0A 3D8HA 2UXCB 2NXEA 3RSSA 4DV7B 3PFHA 1N6LA 1TZKA 1UEXC 3BDAA 2EIXA 1MC8A 1WPRA 5H16A 1Z13A 1IHYA 3DVAB 3KLNA 4B7ZA 1VBNA 4QDXA 3WB2A 2OAGA 2FWMX 3BORA 4JI0B 4GKJB 4J4HA 1O5IA 1JFTA 1OILA 2H65A 2WILA 1H6BA 2GVZC 3F7MA 3VZRA 4TKLA 1KI2A 3OLQA 5KYYA 2QTRA 5BOVA 3W9BA 5I9IA 4Z53A 5A0TA 1CRLA 3E61A 3L7CA 4NBSA 1D5WA 1Y34E 2BY4A 2HV9A 3CNLA 3C43A 4E2XA 2G17A 5BOSB 4GI5A 1NKVA 3EUWA 4QUJA 5FUQA 1HNXB 2IV1A 4XYMA 4D02A 4LY9A 3PEWA 4YREA 3OTHA 4MKRA 1NVWQ 4XSHA 4UUAA 3NUQA 1UXDA 3H0EA 3H6KA 3GLSA 2XNCA 3PEFA 3V34A 4MA5A 4UNRA 1SUCA 5JS7A 5A7GA 3DNPA 4UDXX 4RTMA 4N8DA 2ZUEA 4OB7A 1C1DB 5K0JA 1GNVA 3ZLBA 1U02A 3LS2A 4KE6A 4RMGA 3VOSA 2A9PA 2ZT6A 4C0LA 2R68A 4WDQA 2C9ZA 1TC1A 4J75A 1M10A 3PQFA 4R1TA 1T2AA 2YOFA 1NW9B 4BASA 1QGED 1XCBA 2FZKA 2DPXA 1YJCA 1J07A 1N4DA 1SKBA 1VDMA 1O89A 4PW0A 4BDSA 1X2BA 4Q3EA 2ROQA 3EODA 5EHGA 2IQIA 1O5TA 3A6GA 3DMPA 3FYDA 3QM1A 3JQBA 1EAYA 3RASA 4PZZA 1KZGB 2OG1A 2D00A 1TPZA 1Z2AA 5C2JB 2PGJA 4YYZA 2WKPA 3EG9A 5ITZA 3H2KA 3PQ4A 2NTYC 4YBRA 2I9PA 4BLUA 4UU8A 4FEEA 1HZZC 3EVFA 1L4FA 1S02A 5GZ6A 3UOWA 5IJ0B 1N3BA 1Z4NA 3ZCXA 3HU2A 3S68A 2Z4SA 1CZNA 3PC2A 1TDJA 2NO7A 4L3OA 5H5JA 3VHLB 2AG6A 2CBZA 4Q1FA 4B3DA 4URVR 5JZBA 1PVVA 5B55A 3EIEA 3IKVA 4EITA 4XA8A 3IBSA 4X6YA 4ALNA 4ZEVA 1AMOA 3DDNA 6PFKA 5KEIA 4PF1A 5AKEA 1GFWA 1YE5A 2SCUA 3EXIA 4FYVA 2IXBA 1HV8A 3GV0A 3I04A 5CFQA 3RUHA 3O1LA 4WKNA 5ALYA 4EJMA 2B1IA 4R05A 4PBTA 1TEHA 1PJ3A 3CBQA 3AMVA 4BV2A 1BFKA 1M7GA 3TBKA 1U9YA 1GPWB 1VPDA 4HX2A 2FFQA 4HS9A 1RJWA 4MW6A 1Z29A 3HVIA 1LXCA 2NUPB 5DF1A 5FIUA 1XNGA 4FFPA 4JYPA 5DVZA 1C1XB 4WA7A 3IS3A 1FLAA 2B92A 2R1ZA 4AJ2A 2ZB2A 3DXXA 4DRXB 5M7EA 4R40A 1U5BB 1JH9A 3O73A 3TL2A 1Y6ZA 1EGVB 2NPIA 4TXHA 4DIBA 4IMIB 1Q0PA 1OLUB 4R3UC 4BAZA 2LLVA 1IHOA 5JY1A 4JT8A 4F4CA 3LLSA 3O8LA 1E59A 2DWUA 1RJDA 1QO7A 2GXSA 2V3VA 5J4KA 1L7OA 2V7BA 1H22A 3GY0A 2NYAA 2IDKA 5C5IA 5KVCA 5JD3A 2XUOA 3DPIA 3TO5A 1FU7A 3L7JA 2G9RA 3I12A 1DT5A 2H6EA 2OHXA 2H5EA 4NONA 5K2MA 4ILEA 3ROFA 4B3BA 2BD0A 2HQOA 3A37A 2O3TA 1CNMA 3GLGA 2BI8A 3FZQA 4PU3C 3OHSX 1QM5A 4K46A 3VWSA 1HK7A 1WX1A 5EXDA 1P1IA 3KWLA 3JYNA 3FGPA 4OHVA 9LDTA 2XRZA 3CW9A 3JR7A 2HWWA 4DM3A 5JD4A 3THYA 9ATCA 4UKDA 4WZAE 5F5NA 3H9BA 3DOFA 5BVHA 1NVVQ 4R5HA 1MJHA 3IIIA 4HQ6A 2HCJB 1B14A 4MGYR 4C87A 5IK2A 3H83A 3HWX1 4LN1A 5HXAA 4MR8A 1AX9A 1VPVA 2VWHA 4LYEA 1OROA 4X6XA 2C7PA 4O8BA 1QHSA 4JCYA 4YROA 1EFDN 3TOCA 5KU1A 4BNKA 3WDMA 3K6RA 5FBKA 4GGPA 4CEJA 4PCUA 2GPYA 2WU1A 3TL3A 3GRUA 1AS3A 2YXBA 4KYTA 4MR9B 3SC6A 4DLRA 3EJ6A 3VC2A 4EQ6A 2OZPA 3O7MA 1R63A 3GFTA 1U3DA 4DCJA 4OQNA 4G0YA 4GP9A 5GGXA 1BD4A 5KKAA 1OFVA 2X41A 1XDDA 2C04A 4WERA 2AYXA 4C01A 3QVMA 3DPSA 4I4TF 2NADA 1JYSA 4YPFA 2P9TA 1D1QA 5FA5A 4X8HA 1BMFD 3UQYS 1Z82A 5EIWA 4CUKA 3S27A 4MKGA 2XZOA 1B41A 1IVYA 1JYFA 5LBUA 4HQRA 4CV1A 2QIPA 3EF1A 5G4KA 2BEVB 4PZAA 4BNDB 5A6VA 2YIJA 1BHSA 5CA1A 2PNJA 3COZA 1M73E 2ZAIA 6ABPA 3LGAA 1CBUA 1PR0A 3NJRA 3VX3A 2ZE6A 4IIXA 2Q1YA 4KTTE 4RJLA 5JBIA 1Q0LA 1RFGE 4JT9A 3URKA 2AN5A 5C4MA 4O4HA 4PPYA 3NQ41 1AF7A 1Q6YA 1GTL1 1P33A 2VCEA 3KEQA 3BZWA 4M9UA 3MJVA 5D5QA 5L40A 4I7EA 5BV8A 4B6OA 4EKGA 3Q3GE 4E2ZA 2WFLB 2ZCVA 4RKRA 4XSGA 4DLWA 5H1YA 3OHMA 3LY5A 3HBLA 4QLBA 2FVYA 4JI6B 5KMGB 4RGQA 1SB9A 1GRCA 4LZWA 4BCCA 2P9QA 4O2RA 1OXBB 3ESZA 3ZZTA 1UP7A 2PKCA 2WKRA 4B33A 1XLTA 5AKKA 4ICIA 5AW9A 5JSKA 3RADC 4WCFC 1ZZ7A 1XDSA 1KIAA 2QN1A 2LPMA 3HY4A 4P3NA 2A92A 2E4VA 2R8RA 4N01A 3U62A 1E20A 3D31A 1LTQA 1YO6A 4PM4A 