1R69A

Structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the amino-terminal domain of phage 434 repressor at 2.0 A resolution.
pubmed doi rcsb
source organism Phage 434
molecule tags Gene regulating protein
molecule keywords REPRESSOR PROTEIN CI
total genus 21
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1988-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1r69A00
4PU3C 1JH9A 2AW6A 2IVGA 2AWIA 2OFYA 1GT0C 2KEKA 3D1NI 1B0NA 2LYPA 4PU4C 2IVBA 1RZSA 1UXDA 3GBFA 1LCCA 4OB4A 3OQOA 2KEJA 1R63A 1WH6A 1POUA 2PPXA 3KJXA 4MCTA 3QQ6A 4PU7A 4I8TA 4NDWA 2KZ8A 3CLCA 2PUEA 4J1XA 4F8DA 3FYAA 1OCTC 4X4DA 2XIUA 3BDNA 2AXUA 1WIZA 2B5AA 3CECA 3G7DA 2XSDC 2GRLA 2HINA 1RIOA 1IC8A 1VPWA 3HZIB 4O8BA 3LFPA 2O49A 2EWTA 1RZRA 1ZZ8A 1ZZBA 1QP7A 1ZZCA 2EF8A 4Y42A 2O4AA 2GRMA 2ICPA 3F52A 4I6TA 1ZUGA 4FBIA 4Z5HA 3JXDL 1QP0A 3U3WA 3FMYA 1PRAA 3F6WA 3GN5B 3B7HA 3H5TA 1JFSA 4JQDA 1X2LA 3QF3A 4YG4A 1DW9A 1QQBA 4X4HA 1NEQA 2AXVA 1Y7YA 2PUAA 1YSEA 2ICTA 3VK0A 2R63A 1ZZ6A 1ZZ9A 2IV1A 1SQ8A 1Y9QA 2XI8A 4PU8A 4YARA 4X4EA 2LYJA 1HF0A 2WUSR 2L8NA 1LMB3 3F51A 1JWLA 3CROL 5A7LA 3ZHMA 1ZPQA 2LYSA 4X4BA 2L49A 1CJGA 1UXCA 4YBAA 3GN5A 3PXPA 4Z5DA 2CSFA 1NERA 2BJCA 1BDHA 4X4GA 2JCGA 2HSGA 1XWRA 3ZHIA 3R1FA 1LQCA 5K98B 1RPEL 2AUWA 3SCHA 1OSLA 3FYMA 2BNMA 3OMTA 2R1JL 4I6UA 2IVQA 1QQAA 1R69A 4IA8A 2LCVA 1L1MA 2PUBA 2LYKA 4MCXA 3KZ3A 3MLFA 1UTXA 3BD1A 3IVPA 1AU7A 4J1WA 1PRUA 1LLIA 3SCGA 1ZVVA 4Z59A 2CROA 2A6CA 2MEZA 3ZKCA 2O38A 4YG1A 1E3OC 1QP4A 4YG7B 3KXAA 2FJRA 3UFDA 3LISA 2EBYA 2BNOA 3TRBA 1X57A 4I6RA 4X4FA 3OQMA 1EFAA 4IVZA 2PUCA 4JCXA 3O9XA 1ZS4A 4FN3A 1WH8A 1RZRD 2IU7A 2BNNA 2AXZA 3EUSA 3L1PA 1JFTA 2LYRA 3SCFA 4Z5CA 3JXBC 3QWGA 4JCYA 2GZUA 3OQNA 1DWKA 3OP9A 2LYLA 3S8QA 2PUDA 2D5VA 2PIJA 2KEIA 2JVLA 1O4XA 2LYQA 1BDIA 2PUFA 4X4IA 3G5GA 1S7EA 2H8RA 1ZZ7A 2MQKA 4GQMA 2KPJA 1ZAYA 2XCJA 3DNVB 1PERL 2XJ3A 3RZZA 4Z58A 3QYXA 3BS3A 1LCDA 2OR1L 1WETA 3JXCL 2WIUB 4GHJA 4X4CA 1CQTA 2PE5A 1PNRA 2PUGA 4IWRA 1QPZA 2IUOA 1PRVA 1ADRA
chains in the Genus database with same CATH superfamily
