5DTRA

Crystal structure of dot1l in complex with inhibitor cpd5 [n-(2,6-dichlorophenyl)-4-methoxy-n-methylquinolin-6-amine]
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
319
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 319
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtrA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtrA02
5CVUA 1SUIA 4MHTA 5C1IA 2ZBRA 2O05A 1M6EX 2AOUA 5EIFA 2NP7A 3TMAA 3MGGA 3EVZA 4F86A 3PS9A 4FR0A 4RVGA 4M37A 3OFKA 5EEHA 3FUVA 1O54A 2IP2A 3K0BA 3GRZA 3DMGA 3P9IA 1T43A 1NW7A 4IKPA 3T7RA 3UJAA 3UZUA 3I58A 4C4AA 1JG1A 5E1DA 1P91A 2VDWA 4KW7A 3HVJA 2ZULA 3MCZA 4HGZA 3AXSA 5GP1A 3GXOA 1FPQA 1JR4A 3MTEA 2ZLBA 1RI1A 3RIEA 2AR0A 4KRGA 1VP9A 4PGHA 3OFJA 4X63A 3G88A 2PKWA 1XTPA 2GA9A 2P3LA 3SMQA 4BLUA 2KW5A 2JH8A 3G2MA 4YUXA 1JQEA 3G7UA 1BKYA 3KQTA 5K0FA 5IH3A 1BC5A 4PYIA 4G56A 4KDCA 3HEMA 5F2NA 3TM4A 4E2ZA 5DXJA 3EVFA 4PGGA 4F85A 1UFKA 2PX4A 5DRYA 3MHTA 1X1BA 1KYZA 2PSSA 2JG3A 3IYLW 4MTLA 1F38A 3SX0A 5CVVA 1RI4A 2NXEA 3PB3A 1EAMA 5EC8A 1FP1D 4KIGA 3UA4A 1XXLA 3VC1A 4YUWA 3SSNA 4P7JA 1X19A 1U2ZA 3C6MA 3DLCA 3ELDA 3DXYA 1P39A 4LWOA 3CVOA 5C9ZA 2P41A 3BUSA 4PWYA 3HCBA 4CTJA 1DL5A 3OZSA 2WK1A 5DLYA 5LQAA 2QY6A 2AOXA 3KPYA 2OY0A 2IBTA 4FS8A 3SGLA 4RTMA 4RSRA 4EVIA 2Z6AA 3KR9A 4AUKA 4LG1A 3P71T 3A4TA 4P7GA 3OU2A 3O4FA 1JG3A 4RWZA 4X1OA 2H00A 3ER8A 3FTCA 2B9EA 2OPBA 1NE2A 4YUVA 2PY6A 2FRXA 4U7TB 2OBFA 5EOVA 3REOA 3JWHA 3NJRA 2EFJA 2WA1A 3DULA 3HP7A 3KQYA 4QPNA 2UZ4A 5DTQA 1RI2A 4P58A 3LCUA 2AOVA 2FHPA 4XCXA 1NV8A 1QZZA 2AOTB 3O31A 1KXZA 2I6GA 4CKEA 5FWDA 4QPPA 3GRUA 3FPGA 3OU7A 5LQCA 3DP7A 1F3LA 4DZRA 1VQ1A 2OO3A 3BWYA 3UJBA 4FP9A 2IBSA 4C05A 3QV2A 4C06A 4HG2A 2AOUB 5DTRA 3B7PA 3CJQA 3G8AA 3EGVA 5FUBA 1RJGA 2IIPA 4KWCA 5HEKA 2FYTA 3M4XA 3TPZA 3GNLA 3EMBA 2P1DA 2NYUA 2FK7A 4CKBA 3L8DA 2G8NA 4IV0A 3HCDA 2JHAA 5DX1A 2H1RA 4LECA 4XUEA 2R3SA 3LGAA 5E8JA 1DCTA 2ZZNA 1IXKA 2P7IA 2AS0A 5MHTA 1NW5A 2AN3A 5DX0A 4AZVA 2YQZA 3NTVA 3M6XA 5CUQA 5FULA 5GWXA 2ZSUA 1X1AA 2Y1XA 2IH4A 3KR2A 3E23A 5KYGA 4IV8A 3HM2A 5F2OA 1TPYA 1VE3A 2B3TA 2O06A 5DSXA 4MWZA 2N47A 1L3BA 4DQ0A 9MHTA 1TW3A 3AY0A 4CWAA 1BHJA 3A27A 3I9FA 5GM1A 4HTFA 1JTFA 3HNRA 4RX1A 3THSA 1YFLA 4RTPA 3ERCA 1L3CA 1Z3CA 3EVGA 1WZNA 3GRYA 3R24A 3KQPA 2GB4A 2BZGA 3HVKA 5BXYA 3DOUA 2ZIEA 2AN4A 2HMYB 3TFWA 1YUBA 1Y8CA 3PX3A 3DXXA 1JSZA 2AOWA 1R18A 2IH2A 2PXCA 3GDHA 3UJ9A 3NVKI 3FZGA 1R6AA 5E1OA 2AOTA 4PYOA 3T7TA 3C3PA 2EJTA 2YR0A 3MB5A 3PVCA 2ZWVA 4LWPA 3FPHA 2PT9A 3LDUA 1I4WA 4Y30A 10MHA 3G2PA 4RTNA 4U7PB 1KYWA 1P1CA 2WA2A 4RVHA 2QE6A 2YXLA 1SG9A 2YXDA 3GRVA 3LCVB 4A6DA 3LCCA 3EMDA 4RTSA 1XDUA 3P9KA 2VP3A 1WXWA 4YV2A 4GOMD 4OQDA 3AJDA 1TW2A 3KQWA 1ORHA 3HA3A 4GBED 5EZQA 1WXXA 1XDSA 5B1SA 4C04A 4P7KA 1JQ3A 2Q41A 2ZW9A 3IV6A 4DF3A 3B5IA 2GLUA 5E2BA 4R6XA 4E32A 3BWMA 4AX8A 5K0CA 5EZSA 3OPNA 3PLAE 3M70A 2IPXA 3LHDA 1QYRA 3BT7A 3KR0A 5HFJA 3SVZA 1KPHA 5BW5A 1OR8A 2VS1A 3FYDA 5FA8A 5FA5A 2ZZMA 5EG5A 2PLWA 1EIZA 2FCAA 2PX8A 5EHIA 3T0IA 3GWZA 5HILA 5EKXA 5KS2A 4MQ4A 3FUUA 1AQJA 1G8AA 1L1EA 2ERCA 3IEIA 2VDUE 3ID6C 4JXJA 5LQRA 1NW6A 4DCGA 2PX5A 1RJFA 3E8SA 1KHHA 1YF3A 3JWGA 4EKGA 3SSMA 1FJXA 3R6TA 3G2OA 1Q0SA 5E2AA 4GUAA 4OA5A 5CIYA 2OKCA 3DLIA 5KQRA 3KQOA 5D1NA 3KPUA 3KR1A 5ICGA 2ORED 3PX2A 4YV1A 2ZVJA 4OBWA 1L3IA 5E1BA 1KP9A 1I1NA 3EEYA 2CL5A 2E5WA 4ER0A 3NMUF 1KR5A 4KVZA 1RI3A 7MHTA 5D1HA 3V8VA 3UJDA 3FPFA 1RJEA 4AZTA 1NBIA 2ZIGA 2ZBPA 3LBFA 3GJYA 1EQAA 3MQ2A 1O9GA 1QAOA 3P9CA 2IDJA 4Z2YA 1HMYA 3LBYA 3RODA 4FSDA 5ICCA 2XYRA 1R00A 2XVMA 5FWAA 5F2KA 3WSTA 4E2WA 3R9XB 2YUIA 2R6ZA 1SQFA 5K03A 4RTRA 4HTFB 4PIPA 3UA3A 1VLMA 4R8SA 1M6YA 5EIWA 3E7PA 1N7JA 4E33A 1JG4A 2FPOA 5H02A 4ZTBA 5K0EA 1XDZA 3BKXA 3Q7EA 4PNEA 1QANA 3EVBA 4ATNA 4ER7A 1XCJA 2O07A 3H2BA 3OCJA 5GOZA 1YFJA 5BW4A 4QQNA 2O0LA 1QAQA 3PT9A 4HSGA 3UJCA 4YMGA 3A25A 1NW3A 4RVDA 4H0NA 2BH2A 2YVLA 3ANXA 3HCFA 1N2XA 2PXAA 3CGGA 4GOND 3Q87B 3S68A 3P2KA 4F84A 4XUDA 3HCAA 3FTDA 5E9QA 4C03A 1ZKDA 1G8SA 5K01A 2CMHA 1ZGJA 2UYQA 3CJRA 3M6WA 5GIOE 1BOOA 2ESRA 1AQIA 2K4MA 2JHCA 3FRIA 2Y1WA 3EGIA 3OU6A 3SSOA 2AN5A 4EQZA 4E30A 5DXAA 3LKDA 3CCFA 4RTJA 2C7PA 3DH0A 2B25A 2DULA 1KIAA 2VDVE 1G38A 1VBFA 1EJ6A 4GC9A 5LR6A 2ZCJA 1IY9A 1Q0TA 4DA4A 3OE5A 5E9WA 4RVFA 4KDRA 3FTEA 2QM3A 3EVAA 1SKMA 4WVLA 4P7FA 2YTZA 4DCMA 3EVEA 4B17A 1P1BA 3A7DA 3MAGA 2IDKA 5CM2Z 5ICFA 3R3HA 2PV0A 3BZBA 4E2YA 4ER5A 2QRVA 4QDJA 2I9KA 2GS9A 3A26A 3NWEA 3ELUA 3LX6A 4RV9A 3FPJA 5DM2A 3G2QA 2H11A 3C6KA 3OZTA 3D2LA 2ZBQA 3CKKA 1AF7A 3LL7A 5JUWA 2P3OA 3UFBA 4PCAA 3KPVA 4PIMA 3KKZA 4FT4A 5LQKA 5E1MA 2QYOA 2P3QA 1UIRA 4HRAA 2IGTA 3GIWA 5T67A 3SXJA 1ZHFA 4NECA 4M36A 4PYLA 4EKIA 4QVKA 1DUSA 5FHRA 5HIMA 4IWNA 3NDIA 2DPMA 3GRRA 1JG2A 5HIIA 4CKCA 2G71A 2OB1A 1PJZA 4CTKA 4OX9Y 2UYOA 2OZVA 3DR5A 3EGEA 4HH4A 3B3FA 1JQDA 1YZHA 3KPJA 5K0BA 1V39A 3M6UA 4OA8A 1NBHA 2BR5A 4M7RA 3ELWA 2YX1A 2B2CA 3IHTA 3TKAA 2CKDA 8MHTA 3I64A 3LDGA 4O29A 5E9JA 5E8RA 1M0EA 1G55A 5DRTA 3OZRA 4X60A 2PGXA 1NT2A 5FTWA 4BP1A 1HNNA 4V0RA 3RW9A 4E2XA 3KQSA 1JSXA 4QTTB 5EHGA 