1R69A

Structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the amino-terminal domain of phage 434 repressor at 2.0 A resolution.
pubmed doi rcsb
source organism Phage 434
molecule tags Gene regulating protein
molecule keywords REPRESSOR PROTEIN CI
total genus 21
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1988-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1r69A00
2AXZA 1BDIA 3H5TA 2AWIA 2JCGA 3FYAA 1LCCA 2XJ3A 3OQMA 4NDWA 2O4AA 4YARA 2IV1A 3QQ6A 1SQ8A 2HSGA 4PU7A 3OMTA 1JFTA 4X4EA 3S8QA 1LLIA 3KZ3A 4F8DA 1UTXA 3CLCA 3G5GA 1ZVVA 2EF8A 3ZHMA 4X4BA 4Z5HA 1HF0A 1Y9QA 4J1WA 2LYQA 1R69A 1DWKA 4YBAA 2LYLA 3SCHA 1ZZBA 2IUOA 1AU7A 2LCVA 1B0NA 2WIUB 1PRVA 1L1MA 4FBIA 2R63A 3QF3A 2IVGA 1CQTA 2AUWA 1WETA 3TRBA 2IVBA 2KEJA 1RIOA 2O49A 4IVZA 2XI8A 4Z58A 1UXDA 3SCFA 1ZPQA 2KEKA 3KXAA 2PUGA 2B5AA 1QQAA 1QPZA 2FJRA 2PPXA 4X4GA 3F6WA 3O9XA 4I6RA 4X4CA 4JCYA 4Z5DA 2KZ8A 3HZIB 3B7HA 3JXCL 3GBFA 2OFYA 4OB4A 3BDNA 3FMYA 2PUDA 3R1FA 1VPWA 4JQDA 2BNOA 4Z59A 2WUSR 2KEIA 1UXCA 3LFPA 4I6UA 1ZZ9A 1ZAYA 2ICTA 1NERA 2AXUA 1ZZCA 3OP9A 1ZZ6A 4GQMA 3UFDA 1QQBA 2BNMA 1E3OC 3L1PA 4PU3C 1LMB3 1XWRA 4X4IA 2OR1L 4I8TA 1ZZ8A 2IVQA 2KPJA 1ZUGA 4MCXA 4YG4A 3D1NI 1R63A 1OSLA 1QP7A 2PUAA 3U3WA 2PIJA 3GN5A 3IVPA 2PUBA 1WH8A 4PU4C 3EUSA 1NEQA 1X2LA 1ZS4A 1JFSA 2PUFA 2PE5A 1WH6A 2XCJA 1ADRA 2LYPA 4I6TA 3QYXA 3ZKCA 5A7LA 4PU8A 1RZRA 1PNRA 2R1JL 1CJGA 2BNNA 2LYRA 1EFAA 4IWRA 1DW9A 2GRLA 4Y42A 2L49A 1RPEL 1X57A 2GRMA 3QWGA 1PRAA 2AXVA 1O4XA 3F52A 3JXBC 2L8NA 3DNVB 1RZRD 1JH9A 1POUA 2D5VA 2PUEA 3CROL 2XIUA 1QP4A 2HINA 3G7DA 4Z5CA 4X4DA 4X4FA 1OCTC 3F51A 2ICPA 2IU7A 1RZSA 1YSEA 1JWLA 4JCXA 2JVLA 3ZHIA 1LCDA 1LQCA 1S7EA 2EWTA 4X4HA 1GT0C 2MEZA 3LISA 5K98B 2A6CA 1PERL 3GN5B 4GHJA 3MLFA 2XSDC 1QP0A 3BD1A 2CROA 2LYJA 3PXPA 3RZZA 4YG1A 3JXDL 2GZUA 3OQNA 2BJCA 3CECA 1Y7YA 3SCGA 3BS3A 3KJXA 4FN3A 1BDHA 3VK0A 2CSFA 2AW6A 1PRUA 3FYMA 4O8BA 2EBYA 2O38A 1ZZ7A 2LYSA 4J1XA 2H8RA 3OQOA 2MQKA 1WIZA 2LYKA 4IA8A 1IC8A 4YG7B 4MCTA 2PUCA
chains in the Genus database with same CATH superfamily