2LLWA 1I3KA 3VTFA 4TN5A 3RC9A 1NF9A 2Z98A 4GEGA 4JMLA 5ALGA 5ICEA 1N6HA 9ABPA 5KC9A 1N1GA 2AQ8A 2QRKA 3C0KA 3K70B 4M83A 3BN3A 4MVCA 4FN3A 3JSAA 1CDDA 4O5OA 5HIIA 1ZH6A 2E82A 4RMNA 4B4VA 2IPOA 3PQ3A 2C88A 3BGIA 4V0RA 2PAAA 2IYSA 2W5UA 2O20A 1I4WA 1QCDA 2ZE5A 5TIIA 2LDBA 4KFCA 2X76A 3GT7A 2AXVA 2NZUG 2REOA 1M2VA 2O48X 3FPLA 4ZT6A 3FZNA 1LCDA 1OX4A 5EWJA 2QQ0A 1OPXA 4KQXA 5HIAA 4FWTA 2YFYA 2VNSA 3H8SA 1E5LA 1CUXA 4QFMA 5I4BA 4IHAA 4JJ6A 2E18A 3F5FA 3DW3X 1U9JA 1E7RA 1NF2A 3L7AA 4PLPA 1UKEA 3PBKA 2ZUFA 1U63A 2SICE 3DBRA 1U04A 3ZC3A 4MHSA 4UPEA 3EMVA 1YSCA 4P83A 2BUAA 4ZT7A 4A1FA 3GJ5A 5DYYA 4GOND 5EE1A 2QN3A 1I3LA 3N6VA 4L78A 3ENVA 3GGGA 4U7WA 3I9KA 3LVBA 2BGGA 3COYA 1H9CA 4MI3A 2AEEA 4N5LA 2YY7A 4Q3CA 5DM1A 1NGSA 2VHVA 4NE9A 2B1GA 1V43A 2RH8A 1S2NA 3VKGA 3TNFA 4TTRA 3WQRA 4LGCA 4RPHA 3PEEA 5FJJA 4AX8A 1K4YA 1OZ0A 4AJLA 1XD2B 2ZAOA 3DDCA 2BTQA 4FHZA 5CDFE 1TYDE 4PZCA 3ZKCA 5CXSA 5LWHA 2BF7A 4JYCA 5AIAA 2NACA 2OV6A 2XMCA 4EEKA 3AT1A 4XIJA 3OQOA 4ZHQA 1TZMA 4LRQA 4ZVMA 1DUVG 1G4UR 3T1OA 1JMYA 4MYHA 2IPXA 4QDKA 5I7RA 4BQRA 5KVVA 2EZTA 1H8EA 4QBHA 4MVJD 5DV9A 1ZN8A 2WJYA 1VGQA 5ECGC 1P7WA 2B98A 2WWHA 5ALMA 5BRNA 2DYKA 4M0EA 4N6OA 2VN8A 2WF9A 4CM7A 4DV1B 4QT4A 5JCJD 2I4TA 4GMHA 3SMQA 2IS4A 2LR0A 5TQJA 1UEJA 2AOUA 2FFJA 2R0QC 2BUBA 2AZTA 4XAQA 1ZMBA 4OHWA 5K8LA 2IGBA 3I53A 1NY5A 1QAOA 1MQSA 1TQ2A 1KS2A 1AGXA 1XIVA 4V03A 2BGIA 5J1TB 1K2WA 2HA6A 1OYOA 4G63A 2IEYA 3MT8A 1VP9A 3C5HA 4KNVA 4U2GA 2Q3HA 3ZBQA 3C39A 1N9KA 4N12A 4B3MB 1SOVA 4LE0A 5PNTA 5HM8A 4AYXA 4DEVA 3KJGA 1V9SA 3WAKA 3DLBA 4GPIB 3PLAE 1VCHA 5KAMA 2IE0A 2IU3A 3EF0A 1NC3A 2W58A 4M0CA 3R7LA 2KB0A 3T06B 3I42A 5AFSA 1BFUA 3EWAA 4E94A 1GCAA 2F1RA 4LVOA 3KQMA 2ZJ3A 2ZREA 1QCZA 3KNZA 4WHMA 4F6RB 5B6IA 2GZHA 1PLKA 3QIAA 2HINA 2I1QA 4PINA 4XQGA 4CR6A 5HKKA 2AKEA 1KYWA 4MLDA 4Y98A 3IBTA 3NFYA 5EPUA 1PR2A 1KDRA 3FDJA 3GRPA 2C3MA 2MSKA 3LUJA 3OIGA 4G36A 5CDHA 2E6KA 3NHPA 1T9KA 3PDIB 4ZQCB 4BXOA 5C35A 4BNNA 3GGSA 1FRNA 1HA3A 1VHDA 4L0QA 2QG4A 4RZXA 3VZSA 4H3KB 1E3JA 4EFDA 3SQWA 3BJMA 4QGSA 1AKYA 5DH9A 2XRFA 4MICA 1L5HA 1JQLB 3GCDA 4EB8A 2XQJA 1SXQA 4X1IB 4JVLA 1DAFA 1C30A 2HMVA 4K3VA 5T57A 3IDOA 5SYNA 3THOA 3NBZC 2AWOA 3W2TA 1WHTB 3OJXA 4CR8A 3OOJA 4CQMB 4TT3D 3K32A 3K9LA 3LDHA 2Q9CA 3W6UA 3WWCA 5BNZA 3OIFA 2FMXA 2QQEA 8LDHA 1E2DA 1PSWA 4PZDA 5F9HA 2XTMA 3HA2A 3KB8A 2PL9A 1UWVA 3D6AA 3L46A 3LW7A 4AJNA 4DWWA 4ZYVA 4AKHA 4GE0A 4OQLA 1QFYA 1CK4A 3A3OA 4IQ8A 2I33A 4RFSB 3TGPA 1JQBA 1IATA 2RI6A 3DTVB 4JELA 1G55A 5AJTA 5KQSA 3W7AA 4OU4A 5JG7A 1KWKA 1BMQA 3PNPA 4HTFB 3AYXB 4XR4A 1G2OA 2FR8A 2PD6A 4NS4A 4G0ZA 4Q9AA 4PNEA 1Z17A 1WE2A 1YJXA 2J6CA 2JAQA 4QWWA 5CDGA 3PTLA 4Q48A 2DMRA 2GEBA 1I3OA 1FUYB 1SKAA 1P9LA 5JZOA 4P3OA 3DLIA 1L5OA 3ETGA 1MO3A 4HSEA 3MNFA 1HTTA 2EFJA 1YDGA 1DO0A 2H1SA 4RZSA 1UPUA 2GDJA 4FB4A 4A4DA 3R9XB 4XEHA 3SEZA 1XB2A 3USCS 1JW9B 1UAGA 3O2JA 4GMDA 2ES4A 3BSWA 3I4CA 2EBUA 4FFBA 3OLYA 4LG1A 4M1EA 4NESA 4EGCB 3KP1A 4E14A 4JQCA 5KZMB 5F3RA 2BOVA 2L69A 4BRZA 1L7DA 1PT5A 3IBCA 2Q0HA 1KZHA 3ECCA 3RRBA 2YFKA 1OFUA 3AQIA 4NMMA 3RHFA 5KX5A 5IDWA 3MPUA 4ZQEA 1M1YE 4KPEC 2IUFA 2BFNA 2PA3A 5AW4A 1Z4IA 4XOIA 4K05A 3KL4A 4OK5A 5CVUA 3DBHA 2E6UX 3AR5A 4UD6A 1GPDG 1GR0A 4B84A 4ND7A 4U1RA 3ND5A 3WLRA 4D0GA 3ANMA 3C3AA 4J1XA 1NI5A 2WAMA 3Q8LA 1G5HA 4PBRA 3CLKA 3STWA 2FNAA 2WD7B 2JBHA 4EMSA 1D2HA 4QLAA 2HWYA 3QELB 3RVNA 1J0CA 2C4UA 3DZCA 1L4EA 3E9MA 3G0DA 3HP4A 3X1ZA 4WGFA 3MBIA 2X0IA 3TLJA 4AFNA 2ODEA 