4EZIA

Crystal structure of a putative hydrolase (lpg1103) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.15 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
371
Chain Sequence
EKLVNYIALGEFSRETAEIALKKMPPLDTLTVHYDLQLYKINYKTQSPDGNLTIASGLVAMPIHPVGQVGIISYQHGTRFERNDVPSRNNEKNYIYLAAYGNSAGYMTVMPDYLGLGDNELTLHPYVQAETLASSSIDMLFAAKELANRLHYPISDKLYLAGYSEGGFSTIVMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEPGPRATAYLAYFFYSLQTYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEILQALPQDPLLIFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYAGAEMAYHSFRKYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (lpg1103) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 1.15 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
total genus 124
structure length 371
sequence length 371
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.160 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4eziA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eziA01
3IUJA 3R41A 1EINA 3I2HA 4AX4A 1OCEA 3HLKA 3N2ZB 4KJXA 5LYYA 4LXIA 1SCKA 2ZVDA 1YS1X 3UMJA 5K3CA 3EQ9A 2ZSIA 3FNBA 4Y9SA 4X85A 2XDWA 4ZXFA 3A2LA 5FLKA 3GBSA 4B6GA 1FFCA 3EQ7A 2QXTA 4KRYA 1TRHA 2PSDA 3R40A 2WUDA 4B0PA 4U2DA 5CH3A 1IMJA 2HA5A 2GBIA 3IUMA 1VE7A 3NUZA 4N5IX 1VOTA 1A8SA 4J0DA 4EHBA 1EDDA 3BF7A 4IH9A 1Q0ZA 2VJCA 4WY5A 1ZOIA 4J0KA 3V1LA 1TCCA 3L1HA 5AICA 4BBZA 1QFMA 4QDZA 5FPQA 5JAUA 1XZHA 2BAGA 4X6XA 3GA7A 4M0MA 3O9VA 3N0TA 3WZLA 5IH7A 5EGNA 1MNQA 4FDMA 1ZD3A 2WG0A 1R1DA 1SCQA 4X97A 1CQWA 2Y2VA 2YH2A 1MX1A 2PX6A 4BCCA 3NOXA 2XUPA 3MUNA 1XZMA 3C6BA 3IA2A 2RHWA 1WHSA 3WK5A 1ZI6A 4QNNA 3JWEA 3O4HA 1G42A 1ZICA 3O4IA 1QLWA 3FSGA 1NU6A 1OXMA 2XMSA 5CURA 3DYIA 4K5QA 2PM8A 3FVTA 1ZI9A 3AIOA 4EY6A 3CN9A 3FLAA 1E66A 2XLCA 3M81A 1ZIYA 4ZWNA 1QIMA 4EY5A 2OGTA 4IH4A 1QIJA 1EDEA 2DHCA 4TGLA 5DNVA 1QIFA 1Q0RA 3WQHA 1CEXA 3E0XA 4KACA 1THGA 2OAEA 1R4ZA 4N8DA 2O2IA 4UHFA 1QONA 1R88A 1AQLA 2DFPA 3F96A 5C7YA 5JARA 3GELA 4P9NA 1ODCA 1WB5A 5CH5A 4KE6A 3AINA 2Z8XA 4ETWA 4FWBA 3HABA 2OXEA 4NZZA 4Q1VA 4TPKA 5JADA 2I3ZA 4FNGA 3AZOA 1C4XA 5C8XA 1WPRA 4L72A 2XUAA 4B9EA 3C5WP 4Q3KA 1BROA 2XUFA 2ECFA 4LXGA 5CT5A 3QPDA 2GBFA 1QJ4A 1N5RA 4X90A 4KE9A 1UZAA 1RP1A 1M33A 1EK1A 5ALWA 3G02A 1ORWA 4O08A 4OU5A 1EI9A 3A6ZA 3C8HA 3G0DA 1YAJA 1CLEA 5AOCA 4G8CA 1XQXA 2WFLB 3AJAA 3E1GA 1RWQA 2QKYA 2WG2A 5HKAA 5SYNA 2K2QB 2JGLA 3WKEA 1GQRA 5CMLA 1W52X 1H2XA 1Y37A 3AFIA 3T52A 2Y2UA 1CUFA 5ALGA 4DLNA 5AM2A 1TCBA 2GYUA 3WI7A 4HAIA 1F8UA 3VVLA 3WWDA 5D7BA 3KOOA 5FRDA 5DNUA 3MVEA 5E4YA 3YASA 2ES4A 3FAKA 3IURA 2W22A 4K6GA 1XRQA 4QLAA 3STYA 4DIUA 5AIAA 4CCYB 3I2FA 5CH8A 1K5PA 5ALKA 4X00A 4J0CA 5DLPA 4AO7A 1XZDA 2BUAA 2WJ6A 4OB8A 4EBBA 3R3ZA 5AI8A 5FOQA 1AX9A 3DEAA 3AILA 4RNCA 1LPOA 3A2NA 5AI5A 2GYVA 3PUIA 4MYDA 1CUIA 1IZ7A 1GPKA 2J3QA 1A7UA 2WM2A 3H18A 4X94A 1VA4A 2CEKA 3H0CA 2VT6A 5K3BA 4G1FA 4EY7A 1SFRA 1THTA 2I03A 4UHHA 2BCEA 2FUKA 4GI1A 4BVJA 3ANTA 1LGYA 5ESRA 4J0HA 2WJ4A 1MN6A 4LYDA 2EDAA 5ALQA 1ISPA 4CIAA 1GQSA 4UHBA 1OILA 4BYMA 1QIKA 4X93A 4L0CA 1QZ3A 4J0GA 3QM1A 1XZKA 3DD5A 1MTZA 1A88A 2WIDA 2R8BA 1H2YA 1WPXA 4RGYA 2DCMA 2WUFA 1MPXA 2DQYA 2XB6A 3WWCA 3WKCA 3I2JA 2PSJA 3BJMA 4IHAA 5DYYA 4U2BA 5AK6A 5LP1A 1BCSA 3ICVA 1E3QA 3B12A 1X2EA 1DWOA 3C6YA 2QT9A 4MQLA 1IUPA 1W75A 1JJFA 3IIIA 3VJLA 3G8YA 4AB1A 4A23A 3WMRA 1YA4A 2XMGA 3HEAA 3C6ZA 2PSHA 2QRUA 3HYSA 4ZV7A 1GXSA 4HRXA 2WLSA 3DL7A 3H1AA 3OC0A 1QFSA 2AJDA 2YYSA 5ALHA 3DS8A 2HFKA 1UWCA 2XQGA 3F9CA 1ACLA 3FVRA 3H2KA 2QOEA 5KBYA 4C4YA 3M83A 3RKSA 3EQ8A 4UBJA 5CXUA 2HHAA 3JW8A 4JNCA 5HF8A 1IUNA 3PFBA 2C0QA 3RK4A 5DNWA 2JEYA 2X5XA 1YA8A 3LIPA 1FFEA 3OURA 2VTVA 3LP5A 1EA5A 1FJ2A 2BKLA 2OAGA 5ALSA 4Y2QA 3RARA 5CXXA 3TJMA 5ALYA 4QE3A 4M0FA 1XRRA 2C58A 3EF3A 4X91A 1L7QA 4P08A 4HXFB 3QMWA 4U2CA 3WL7A 5D3KA 2HADA 1UKBA 1LBTA 5AKLA 3E4DA 4BE9A 2Z3WA 4B7ZA 3G9XA 3H04A 5KREA 4HRYA 2AJCA 2QJWA 1XQYA 1CQZA 1HL7A 2GBGA 1HKHA 2WG1A 2OCKA 4E15A 4DNOA 3BIXA 2ZSHA 4L9AA 4WCVA 3WJ1A 4MXDA 1T4MA 2XUIA 4QLOA 1B41A 1K4YA 4DYHA 1XRMA 3WYNA 4DNQA 4QWWA 1TCAA 2O7VA 3AIKA 4WJLA 2JGJA 3R3YA 2XMQA 1LPBB 4N8EA 3P2MA 3BWXA 4IQ4A 4MEBA 2RAUA 3D2CA 3R3XA 1MU0A 2O2GA 5JIBA 1UOOA 4J3JA 5JAHA 2HU5A 1BCRA 5CT8A 3FLEA 3CN7A 4GHWA 2CKMA 2J3DA 5JZBA 2V98A 3EBLA 2C4HA 2J4FA 3C6XA 1HLGA 5EHZA 1W1IA 2WFLA 1DTEA 1CRLA 3BXPA 5KWIA 4GEGA 4MEAA 5C81A 2ZJ6A 1BEZA 3HI4A 3IVMA 3G0BA 4GLBA 3WIOA 5DJ5A 1LLFA 3R3VA 4Y2VA 3IB3A 2I78A 2XMRA 2HA0A 1J06A 5CT4A 1T2NA 4ZI5A 3V1MA 4MWTA 3SK0A 4BATA 3ZLVA 3IDAA 3U0VA 5CT6A 2WFZA 5EI5A 1G5FA 4J0IA 3DOIA 4D9JA 2XT0A 4K6KA 4AN0A 4BDTA 4CCYA 2JGFA 4AMZA 4G9GA 2HA7A 2D0DA 4OYYA 2Y1KA 2B61A 4PQEA 4B84A 1ZJ4A 4H7JA 5JZSA 4KR0A 1SOMA 4PSCA 4AQDA 4P93A 2J4CA 2PBLA 1L7AA 4DNFA 1QIHA 3B3QA 1AMNA 1WHTA 5EIAA 5AI9A 2CJPA 5AM0A 4QDTA 4C88A 2RIPA 2ZJ7A 1Y7IA 5AK4A 5LZ7A 5A2GA 2V96A 1LBSA 5HKBA 2GYWA 3PICA 2VT7A 4LYEA 3QBJA 2VSQA 5K3AA 2X76A 5JANA 5ALPA 1DT5A 3V48A 2B4KA 4C87A 1TIBA 3D2BA 1EH5A 1DT3A 5EHQA 4EA6A 2WKWA 3LS2A 1QO7A 1O6FA 4J7AA 3HSSA 2HFJA 4DMCA 4WY8A 2CB9A 1UK6A 1CUYA 4NMWA 5JAPA 4Y2RA 4HZGA 3RM3A 2GZRA 1BS9A 3KSRA 1A8QA 1F6WA 