3H5TA 3FYAA 3OQMA 2LLVA 1SQ8A 3KZ3A 3PE5A 1UTXA 3CLCA 2YBDA 4X4BA 5JUWA 1R69A 2IUOA 1AU7A 3TELA 2J7WA 4FBIA 2R63A 2AUWA 2O49A 4IVZA 2XI8A 2M4HA 1QQAA 2PPXA 4JCYA 1DULA 3JXCL 3NZLA 3BDNA 1UXCA 3A9YA 5DTMA 1U2ZA 1QQBA 2LLWA 2OR1L 1QP7A 1ZUGA 4EQZA 3IVPA 4ER6A 1WH8A 4PU4C 4EKIA 1X2LA 2PUFA 2LYPA 1PNRA 2R1JL 4OBMA 2GRLA 4EK9A 4HRAA 1RPEL 1X57A 3QWGA 2XXAA 1PRAA 3F52A 4ER3A 3DNVB 2PUEA 3G7DA 2PXQA 5DRYA 3F51A 4Q2JA 3ZHIA 1LQCA 1S7EA 2EWTA 4GHJA 3JXDL 2CROA 2LYJA 3OQNA 2HCSA 3BS3A 3KJXA 1BDHA 3G0TA 2EBYA 2O38A 3GZDA 4J1XA 1MFQC 3DM5A 4IA8A 1IC8A 2PUCA 1BDIA 2AWIA 2HSGA 3OMTA 1JFTA 4X4EA 3S8QA 1HQ1A 3GUUA 1ZVVA 1Y9QA 3MEJA 3OKZA 3SCHA 4YBAA 3VWSA 2XXQA 4WVLA 3TRBA 4Z58A 1UXDA 1ZPQA 2B5AA 3LQXA 1QPZA 2FJRA 3F6WA 3O9XA 4Z5DA 3HZIB 2HCNA 2BNOA 4EZIA 4Z59A 1ZAYA 3GZDC 1ZZ9A 2ICTA 2AXUA 1ZZCA 3OP9A 3UFDA 3NROA 4I8TA 1ZZ8A 2IVQA 1OSLA 1R63A 2PUAA 3U3WA 2PIJA 2PUBA 3EUSA 1ADRA 2PE5A 3QYXA 3ZKCA 1QB2A 4PU8A 5GAHi 2BNNA 1DW9A 2L49A 2AXVA 1O4XA 1POUA 2VEOA 2XIUA 2HINA 4X4DA 2ICPA 2IU7A 1JWLA 5K98B 2A6CA 3GN5B 3RZZA 2GZUA 3UWPA 2BJCA 3CECA 3QFIA 5DT2A 2AW6A 1PRUA 2FFHA 2LYSA 3OQOA 2LYKA 4MCTA 4ER0A 2PXVA 2JCGA 3R09A 2XJ3A 4NDWA 2IV1A 3QQ6A 1LLIA 2XXPA 5DSXA 1NW3A 3G5GA 3A9ZA 3ZHMA 4Z5HA 1HF0A 4J1WA 3A9XA 2LYLA 2LCVA 1L1MA 1PRVA 3QF3A 1WETA 2IVBA 2L1PA 5DRTA 2KEJA 2KEKA 3SCFA 4ER7A 3KXAA 2PUGA 4I6RA 4X4CA 2KZ8A 4OB4A 2PUDA 3R1FA 1VPWA 2KEIA 3LFPA 1NERA 1ZZ6A 4GQMA 1E3OC 3L1PA 1LMB3 3ME5A 4X4IA 3D1NI 4YG4A 3NXHA 2HFZA 3QOWA 1ZS4A 2V3CC 3SR4A 2XCJA 4IWRA 2PXEA 4DE9A 2D5VA 1RZRD 1JH9A 2PXUA 4DE8A 1QP4A 4Z5CA 2MXDA 4JCXA 4X4HA 2J7UA 1PERL 3MLFA 1QP0A 3BD1A 3PXPA 4YG1A 3ZPXA 1Y7YA 3VK0A 3FYMA 1WIZA 2AXZA 2PXKA 1LCCA 2O4AA 4YARA 3QOXA 4PU7A 4F8DA 1QZXA 2EF8A 2LYQA 1DWKA 1ZZBA 3GZCA 1B0NA 2WIUB 3TFLA 2PXFA 3NDBB 2IVGA 1CQTA 2ODRD 1RIOA 5DTRA 4X4GA 3TEPA 3B7HA 3SX0A 3GBFA 2OFYA 3FMYA 4JQDA 2PXDA 2WUSR 4I6UA 2PXBA 2BNMA 4PU3C 5DTQA 1XWRA 2KPJA 4MCXA 2PXTA 3GN5A 4EKGA 1NEQA 1JFSA 1WH6A 4I6TA 3KL4A 5A7LA 1RZRA 4ER5A 1CJGA 2LYRA 1EFAA 2JQEA 4Y42A 2GRMA 3JXBC 2PXLA 2L8NA 5GAGi 3CROL 4X4FA 1OCTC 1RZSA 1YSEA 3OWQA 2JVLA 1LCDA 1GT0C 2MEZA 3LISA 3M9LA 2XSDC 2LNMA 3SCGA 4FN3A 2CSFA 4O8BA 2PXPA 1ZZ7A 2H8RA 2MQKA 4YG7B
