5DTRA

Crystal structure of dot1l in complex with inhibitor cpd5 [n-(2,6-dichlorophenyl)-4-methoxy-n-methylquinolin-6-amine]
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
319
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 105
structure length 319
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtrA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtrA02
3ELWA 4CWAA 1M0EA 3KU1A 1SQGA 5DTMA 1N7IA 3A27A 4GOND 5LQKA 1YFJA 1QAQA 2Z6QA 4PYKA 4OX9Y 3LL7A 1JG1A 3TKAA 4DQ0A 1NW8A 1NE2A 2Y1WA 5FHQA 4YUZA 5E1DA 3LSTA 5FADA 4XUDA 5T64A 1SVUA 2PT9A 5KS2A 3D2LA 1ZKDA 2G1PA 4QTTB 2BR4A 2H1RA 3C0KA 1D2GA 3E7PA 1R8XA 2NP7A 4M38A 4WVLA 1RI5A 2ZVJA 3O7WA 4GC9A 5C1IA 3HVJA 5HOQA 1VBFA 5FHRA 2LD4A 5FTWA 1XDUA 3SGLA 4DF3A 1NW7A 3EPPA 1YZ3A 4EKIA 4GOLD 4PGHA 1DCTA 2B25A 1FPQA 2BM9A 3A26A 2EG5A 1WZNA 4PYOA 3FUTA 2O05A 2OB1A 5MHTA 2UYQA 3C3PA 3DH0A 3P2IA 2PY6A 4QQNA 2XYRA 4AZSA 7MHTA 1TPYA 2BH2A 4GBED 5EKUA 5EMLA 3EGVA 3JWJA 4DM3A 4FSDA 2CMGA 3LDUA 2UYCA 2EJTA 3BWYA 3M6WA 5KQRA 3C6MA 1HMYA 2ZZKA 4EVIA 3AWIA 1TW2A 2V74B 3FPEA 3K0BA 3OFKA 4YMHA 5LQNA 3HEMA 1XVAA 3OU2A 4OBWA 1N7JA 2OBFA 1XCJA 4E2WA 3HVIA 4KIFA 2G70A 3PTAA 3HA5A 3UJ7A 4Y30A 4RYLA 3SXJA 3TOSA 2QRVA 4IWNA 3GRVA 3DP7A 3G5LA 2WA1A 5EOVA 5DSXA 2AOVA 2NXCA 3I58A 3GU3A 4AZTA 4FT2A 3UZUA 5CVDA 2JH9A 1NV9A 3DXZA 5FUBA 3HCAA 2XVAA 3A4TA 5FA8A 5K0GA 3G88A 3DXYA 1RI4A 4IKPA 4YUYA 4CKBA 4DA4A 3MGGA 1Q0TA 1R6AA 5CM2Z 2GH1A 4YUVA 4PCLA 5BW5A 8MHTA 5DRTA 4P7JA 2PX5A 1D2HA 1M6YA 2YVLA 2AOTA 2VP3A 3GRRA 4KW7A 5ICGA 5CIYA 4FR0A 3AXTA 4GOMD 4RVHA 2OXTA 1JQEA 1QAOA 4FZVA 5K01A 5DX1A 4PYLA 4CKCA 4E2XA 1VP9A 3R9XB 3TLJA 1YF3A 4X61A 4KIGA 1X1DA 5DM1A 3IV6A 5M5BA 2O57A 4X60A 2IH4A 4E70A 5EEGA 4C05A 4PONA 2B3TA 4IV8A 5LQJA 1FP1D 3EVBA 3LPMA 1YZHA 2ZBRA 