4RTQA 3NDJA 1UWVA 4Y2HA 3JWIA 5LQNA 3KHKA 3MTIA 4EMSA 3FTFA 3FPEA 2EG5A 1RJDA 2PVCA 4X61A 3HA5A 1XJ5A 4ISCA 4PYNA 5K09A 5C0OE 3NWBA 3G5LA 3B3JA 3JWJA 4PINA 3P97A 3TLJA 2NP6A 1ZQ9A 3MCTA 4FGZA 4PYJA 2ONYA 2PT6A 1MHTA 2I62A 2ZZKA 3PTAA 5GINE 4UOEA 1AV6A 3CBGA 2F8LA 3PFHA 5DM1A 5EQJB 1PRYA 1D2CA 1VL5A 1NKVA 3MERA 3HCEA 3P8ZA 5P8WA 4C07A 1I9GA 3DMHA 4C08A 5ERGB 5EMMA 2OB2A 1INLA 3X0DA 4GC5A 3VYWA 4V0QA 5K05A 1FP2A 1H1DA 3FRHA 3M6VA 4HGYA 4QTUB 5IKMA 1G60A 3ELYA 4PCLA 5DM0A 3B89A 5LQUA 1N7IA 5U4XA 4YMHA 5EEGA 1XVAA 2FK8A 3KQVA 1R8XA 3KQQA 3NW9A 4PYQA 5EPEA 3TR6A 3GGDA 5DM4A 1WY7A 5EMLA 5CD1A 2GAFA 2QRVB 3BKWA 3U81A 2JHPA 3OE4A 3BWCA 4XUCA 3G89A 3CJTA 4EK9A 4YUYA 4RTKA 2P7HA 3GCZA 4GOLD 1D2GA 4WXHA 2G1PA 4R05A 5K0GA 2P40A 2UYCA 2C7OA 5ICEA 2IH5A 4X41A 3I5UA 3F4KA 3HVHA 3R0QA 4RYLA 3UBTA 1X1CA 3HTXA 2BM9A 2PWPA 3EVCA 3GU3A 3QOWA 3LDFA 4R6WA 2UYHA 3PFGA 4GQBA 4BLWA 3P2EA 2EJUA 2XVAA 1G6Q1 5CVEA 2Z6QA 3UJ6A 2CWWA 2GH1A 3FYCA 5FQNA 5BP7A 3SR4A 3ME5A 5K0JA 2PBFA 2NXNA 2A14A 3C0KA 3DMFA 1VP3A 1RI5A 4OQEA 4AZWA 3KU1A 2ADMA 5DTMA 3NVMB 5DPMA 2NXCA 2ZWAA 2XYQA 4BLVA 3T7SA 3CC8A 2IFTA 5KQSA 4A6EA 5CCXA 5CCBA 5EMJA 5K0LA 2AVNA 2I7CA 1IM8A 3FUTA 2PWYA 5HOQA 1X1DA 3HVIA 1ZG3A 3ER9A 2G72A 3BGIA 4GOOD 3G8BA 1KPIA 3UJ8A 3UWPA 2PJDA 3EVDA 2JJQA 5FADA 3BGVA 1JTEA 3G5TA 3BWBA 3ORHA 5FHQA 3TOSA 3UJ7A 2AVDA 3SM3A 5FCDA 5T64A 2JH9A 2XBMA 2AZTA 5JR3A 3AXTA 5GIPE 2ZTHA 4GF5A 2CMGA 5CVDA 1XCLA 1R8YA 1QAMA 2P35A 4ER3A 5HZMA 1SVUA 4PYKA 1L9KA 2ZIFA 4L7VA 3HCCA 5GM2A 3LKZA 3THRA 4DM3A 5DSTA 3TM5A 1EJ0A 3VSEA 2C7RA 4K6MA 5K8VA 2ONZA 2HNKA 4DMGA 3LECA 2HR1A 3TRKA 5CVJA 1ORIA 5G02A 5DT2A 2PXXA 3QOXA 5EKUA 3VC2A 3P9NA 2Z6UA 4QQKA 3AWIA 4HC4A 1O9HA 1EG2A 2HWKA 2PX2A 1B42A 3LSTA 3TKYA 3EPPA 2V74B 2VZ9A 4E70A 2BR4A 4GEKA 1R74A 3KQMA 3M33A 1VIDA 2P8JA 4POOA 1SQGA 3O7WA 3BGDA 5DWQA 3C3YA 5HIKA 3DTNA 3DUWA 4CXMA 3FUXA 5T6BA 4FSXA 2HV9A 4QDKA 4QVGA 2YXEA 3B3GA 1SUSA 3E05A 3FUWA 4YV0A 4BP3A 1D2HA 2BR3A 3K6RA 4FZVA 4PYMA 5EGSA 1WS6A 4R8RA 5DX8A 4FT2A 1WG8A 1YZ3A 4MIKA 1YB2A 2BM8A 5EVJA 3TQSA 3I53A 3P2IA 2O57A 4OBXA 5FQOA 5EMKA 4PONA 4RTLA 3BXOA 3KPWA 5LSAA 1KPGA 1MJFA 3GO4A 3A7EA 4RTOA 1NV9A 4M38A 2XYVA 2OYRA 2GPYA 2B78A 5HIJA 5K0NA 2OXTA 3EEOA 5KVAA 2LD4A 2HTEA 5M5BA 5LQJA 1FBNA 2NNWB 2ZFUA 3DXZA 3LPMA 4KIFA 3V97A 2V7EA 3HA7A 4DKJA 4ER6A 4YUZA 4E31A 2NXJA 4AZSA 1ZGAA 4BY9E 2C7QA 1VPTA 1NW8A 2G70A 2EX4A
chains in the Genus database with same CATH superfamily
3INNA 5FP0A 2QGZA 3KT8A 3RG2A 3TB4A 3W77A 4DDMA 4X4DA 2O05A 4K2HA 1J22A 1R2QA 1YKSA 1UKZA 4FYVA 5TV2A 1PSDA 4FR0A 4NMXB 5D7NA 1U8CB 4X1KA 5EEHA 5FNZA 4BTLA 4FBMA 1M2VB 1Q0PA 4LJ6A 1GU0A 4KLNA 4CQJA 4CEIA 3K1ZA 1X1SA 1B2RA 1AB6A 2VJDA 1Z5WA 4C6RA 5L95A 5FWYB 1N1EA 1KZ7B 2Y0DA 4OB8A 1RM3A 4G9BA 4WOBA 4G4IA 1KJWA 2AEFA 2X41A 4ZYUA 2NYRA 5AOAA 2MHCA 3A4NA 4INPA 3M1YA 3FSRA 4AJOA 4BNVA 2ZR7A 4C3OB 2X9NA 1PFUA 3ZW7A 3BB1A 2LYPA 1BC5A 4RD0A 3PK0A 4K9DA 4PYIA 4PSCA 4ZKEA 4DGQA 1H2ZA 5F2NA 2XXAB 2HM7A 2XBLA 4R31A 2V7XA 1TRHA 2W6JA 3NEJA 3UAWA 3S2SA 2JCVA 3H84A 1Z5VA 5JSUA 2GKOA 2V6GA 1Z62A 4E7PA 1V2HE 1E5DA 1K6JA 4X3CA 4IUDS 2BBTA 3FF4A 5E95A 3LBNA 1R4NA 1YS9A 3JV7A 3ZKAA 4YUWA 5AW4A 2ZI4A 1L7RA 4L8YA 1V1RB 4LAFA 5EIEA 3RU7A 2DHDA 1MIHA 4FCTA 1G8YA 2REQB 4DV1B 4UHFA 4A8JC 1D9XA 2JEZA 4KSBA 3HM9A 2PUHA 2AG1A 2ZSEA 5KU1A 3OZVA 4UEOA 3L1UA 5C8DA 2WICA 3IE2A 2Z3WA 4JJAA 5DHAA 5HVNA 4LY9A 5L3VA 1PFKA 1RXVA 1R5NA 1KR2A 2OZLA 5EMNA 3OESA 5A5DA 3FOAA 2A30A 5K0TA 3B1YA 3T7JA 1PU2A 1GQOA 3TDNA 3GG2A 5JMPA 2I3BA 2PX3A 3KVNA 3PHBE 2HTFA 2H4YA 3FCUB 3UANA 1A27A 2JIZD 4B6GA 1XHFA 1TUEA 3C43A 2OQIA 3HCNA 2XB6A 3NM6B 1I2DA 2DH6A 2XI4A 3CKMA 3PP8A 5A5EA 2FAXA 5TPZA 2IT1A 2FSUA 2Q3EA 2X7XA 1CLEA 5DTJA 1JXQA 4RLFA 4IQ8A 2I2CA 3I3OA 4MS1A 3ZK7A 5I3ZA 3S8EA 2BAGA 2MWMA 1QFJA 1ZUNB 4CF3A 3ZI7A 1AGYA 1JR3A 2LPMA 4K81B 3BJIC 4WNCA 3PJRA 2ECFA 2ET6A 5IM4A 4W5RA 1Z36A 3VZPA 3OOYA 5HGXA 2IBSA 1N3BA 1NT4A 1VMAA 1XVLA 2R79A 1E20A 2IA5A 3EGVA 1EDDA 3K9HA 4QDUA 3KJFA 5CB4A 4HYTA 2GBCA 1DKUA 3TTTA 4TRRA 3H9CA 3MYRA 4YRAA 1F4PA 1K4MA 2BP7B 1VM6A 1B26A 1VDZA 2FPSA 1EDBA 2HA7A 5B2ZA 3SQNA 5BORA 5B6JA 2DSTA 4JC8A 1KE2A 3O0TA 2FOLA 4MQMA 3USES 2HIMA 2HU2A 4FFNA 1S9DA 4W99A 5D01A 1G6OA 3RS7A 5CUQA 3O9XA 2OV6A 4EO9A 2UXBB 3F6RA 2CHVA 3IAXA 4MEJA 3TMKA 2P9YA 3BMXA 1Z2PX 3FSGD 1H8HA 4OI4A 4LJRA 3D43A 1Q92A 1Y4AE 2IUSA 1MVOA 2VT7A 3GLTA 3HNOA 4UBLA 2BBWA 4L6AA 3VU9B 2WFLB 3HCWA 2P2DA 2HKIA 2IL1A 5G41A 2G08A 5CT9A 2Z09A 5GM1A 1PJQA 2J3KA 4L8FA 1W5SA 3SZLA 2OAGA 4LDQA 4UAUA 1IJBA 2O7VA 3THSA 3PE6A 2FN7A 2AJLI 4RTPA 4Q93A 2LR0A 5F4ZA 4MQFB 5DWVA 4WZ6A 1Q7BA 2GNPA 2HYDA 3BIFA 1OXKB 3UJHA 1XTBA 5KVQA 4MHOA 4YJFB 2W2QA 4PGAA 3KM0A 1O96B 1YUBA 1U0GA 2I87A 2AOWA 2WYWA 3Q15C 3L7BA 1I2BA 4BAZA 1I7PA 4BRUA 3U61B 2AOTA 5FBHA 4PYOA 4HYQA 4R01A 4UUQA 1E4EB 2EDAA 2EJTA 4A91A 1LDNA 2PS9A 4Q4DA 1ZZ9A 1Q3HA 3GJQA 2XTJA 2W6NA 4G6ZA 3NBFA 3AUYA 4EUHA 1T3GA 1Y6JA 2IRWA 2QE6A 3D6AA 3F9CA 3HO6A 4ZALA 2JH3A 2Q49A 4GBJA 4LGYA 4DZTA 5MDHA 4WACA 4N01A 1O6ZA 1TAUA 3BQMB 