chains in the Genus database with same CATH topology
2AXZA 1BDIA 3H5TA 2AWIA 2JCGA 3FYAA 1LCCA 2XJ3A 3OQMA 4NDWA 2O4AA 4YARA 2IV1A 3QQ6A 1SQ8A 2HSGA 4PU7A 3OMTA 1JFTA 4X4EA 3S8QA 1LLIA 3KZ3A 4F8DA 1UTXA 3CLCA 3G5GA 1ZVVA 2EF8A 3ZHMA 4X4BA 4Z5HA 1HF0A 1Y9QA 4J1WA 2LYQA 1R69A 1DWKA 4YBAA 2LYLA 3SCHA 1ZZBA 2IUOA 1AU7A 2LCVA 1B0NA 2WIUB 1PRVA 1L1MA 4FBIA 2R63A 3QF3A 2IVGA 1CQTA 2AUWA 1WETA 3TRBA 2IVBA 2KEJA 1RIOA 2O49A 4IVZA 2XI8A 4Z58A 1UXDA 3SCFA 1ZPQA 2KEKA 3KXAA 2PUGA 2B5AA 1QQAA 1QPZA 2FJRA 2PPXA 4X4GA 3F6WA 3O9XA 4I6RA 4X4CA 4JCYA 4Z5DA 2KZ8A 3HZIB 3B7HA 3JXCL 3GBFA 2OFYA 4OB4A 3BDNA 3FMYA 2PUDA 3R1FA 1VPWA 4JQDA 2BNOA 4Z59A 2WUSR 2KEIA 1UXCA 3LFPA 4I6UA 1ZZ9A 1ZAYA 2ICTA 1NERA 2AXUA 1ZZCA 3OP9A 1ZZ6A 4GQMA 3UFDA 1QQBA 2BNMA 1E3OC 3L1PA 4PU3C 1LMB3 1XWRA 4X4IA 2OR1L 4I8TA 1ZZ8A 2IVQA 2KPJA 1ZUGA 4MCXA 4YG4A 3D1NI 1R63A 1OSLA 1QP7A 2PUAA 3U3WA 2PIJA 3GN5A 3IVPA 2PUBA 1WH8A 4PU4C 3EUSA 1NEQA 1X2LA 1ZS4A 1JFSA 2PUFA 2PE5A 1WH6A 2XCJA 1ADRA 2LYPA 4I6TA 3QYXA 3ZKCA 5A7LA 4PU8A 1RZRA 1PNRA 2R1JL 1CJGA 2BNNA 2LYRA 1EFAA 4IWRA 1DW9A 2GRLA 4Y42A 2L49A 1RPEL 1X57A 2GRMA 3QWGA 1PRAA 2AXVA 1O4XA 3F52A 3JXBC 2L8NA 3DNVB 1RZRD 1JH9A 1POUA 2D5VA 2PUEA 3CROL 2XIUA 1QP4A 2HINA 3G7DA 4Z5CA 4X4DA 4X4FA 1OCTC 3F51A 2ICPA 2IU7A 1RZSA 1YSEA 1JWLA 4JCXA 2JVLA 3ZHIA 1LCDA 1LQCA 1S7EA 2EWTA 4X4HA 1GT0C 2MEZA 3LISA 5K98B 2A6CA 1PERL 3GN5B 4GHJA 3MLFA 2XSDC 1QP0A 3BD1A 2CROA 2LYJA 3PXPA 3RZZA 4YG1A 3JXDL 2GZUA 3OQNA 2BJCA 3CECA 1Y7YA 3SCGA 3BS3A 3KJXA 4FN3A 1BDHA 3VK0A 2CSFA 2AW6A 1PRUA 3FYMA 4O8BA 2EBYA 2O38A 1ZZ7A 2LYSA 4J1XA 2H8RA 3OQOA 2MQKA 1WIZA 2LYKA 4IA8A 1IC8A 4YG7B 4MCTA 2PUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXZ A;  1BDI A;  3H5T A;  2AWI A;  2JCG A;  3FYA A;  1LCC A;  2XJ3 A;  3OQM A;  4NDW A;  2O4A A;  4YAR A;  2IV1 A;  3QQ6 A;  