2AW6A 2IVGA 2AWIA 2LNMA 1LCCA 3OQOA 1WH6A 2PPXA 4MCTA 4PU7A 4I8TA 3QQ6A 3QFIA 2B5AA 3G7DA 3G0TA 2XSDC 1RIOA 1VPWA 2PXUA 1RZRA 1ZZBA 3JXDL 4Z5HA 3U3WA 2PXBA 1PRAA 1JFSA 4YG4A 2XXQA 4ER7A 1QQBA 1YSEA 2ICTA 2R63A 1ZZ9A 1SQ8A 4X4EA 3M9LA 3GZCA 1HF0A 2WUSR 3CROL 5A7LA 3TEPA 1ZPQA 2LYSA 4X4BA 3PXPA 1NERA 1BDHA 1XWRA 1LQCA 3SCHA 2R1JL 4I6UA 2PXKA 2LCVA 1L1MA 3PE5A 3SCGA 1ZVVA 3KL4A 3ZKCA 2O38A 2MXDA 4YG1A 1E3OC 4YG7B 2EBYA 1EFAA 2AXZA 3EUSA 2LYRA 3QWGA 2GZUA 1DWKA 2PIJA 1S7EA 5GAGi 4GQMA 2XCJA 3DNVB 2ODRD 2PXFA 2XJ3A 3R09A 3JXCL 2WIUB 4X4CA 1PNRA 1PRVA 2KEKA 1B0NA 2LYPA 4PU4C 2IVBA 2V3CC 1POUA 3DM5A 3KJXA 3ZPXA 2JQEA 3CLCA 4J1XA 4X4DA 2XIUA 2PXVA 3CECA 2GRLA 3OWQA 2HINA 3A9YA 4O8BA 2O49A 2EWTA 1ZZ8A 4DE8A 1QP7A 3NROA 4Y42A 5DRYA 1QP0A 2PXQA 3H5TA 4JQDA 2PXLA 3QF3A 2L1PA 1DW9A 3SX0A 4X4HA 2HCNA 2AXVA 3VK0A 2IV1A 4PU8A 4EQZA 2L8NA 1LMB3 3ZHMA 4Z5DA 5GAHi 2BJCA 2HSGA 3ZHIA 5K98B 3R1FA 3GUUA 2VEOA 1QQAA 1R69A 4IA8A 3UWPA 4ER6A 3KZ3A 3MLFA 1UTXA 3IVPA 1AU7A 4J1WA 2CROA 2A6CA 3KXAA 4EZIA 4HRAA 3TRBA 4X4FA 4FN3A 2IU7A 2BNNA 3SCFA 4Z5CA 2XXPA 2LYLA 2PUDA 2JVLA 4EK9A 2PUFA 3GZDC 3G5GA 2H8RA 1HQ1A 2KPJA 3NDBB 3QYXA 5JUWA 2PXTA 1QZXA 1CQTA 2PUGA 2IUOA 4PU3C 1JH9A 2FFHA 2OFYA 1GT0C 3D1NI 2PXEA 1RZSA 3GBFA 2KZ8A 4WVLA 4OBMA 4F8DA 3BDNA 2AXUA 5DTQA 3LFPA 1ZZCA 2PXPA 3F52A 3NXHA 3B7HA 1X2LA 3MEJA 1NEQA 1Y7YA 2XI8A 3QOXA 4YARA 3OKZA 4EKGA 1JWLA 1UXCA 3NZLA 2CSFA 4X4GA 2JCGA 1RPEL 1OSLA 1MFQC 3OMTA 2IVQA 1DULA 3BD1A 1PRUA 4Z59A 1QB2A 2FJRA 2BNOA 3OQMA 4IVZA 1ZS4A 1RZRD 3L1PA 3JXBC 2YBDA 3OQNA 3OP9A 2PXDA 2KEIA 2LYQA 1BDIA 1NW3A 4X4IA 4EKIA 1ZZ7A 1PERL 3RZZA 4Z58A 1U2ZA 3BS3A 4ER0A 1LCDA 2OR1L 1WETA 2PE5A 2LLWA 1UXDA 4OB4A 5DTMA 2KEJA 1R63A 4NDWA 2PUEA 2J7UA 1OCTC 3FYAA 4Q2JA 1WIZA 1IC8A 3HZIB 2EF8A 3QOWA 2O4AA 2GRMA 5DRTA 2ICPA 4I6TA 4FBIA 1ZUGA 4DE9A 3FMYA 3F6WA 3GN5B 3SR4A 3LQXA 2PUAA 1ZZ6A 1Y9QA 2LYJA 2XXAA 3F51A 2L49A 3VWSA 4YBAA 1CJGA 3GN5A 3TELA 3ME5A 5DSXA 4ER3A 2AUWA 3FYMA 2BNMA 2HFZA 2PUBA 2LYKA 4MCXA 2LLVA 1LLIA 3GZDA 2MEZA 1QP4A 3UFDA 3LISA 1X57A 4I6RA 3TFLA 2PUCA 4JCXA 3O9XA 1WH8A 2M4HA 1JFTA 3A9ZA 4JCYA 3S8QA 3A9XA 2D5VA 1O4XA 2MQKA 1ZAYA 4ER5A 5DT2A 2J7WA 5DTRA 4GHJA 4IWRA 1QPZA 2HCSA 1ADRA