4UATA 3KQWA 1SURA 2WFZA 4GUDA 5IWCA 2R4UA 2KLBA 4YCMA 4H1UA 1KQOA 3H1PA 4XR9A 1SUEA 3KTAA 1UPTA 3NRBA 5CVCA 1PLLA 1XAIA 5D51S 1F6WA 5IT5A 1XLTA 2QD1A 1DT5A 4P4SB 1H4TA 3BT7A 1NXQA 3SQLA 4TQUS 1MN6A 2HF7A 4B6PA 5HTKA 4CT5A 2PUJA 1F2DA 1KTIA 3DC7A 3V6MA 4M9CA 4OJKA 5ALPA 3T0IA 4F1KA 1FA9A 1SUFA 5EKXA 1NM5C 3I72A 4URUR 3U80A 3A14A 4B1FA 3ID6C 3LCMA 5LQRA 4B5KA 1OXXK 5DYIA 3LUPA 5IJ0A 4PNHA 2Q7DA 4I46A 1NVWQ 2VRBA 1QK4A 2CDNA 2Q45A 3BFJA 2WB4A 2QRKA 1NW9B 2O4UX 2QLJA 4GMFA 4EFNA 4LF7B 4HWSA 2VZ0A 1I51A 4F91B 1W59A 4MJLA 5HKBA 2FPXA 4L2IB 4G8DA 1KP9A 3NEYA 2BSXA 4O6VA 1BYUA 1FYVA 1PWYE 5COBA 1DINA 3FMYA 2P6OA 2X8JA 5K8UA 4JZYA 5F23A 3VMFA 3ZYCA 2GD0A 2QN6A 3OFVA 3G85A 3RIHA 1EQAA 1QO0D 2CXNA 4YRMA 4O3MA 1Q57A 2OFWA 5LDHA 4YX9A 2OLKA 1U6IA 2H2FA 4PLZA 4ZQIA 4YR9A 4MA0A 3GCXA 4Q1FA 5HKLA 2ID4A 4G0PA 2VWPA 1QC5B 3EAGA 1RYYA 1BMFA 4A0SA 3OLXA 4JP5A 1T5TA 4M0MA 2WM3A 4FWTA 1O94D 5F7XA 1GA1A 4WKCA 3A58B 3LLCA 5DNUA 4WZZA 2KZ8A 1ZMBA 2O3SA 2YJGA 1X14A 3E8MA 5HKOA 3IOEA 4AECA 1OFHA 2E5LB 4D8TA 1P7WA 1KH1A 4XXHA 4ZC8A 4XUDA 5CA1F 5HTOA 5H68A 5B7QA 1H2YA 3E0QA 1EDOA 3L1JA 2WLSA 4XWWA 4UXHA 5HFAA 2ZYVX 1A97A 3P2MA 4XSVA 3KLPX 3MZ0A 1AO0A 2WPDD 3BH6A 4Q3OA 4CLDA 3NKLA 3LQXA 2CJYA 2QWXA 1YUNA 1GUAA 4XWKA 621PA 4K9SA 2YWDA 1OZ0A 1CJUC 2OV1A 3SYLA 1MAWA 2JJ8A 1SCAA 1VBFA 1CS4C 1J8MF 2RB4A 2BJVA 3HBLA 3OZGA 3BD9A 3W7BA 1LPBB 3U0BA 5B1EA 2QLTA 3JQ9C 2XT0A 3SJ7A 1TM5E 4RA9A 1QFMA 1WQ1R 3EA0A 3E82A 1SKMA 2EFHB 4LGCA 2ORVA 1PT9A 1S4MA 4JOCA 4Z1MA 1Y81A 4B17A 3ZHOA 3DMNA 3KCNA 1JPUA 3KHSA 3M6MD 4LDZA 3BZBA 3DQZA 4GVXA 4L0MA 4KGXA 1M3SA 2WG2A 4KXVA 4QDJA 4DMMA 1RHJA 3T06B 3RYFB 4CQMA 1M2OB 2AN1A 3H8SA 3M5PA 4KUHA 2BGTA 4L15A 2W37A 1JAZA 4R4JA 1RWQA 1DJPA 1BO6A 2PZMA 3I1JA 3KEOA 3OZTA 3P94A 3WB9A 5IUNC 5HRUA 3Q1KA 1USKA 3DEKA 2JEYA 2P3OA 1N5IA 3LFUA 1NYLA 3KKZA 4PEVA 4V3BA 2QYOA 3WRYA 3UT0A 2ZSAA 1X3LA 4A26A 1X7YA 5B1YA 2FJUA 2HMTA 4M36A 2NV6A 1DUSA 2KBEA 4P3XA 4YH1A 5HIMA 2WFAA 3VR4D 1H2WA 3FKQA 2R6R1 2OXIA 4OHXA 3SN6A 3VDRA 2Q6IA 4FMCF 3BSWA 2FR0A 3LXMA 2W4QA 1SC6A 4JR1A 1GZ6A 2NYVA 1YACA 1YZHA 1U7DA 3WR5A 3EB9A 3NXKA 2G5CA 4QHTA 3SZ3A 5JMTA 1V1MA 2BR5A 2W6QA 3VDQA 1AMOA 5ALTA 1Y9EA 3MJFA 3UFXA 4H4DA 1DBSA 1UBKS 3DAYA 3D31A 3KVOA 1H2HA 4DTIA 1YS6A 3VUFA 1OLXA 2YASA 4CCYA 4E08A 4V0RA 3A9CA 5TQ2B 3CRZA 2QUAA 4IDDA 3LYHA 4Q1AA 1U7ZA 1UJMA 3AVTA 1PYOA 3E9EA 3LM8A 3F0TA 4GI7A 2XE6A 2R85A 4L8VA 4ISCA 3JQ7B 1YZUA 3ILHA 1UBRS 2AIRA 2B4KA 2FXIA 4TWJA 3UMGA 3VO2A 4UTVA 2I8AA 5HQJA 4QGGA 5K6AC 3S28A 3B3JA 1JDNA 3QTBA 4KE7A 2J45A 1VCMA 1DC5A 2RCNA 3TX2A 4BVGA 3KJHA 1E4VA 4MDYA 3ZIAA 1WLSA 4QWWA 2GGSA 1TT5B 2UVPA 5HW0A 2F8LA 2W58A 3AGQA 4U6QA 2DQKA 4U0KA 4BBAA 2HCJB 3H8JA 1PT7A 5AI9A 1U04A 1U3DA 4F5EA 1MQ8B 4G41A 4J8PA 3RYIB 2REXB 5M3BA 1JS1X 2H08A 3A9YA 4QKQA 1RZVA 3C4VA 4UM9B 1DPFA 4HAWA 5CFNA 4HDMB 4HJRA 1S8AA 2YJNA 4MPJA 1FDOA 4MVJI 2ZUTA 4EW1A 1E2DA 1YCDA 2J9GA 2JCGA 1N7IA 1I2ZA 1L8XA 1G8KA 3AVOA 4Q00A 5DBFA 3QGMA 1WR8A 1ZXBA 2E4XA 1PWZA 1X77A 5H1YA 3BKWA 4DNOA 4PWZA 3G89A 3REQB 3IUSA 3K05A 4MSUA 4EHKA 3THYB 3HMKA 3PFBA 3LWDA 3PJEA 1BG6A 4QATA 2O7RA 2ZRHA 5FAXA 3C5WP 2H4XA 4EYSA 2F1HA 5K3DA 5IWAB 5K0GA 1SM4A 3C3WA 1DO8A 4HLUA 1U0HC 2EKBA 1EFVB 1HDZA 2XTMA 5G2OA 4ZT5A 2A0YA 2WJAA 4AN4A 2L8NA 3ASUA 3GGPA 2J0UB 4GLLA 3TUIC 1HE5A 2Y1KA 4FTWA 2O23A 4BLWA 3INRA 2PU5A 4ZIRB 3TQCA 5AW9A 2LYJA 1EMDA 2ZE5A 3RVLA 4Y2TA 1HT2E 1VJGA 3WMFA 5LYJB 5K0JA 2MEZA 3CNLA 4JX9A 1AHNA 3WGTA 5IKOA 2I71A 4KQFA 3U4DA 3LZDA 4BFSA 3WDMA 4ARZA 4FZJA 4LHYA 4QFDA 3STWA 4XX0A 3T7SA 2QLLA 2WT9A 3DC2A 1L5NA 4NV0A 5LJIA 1P74A 1SBQA 3RFUA 3E6AA 3UXHA 4ZEVA 4EJ2A 3RARA 1X7ZB 4Q3KA 5HS4A 1MA3A 3DE4X 1XZBA 4R5MA 3NBUA 1QHHB 5DDIP 3UJ8A 2GMWA 2V45A 3A31A 1JEQA 1XZLA 2EC5A 1CTQA 2VXBA 2GZUA 3PDCA 1Y5RA 4NFHA 3G5TA 5FADA 3RREA 1DXOA 4AMUA 4ZGBA 5CYPA 2XA1A 3L0ZA 4Q7QA 2AVDA 1IFXA 3AI3A 4HX2A 1U80A 5EIHA 5DNVA 1Y89A 4P53A 6PFKA 1LQCA 4FGWA 4WZBE 4CGZA 4JI4B 4ZXFA 1IQ0A 1QAMA 1E96A 3M2PA 4LXXA 5LYYA 4BYGA 2XW6A 4I14A 1R50A 3ISVA 4PYKA 5LUAA 3A4VA 3M3DA 3FXAA 4UHEA 1VI2A 1UDBA 3K0CA 1RQXA 4US1R 2ZB2A 4WZBB 4ZVTA 1J6UA 3RC9A 5DO9A 3RJMA 3T38A 4QT4A 3EN0A 3K8QA 1T8UA 3UMJA 4BEJA 3FCSB 2RIPA 2IYLD 1OI7A 2PXXA 4M4SA 3BRCA 4C76A 4CN9A 4JBIA 4UBJA 4KO4S 1G20E 3MQFA 3O91A 4OUDA 4XLLA 4DSUA 4B45A 3F9IA 3U7FB 3COJA 2BKVA 1AK1A 2Q3LA 1MOSA 4EG3A 3MT9A 2BR4A 1IUKA 1V8DA 4WK6A 4AJKA 3F7MA 3URMA 1EM6A 1DWQA 1FDTA 3CMMA 1DFIA 1G20B 1ZK0A 3SZGA 5KQGA 1TAHA 3ZU5A 4BLQA 4UHBA 3TBHA 1KIMA 4QBTA 3W5VA 4DLNA 3K9FC 5T6BA 4RSHA 4OL9A 2FW0A 4TYQA 1G3RA 3HZIB 3A2NA 1QZXA 4HXGA 1XZGA 2H1WA 3WIUA 1JFRA 2C7BA 3B3GA 3WFIA 2ATEA 3BAFA 3SKVA 4FZVA 4ZYVA 1AK9A 2I8LA 1VRCA 3NHBA 4MUAA 4R7ZA 2MMGA 3QPBA 3MOIA 1OYYA 5FQOA 3SFVA 4HR7A 3V7UA 2V7WA 2LZ0A 1BEEA 3FHTA 4ZOAA 1JE0A 1RVV1 2QVCA 4MUEA 4ZYYA 3QUAA 4QM6A 1A3CA 3HB9A 8LDHA 1FQKA 4G0XA 5K0NA 4ZVRA 4MAAA 1TM4E 1KE1A 4HQ0A 2ZRQA 1RWNA 1PV4A 2LLVA 3RB8A 3Q10A 4HNVA 4R1UA 1OFGA 2FJRA 1T91A 3C6QA 3MS7A 1ZSVA 3SIXA 1L6IA 2XI8A 3CECA 1YAJA 1Z56C 1S8FA 2X8LA 3CO5A 