4WFKA 1U2EA 4FFWA 5JAOA 1R9NA 3D0KA 5HZGA 5AKXA 5FP0A 2XQJA 1SCIA 4JYMA 4DMFA 2HA2A 5IVKA 4HVTA 3OOSA 3R3WA 5LKAA 3ZWQA 1IZ8A 4DSAA 3QPAA 3V1KA 1CUDA 4JH0A 4NS4A 3ZV7A 2WUEA 4W9RA 1EB9A 5JALA 1AKNA 3C43A 5CW2A 2XUDA 2RI6A 3O95A 1CUWA 3E3AA 2HA3A 1IVYA 3W2TA 4X71A 3VVMA 1QIIA 4Y2TA 4OB7A 5EHXA 3BL8A 3V9AA 5A71A 4Q05A 4ZRDA 2GBCA 2ORYA 5H3HA 1MNAA 5AHXA 6YASA 4B9AA 4G5XA 4BVLA 1H2WA 2H7CA 3IUQA 2XMDA 2VEOA 4FLEA 3L1IA 3ZLUA 4AXBA 5HQ3B 1XRPA 3MGAA 1P0MA 4CCWA 5IVHA 4EY8A 2HRQA 1WM1A 3K2IA 2E3JA 5CT9A 4Z49A 5A62A 4BRZA 1R50A 2WHPB 2VAXA 4K2AA 4G4IA 2WHQA 4H7EA 3I1YA 5JYCA 2CMFA 3ILSA 3KWJA 2P8SA 4FKBA 2XQIA 3PF9A 4UFOA 1CIJA 1ORVA 3PE6A 4GBGA 2WTNA 4WFJA 3ZI7A 5A7FA 5JZ9A 4ZGBA 4RPCA 2QMQA 5FXMA 4WFIA 1XRLA 2H9YA 2WTMA 2QUBA 3ZPXA 3I6YA 3UUFA 1XZGA 4H35A 2HRRA 2CUTA 4G4JA 3WKAA 4OB6A 1BN6A 2QS9A 5FKJA 2PL5A 2EEPA 4X6UA 3GFFA 3U1TA 1QIGA 4B80A 3WLAA 1JMYA 1S8OA 1XLUA 2OLEA 1EXWA 5CTAA 4KAFA 5ALIA 1JKMA 3NWOA 5ALRA 1JFRA 2WU3A 2AJBA 4Q3LA 3TRDA 1QIDA 2B20A 3FSGD 1XQWA 3W9BA 4FNMA 4KEAA 1U65A 4FHZA 2PKYX 3F67A 1CVLA 2IIVA 3BDIA 4BP8A 1UXOA 2JIDA 5FPPA 1JU4A 4H7IA 3WWOA 3AZQA 3G7NA 4B81A 4QA9A 5AI0A 4XIIA 5AM5A 2BGRA 4AZ0A 4C4ZA 1LNSA 5K3EA 2O7RA 2IITA 1JU3A 2I3DA 4E11A 4ARBA 2DQZA 3R3UA 3AIMA 4EZIA 1EVQA 3KWFA 2OGZA 1MX5A 3WL6A 3HJUA 5C8VA 3B5EA 3M82A 3QZUA 2RGUA 4PNZA 2WIGA 5AH0A 2VQ6A 4U2GA 1SC9A 1YASA 1XKLA 1N8SA 4C6HA 3H1BA 3BDVA 1WB4A 1F0NA 4M0EA 4W1RA 3AZPA 4X92A 2Z3ZA 2AJ8A 4QDUA 4UHCA 5LZ8A 4W1SA 4PO3X 4X7BA 2ZJFA 2DR0A 4U2FA 1C7JA 3HACA 5E4JA 5EIEA 5AKGA 2C5GA 3M3DA 2XLBA 3L1JA 4OD0A 3QPCA 5ISMA 4BB0A 3LLCA 4MWSA 4PF1A 2O2HA 2QUAA 4AO8A 1PFQA 3DLTA 3HC7A 2XUGA 1CUUA 3D5EA 3ESDA 3HRHA 1P0QA 1G4HA 1EDBA 1VA5A 2OGSA 1EVEA 4GXNA 1XFDA 3I28A 1EX9A 1LPAB 3VISA 1K63A 5JATA 5HK9A 3OM8A 3FYTA 5T4BA 1ZJ5A 3QMVA 3FBWA 5K3FB 1VJ5A 3EIOA 4F0JA 1XZEA 1G66A 2XUJA 2IX9A 4J0JA 2GZSA 1CUHA 2ACKA 2XMBA 2QZPA 4RE5A 3VXKA 5AP9A 2QXUA 3WKBA 4H77A 5AO9A 4H7FA 4QDOA 2JGKA 3VKFA 4AO6A 3ED1A 5DWDA 3MUOA 5AIBA 1LPSA 3VJKA 2PUHA 3FOBA 1K8QA 5LKRA 5ALEA 2WSLA 2XE4A 1LPNA 2VJAA 3WYDA 5HFNA 2PUJA 4H0CA 2PU7A 1EHYA 5HQ3A 5J3JA 1NU8A 2H1IA 2X8BA 5LZ9A 1K6EA 5IVDA 4BCDA 5D6OA 3W06A 5IVIA 4UFNA 2VJBA 2G63A 4I3FA 4UBOA 3H2JA 5KWJA 5ALFA 2ZYSA 1DU4A 2PVSA 2C0PA 4KAAA 4B85A 4XVCA 2WHPA 1WOMA 2XMZA 3PF8A 5K3DA 4NVRA 3I2GA 3PI6A 5EHNA 1USWA 5BV7A 1QE3A 1MO2A 4C4XA 3WA7A 3QYJA 3UUEA 3V1NA 5I9IA 4IO0A 2CBGA 4CG2A 5JD6A 4OUKX 4A5SA 1VZ2A 5AI4A 4BZZA 5ALNA 1W4LA 1DX4A 1H2ZA 3STTA 4CG3A 5BOVA 1KEZA 3BE8A 2JEZA 3G0GA 1Z68A 3I2IA 4QEKA 4X3CA 3WL5A 2PSEA 7YASA 2WJ3A 1XQVA 2CZQA 4FFVA 2HM7A 1XZBA 5DTIA 1E8NA 1GT6A 5FDFA 4Y2XA 1AZWA 1YB6A 5HF5A 1H23A 5HCUA 2VJDA 1LZKA 4WDQA 2OCLA 4F21A 5ALOA 1QOZA 1FFBA 4HXEB 4H7DA 2HU7A 2XUOA 3ANSA 3KXPA 5CBKA 3TGLA 1UT6A 3W04A 3VJMA 5I7UA 1Y7HA 1F0PA 5JD4A 4H18A 3H19A 1TQHA 3SWWA 1ZGCA 4DNPA 3KD2A 1TK3A 1QTIA 3FYUC 3IULA 2ONCA 2HDWA 1CUVA 4LKOA 5E2IA 4FOLA 3D59A 5A7HA 1JI3A 3QH4A 1JJBA 4P92A 4OYLA 1R9MA 4F5ZA 2WIFA 4INZA 4BVKA 4BRSA 1E5TA 4BDSA 1J1IA 4PSDA 5K5EA 4OU4A 4BAUA 5JASA 3WWEA 4WDRA 3G0IA 1DX6A 5FUMA 4E14A 4QWMA 3FLBA 3HZOA 3WWPA 3FWHA 1MJ5A 4W63A 2OQVA 2DHEA 4KE8A 5HK8A 1YSCA 2JBWA 3ZLTA 4Y2JA 3WK4A 4I4CA 1YS2X 2BFNA 2XMCA 2QJRA 4DMHA 4QZVA 1ZD2P 3F8SA 1X70A 1DQYA 2DSNA 3I2KA 1LPMA 2V9ZA 1AC5A 2ZYRA 1XLVA 2JGIA 3A2MA 4GW3A 2XI4A 4W1QA 4C01A 1RYYA 2R11A 4RE6A 4FTWA 3C5VA 4ITVA 1XZCA 4Y2UA 4N8SA 1ZD4A 5AKHA 1C7IA 1QTRA 1UKAA 4FMPA 3FYUB 5LIPA 3K9BA 1P0PA 3K6KA 4UBMA 2XUQA 4W1PA 2VAVA 4L3WA 2JF0A 2PSFA 3ESAA 4BCBA 1AUOA 3WK6A 4DTCA 3CCBA 5AK3A 1DWPA 5ALLA 1UK7A 4BAZA 5AK5A 4KAJA 4GECA 5SYMA 3W9UA 3VDXA 3GUUA 5AM1A 1FFAA 3D7RA 5K3FA 1GGVA 3O4GA 4E46A 3I6ZA 4PV7A 5LLSA 2YASA 1R3DA 3SC2A 4UUQA 1E8DA 1CUAA 4G8DA 1WCYA 1I6WA 3D3NA 3I1IA 2VA9A 4H7KA 4X6YA 3T4UA 4BZWA 1GKKA 1LZLA 4FBMA 2AXEA 5HFAA 3G9UA 5HF6A 3TEJA 4UFPA 1ZI8A 1KU6A 4UHDA 3I6MA 2QR5A 1YCDA 2PPLA 1ODTC 4EUSA 3WA6A 2HL6A 2PU5A 1U8EA 3WZMA 3DDUA 1MX9A 2WQZA 1XZLA 1LPPA 1A8UA 1L7RA 3C70A 4YPVA 4HS9A 5D3ZA 3DYVA 5A7GA 2Y6UA 3DNMA 1MAAA 2AJLI 1CUGA 1UK8A 3A70A 4Y2YA 3WJ2A 4UBNA 4S0XA 4KRXA 1MAHA 3O0DA 1VKHA 3QITA 3GROA 4CG1A 4CI9A 1XZFA 4JEIA 4LXHA 3QMMA 3WK8A 5DYTA 1J2EA 3S2ZA 2UZ0A 1UK9A 5AKKA 4ARAA 2WIJA 1GZ7A 4FBLA 4N5HX 1N1MA 3D2AA 1WB6A 1ZIXA 2RHTA 5T4FA 2FX5A 4IH1A 4BE4A 3CXUA 3X3HA 1NX9A 4MYSA 2VF2A 2C5FA 1CUCA 1QGED 1UOQA 5ALMA 2OPHA 2C7BA 3D4LA 1ACJA 5T4HA 4G9EA 2ZYHA 1ODSA 1ETHA 3IBTA 5ALZA 3G9TA 1E89A 3ICWA 5BWBA 1VLQA 2HU8A 4Q3OA 1W6RA 1XLWA 3WIBA 1TAHA 4HTAA 2VATA 4JYPA 1CUEA 3OTQA 3O4JA 1PJAA 2HA4A 1JT2A 4Q82A 3Q0TA 1GPNA 2WFMA 2JGEA 4B0OA 3CCCA 3BF8A 3F98A 1YR2A 2XQFA 1XRNA 1O6GA 4K6HA 2QM0A 1YB7A 3STWA 3STUA 5ALJA 1XZIA 4ROTA 3QVMA 4Y7DA 2Y6VA 3JYHA 1HPLA 2QVBA 4MQMA 4UBLA 4FLFA 5EIHA 1CV2A 5AOBA 4EB0A 2WIKA 1J07A 1CUJA 5AKJA 1AURA 2Z8ZA 1B6GA 1TKRA 1MT3A 5ALTA 1P0IA 4UBKA 4XX1A 4BTLA 5FV4A 4ZV9A 2EDCA 1UKCA 1ZD5A 4X95A 4FLMA 2D5LA 1XKTA 2BUBA 4DGQA 4GDMA 1Q84A 1D07A 4AZ3A 5I8PA 5AKIA 2H7YA 3PUHA 1X2BA 5AKEA 2FJPA 5CRIA 3IUNA 3C8DA 5F4ZA 4B82A 2HIHA 2WILA 1FSSA 5LZ4A 1XZJA 1ZGBA 1CR6A 1CUXA 2BJHA 2QTBA 4CIBA 1XZAA 4QDXA 