1SQ8 A;  2HSG A;  4PU7 A;  3OMT A;  1JFT A;  4X4E A;  3S8Q A;  1LLI A;  3KZ3 A;  4F8D A;  1UTX A;  3CLC A;  3G5G A;  1ZVV A;  2EF8 A;  3ZHM A;  4X4B A;  4Z5H A;  1HF0 A;  1Y9Q A;  4J1W A;  2LYQ A;  1R69 A;  1DWK A;  4YBA A;  2LYL A;  3SCH A;  1ZZB A;  2IUO A;  1AU7 A;  2LCV A;  1B0N A;  2WIU B;  1PRV A;  1L1M A;  4FBI A;  2R63 A;  3QF3 A;  2IVG A;  1CQT A;  2AUW A;  1WET A;  3TRB A;  2IVB A;  2KEJ A;  1RIO A;  2O49 A;  4IVZ A;  2XI8 A;  4Z58 A;  1UXD A;  3SCF A;  1ZPQ A;  2KEK A;  3KXA A;  2PUG A;  2B5A A;  1QQA A;  1QPZ A;  2FJR A;  2PPX A;  4X4G A;  3F6W A;  3O9X A;  4I6R A;  4X4C A;  4JCY A;  4Z5D A;  2KZ8 A;  3HZI B;  3B7H A;  3JXC L;  3GBF A;  2OFY A;  4OB4 A;  3BDN A;  3FMY A;  2PUD A;  3R1F A;  1VPW A;  4JQD A;  2BNO A;  4Z59 A;  2WUS R;  2KEI A;  1UXC A;  3LFP A;  4I6U A;  1ZZ9 A;  1ZAY A;  2ICT A;  1NER A;  2AXU A;  1ZZC A;  3OP9 A;  1ZZ6 A;  4GQM A;  3UFD A;  1QQB A;  2BNM A;  1E3O C;  3L1P A;  4PU3 C;  1LMB 3;  1XWR A;  4X4I A;  2OR1 L;  4I8T A;  1ZZ8 A;  2IVQ A;  2KPJ A;  1ZUG A;  4MCX A;  4YG4 A;  3D1N I;  1R63 A;  1OSL A;  1QP7 A;  2PUA A;  3U3W A;  2PIJ A;  3GN5 A;  3IVP A;  2PUB A;  1WH8 A;  4PU4 C;  3EUS A;  1NEQ A;  1X2L A;  1ZS4 A;  1JFS A;  2PUF A;  2PE5 A;  1WH6 A;  2XCJ A;  1ADR A;  2LYP A;  4I6T A;  3QYX A;  3ZKC A;  5A7L A;  4PU8 A;  1RZR A;  1PNR A;  2R1J L;  1CJG A;  2BNN A;  2LYR A;  1EFA A;  4IWR A;  1DW9 A;  2GRL A;  4Y42 A;  2L49 A;  1RPE L;  1X57 A;  2GRM A;  3QWG A;  1PRA A;  2AXV A;  1O4X A;  3F52 A;  3JXB C;  2L8N A;  3DNV B;  1RZR D;  1JH9 A;  1POU A;  2D5V A;  2PUE A;  3CRO L;  2XIU A;  1QP4 A;  2HIN A;  3G7D A;  4Z5C A;  4X4D A;  4X4F A;  1OCT C;  3F51 A;  2ICP A;  2IU7 A;  1RZS A;  1YSE A;  1JWL A;  4JCX A;  2JVL A;  3ZHI A;  1LCD A;  1LQC A;  1S7E A;  2EWT A;  4X4H A;  1GT0 C;  2MEZ A;  3LIS A;  5K98 B;  2A6C A;  1PER L;  3GN5 B;  4GHJ A;  3MLF A;  2XSD C;  1QP0 A;  3BD1 A;  2CRO A;  2LYJ A;  3PXP A;  3RZZ A;  4YG1 A;  3JXD L;  2GZU A;  3OQN A;  2BJC A;  3CEC A;  1Y7Y A;  3SCG A;  3BS3 A;  3KJX A;  4FN3 A;  1BDH A;  3VK0 A;  2CSF A;  2AW6 A;  1PRU A;  3FYM A;  4O8B A;  2EBY A;  2O38 A;  1ZZ7 A;  2LYS A;  4J1X A;  2H8R A;  3OQO A;  2MQK A;  1WIZ A;  2LYK A;  4IA8 A;  1IC8 A;  4YG7 B;  4MCT A;  2PUC A; 