4HAOA 4LNUA 5G3YA 4B8WA 1ZGAA 3QVJA 3ONNA 3MMSA 4KWHA 1Z7GA 3QM1A 4O2AA 3CH5A 4LYDA 4ESEA 1P7PA 3L40A 2C7QA 2QTAA 1II8A 1R1DA 2HC9A 4BAGA 4D3XA 1QV6A 1AGRA 1PK9A 3RHFA 4OQQA 1V4NA 2BTQB 3W5SA 4OU4A 5KNBA 2WNSA 3IMCA 4WNAB 2XMPA 3QA3E 3CEHA 3DMGA 4S12A 1Z9BA 3G0DA 1V5EA 1Z8NA 3ZUPA 2PKQO 5K98B 3U3OA 4QG7A 5AKEA 2RJOA 5J2UA 1LBSA 1FFWA 1ZJJA 3EDQA 5ALJA 3I62A 3K0FA 2GZAA 3RFCA 1ZRMA 2BEVB 1UEXC 2D0DA 4BCCA 4M0UA 3JATB 3FOZA 2V5AA 1MO6A 1Z4OA 4NZPA 4O2BB 1UK7A 3PPXA 4EHFA 4KDCA 3COSA 4C4TA 1VSTA 4D6PA 5BMVA 2B5AA 1LTQA 1NOIA 4X4IA 1UC5B 2JFFA 5DHUA 4F85A 1V35A 4CCWA 3MCVA 1H3EA 3MHTA 5FL3A 5ED4A 3EXG1 5B7PA 5AJUA 3IYLW 1JH9A 3HN2A 3KLBA 5GPBA 4C9BA 4EWLA 1FP1D 3ZJ5A 3SY8A 2C97A 1C14A 1NPTO 2R1TA 3GVPA 4NYIR 5EJ2A 3VR3A 3V8BA 3PC8A 4R2LA 3AY7A 1YRBA 1TZCA 4DR6B 3BS3A 3D3WA 4PWYA 4KRFA 1BS9A 4TYYA 2FPIB 5FB3A 3OG9A 3L4BC 5B3JC 2GJSA 2V7GA 1FRQA 5BOSA 5JO9A 2O8DB 2FY8A 5KMGA 3MM4A 4JI8B 4UUBA 5AVSA 4DLWA 1FS4A 1W48A 5BVHB 4O1MA 4FS8A 2YHBA 2C88A 3R5TA 2NSJA 4JJ7A 5SICE 1CY2A 3V3KA 1N2ZA 5AVYA 4LTDA 1GPMA 1N92A 4I9UA 4TTPA 3ESCA 2G83A 3DL4A 1M83A 3EMVA 3K9NA 3SWWA 1DUIA 3NJRA 4FN4A 1DG3A 5KCZA 1S2NA 4CL0A 5HM6A 3IMFA 4HDSA 1N2GA 3AF1A 2UZ1A 3SIPA 4KXXA 5LU8A 2DH5A 5TVKA 5FYDA 3ZEIA 3N2ZB 1ESZA 2R96A 3VTFA 5HQ3B 5I8PA 4GNRA 1KP2A 3EIWA 3KDSE 3FGOA 4FDVA 3BB4A 3UM9A 5HPYB 2WU8A 3SM9A 2R2GA 3EIUA 2HRDA 2QROA 3QPVA 3LRPA 2EWWA 4C05A 1SVNA 1F14A 4HEA6 1E64A 4HYEA 3RVQA 1N6KA 2W2PA 3MELA 4GW3A 1PG5A 4GI1A 5D5QA 4DMFA 4N5MA 1R6XA 3PTZA 4GS5A 3IVMA 1K7FB 2XE7A 2Y1FA 3M49A 1UZLA 2H4WA 5AMXA 3VM6A 4AKGA 3GVCA 1QVAA 2D8AA 4MMXB 1T4GA 4LYHA 4O2LA 4P3YA 5EMHA 4A8PA 4NCNA 1TEVA 2HA2A 4PS1A 4W4TA 2PXBA 2GCPA 4LECA 4BJHB 3KXKA 2YJ3A 2X9GA 3KJEA 4GPBA 3VSAA 2MJLA 2FUCA 5BSMA 4HAXA 1NW5A 3R0ZA 1QGED 3E2MA 1U9ZA 2FZ4A 2IZ5A 1SG0A 2R6CA 5FULA 2ZRJA 4ZRMA 5BNWA 3I6QA 3KDAA 4IH1A 1J0CA 1KSHA 4JIGA 1FW6A 4KE6A 2D3WA 2AW5A 1TPYA 1VE3A 3S2EA 4F11A 2OPHA 3FOEC 3UMMA 1CEYA 2GAJA 1DBRA 3TD6A 3KSDO 3DP9A 3DZIA 1HTWA 2XTNA 5KYVA 3FYHA 4BZQA 2P4QA 3CX7A 4GHWA 1R7RA 2WU1A 3C41J 3ZHXA 2MSDB 1EP9A 1Q20A 2DUUA 2Q2WA 2VDOB 4TLDA 2AWNA 3LQQA 4ZCRA 1MXHA 1R4NB 1GZ7A 3I2IA 4Z4QA 5BXYA 2QLNA 2HJSA 3C8DA 4LC9A 2CYAA 5F1PA 3CT4A 3TFWA 4M1MA 4IYJA 4CTNA 3VR2D 5J40A 4ZEMA 3ADDA 2BFDB 1H2XA 1DIGA 1I4LD 2ZR8A 2HRRA 4PFKA 3GDFA 3H8VA 3AR2A 4LZLA 5CG2A 3GDGA 1ILWA 4FNMA 5TMDA 1WUKS 2OZLB 3AFNA 3FPCA 2PZBA 3A1EA 2EV9A 1MABA 3N2GA 4RVHA 1AS0A 2NADA 2LYRA 2DHEA 4A6DA 1G4AE 5LZ8A 5FWXB 1SPBS 2AXNA 4YP6A 1VLVA 1EK5A 4H7PA 1ORHA 3W34A 3U60B 1AZSC 5JNSA 4M98A 3K35A 2FZKA 5DGXA 5FIUA 4DMKA 4B75A 2X1VA 1PR2A 3H2HA 4DBVO 4QOFA 2WUVA 2BVNA 2FSHA 1U4NA 1UZNA 4BGUA 1UBOS 3VOAA 3SVZA 3AR4A 4BO2A 2NO0A 1DFGA 4KWIA 4MVJP 2QTTA 5GTDA 5M29A 1OGYA 1ST2A 4AI6A 4O4JA 3FRJA 2V7QA 1JR6A 2ZYTX 1KK1A 3QPUA 1W4LA 4HEQA 4EMTA 2B7BA 3IEXA 4LE2A 3A1CA 4MR8B 4R81A 3JPWA 4H3VA 3R7NA 1CJMA 4BFYA 4QIHA 4LWQA 4RK1A 2VPIA 4C43A 1ZR2A 3I6YA 4FKBA 3KQOA 1PUJA 2IEBA 3IAM6 5AHXA 2PD3A 4GL2A 4H9GA 3TIIA 4MW9A 1N9ZA 3FVTA 5SY4A 4JC5A 3I9KA 3KK0A 2WIFA 5B3KA 4XVQA 5KJ6A 2W6OA 3H19A 1ZXXA 2KS6A 5IYZF 4H7JA 1EQUA 2OLJA 2WF5A 5HR5A 2CK3D 3LOPA 4QLOA 3J81k 2IUUA 1JU3A 1NZJA 2G9NA 3ILSA 1G8HA 2WIJA 1ZLYA 1USUA 4RMJA 5DT9A 1C3JA 3UWMA 3U4MA 3MK31 2ZDQA 3E84A 3OZAA 3HFGA 3N0VA 2ZJZA 1AUVA 2XXBA 1NC3A 2G5GX 2NU7A 3L7LA 4J0QA 1KQFA 5K03A 1U3GA 4DB4A 4F2PA 2PXEA 1GG9A 5EIWA 1R6VA 2CLDX 2KHZA 3MJEA 2CROA 2VHXA 2ZI6A 4GL4A 3MSXA 4AMGA 4TX1A 1V6SA 4ER7A 2YWBA 1RZUA 3NYIA 2QN7A 5E4YA 5A1TA 4P1ZA 1X9HA 1NW3A 3W2GA 4BMOB 4ZI7B 2WWHA 3B12A 3D4IA 2BH2A 3LQFA 3EGDA 4H31A 4F56A 5EYPB 4GOND 3UAGA 2CLCX 1SHKA 3QEBZ 2PWZA 1ZH8A 4C03A 1U0OC 1ZGJA 3RNOA 3QNWA 4KE9A 3TUJC 4IFEA 4JVMA 2DQ4A 3JQPA 5J2TB 1YIAA 1FB5A 4B80A 4OPMA 4DDUA 3FLMA 4EQZA 4NBWA 4GYKA 5AUOB 4Y6LA 4JYZA 3BPSA 4JL8A 3WMGA 4QRHA 1EH5A 2OZKA 2C99A 2VRCA 1HE4A 4E4TA 4E14A 2GEKA 3ZJYA 2ZCJA 421PA 4DTCA 1JKIA 2FUKA 4WMLA 3ZBPA 5LKRA 1I80A 2ZB8A 4GQIA 1FXSA 3IPCA 4RO0A 1GN8A 1IZ7A 1XCGB 4DWWA 4ECEA 3BXEA 1XELA 3QUQA 4P7FA 5EE9A 2GYWA 4I4LA 5FBWB 3V4LA 2AR9A 3RC8A 1GZDA 4B35A 1RZRA 4ER5A 2QRVA 3HL4A 2K7ZA 5B12A 1T15A 1BKSB 1N5MA 1XYYA 2GERA 3P4YA 5CT6A 3VKUA 2I76A 4OI1A 3F73A 3WLJA 1AKRA 3NM4A 2W8ZA 3BK7A 2JIPA 3HPRA 3S6JA 4QOEA 4YR7A 5BSKA 4BXOB 2K5UA 4DCSA 3LF2A 5JUWA 2ORWA 1DTEA 1T2VA 5HF8A 4NG4A 2Y76A 5IEBA 3S8QA 1HC7A 1NXTA 1RTTA 3QYJA 5DBOA 2IGTA 2G7MC 3I2HA 1GV0A 2NZXA 1PTJC 3BDAA 3QVSA 3UOAB 2NM0A 4KXFB 4EKIA 4PYLA 5HK8A 1EFKA 3MPOA 4IWNA 2QBYA 3BHJA 3NDIA 3WQSB 3NQ41 1L5WA 1H0HA 4P92A 3GEDA 3DR5A 5IDQA 3EGEA 4G5QA 4BV8A 2BV3A 3T9BA 2KLHA 4H2DA 1JZSA 3K7EA 4FC6A 2XXPA 4F3TA 4D98A 1TC1A 2Q0XA 4N0PA 4NAUA 2CCGA 3LGSA 1A4UA 3BGWA 3P5SA 2PUAA 1KKLA 2IX3A 1NG9A 4UPVA 1L9XA 4LZWA 1L4LA 1R6BX 1D2EA 1JHRA 2CXHA 2QD3A 3K1TA 4A0QA 5JJLA 5HJ2A 3K5WA 1PEAA 2YS6A 4HP8A 3QF3A 1O5OA 2C5FA 5EHGA 1P0PA 1NVTA 3H0CA 4OQ4A 1RHRA 3H83A 3GFVA 3H3FA 3KC2A 4QC2A 4UEQA 3E7XA 3OJFA 4ALKA 5AJTA 3JAWB 1C9NA 2XTAA 1AX9A 2P4UA 4IYRA 1E1CA 4X61A 2I3ZA 2ZJ6A 4X4BA 2DFPA 4M60A 2DLNA 