3OU7A 2I62A 5E2AA 3G2OA 4BP1A 3OE5A 3JWIA 1SKMA 3K6RA 3ER8A 4CTKA 5JR3A 1YFLA 3BZBA 1FJXA 1BC5A 2P3LA 4PINA 3UJ6A 3G2MA 3B3JA 4AZWA 2B9EA 2AOUA 4YUXA 1JQ3A 3R3HA 3OE4A 3EVFA 5EMKA 3GRZA 3LDFA 5E1BA 2G71A 2JH8A 2XBMA 1I9GA 3HCCA 1L3IA 2PLWA 4LWOA 1NW6A 2IDKA 3EEOA 1M6EX 4DCMA 2EFJA 2ZULA 3BWCA 1O54A 3HVHA 3A25A 2PXCA 4A6EA 1RJGA 3FUVA 5B1SA 2FK7A 5EVJA 5K0JA 2QY6A 4LWPA 3HCEA 3M4XA 2IDJA 3THRA 3JWGA 2BZGA 3REOA 2P1DA 4ISCA 1L3CA 4C04A 1NT2A 4PYNA 3GNLA 3KPUA 3KQMA 1RJEA 3TKYA 5HIJA 5GIPE 2ERCA 1QANA 1XCLA 3LKZA 2ZTHA 3PS9A 4FT4A 3SSNA 5EG5A 2ZLBA 5T6BA 3KKZA 1WXXA 2XYVA 4HGYA 4GUAA 3LGAA 2QM3A 1R18A 4DMGA 3M70A 2A14A 2GS9A 3NJRA 5D1NA 3LBFA 4BP3A 1AQJA 3UJ9A 2I6GA 1O9GA 4CKEA 1Y8CA 1VLMA 2P3OA 2N47A 1AQIA 4U7PB 5LQCA 3KPVA 1PJZA 4QPPA 3KQOA 4XCXA 4ZTBA 2ZZNA 1DUSA 1RI2A 3HCDA 1X1CA 3FTDA 4LG1A 3MTIA 4GQBA 4BLWA 1ZGJA 4RTMA 1I4WA 3U81A 1IM8A 2JHAA 2FPOA 2AOWA 4ER3A 4BLUA 3GXOA 2IPXA 3P9IA 1KPIA 4E31A 5C0OE 3X0DA 1EG2A 2OZVA 2OYRA 4QTUB 1KYWA 3KR1A 5DPMA 4GC5A 1WS6A 3GRYA 3Q87B 3A7EA 2G8NA 4C06A 3CJQA 4C08A 1N2XA 5E9QA 3EMBA 4NECA 2H00A 3NDJA 3LDGA 3OZTA 2O0LA 5GWXA 2NXNA 5FQNA 4CXMA 1BOOA 5BP7A 1G8AA 3SSMA 2HTEA 2QRVB 4OA8A 5DT2A 1ORIA 4MIKA 3MCZA 1SG9A 2B78A 2UYHA 3FTFA 3HTXA 3NW9A 1G55A 2ZSUA 4K6MA 4E33A 4H0NA 2BR3A 1U2ZA 3V97A 5K0EA 1JTFA 5CCBA 2OPBA 4HGZA 1I1NA 3A7DA 2ZBPA 2BR5A 4HC4A 5DSTA 3AJDA 1KP9A 2YR0A 5DM4A 3M6UA 1NW5A 1TW3A 3ANXA 5KVAA 2ZZMA 2GLUA 4X1OA 3TM5A 2PKWA 4OQEA 1EAMA 2PBFA 3L8DA 4KWCA 2WK1A 1MHTA 1KIAA 3R24A 2E5WA 4QVGA 1SUIA 1O9HA 1WG8A 4WXHA 4JXJA 1G60A 3KQPA 2ZCJA 1NV8A 1EJ0A 2GB4A 3FUUA 1KHHA 5EQJB 5E9WA 3LCUA 3THSA 5K8VA 2PV0A 3BKWA 3LCCA 3UJDA 5CVVA 5GM1A 5EMMA 3DMHA 3IEIA 2ZBQA 2I9KA 2QE6A 5HEKA 2C7OA 3PLAE 4YV0A 2YTZA 3HCBA 2H11A 3QOXA 3BWBA 3PFHA 3MB5A 3T7TA 