2LLWA

Solution structure of the yeast sti1 dp2 domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
QPGTSNETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The architecture of functional modules in the Hsp90 co-chaperone Sti1/Hop.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Heat shock protein STI1
total genus 22
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17830 STI1 STI1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.100 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2llwA00
2LNMA 2LLVA 2LLWA
chains in the Genus database with same CATH superfamily
4EK9A 2KZ8A 4PU8A 2MXDA 4ER0A 2O49A 3NROA 1XWRA 1NEQA 4YG1A 1LMB3 1UXDA 2B5AA 4IWRA 4I8TA 2HCNA 4X4GA 5DT2A 2O38A 3TRBA 1ZAYA 1S7EA 3CLCA 2LYJA 4MCXA 4EZIA 3FYMA 4X4CA 3GN5A 3BS3A 1NERA 2LYSA 3A9XA 3JXCL 1ZUGA 4OBMA 1RZSA 1PNRA 3SX0A 2XXAA 1PRVA 1DW9A 3QYXA 2LLWA 4EKGA 2PUDA 4FBIA 5DTMA 1U2ZA 4X4HA 1RZRA 1L1MA 1WETA 3LQXA 1ZZ8A 2PXEA 3CECA 2GRMA 4JCXA 2ICTA 1QP0A 3OMTA 2VEOA 2O4AA 1ZZCA 3KJXA 3B7HA 2WIUB 4ER3A 2PXUA 4GQMA 3JXDL 1BDHA 3L1PA 2AUWA 3GZDC 2PXBA 3ZHMA 3BD1A 2XJ3A 1QPZA 3IVPA 3KL4A 3QF3A 4EQZA 2PUBA 3DNVB 2L1PA 5GAHi 1QP7A 1POUA 4MCTA 3LFPA 1DWKA 1ZZBA 4IVZA 5DRTA 3QQ6A 5DSXA 1WIZA 2LYLA 4DE9A 2XI8A 2PXPA 2AXVA 4X4EA 3F6WA 4YG4A 4J1WA 2FJRA 2R63A 2KEJA 3PXPA 1X2LA 2IUOA 4F8DA 4DE8A 3F51A 3PE5A 1JWLA 4X4IA 3NDBB 4PU3C 3H5TA 3NXHA 2H8RA 4ER5A 3SR4A 2JCGA 3GZDA 4JCYA 2V3CC 2IV1A 3ZKCA 2ICPA 2J7WA 3KXAA 4YARA 2BNOA 2PXDA 2LLVA 2M4HA 4Y42A 3QOWA 2CROA 2PUFA 1ADRA 2IVQA 3ZHIA 2XXQA 3VK0A 2LYKA 3SCFA 2KEKA 3MEJA 2LYPA 3D1NI 1LCCA 4JQDA 1X57A 2PXVA 1Y9QA 3QWGA 2LNMA 4Z5HA 4FN3A 1WH8A 1AU7A 4ER6A 1ZZ7A 3S8QA 4WVLA 2J7UA 2EF8A 2PXQA 4X4DA 1R69A 2PPXA 4OB4A 2XCJA 3UWPA 2GRLA 1LCDA 1RZRD 3TFLA 4EKIA 1Y7YA 1EFAA 2JQEA 3M9LA 2MQKA 3G5GA 3UFDA 3G0TA 2D5VA 1OCTC 1SQ8A 4Z5DA 3JXBC 3QFIA 5JUWA 3BDNA 4GHJA 1CJGA 3GZCA 1ZS4A 1RPEL 3R1FA 2BJCA 2L49A 1QB2A 1R63A 5GAGi 2MEZA 2BNMA 1GT0C 2FFHA 3OP9A 2BNNA 3TEPA 1NW3A 4IA8A 4PU7A 1IC8A 2JVLA 2R1JL 4Z58A 1LQCA 1BDIA 2KPJA 2PUCA 4I6TA 3HZIB 2PUGA 2LYRA 1ZZ6A 2OFYA 1PRUA 1QZXA 1PERL 1JFTA 2OR1L 4YG7B 1MFQC 3U3WA 2YBDA 4X4FA 2ODRD 1PRAA 2AXZA 1UTXA 3FYAA 3NZLA 1ZVVA 3OWQA 4Z59A 1QQBA 2GZUA 2PXKA 3MLFA 3EUSA 4O8BA 1OSLA 2AW6A 2XIUA 5K98B 3SCGA 1QQAA 1E3OC 5DTRA 3SCHA 4NDWA 1DULA 2XXPA 3OQOA 1CQTA 4I6RA 2HCSA 3TELA 1HF0A 3VWSA 1RIOA 2HSGA 1YSEA 3RZZA 3R09A 4Z5CA 3F52A 4HRAA 4Q2JA 3QOXA 5A7LA 3GN5B 2WUSR 3GUUA 3A9YA 4ER7A 1JH9A 1UXCA 1ZZ9A 3KZ3A 2A6CA 3G7DA 5DTQA 3OQNA 2LCVA 3FMYA 4I6UA 2AWIA 2IU7A 5DRYA 2XSDC 2PUEA 1O4XA 2PXFA 1WH6A 3OKZA 4YBAA 2CSFA 3CROL 2PXTA 3GBFA 1JFSA 1LLIA 2PUAA 3ME5A 2PXLA 1HQ1A 3LISA 2KEIA 2PE5A 2HFZA 3OQMA 2L8NA 1ZPQA 1QP4A 2LYQA 2EWTA 1VPWA 1B0NA 2AXUA 2IVGA 3A9ZA 4J1XA 4PU4C 3DM5A 4X4BA 2IVBA 2HINA 3ZPXA 2PIJA 3O9XA 2EBYA