4B7XA 3P2YA 3NWBA 1JBKA 3VNSA 1ZM2A 2NU9A 5SY6A 1CP2A 1OI3A 1RMQA 4DUYB 2ONYA 5AVRA 1O94C 1RKQA 4PGFA 5JD4A 1PERL 2X5NA 3NC4A 5JAUA 1SC4A 3I6BA 4DVGA 4EI7A 3UGTA 3W6PA 1RHUA 2ERXA 3V4PB 1C3VA 2DFKB 2Y0BA 1I9GA 1IHDA 1I24A 1KEPA 2VP6A 4PLVA 5JNRA 2JVKA 4Q39A 1WE2A 1FDSA 2H7VA 2O2CA 2X15A 5AYVA 1DJLA 1QHNA 3FMFA 2QTVB 4RA9B 3T3MB 4XWOA 3OD5A 3HFJA 2YIVX 4NBUA 4W6ZA 5JCXA 3K71B 5LIRA 2WWTA 5EGNA 4YDHB 4FK8A 1LCIA 1FOEB 1UOQA 3IHKA 5EEGA 5EPOA 1ORDA 1SA0B 1WPGA 2OORA 4KOEC 4EPVA 2CFTA 4EX7A 1GNRA 1S8NA 1QZUA 5JDIC 3CE9A 1DOZA 2OBLA 2QI9C 3HQ4O 4CMBA 4N48A 4E6EA 3OOHA 1M10A 4TZ6A 2O19A 2HCRA 1C8VB 1KSJA 3JCZA 3RSCA 4CQMB 2AG6A 2C31A 2HJVA 1GPDG 1XMJA 2QPOA 2VAXA 3B60A 2PZLA 1D2GA 4ARAA 4RD1A 3CN7A 3RFXA 4D0NA 4FHCA 2AGVA 3WB0A 3DGFC 3DT8A 4IKEA 4PSDA 4Q05A 4Z99A 4A4DA 5ICEA 1H69A 4DIKA 1CXZA 4DLUA 4XJXA 2P5YA 1USWA 1Z4KA 3PXPA 3I01A 1X7YB 1MX3A 3AKCA 3F1LA 4YQZA 2BFWA 2YJTD 3H65A 4TMZA 4XQ9A 3MAJA 4MR9A 3OEED 1QHEA 3SR4A 3REFA 4NCXA 3DZFA 3FDJA 1N57A 1D1TA 1NBAA 5BN4A 1KI9A 2OR1L 4MLDA 3ZW9A 4B4KA 2BLLA 4GFDA 1V1MB 2AJDA 3FAZA 1X1EA 1YV9A 5DEIA 2Q4DA 1D8TA 5CT5A 5HUHA 2IFTA 1YR7A 2VSXA 3PDJA 2I6QA 5EZYB 5DASA 3FUTA 4CCYB 1TMYA 4S04A 1Z75A 3S7TA 4K26A 1JJIA 3OX4A 4D02A 1QIHA 5WRFA 3ADOA 4EAQA 3K1AA 4OY3A 1ND6A 3TTUA 1RKVA 2XRMA 4YACA 5BUCA 1KY3A 1I3KA 3V1LA 1PWXA 2PSDA 3PNVA 2ZEJA 2VHJA 3EZNA 1HUQA 1YDMA 2M4HA 1T5OA 2FP4A 5CVDA 5LOVA 1HZZA 5ER9A 1XROA 4GBMA 2F3SA 1GSIA 4IDOA 1SVUA 1WPXA 3IO3A 2UVPB 3GHYA 4GT1A 5HE8A 3WMXA 4YAIA 2NXWA 1DS6A 3HCCA 4DV2B 3LKZA 5F78A 1Q7EA 3VTKA 1MAHA 4G0UA 3G9ZA 3MCWA 2JASA 4DDTA 1C3EA 3L7NA 4BE7B 3P9SA 5DT2A 3U7RA 1UBJS 1Q1EA 4Q37A 1AQYA 4C7BA 1L7VC 3FI9A 4HC4A 1M1YE 3EEBA 4FD2A 1B42A 4J03A 3HUTA 3FUCA 3IP5A 2GPNA 4J75A 1LBIA 4KQJA 1N0IA 2C95A 4UHJA 1Z2DA 1POWA 3AZOA 3AR8A 4F4CA 3EBPA 5EQFA 3A2KA 1JB1A 1GQFA 3FDZB 4WOKA 1M1YB 1WCV1 3Q98A 1Y4SA 2ZSFA 4QGFA 4NESA 5EQTA 3SR0A 4UE2A 3Q7QA 1NU6A 1M34A 1CFJA 2P68A 3E4DA 1FTWA 1KEVA 4R2KA 5JQGA 4N82A 2VQ6A 5CNJA 3C87A 2X7HA 4BFCA 1U6KA 1IBLB 2FUNB 1YZVA 4Q82A 3VKWA 3HV0A 4F38A 5K5EA 3JZFA 2EBUA 2TSYB 1WBJB 3U4IA 4EUFA 2D4AA 1WS6A 1XIVA 1WKCA 3FNRA 2HZBA 3KZKA 4L07A 3G2KA 4BMXA 1VCHA 5TLSA 1IDOA 3WJ2A 5IAAA 1D6NA 1BD3A 3NNNA 221PA 3JZAA 2ENUA 3BXOA 1AA6A 2XKBA 3C5VA 2NTEA 1K75A 4LBVA 1G41A 2YCLA 4A0HA 4QUHA 2VCYA 2JD2A 1NF3A 3D6MA 5FFFA 1HRDA 1OU0A 1T2EA 1U7XA 5LQJA 5HXAA 1AKTA 4I99A 3V97A 1D6SA 4MQUA 2WTBA 2QW8A 3VH3A 1YL7A 2WQZA 1E5VA 1Z5UA 1GRNA 4QOHA 3HCOA 4TMYA 2D7DA 4UTOA 1PD0A 2QTLA 3LAWA 2ZRAA 5KNLA 1M6EX 3K96A 1WTCA 3H4MA 3TTXA 1KFBB 1X1TA 4TT3A 3PS9A 1GFZA 2VJCA 1ONBA 3Q1LA 1JEQB 3G2LA 4IDQA 3N9IA 1RAHA 4O4HA 5B4VA 2IP2A 3HU5A 5F5NA 3WOVA 5KOHA 3D0KA 3QJGA 4HL6A 4KW7A 2NT4A 3MCZA 4KK4A 4B2IA 2D1TA 2ZPUA 1T13A 1PZFA 1Z45A 1PK7A 1JR4A 2Q1TA 2YQ5A 2W6IA 4XWGA 4BIMA 3MW8A 1P3Y1 2Q1WA 5GADl 4I8DA 2RGNC 4YROA 4BBZA 4CL8A 3IB3A 2EKPA 2QUZA 3KWLA 4X20A 4YUXA 4ZVLA 3AT1A 4G56A 1E6CA 2N1MA 2VHUA 1C0LA 4B0PA 1N25A 3RADC 1VHTA 5A5FA 5DYNA 3ZE9A 1LRJA 1FXWF 1FVXA 1UFKA 3PQ2A 2VYCA 3VO9A 4OUDB 4E5PA 1KYZA 4OI0A 1FL9A 4Z0PA 2YHIA 3VKHA 2JGAA 1ZINA 2X0NA 3PV0A 3H1AA 3SSNA 1X19A 3AZPA 1IK4A 4GLBA 2VDJA 5KWIA 2N0SA 2GBLC 2VAVA 2VDPB 3AERB 2ZUUA 4K88A 5EWMA 1R0RE 1TYBE 5A2GA 1VE6A 5IF9A 1S96A 2WK1A 3A6KA 4LXIA 2ODBA 2PZAA 1CNMA 4YPVA 4CU2A 5M34A 2FFBA 1M6NA 2FPUA 3O3NB 1C1XA 3ORFA 4KQEA 3GPBA 4PZYA 5AXDA 3TK1A 4CG2A 5DNYB 1JWBB 3OEWA 4WN3A 5JZ9A 4F3YA 2P62A 1BW9B 5DWDA 4Z6KA 4YUVA 1OFUX 3RFFA 2QX8A 3AOEC 5C37A 2VWQA 3PDHA 5I01A 3OT4A 3LL4A 4K87A 1CZHA 1EGVB 4QPNA 3GD7A 1RI2A 4GKJB 1M0WA 4O63O 1BCSA 3AIMA 4RY8A 3HCRA 1YDEA 1XQWA 3O31A 4S3MA 4A36A 1JDVA 3HU1A 1NUAA 4OXKA 4JI3B 2Z30A 4QPPA 3GRUA 4D99A 5CEEA 3Q6MA 2YMPA 2EQBA 4LNUB 4JLMA 1QYVA 1PJTA 3QOYA 1PZGA 4QGAA 5CB6A 2PBRA 3U6KA 4O2AB 5J4KA 3UJBA 1UMBA 1II8B 4JUAA 1CFZA 3E70C 3PF8A 3NIBA 4Q4HA 5DYWA 4Z9YA 2JIRA 1P5ZB 2GK6A 1YIOA 1T3HA 4LDJA 3CWZA 2PJZA 2XAAA 4WKGA 2RH8A 3U5TA 2P9EA 4EY6A 1T26A 3IDSA 2A88A 2FE4A 3UG6A 1V6AA 1ZM4A 1Z5GA 2PVPA 3MGKA 4KH1A 4YLEA 3PUIA 5A1JA 5J2UB 2R3SA 4TMFA 5C4GB 4K2AA 3B1ZA 1G66A 1IY2A 3OZEA 5KSZA 3QW2A 1CUFA 1B1AA 2IITA 1QQ5A 3M6XA 4KACA 4IFTA 1MH1A 1UT5A 3UFXB 2OO5C 3MOGA 3E23A 3OIDA 3T5BA 5BMVB 1BDJA 3K5HA 3WYGA 2HA3A 5DM60 2I99A 2J48A 3DDOA 5GMOA 4ALNA 2BNNA 2R0QC 1M2KA 4I0WB 4IICA 2NYAA 2X0JA 1IOWA 1PVVA 2O1XA 2QNBA 3F7NA 1U3VA 4WK0B 1EUDA 4ENTA 3JTEA 1YFLA 1KY5A 1YMVA 3RVKA 3GVXA 3QQ6A 3G2HA 4L4UA 2ORIA 4Q7JB 2JHGA 4LQCA 4DA0A 1W49A 4OAOA 4Q3CA 4DNQA 3QF4A 1QGUA 4L3WA 2DHCA 2SKDA 4FCWA 1PI3A 1XALA 1JQJC 3ZCVA 1W44A 3ITKA 4UOQA 2CJWB 3SX2A 5JFTA 2L2QA 1CR6A 4Q9LA 4YI3A 5K4GA 4WQMA 3T7TA 5KMGB 4BNGA 3PVCA 4ZO9A 1XCPA 4ILKA 1C8LA 2EKQA 1PVDA 3AJ9A 1UP4A 1PR1A 4AJHA 3N3BC 2XLCA 5KVSA 3TVYA 2YBDA 1PKEA 5JE8A 2JFBA 3Q8MA 3GUCA 3EMDA 3CRRA 3R0VA 3ZNPA 5JQGF 2WU3A 1D3AA 1XDUA 4P0PB 5DLDA 3PWTA 5AKHA 3RU9A 5A5VA 1B93A 1IPEA 3A32A 5B1SA 3K6SA 1A71A 3C6BA 3I2GA 4R2JA 2UZ1B 2PMBA 3LQ2A 4IIHA 3SQOA 1SPXA 3B5IA 3STUA 2ZUEA 4V1CA 4AX8A 4HWOA 1PDVA 4ZJPA 3JQAD 3ZY6A 