4EY4A 3FCXA 1UFOA 1EB8A 1VXRA 1GKLA 3AUKA 4UHEA 3LCRA 5AM3A 4AN1A 2HA6A 2G5TA 4XWGA 1UOPA 1EK2A 4MJ3A 4V2IA 1QO9A 3H2IA 5DTJA 4PW0A 5LZ2A 3G0CA 3HXKA 3WK7A 5ALVA 1HQDA 3PDCA 4Q34A 4I19A 5A6VA 4KE7A 3FYUA 2WUGA 1QIEA 4J03A 2FJ0A 5HF9A 4KYVA 4UPDA 2G5PA 3STXA 2BGNA 5ALXA 4PSUA 1U4NA 4DM7A 3DL4A 1H22A 5EFZA 2ZYIA 1PV1A 1BEEA 3WK9A 5AM4A 3G9ZA 3BJRA 3DQZA 3OG9A 2ROQA 2LIPA 1IUOA 2XQKA 4Y2PA 4BTVA 5AKZA 1W76A 3DKKA 1BE0A 2B9VA 4B83A 4A16A 3STVA 4OCZA 2V97A 3H17A 4G8BA 3DJYA 5BWCA 1CUZA 3S8YA 4TVKA 2Q0XA 4DSZA 4GWLA 3PFCA 3W05A 3H2GA 5DYWA 1BRTA 4BC0A 5AJHA 4CFSA 3OPMA 4YX9A 1DINA 3NGMA 2XUKA 1BN7A 2ACEA 2DHDA 5E4TA 2OG1A 4C89A 5LZ5A 3WKDA 1CFJA 1AGYA 2NW6A 4Y2SA 4U2EA 1CPYA 4H7HA 3ESBA 3R0VA 3Q8WA 3RLIA 3H2HA 1KU0A 3DOHA 2WU4A 3C45A 1HBJA 1DQZA 4LIPD 5AI6A 5AOAA 5YASA 1JJIA 2OCIA 4G4GA 2RONA 1DWQA 1N5MA 1CUSA 4BC1A 4AMYA 1CUBA 3DKRA 1XROA 1FFDA 2BUCA 3BIWA 1Q83A 2OCGA 4BP9A 4UBIA 3O9MA 1BU8A 3ESCA 3F97A 5ALUA 1GPLA 4HXGA 5AKYA 4F60A 3KDAA 3SX4A 2OQIA 1VXOA 2XUHA 4YASA 4ZREA 2YXPX 3LIIA 3GZJA 2G4LA 1E8MA 4YK7A 3FCYA 2JGMA 1YAHA 5T4EA 4BAGA 3WL8A 2W6CX 3DCNA 4XJVA 2H7XA 4DMKA 1VZ3A 2WHRA 4LHEA 1HDEA 3C87A 5ALDA 1VE6A 4OPMA 1JMKC 4JUIA 5C8ZA 2Z5GA 5IKXA 4OSEA 5JD5A
chains in the Genus database with same CATH superfamily
4MW6A 2QZZA 5F64A 3N05A 3RT9A 5BP7A 2JKZA 1OCEA 4F5DA 2DBYA 5LYYA 1X1TA 4EEZA 3ZZTA 3AH8A 3KUCA 4LXIA 4Q19A 4HSEA 2VK1A 4RTOA 1GP2A 2ZVDA 2EKBA 3UG6A 2AN3A 4ZVNA 3KU1A 5K3CA 3N5KA 4L4RA 2IU4A 4WECA 1KY2A 1Q7TA 1Q20A 2DVMA 2WPNA 1QU2A 1NMEA 4Y9SA 4WT7A 4B7UA 1J1ZA 1J8MF 4K28A 4ZXFA 3PE3A 421PA 1VM6A 2FJUA 2R8PA 3BB3A 3GBSA 4QJ5A 4BKQA 4EF6A 1OWMA 5L4NA 1B8PA 3CH5A 2JZCA 1A1SA 2ORVA 5A9TA 4BYGA 4KRYA 2X0IA 1OWPA 1MFQC 2LYRA 3QFCA 4QQ8A 3DNPA 3DLCA 3EF1A 4YP9A 5B1YA 5K3OA 1SBNE 1YZFA 4QAJA 5KDOA 3DBLA 3R40A 5DSXA 2EBWA 4E1BA 3K2QA 4B0PA 4ABTA 2CLFB 5K6AA 4U2DA 3THRA 4XYMA 3UQZA 2UZ1B 1QP4A 1ZU4A 3COPA 3IUMA 3AYXB 1ECGA 4R16A 4AJIA 4RZSA 1VE7A 1M2GA 3F4KA 2F8TA 3AL2A 1C3XA 3DMGA 1HF0A 5JSKA 4B47A 4ZTBA 1AIPA 3EIWA 4IINA 3HM2A 4J0DA 4XJTA 4UULA 3L8FA 3GBPA 1Z35A 2D1FA 1QV6A 1V7ZA 1X8KA 2H1WA 3ZV3A 4QTYA 3BHNA 4BV8A 3B6EA 3IOMA 4MLZA 1Z45A 4YALA 4HH1A 3KEMA 5LWQA 1F2UB 3L7DA 1XTBA 1ESCA 4FEYA 1C0IA 1ZO8A 4QOEA 2NO9A 1Q0ZA 5DCLA 2I6SA 3VZCA 2AJTA 1L5OA 6ADHA 5C1PA 3RTCA 3V1LA 3DBIA 2O54A 5AICA 2PG3A 4WTOA 4D6XA 2GNOA 4BBZA 3HHPA 1X7YA 5ICCA 5KJFA 3AGPA 1UC8A 5FPQA 1DW9A 2OFYA 4UDNA 4OHBA 4GXRA 2XOEA 4G6ZA 4TLMB 3MLEA 1H05A 2BN4A 4RSRA 1A2OA 3TB6A 3GA7A 3LXXA 4M1QA 4JT4A 3WICA 1HOXA 5UKDA 2R85A 4TKUA 3H1FA 2IXBA 1PLLA 3O9VA 4K26A 4YP1A 3U1VA 2BZ0A 2MT9A 1R4AA 2TMGA 1Y7LA 4G65A 3WZLA 2BGIA 1NNLA 4Z9YA 1VG1A 5FUQA 5EGNA 3CEJA 4DV5B 2EOAA 2I0FA 4XX0A 4MUFA 4E5NA 4QM7A 3HBMA 3LA8A 2ZUDA 4IDGA 3RZZA 1ZD3A 3ZCQA 5C18A 2WG0A 4DKJA 4CM9D 4WKCA 4ZKEA 3V55A 4YRIA 3LUBA 1EP3B 3UFXB 1RMYA 1UC5B 4EO7A 1HLFA 3IVPA 3OE5A 3I01M 5CCDA 3K94A 4GE0A 4JVMA 2OGWA 1MX1A 2Q46A 2QLLA 4RD6A 1UBUS 2PX6A 3C8ZA 3GJ0A 4HTFB 5KTMA 3D31A 4L28A 3W9YA 2X42A 3DT8A 1AS0A 3FF4A 3SX0A 4QFBA 3IE1A 2XYHA 4D2IA 1GUZA 4QPDA 3IA2A 1H0KA 1ZJ6A 2BFFA 2RHWA 4WWHA 2PXKA 3WK5A 1LH0A 4QNNA 2P11A 2Z2JA 3JWEA 5ER9A 2R0QC 2K4MA 1LDBA 1NZJA 2GTIA 3O4HA 2HX1A 3O4IA 1OLXB 3T9FA 3A3YA 1I2DA 1NU6A 1TQDA 2SHKA 2C00A 3BMCB 4F5EA 3FVVA 2QM3A 4HNAB 1KJJA 3AU8A 2XMSA 1TPYA 4QQKA 1YKSA 4MGZR 1ILWA 5AFSA 3DYIA 3BB1A 1D2CA 2QP3A 4KXQA 4WK0B 4DQVA 3FVTA 2BGTA 2ID4A 2J9FA 2RIRA 1FFHA 1UDAA 4KQWA 4IYJA 2I55A 1JVNA 3THOA 4JCXA 3WDLA 4RTPA 3EZ9A 4CIYA 2IYUA 3MXTA 3FLMA 1CCWA 1BH2A 4ZVQA 5LWHA 2MSWA 2BTEA 2BEWA 1O0SA 3C1TA 3PR3A 4EY5A 3F3SA 4IH4A 4KQMA 3VSCA 4IDBA 4DQKA 1XVIA 5E7IA 4BNIA 3V00A 4V2UA 2P9HA 1ML3A 1PJ4A 3E7WA 2DHCA 5J2UF 1GKIA 3M8KA 5C4MA 1S7EA 2ZRCA 4B6PA 4KDRA 1IM8A 3HBAA 2R1VB 3GW8A 3HCNA 4I6UA 1P17A 4V38A 3WQHA 4J94A 3E0XA 5LFAA 1MCZA 4KACA 5AWFC 1O8BA 1X19A 1GITA 2OAEA 2GCOA 3BH6A 4XDYA 4AF8A 4DA7A 1W49A 5JVDF 3DW1X 2NIPA 4FMBB 3CB4A 4KUGA 2YN4A 1QVRA 3G3EA 5LQAA 1B15A 3WRXC 1S7CA 4ETIA 2ISSD 1YS9A 1MOQA 3DJFA 3EPJA 4UHFA 3NDRA 1NBHA 4PZ9A 3SJCA 3TS1A 3G8DA 4N01A 1D0SA 2DWUA 3MTGA 2Z8YM 1P74A 3EDQA 1EFPA 2YTZA 1AB5A 1HNNA 2VDJA 3GELA 1T0UA 4M8LA 4GX5A 2EIHA 4XSVA 4OQZA 2LWIA 4CMJA 4C0AC 4P9NA 1DBQA 3GP3A 5AVZA 3HJGA 3GJRA 4GOXA 1I7LA 4XWKA 1K6JA 1V3UA 2PJDA 3LECA 2EF8A 5JY1A 2I66A 3TIFA 3HV2A 1T6BY 1TF7A 1KTVA 5H8WA 4XGIA 2I2CA 3LK6A 4IEIA 4BMYA 1ZU5A 3IQFA 1EEXB 4DE5A 4I2NA 3BE5A 3B9QA 4NZZA 3NXHA 2ZRMA 4ZTUB 1XMSA 4TXJA 4TPKA 1DKOA 2B37A 3HRKA 3M4YA 5B7NA 1CTQA 1FDOA 3UMYA 2QX9A 4YFYA 4QPPA 5DNCA 1SBIA 1U0GA 4TYNA 2REQB 3O1IC 1K8XB 2R6GA 3EG5A 2XA1A 3PJGA 4NE9A 3W1WA 1WPRA 1SKBA 1R74A 3D8SA 4JB8A 1ZLXA 4DMLA 3GH3A 2DKOA 3KWMA 4YAWA 1BROA 4YJGA 4HH0A 2J5XA 1U2ZA 1FK8A 1ZM7A 1BVRA 2PFGA 4IY1A 4LXGA 1E5XA 2GPWA 3PFFA 4UAGA 3MEQA 3JD3A 4GOJA 4YA6A 3L41A 4D1YA 2V5AA 4DLZA 5I7OA 3RYCA 1QJ4A 1MHPA 4X90A 1IXSB 1MXFA 3I5XA 1WJGA 3N3AC 3JQ9A 4ACAA 1KEWA 2BKEA 2O4UX 3LSTA 1ML4A 1TTHA 1TE2A 2JJ2D 1K9VF 5M3BA 1N2GA 4R1PA 1RWBA 4A2PA 3AY3A 3EYAA 3JQGB 2VK4A 1UAAA 5A3JA 2ID7A 3C8HA 2O3JA 4FFOA 1JLLB 1UKYA 2PA0A 4XCXA 3ZNNA 4CKWB 4ENQA 4ZA2A 3A9WA 