3JWHA 1XDZA 1P91A 1RI3A 3HCFA 1AV6A 1X1AA 3FUWA 3KHKA 3DULA 4FS8A 3VC2A 4QDJA 5E9JA 5F2NA 5ICCA 1NBHA 3UBTA 1VP3A 2OKCA 1XDSA 3TRKA 2NP6A 1G38A 5LQRA 1Z3CA 5K09A 2PT6A 3CVOA 3CCFA 4Z2YA 3V8VA 3SMQA 2BM8A 3UFBA 3NVMB 5D1HA 4RTQA 1HNNA 1JTEA 3TR6A 5HZMA 3DMFA 4BY9E 2C7PA 2JG3A 4ER0A 3KQTA 5BXYA 4O29A 3TM4A 4AZVA 1VIDA 3FYDA 5LQAA 3HP7A 3CC8A 3GO4A 4R8SA 3DOUA 2IH5A 3GGDA 2FYTA 5K0CA 2Z6UA 3G2PA 2HR1A 4AUKA 4P7KA 3VC1A 1WY7A 1XTPA 2OY0A 3NWEA 5DLYA 3BKXA 1VQ1A 3HNRA 3DR5A 3G2QA 3TMAA 4KRGA 5DTQA 1P1CA 3B5IA 2IFTA 3EVAA 3I5UA 4RVFA 4DKJA 2PSSA 4FGZA 3OZRA 4R6WA 3TFWA 5DTRA 3BGDA 2FK8A 2P41A 2HV9A 3SM3A 3KQYA 3M6VA 1UWVA 5GP1A 1G8SA 1MJFA 2AOXA 1EJ6A 2I7CA 2WA2A 3GJYA 2AVNA 2P40A 5DM0A 3SSOA 2YXDA 3NTVA 5HIKA 3BWMA 5GIOE 4CTJA 1QZZA 2OO3A 5EHIA 2O06A 1T43A 4PCAA 4C07A 3UJCA 2PJDA 5CVJA 5EZSA 4PIPA 3ME5A 3P8ZA 4DZRA 2Z6AA 4GOOD 1BKYA 2NXEA 3PX3A 3P97A 3P9KA 2JHCA 2DPMA 2PX2A 4KVZA 3UJAA 3CGGA 1JG3A 3GDHA 3R0QA 4E30A 3SR4A 4R6XA 3P2KA 1OR8A 3OCJA 3M6XA 2EJUA 2AZTA 3LECA 4UOEA 2C7RA 2Y1XA 3TQSA 3ID6C 4RTNA 4RTPA 1P39A 2ESRA 2HMYB 5LR6A 2PXAA 2QYOA 4E32A 3UWPA 5G02A 3EVGA 1NW3A 4HTFB 5EEHA 3BXOA 1KPHA 2HWKA 5E8JA 2B2CA 2PWPA 5DRYA 1VE3A 4YMGA 5F2OA 2AOUB 4PYQA 3IYLW 4YUWA 3B3FA 4HG2A 4OA5A 4RTLA 2ADMA 2P3QA 1D2CA 3LX6A 4XUCA 1R8YA 1EQAA 4A6DA 3NMUF 4RWZA 2JJQA 1EIZA 2UYOA 2P35A 3FRIA 5EGSA 1JSZA 4M37A 2R6ZA 3EGIA 4Y2HA 5BW4A 3B3GA 4PGGA 1ZG3A 1ZQ9A 2NNWB 2GAFA 3G5TA 10MHA 1F38A 3AXSA 2ONZA 3UA4A 3KQWA 5HFJA 5LQUA 3FRHA 2PX4A 3HA3A 3LHDA 4PYIA 1WXWA 3FYCA 3ELYA 4OBXA 3UJBA 3FPHA 3FTCA 1VPTA 4AX8A 1IY9A 3DLIA 4GEKA 2P7IA 1XXLA 3GCZA 3KR2A 4YV2A 1KYZA 1R74A 3MERA 3O4FA 3PX2A 2ZIGA 5IH3A 3Q7EA 5KQSA 3T0IA 3MHTA 3E8SA 5EZQA 2NYUA 2EX4A 5FULA 3E23A 2K4MA 2VDVE 3ER9A 3LKDA 2F8LA 5T67A 5HILA 3H2BA 3KPYA 