3HXTA 1KJWA 5B3KA 3K5PA 3U7RA 1YI1A 3FIUA 2PH7A 2XLBA 4HB4A 1IU9A 2IX9A 1KGSA 4BIMA 2BM9A 2VF4X 2H4HA 4N3AA 3VNVA 3TKAA 4EX7A 1XPUA 1JV2B 2BR4A 1ZINA 1IXKA 3AYZB 3EDOA 5SY9A 1D5CA 1R2QA 2JLVA 2LCIA 3AH8A 1S01A 2YYYA 4K8OA 4L6AA 1E1QD 2FZCA 4ZDWA 4FOSA 2DB3A 3GFRA 4Z1MD 3O8CA 1XLVA 4O4LF 3QJ5A 3SBEA 4LOAA 4TTAA 1ZSYA 1JEEA 2DQ4A 2HMSA 3DO6A 3N39C 5TV2A 4RVCA 1WUKS 2IHVA 2ZR8A 1YJ8A 3ZWQA 5J5AA 1DQPA 3MWEB 4ZCRA 5KNBD 3THWB 2VSQA 3KLPX 3BBPA 3KTDA 4PGAA 5A5DA 4DV2B 3G7SA 3PKJA 1Z6PA 2PBFA 1EHIA 4EW2A 2BV3A 2VK4A 1XTVA 3LDAA 4RCZA 3BSFA 3IHTA 5DGHA 1E3SA 4UTZA 3O9XA 2ICPA 1NW5A 1K3TA 3KPWA 3ZKWB 1MX1A 4BPRA 4TTIA 2EGHA 3V8VA 2ZWOA 1Q7TA 1JALA 4MA4A 4MGHA 2GEKA 2J33A 1LTHR 1T9BA 1XKQA 1ND6A 2JCSA 3NI2A 2V59A 4KVFA 4S35A 4IA8A 1KSHA 2J87A 3GDHA 3KJNA 4XUEA 4AM8A 1IY0A 2GUGA 4BKPA 3HXMA 2LYJA 1W36C 1PAUA 5DU2A 4LW8A 2G8NA 1YBVA 2VWGA 1ZS9A 2MSCB 1R9NA 2XMZA 4Y6LA 5CLIA 1KDVA 4TXLA 1MAUA 2Z5LA 4C30A 2Z6QA 3RIYA 3RRJA 1PP4A 1XEWY 4UUPA 2PSDA 4F4UA 2BJWA 4QUDA 3H75A 4N5MA 5AJXA 1FP7A 1XTTA 2J9YB 1NVDA 4P92A 2VUIB 4IIDA 5K8UA 1VMEA 2YMLA 3LIIA 4KMMA 2ORVA 4R8RA 4XGKA 3SDSA 4G5XA 3VR5D 1O08A 2OQRA 2VJAA 2PT5A 2VYCA 1DC4A 1JBKA 3PVSA 3NDRA 3ILHA 4PTYA 1ULTA 3G2HA 4EW3A 4UFNA 3Q0EA 2EJCA 4X7RA 4Z5HA 1NV9A 3K1TA 4XI9A 5C8YF 5FP0A 4LRTB 5EEHA 1NDUA 3EGOA 2P78A 4L15A 1FDOA 4MW7A 1Z5ZA 4AXXA 1TU0A 3SHTA 3VDNB 3GEMA 4IJVA 3OZTA 1QIKA 4NZMA 3NYWA 3R2JA 2WSBA 1RYDA 3RNLA 3AVXA 3U13A 4DEYA 4G0OA 4UQOA 3RVRA 3KKPA 3TR6A 5K6AA 1I0LA 4OBWA 1BMFA 3IILA 3HUFA 4UMEA 4UUNA 4C1NA 4H3SA 1QMGA 2XODA 1FS4A 3OQJA 3ONFA 4GZ3A 3FTFA 1OKKD 4NOKA 2CB0A 5JYCA 3L8EA 4PYQA 2JLRA 4YT5A 2XGGA 1YGPA 2JLZA 3G0HA 1CJBA 2O52A 1CU1A 4H4EA 5TRTA 7GPBA 1RZRD 3GFBA 4YI5A 3I4FA 5JMTA 1RT9A 1YDMA 3DF7A 1NKTA 1PU2A 1FNMA 1Q5PA 1WV1A 3AUFA 3IQDB 3WLIA 4QUEA 4L5IA 5B7PA 3G2LA 3NUGA 3RF6A 1TIBA 1OW3B 1YDFA 3DS8A 3IERA 4AMGA 1W1IA 1WMSA 1Q2UA 3WLAA 5JJBA 2KEJA 16PKA 1PT7A 4D74A 4KWHA 3W77A 5LB4A 1DBRA 1KKUA 4R83A 5KSPA 3AR6A 1Z0DA 3S29A 4KIUA 4E5MA 2VI5A 3NAQA 3QYPA 2NU7A 2NU8A 4F45A 1SUPA 1PFYA 4EGFA 2DUUA 5DPMA 4I6EA 2ZATA 1O57A 1DQNA 1T8UA 1YU6A 3PQ6A 3FRIA 1P44A 4FD3A 4PYLA 2ST1A 4MITA 5FO0A 3RG8A 5JI2E 3H5VA 3GU3A 4C08A 4COKA 3C3EA 1E6LA 1YONA 4MW4A 5G0WA 2BT4A 3RFTA 2P6MA 3CJRA 2OV3A 3N2YA 3LW8A 2W6ZA 2JJ2A 5IT4A 2WJPA 2KWIA 2GERA 3KT3A 5BYJA 3ZU2A 4LJ9A 4MJLA 2QS9A 3NHUA 1N57A 3IH5A 1MB2A 4Q9NA 3TBFA 2GK3A 1L4MA 2R6R1 2QTLA 3BE6A 3CEJA 3PIRA 4Q9HA 4KTVE 3ZZNA 1IHPA 2FZWA 1D3AA 2VSXA 5TQ2A 5CB4B 2O7QA 3CUWA 2V7TA 5JPIA 3WI7A 1WEHA 3IR5A 1H42A 1D2RA 4V0NA 4ZAWA 2AOXA 5AXCA 3WX0A 4IJUA 1C9MA 1YD7A 4FUTA 3QKRA 1IFXA 3Q1LA 3IGFA 1F8GA 4PPFA 3GAZA 4RVHA 5E1MA 1X1RA 4PGMA 4F1KA 2VG8A 4EHAA 2BWJA 2VUTA 1SHLA 1U0LA 1WULS 1PQPA 3JQ8B 3KOUA 5EKSA 3O1IC 3KOWA 1NVVR 4LYHA 1M1NB 5DGDA 2HHLA 1SA0A 3DV0A 3QTBA 1ZN7A 4JLVA 4Q6WA 3EQ7A 2B25A 4PAGA 3SXPA 2GLXA 2R751 1UBHS 2XF2A 3CNHA 2HSGA 1FC0A 1Y7IA 1O6FA 3V4LA 2A0UA 1UAYA 5CRIA 4HH3C 3ZXUB 5JH7B 2I76A 4UEQA 5FL3A 2H2HA 4CMJA 5CFPA 4R9VA 3WC4A 2NZWA 3FPBA 3JQAD 4RK4A 5H3HA 2XSZD 3PUIA 2EFGA 1WR8A 3IAXA 3TSYA 3ZU6A 4EHDA 2CD7A 1Q0ZA 4QXAA 2AMLA 1QIMA 2OSVA 3WP1B 4JXXA 3RT7A 2FR8C 2GKOA 4J0HA 2XOKA 4P22A 2O8BA 3MXOA 4OIFA 1K3UB 2DFKB 3FWPA 4GBED 1FBTA 1N7HA 4FUQA 4C7KA 4WN3A 1XP5A 2B5AA 2W00A 4D56A 4KVGA 3ZNNA 3TLEA 4MIKA 1V71A 5LQSA 3T5AA 4H15A 4RELA 3HYTA 3NIFB 1SBNE 4XEUA 1J90A 1SUSA 3FUVA 3UXEA 4AKIA 1A2KC 2QK4A 4HWKA 2LYRA 4RVOA 3EY9A 3ZQ4A 3OJCA 