chains in the Genus database with same CATH topology
4PU3C 1JH9A 2AW6A 2IVGA 2AWIA 2OFYA 1GT0C 2KEKA 3D1NI 1B0NA 2LYPA 4PU4C 2IVBA 1RZSA 1UXDA 3GBFA 1LCCA 4OB4A 3OQOA 2KEJA 1R63A 1WH6A 1POUA 2PPXA 3KJXA 4MCTA 3QQ6A 4PU7A 4I8TA 4NDWA 2KZ8A 3CLCA 2PUEA 4J1XA 4F8DA 3FYAA 1OCTC 4X4DA 2XIUA 3BDNA 2AXUA 1WIZA 2B5AA 3CECA 3G7DA 2XSDC 2GRLA 2HINA 1RIOA 1IC8A 1VPWA 3HZIB 4O8BA 3LFPA 2O49A 2EWTA 1RZRA 1ZZ8A 1ZZBA 1QP7A 1ZZCA 2EF8A 4Y42A 2O4AA 2GRMA 2ICPA 3F52A 4I6TA 1ZUGA 4FBIA 4Z5HA 3JXDL 1QP0A 3U3WA 3FMYA 1PRAA 3F6WA 3GN5B 3B7HA 3H5TA 1JFSA 4JQDA 1X2LA 3QF3A 4YG4A 1DW9A 1QQBA 4X4HA 1NEQA 2AXVA 1Y7YA 2PUAA 1YSEA 2ICTA 3VK0A 2R63A 1ZZ6A 1ZZ9A 2IV1A 1SQ8A 1Y9QA 2XI8A 4PU8A 4YARA 4X4EA 2LYJA 1HF0A 2WUSR 2L8NA 1LMB3 3F51A 1JWLA 3CROL 5A7LA 3ZHMA 1ZPQA 2LYSA 4X4BA 2L49A 1CJGA 1UXCA 4YBAA 3GN5A 3PXPA 4Z5DA 2CSFA 1NERA 2BJCA 1BDHA 4X4GA 2JCGA 2HSGA 1XWRA 3ZHIA 3R1FA 1LQCA 5K98B 1RPEL 2AUWA 3SCHA 1OSLA 3FYMA 2BNMA 3OMTA 2R1JL 4I6UA 2IVQA 1QQAA 1R69A 4IA8A 2LCVA 1L1MA 2PUBA 2LYKA 4MCXA 3KZ3A 3MLFA 1UTXA 3BD1A 3IVPA 1AU7A 4J1WA 1PRUA 1LLIA 3SCGA 1ZVVA 4Z59A 2CROA 2A6CA 2MEZA 3ZKCA 2O38A 4YG1A 1E3OC 1QP4A 4YG7B 3KXAA 2FJRA 3UFDA 3LISA 2EBYA 2BNOA 3TRBA 1X57A 4I6RA 4X4FA 3OQMA 1EFAA 4IVZA 2PUCA 4JCXA 3O9XA 1ZS4A 4FN3A 1WH8A 1RZRD 2IU7A 2BNNA 2AXZA 3EUSA 3L1PA 1JFTA 2LYRA 3SCFA 4Z5CA 3JXBC 3QWGA 4JCYA 2GZUA 3OQNA 1DWKA 3OP9A 2LYLA 3S8QA 2PUDA 2D5VA 2PIJA 2KEIA 2JVLA 1O4XA 2LYQA 1BDIA 2PUFA 4X4IA 3G5GA 1S7EA 2H8RA 1ZZ7A 2MQKA 4GQMA 2KPJA 1ZAYA 2XCJA 3DNVB 1PERL 2XJ3A 3RZZA 4Z58A 3QYXA 3BS3A 1LCDA 2OR1L 1WETA 3JXCL 2WIUB 4GHJA 4X4CA 1CQTA 2PE5A 1PNRA 2PUGA 4IWRA 1QPZA 2IUOA 1PRVA 1ADRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PU3 C;  1JH9 A;  2AW6 A;  2IVG A;  2AWI A;  2OFY A;  1GT0 C;  2KEK A;  3D1N I;  1B0N A;  2LYP A;  4PU4 C;  2IVB A;  1RZS A;  