5K03A 2Q41A 1SQFA 4LECA 3HM2A 5EIFA 9MHTA 3P9CA 3C3YA 3P2EA 5DX8A 2AN3A 2YXLA 5K0LA 3VSEA 3FPGA 4EKGA 1BHJA 2YUIA 5CD1A 4P7GA 2ZW9A 4EMSA 3DMGA 2CMHA 3UJ8A 3P71T 4XUEA 1QYRA 2P7HA 3KQQA 4F84A 5JUWA 3DXXA 5P8WA 2IBSA 1Q0SA 1NBIA 3I9FA 5E1MA 2YQZA 3G8AA 4V0QA 5EC8A 3B7PA 5EMJA 2AVDA 1RJFA 3FPJA 4HTFA 5FQOA 2O07A 1P1BA 1VL5A 3LCVB 3EVCA 4HRAA 2VZ9A 3R6TA 4FSXA 4MTLA 5GOZA 3HA7A 2PX8A 1ZHFA 4E2YA 4FP9A 2VDUE 2VS1A 5ICEA 3FTEA 3NVKI 5ICFA 2R3SA 4OQDA 3B89A 4HH4A 3KQSA 4X63A 4C03A 3QV2A 4V0RA 1QAMA 3KPJA 2ZWAA 5EPEA 3EEYA 5EIWA 1KXZA 3G89A 3ELDA 3MCTA 5E1OA 4MWZA 2PWYA 1X1BA 5DX0A 4GF5A 4HSGA 1JG4A 4X41A 2IIPA 5FCDA 5K0BA 1INLA 1L1EA 2UZ4A 5DM2A 2IBTA 3DTNA 3KQVA 3OU6A 4R8RA 3PB3A 3BT7A 4ER5A 1PRYA 1RI1A 4ATNA 4ER7A 3BGVA 3OZSA 4M7RA 3KPWA 2FRXA 1JSXA 3I53A 4G56A 4RX1A 5E2BA 2XYQA 3IHTA 1L3BA 3EVDA 3S68A 3T7SA 3OPNA 3GIWA 1KR5A 3LBYA 1XJ5A 4MQ4A 4F85A 1SUSA 2KW5A 5IKMA 3SX0A 1NKVA 4QQKA 2AN5A 2ZWVA 2IP2A 2ZIEA 2DULA 5HIMA 4RTRA 4RVGA 3VYWA 5DXAA 4E2ZA 2PVCA 2NXJA 3FPFA 5K05A 1ORHA 1V39A 2XVMA 2AOTB 3MQ2A 3NWBA 3OFJA 2FHPA 5EHGA 5H02A 5C9ZA 1UIRA 1B42A 5U4XA 1JG2A 3T7RA 2CKDA 3EMDA 4R05A 5DXJA 4C4AA 2P8JA 4YV1A 2OB2A 3M33A 4RTJA 2PGXA 1YUBA 3BGIA 3SVZA 3E05A 3G7UA 2PXXA 4PWYA 2ORED 3I64A 2YX1A 3EVZA 1RJDA 4BLVA 1DL5A 3DUWA 4PYMA 1G6Q1 5DWQA 2JHPA 2GPYA 5ERGB 5GM2A 4POOA 3O31A 5FWAA 3PFGA 3FZGA 3RW9A 1L9KA 5F2KA 5CCXA 3PT9A 3QOWA 3CBGA 4L7VA 2IGTA 1UFKA 1F3LA 2VDWA 3EVEA 4RVDA 4KDRA 2ONYA 3EGEA 3NDIA 2AS0A 1KPGA 3C6KA 5K0NA 5K0FA 3KR0A 1X19A 5KYGA 3DLCA 4RTKA 2CL5A 3TPZA 3FUXA 5CVUA 3KR9A 5HIIA 3MTEA 3CJTA 4QPNA 5GINE 5E8RA 4MHTA 3UA3A 4RTSA 1JQDA 4P58A 2AR0A 1H1DA 2ZFUA 3WSTA 4B17A 5CUQA 4QDKA 2YXEA 3AY0A 1FP2A 3GWZA 3GRUA 4PYJA 3ERCA 3ORHA 5CVEA 4QVKA 2GA9A 4RSRA 3PVCA 2V7EA 5LSAA 3G8BA 2G72A 4KDCA 3MAGA 3ELUA 4RTOA 4EQZA 1JR4A 2ZIFA 1YB2A 3CJRA 4ER6A 1FBNA 2IH2A 4IV0A 2AN4A 4M36A 4P7FA 4PIMA 5FA5A 4PNEA 2CWWA 5EKXA 3RODA 4EK9A 1R00A 3BUSA 3HVKA 4RV9A 3P9NA 1IXKA 4DCGA 1ZGAA 2FCAA 4F86A 3CKKA 1AF7A 2HNKA 5FWDA 4U7TB 3F4KA 3RIEA 2C7QA