5AXDA 4OSOA 3TAHA 4M0FA 2SKCA 1R1DA 1C7RA 3OO1A 4OP3A 4UVIA 2IXTA 3PXEA 2IYPA 4GX2A 4MVJA 1FPMA 4O63O 5ALIA 3O4HA 2K4MA 2WSSD 2V03A 3LBYA 2FN9A 1GZUA 4CIVA 4OX9Y 3PIIA 4ZRDA 2P7IA 1BA2A 4F5YA 4MV9A 5JCJA 1E1RA 4CR7A 3LMKA 4TXJA 4OYLA 2M6KA 5I7UA 4WNIA 1QWOA 3L0SA 3UJHA 1EP2B 2ZSHA 5GPBA 4Y9RA 2NO0A 2Q07A 4RACA 1NP3A 4ZARA 4ZOBA 2WJAA 4J3FA 4LKOA 1QH8A 5EGNA 2XRYA 1IXZA 2J45A 3AC0A 1ZVJA 2W2KB 2YWCA 3PJGA 3GNLA 3NTQA 4JJGA 5JSFA 4F3TA 1YUBA 3DTTA 1S6YA 3BHJA 3BMXA 3K8YA 1J9ZA 5IARA 3NDIA 4YBZA 3RKRA 4BMZA 1D0SA 3NBFA 1PR4A 1XQVA 2HMTA 2FVXA 3GJXC 1RMYA 3Q8WA 5IAJA 1VDZA 3GUVA 1IK4A 2B30A 1LQCA 3HUDA 4ZREA 3RC1A 3RS9A 4AJ4A 1KSJA 4I55A 3T3OA 4X92A 4O1HA 3DEJA 3Q10A 4IGFA 4BLWA 4HNAB 5HBGA 4XCVA 4N0EA 4R3WA 1KO7A 3OF5A 3NB0A 5K3CA 1RRPA 4AN1A 2EBHX 1W30A 4TKVA 2OFXA 2FPKA 2VLBA 4ZVUA 4LBWA 1KARA 4JS0A 4YRPA 3UT5A 2F9MA 2J85A 2D1TA 3MS4A 2Q1SA 5EI5A 3JD1A 1GUDA 1T3GA 2QUHA 1J06A 4G6ZA 3RANA 1W5BA 1UDRA 3ETNA 2IYFA 1RPJA 3VYUB 4K9KA 3EEFA 2XQIA 5ENZA 5IVDA 4I5GA 3IODA 1BS9A 3QY0A 4FDTA 3ZHBA 1XWFA 4MO2A 1AIPA 2SKEA 3L06A 2IU7A 3WK9A 1VP3A 2YN0A 3E22A 2V3CC 1J0AA 3L1KA 3I6IA 4WECA 2I7XA 4Z0PA 4J1QA 1MHTA 4J91A 1Z2OX 1TAQA 1UF9A 2AQKA 3FX2A 4RQAA 2YY5A 1OBHA 1U3FA 2KJQA 2QU7A 4R41A 4XM2A 5F5XA 3SEAA 3NBAA 2WVGA 4Q4HA 3HXKA 1R9JA 4NBTA 2GKGA 2GN1A 3KPYA 4TT3A 3S4YA 4PR3A 2PZFA 4G07A 4RZ3A 1LJ8A 5C1DA 2RGNA 2EW8A 5GAGi 2XT6A 1NP7A 1KAMA 3FHTA 2XA1A 3BBLA 3MFQA 5DASA 4YT8A 1HNZB 2OQ2A 1GD1O 4LRXA 5EOVA 5H0IA 4CJXA 3ENKA 1WHSB 4EPXA 3A9XA 4NF2A 3I9V1 1DKUA 4WXYB 4P08A 1VJCA 4Q01A 4J3JA 3RIHA 1P5RA 5KREA 1I6MA 4OCZA 4HYEA 1ZVKA 3I2IA 3OICA 4JUAA 1GN9A 2OILA 3IVPA 3L8YA 2QX6A 3S40A 4EG5A 4GSYA 1ADGA 4BFYA 2X6QA 1V9LA 1BG6A 4M53A 2ZTMA 4B87A 3GN5A 4LOKA 3LX5A 1NLYA 4LZAA 5TJHA 2Q62A 4YO8A 4A8JC 4JSRA 2FPPB 4WY8A 3HM2A 1P6UA 3F78A 5E7MA 3UKDA 1G5QA 1RD4A 5K6TA 1ND5A 3VJMA 2G1PA 3KAPA 3SI7A 1P2VA 1PNRA 5LWQA 2HADA 1EDEA 1LBTA 1V6CA 2FPUA 2O05A 3RIXA 3ZK7A 4X0EA 3RTGA 1WKVA 5H59A 1XTPA 3GRVA 2RC6A 5FYDA 1EFVA 3QXCA 4AJ9A 3GA7A 3OQ6A 2ECOA 1SOMA 2PLNA 1XAJA 3OZWA 4KRGA 5KJEA 2PJUA 3AERB 3I1JA 4KN9S 4DIDA 3VMFA 1ABBA 3G1WA 5IJWA 3NNSA 5LA6F 3OFND 2V7XA 1Z33A 2B7BA 4NEGA 1UMBB 4O4IF 5JMOA 3F3SA 2OXTA 2PXEA 4LTNA 4WH0A 3ZNPA 2IHZA 2P9GA 5D3MB 2PZ8A 5C8DA 3AJAA 4MV1A 1M33A 5GOZA 3CVOA 1QQBA 5JVDF 1KEEA 1SD5A 4IZHA 1RKUA 2BBTA 1RMQA 1QPBA 5DCLA 2F3RA 5FBHA 1V37A 5A7FA 4WNYA 1OZAA 1HSOA 1LWNA 3BB1A 3OQPA 2UYHA 4U6NA 5HRAA 2HD4A 4OAQA 4X3CA 5C1IA 1BDBA 3IT1A 3CXRA 4MVJH 1K66A 2A2ZA 2VRNA 3IBYA 3QMMA 5G41A 3ON5A 5JCPA 1LY1A 1U7WA 2HFZA 5I45A 1CHNA 4BLRA 1TD1A 1WA5A 4GPAA 1IQPA 4BO2A 1YDWA 3B53X 3D7KA 3H1PA 4YRSA 4W82A 3TR0A 4Z1MA 4MYUA 3H17A 2HK6A 1MH9A 3FNQA 2IOHA 4EA7A 2F9FA 2UYYA 3B36A 1XPRA 1PN3A 1EE1A 4M9XA 1DINA 2BFEA 3FTEA 1QE0A 2PVCA 3WTBA 4UVEA 4BX8A 5GJWC 2JAHA 4X24A 3W2HA 2QYSA 2AV6A 4QGBA 3QBEA 3LVFO 3U44B 4DSTA 2NZJA 5FCDA 2PKEA 3G5MA 4K1LA 2FJUA 1J2RA 2CJWB 2X5JO 3ESBA 4UHJA 5JU6A 4L4RA 2HHHB 3A4IA 4IFEA 1Z4OA 3TRDA 3QSGA 3RYHB 2A1UA 3WA6A 1N2GA 1ECPA 4RMHA 3RBZA 1EXDA 2BHLA 2WT4A 2REQA 1J2EA 1JEOA 4PGFA 1H3EA 3WRWA 4A16A 4NV3A 3TH5A 1M8GA 2CZQA 3NOOA 1H2FA 3R3JA 4FE4A 4EW6A 2PKRA 4FYKA 2P0EA 4ZQHA 2CHUA 3O91A 1X9GA 1F4PA 1U1EA 2P90A 3FDXA 4G8BA 2CLEB 3SF8A 3K5HA 4Y1EA 2XCOA 4P5PA 5B3LA 1QQ5A 2XR1A 1KH1A 1USIA 2J7WA 1Q12A 1EK1A 2O2EA 2OGWA 3AETA 4LXGA 3DEYX 4B0PA 4EA6A 1KF0A 4C22A 2PUGA 3GLKA 5HZKA 2FRVA 3VR5A 4YJDA 4YRRA 1FP1D 3DAOA 3UXYA 3E5NA 