1AVTA 1P8AA 1YAJA 2GCPA 3BMNB 4NBKA 4PG6A 4NCXA 1KWGA 1JB9A 3P9NA 1HEIA 1Z5PA 2JLCA 3A6HA 1U81A 2Q62A 1AD2A 2X5OA 4W9NA 3LUDA 4PRZA 1NXSA 3W2GA 2D2XA 1VL6A 3FJ1A 2JGLA 2L19A 3DKPA 2CW5A 3KBOA 3CZMA 4XPZA 4MA5A 2YV3A 2C3PA 1I32A 4A3SA 1XMPA 1XU7A 4NV0A 3KETA 2EVWX 3K6SB 4CODB 4MWGA 3K2EA 3AR6A 3NDJA 4NAHA 5JXIA 1J42A 3JQ6A 2IL1A 1H2XA 1Y37A 2OYRA 1MB4A 3AFIA 3UICA 1XCLA 2Y2UA 4G26A 2NNLD 2WKRA 1TD1A 1K92A 3ZXSA 4CDGA 2FB9A 4CV3A 3O3OB 1EA7A 4MV3A 2H1LA 3DR3A 3RO7A 4IDDA 4PZZA 2R1JL 1KAMA 1WD7A 3NVAA 4WI1A 4B5KA 2PWZA 1PWZA 2NP7A 4N0QA 3L8DA 5AM2A 3EPLA 3MILA 3Q10A 2CWWA 3K1AB 3W4JA 4KWCA 3ZIUA 2DLCX 3UAWA 1CDOA 2D7CA 4X63A 4TT3D 4GUAA 2NV6A 4HAIA 2A9JA 1P2VA 3GO4A 3MOIA 5D7BA 3TQOA 3ENKA 5FRDA 1OROA 2HC9A 3WNZA 1TT5A 4X4GA 3FSJX 3ANNA 4ILEA 4YBZA 5CFNA 4BJ1A 2Y4OA 4F46A 3MAJA 1XEFA 4ZAVA 3IURA 5JQWA 3T7AA 4AMGA 3ZHXA 4A91A 2ZVQX 2AYYA 4FYMA 4OJMX 4QLAA 5DBGA 3RS0A 4B09A 1YVEI 4B3IA 4DIUA 3NM5A 1KMIY 3VZPA 1GTRA 2RBEA 4Q4JA 4I9UA 4S3MA 2BNNA 4D41A 4NG5A 5G4LA 3VHLB 4J0CA 1X15A 4OXXA 4UCWA 1RWNA 3A3PA 1U7OA 2NVWA 4IZOA 4L73A 3N7UA 4EGJA 4HWOA 2FW1A 3NEPX 4UVIA 5A5VA 5BNZA 3JQAD 4MV7A 2IIBA 4K6FA 4HBZA 2WQ7A 2M1ZA 3K4QA 1EUCA 3F52A 2IXTA 2WQ6A 1U7ZA 2EQAA 2G1KA 4QNRA 5AI8A 5FOQA 2QK4A 3LDFA 4RFSA 1GPWB 4ISBA 2HREA 5EP4A 5K2MA 4FFMA 4B4VA 3NHLA 5JLJA 1WHTB 3QHQA 3GLQA 1LPOA 4RNCA 5T41A 3WLMA 1W30A 4KRGA 2P2DA 5H80A 4G1EB 3LFPA 3K9QO 4HMPA 1KEUA 1PGNA 4MYDA 4UM5A 3RRXA 3TQIA 4A82A 4EG6A 5LBTA 3RYTC 3RGGA 3QFSA 1I4EB 3HNRA 4WUVA 3UKOA 5KKCA 3FXAA 2QUKA 1VA4A 2CEKA 4M1YA 4ZCRA 3EMBA 5GGYA 2F48A 1JE1A 4G81A 4B3MB 3JZMA 1X14A 5E8RA 1QF7A 1SFRA 2Q4DA 1HG1A 4CM8A 3DKVA 4RBNA 2BCEA 1PJQA 4GI1A 4R9SA 4MV0A 2IHNA 1LGYA 2CNOA 5JWOA 2H17A 5EKSA 1XJCA 4RS3A 5EWLA 3HJCA 1KEVA 3OT4A 4LYDA 4GR4A 4OGLA 1T9KA 4B6QA 3TEMA 4EGCB 1B42A 1RWVA 1LWOA 2I9PA 2ZUWA 3ZTYA 2O8CB 5H3CA 4EMTA 4MO2A 1GQSA 4I4TB 1NVEA 4UHBA 4A6DA 2PMEA 4FN3A 1P1IA 4PX2A 1NERA 4BYMA 3PYXA 4D46A 1U6KA 5JH7B 2G36A 4EJ6A 1P2UA 3JTEA 2QNBA 4XQCA 4E2FA 4BGIA 5CEFA 1SA0A 4B4UA 3QEJA 1T5OA 5JPIA 1JA9A 2WIDA 1XG5A 2R8BA 3TKLA 1P45A 3ABRB 1K4MA 4CTJA 2QRMA 4L2IA 1A0OA 3TW6A 3ZGVA 1NSYA 2DCMA 3KZ3A 2FCRA 3QKWA 4DE9A 4HNSA 3NEYA 4IKOA 3WTBA 3CJQA 4DC9A 1MPXA 5JQGB 2IT1A 2XW6A 2ON6A 4NONA 2XB6A 3E1SA 3WKCA 1UWLA 1NR7A 4Z86A 3DDZX 5EHGA 1WUYA 5J2TF 3AUYA 3G2IA 4JYCA 2J0VA 3Q7SA 4L6IA 1PVOA 4RMNA 4BMOB 4C6TA 1JR3E 2D8MA 5F76A 4W6ZA 4DDWA 2ZRBA 4QRHA 4C05A 1MVLA 1QFZA 2JAXA 3JQFC 1R5JA 4U2BA 3FVQA 5AK6A 3W2EA 1BDJA 1E3QA 2AC7A 3K0FA 3C3KA 3PHLA 3B12A 3TUJC 3PFHA 5DHUA 2Y66A 1DWOA 3GIDA 4EG5A 3C6YA 2ZU6A 2JI4A 2Q2QA 2QT9A 4FX2A 2V7BA 3GR6A 3MMSA 1IUPA 3OA0A 3RUHA 5B3LA 3KKOA 1GKYA 3QMPA 4EP1A 2Y05A 2FFHA 2YV5A 3CW9A 4OHXA 621PA 2LZ0A 4BWVA 2ALJA 5HW0A 4MK4A 5JJCA 1OX4A 2BKVA 3WMRA 4A23A 4GAEA 2XMGA 1K4KA 3S81A 3C6ZA 5FJIA 3PNQA 3S1AA 1B7GO 2PSHA 1R6UA 2F00A 1GXSA 3PXGA 3Q0IA 3N7TA 4D9FA 1X86B 2R63A 3BXGA 1NJ8A 1NBME 2QRVA 3H1AA 2NM0A 3QXJA 1ZC3A 3ZJYA 1Q3TA 3DZIA 3DGEC 3GEEA 5ALHA 4QPJC 3B48A 3DS8A 2GZ1A 1I0LA 4TQUS 2XQGA 2PT5A 4CTMA 2LGJA 3WLJA 3HPRA 2ID9A 1Z4OA 1VPWA 2BGMA 4PIPA 2BGWA 4M36A 2QUIA 1RVDA 2CHFA 3AF0A 4O5OA 1ZJYA 5JLAA 4XB1A 1PZGA 1P31A 3IJ5A 4MKRA 4NV1A 1U7TA 3M83A 5KYUA 2XIJA 4UBJA 2JB9A 4KO8A 2G28A 2HCNA 3GZDC 4KXUA 3DMFA 3QUQA 3DP9A 5CXUA 5LIRA 2DETA 2FK7A 2JA1A 3JW8A 1QCYA 2VF4X 5HF8A 3OD5A 4POAA 1E1YA 3AJDA 2FWJA 1AV7A 1PNQA 1EJ6A 1V5EA 3WLHA 1HL3A 5DNWA 4UTPA 4KPEC 2V4MA 1A8IA 1ZMTA 3OURA 4Q1CA 1KDOA 4L76A 1EA5A 4ZC8A 4F2PA 1FJ2A 1YVUA 4HAWA 4ZEVA 3D43A 2BKLA 5MN6A 2HYIC 2OAGA 3WAKA 4Y2QA 3SYMA 3TNFA 2ZG6A 4WESB 1J2JA 1UJCA 3GGOA 3V8NA 1TVKB 3SVZA 5BURA 1DC3A 2GCIA 1H0SA 4G5OA 4IDHA 2VDMB 1SZJG 4TMZA 1GR1A 1CJGA 1P4GA 2RKOA 3EXIB 1AKEA 4HDMB 4JQOA 4K6CA 3UAOA 2JFWA 1L5ZA 1L2TA 4UVDA 4NX2A 2P0AA 4TRJA 5KJ6A 5J4YA 2AH5A 2HJGA 4TWZA 1NLYA 1L7QA 2ADOA 4P08A 2IPXA 3EUWA 4Z1MA 2HD4A 1Q57A 2NXJA 1UXGA 2FWPA 2NVBA 4UXIA 2HADA 5REQA 3WL7A 5AKLA 4S0ZA 1UJMA 4ZMRA 4J75A 1FIUA 5DGHA 4BE9A 1Z2OX 4HVLA 3GLGE 5LC1A 4I6RA 1DCKA 4QBTA 1O58A 1SWWA 1E59A 2YW2A 2Z3WA 3EFBA 3H04A 3KKNA 4NZOA 3TTUA 1JR2A 2C9YA 3O5AA 5ICFA 4KN8A 3IP9A 3L02A 3VNAA 3VTFA 4BS9A 5HRUA 3VTKA 3ZY5A 3WDMA 5IJ9A 3WADA 4ZV4A 2BC9A 4OYRA 3TE6A 1J1UA 4N9WA 4LV6A 4B2IA 4PYOA 1R12A 4F1JA 3NYRA 4DDTA 2IHUA 2PIAA 4N5NA 4LYGA 5J2TA 1NPTO 1Q1NA 3GNSA 3LHSA 1Z88A 3MCZA 4WXHA 3PNYA 4IJVA 4DRXA 3DOEA 3GLHA 2BFPA 1E0DA 2QSYA 3GEMA 1QGYA 4YO8A 4DJJA 3T61A 1VMEA 6PFKA 1P7PA 3QF4A 3AF3A 4PQYA 5F2KA 5HMLA 2XMPA 3F49S 3LQ4A 1E4OA 4MXDA 1NVGA 1DX9A 2BYTA 4WBXC 3UWOA 2XUIA 2FCAA 2ZE8A 3F74A 3TNJA 1TAUA 1B41A 5DI9A 1FVHA 4EG3A 1K4YA 3KAQA 4FSDA 2ZJ1A 3JSXA 3H4IA 2WSSA 2R96A 4PSKA 3BH0A 2P40A 4B5LA 4DNQA 2R8YA 4QWWA 4ZOBA 4XM2A 4Z6KA 3K0BA 3RFFA 4JIGA 3OE7D 4FCCA 1T25A 3AIKA 1D0VA 1NUHA 2JGJA 3B1FA 3D7MA 3R3YA 4EM6A 4BBAA 4MR7B 2PNJA 3IHWA 3MYYA 1Y8QA 4HVCA 4TLLB 2H07A 2NXCA 4L74A 1PF7E 4PEVA 4GPBA 1WIZA 1U1FA 2QIPA 4MEBA 5FI3A 5K0TA 5LMCA 5DM1A 3DPSA 2XJ9A 2X8LA 1E32A 2XNDA 4OL9A 1B1AA 3RROA 1KAHA 1UOOA 3FB1A 2WTUA 4IHQA 4G1VA 2CWDA 3L6OO 1TEXA 2PZAA 2Q1WA 1QG2A 2ZRNA 4QBHA 3ZLBA 1BCRA 1ZNQO 5CT8A 