1UXD A;  3GBF A;  1LCC A;  4OB4 A;  3OQO A;  2KEJ A;  1R63 A;  1WH6 A;  1POU A;  2PPX A;  3KJX A;  4MCT A;  3QQ6 A;  4PU7 A;  4I8T A;  4NDW A;  2KZ8 A;  3CLC A;  2PUE A;  4J1X A;  4F8D A;  3FYA A;  1OCT C;  4X4D A;  2XIU A;  3BDN A;  2AXU A;  1WIZ A;  2B5A A;  3CEC A;  3G7D A;  2XSD C;  2GRL A;  2HIN A;  1RIO A;  1IC8 A;  1VPW A;  3HZI B;  4O8B A;  3LFP A;  2O49 A;  2EWT A;  1RZR A;  1ZZ8 A;  1ZZB A;  1QP7 A;  1ZZC A;  2EF8 A;  4Y42 A;  2O4A A;  2GRM A;  2ICP A;  3F52 A;  4I6T A;  1ZUG A;  4FBI A;  4Z5H A;  3JXD L;  1QP0 A;  3U3W A;  3FMY A;  1PRA A;  3F6W A;  3GN5 B;  3B7H A;  3H5T A;  1JFS A;  4JQD A;  1X2L A;  3QF3 A;  4YG4 A;  1DW9 A;  1QQB A;  4X4H A;  1NEQ A;  2AXV A;  1Y7Y A;  2PUA A;  1YSE A;  2ICT A;  3VK0 A;  2R63 A;  1ZZ6 A;  1ZZ9 A;  2IV1 A;  1SQ8 A;  1Y9Q A;  2XI8 A;  4PU8 A;  4YAR A;  4X4E A;  2LYJ A;  1HF0 A;  2WUS R;  2L8N A;  1LMB 3;  3F51 A;  1JWL A;  3CRO L;  5A7L A;  3ZHM A;  1ZPQ A;  2LYS A;  4X4B A;  2L49 A;  1CJG A;  1UXC A;  4YBA A;  3GN5 A;  3PXP A;  4Z5D A;  2CSF A;  1NER A;  2BJC A;  1BDH A;  4X4G A;  2JCG A;  2HSG A;  1XWR A;  3ZHI A;  3R1F A;  1LQC A;  5K98 B;  1RPE L;  2AUW A;  3SCH A;  1OSL A;  3FYM A;  2BNM A;  3OMT A;  2R1J L;  4I6U A;  2IVQ A;  1QQA A;  1R69 A;  4IA8 A;  2LCV A;  1L1M A;  2PUB A;  2LYK A;  4MCX A;  3KZ3 A;  3MLF A;  1UTX A;  3BD1 A;  3IVP A;  1AU7 A;  4J1W A;  1PRU A;  1LLI A;  3SCG A;  1ZVV A;  4Z59 A;  2CRO A;  2A6C A;  2MEZ A;  3ZKC A;  2O38 A;  4YG1 A;  1E3O C;  1QP4 A;  4YG7 B;  3KXA A;  2FJR A;  3UFD A;  3LIS A;  2EBY A;  2BNO A;  3TRB A;  1X57 A;  4I6R A;  4X4F A;  3OQM A;  1EFA A;  4IVZ A;  2PUC A;  4JCX A;  3O9X A;  1ZS4 A;  4FN3 A;  1WH8 A;  1RZR D;  2IU7 A;  2BNN A;  2AXZ A;  3EUS A;  3L1P A;  1JFT A;  2LYR A;  3SCF A;  4Z5C A;  3JXB C;  3QWG A;  4JCY A;  2GZU A;  3OQN A;  1DWK A;  3OP9 A;  2LYL A;  3S8Q A;  2PUD A;  2D5V A;  2PIJ A;  2KEI A;  2JVL A;  1O4X A;  2LYQ A;  1BDI A;  2PUF A;  4X4I A;  3G5G A;  1S7E A;  2H8R A;  1ZZ7 A;  2MQK A;  4GQM A;  2KPJ A;  1ZAY A;  2XCJ A;  3DNV B;  1PER L;  2XJ3 A;  3RZZ A;  4Z58 A;  3QYX A;  3BS3 A;  1LCD A;  2OR1 L;  1WET A;  3JXC L;  2WIU B;  4GHJ A;  4X4C A;  1CQT A;  2PE5 A;  1PNR A;  2PUG A;  4IWR A;  1QPZ A;  2IUO A;  1PRV A;  1ADR A; 