1W36D 2P2NA 4WOJA 3BK1A 5B55A 5MFPA 3W78A 3TGPA 4DIFA 1SVSA 1YBFA 2BBSA 3DJFA 1H9CA 1KDZA 3AYZB 2GVNA 4KNVA 4EOGA 3UKDA 2PLWA 5B6PA 5KS2A 1AQJA 1D09A 4Z9AA 1FYXA 2FWRA 2MYUA 2PBZA 3BFXA 2HDOA 3ZHCA 2ZGVA 1U2EA 2LIVA 4DCGA 4KYIB 1JXMA 2GAIA 3B53X 3N0TA 1P80A 1RWOA 3O9VA 3VPGA 2NZWA 4UU0A 4DA9A 5IFLA 1QP8A 4DQVA 1Q77A 2ZXEA 4KQ2A 1HE2A 5KQRA 1TCCA 3K2BA 5CXQA 3WIEA 3KZNA 3L92A 3MG9A 1U98A 4TV8A 1T9ZA 5EE3A 2W22A 1DAMA 2VNSA 4FYXA 4LHXA 4RK4A 4YCLA 5LXTA 1JHPA 5KDLA 4CRWB 4ND4A 5FBQB 2RI6A 3HDTA 1RKUA 2W6PA 1XZ8A 5HUQA 2EKDA 1YI1A 2ZBPA 5ARDA 5CB8A 3AR5A 4MWOA 2FWNA 4C5AA 5JIBA 4XD7D 5EE0A 4FBGA 5EUCA 1SEVA 1ZJ5A 3DV9A 4Q02A 4DWVA 1ODIA 1R15A 1IRXA 1MC1A 4L1KA 5JG7A 3MTDA 3K73O 3WWDA 4DC1A 4KO3S 4E2WA 1R27A 2VKTA 4KP7A 3TNJA 3IODA 4RPIA 1EFPB 3SZUA 2DE0X 3CA8A 3ABIA 1UQUA 2VO1A 1N7JA 4G8JA 1WMAA 4GZ5A 1RLMA 1SBCA 4TTSA 1UBMS 2WSSA 3ZZ0A 4II3A 2I7VA 2ZRNA 4ATNA 4N7RA 5IMBA 3GOQA 5JISA 4H18A 2ZSJA 2UUCB 3K32A 3KZ1E 4W7SA 2OBMA 3L0OA 2DYKA 1CIPA 4RVDA 4D8YA 1QV7A 1WBBA 3OSZA 3AVVA 2GXUA 3M5CA 3ANXA 2YJ4A 2QS9A 1I14A 5FV7A 3OT1A 1BA3A 2R1VA 4TN5A 4KAJA 3L1KA 2XCIA 1DV2A 3VPFA 1ZKDA 4BKOA 2V7PA 1MABB 1OVGA 2GXAA 3B6MA 4NY1A 1CEXA 4GRAA 4JBHA 4V2IA 1MDBA 5IF3A 3JYLA 3R23A 2XT6A 1AS2A 2W7TA 4PZDA 1KZ1A 2HQ1A 3SU8A 3L6OO 4WZAA 3B20A 2WJZB 2WQ7A 5JCOA 3VPBA 1Y6ZA 3ZTTA 2JIDA 1NQTA 1W5AA 5LL6P 1H4QA 2CNOA 3SZOA 5L7WA 2OT3B 2DULA 3LY5A 3HVRA 3KEMA 1EFUA 3GZDA 1M76A 3SS7X 4J43A 2PA0A 4IWRA 5CM9C 4ZHSA 4BKMA 2YN2A 4O4LA 4D4IA 5CK4A 1EA7A 4YAKA 2E6KA 3SQMA 4X8OA 3E35A 4JB3A 3FGZA 1LC3A 3KUKA 1IXZA 4M22A 2SHKA 3ETHA 4G1FA 4O4JB 4JVSB 1KSGA 1OAOC 1CJSA 5JSYA 4N41A 1SBIA 2QEQA 2YH2A 4NC9A 5BUQA 1KI3A 1ZVQA 2DUNA 2VJMA 2G6BA 3LH5A 2FZGA 3NWEA 3UMFA 2GZSA 1MQAA 3BXZA 3ZDYB 3AX6A 3QKRA 4ZPXA 4D4HA 1V48A 4Q3EA 3TW4A 4RV9A 5LDDC 3RLFA 1CDEA 3F49S 3UUEA 1WHSA 2OV3A 3D2LA 2JQEA 3PQCA 2SKEA 3C3XA 3WOHA 3VI3B 4LQDA 4FDLA 5HRCA 4KRYA 1SIUA 4P35A 2K87A 1F2TA 5LQKA 4PR3A 1S8OA 2KQUA 4YPOA 3DZDA 3NYQA 1BXKA 2GLXA 1GRQA 1UXOA 2Q1XA 9GPBA 2PJUA 4QVKA 4B3IA 2QZZA 1E3EA 1SBTA 3G0OA 3ONEA 2DQZA 4XD2A 2RMKA 1Y48E 2IEDA 1RWWA 2LTAA 5T3UA 2H2IA 4YBZA 4DARA 2ZUFA 5KPDA 4BFWA 2NU7B 3R4VA 5BYKA 2QLBA 5BVGA 3SBDA 5K0BA 7REQA 4X1YB 4V2UA 1G21A 1CQXA 3IHWA 4DA7A 2JC3A 4J91A 5DBHX 1P3DA 1OAKA 1S7GA 4NU8X 5HF6A 2IEAA 3SVTA 1GDHA 3IBGA 1CF2O 2ADFA 2QMEA 3PNLA 1M75A 5JH7F 4P83A 5HZKA 1DCKA 5JVDA 2BFPA 4FR2A 4TTVA 3FI0A 1Q1BA 4AL4A 2QUKA 4EFMA 4R69A 4YBRA 1D03A 2JFXA 2J6CA 4D46A 2CNLA 2E1PA 3EGDB 5P21A 1G8PA 3P2JA 4PC2A 4RANA 5KTKA 4N39A 3MMPA 1LJUA 1I0LA 2Z2JA 2FR8C 2POCA 3IEUA 1O8CA 4ZK6A 3JTMA 2EEPA 1Y7LA 4ZT4A 1MJNA 3MERA 3P8ZA 3PT5A 4B3CA 1KU6A 2F3PA 5KINB 2YZGA 5LJLA 1AK2A 3LE8A 1SVIA 5JWOA 2ZSIA 4UUPA 4N4AA 4WFQA 3BN3A 4CR6A 1L7BA 2OB2A 5EINA 4CI9A 4ZVUA 4BUCA 3FCOA 2QVGA 4UREA 5IXSA 4CLHA 2GRLA 4K40A 1W1IA 4FW8A 1XD8A 3HB5X 1ICEA 5FI1B 2PLAA 3VX3A 4XWYA 3JW8A 4MWEA 2GNAA 4DR7B 1UK6A 2HY7A 4EIWA 4BNFA 2V98A 1WY7A 3ASVA 5CMLA 5JXGA 4K46A 2QRVB 4NX2A 1ZGGA 4JLDA 1YR6A 3BWCA 2XAUA 1FU8A 3CJTA 5BNTA 1SXJD 1DXQA 1PGPA 1CT9A 1ODSA 1USGA 3LI2A 1QIJA 4EY4A 1OC4A 3E3LA 3ZLBA 5JC1A 2XIJA 3HYTA 4X41A 3CRW1 3I5UA 1SMKA 4DBZA 1NF9A 2ISSD 1J00A 4WIAA 2PGIA 2QBYB 1BN7A 3U9LA 1XQ9A 2WNHA 2GH1A 4AAYA 4F4JA 1GG5A 2Q07A 4IIBA 1X2BA 2Z95A 4BEWA 4PTYA 5KX5F 2ZVPX 4MV5A 3C0KA 3AF2A 5KSPA 1A9TA 1FUIA 2CXPA 2QTFA 2EFEB 1Y3HA 4L9SA 4OQEA 3V3TA 1JJFA 4HNUA 2VQFB 4BLVA 4YRZA 2CYCA 3KTOA 4QVIA 3DE3X 2O1SA 3ZDAA 2YOGA 1NTRA 1C7JA 2A9QA 2I7CA 4U2EA 5TPZD 1L1FA 5C31A 1PHRA 3VZRA 1GG8A 3GC6A 4Y8VA 4LYFA 2FR1A 3ROKA 5FH9A 3A6LA 2DFVA 3MC1A 4TTJA 3KU4A 1U2DA 4E13A 1B6TA 3VKFA 1JR3D 4G5YA 2WU0A 2ZYSA 4Q3LA 3EC7A 3I0MA 1E1CB 3WFJA 2VI5A 1XWWA 3BGVA 1JTEA 4LSGA 2O54A 3UB3A 4FXPA 3N3AC 2BMFA 2B2XA 3NKFA 4N65A 1G5RA 1U3FA 2GK4A 4GMGA 3DBHA 1MQ9A 2AN9A 4MMYB 2CNKA 3AXTA 4DIDA 3D2CA 1PJSA 4JELA 5GIPE 3FBWA 1E3OC 1YOVA 2H06A 4DEXA 5HCIA 1P7YA 5AW0A 2W83A 4KVGA 1ZJ4A 2CLLB 2FVXA 4M0DA 3RKUA 2RK6A 3JD2A 1ZXLA 4Z5XA 4B47A 4A1OA 3ETGA 2CF5A 3IJPA 1HFWA 4UTRA 3I37X 5K8VA 3ZG6A 1NAIA 5JPIA 1CUHA 2C2KA 2JGNA 1UFRA 2MSEB 3ITNA 4UEWA 4ZYLA 4X92A 2F8MA 1BVUA 3LZ6A 3OAAA 3OEYA 4G0ZA 4QJ5A 4QQKA 2BISA 1OT5A 5EQDA 4OVKA 3HJNA 4G4GA 1CQTA 2Q2OA 3AR3A 2C5AA 1H8HD 1E8NA 1KK0A 3M4YA 1N2SA 3B85A 2G3YA 2ZT7A 3IURA 3MBKA 4F8DA 4C0JA 5KO2A 5CW2A 1UPAA 5HCNA 1NXWA 2Q4TA 2RGYA 4HZUA 3G0CA 4U9UA 1AO3A 1E2MA 3G1UA 3QVGB 1IYZA 2Q3BA 4LX8A 4LVUA 3GZCA 2HV9A 4YHBA 1W4CA 1WDWB 1DC3A 2OBNA 1D8AA 1KZ6A 3FUWA 2SBTA 3DVRX 4LJYA 2C5EA 3BCRA 5EGSA 3WNDA 4DYDA 3IR7A 3WICA 1B00A 1OROA 2QJTA 4RVCA 1J56A 1CKEA 2FEKA 3CSSA 3OIWA 3P2IA 2WJHA 4LRQA 3AEYA 3RSOA 4L74A 3T9CA 4ZJYA 4EW2A 3RJ5A 1NRWA 4UARA 3ZQ6A 3DKRA 1NBEA 4B5LA 4MR9B 3HXLA 4IGEA 3TS1A 2PEZA 2B78A 4XQGA 4QZVA 1LRKA 5M5BA 2BDTA 3QFSA 4LQ4A 5BN4B 4CMGA 4AK9A 3AF6A 1K7XB 4OMDA 1NULA 5B4TA 3AFGA 2MINA 1TM2A 3PGMA 2DQYA 1GFWA 2GPTA 5E2IA 2IIQA 4Y0VA 3BL8A 4R2MA 4CPDA 1J2UA 2O9JA 4MHTA 1AZTA 1DQRA 2UDPA 4MK4A 2UU9B 1K97A 2AOUA 2IV7A 2Y27A 4ZCSA 2GDZA 1PR6A 4S1TA 3I9NA 