3ZDAA 1MKYA 1AGRA 1V48A 2OHIA 1PL7A 4RD0A 3ADCA 1AHNA 2GR9A 1UPFA 2CKMA 3MBOA 3HA2A 4GUDA 5JZBA 4GOMD 3V97A 1VG0B 4N9QA 2XDQB 2W2TA 3CRQA 2BDUA 1XD2A 2R7KA 3LBAA 1OVMA 4RK5A 4OHZA 3W34A 2RK6A 3Q3GE 3LPDA 4K9QA 3FFXA 1NXXA 1PI3A 1I4OA 5EWJA 5F73A 3OQHA 1J2TA 3OZCA 4EVQA 1CRLA 4F8JA 1WUKS 4GI7A 1HTTA 3ZUGA 5IT5A 2OZLB 1HDYA 4BMDA 4J3FA 5GMOA 3PLRA 3HVRA 1A9PA 1P80A 3E9DA 3H5IA 2BGGA 5KOHA 1DEAA 4OMFG 3H16A 1U7UA 3HI4A 3IVMA 4S1NA 3O7MA 1KFCB 1Z6ZA 3P9CA 4QUAA 2CVPA 2AOUB 1GU7A 4L16A 4UXHA 3ZCUA 4EABA 3TTSA 2QGZA 4ROSA 3TYXA 4YMUA 1GAWA 5MFZA 1ZL2A 3H3XA 3LZ6A 1JNXX 3VUFA 3KQMA 2HA0A 3KXDA 4HDSA 1ZVMA 4DYDA 2QL6A 3NWEA 4RVNA 3REOA 1DJOA 1AGXA 4Q4AA 5CT4A 3EUFA 4AUMA 2DFKB 2HI0A 3NV7A 2BM9A 4F2HA 2GDJA 3R6DA 1P0FA 4P80A 2P4QA 1JMVA 3TOSA 2DG2A 4DCVA 5CCBA 1OYOA 3V1MA 4EO4A 2Q5QA 4PY2A 1Y9AA 3C3YA 1RDFA 1VL5A 3HN7A 4BATA 3TNYA 2G06A 1F2VA 3HKDA 1OT3A 3M4NA 3ZLVA 5I7SA 2HTFA 3O47A 3UBMA 4ND1A 5K0JA 4FN4A 1ESZA 3IPXA 1G5FA 4OFXA 4IHJB 1O3YA 3WRXA 1G2IA 2F1KA 3GT4A 1TM5E 3KSDO 6REQB 4F5YA 1G20E 3FUCA 4W1QA 2NTJA 4CCYA 1GCUA 4GHJA 1HT3A 1WF6A 2FQXA 1VP9A 2VG8A 3DWEX 4G07A 5JMWA 1OX5A 2JGFA 2R66A 3CONA 2HA7A 1SIUA 3BJIC 3L8GA 3WSTA 3ZDQA 3LP6A 1U4OA 2A3RA 2FW8A 5L3QA 2FFAA 2W2LD 5BWNA 1YC2A 3CINA 4PQEA 2B61A 3N6VA 3LBNA 1ZJ4A 4PSCA 4U6QA 5LU9A 5DHAA 4XJSA 5L7WA 2D8AA 5HE8A 1JHDA 2YV2A 3BFJA 1J0XO 3L7BA 2W43A 2PBLA 4Z4GA 1T1RA 4DNFA 5EKXA 1R6TA 3B3QA 4ZDKA 1C3OB 3C5EA 1Q1QA 4LRQA 1AMNA 2HDNB 1DEXA 1RPJA 2QTCA 2XJ4A 3BSWA 3MTIA 5F7JA 3A1SA 5C7LO 4DBZA 3PKJA 5L95A 1WTAA 3DHWC 5I7EA 4L15A 1FS4A 5DMHA 4Y6LA 2H0RA 1C9JA 5AM0A 5DVZA 5CYGA 5J59A 4ZKDA 3FROA 2G6BA 3EZNA 3BCSA 4ND5A 4XXHA 4QDTA 4ZAYA 4C06A 1XLTA 4C88A 2G1JA 2MR5A 1YHNA 5CYPA 2G0NA 3ELWA 1Y7IA 2IOFA 5LZ7A 4CIDA 5A2GA 1BOFA 3QE9Y 2V96A 2BTQB 3C5HA 1DJQA 2PANA 2QPAA 2ETVA 3VPCA 1PGPA 3NCHA 2BD0A 3LFUA 4OX9B 3HO1A 2FPRA 2HT6A 2OBYA 3WGMA 2FGKA 3GPDG 4RULA 4O59O 4MYCA 1ZG3A 1S9HA 3UK1A 2E4VA 1S6YA 4GT1A 2MIIA 1AKRA 4FWIB 5ALPA 5E6UB 4CMKA 3TVYA 3GDOA 4CWAA 3ND5A 3ABSB 3V48A 1CT9A 1AZTA 3CPJB 4ETMA 4KQ1A 1G19A 1TIBA 3L0OA 1N2CA 3FPGA 3BPSA 1EH5A 1BKDR 4FP9A 1TMKA 1YULA 5EOVA 3DAGA 4HQLA 4M9XA 4NCAA 2I1WA 4AS3A 3MT9A 1W0JD 3STHA 2HZ7A 3NTVA 5BV2P 1CJKC 1QO7A 4Y9TA 4DS3A 1XRSB 4RZ2A 1G7CA 1C0KA 1NI4A 1O6FA 4RD2A 3M5DA 4XWAA 3W7AA 4CHTA 3HSSA 3SCGA 1GPH1 4JVSB 3EASA 3OEED 2CFRA 3RUEA 2CB9A 1SIBE 3WXBA 4YLYA 1GPYA 1JFFB 3E7PA 5L53A 2F55A 5BV1A 1DXQA 2JLUA 5D2CA 1DQSA 2YHBA 2ZE6A 2A0YA 3MRVA 4HZGA 1XQ1A 1UM9B 4QHSA 4V1CA 2DB3A 3RM3A 4RDHA 4CF4A 3JQ7B 1G3RA 2QR3A 2H7VA 3KZKA 2OVBA 5BW4A 3LUGA 3OPYI 1C1XB 3RAFC 4I36A 2CVHA 3KSRA 1C0PA 1A97A 2VSOA 3KTAA 3TL3A 3EY9A 3QVUA 5AJVB 2VPXA 4WFKA 3DPIA 2L8NA 3P2YA 3T5GA 3SBXA 2FN9A 2B2CA 2QJTA 3I8XA 4LQDA 3GF4A 3OP1A 5LB2A 4I7EA 2HNBA 2QVGA 1E2MA 1G5HA 1IAVA 2HU2A 3AOEC 3LCCA 1JEQA 4JYMA 4PRYA 4R2HA 3ROTA 4DMFA 8ABPA 1KZ4A 1Q50A 2JDID 3JALB 2HA2A 2I4MA 3JPYA 3LO8A 4L5CA 3OJXA 1PCXA 1LTKA 1QGUB 1TA4A 1SBCA 1ZONA 3I9NA 2LUOA 4ZOLB 5EZYB 3WGJA 4UNPA 6GPBA 3PDJA 1CUDA 2FH5B 2Q4RA 4JH0A 3V1KA 1XI2A 3TR6A 3ZV7A 2HBRA 2ORED 3IQDB 1M5TA 4KQXA 4Q4HA 1SKAA 1L7XA 4JVOA 4IAOA 3REFA 4W9RA 1NQ5A 2Q5IA 2QDKA 1EB9A 2RK3A 4JI5B 3RLFA 3TK1A 4R2XA 3NROA 2ECOA 5E4FA 4OUDB 3T41A 1B2RA 5ETJA 1NUAA 1GWNA 1TGYA 1M2WA 2VYNA 4C7JA 1T10A 4E09A 3O1LA 5GADl 1TKBA 4EYQA 3OLCX 2ZK7A 2VIIA 4KWEA 5HKKD 3EFOA 1OC4A 3I04A 3CNNA 3W2TA 3C1AA 3C3PA 4S2UA 3OZSA 1QIIA 3L93A 4FFBB 3RS4A 1I3MA 4RA9A 2D1TA 4OB7A 1E3TA 1V6CA 1Z6YA 1Q7GA 5JJBA 1CE8B 3L01A 5DH9A 3V9AA 1JH8A 2JHPA 3D1VA 3VHQA 1JHOA 1FP2A 2DY1A 4LHZA 2XKBA 4Q05A 1D1TA 1IEQA 1YKFA 5BRAA 2HRBA 3JQAA 2G5GX 3AKZA 2AZMA 2IPMA 5FTNA 4YAUA 3LX5A 4AULA 5H3HA 5AHXA 6YASA 3IQEA 4EVSA 4ND6A 1K3UB 1J21A 1WMFA 3L9WA 4JLPA 1Y4ZA 3NZLA 1TDJA 4LVCA 1NJSA 4JZKA 3WBFA 5DX0A 5ERGB 3IVRA 4M9QA 2FSGA 2X5JO 4ZAZA 1SC3A 1G9TA 2A84A 2XNJA 2XMDA 1JS1X 3ADKA 3G88A 3MELA 3JVIA 3IV9A 1X1QA 1CK4A 3ZUPA 2QN2A 3L1IA 4JBGA 1H2AS 1R63A 4OJQA 4CI0B 4GU5A 5HQ3B 1C8VB 1KVSA 1XRPA 4MVJH 1OBFO 1IWOA 1YS6A 2X41A 1P1RA 4QFCA 4UD2A 2BKUA 1K7CA 1MEEA 2BGJA 3KTOA 3HCDA 1QQBA 4PPGA 3U9SA 4JY7A 4JITA 5A3SA 3X44A 1FDTA 4I50B 1EMDA 2AV6A 4MZDA 4P8RA 1B6TA 3K2IA 1QFJA 3P2IA 3LV8A 2H3HA 4LSMA 1CF4A 5KAPA 2XB8A 1JQAA 1F2TB 4KIFA 3QEKA 3U3MA 4G2NA 1QGAA 2CJYA 5JZOA 4C7OB 4Z49A 1CVIA 1NJ6A 4KRFA 1CF9A 1I3CA 4QVKA 4IDFA 4J1QA 3GBFA 3M7IA 3AUTA 3PGJA 4IZIA 1CJBA 5EYPB 2V7GA 4F56A 2WHPB 4B4WA 3GB9A 3UWDA 4AI6A 1LBQA 1ZZ7A 1P77A 3EGIA 1T36B 4BIIA 1B23P 3RYIA 1M1YA 4C04A 2IHTA 1UKVY 1YZVA 3I1YA 4R7GA 3HNOA 4GG1A 5JYCA 5CX4A 3T1TA 1R10A 2FPLA 2AF3C 3FGNA 5FNVB 3ILSA 4F2WA 2WWXA 4R8VA 3UIEA 2OCYC 2P8SA 2ID8A 3CPHA 3IYLW 1MF7A 2PRJA 4OLBA 2IYLD 5ARCA 2XQIA 1GARA 2IYNA 3MCAA 4UFOA 3WV5A 4PYRA 1PQUA 4DV4B 3IEVA 2AR9A 3TFLA 1U1EA 5E9WA 1GRVA 2IIPA 1QKIA 2P2ZA 3NC1C 4BUZA 3LCUA 4PIMA 1QE0A 2I99A 4GWGA 4O4IF 3AF5A 1QR2A 2Q9UA 2IS6A 4R3NA 4DPMA 4JUAA 5A7FA 1FSFA 2ZSKA 2V7UA 2WZBA 1RE1A 1L4EA 1IN8A 2RFLA 4AJLA 5BSKA 1DQPA 1C9KA 1JDPA 1W5EA 1PT9A 2OXCA 1L1MA 4BGDA 2EGUA 3JXCL 1RBYA 4P4SA 4R1QA 2C78A 3I53A 3NHYA 4X8MA 3CECA 5J40A 5TV2A 4IIXA 3S2EA 1QFYA 2ZPUA 