#chains in the Genus database with same CATH topology
 2AW6 A;  2IVG A;  2AWI A;  2LNM A;  1LCC A;  3OQO A;  1WH6 A;  2PPX A;  4MCT A;  4PU7 A;  4I8T A;  3QQ6 A;  3QFI A;  2B5A A;  3G7D A;  3G0T A;  2XSD C;  1RIO A;  1VPW A;  2PXU A;  1RZR A;  1ZZB A;  3JXD L;  4Z5H A;  3U3W A;  2PXB A;  1PRA A;  1JFS A;  4YG4 A;  2XXQ A;  4ER7 A;  1QQB A;  1YSE A;  2ICT A;  2R63 A;  1ZZ9 A;  1SQ8 A;  4X4E A;  3M9L A;  3GZC A;  1HF0 A;  2WUS R;  3CRO L;  5A7L A;  3TEP A;  1ZPQ A;  2LYS A;  4X4B A;  3PXP A;  1NER A;  1BDH A;  1XWR A;  1LQC A;  3SCH A;  2R1J L;  4I6U A;  2PXK A;  2LCV A;  1L1M A;  3PE5 A;  3SCG A;  1ZVV A;  3KL4 A;  3ZKC A;  2O38 A;  2MXD A;  4YG1 A;  1E3O C;  4YG7 B;  2EBY A;  1EFA A;  2AXZ A;  3EUS A;  2LYR A;  3QWG A;  2GZU A;  1DWK A;  2PIJ A;  1S7E A;  5GAG i;  4GQM A;  2XCJ A;  3DNV B;  2ODR D;  2PXF A;  2XJ3 A;  3R09 A;  3JXC L;  2WIU B;  4X4C A;  1PNR A;  1PRV A;  2KEK A;  1B0N A;  2LYP A;  4PU4 C;  2IVB A;  2V3C C;  1POU A;  3DM5 A;  3KJX A;  3ZPX A;  2JQE A;  3CLC A;  4J1X A;  4X4D A;  2XIU A;  2PXV A;  3CEC A;  2GRL A;  3OWQ A;  2HIN A;  3A9Y A;  4O8B A;  2O49 A;  2EWT A;  1ZZ8 A;  4DE8 A;  1QP7 A;  3NRO A;  4Y42 A;  5DRY A;  1QP0 A;  2PXQ A;  3H5T A;  4JQD A;  2PXL A;  3QF3 A;  2L1P A;  1DW9 A;  3SX0 A;  4X4H A;  2HCN A;  2AXV A;  3VK0 A;  2IV1 A;  4PU8 A;  4EQZ A;  2L8N A;  1LMB 3;  3ZHM A;  4Z5D A;  5GAH i;  2BJC A;  2HSG A;  3ZHI A;  5K98 B;  3R1F A;  3GUU A;  2VEO A;  1QQA A;  1R69 A;  4IA8 A;  3UWP A;  4ER6 A;  3KZ3 A;  3MLF A;  1UTX A;  3IVP A;  1AU7 A;  4J1W A;  2CRO A;  2A6C A;  3KXA A;  4EZI A;  4HRA A;  3TRB A;  4X4F A;  4FN3 A;  2IU7 A;  2BNN A;  3SCF A;  4Z5C A;  2XXP A;  2LYL A;  2PUD A;  2JVL A;  4EK9 A;  2PUF A;  3GZD C;  3G5G A;  2H8R A;  1HQ1 A;  2KPJ A;  3NDB B;  3QYX A;  5JUW