4FKMA 4Z3DA 3R9WA 3UJAA 2Q49A 3ROEA 2HRQA 2CLCX 3ZE9A 1WVIA 3QUQA 1JG3A 4ZCLA 3EHEA 1F2UA 1W48A 1IEVA 2H17A 2QAGB 1UJBA 2L42A 2CLLB 1S9DA 4HNGA 5HWSA 4JJIA 5H83A 5MGBA 3K0CA 4B6EA 2PT9A 4J4BA 1E69A 4DR7B 2WBLC 4O1MA 1A1VA 1UBFA 2DH6A 2ZRNA 4MJ3A 5B37A 1WABA 1PZNA 2VBFA 1JH8A 3WLTA 2XUDA 3QPUA 5EMNA 3WMRA 5LOVF 1PZHA 2RHBA 4P7BA 4DY6A 3HZIB 3GLUA 1Y1TA 4MQLA 4W63A 5EHNA 4OATA 1OKKA 2W4IA 1U80A 4RHYA 4AIRA 4P5EA 3AHGA 2VQFB 1O4VA 1EFHA 4ZN6A 1FFSA 2LW7A 2R8YA 1D03A 3R7FA 1JSZA 3SR4A 5ADHA 3CB2A 5ESRA 3V3TA 2YRFA 5CITA 4M1WA 4I1IA 3G8YA 3V8QA 2JC3A 2VA8A 1GAWA 1Z8HA 3V4ZA 4UEOA 2QY9A 1Z25A 4CMCA 1JHDA 5BW4A 3Q5EA 1G20A 3LY7A 3ML1A 2XI8A 1ODLA 2P6UA 4RA9B 1V25A 2A0KA 2RCYA 3PD1A 4BV9A 2FN3A 4IJKA 1UM9B 4REOA 3C4JA 1A27A 4NZ9A 1E7SA 4B6FA 2D74A 1EZ4A 2YQ4A 5BSKA 3IL2A 1XZLA 1DDIA 3JWEA 1VJ0A 5CX4A 3D3WA 1Y4SA 4YA6A 5I48A 1YVPA 2UVDA 2HTEA 1XTIA 4M8KA 3PUVA 2B2NA 4HYTA 2NUAB 1LCIA 1WCIB 3LLUA 4EKYA 5J4VA 4BPBA 1V5IA 5HKBA 3Q85A 5GJVC 2WHEA 4QBKA 3KETA 1PF7E 1OXSC 4PWYA 3H5NA 2YHSA 4W99A 5I7HA 3K5IA 4RY9A 1YOVB 1KH2A 4M1YA 3GLGE 4D79A 3GLIA 1KMCA 2IYXA 4MQEA 1OWOA 1DTWA 3RJZA 3TINA 2VDMB 2WFAA 1QHFA 4D42A 2H4WA 3N2KA 2I6GA 4XWKA 4R0NA 1FJXA 1CR6A 1IC6A 5NLLA 3JS5A 3QGMA 3F46A 3U40A 1XHEA 1Q20A 3RS8A 2EFYA 1VYTA 2PHZA 3EVDA 4IRMA 5H3LA 2CDBA 1A9XA 3DE7X 4NL4H 3TELA 3FFBA 3N3AC 1GL7A 1I7SB 2Q27A 2CL6X 1Z4QA 5LQUA 2Y1CA 2I0FA 1UWCA 4ZKEA 4MQ4A 5H68A 4G5SA 2FW8A 5KYKA 1FXSA 1TEXA 4HN4B 1G42A 3CLRC 4PC2A 1T5HX 3GUUA 4I2VA 1E2HA 4A26A 1NPTO 5K0SA 4YNBA 4IH9A 1W5EA 1V0JA 4HWRA 5J23A 4HQKA 2Q5QA 4RKWA 2C0CA 3OJLA 3L7NA 3SMVA 2O49A 2GK7A 2VQDA 1CQIB 5DM70 3OZ7A 4I99A 5KNDA 2EW1A 4UCXA 3QU9A 3ESRA 1HMYA 3W2EA 4P0PB 1YBAA 2XSZA 2OHVA 1PFKA 4PYOA 1W0CA 4ZOLF 5LPNA 4URZR 1P1CA 2XD9A 5IJXA 2PR2A 1T5DX 2HU2A 3GBVA 4D9GA 4E3WA 3RAFC 3EZFA 1IB0A 2CXXA 4NENB 4DNXA 2CF6A 3JVIA 3AEUA 4WZBA 3VU9B 2RIPA 1UBEA 4D2IA 4FLMA 3RQIA 5F7JA 4OLJA 4OXXA 4F86A 1BGVA 4DPMA 2QMYA 5A06A 1BGWA 2B4KA 3HJCA 5U9CA 4H1WA 5KHOC 1YKFA 1KE2A 4JP3A 3I62A 1HLGA 3LZ6A 4BKOA 5JQGF 4TZTA 1YL5A 3NP7A 1YL7A 2J7PD 3EULA 1G6OA 4GLBA 2Z9CA 2ZB4A 3DHVA 4QPPA 3QK7A 2JL1A 3NEPX 4NBWA 4P33A 1J5PA 3VR5H 1H4QA 4LY6A 2TMDA 4BLSA 5JLJA 2IU6A 5A5FA 2O59A 4E3ZA 2BL4A 2WSSA 1J0DA 1OU4A 1GKYA 5EIBC 4HWGA 4YR7A 4YMSA 3HHEA 4IXMA 1N7IA 2D1SA 1CULC 1TGYA 3L6CA 3O75A 4N5DA 3I6ZA 3DC2A 4TQ9A 3PZBA 5DJ5A 2AB0A 4NCXA 3A4LA 4X20A 2E4XA 1DQZA 4IJ5A 4EPVA 3QV1A 2AMVA 2IKQA 1Z36A 3EIQA 4H08A 5BMVA 1X86B 2I65A 2NGRA 2IYVA 2UV8A 3MZ0A 4HVCA 3S2UA 1ELOA 3UTCA 2Y0BA 3PA6A 4FNOA 4WD3A 4FFVA 3RSGA 1R0BA 3GQBA 4YRZA 3FY4A 2P9CA 1PQUA 1FBNA 4RCYA 1GVNB 5K0TA 2O8EB 1NXVA 1C3OA 2HSJA 2M1XA 1FMFA 1QC5B 4RIFA 3R0JA 1JHQA 1QZ3A 4AJKA 4INJA 4HADA 4XD7A 2VS1A 1IC8A 1F0YA 1ENOA 2PZEA 4IGAA 8MHTA 4C0XA 5ALHA 1O6GA 1BE0A 1JFRA 2LE0A 3QBVA 4B3RB 2BELA 4QQFA 3VYWA 4E2WA 4V0SA 1V95A 2LV8A 1DRVA 3UFDA 2ZB3A 3C3JA 3GCXA 3DUFA 2W2NA 3EJWA 4WLNA 1Z6GA 4M9CA 4OHMA 5BVGB 2JKZA 4KRXA 2EU8A 3B5EA 1AZSC 1G21A 1KVTA 4Z5CA 1NC1A 1P3Y1 2UZ1B 3BL5A 1O9HA 3GO4A 4KXWA 5JDIC 3H8WA 1CY8A 3E6AA 4QKQA 5BMOA 1MAAA 2F1OA 4Q9KA 5JYEA 2WR8A 1NR1A 4U2FA 4TSFD 3HI6A 4Q9DA 1P19A 3CVWA 3N3BC 1PD1A 5D8DA 5EWMB 4LPSA 4E5UA 3MWFA 4MS3B 1P1RA 3FCAA 4NLLA 4S0ZA 2CCJA 4XIYA 2QD4A 2Z2ZA 5JC8A 1KY5A 1NQVA 3ZE8A 1Y3IA 3E9YA 1E1MA 2B34A 5A9SA 2YQ5A 1V16B 3QQ6A 1ZA2A 2GFHA 1P4RA 2J9FB 3QVLA 4JWKA 4QOFA 2HEIA 4KAJA 1VB5A 3CIFA 1IEXA 4JBWA 3Q7SA 3RV4A 4CKBB 3FOWA 3SYMA 1N8KA 