chains in the Genus database with same CATH topology
4EK9A 4HRAA 4Q2JA 3QOXA 4ER6A 3GUUA 3A9YA 4WVLA 4ER7A 2MXDA 2J7UA 4ER0A 3GZDC 3OKZA 2YBDA 3QFIA 3NROA 3TEPA 5JUWA 1NW3A 3A9XA 2J7WA 5DRTA 5DSXA 5DTRA 2XXQA 2ODRD 3A9ZA 4OBMA 3GZCA 4DE8A 3UWPA 2HCNA 3SX0A 2LLVA 2XXPA 3PE5A 2M4HA 2VEOA 5DT2A 4DE9A 3NZLA 3MEJA 3OWQA 3ME5A 2HCSA 3TFLA 3TELA 4EKIA 3NXHA 3VWSA 4EQZA 2LLWA 5DTQA 4EKGA 3M9LA 2HFZA 3QOWA 2LNMA 3SR4A 4ER3A 4ER5A 3ZPXA 4EZIA 3GZDA 2L1PA 5DTMA 3R09A 1U2ZA 5DRYA 3G0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNM A;  2LLV A;  2LLW A; 
#chains in the Genus database with same CATH topology
 4EK9 A;  2KZ8 A;  4PU8 A;  2MXD A;  4ER0 A;  2O49 A;  3NRO A;  1XWR A;  1NEQ A;  4YG1 A;  1LMB 3;  1UXD A;  2B5A A;  4IWR A;  4I8T A;  2HCN A;  4X4G A;  5DT2 A;  2O38 A;  3TRB A;  1ZAY A;  1S7E A;  3CLC A;  2LYJ A;  4MCX A;  4EZI A;  3FYM A;  4X4C A;  3GN5 A;  3BS3 A;  1NER A;  2LYS A;  3A9X A;  3JXC L;  1ZUG A;  4OBM A;  1RZS A;  1PNR A;  3SX0 A;  2XXA A;  1PRV A;  1DW9 A;  3QYX A;  2LLW A;  4EKG A;  2PUD A;  4FBI A;  5DTM A;  1U2Z A;  4X4H A;  1RZR A;  1L1M A;  1WET A;  3LQX A;  1ZZ8 A;  2PXE A;  3CEC A;  2GRM A;  4JCX A;  2ICT A;  1QP0 A;  3OMT A;  2VEO A;  2O4A A;  1ZZC A;  3KJX A;  3B7H A;  2WIU B;  4ER3 A;  2PXU A;  4GQM A;  3JXD L;  1BDH A;  3L1P A;  2AUW A;  3GZD C;  2PXB A;  3ZHM A;  3BD1 A;  2XJ3 A;  1QPZ A;  3IVP A;  3KL4 A;  3QF3 A;  4EQZ A;  2PUB A;  3DNV B;  2L1P A;  5GAH i;  1QP7 A;  1POU A;  4MCT A;  3LFP A;  1DWK A;  1ZZB A;  4IVZ A;  5DRT A;  3QQ6 A;  5DSX A;  1WIZ A;  2LYL A;  4DE9 A;  2XI8 A;  2PXP A;  2AXV A;  4X4E A;  3F6W A;  4YG4 A;  4J1W A;  2FJR A;  2R63 A;  2KEJ A;  3PXP A;  1X2L A;  2IUO A;  4F8D A;  4DE8 A;  3F51 A;  3PE5 A;  1JWL A;  4X4I A;  3NDB B;  4PU3 C;  3H5T A;  3NXH A;  2H8R A;  4ER5 A;  3SR4 A;  2JCG A;  3GZD A;  4JCY A;  2V3C C;  2IV1 A;  3ZKC A;  2ICP A;  2J7W A;  3KXA A;  4YAR A;  2BNO A;  2PXD A;  2LLV A;  2M4H A;  4Y42 A;  3QOW A;  2CRO A;  2PUF A;  1ADR A;  2IVQ A;  3ZHI A;  2XXQ A;  3VK0 A;  2LYK A;  3SCF A;  2KEK A;  3MEJ A;  2LYP A;  3D1N I;  1LCC A;  4JQD A;  1X57 A;  2PXV A;  1Y9Q A;  3QWG A;  2LNM A;  4Z5H A;  4FN3 A;  1WH8 A;  1AU7 