#chains in the Genus database with same CATH topology
 3H5T A;  3FYA A;  3OQM A;  2LLV A;  1SQ8 A;  3KZ3 A;  3PE5 A;  1UTX A;  3CLC A;  2YBD A;  4X4B A;  5JUW A;  1R69 A;  2IUO A;  1AU7 A;  3TEL A;  2J7W A;  4FBI A;  2R63 A;  2AUW A;  2O49 A;  4IVZ A;  2XI8 A;  2M4H A;  1QQA A;  2PPX A;  4JCY A;  1DUL A;  3JXC L;  3NZL A;  3BDN A;  1UXC A;  3A9Y A;  5DTM A;  1U2Z A;  1QQB A;  2LLW A;  2OR1 L;  1QP7 A;  1ZUG A;  4EQZ A;  3IVP A;  4ER6 A;  1WH8 A;  4PU4 C;  4EKI A;  1X2L A;  2PUF A;  2LYP A;  1PNR A;  2R1J L;  4OBM A;  2GRL A;  4EK9 A;  4HRA A;  1RPE L;  1X57 A;  3QWG A;  2XXA A;  1PRA A;  3F52 A;  4ER3 A;  3DNV B;  2PUE A;  3G7D A;  2PXQ A;  5DRY A;  3F51 A;  4Q2J A;  3ZHI A;  1LQC A;  1S7E A;  2EWT A;  4GHJ A;  3JXD L;  2CRO A;  2LYJ A;  3OQN A;  2HCS A;  3BS3 A;  3KJX A;  1BDH A;  3G0T A;  2EBY A;  2O38 A;  3GZD A;  4J1X A;  1MFQ C;  3DM5 A;  4IA8 A;  1IC8 A;  2PUC A;  1BDI A;  2AWI A;  2HSG A;  3OMT A;  1JFT A;  4X4E A;  3S8Q A;  1HQ1 A;  3GUU A;  1ZVV A;  1Y9Q A;  3MEJ A;  3OKZ A;  3SCH A;  4YBA A;  3VWS A;  2XXQ A;  4WVL A;  3TRB A;  4Z58 A;  1UXD A;  1ZPQ A;  2B5A A;  3LQX A;  1QPZ A;  2FJR A;  3F6W A;  3O9X A;  4Z5D A;  3HZI B;  2HCN A;  2BNO A;  4EZI A;  4Z59 A;  1ZAY A;  3GZD C;  1ZZ9 A;  2ICT A;  2AXU A;  1ZZC A;  3OP9 A;  3UFD A;  3NRO A;  4I8T A;  1ZZ8 A;  2IVQ A;  1OSL A;  1R63 A;  2PUA A;  3U3W A;  2PIJ A;  2PUB A;  3EUS A;  1ADR A;  2PE5 A;  3QYX A;  3ZKC A;  1QB2 A;  4PU8 A;  5GAH i;  2BNN A;  1DW9 A;  2L49 A;  2AXV A;  1O4X A;  1POU A;  2VEO A;  2XIU A;  2HIN A;  4X4D A;  2ICP A;  2IU7 A;  1JWL A;  5K98 B;  2A6C A;  3GN5 B;  3RZZ A;  2GZU A;  3UWP A;  2BJC A;  3CEC A;  3QFI A;  5DT2 A;  2AW6 A;  1PRU A;  2FFH A;  2LYS A;  3OQO A;  2LYK A;  4MCT A;  4ER0 A;  2PXV A;  2JCG A;  3R09 A;  2XJ3 