1I3MA 2O8DB 1KO8A 1GQYA 2BFDB 3FTCA 5CB4A 5J4LA 2VPXA 1F8XA 1GLGA 2XE8A 3IDZA 2OGTA 1U1IA 4UBMA 2IXDA 2R8BA 4PLHA 3ETCA 2N75A 4CM9D 1G8KA 3FPJA 2ZDQA 5HFJA 4B5LA 4C7OB 4MROA 1DIOB 2NYRA 4OG2A 4AUNA 1E1DA 3HEAA 1NPYA 1WXGA 2DSTA 3PUWA 3WB9A 4WK4B 4MS1A 1T36A 2X8BA 4LYYA 4LK2A 4EZBA 5EG5A 3RVDA 3I6BA 3I9NA 5HCNA 3IAFA 2VA9A 4INZA 4B45A 3RAGA 2ODBA 3G9QA 4WY5A 1VZ2A 1ACJA 3BJIC 3V7NA 5LXTB 4PG8A 4M87A 2HO4A 4U9HS 1YS1X 4DJDC 3C1TA 4JWTA 4B71A 3EDMA 2XNJA 3X1KA 1Y3CE 1ZXBA 1U0NA 3PGVA 5CB6A 4JCXA 4RV5A 3OP9A 1LBEA 4HYYA 4B3TB 5KNDH 1TU4A 2QROA 1R9MA 1Q50A 3OJWA 4Y9UA 4PZEA 1GQOA 2BMFA 4Y2PA 1W25A 4QTTB 1CZHA 2GXQA 3QU2A 2F67A 1IJKA 2W22A 3ORFA 1C7ZA 5CPBA 2ZWMA 1PLJA 3OFNA 2PX5A 1K9SA 4FGJA 4ALJA 4J16C 4URXR 5CXQA 3UUEA 1DAOA 4R1MA 1U4NA 1KEVA 5M5BA 1MDBA 2XOXA 2DX7A 2IF0A 1OLSB 3U5TA 4J0QA 5DOZA 2CROA 1SVWA 4E22A 3ZHXA 3JWJA 1V1MB 3FD8A 4UXIA 4I8DA 4OIMA 4UMFA 4UTXA 1UM8A 3T0IA 3CZPA 3IV7A 1IEWA 4G4IA 3GXOA 2BEWA 1EE2A 3Q3EA 2P9HA 4PAMA 2P3OA 3VGJA 1CQJA 3LHSA 4PR0A 3ORQA 4YPOA 3KSMA 4WJZA 3BB4A 3B5JA 1CJCA 1ZPDA 2EL7A 4YWHA 1BEEA 5BSRA 4LMAA 2RGUA 4YCMA 3OJ0A 4FDAA 3W3ZB 4BGVA 4UEWA 4W5RA 3IKMB 2WM8A 2PPVA 4W1SA 1IAVA 3VKUA 2Y9PB 1HQDA 2MXDA 1H3NA 1RLJA 1UDAA 3KUKA 1LBSA 1TMYA 4KX3A 4P5DA 3TIXB 5GTDA 2GCOA 4C3OB 3AHIA 3VU0A 1SG6A 3GLFB 4DSAA 5IS2A 4HAUA 5EINA 4GMXA 4ZICA 1KSFX 4M21A 4ROTA 1DTEA 2WYWA 3G9TA 1I6LA 2VH5R 3A1EA 3K70D 2C2BA 3KZVA 4WESA 5I6DA 4CCSA 2DR0A 3LO8A 4H60A 1RQPA 1T8YA 5J2UB 4DE9A 1IDN1 1AZTA 4W8HA 2C5GA 2WD8A 4H0NA 3TLKA 4AJPA 4E6EA 1W5TA 3TZKA 1U90A 2XDQB 1IM2A 1HL3A 1QRTA 1FYXA 3C14C 4PN7A 4UTRA 3C6MA 4E11A 1FSZA 1YQUA 3HQ4O 3KHUA 5A2QA 3A1NA 4MZXA 4LDZA 1M54A 4HLCA 1RRCA 5HIMA 4RDHA 1DNPA 3RM3A 4ND1A 1GPBA 4UHEA 4XTRA 5BWMA 3E3LA 3T5DA 4IXNA 1U8AA 5DTQA 1XEAA 3MCUA 3RTEA 4AK9A 2IHTA 1GCGA 3KKOA 1X7XB 1CEEA 3C1UA 2G1KA 1SC1A 2Y92A 3T3MB 1B1AA 4H4CA 4QYIA 1DXHA 1C0PA 3KQWA 4ZAVA 1ZOOA 2HJ9A 1C4KA 5JAUA 3O8QA 4I08A 1ZY2A 2BFCA 2OCIA 4EAQA 3W8EA 2F4NA 3NTUA 3TTVA 1I3CA 4WOBA 2C98A 5HRUA 3CIOA 2F62A 1EDDA 4WZZA 2ATCA 4O4LB 2G04A 3Q9UA 3A1DA 3F6WA 1AC5A 5KS2A 2ONYA 1KBOA 3JD3A 4X7MA 5LU9A 3AESA 3RLIA 1YB1A 2EXXA 1JPUA 1YMQA 1WPGA 3AOEC 1FE8A 2OXRA 3S2EA 1T0HB 2QUBA 3H87A 3HB5X 3AWIA 3O4JA 3KR0A 3OCJA 5FFFA 4F5DA 2FOXA 1R5NA 1YZNA 1WMDA 2KX7A 4C7MA 4FHDA 1ODJA 1HY3A 2B6NA 3C4QA 4Z7OB 1Z63A 3PQ2A 1L6RA 3R5JA 3RVMA 3U0BA 3MHTA 1ZCBA 1JB1A 4YDSA 1O8CA 1KO4A 1QIFA 4MVJI 4UXJA 1U8EA 3S1AB 4HDKA 3SR0A 5A62A 4EF6A 2FG6C 2PUTA 4ENTA 3TEFA 3T4UA 1MJGM 1EEHA 3CLTD 4JSYA 3E3AA 4AZWA 3HR8A 1YRQA 3K31A 1SOWA 3H7IA 4KW7A 1ZITA 2QI9C 2PL3A 5HOEA 2YXEA 1KU0A 1S9HA 3SD7A 1EPUA 1QK3A 2QMUA 4FHEA 3WBKA 4TYWA 1M9NA 2XY4A 4QBTA 2PZJA 2YJ3A 4OY3A 1VFNA 2D2VA 4UAGA 1GL6A 2C8JA 1U1CA 1CV2A 4N3BA 1YB2A 3REQA 1O95C 1GAQA 4R9RA 1WTCA 3P2MA 1T0JB 2EFDB 4ZV4A 2CHQA 2P4EA 1Y4AE 4B76A 5IT9A 3TD6A 5JYDA 4LIPD 5FOVA 5K0ZA 1FQOA 2GJ4A 1W0JD 4KJXA 2YOGA 4JC4A 4AO7A 3NU1A 3NWJA 4HMOA 5DK6A 2HYIC 3RS7A 3U4GA 1TJ3A 3T4EA 2GZ2A 1FY2A 3FDIA 3G2OA 3PENA 2CKMA 3HB1A 5C8YB 3U19A 4J0FA 5FWXA 1HRDA 4JA2A 2E0IA 2RK6A 4UREA 3OQ1A 1BCSA 1A5SB 4B6RA 4JP5A 1QHHB 4EUEA 4BQNA 2RHWA 5LA6A 4F9EA 4CT5A 5BP7A 2FMTA 4IKPA 4YMIA 4AIIA 5JROA 3AW9A 4LI3X 5F4BA 3ESDA 4HDNA 4ZEMA 1PJLA 4PU7A 4AQDA 1SVIA 4RTQA 2NYVA 5LUAA 1IBMB 3WGLA 1UXKA 1Y33E 1VHJA 4I5DA 2C7GA 2HNKA 3N8IA 2G5CA 4QUBA 1R6AA 2P75A 2IYQA 3WP0A 1I2MA 4GZLA 4P7KA 3MMPA 1RI1A 3ET4A 2FQYA 2AHOA 1HYHA 1DJPA 3JXEA 2M2IA 