1XELA 1PVDA 1VJCA 2GB4A 2Q1XA 1RKBA 4S1VA 4C7XA 3P27A 1WXEA 1R6BX 3U4HA 5MDHA 1Y9DA 1U2DC 1N0HA 4UMVA 3WGUA 5IMSA 2JGAA 2MHCA 1XEWX 1IOWA 2NO1A 2MYNA 3EPKA 1EGVB 3EQZA 3D8TA 4M1MA 1QG0A 4Q24A 5G1NA 2CUTA 2JFGA 2VJOA 4Q3CA 4AJEA 2GAAA 1YJAA 4JI3B 3VR1A 2PXPA 3VU8A 5B55A 2FWRA 2NP6A 4F45A 1PGJA 4P38A 3WKAA 4E22A 3BGOS 5A7LA 2YBDA 1Y8RB 2HB6A 3I5UA 3EJWA 1MAVA 4C14A 2E4XA 1UDXA 2W00A 1NW4A 3ILVA 1Z15A 4JP1A 3QQ5A 1LVUA 3HB5X 4LOLA 2PL5A 2EEPA 4YV1A 1EX1A 2D0PB 2QTRA 1W36B 2FP3A 2GM5A 2WVJA 2P5UA 1T1GA 4FWTA 4B80A 4D4JA 2P5YA 2HMAA 1DULA 3HDTA 3Q7QA 4HUQB 3TCNA 1L7MA 3V1TC 2ZGVA 5FOSA 3BQNB 1V7PC 5LLTA 4TTAA 3KOMA 3HE3A 4MUAA 3WGHA 2X0FA 5AW0A 1U9IA 4TTIA 5CTAA 3SZMA 2Q9BA 3C3MA 4L4UA 5ECYA 5ALIA 5K7SA 1GA6A 1CYDA 1N5JA 3IDSA 1I6KA 4WZBA 5JHHB 5U4XA 4BZPA 5KTPA 4G23A 4CMAA 4RV4A 2W0MA 1QZTA 1JEYB 2TSYB 4POOA 1G17A 2WU3A 1H4VB 1DIRA 3A6KA 4QUDA 2C96A 3SIXA 3TRDA 4CE6A 4MCXA 1SIOA 5GAJA 1R9GA 4CU5A 5IPFA 2J07A 1HSZA 5FT9A 3ASZA 4EB8A 1XQWA 2QP9X 2XEXA 3OQBA 1XTZA 2IEAA 2Z2ZA 3K4PA 4MDEA 3OUTA 1EVLA 3EVGA 4O8BA 2F8LA 2QRZA 3F67A 3KRTA 4N47A 1SQGA 4IFTA 4UJ5A 5MN5A 1CVLA 5C53B 3KXAA 2X1LA 4QG3A 5CLIA 2ICAA 4NEGA 1SM4A 4GPAA 3PX3A 3VDMA 3BWMA 1WZCA 2Q9CA 2P4EA 4LF5B 4OYHA 2JIDA 4S12A 3PT9A 4CEHB 4IUBS 2NAFA 4E5DA 5JS8A 1LSOA 4BJ3A 4MDHA 2HPAA 4M7OA 3VUEA 1PG5A 5A4DA 5IF3A 2W2XA 5B58C 5IASA 4Y2GA 1ZWKA 3DNVB 2GOYA 5I7WA 3UJ7A 1HTBA 3ZWMA 1T26A 5BQPA 3TX2A 1IMOA 4LGCA 4WNAA 4KQHA 1N9ZA 1OFUA 4PLPA 5I9LA 5FO0A 4QA9A 2YIJA 3UC5A 2CK3D 5AI0A 1RBZA 3MW8A 3SJZA 1MA0A 3B3FA 4ZVKA 1DELA 1PNRA 1THZA 4LEIA 3USZA 2EW8A 2IYQA 4M9RA 4NZMA 4AZ0A 2OSBA 5I4KA 2IITA 3FYCA 5B30A 1Z06A 4FQ7A 3U3JA 5KB3A 1JIKA 2C4TA 4P7KA 4O2BF 1Z5ZA 5EVJA 1GAEO 3AR3A 1S3GA 1Y80A 2I3DA 4Z7JA 1E62A 4JUFA 2QTNA 4QPCA 1TZ2A 2CUKA 1RXVA 3U1BA 3AIMA 4EZIA 1XVTA 3ABOB 5H1YA 2OO3A 2YJ6A 2XE6A 2Z9BA 1MX5A 2FW0A 4DR5B 2GRLA 1J23A 3MQ2A 2D5VA 3B5EA 1ZW6A 2CLEB 2EV9A 4U5QA 4PNZA 1XHLA 4PICA 2BELA 5AH0A 5BUSA 1HC7A 4OP3A 4CKEA 2G71A 5B2FA 1V8FA 1RKXA 1YASA 1XKLA 2JFHA 4BO0A 1VJDA 1YOVB 3BD1A 3D81A 4N5MA 3FPSA 5KU1A 1N5IA 2BSAA 2WF7A 4C6HA 3R5FA 5C7IO 3BZWA 3A1EA 1GGNA 4P36A 3S6JA 2GQ0A 3H1BA 1KY5A 1S7GA 1ACMA 1R00A 4G4SO 1HE5A 1RHRA 4G5FA 5DULA 4EAAA 1P4AA 2SKEA 3NIGB 3GI1A 1SVLA 1EP9A 3BXZA 1QG4A 3NP9A 4DMRA 4PZCA 4YYEA 5TGTA 4HZIA 3HBLA 5M34A 2CFIA 4OP2A 2QYSA 1VG8A 1H2BA 2P4UA 1A96A 2AJ8A 3K35A 5I9SA 3ZU3A 4MLDA 4JLJA 4U39A 2NYAA 2ZWVA 4W1SA 5I5GA 1QZUA 1KYWA 3JWGA 3L4KA 3VU9B 3F3KA 1OH7A 2ZJFA 3H5OA 3IT0A 4LAFA 1T8UA 1W96A 1QP7A 1PDOA 3HACA 4RU1A 3SIPA 1H8ED 1AA6A 3BRQA 3FOCA 2AWNA 2DBQA 1T13A 1QDUA 3RRBA 2YNMC 4R5MA 4RQAA 1FPMA 3GEBA 1WO8A 1BX0A 2I1QA 3JWIA 4HNGA 4P22A 4M38A 1U7DA 3HU2A 3L06A 1G16A 3WBKA 1KP9A 4NESA 4B2YA 3ETLA 4NH4A 2MSNA 3RYHA 5ISMA 2BIFA 4BB0A 3E5MA 1V95A 4PF1A 5A5DA 4W8OA 3TG8A 5TVKA 4UUPA 3LUCA 4GKJB 1WB9A 1UF9A 4TWRA 1D4ZA 1ZN8A 3NEJA 1FUYB 2QG6A 3Q41A 4LVNA 1ABBA 2WPDA 5HHTA 1E79D 3QBEA 1FDVA 2HBYA 1J2YA 4IOKA 2ZSAA 3DO5A 3HKBA 4QFMA 5H5JA 5JE8A 1Q15A 2A6PA 1EDBA 1JQJC 3PPWA 1CF2O 1ISIA 4CM1A 2GEFA 4JBWA 1JDBB 1P18A 1Y5NA 2DBRA 2R00C 2XCOA 1NJFA 1IVSA 5AW3A 3LVRE 3VQTA 2XTMA 3PBKA 3DBOB 1ZEMA 5BQ5A 4GXNA 3FDIA 4IYRA 1EX9A 1WMBA 4R5HA 1Z2AA 1LPAB 3I0NA 3NOVA 5DN9A 4M1SA 2O6HA 5JSHA 2AUMA 1PX2A 1B6RA 2HEIA 2W48A 2HSJA 3OM8A 5BYBA 1F3LA 5T4BA 3S5JA 1ZJ5A 5EZQA 3ZDFA 1RU3A 2XXQA 2I6TA 2VUUA 2CSXA 1FRNA 2ADMA 2WJYA 1VJ5A 2PX2A 3M6WA 4QULA 1NURA 2GZSA 3A3NA 1SQSA 2ACKA 2HNKA 2PXAA 2QZPA 2QN8A 3CUKA 1UT8A 4GE3A 5JANA 4RE5A 1GTJ1 3VXKA 3GDWA 5AP9A 3RC2A 3SZ3A 1JB1A 2XDYA 1RYHA 4O2BA 1M6HA 2FR8C 2IDKA 2JAQA 4TMYA 2AXUA 4IIHA 4QDOA 4GQBA 3H2SA 3VKFA 4JOBA 4H6XA 3MUOA 1HE4A 2YWHA 2VKQA 3WE7A 3F9IA 4OQDA 3FMOB 4R8LA 2J3IA 2ZIFA 1Y48E 3NDIA 4KYUA 2YXBA 1FFXB 2CXHA 2AE1A 1TM1E 3AUSA 4AX8A 2A9OA 2Q2OA 1P61B 2C8VA 1YJXA 5ALEA 2LLVA 1Q2XA 4J7UA 3L0CA 4OFBA 3ONEA 4RFLA 2FQ1A 4W5QA 4HD8A 2GMWA 2VJAA 3GMDA 1EFPB 1M1XB 3DE2X 4JI2B 5HFNA 2O0LA 4NCHA 2O52A 2PUJA 1HLDA 2Y68A 3CZ5A 3G1UA 4OSPA 4X4IA 3BYZA 2PWYA 3AV0B 3FPKA 3CTMA 1JTFA 2Y93A 3MLFA 3SR0A 4AKIA 4R31A 1BYIA 3X1MA 1NZDA 2G9NA 2C2ZA 2QRHA 3C3BA 4HQ6A 4OI1A 3FJOA 3IVAA 4KLCA 4KWHA 4NU5A 5BO5A 5A4FS 1HM5A 4BEBA 5CVCA 3TFQA 2AKAB 4A7PA 1ULBA 2CMDA 5IVDA 1XMQB 4WEOA 4Q03A 1NQAO 1IDN1 1CIPA 1AUQA 1R37A 2GWRA 5KOJB 1DDIA 1RWMA 4O63O 3UB4A 4CIVA 4QO7A 1NLMA 5HJEA 4GPZA 1QH0A 2OTCA 3AB7A 1EUQA 4UBOA 1Q0PA 4DRZA 2ZWOA 1XEWY 2QNRA 1AH2A 4MDFA 4IUDS 3ESZA 1X8XA 2DCUA 2IYVA 4ENPA 2EP8A 3LG2A 1MA3A 4DDUA 1EVYA 3AONB 4MAAA 3DE6X 2YMLA 3WLQA 3U60B 3F3MA 2DE0X 3QOFA 2FG5A 3R7FA 4Q7QA 3P4UA 4BFCA 2OCXA 1P4RA 1OHHD 4I6JA 1FBTA 2ZYSA 4BVKA 2WYOA 3CG4A 4XVCA 2EJVA 3I9V1 5CR9A 3N28A 1G8SA 1U0JA 4YCCA 5K3DA 2FVYA 3A6JA 2V59A 3I2GA 4MWDA 5I7RA 4YR7A 3GGSA 2IOFK 2E9SA 3E3NA 3WISA 4EKYA 3THXA 2VOJA 5F9MA 3MTQA 3JX9A 2ODAA 3WQBA 1QE3A 2QY6A 3PT5A 2W6JD 1T91A 1T6YA 1XXHE 2JFOA 5J2UB 2PZ8A 2ZT8A 4C4XA 3WA7A 2M9MA 4P31A 5H9WA 1I7PA 1BA3A 1UBKS 4LOJA 5DFAA 3WLTA 2F43B 1O0BA 5JRZA 1A9SA 1PS8A 1E5DA 2CBGA 1SUSA 1M6WA 2DTEA 2HBQA 4JQSA 3HFSA 3BICA 4JBYA 4DG9A 2P41A 1PNTA 3RHSA 2PKQP 3TWOA 1POUA 5TRTA 3TXYA 3R5JA 