chains in the Genus database with same CATH superfamily
3BIXA 4H3VA 3OD1A 1MRSA 1FSFA 4Q48A 3T9EA 3V8RA 4LY6A 3EJ6A 4WY8A 5DCYA 5L40A 2OGZA 3VDQA 5JZSA 4C89A 2NSDA 1QAQA 1WV0A 1YR2A 3UC9A 3S44A 4DM7A 4OX9Y 4PAMA 1CXZA 1NN1A 4RY8A 3SBOA 2HIGA 3ZV3A 1HFJA 4TXHA 1X86B 2DKOA 4RZQA 4E5NA 1L7AA 3C3JA 2KBEA 3PLNA 3LE8A 2CF5A 4XQGA 1MG5A 3CGWA 3JXDL 3QLTA 6GPBA 4DR7B 3NC4A 1YD7A 4S35A 4DJDC 4DXDA 1RACA 2ZU0C 2AKEA 1L5VA 5AKYA 1VYHA 2R85A 4ZT5A 3ZD6A 1XEWY 3LDAA 1NW9B 2C97A 3MG9A 2XNKA 2PSFA 3O7WA 4B8ZA 1AG9A 2KBFA 2J30A 4FC6A 4PO3X 3FOBA 3LM8A 1PWHA 1S2LA 3MCAA 2A1IA 2GYVA 1YQDA 2XRMA 2BRUA 4KIWA 2NG1A 4AUNA 2WT9A 5AVKA 2FMTA 1BE1A 2H4YA 3EODA 2WSSD 3KKMA 3R77A 4QBHA 3VDXA 5EESA 3IUNA 4QUAA 1CS0A 4HMOA 1YSCA 4GI2A 1MZVA 3IBCA 3EZ9A 4PNPA 1Z29A 2D2EA 5FUYA 2CLDX 4C0KA 1BQEA 3JWJA 5KWJA 3BXHA 3TSYA 3OECA 3AP3A 2CMGA 5ER6A 4D96A 2HA5A 4GYYA 3TNJA 2C9ZA 2HTFA 3Q9SA 2YC4C 4CM7A 1PZHA 1WHTB 2GJ8A 2Z2IA 5ADWA 2V74B 2P91A 3K0BA 4KYVA 5FUMA 1GPLA 3VNRA 3QVSA 1K27A 1XVAA 1RM3A 4O3MA 3LT2A 2CUTA 3MM4A 5JNLA 2XOXA 2WJ4A 1R6UA 1DI0A 2X5KO 5I9IA 2QR3A 2FZ4A 4XW2A 3U3KA 2HO4A 3OZDA 1F2TB 4FONA 2NSHA 2HU2A 3A6PC 1JE0A 3MWEB 3CEHA 1FDRA 1ZXBA 2HSDA 4MI3A 4AZTA 4FT2A 4YMVA 1UPUA 3ZI0A 4XGRA 1W88A 1IVSA 1M3SA 4LSWA 4W99A 1XRRA 1KZYC 4ZCMA 3M4NA 1G5IA 3DJYA 1RI4A 2CFRA 4YQZA 5ALRA 2VH1A 4PY2A 2VRNA 3AJ9A 4LYHA 4RIFA 2HCTA 5F7JA 5TPZA 5IT9A 4CFZA 3AV0B 2FOIA 3AVOA 4IILA 3O9MA 3X1KA 4BVBA 1XALA 3Q6MA 5ICGA 2ACWA 1B8VA 3E9EA 3O4JA 4GW3A 3O8LA 4K7JA 5B55A 4WLOA 2RGYA 1OA1A 