4Y1FA 5ESWA 4CQMD 4UTVA 2ZZNA 3ZJ4A 3UH0A 4RTPA 2NX2A 1KK2A 1V45E 1G8GA 2O0JA 2B3DA 3MILA 1RYHA 5BN3A 2J3LA 2JLWA 2OG2A 4WZAB 1EXNA 4DC1A 4XYLA 3QHAA 1IDOA 2V3WA 1QVRA 3FMOB 3DTVD 3FWKA 2CDAA 4A3SA 3ZDRA 2WIFA 1ZHFA 1C5KA 3UN1A 3A27A 4JI7B 2I22A 2WUFA 2WAYA 4K9LA 1HSZA 5DNDA 1HOXA 3KX2A 1P8JA 2WYUA 2Z2YA 1RWKA 4TRNA 3L05A 1HDRA 2GETA 4C0SA 3BDIA 5HUHA 1XVVA 2WZQA 4A0HA 1GCIA 2BF4A 1EUCA 4Q3DA 5TQ0B 3PLNA 3HVKA 3SZMA 5FUVA 4FBIA 4AJIA 2XUHA 1GADO 2AOWA 1SEPA 2CNBA 3DXZA 4MS4B 4QOJA 3K09A 3V32A 3AJ8A 3WSVA 5KTRA 1Z0KA 1Y3DE 1UOPA 3G0CA 2PG3A 3R76A 4RJ2A 4IOMA 1Z3CA 5JWHA 1RXEA 1Z9BA 5FTMA 3VISA 3CU5A 1SUAA 3AR7A 4HH1A 4XIFA 1J0EA 5AVJA 2ESRA 2XXAB 3MGCA 3V6LA 2O5EA 5THQA 1CVLA 4MP3A 3OJEA 3FNEA 4RS3A 2I8CA 4M8NE 2P9EA 2PMFA 1SUFA 4YCSA 1QTQA 1WDWB 3BFVA 3JQGB 2QRLA 4JLJA 3HKCA 3DZKA 5HKAA 1M2HA 2WHXA 5ESXA 4BZZA 9GPBA 1MXHA 2J7UA 1C4WA 2IUSA 1QOQB 4IS3A 1Y80A 3BC1A 3QKIA 1RAIA 4MRVA 4PNHA 5ISMA 4FGZA 3P96A 1JHPA 1M2JA 2EQBA 3E7PA 3INGA 4G89A 5KINB 1NG1A 1UZAA 1T9ZA 4R16A 1GZSA 2F7SA 4HFJA 5IJ0A 3IAAA 1X8KA 3VPAA 2B4TO 3ZWBA 5AUNB 4MVJG 2C29D 2IUEA 1EWVA 1LQUA 4BFZA 5ENDA 1I14A 3BWCA 2D54A 2VXOA 3NBUA 3Q5GA 3HVRA 4H7JA 4YT2A 5F3WB 2CLHB 1IM8A 1GHTA 1Z6TA 3MELA 4IDGA 1TFUA 5TF0A 2A4KA 1ONBA 1YZQA 4QFDA 3WRYC 2AVNA 4IHJF 3K4QA 3ED5A 2VP4A 1BWRA 5FNVB 3WG9A 5C8XA 2OHHA 2ZSIA 3O31A 5CA1F 2R62A 2VP3A 5K0GA 2J3DA 5L3SA 3ZGZA 3B6EA 3DZ8A 3LQYA 4FC7A 2AN9A 1SXGA 4KWTA 4OGWA 5B7QA 3EEQA 1MHPA 4J94A 2O19A 1WW8A 1DB3A 3OLCX 3PDHA 4YC7A 1KYQA 1J0XO 3A36A 2EP5A 2AXUA 3G5TA 3PJEA 4RO0A 3VO1A 3SCFA 1IULA 2X4GA 1JR3E 1SN7A 1XYYA 1QO9A 2IZ1A 4U3JB 1E1YA 2RBEA 4PRYA 1UC5B 1B0PA 3VO2A 3IDAA 1XF1A 3OMXA 2D2XA 1FDWA 2R60A 2X0NA 2P68A 3P27A 4FFDA 3SSAA 1NATA 1B0AA 1AO0A 4G9EA 5FRDA 3K72B 4TSFA 1OLUA 5JAHA 2O7VA 1WQ1R 1HF0A 2IW3A 4ENSA 2HRCA 3IE1A 3MD9A 2AC7A 2LGJA 2EF0A 2WU0A 3LLMA 3M4XA 4FMCF 1E1CB 4KACA 4HX5A 4CKYA 4DHEA 1K6JA 1NXXA 5CU7A 2PXQA 1I10A 3WGYA 3GARA 1XALA 4MVYA 3NFRA 4TV8B 1GG2A 3A6PC 4Y2GA 1CUDA 1FJHA 2ZVQX 2J0VA 1ABFA 1NSTA 3SK0A 3BXHA 4RTRA 5H8WA 1N34B 4HLDA 3S2FA 3JXBC 3IP1A 4Q4CA 1JFLA 3BA1A 4Q4AB 1LDMA 4AQYB 4GAEA 4MQUA 1XSEA 3F98A 3OKAA 3LUPA 4LFCB 4W9MC 1V47A 4LFAB 1D6SA 3GJQA 1C9NA 3BVPA 4IJQA 1UXIA 2PRYA 2DTDA 5TGDA 3U9LA 5C7IO 1G6KA 1QANA 2HWUA 4KV9A 2QL5A 4ZMBA 4JLUA 3DXFA 4MVJE 2W11A 5H9VA 4P82A 1X1SA 1XD8A 5LL6P 4QG7A 4RV4A 2P11A 2MSWA 3LP5A 2WWTA 3SHWA 5EFOA 3ZHRA 5JAZA 3I0MA 1ZESA 1P2SA 2BCGY 1ZJYA 2BISA 1RZ3A 1TLTA 1XNJA 5ARCA 1IB6A 4EMTA 4MR9A 3CUTA 1YMUA 3MTQA 3F2IA 2RAVA 1CUCA 4NNJA 5CT6A 4AWBA 2AEMA 4CFZA 3KSAC 9MHTA 1PWZA 5CB0A 3GT0A 4UAUA 4KIFA 1MAVA 4Q24A 2B3TA 5HDQA 3IPYA 1FFXB 1RE0A 1IAQA 1UKZA 5FBLB 4L8YA 4JLSA 1ZH2A 4GQAA 4OGLA 1GA4A 1L1FA 2BEVA 2PXXA 4LV5B 2BJCA 1XZ8A 1U1DA 1SVOA 2HQBA 4ZYYA 3QWHA 4C0JA 2KPJA 2XB9A 1JIUA 3BRWD 3GBPA 1I94B 3MLBA 4WLOA 3OOYA 1HE8B 2DRIA 2V7VA 3SVZA 5AK0A 2QTTA 1Z26A 4KRYA 4XVCA 1SC4A 1KQFA 3PU6A 3WGZA 2VJYA 4NCHA 1C9DB 1G60A 2HA7A 4MW2A 3N76A 3ILYA 3H2YA 4URWR 5I5GA 2J5BA 3MJHA 1ZD1A 4LSMA 4OKNA 3DUWA 4EF5A 3I73A 1Q2XA 1TVKB 2PKQO 4ZHQF 1ECBA 1FNSA 2WEKA 4MWEA 1TXGA 2LKDA 1PRYA 4DDWA 2VR1A 2HJGA 2FSHA 2OCDA 2XDYA 3AV0B 3LI2A 3V2GA 5KMGA 4U7FA 1NQOA 4P8RA 2CLFB 5T3YA 2PZBA 5JLAA 1PEYA 4EVQA 1X80A 4U5XA 3N8KA 4TMXA 1V9CA 2X4DA 1VOTA 1Y8RB 4P36A 1UT5A 4PS1A 1ZPQA 5CMLA 3N7UA 4D98A 1BE6A 1YR3A 3OFJA 4YGXB 2C42A 4E46A 5AUQA 2GPWA 2HF7A 1R0CA 2B83A 5E7QA 1G8PA 1QFSA 4PTLA 2JLYA 4AO6A 3ZDCA 