A;  4NDW A;  2IV1 A;  3QQ6 A;  1LLI A;  2XXP A;  5DSX A;  1NW3 A;  3G5G A;  3A9Z A;  3ZHM A;  4Z5H A;  1HF0 A;  4J1W A;  3A9X A;  2LYL A;  2LCV A;  1L1M A;  1PRV A;  3QF3 A;  1WET A;  2IVB A;  2L1P A;  5DRT A;  2KEJ A;  2KEK A;  3SCF A;  4ER7 A;  3KXA A;  2PUG A;  4I6R A;  4X4C A;  2KZ8 A;  4OB4 A;  2PUD A;  3R1F A;  1VPW A;  2KEI A;  3LFP A;  1NER A;  1ZZ6 A;  4GQM A;  1E3O C;  3L1P A;  1LMB 3;  3ME5 A;  4X4I A;  3D1N I;  4YG4 A;  3NXH A;  2HFZ A;  3QOW A;  1ZS4 A;  2V3C C;  3SR4 A;  2XCJ A;  4IWR A;  2PXE A;  4DE9 A;  2D5V A;  1RZR D;  1JH9 A;  2PXU A;  4DE8 A;  1QP4 A;  4Z5C A;  2MXD A;  4JCX A;  4X4H A;  2J7U A;  1PER L;  3MLF A;  1QP0 A;  3BD1 A;  3PXP A;  4YG1 A;  3ZPX A;  1Y7Y A;  3VK0 A;  3FYM A;  1WIZ A;  2AXZ A;  2PXK A;  1LCC A;  2O4A A;  4YAR A;  3QOX A;  4PU7 A;  4F8D A;  1QZX A;  2EF8 A;  2LYQ A;  1DWK A;  1ZZB A;  3GZC A;  1B0N A;  2WIU B;  3TFL A;  2PXF A;  3NDB B;  2IVG A;  1CQT A;  2ODR D;  1RIO A;  5DTR A;  4X4G A;  3TEP A;  3B7H A;  3SX0 A;  3GBF A;  2OFY A;  3FMY A;  4JQD A;  2PXD A;  2WUS R;  4I6U A;  2PXB A;  2BNM A;  4PU3 C;  5DTQ A;  1XWR A;  2KPJ A;  4MCX A;  2PXT A;  3GN5 A;  4EKG A;  1NEQ A;  1JFS A;  1WH6 A;  4I6T A;  3KL4 A;  5A7L A;  1RZR A;  4ER5 A;  1CJG A;  2LYR A;  1EFA A;  2JQE A;  4Y42 A;  2GRM A;  3JXB C;  2PXL A;  2L8N A;  5GAG i;  3CRO L;  4X4F A;  1OCT C;  1RZS A;  1YSE A;  3OWQ A;  2JVL A;  1LCD A;  1GT0 C;  2MEZ A;  3LIS A;  3M9L A;  2XSD C;  2LNM A;  3SCG A;  4FN3 A;  2CSF A;  4O8B A;  2PXP A;  1ZZ7 A;  2H8R A;  2MQK A;  4YG7 B; 
#chains in the Genus database with same CATH homology
 2AXZ A;  1BDI A;  3H5T A;  2AWI A;  2JCG A;  3FYA A;  1LCC A;  2XJ3 A;  3OQM A;  4NDW A;  2O4A A;  4YAR A;  2IV1 A;  3QQ6 A;  1SQ8 A;  2HSG A;  4PU7 A;  3OMT A;  1JFT A;  4X4E A;  3S8Q A;  1LLI A;  3KZ3 A;  4F8D A;  1UTX A;  3CLC A;  3G5G A;  1ZVV A;  2EF8 A;  3ZHM A;  4X4B A;  4Z5H A;  1HF0 A;  1Y9Q A;  4J1W A;  2LYQ A;  1R69 A;  1DWK A;  4YBA A;  2LYL A;  3SCH A;  1ZZB A;  2IUO A;  1AU7 A;  2LCV