4BFLA 5TQ2A 3DT9A 4IOMA 4IJUA 4CKBB 2OZPA 2VUIB 1OD6A 4EYSA 1KFBB 2JFUA 1PHPA 4ARUA 3I1IA 4ENPA 4ILEA 5BQPA 3RFXA 4DABA 1SQ6A 3K8ZA 5ALHA 5A6SA 1SXJB 3GGPA 4I9UA 1GNQA 4I50B 2PKQP 1ZAKA 5KKAA 1GHTA 3SEQA 4BP1A 2WF9A 8LDHA 4D9IA 2ONKA 4UATA 2OAEA 4TPKA 4MTCA 1T4MA 1QMPA 4PINA 2BL4A 3DTVA 3RT7A 3E2MA 4HO1X 3GUHA 3X3HA 5BSMA 2JGMA 1PL8A 4PTZA 4FE7A 5DN6A 3QKSA 1DRJA 2WT8A 1Z7WA 1FYFA 2XCIA 4O4LF 3QGMA 4NVRA 4EVQA 4DZTA 1WULS 1MP0A 5DI9A 3JQGA 2BDTA 1I5RA 1MH9A 1WXQA 1ZOLA 2PLWA 1M6EX 2ES4A 4IFIA 4N03A 3WY9A 2QWXA 5EJ8A 1H9AA 3IP9A 5D7NA 3FOCA 4ZGBA 1MA0A 1QBGA 4KQXA 3TE6A 4RKWA 2FPSA 1UFOA 3THRA 3DPSA 4B45A 3FCYA 1RLJA 4FM9A 5B3JA 5H68A 1KHTA 1NLYA 3A9WA 3GHHA 5AXCA 2VZLA 4CMBA 5GIPE 5BQ3A 2M98A 3ZIAD 2FHSA 3QXSA 2BDEA 2K87A 3C7TA 1O08A 2EX0A 1V7ZA 2E1RA 2ZVDA 3HB7A 3R3XA 4NEHB 5M3BA 1LBEA 2D2IA 3S4YA 5ED0A 4D8YA 4TLBA 2AUNA 3SZ3A 4R2WA 1OFUA 2Q5CA 1QK5A 2A5FA 2P4QA 5H80A 1BOFA 3BS3A 5F1OA 4DEYA 4KV7A 4GO1A 3K70D 3PUJA 4UQPA 3W5DA 2C9BA 3WE7A 4L8WB 1XC7A 4IM7A 4OFXA 4PLGA 5TS2A 5KTPA 2FPOA 3TQHA 2W42A 2P9YA 1IQUA 5CH5A 2EJCA 1YRWA 1CQXA 4ODIA 5BNZA 2I6FA 1RKVA 2IOFK 1XZ8A 3URMA 4GMXA 1J5XA 2AA3A 2BBOA 2WHEA 3A58B 5KNLA 2OZVA 1EK2A 1G291 2H2FA 3MMPA 4NZMA 3NP7A 4QTUB 4WA8A 1GQFA 4S1VA 1UINA 5K3FA 3R76A 2WKWA 1YVEI 3NVAA 4C08A 5IN4A 2YZNA 3D7MA 4I9HA 1NMQA 3QM1A 3EMBA 4UEJA 4QICA 3EGXB 5CXXA 1T34A 4CIAA 2V7PA 2LLWA 2JCSA 2NXNA 1ZD8A 1VDZA 1BOOA 3QA3E 4OLHA 4PX2A 4LF9B 1I7PA 2P4UA 2FMFA 3FDJA 4LUCA 5EIBC 2FR1A 4NXNB 5BUCA 4QFCA 4KKVA 1SG9A 3LLUA 2AD1A 1AK9A 1TEHA 2FW0A 5CP8A 1G55A 4C4PA 1MX3A 1R6TA 2R63A 1RXIA 1VSUA 2G7MC 2G88A 2F43B 4L73A 4RKYA 4GL4A 4MGKR 5KSPA 4LGYA 1G64A 2IK8A 5DNUA 4GKJB 3MF4A 3Q6NA 5CTAA 3RTDA 2ZBPA 2HT1A 4MW2A 2PQ2A 5DM4A 4GS5A 1W19A 2C5AA 3NNDA 5J1TB 5TPWA 1N4AA 1RHKA 