2VTEA 1Z06A 1U11A 2RGXA 1HTBA 4LXXA 1T9GR 3RBXA 2CB9A 4YGYA 5KQGA 3JALB 1OU0A 5KOJB 2AJCA 2A1TR 2DECA 2R7MA 4GYWA 3CX4A 1CP3A 1MT0A 2FWNA 1G41A 3HL4A 4HH0A 4QATA 3CE6A 1QFXA 3M4YA 4KG7A 3K0FA 1NVUQ 5C7OO 2FSUA 5BPHA 4B44A 1JSXA 3PE5A 1NNLA 4Q5IA 3QOWA 2C9BA 1V8FA 4FQ5A 4WMLA 1BO6A 2VK1A 3A04A 4ARSA 1PGQA 3KJIA 3OX4A 4Q05A 1LV7A 1FDSA 2JDID 2J41A 5IBPA 3B60A 1XVIA 1M2GA 2AG1A 3JAWB 4L4XA 2E85A 1KJJA 1EKXA 3DLPX 5AQEA 3ZY2A 2OYCA 3ZV7A 3E81A 3LK7A 3RYIB 4DNOA 4HXFB 2A84A 1W85B 3L93A 3JX9A 1VSVA 4H3VA 1QGAA 2XQGA 3TM4A 2OB1A 4CVNA 4CKEB 3GBFA 4Y9SA 3T3IA 1G7CA 2LYPA 2EX0A 3H1FA 3KKNA 2BNOA 2Z4RA 1QH1B 2FWAA 1W0KD 3U7FB 4V24A 3VTAA 2PKQP 4JQDA 1CR0A 2IDZA 3Q98A 1DKOA 1F4VA 4BCDA 3MSCA 4Z9FA 3E4DA 4J1TC 1PL7A 3R7WB 5FBWB 3UK7A 1P1KA 1SCKA 2NV0A 1WXQA 3B38A 3KKEA 1YZKA 5AK6A 5JSZB 3BL8A 4L8GA 2I4OA 2JRLA 2FH5B 2Y1LA 3MWDB 4WEQA 5DM4A 2X6TA 1W49A 4O4JF 1M1YB 1OWMA 1R6DA 4PLTA 4BJ3A 4CM8A 3FHJA 4MXDA 2GBPA 2R2GA 3LBHA 4YP1A 1GRNA 1GARA 3C5WP 2VTDA 3KOMA 4FU0A 5C7LO 4MV8A 3T54A 3C5VA 1TT7A 1R18A 5EUBA 2GN8A 4X91A 1FMCA 1LF0A 2CC2A 1J25A 2I2FA 5LKRA 3EBLA 4A0SA 1K7CA 4A82A 2C9MA 2ORYA 3IVGA 1F06A 4A0QA 3D6NB 2ODPA 3H1EA 3NVKI 4HDMA 3KAQA 4RZHA 4XB1A 3ZY5A 4BX0A 2PLWA 4CL3A 1Z88A 1F6WA 3KR9A 4BFWA 2XOEA 5ER9A 5FQNA 3ICOA 3NUZA 4TUYB 2BEJA 5EIOA 4OB6A 2ET6A 3AVUA 5IVHA 3ZBTA 1SIWA 2FPGB 4C03A 3GHYA 1NN1A 5CT5A 2ZU0C 3RGWS 3ODPA 3U61B 1JJBA 5F52A 3IAEA 5TS2A 1A04A 1SIUA 3QVSA 1ZD3A 2ZDGA 4S12A 5AJUA 1Z8FA 1W0JA 2RHCA 2GR9A 3NRJA 1JSCA 1KQGA 3K6SB 2AUMA 5KX5F 2QJRA 4X54A 4CI9A 4MK4A 5JJCA 1GNPA 5DT2A 1MEJA 3K0EA 3VH3A 4EI9A 1QHIA 4TTPA 5AJHA 4UBJA 4ATNA 5AD1A 1KNXA 1KJQA 1HBJA 1ZCFA 2EJBA 4XB2A 3ZZMA 4DIMA 5TXGA 5IEJA 1M1XB 5U1PA 1UC9A 1MZPA 2GBCA 4F6RA 3CF4G 4ZMSA 2FWRA 1KY3A 2W2LD 2TS1A 5I5EA 2F43B 3F2VA 3SHOA 5IKMA 1U8FO 3K8ZA 1M83A 3VHRA 5GM2A 1EFAA 4CUZA 3PDIA 4TTSA 5LOVB 2Z58A 4HAIA 2EP8A 4MR7B 4OI4A 5EIAA 1TM3E 3TQHA 1P0IA 2ONJA 4BL5A 4ZI5A 4NE7A 5DTRA 1JDBC 4NV0A 3L0OA 1LBHA 1QIJA 4FT2A 4W1QA 5D87A 2XNSA 4DA8A 4EHNA 3ISTA 4JJZA 3TRBA 5IUKC 3TZEA 3WL6A 2ATIA 3KDSE 1JXMA 4OXYA 4PHFA 4XFDA 1RQXA 3DZGA 1Y7LA 4X41A 1FNBA 4RNDB 3ROQA 4WKOA 3TCKA 5BN5B 3A8TA 4V2UA 4CQMA 2FOLA 4J49A 4OM7A 4Y3UA 1ZD2P 5F98A 4LXQA 5EJ5A 1N5DA 3O3OB 5AUOB 4M9QA 3TG2A 1LC0A 1FA9A 1NJ5A 4IZ6A 4UCQA 2VDQB 4UULA 4W6QA 4MUYA 4Q3AA 2RBGA 1TM7E 5K7SA 1MV8A 4RLSA 4OH1A 4DUZB 2Q2WA 1E64A 3AJRA 4INOA 4RFSA 4TMZA 4KK4A 5ERYA 5F7ZA 2JFOA 2QUKA 3BMQB 3WNDA 5BR4A 2PAFA 3IUMA 3O93A 1ATZA 4HCJA 4HTFA 3HFJA 1AHHA 5HE8A 4B3GA 1H6CA 4YRBA 2WAAA 4LZOA 3LIPA 5DLEA 3LLCA 1I33A 3OPNA 1OAOC 1WPQA 2REBA 3E3NA 3G23A 7MHTA 4JY7A 3D4NA 2WJJA 1MQAA 3IOCA 4RVSA 5ITWA 1TM5E 1A72A 1NHWA 5T7BA 2GCGA 4HKTA 5CVDA 1BVRA 3JY6A 1CQXA 5GIPE 6LDHA 4YCCA 6AT1A 1GPMA 3CURA 1EDOA 1A71A 1E6WA 1KMHB 4MV7A 1MVLA 1XRMA 4RHUA 3A6LA 1QONA 4LYAA 4F9FA 3ACBA 3H99A 3EOAI 5I47A 3S8QA 1B7GO 2A4MA 2HUNA 1DAPA 1OLOA 1XZIA 1G20E 3L9XA 3PUKA 1OIVA 2DY1A 5LBIA 3AK4A 2WG0A 1I1NA 4ZVVA 1IPHA 1SAYA 2QLFA 1YHNA 2JVJA 1PL0A 4V02A 2G1UA 2NUTB 4LXYA 4E5PA 2CXPA 4X00A 3BJRA 2O07A 1YJBA 2ZYTX 5EYPB 2KLBA 4DCCA 5GJCA 4D9FA 1W29A 4DYVA 4QZVA 5CLGA 3IDQA 2PX8A 1D7OA 1X13A 2ZETA 1GZ5A 2GPBA 2NTVA 1NVAA 1WIZA 2O5RA 1C3JA 3L7IA 2GESA 4CKWB 3EGIA 2B35A 3MD0A 4Q12A 3FDFA 2E4ZA 2QW8A 2V7WA 3O83A 5AI6A 4BNUA 4C76A 1J99A 1ZOSA 1NRIA 2I3BA 3CONA 1XA3A 2Y0CA 7REQB 2LCVA 2P8SA 3EQZA 2Y2UA 4Z54A 1JG6A 3MN1A 3EZGA 3A6FA 2V6BA 3BERA 4YV1A 1HE3A 3BMNB