A;  1B0N A;  2WIU B;  1PRV A;  1L1M A;  4FBI A;  2R63 A;  3QF3 A;  2IVG A;  1CQT A;  2AUW A;  1WET A;  3TRB A;  2IVB A;  2KEJ A;  1RIO A;  2O49 A;  4IVZ A;  2XI8 A;  4Z58 A;  1UXD A;  3SCF A;  1ZPQ A;  2KEK A;  3KXA A;  2PUG A;  2B5A A;  1QQA A;  1QPZ A;  2FJR A;  2PPX A;  4X4G A;  3F6W A;  3O9X A;  4I6R A;  4X4C A;  4JCY A;  4Z5D A;  2KZ8 A;  3HZI B;  3B7H A;  3JXC L;  3GBF A;  2OFY A;  4OB4 A;  3BDN A;  3FMY A;  2PUD A;  3R1F A;  1VPW A;  4JQD A;  2BNO A;  4Z59 A;  2WUS R;  2KEI A;  1UXC A;  3LFP A;  4I6U A;  1ZZ9 A;  1ZAY A;  2ICT A;  1NER A;  2AXU A;  1ZZC A;  3OP9 A;  1ZZ6 A;  4GQM A;  3UFD A;  1QQB A;  2BNM A;  1E3O C;  3L1P A;  4PU3 C;  1LMB 3;  1XWR A;  4X4I A;  2OR1 L;  4I8T A;  1ZZ8 A;  2IVQ A;  2KPJ A;  1ZUG A;  4MCX A;  4YG4 A;  3D1N I;  1R63 A;  1OSL A;  1QP7 A;  2PUA A;  3U3W A;  2PIJ A;  3GN5 A;  3IVP A;  2PUB A;  1WH8 A;  4PU4 C;  3EUS A;  1NEQ A;  1X2L A;  1ZS4 A;  1JFS A;  2PUF A;  2PE5 A;  1WH6 A;  2XCJ A;  1ADR A;  2LYP A;  4I6T A;  3QYX A;  3ZKC A;  5A7L A;  4PU8 A;  1RZR A;  1PNR A;  2R1J L;  1CJG A;  2BNN A;  2LYR A;  1EFA A;  4IWR A;  1DW9 A;  2GRL A;  4Y42 A;  2L49 A;  1RPE L;  1X57 A;  2GRM A;  3QWG A;  1PRA A;  2AXV A;  1O4X A;  3F52 A;  3JXB C;  2L8N A;  3DNV B;  1RZR D;  1JH9 A;  1POU A;  2D5V A;  2PUE A;  3CRO L;  2XIU A;  1QP4 A;  2HIN A;  3G7D A;  4Z5C A;  4X4D A;  4X4F A;  1OCT C;  3F51 A;  2ICP A;  2IU7 A;  1RZS A;  1YSE A;  1JWL A;  4JCX A;  2JVL A;  3ZHI A;  1LCD A;  1LQC A;  1S7E A;  2EWT A;  4X4H A;  1GT0 C;  2MEZ A;  3LIS A;  5K98 B;  2A6C A;  1PER L;  3GN5 B;  4GHJ A;  3MLF A;  2XSD C;  1QP0 A;  3BD1 A;  2CRO A;  2LYJ A;  3PXP A;  3RZZ A;  4YG1 A;  3JXD L;  2GZU A;  3OQN A;  2BJC A;  3CEC A;  1Y7Y A;  3SCG A;  3BS3 A;  3KJX A;  4FN3 A;  1BDH A;  3VK0 A;  2CSF A;  2AW6 A;  1PRU A;  3FYM A;  4O8B A;  2EBY A;  2O38 A;  1ZZ7 A;  2LYS A;  4J1X A;  2H8R A;  3OQO A;  2MQK A;  1WIZ A;  2LYK A;  4IA8 A;  1IC8 A;  4YG7 B;  4MCT A;  2PUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...