2PIJA 1GGNA 3CZCA 3GVIA 2ZB7A 3HJAA 3U37A 1IWPB 3K1AB 4JLSA 5ALUA 4EG1A 3HBNA 2DEUA 1EFHA 2GN0A 4IOJA 1G7RA 1KAGA 1TL7C 2A5LA 4JL6A 1YMQA 3ITDA 4RPKA 5ESDA 1UM9A 3FB4A 4LA4A 2L19A 2VK2A 5EJMA 3DF9A 2ROQA 2FW7A 4ZCMA 3MTEA 2FP4B 3UB4A 2C7VA 5F1OA 3LT2A 4JAVC 4X1IB 4M0KA 1OOEA 5IXJA 3UAOA 1E0JA 1PT8A 3Q9NA 1L0BA 2JH8A 1NN0A 4DM7A 3G7UA 3I5YA 3DVLA 3NOVA 4RE6A 2Q2VA 3HEMA 1M6HA 3TM4A 2D54A 1EX7A 1E7RA 3A6JA 3H2SA 4YEDA 3Q0EA 1OH8A 1PNQA 3ASYA 4MH0R 4W5QA 2QXUA 2P9QA 4NOJA 2PSSA 3ACDA 1ODJA 3JAKA 1K4YA 1C3XA 2C0CA 3CUYA 3KZOA 5IVPA 1BFUA 3CIOA 4PVDA 5JEEA 4PSKA 1M34E 1T0IA 2AYYA 3D6HA 4RACA 3SAJA 3UF0A 1Y3AA 3HDGA 2YVQA 3JZMA 4G65A 2QNIA 5AHWA 4YP7A 1Y1PA 3SG0A 3LIIA 2PZKA 4DJFC 1JT2A 1XLWA 3Q5DA 4FE7A 5AM1A 1CUWA 1GT6A 2CEAA 1HLGA 2EFDB 1M34B 1V16A 3F74A 3SSAA 4QELA 1BMFD 2Q1SA 4KDFA 5NULA 4CTJA 5JQGB 5L51A 4FZRA 1SC9A 4HEJA 4AO6A 5LLDA 3RRNA 3SFTA 3VSDA 1ZA1A 4MWSA 4MVJH 3WKCA 4N9WA 3WV4A 4B85A 3KR9A 4KO1S 1YKFA 3PNYA 2TMGA 4ASUD 1KYVA 5E7IA 1DWUA 2H29A 2P1ZA 1DAGA 1LDGA 5B36A 1GGMA 1OX4A 4ARSA 2BRUC 2ZKLA 1E92A 4S05A 1J07A 3LX5A 4DCCA 4WE3A 3JWHA 1AQUA 3TG2A 2EFJA 2W90A 1P2DA 4ZVOA 4RULA 3QE2A 4K6FA 3I76A 2J4CA 3UV6A 3D4PA 4JOBA 3FYAA 4ZYTA 1NV8A 3VZQA 2V1UA 1MB4A 5HG0A 2AEJA 5CDUA 3EXEB 3LW7A 3WYBA 3VPXA 3T5CA 3KOXA 1NM5A 1LI4A 1NXSA 2V65A 3M4NA 3PJDA 4KEAA 4NQRA 4BJ6A 1KRHA 3R8CA 4BKPA 3G23A 2AEEA 2VK4A 2I55A 5AJXA 4EB3A 5JFOA 1Z7WA 4OQZA 2I4OA 4QX6A 2BHTA 3SHWA 4KQCA 3SDZA 4B3TB 2ZBGA 1PJ8A 2DUJA 1QCCA 2VT2A 4UHDA 4XWAA 3T35A 2G0NA 4B48A 1OBFO 1KYTA 2IC5A 3FG9A 3HO8A 3UENA 1C2YA 4QAJA 1XEFA 4ZQEA 1P4RA 1RJGA 1A9OA 1GKKA 3IIEA 3IQDB 4O4HB 4E32A 4F2WA 1CVIA 2ZI9A 4GR4A 1R4ZA 2DLDA 4Z1MD 3I05A 2FLWA 3AKYA 1MJ5A 4GO1A 1EVEA 4JX8A 1C8KA 1S01A 4XUEA 4PQGA 2OL4A 4IXTA 5K3FB 3GFPA 1MLDA 4URWR 4WUVA 5CIWA 2PXPA 5BV1A 4GI2A 4CQMD 1HQCA 2JAQA 5DK4A 2AN3A 4IDEA 2ZSUA 3FIJA 3RGGA 2WLTA 1J33A 2TMYA 4GMDA 1J09A 1YO6A 2QT1A 3BRSA 1WMBA 2B99A 1EE1A 2CJFA 3DAPA 1ZCFA 3LPCA 3RPEA 2XRZA 4UPEA 1E6LA 4XJVA 4QPDA 4A5OA 1QE5A 3FR8A 2YHIB 3DOHA 3G1TA 4G9EA 1O0SA 1H3NA 2CDAA 2IYAA 3HUDA 3IJEB 4I1YA 4QICA 2BZGA 5K0ZA 1BVRA 1TK9A 2X6RA 3F5FA 1FFCA 3AF3A 4EM6A 3NASA 3VMMA 1IBRA 4LISA 4RM3A 5EWMB 3WGIA 1T1IA 4JBNA 1NUSA 1A7JA 1Y1RA 5E1OA 4IJQA 3E1KA 1RPEL 2F90A 2P2ZA 3ZCXA 3C3PA 1Y1LA 4URFA 1ISIA 4B81A 4JQCA 3T3IA 2ZU0C 521PA 1RD4A 5JROA 4J1WA 2PKEA 3WA6A 3G0GA 4NJMA 4OEHA 4E09A 2ZIUB 2NZUG 5TJ9A 3GH3A 4E2FA 1Q11A 3WYAA 2D1YA 2WIKA 1UF9A 4YWJA 3CCBA 3F9RA 1JFFB 4W63A 3AVPA 1ZZBA 2QLFA 2YICA 1GAEO 2Q5QA 1WXXA 3JQ9A 5KKAA 4C04A 5JCPA 1FYFA 4MEAA 3N07A 1BCSB 3TW8B 4E12A 1Q0UA 1SIBE 3RYCB 2ILTA 4ZC1A 1IEWA 4YJGA 3ZIAD 1HFEL 1Q0RA 2P6MA 3E03A 3H9BA 3FNEA 5EWJA 1GCIA 1KPHA 3IQFA 4B4VA 3NPAA 4LDAA 3GWZA 5HILA 3TGWA 4C88A 4ZOLF 3Q3GE 4XIGS 4Q4HB 2VDUE 4D44A 1NW6A 4Z4HA 4P08A 4QBHA 2QTWB 3JWGA 1TADA 3CE6A 3OJOA 1BE0A 2QZSA 5C3UA 5FI5A 3EX7C 1TQDA 4U3JA 1WXGA 3WVNA 1CUIA 3A11A 4ABYA 4UAGA 3GLGE 4WXRA 1LK0A 3AHJA 3NMUF 1TGYA 3Q2KA 2XZPA 3ULKA 1CNFA 1P45A 1QH0A 2GESA 2W98A 1DO0A 1YD7A 3QBJA 5AO9A 3ZLVA 3BA1A 3V9AA 4MIOA 3GLGB 3O38A 4IXWA 4EMUA 3T4EA 4EYGA 1U8TA 1XC7A 2J9FA 2MYPA 3GJ8A 3NANA 3ZXXA 8OHMA 3LPLA 2WSMA 3D8TA 1CJKC 4RUKA 5KDDA 3OZUA 3FZEA 2VN8A 3QVXA 1NKSA 3OURA 3U4QA 3TF5A 2HWUA 2BNMA 2LCVA 3DKIA 3T9FA 3SYMA 2FDCA 1EUDB 5BRAA 3AFIA 4DBLC 4CR7A 4GDFA 2FPOA 3QYPA 4UFOA 4PLHA 1SULA 4N6NA 3S27A 3S2FA 1MO4A 4WAUA 5IKPA 1GPJA 4UM8B 1PF7E 1YFJA 2FMTA 2O07A 1QGUB 4QDZA 3SYKA 4AWXA 3QJ5A 4PU8A 1BWRA 1QGZA 3AJEA 4YMGA 4UU1A 4URXR 1OFVA 3H9JA 5K6AA 3TRDA 1XQYA 5EKDA 1U5CA 4IJ6A 4CIAA 1PZMA 4K9QA 1QKJA 3RU2A 2REBA 5THXA 1C1HA 3GQBA 4MGYR 1K9SA 2QRHA 1HX7A 5J1TB 2HUPA 4J7CA 4QE3A 2HINA 2FU5C 1GQQA 3N0XA 4UEKA 4DUGD 4E4YA 3UHPA 2IZOA 3SFZA 3WYNA 3ENQA 1O5TA 2AN5A 2R5WA 4HCJA 3HPQA 1FBTA 3L7MA 3ZUGA 2ZT6A 1H8EA 4DMUB 3K6SB 4NEGA 2O49A 5BO5A 4L16A 2C2ZA 1IN1A 1KIAA 1RPTA 1F8YA 4V1CB 3UIEA 4G4SP 3PJGA 5EJ4A 2WMOB 1F8XA 1KZYC 4AURA 1TIBA 2GYUA 2YIJA 1FUUA 5MN5A 3WQRA 2QM3A 3VBCA 1HZJA 1X38A 5L3ZA 5KTMA 1U5BB 3OFND 4YYZA 2IHTA 3AY3A 3CNEA 3OQNA 3WYDA 2CKMA 3GFOA 4JVOA 3SJAA 5AQ1A 4MVCA 2PZEA 2WV7A 3ENZA 1CVLA 2I9KA 3A26A 1Y6GA 1FSSA 2A0WA 4O1IA 4RU1A 3WLRA 4FFRA 1VZ2A 3LX6A 3WLKX 3PQFA 4QEKA 3ANYB 1W36C 3CH6A 4C0AC 1PYGA 1ENYA 1R0ZA 2CHGA 4U5XA 3DLBA 4U4AA 1QTRA 5KZMB 4RZSA 3JRXA 4IX1A 3PVSA 2VSYA 1EK1A 3QEMA 5F5XA 3UFBA 5TGZA 3X2FA 3QSYA 2J59A 1UZMA 4INZA 3GK3A 1Z37A 1DNPA 1XMPA 2X7JA 3U1BA 1Q1GA 3AIKA 1H9AA 2GEJA 4JT2A 1XJ0A 5A3JA 2ZSHA 5SZIA 2IZ6A 3GN1A 4GHJA 1V7ZA 5EHNA 4BVFA 2WR8A 4CM5A 3CUWA 3N8KA 3CKYA 2FGJA 4UVIA 1TIPA 3CLKA 4LOHA 2HHJA 1Y7YA 4HH4A 1FTSA 5HNKA 4G63A 2I6TA 2Q4RA 2R7LA 2EGUA 4RCZA 2FMFA 3IUEA 1EP2B 1C8BA 5I45A 2X6TA 2VIIA 3DG9A 2YX1A 2B2CA 2BE7A 3HWSA 4CDRA 1EEHA 4XDYA 4DVJA 1W75A 3DZJA 5PNTA 1G55A 5JS7A 2P9FA 1UDCA 3EYAA 1R8JA 1VCOA 4XCQA 1P4HA 2X42A 5GV8A 1JSXA 1DCMA 2ZUDA 1BD4A 4PHGA 3PL1A 4AJNA 5AK0A 1YJBA 3L0BA 1ZH0A 3FTFA 4DZZA 2X5XA 3A1FA 1SIWA 5I5GA 1UMKA 4JBWA 3OT1B 2R1VB 4WZAE 4BX8A 2N1BA 2ATVA 4O02B 1SD1A 4J2TA 1A0OA 