A;  2PXT A;  1QZX A;  1CQT A;  2PUG A;  2IUO A;  4PU3 C;  1JH9 A;  2FFH A;  2OFY A;  1GT0 C;  3D1N I;  2PXE A;  1RZS A;  3GBF A;  2KZ8 A;  4WVL A;  4OBM A;  4F8D A;  3BDN A;  2AXU A;  5DTQ A;  3LFP A;  1ZZC A;  2PXP A;  3F52 A;  3NXH A;  3B7H A;  1X2L A;  3MEJ A;  1NEQ A;  1Y7Y A;  2XI8 A;  3QOX A;  4YAR A;  3OKZ A;  4EKG A;  1JWL A;  1UXC A;  3NZL A;  2CSF A;  4X4G A;  2JCG A;  1RPE L;  1OSL A;  1MFQ C;  3OMT A;  2IVQ A;  1DUL A;  3BD1 A;  1PRU A;  4Z59 A;  1QB2 A;  2FJR A;  2BNO A;  3OQM A;  4IVZ A;  1ZS4 A;  1RZR D;  3L1P A;  3JXB C;  2YBD A;  3OQN A;  3OP9 A;  2PXD A;  2KEI A;  2LYQ A;  1BDI A;  1NW3 A;  4X4I A;  4EKI A;  1ZZ7 A;  1PER L;  3RZZ A;  4Z58 A;  1U2Z A;  3BS3 A;  4ER0 A;  1LCD A;  2OR1 L;  1WET A;  2PE5 A;  2LLW A;  1UXD A;  4OB4 A;  5DTM A;  2KEJ A;  1R63 A;  4NDW A;  2PUE A;  2J7U A;  1OCT C;  3FYA A;  4Q2J A;  1WIZ A;  1IC8 A;  3HZI B;  2EF8 A;  3QOW A;  2O4A A;  2GRM A;  5DRT A;  2ICP A;  4I6T A;  4FBI A;  1ZUG A;  4DE9 A;  3FMY A;  3F6W A;  3GN5 B;  3SR4 A;  3LQX A;  2PUA A;  1ZZ6 A;  1Y9Q A;  2LYJ A;  2XXA A;  3F51 A;  2L49 A;  3VWS A;  4YBA A;  1CJG A;  3GN5 A;  3TEL A;  3ME5 A;  5DSX A;  4ER3 A;  2AUW A;  3FYM A;  2BNM A;  2HFZ A;  2PUB A;  2LYK A;  4MCX A;  2LLV A;  1LLI A;  3GZD A;  2MEZ A;  1QP4 A;  3UFD A;  3LIS A;  1X57 A;  4I6R A;  3TFL A;  2PUC A;  4JCX A;  3O9X A;  1WH8 A;  2M4H A;  1JFT A;  3A9Z A;  4JCY A;  3S8Q A;  3A9X A;  2D5V A;  1O4X A;  2MQK A;  1ZAY A;  4ER5 A;  5DT2 A;  2J7W A;  5DTR A;  4GHJ A;  4IWR A;  1QPZ A;  2HCS A;  1ADR A; 
#chains in the Genus database with same CATH homology
 4PU3 C;  1JH9 A;  2AW6 A;  2IVG A;  2AWI A;  2OFY A;  1GT0 C;  2KEK A;  3D1N I;  1B0N A;  2LYP A;  4PU4 C;  2IVB A;  1RZS A;  1UXD A;  3GBF A;  1LCC A;  4OB4 A;  3OQO A;  2KEJ A;  1R63 A;  1WH6 A;  1POU A;  2PPX A;  3KJX A;  4MCT A;  3QQ6 A;  4PU7 A;  4I8T A;  4NDW A;  2KZ8 A;  3CLC A;  2PUE A;  4J1X A;  4F8D A;  3FYA A;  1OCT C;  4X4D A;  2XIU A;  3BDN A;  2AXU A;  1WIZ A;  2B5A A;  3CEC A;  3G7D