2ODBA 4B6OA 1AK9A 1C4WA 3RVJA 2VF7A 4OXRA 4DLVA 5JD6A 3DOOA 3K8ZA 5LYJB 4N54A 4A0RA 1A2QA 2V6JA 5GONA 1USUA 4M86A 4R98A 1WMAA 4J4HA 1UOEA 4LWOA 1DX4A 4LJ9A 3VNUA 4RLHA 3JVVA 1GFZA 2Z1DA 2V6GA 3AY0A 2AF4C 4KI7A 4X20B 3KJXA 1ZJZA 3SQNA 1RWKA 3M89A 1ZXBA 2KJQA 3I2IA 5EL0A 3V8VA 2H08A 1P1HA 2IHJA 4PYLA 2NLOA 1J99A 1ECFA 2H5JA 2NSDA 3MGGA 3N6XA 7YASA 5H4HA 4WLVA 1YNSA 2REXB 1M0WA 1KI9A 2OT3B 1SY7A 4WK6A 1HFWA 1YL7A 4FFVA 2EJUA 2JLVA 1E8NA 1OLUB 5FDFA 2FX2A 3IUBA 3MSXA 3O0TA 4HB3A 5FPYA 4HDQB 2B6NA 4DMUB 2VPQA 3ECAA 1C7ZA 2GXUA 4KOAA 4LGYA 5DW0A 4Z3OA 2JL1A 3N59A 5IHPA 1FTYA 2VZEA 3MHTA 3P4YA 3M6UA 5HCUA 3BMQA 5JVDB 4X65B 2PUEA 3UO8B 3L92A 5LUAA 1VKRA 2QVYX 4XEHA 4JU8A 4QNMA 4F21A 1WUIS 3L1PA 3OX1A 3P0FA 4XIFA 5HKKA 5IVPA 1ATZA 1ECJA 1G5TA 2QF7A 1CQJA 1PJBA 2ZRDA 3E9NA 1GDHA 4Z0HO 2MJLA 5DSTA 4RO0A 5H16A 5MFPA 5H3LA 1FQKA 2WNIA 4ZICA 4RIEA 4H7DA 4WOCA 2FMXA 5D51S 3DDNA 2X0EA 3VR2D 3ZHZA 4LF4B 4PX9A 4MRMA 3VJMA 3TZQA 3QFIA 4R81A 2VHQA 3WQSB 4KKXB 3RC7A 2GEBA 4K1XA 2H1VA 1RHJA 1F5NA 2E4ZA 1SVSA 3KD2A 2WTAA 3N6RA 1INLA 4P4LA 4YWJA 3W2HA 1G5IA 2IVGA 3IMCA 2YIMA 4LOHA 2NYVA 4UVGA 3O3NB 4EUNA 1QB2A 1HFKA 1FNDA 1KI2A 1ZHHA 1B4DA 4J2TA 2C7GA 5LJLA 4TZ6A 1K6MA 1QS0A 1CUVA 1N6LA 1DAIA 1PZXA 3BDNA 3K1TA 2QE7D 5SZKB 1E5LA 2EZ8A 1WUHS 4LDQA 3PFIA 4UM9D 4X5OA 2GHIA 5CHYA 3BBLA 3QA3E 3I1JA 3MK31 4KVZA 4PTLA 1KFBB 3ZK7A 4OYLA 2O5EA 3SQLA 3F78A 2J1LA 2WIFA 1RYDA 4GM4A 3MD9A 4INZA 4EZEA 1FYDA 1TC2A 2ZWMA 1MLDA 3KT8A 1E5TA 1GUDA 1VBMA 3SICE 5KCZA 1DTWB 4YCDA 2IBTA 5LPNA 2WJWA 3T1HB 4W7IA 3H9UA 2WU0A 2EX1A 3BH7A 4GLOA 1N4AA 4CTNA 2JCSA 3TZ6A 3S2UA 4JIMA 5KKNB 2P30A 3G0IA 1XWWA 1DX6A 4P4NA 3P9XA 4C0LA 1PDVA 3C5CA 3W5UA 1L6RA 5K99A 2F4VB 1LCIA 1P75A 3HZOA 2JAWA 1CS0A 1X94A 2QD3A 4RIGA 4DUPA 4JI6B 1OZ0A 5AVTA 1T9GR 5PNTA 2DX7A 3SF8A 3AUJB 4K8OA 1T8TA 4YRNA 3OZAA 1OAKA 3JQRA 3AP2A 1RYNA 1ZX1A 2CVZA 2XVAA 1PFVA 3E27A 1N2JA 5CVEA 1CY8A 2YJTD 2IYOA 3D6TB 1MP0A 3DDOA 2BHNA 1HYBA 1WQ4A 1Z7WA 2JNWA 2LDXA 3FKSD 5FYDA 2NT3A 4O1MA 4RPKA 4DQUA 2Q6OA 4NPHA 2MYUA 3QVSA 4L2IB 4RACA 3KJIA 4Y2JA 3GGJA 3V5NA 3HYTA 4KXXA 3REGA 1NDQA 1RQRA 2O8EB 2FR0A 3U5ZB 4Z0PA 1YS2X 2V74B 3V1YA 3R0JA 1O57A 3LOQA 1HZJA 2BFNA 4R51A 2D1SA 3AP1A 3HB4X 4XGKA 1Z18A 2CXTA 5HQJA 4IRMA 4JJ8A 4JJ7A 1ST3A 2ECKA 3KKLA 3OBIA 4DC0A 1GPJA 4QZVA 3ZD7A 1ZD2P 3HMKA 1U2DA 2QSUA 2IA5A 4M6WB 5D5HA 1OTYA 3RS7A 1E98A 4R1LA 3ENZA 4DCJA 1VL1A 1RT9A 3P9PA 2J0UB 4X4CA 1DQYA 2Y27A 4FMCB 1II0A 4TRRA 2DSNA 3GUCA 1JHUA 3I2KA 1YVDA 2GXSA 5EMMA 3FTPA 2RMKA 3LUAA 3T3NA 5DTRA 2NZXA 2ZLBA 4HDKB 4L9RA 2ZYRA 4BO9A 5MHTA 4B48A 2JGIA 2YWRA 4IXTA 1B74A 16PKA 2XI4A 2YY6A 3DL2A 4GW3A 1K06A 3BXOA 1RYYA 4I1UA 2CL5A 2B5WA 2R11A 4JBHA 1V7CA 1XJQA 1Y8CA 4ARVA 4E6EA 4S04A 4OM7A 1X8JA 1SKQA 2Y76A 4RE6A 5DGXA 1E5VA 1I9CA 1SBTA 2JHAA 2ODQA 2VDLB 3IUSA 4QHTA 4D82A 2AX3A 1PZNA 1UFKA 4UUAA 3O3MB 4ITVA 4IA8A 1F6BA 2VYFA 3JQBA 4MVJD 4YIKA 3BD9A 4N8SA 3U3OA 2XB4A 1EFRA 2XAUA 2YVLA 4NC9A 1IWBB 4HAXA 4FFPA 1E1RA 4BBPA 1DIAA 1E99A 2O07A 1KZ9A 4TLBA 3VGJA 3DVAB 2QN1A 3ZWAA 1IK4A 1TTTA 3P20A 1XPUA 3KFLA 3HDQA 4I4LA 1EFUA 2DKNA 4BUJA 2INGX 1W4BA 1COZA 2CNNA 3RW9A 3D0RA 3TOCA 5BSTA 4DQXA 3OM1A 3K9BA 2CNKA 4E12A 4E7OA 2BM1A 3M6LA 4HEA1 3RAEC 3A36A 3K6KA 1TYCA 2B1JA 4O4JA 3LA6A 2HIGA 3FNFA 3DLHA 5CD9A 3PHCA 5ESXA 5K09A 4F7DA 2GN8A 3MAAC 4W1PA 5DEOA 1MH1A 3ITKA 1VBNA 1WZEA 2B0CA 2QW1A 4L3WA 1RFLA 1R3UA 3P8ZA 3UJ9A 2VXCA 2ZAYA 3PITA 5DISB 3L0YA 4Q7JB 2FPGA 4N3CA 1I36A 4CMHA 1V6SA 2WFAA 3QQ6A 1DUIA 1SWVA 2MSDB 1ABEA 3GRCA 3L46A 2IHVA 3PUKA 4RXUA 1PJLA 4MV8A 4ED9A 4C5BA 1M34A 3KQQA 1YQTA 1UK7A 2CDRA 3OZXA 1T4BA 4KAJA 1V1MB 3VTAA 1N7GA 1AQUA 4GECA 5F4BA 3EC1A 8GPBA 5AW4A 3JVDA 1S89A 2HV9A 4M4SA 2GFHA 3O4GA 1H93A 3PHBE 4NJEA 3BA6A 4H60A 1WU8A 3NQ41 1T9ZA 3KLNA 2HJWA 4LRSB 3AJRA 4LFCB 1SCUB 3PC2A 5B12A 5REQB 1T2FA 4JEHA 2V6MA 4UUQA 3SC2A 3EIFA 1PSDA 2QTWB 3UMFA 2VP5A 4D0NA 1OKKA 3JWPA 4HDNA 1Q1ZA 4JKYA 2B5OA 2IDMA 2C59A 2XCTB 1ZSYA 2I33A 5MF6A 1WW3A 4F3YA 2CV2A 3FHOA 1WCYA 2DXIA 5DP2A 1I6WA 5HZHA 2GJKA 2J08A 3KPYA 4MZXA 4X6YA 5BN1A 4BZWA 3OLWA 1Z4JA 4UOQA 1FLVA 3U56A 1OYYA 4GGPA 4TZ0A 2GA9A 1ZEJA 3AEQA 4FJ0A 4ID9A 1RZUA 1IE3A 3KYIB 5EWMB 5HFAA 5ILGA 4DREA 1DQNA 3I58A 3VSBA 5JFTA 1RCUA 3T4EA 2GM3A 4MGKR 3QEMA 2WLTA 5H0IA 5IMBA 4BLVA 4C0KA 1SBYA 3ZHCA 2H1SA 1ZN7A 1PR3A 3PRJA 4RIIA 1W88B 2QR5A 5EKUA 1FXUA 3KJQA 5EIOA 1A8HA 4EUSA 2A78A 1GAXA 1H6DA 4WOKA 3ROGA 3TVTA 3C74A 4I81A 4FZVA 1YFJA 1XMOB 3WZMA 4W99A 3B6JA 5FEMA 3EXG2 4W5RA 1CHNA 1HQ1A 4BQNA 1LPPA 1A8UA 4H2DA 4TMFA 3MJHA 3QKUA 4IP0A 3Q9LA 3WDSA 4EARA 4YPVA 3HJHA 4IILA 5D3ZA 4XQ0A 1D2AA 1Y3BE 5HRCA 1AK1A 3M1LA 2WTXA 1ULSA 3QX9A 3UK0A 2G88A 1F8GA 1V11A 5A7GA 5B4TA 2AC2A 3FFBA 5C9ZA 3QRWA 4RD4A 1S2NA 2GVZC 2QRJA 4NHEA 2YXNA 3H9GA 4BJ6A 5KJ1A 1QH8A 2AVDA 3HSKA 4AT1A 4B3GA 1PP4A 1XTUA 1CUGA 2QUJA 1YU6A 5K05A 1QYXA 3WJ2A 2YNMA 4UBNA 4XCVA 1KSJA 3VNBA 2PGDA 4KRXA 1RJFA 2A33A 5I8WA 1FFYA 1TUGA 3TZCA 3J7TA 4KX3A 4PQRA 3I39X 2ZBUA 2Y0CA 1I0ZA 3B9PA 1H5QA 3ICPA 1ADYA 4D9KA 1XZFA 4JGIA 4H1TA 1WCIB 4JEIA 2BTOA 2ARKA 1NUUA 4DV0B 5SY4A 4I1PA 3JASA 4BNGA 3CVUA 5KINB 2XUZA 2QL5A 