2HEIA 3D64A 4MW4A 3A28A 3RTBA 4B4OA 3ZWCA 5KNBD 2V7UA 2KWIA 5CXXA 2GILA 4WZAB 1BHO1 2ZZKA 5JD3A 3PTAA 1B3BA 1DJQA 1FNSA 3AHIA 3G5AA 1FYWA 1E3JA 1HTBA 1TA0A 3PRYA 2HCNA 1CR1A 3H2YA 4NYIQ 2D4HA 3DKPA 2WAYA 1JDBC 2ZJ7A 4ENQA 1XPUA 5ERGB 3NJ4A 2BPOA 3HYCA 1JA0A 3VYWA 3S1SA 4O4LB 3GNTA 3N2NA 4V38A 4N76A 2H5JA 2IOQA 4OFWA 5FLKA 1QWOA 1SQSA 3A3NA 3I4FA 2XCOA 3FTPA 4D9CA 4YMHA 1QQAA 1ANKA 3G0IA 1VL8A 2WTXA 3H2KA 4G0NA 3A1NA 2GAFA 4D9KA 2VJMB 3GN5A 4UD6A 1ZZEA 1WRBA 1DMRA 1KQPA 3K0EA 1QJ4A 4HGPA 4Q24A 4UMDA 5GY7A 1DQSA 2P5TB 4KXNA 2B3DA 1C80A 2Q3MA 4JUIA 3VR3D 1NVBA 1OD6A 1WHSB 4GVLA 2JIMA 1MEJA 1DEAA 1DRVA 1SOMA 5SY9A 1VHJA 2WG0A 4DCOA 3F4LA 4G8BA 4MB6A 4YRLA 3HN6A 1F2TB 3OX1A 1XWFA 4M1OA 4LF4B 5E6RB 4H0CA 3UAXA 2C7GA 1B8OA 4D4JA 3HTXA 3F98A 4HS9A 1Z47A 5ECYA 3EC2A 4M1ZA 3OPXA 4IZOA 3CH4B 4KBYA 3AESA 3PWZA 4ZODA 1O97C 1JLSA 3QOFA 4MOWA 5L6MB 4Z5CA 3UTCA 2X6QA 3ZDCA 2BUCA 1T9CA 1TKBA 1Z17A 1F8FA 5TGDA 3RBXA 1X7XB 2NXNA 2A14A 1EZ4A 4PAMA 3WLNA 2JLXA 4RDIA 1Q2XA 1NLUA 5BVGB 7REQB 1Y8RB 2J3EA 5LZ9A 2XNJA 2ZAYA 2C98A 4B6JA 3DO8A 1GCOA 4BC0A 4X65B 3ZC3A 3ZOKA 1Y7TA 4QXPA 2FSFA 4RENA 5HF9A 4G4JA 4A6EA 1KJJA 2YWEA 5HMLA 3WFZA 2FG6C 3ZDXB 1K0FA 4C7KA 5CAEA 4X93A 2INGX 3NGLA 4GOOD 4HMPA 2PFKA 5AJYA 1Y3BE 2ZANA 2C8LA 3JQBC 4N3GA 2ONKA 1XJWA 3AQ4A 2HAEA 4EJSB 3WY9A 4D6YA 3AUSA 5ADWA 4HS4A 3AIIA 3P27A 3NHSA 2HRBA 1IDN1 2ETXA 2QMOA 2VTKA 2QUBA 4GG1A 1RRMA 2XVXA 2C3MA 2XBMA 3JR7A 5BSHA 1NA5A 1U02A 4KU4A 5CURA 3TNDA 1V96A 1AV7A 1XCLA 3UJ3X 2FDXA 4XSHA 1J39A 4FT4A 5LZ5A 4IH4A 1N6IA 4DLPA 1QG0A 4JJKA 3DB2A 4QU9A 3OY7A 4E1AA 5CLJA 6LDHA 2E89A 1K6IA 3IEPA 2SICE 4ZJZA 2PO5A 4FILA 5KYUA 4F93B 1V8OA 3W3AA 4Q16A 3T1VA 5KI6A 5C51B 1JHYA 5DP2A 1IN4A 4F9EA 3GGOA 3IP9A 3TKYA 2JLZA 2PTGA 2BT4A 5HKKA 2W42A 2PLFA 5AK3A 2JA2A 5EIOA 2VF8A 2WKSA 1XZCA 1T1RA 3B3QA 4PM4A 1H6CA 5K6RA 2C9MA 1PQUA 2CL6X 5ALMA 1MJGA 1RMTA 2C9YA 2YYAA 3FUXA 1HDXA 1APBA 3M0EA 2CVQA 4BWYA 1BEUB 5ES4B 3O75A 5LVAA 1B14A 2JGKA 5CX4A 1SUSA 2V5UA 4CMCA 3B1KA 2BTOA 1K6MA 2D0PB 1Z73A 1FQOA 5FORA 1WG8A 2WMYA 4JR0A 1E9SA 1G1MA 4LF9B 1OWOA 2Y71A 3TX6A 3WSWA 1DG9A 2VHCA 3MSCA 4MMZB 5CP8A 4TQGA 2FQQA 4PVCA 1R9MA 1XCBA 2O8BB 4BO0A 1SXJC 3LUGA 4PFSA 4GICA 2M6KA 1PEYA 3NHZA 2P9HA 4EUNA 2LD4A 3HWWA 2W2MA 3COWA 1T1JA 4UBMA 4EFKA 6REQA 2ZFUA 1GOTA 3DXZA 3EQ2A 4ZK2A 5J4VA 1XWIA 2ZB4A 4G1UC 5FPSA 3H3JA 5EJEA 3FPBA 1XX6A 4Y6SA 4MW1A 1VPTA 5JAIA 2G70A 2I2BA 4K9NA 5EXEA 5CDYA 2Q46A 2MSLA 3D8BA 2OCXA 1ONOA 3LFHA 1WWKA 4I1OA 3SBXA 3T3HA 8ATCA 3IE1A 2RH5A 1EHIA 2GT1A 4F2GA 1MOZA 4CMHA 4Z4IA 2JKZA 3K0BA 3BFPA 3BREA 3D8HA 2V7QD 3EGXB 3UZUA 1F0NA 4URVR 1P91A 1L4HA 4IM7A 4Y2YA 1DZ3A 4JEHA 2XYGA 3DBHB 3QVTA 3GXOA 1FPQA 2HK9A 2R6AA 4ND2A 4HRYA 1OT3A 1I0IA 1W5EA 1WZUA 2XCQA 1DC4A 3SLGA 4PGHA 3QEAZ 3T9DA 2EZ4A 3OIGA 1XTPA 1N3LA 2EVWX 3FF1A 5LKAA 3FA2A 2MSKA 2WOOA 4FZ5A 1ZZ7A 3MLFA 3I61A 1K08A 1TA9A 2CMKA 5TC4A 5K0FA 1F8UA 4WLOA 4C2TA 3Q40A 3CNBA 2C2OA 1NVFA 2RGUA 4LXGA 2F00A 1ORRA 3FCEA 4MKIA 5DXJA 3U3RA 2FZVA 2FEWB 3Q0IA 1CV2A 1HT0A 2QD4A 1OKKD 2R751 1YVEI 2I33A 3NCHA 4GOJA 4YQYA 5A5GA 3EDRA 3HA2A 4BE4A 3TZQA 1XEWY 4MTLA 5FV4A 1CUBA 1RI4A 3BBLA 5LLTA 2M6RA 4A8JB 2C9DA 1RLTA 1YCGA 3EXG2 2L17A 2DKOA 1QF9A 4BLRA 4H59A 1QQ7A 1CY0A 4HZUB 3EXFB 2JCSA 2R8YA 4FW9A 4OGKA 2IU4A 2CVPA 4ZREA 3TIXB 3N59A 4H4CA 4RFSA 4Y7CA 1BDHA 3OZSA 2O8CA 1CK4A 4J0HA 1WXEA 2BH9A 2FPKA 5ESXA 1KDTA 3SIRA 4EP1A 1MFQC 5LDGA 3PQ6A 1MMFB 3NVAA 2I1QA 2W4IA 3QXSA 1G2PA 4LG1A 3AWDA 3DOOA 4NFLA 4P84A 3BMCA 2G04A 3U3MA 1GEGA 4I50F 4CFSA 1ZIDA 3P20A 1ZH4A 4LW8A 3ZIDA 1ZAYA 4U7TB 2XGOA 3GPIA 4RBNA 2BKEA 3L0YA 1BA2A 3JD3A 3Q7SA 2WA1A 4FFVA 3DBRA 4OHOA 4QL3A 1XGKA 1YWGO 1OLSB 5DTQA 1KAQA 1VG1A 1ZCZA 3O2JA 3OM1A 4Q9JA 1UQTA 1KQNA 3TXXA 4A2PA 4U6SA 4DCUA 5JMOA 2JAXA 2ZDHA 5CGQB 1EJBA 3KQKA 2I91A 2JIZA 4EUSA 2MINB 1DIOB 4MKGA 4EY7A 5EJGA 4KFTA 3UKOA 1F3LA 3QELA 4CYMA 2VRCD 3K0SA 1VYHA 5ERXA 2AOUB 3GEPA 2VUHB 1FY2A 2HX1A 2VP9A 2Y4OA 2XPCA 1JEJA 2FOXA 2VUSA 2X2PA 3EZ2A 4E11A 4E5YA 1I1OA 2FYTA 2I3AA 3ZWYA 5L40A 1LGYA 2PXKA 4H7DA 3T99A 1QZTA 1UM9B 2QPAA 2ODWA 2GCNA 5IAKA 5FDFA 1JIIA 4D8VA 2NW6A 2BEUB 1RWKA 4EHAA 1BX1A 2QKYA 5MHTA 1ZJ6A 1ZI8A 1QDLB 1XLTC 2VF2A 3QENA 3L8FA 1GARA 3DL7A 4I5IA 3QLTA 5JSKA 3WLTA 5F33A 4ESHA 5KYGA 4W8HA 1UBGA 1ZUD1 1SXQA 5CH8A 2P9JA 4MV8A 1L4BA 3U4HA 1R5BA 3PLNA 2XDQA 3PGJA 4COOA 2R7MA 1ZNQO 4YLGA 4Z0TA 4F4DA 1YA6A 4Z5DA 1SCQA 4LI3X 3JAKB 4LRUA 4RHTA 4A23A 5JASA 4WBSA 4FIDA 4DLLA 1Y1QA 2E6UX 3HH8A 5I8ZA 1WZNA 1DKQA 2VYVA 1GIAA 5EY5B 2Z2IA 2WZQA 2QVYX 3HVKA 2Q3DA 4TKVA 5ILQA 2ISCA 13PKA 5G53C 4JQOA 2ORYA 1V16B 3QU5A 1IZ0A 4UCQA 1CY4A 3NOXA 4HN4B 4KHPB 2YHSA 3PEYA 3ND9A 1SELA 1D2RA 2P67A 4R9UC 2ZWVA 3NR2A 3FPHA 10MHA 5HS6A 1I4WA 4Q7EA 1PJ3A 3VR5H 1IEVA 4EA8A 1PR4A 1DBIA 2G36A 2P65A 3DBIA 3LNTA 5JAMA 1NR5A 2PGNA 4Q7LA 2JNWA 5IASA 1YTLA 1OX4B 1SG9A 5AW2A 5HJ5A 2HLPA 1RU3A 1N5OX 2D74A 2X5OA 2VP3A 2GLTA 2I34A 3H1GA 2AFIA 3T3OA 3AVQA 4M9RA 5CYOA 3ZWOA 1QIIA 4YG4A 2JPDA 5ADVA 3AB3A 5L53A 4DF3A 3KJNA 4A82A 1GVNB 5HJ7A 4GRIA 2AJ8A