A;  4ER6 A;  1ZZ7 A;  3S8Q A;  4WVL A;  2J7U A;  2EF8 A;  2PXQ A;  4X4D A;  1R69 A;  2PPX A;  4OB4 A;  2XCJ A;  3UWP A;  2GRL A;  1LCD A;  1RZR D;  3TFL A;  4EKI A;  1Y7Y A;  1EFA A;  2JQE A;  3M9L A;  2MQK A;  3G5G A;  3UFD A;  3G0T A;  2D5V A;  1OCT C;  1SQ8 A;  4Z5D A;  3JXB C;  3QFI A;  5JUW A;  3BDN A;  4GHJ A;  1CJG A;  3GZC A;  1ZS4 A;  1RPE L;  3R1F A;  2BJC A;  2L49 A;  1QB2 A;  1R63 A;  5GAG i;  2MEZ A;  2BNM A;  1GT0 C;  2FFH A;  3OP9 A;  2BNN A;  3TEP A;  1NW3 A;  4IA8 A;  4PU7 A;  1IC8 A;  2JVL A;  2R1J L;  4Z58 A;  1LQC A;  1BDI A;  2KPJ A;  2PUC A;  4I6T A;  3HZI B;  2PUG A;  2LYR A;  1ZZ6 A;  2OFY A;  1PRU A;  1QZX A;  1PER L;  1JFT A;  2OR1 L;  4YG7 B;  1MFQ C;  3U3W A;  2YBD A;  4X4F A;  2ODR D;  1PRA A;  2AXZ A;  1UTX A;  3FYA A;  3NZL A;  1ZVV A;  3OWQ A;  4Z59 A;  1QQB A;  2GZU A;  2PXK A;  3MLF A;  3EUS A;  4O8B A;  1OSL A;  2AW6 A;  2XIU A;  5K98 B;  3SCG A;  1QQA A;  1E3O C;  5DTR A;  3SCH A;  4NDW A;  1DUL A;  2XXP A;  3OQO A;  1CQT A;  4I6R A;  2HCS A;  3TEL A;  1HF0 A;  3VWS A;  1RIO A;  2HSG A;  1YSE A;  3RZZ A;  3R09 A;  4Z5C A;  3F52 A;  4HRA A;  4Q2J A;  3QOX A;  5A7L A;  3GN5 B;  2WUS R;  3GUU A;  3A9Y A;  4ER7 A;  1JH9 A;  1UXC A;  1ZZ9 A;  3KZ3 A;  2A6C A;  3G7D A;  5DTQ A;  3OQN A;  2LCV A;  3FMY A;  4I6U A;  2AWI A;  2IU7 A;  5DRY A;  2XSD C;  2PUE A;  1O4X A;  2PXF A;  1WH6 A;  3OKZ A;  4YBA A;  2CSF A;  3CRO L;  2PXT A;  3GBF A;  1JFS A;  1LLI A;  2PUA A;  3ME5 A;  2PXL A;  1HQ1 A;  3LIS A;  2KEI A;  2PE5 A;  2HFZ A;  3OQM A;  2L8N A;  1ZPQ A;  1QP4 A;  2LYQ A;  2EWT A;  1VPW A;  1B0N A;  2AXU A;  2IVG A;  3A9Z A;  4J1X A;  4PU4 C;  3DM5 A;  4X4B A;  2IVB A;  2HIN A;  3ZPX A;  2PIJ A;  3O9X A;  2EBY A; 
#chains in the Genus database with same CATH homology
 4EK9 A;  4HRA A;  4Q2J A;  3QOX A;  4ER6 A;  3GUU A;  3A9Y A;  4WVL A;  4ER7 A;  2MXD A;  2J7U A;  4ER0 A;  3GZD C;  3OKZ A;  2YBD A;  3QFI A;  3NRO A;  3TEP A;  5JUW A;  1NW3 A;  3A9X A;  2J7W A;  5DRT A;  5DSX A;  5DTR A;  2XXQ A;  2ODR D;  3A9Z A;  4OBM A;  3GZC A;  4DE8 A;  3UWP A;  2HCN A;  3SX0 A;  2LLV A;  2XXP A;  3PE5 A;  2M4H A;  2VEO A;  5DT2 A;  4DE9 A;  3NZL A;  3MEJ A;  3OWQ A;  3ME5 A;  2HCS A;  3TFL A;  3TEL A;  4EKI A;  3NXH A;  3VWS A;  4EQZ A;  2LLW A;  5DTQ A;  4EKG A;  3M9L A;  2HFZ A;  3QOW A;  2LNM A;  3SR4 A;  4ER3 A;  4ER5 A;  3ZPX A;  4EZI A;  3GZD A;  2L1P A;  5DTM A;  3R09 A;  1U2Z A;  5DRY A;  3G0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...