1H8EA 3HWWA 3LE8A 2IC5A 3MN1A 2A9PA 4WLOA 2ZJOA 3CX3A 3HLTA 1UK9A 4QXPA 3BGVA 4XIYA 4JP5A 1DBWA 2HJ9A 5G40A 4ME6A 1CZOA 4DVGA 2LR0A 2JVKA 4NFSA 2WAMA 1E9SA 1BU5A 2R00A 2JGDB 1HUQA 1E2PA 4FBLA 4EI2A 4LJKA 5K51A 1CW2B 1SZPA 3FGOA 5FWDA 4CEJB 4HKTA 3HR7A 4D8WA 1IZ0A 3VOSA 1N1MA 4RMJA 3S99A 1WBDA 5DOVA 3HV0A 3QX8A 3V46A 4ZCQA 1O77A 3MRXA 4DUGA 2GUWA 4I3GA 3A32A 4I5FA 2HRDA 5T4FA 2RHRA 1FC0A 2P6NA 3HVIA 4IH1A 4Z9FA 5F52A 1H1LA 1KYZA 2HO5A 3X3HA 1J8QA 3NT5A 3GPBA 5DGIA 2VF2A 3RVPA 2YS6A 4KSYA 3DZGA 3KE8A 3DL0A 4Y6RA 1EXDA 2C3UA 1PFGA 3D4LA 5J5AA 4YJKA 2XCJA 1C9DB 4HDSB 3L8EA 1U3FA 4XPIA 3TW8A 1S02A 1I4DD 2KEIA 1KAEA 4IUCS 4KBGA 1IQPA 2XPCA 5T4HA 1E92A 2E48A 2GA8A 2ZYHA 2NMVA 2FR8A 3RIXA 2ZPAA 1YHZA 3MEJA 1I4LD 3OFSA 3DW3X 4C3VA 2IYRA 1YIAA 4KUEA 3A05A 4JD5A 3IBTA 2WJHA 1ZVJA 1VLQA 1I3OA 1ULUA 3C6QA 4FGKA 4P6VF 2B82A 2VHWA 3EQ6A 5TQVA 1C1YA 1BMFD 1D6JA 3DUFB 4J9VA 3NJ4A 3IAM1 1XDGA 1XLWA 3ZNQA 4CV2A 1NF2A 3FYDA 2LNMA 4HTAA 1AY0A 1DAHA 1ADBA 4JYPA 3W6PA 5KUTA 5LXTB 2D0OB 4RF2A 3NYQA 4KFCA 3GCGA 5JNSA 1HORA 1R5OA 2WJGA 2HA4A 3O4JA 4TZTA 1JT2A 4XWYA 5HZKA 2C2GA 4Q82A 2EP5A 3A9UA 4GZLA 1H4TA 1HE2A 1OH6A 1P2BA 2WIUB 3KV3O 2WFMA 4XVQA 1DPGA 1PS9A 2I7TA 2JLWA 1ECBA 3BF8A 2W2MA 3VPGA 1Z12A 3NTQA 1Q0LA 2LYPA 3PCTA 1YR2A 3B9RA 4O4LA 4B4DA 4P53A 4EG0A 3R9XA 2VI5A 1GEEA 5JW6A 5KNCH 4RGVA 4EF5A 1EJ0A 3MS4A 4I8XA 2QM0A 2QBYB 2L2QA 1YB7A 2P62A 1X80A 2AQHA 2QZJA 2WINI 3PNPA 5AQEA 1YVPA 3GFVA 4P7BA 4YV0A 1G63A 2WD7A 3GPCA 1T4DA 4BNLA 5FPTA 2Z6AA 4PZ0A 5KTKA 3C24A 3B5IA 2PS3A 2DPLA 1HEYA 3AB8A 1PL6A 4Y7DA 5AUQA 5LD2C 1GGJA 2XRZA 5LR6A 2OCBA 2PGXA 5DNDA 4W9MC 2QVBA 1T3ZA 1V39A 1I4WA 5KWVA 3OTGA 1CV2A 2O2XA 2LYLA 3R9KA 4CL3A 4WZAB 4EPTA 2E4UA 3V34A 1E9RA 2DFLA 2EX0A 1EBBA 2H4WA 5AKJA 3RV3A 3WRYC 3B1XA 1AURA 2BCGY 2YXEA 4IFEA 5AT1A 2Z8ZA 3BA1A 1XK6A 5DHTA 2Q29A 3AI1A 3I4FA 4M1EA 1FZQA 1KK3A 2C94A 4EELA 2XADA 3S0JA 1EXVA 1N3BA 3ZDZB 4QC2A 2X1VA 5C8YF 2XJ3A 3MSCA 3V7WA 1SQ5A 1XVAA 4MUJA 4ZV9A 2AMYA 1CR2A 2IW1A 2Q0SA 3C39A 5K0SA 4K2HA 2EDCA 4Z0TA 1UKCA 4M9CA 3OKZA 2CCJA 2Z9DA 1PT8A 3B53X 4F38A 4X95A 4LZWA 3LY9A 3M5CA 4FS8A 4N7RA 5BXQC 1OHHA 2PD3A 3JQCA 4GGMX 1XKTA 3DF9A 3SJAA 1NQVA 2HT1A 3OF5A 2QTVA 3NGLA 3THYB 1TW3A 3T5CA 3UMVA 4BHTA 2AFRA 4CQLA 5BN4A 1NJGA 1GCGA 2O8DB 3LTEA 1T4GA 1Z73A 3RCBA 4X1IA 2V65A 3QLVA 5EMHA 4EGAA 1KQFA 1A2BA 3FCUB 2AOTA 5TPZD 1GNRA 5JY6A 3KPJA 2CBXA 2YY5A 1H3EA 5AKEA 4UKDA 1IOVA 3I42A 4WKBA 5ERXA 5HXAA 5CRIA 4HYEA 1HDZA 3IUNA 2QMHA 3IEKA 5A4MS 4ZYVA 3R7WB 3R8FA 3JQ8B 2ZDHA 2IV2X 3VO2A 2Q8NA 2GRUA 3PPIA 1AF4A 4BV2A 5IKMA 1Z62A 1DV2A 3WOVA 3ACBA 3A6GA 3G13A 4F91B 1BW9B 4F2DA 1EU1A 3K70B 2QTBA 4FIDA 1JLKA 2HMSA 3QKSB 4EW2A 1DAMA 1RJGA 1XZAA 4CIBA 5TQ2B 3U6BA 3DEYX 1N3LA 3F4LA 1A9RA 2I6GA 4QDXA 5ADUS 4OQXA 3NNDA 1AKUA 4J6EA 5F33A 3NFRA 1CZLA 1GKLA 2WP8J 2J7WA 2WNHA 5BNIA 1GV0A 1JEQB 2FZKA 3JAWA 4AN1A 5HE9A 1T5DX 3PFGA 1UOPA 2FI1A 2WWGA 5DX1A 5K0GA 1WHSB 2IYSA 2GVNA 1NL3A 3R5XA 4LRWA 4PNHA 1TEHA 1Q91A 4I2VA 3OQ1A 5I3ZA 1PV4A 2LV8A 1K88A 2DPXA 2QTTA 2MQKA 1V8BA 1WSAA 5F3WB 2LRHA 1RNLA 3RADC 1QH1A 1T8YA 4II2A 2IU7A 4FDUA 3VOBA 4LVOA 3QPUA 1NVMB 3Q85A 4FE4A 5KQLA 1O4WA 4LZAA 5IBRA 3ELUA 4N03A 3G5GA 1WZIA 1Z0IA 4PLZA 2D5CA 4R2LA 3EBOA 4E5VA 4U00A 2QYHA 3OD1A 1W6UA 4OIMA 4BNDB 3ZZMA 5HS4A 4QD3A 4ZK6A 4O2AB 4Y6QA 1ZMBA 3CF0A 4L4XA 4BFTA 4G85A 1GV1A 3RHZA 3ACDA 2VP3A 3TLJA 2X8JA 1TIPA 4EFKA 3D54D 3AEZA 1NFFA 1WXDA 1XEXA 1QIEA 1MC1A 3E9CA 3QLUC 5DGCA 1NTRA 1KMCA 4D92A 3TXAA 2OXFA 1AQIA 5A3QA 1SBZA 2KW5A 3MJFA 2IYEA 2IZ5A 1E77A 1XNJA 1VKOA 4PGHA 4ZOQI 3TGPA 1IY8A 4MCIA 3DL4A 3L7YA 4QYTA 1NY6A 1DIBA 2MYPA 2XYRA 1QU3A 1THMA 2X9LA 4NRDA 5EFZA 1Z17A 5BSWA 2GM4A 4WA8A 1FMTA 1FU4A 1KNXA 1ZH8A 1BEEA 2XCIA 3DBRA 3NM4A 4H27A 3IDFA 3BJRA 3IPYA 2W70A 2ZRLA 5FFMA 2ZM6B 5BT8A 3H9EO 5JJ5A 1TU0A 2LIPA 2ROQA 3OEWA 2N0SA 4Y2PA 5F21A 1W581 3L07A 1ST2A 1W76A 2RSLA 1ZCJA 2AKEA 3FPLA 3GDHA 2BFCA 3LQ1A 4EK9A 3V4LA 4PYMA 2B4QA 2B9VA 1F7UA 4OCZA 3ZW8A 1BXZA 3D3JA 1XTVA 4AG5A 3RD5A 1IBSA 2KBEA 1JFSA 4RVHA 4DABA 1CUZA 1OI4A 3F71A 1CNFA 4RAQA 3SYTA 4LISA 2QUHA 4PQFA 3PGKA 3S8YA 3EFHA 4K88A 4DSZA 3UK6A 5DBFA 2C7VA 2Z0MA 3H2GA 2C2WA 2PXBA 1HDRA 4K9DA 5DYWA 5K4AA 1YL6A 3GNQA 3CUVA 3PFNA 1IG0A 1FX0A 1WETA 4RJKA 1A4RA 3OPMA 4MQ6A 4N3BA 4XYEA 5J63A 2N47A 3W2FA 4YX9A 3E8XA 3NGMA 2CD7A 1JEDA 3QUCA 4TN1A 4NS1A 4JLVA 3DE3X 5TDHA 1JHMA 2VNSA 2KLHA 1N5KA 2BONA 2DHDA 3DPUA 1FOEB 3Q9UA 4R2MA 4EHNA 4OV6B 3RS2A 3OTOB 2FQQA 2I4RA 1Q3KA 3E7FA 4FYIA 1NVBA 2W2KA 2NU7B 3OM9A 3T3PB 1CULC 3AEUB 3WKDA 4RDXA 2XNCA 4YP6A 1Z22A 2CF6A 2BI7A 3TBHA 5CFZA 3ESYA 1BAPA 1E2DA 2C2KA 3KR1A 4RGBA 2QMOA 2J7KA 3OZEA 1ZCZA 4GRAA 4P35A 2NW6A 5TY0A 5AW2A 4UDYX 1NDUA 3MYRA 1P62B 4YRKA 2Z9CA 4KLZA 5KMGB 4NI5A 3E05A 2FG7C 1OPRA 3JYQA 3EMVA 3L7AA 3VKGA 2ZRQA 4WASA 1XYGA 3K16A 2ZBVA 1H3NA 4I4IA 3RLIA 1JHQA 1MB9A 3E9ZA 4QOIA 2WU4A 4ZPXA 4XOUA 4Q02A 3NKLA 3C45A 3ZWYA 5BN5A 4ZALA 3QVKA 2EZ4A 3JPWA 1AQNA 4P58A 4H3KB 2G9RA 4JEUA 2BMFA 5FWAA 2JIZA 5JNUA 3AKEA 3RHFA 2TS1A 3IT3A 2WYWA 4ASUA 3CUSA 4RL4A 1Z34A 5AOAA 3NHUA 2UYOA 3G5UA 2OCIA 1WSWA 3D7SA 3AC0A 4U3JA 5B4UA 1REQB 4DIOA 5HUQA