1Z0FA 4QWMA 4QUEA 4A5OA 3ZDDA 2WSYB 4MUMA 3TM5A 3V3TA 5I8ZA 1OIVA 2B1RA 1RQLA 3KYCA 5FI3A 3ZK7A 4K1LA 2RGRA 4XWWA 4ZEXA 4JP5A 1U7OA 2I22A 3SC3A 4FFDA 1W5TA 1RKBA 5FO0A 3SS7X 3U4GA 2PL9A 4AM8A 5KC8A 2AUWA 2WWGA 1T3GA 2PIJA 5DLPA 3HYSA 3MJSA 1KAGA 5GM1A 2GMWA 3DMHA 4MR9A 2P9EA 4I99A 4RIIA 4OHMA 4C7OB 4HNUA 4I5FA 1NTOA 1CZHA 1NBWB 1GGMA 2Q1YA 1H3EA 1Z8FA 2HD4A 2J9FB 4Q19A 1RXEA 1P2GA 4Z9AA 1E7QA 4PXYA 4MKIA 3TJRA 2BHSA 2ZETA 4RQBA 2PKXA 3R7NA 1V96A 2IEGA 1OUMA 2QQFA 1T6BY 3EC2A 4IXNA 1QVRA 2RKBA 4R81A 4WINA 4BIIA 5F2NA 4ILKA 4MB2A 1GUFA 3A1EA 1CJMA 1Q5PA 3BTUA 1SCKA 4DMCA 1YZNA 2AI2A 3NOOA 4DLLA 4EJ0A 5LNK1 4W5HA 3RVRA 4FMBB 4CEIA 5C7LO 1XD2A 2FU5C 3ETNA 3S2EA 3V8VA 4HZUA 1YL5A 5DTJA 4B4DA 4EKYA 4X0EA 1RC1A 1M73E 1ZD9A 3QWFA 5BSTA 3KQTA 1ISSA 4V24A 4G0VA 4J1WA 1OBOA 1ZK4A 1UBCA 2RFLA 4QM7A 4CM1A 5IZCC 3W9UA 1ZRHA 5EUCA 5A3VA 2MTBA 3U61B 3DOUA 5C31A 621PA 2DEUA 4BYGA 3A1DA 4EY4A 4F6RB 4A3SA 1TIKA 4Z4GA 2OKGA 4AUKA 1O7JA 2IHYA 1O95D 3P32A 2YWCA 3DD1A 4AW9A 3CT6A 1SBCA 1T8WA 1XF1A 3PFBA 2WILA 3B5IA 4L95C 2R87A 3GMDA 4RVFA 2NN3C 2VBIA 4A8JB 4FGZA 3FH0A 4ZPXA 4YCSA 5JOQA 2E4VA 2F17A 1PZGA 2X0NA 4JC4A 1HWYA 5ADHA 1UWVA 1M8JA 1GKYA 1YDWA 1MJFA 3NNNA 2AOXA 4FOOA 4QDXA 4QEDA 4RXMA 3UYKA 4UTOA 3WGMA 1BHQ1 4AXXA 5CXQA 5IX8A 4IFBA 5BMVB 1Q6YA 2CJPA 4OUKX 4M1MA 4KTVE 4J1TA 2UKDA 1L5QA 3X1MA 1P0MA 3E3OA 4RADA 4KQCA 2GK6A 3FFAA 4F11A 2BGKA 2JS7A 4BLPA 2Z6AA 3V00A 2A0UA 4RD3A 4AP9A 2QM0A 1UT6A 3JW8A 2O8EA 4G07A 2H1OA 1KRHA 3M6XA 3LECA 4HQ6A 4ZQFA 1FFAA 4OKSA 1U6JA 5DIZA 2EAUA 3VPCA 1E2HA 1K98A 3WMEA 1PDWA 1L1MA 2C5LA 4L3VA 5B2EA 4WL0A 3AIKA 4DDMA 2Z2ZA 5TQ0B 1K6JA 1A5TA 3I1YA 4GX5A 2IXAA 4JLMA 1OF1A 3TRFA 3SYKA 5DRYA 4WLFA 3ADBA 1Y5NA 3ILSA 1MFPA 4TSRA 3UAZA 4F4IA 1CJKC 4MZDA 3L0BA 1BA3A 3QQ6A 5TJHA 4IO1A 