A;  2XSD C;  2GRL A;  2HIN A;  1RIO A;  1IC8 A;  1VPW A;  3HZI B;  4O8B A;  3LFP A;  2O49 A;  2EWT A;  1RZR A;  1ZZ8 A;  1ZZB A;  1QP7 A;  1ZZC A;  2EF8 A;  4Y42 A;  2O4A A;  2GRM A;  2ICP A;  3F52 A;  4I6T A;  1ZUG A;  4FBI A;  4Z5H A;  3JXD L;  1QP0 A;  3U3W A;  3FMY A;  1PRA A;  3F6W A;  3GN5 B;  3B7H A;  3H5T A;  1JFS A;  4JQD A;  1X2L A;  3QF3 A;  4YG4 A;  1DW9 A;  1QQB A;  4X4H A;  1NEQ A;  2AXV A;  1Y7Y A;  2PUA A;  1YSE A;  2ICT A;  3VK0 A;  2R63 A;  1ZZ6 A;  1ZZ9 A;  2IV1 A;  1SQ8 A;  1Y9Q A;  2XI8 A;  4PU8 A;  4YAR A;  4X4E A;  2LYJ A;  1HF0 A;  2WUS R;  2L8N A;  1LMB 3;  3F51 A;  1JWL A;  3CRO L;  5A7L A;  3ZHM A;  1ZPQ A;  2LYS A;  4X4B A;  2L49 A;  1CJG A;  1UXC A;  4YBA A;  3GN5 A;  3PXP A;  4Z5D A;  2CSF A;  1NER A;  2BJC A;  1BDH A;  4X4G A;  2JCG A;  2HSG A;  1XWR A;  3ZHI A;  3R1F A;  1LQC A;  5K98 B;  1RPE L;  2AUW A;  3SCH A;  1OSL A;  3FYM A;  2BNM A;  3OMT A;  2R1J L;  4I6U A;  2IVQ A;  1QQA A;  1R69 A;  4IA8 A;  2LCV A;  1L1M A;  2PUB A;  2LYK A;  4MCX A;  3KZ3 A;  3MLF A;  1UTX A;  3BD1 A;  3IVP A;  1AU7 A;  4J1W A;  1PRU A;  1LLI A;  3SCG A;  1ZVV A;  4Z59 A;  2CRO A;  2A6C A;  2MEZ A;  3ZKC A;  2O38 A;  4YG1 A;  1E3O C;  1QP4 A;  4YG7 B;  3KXA A;  2FJR A;  3UFD A;  3LIS A;  2EBY A;  2BNO A;  3TRB A;  1X57 A;  4I6R A;  4X4F A;  3OQM A;  1EFA A;  4IVZ A;  2PUC A;  4JCX A;  3O9X A;  1ZS4 A;  4FN3 A;  1WH8 A;  1RZR D;  2IU7 A;  2BNN A;  2AXZ A;  3EUS A;  3L1P A;  1JFT A;  2LYR A;  3SCF A;  4Z5C A;  3JXB C;  3QWG A;  4JCY A;  2GZU A;  3OQN A;  1DWK A;  3OP9 A;  2LYL A;  3S8Q A;  2PUD A;  2D5V A;  2PIJ A;  2KEI A;  2JVL A;  1O4X A;  2LYQ A;  1BDI A;  2PUF A;  4X4I A;  3G5G A;  1S7E A;  2H8R A;  1ZZ7 A;  2MQK A;  4GQM A;  2KPJ A;  1ZAY A;  2XCJ A;  3DNV B;  1PER L;  2XJ3 A;  3RZZ A;  4Z58 A;  3QYX A;  3BS3 A;  1LCD A;  2OR1 L;  1WET A;  3JXC L;  2WIU B;  4GHJ A;  4X4C A;  1CQT A;  2PE5 A;  1PNR A;  2PUG A;  4IWR A;  1QPZ A;  2IUO A;  1PRV A;  1ADR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...