4LHEA 4UQOA 3FKSD 2JAWA 1UBSB 5AI9A 2J0EA 2DPLA 1EIZA 3P9ZA 1IXRC 2PMBA 3PZRA 5FI0B 3BICA 3R3JA 4RL6A 3T34A 2DUNA 2AFIE 1URPA 2GXSA 1P1KA 2I65A 2NNWB 1KU6A 3IUYA 2P4HX 4UFOA 4BWVA 4N3BA 1TK9A 2C82A 1RYZA 3DF7A 5I9NA 2IS6A 2AJ8A 2A5GA 4J0IA 5IM4F 1KYYA 1TJ5A 3FPHA 1HE1C 5A0TA 1UXOA 2JAUA 3EDMA 4F9GA 3H5NA 3IODA 3LZCA 5FNVF 3QKTA 4MR8A 2N75A 4TVKA 1FFWA 1BW9A 3M9XA 5EZQA 1DEXA 1KC1A 3OVMA 1T5SA 3PNPA 4IMJB 3N5KA 2QXYA 4LC0A 2BGUA 3D6MA 4NU5A 1ZWKA 3QFHA 1QH8A 3H9UA 1G6OA 1OLUB 3VYTB 2AW6A 2BFFA 3VR2D 4D79A 3UK0A 3TJMA 4FINA 3GVIA 2W6JA 4GSKA 2YUIA 1Q0UA 2JGJA 2BFEB 2ZJ6A 2W6CX 4P7GA 5JDCC 2H63A 1EFPB 1ZH8A 1NQTA 2RHJA 3JWPA 4TWZA 3AI1A 1JPUA 2DJIA 2EW8A 3SYMA 4F84A 1PGJA 2MSEB 1Q0SA 1RHRA 3I2YX 4PU0A 3FIJA 4J4BA 5EC8A 4Z1OA 3ZBUA 1HYGA 3K16A 4ZHQF 4K8OA 2H9IA 2I1LA 2AK2A 2WHPA 4NFSA 4C4SA 5AJZA 2JK1A 1B00A 1N0UA 3A6GA 4YLYA 4OHKA 2DKFA 3TEJA 3GPLA 5FR2A 5GOZA 4ZRNA 1DC8A 4GPEA 2VS1A 2WD7B 4IS2A 4KPYA 1COWA 5KTRA 2REQB 1KERA 4OQDA 1C3XA 1PX0A 1X2EA 3IS3A 3KZVA 4K5QA 1XPUA 3LHFA 4CUZA 1RP1A 2WAAA 1M1YA 1M0SA 2A8YA 4MR7B 1TF5A 3W2FA 2UZ4A 3FOAA 5IJAA 1A4IA 3NPMA 3G85A 3IP1A 4MKHA 5LDDC 2ORWA 4ATNA 3LFHA 3GUUA 3OZSA 4RXTA 2OTCA 4YB8A 5DNVA 2XT9A 3HVRA 2ZUWA 4QOFA 5JDIA 2CDCA 5B12A 3COZA 3S68A 5JJKA 4PQRA 1LRJA 1CC1S 4KPGA 2VP4A 1G4UR 1U0HC 4CMIB 2NZ8A 2WINI 2O0KA 3PE3A 2KEJA 1NJ1A 1Y7TA 4U7FA 5HCIA 1ZXXA 4WN9A 5M04A 1NG1A 3D3WA 1Z2EA 5DXAA 2MINB 1BX3A 3M5CA 4FCCA 4I55F 4B80A 1Z7GA 4KFUA 13PKA 4ZXFA 5K01A 2QENA 4C14A 1HNZB 1IBRA 3P2JA 4MYCA 1FSZA 4G09A 5SY6A 5AM1A 2ZRGA 4LFCB 4GLFA 3HM9A 3LVQE 3ND8A 5AHRA 5A9SB 3Q1KA 1GTZA 2UVPA 4I6TA 3NDRA 4KXLA 1RS0A 1YDMA 2EFGA 1T0UA 3EVZA 4D3SA 1G8JA 4PYMA 3EULA 4ASUA 5GM2A 2O2EA 4JT8A 4MW0A 4LF6B 2IPMA 3PNKA 1F17A 3MEJA 3OM8A 3QLUC 4GXTA 2NADA 1J9ZA 4J4TA 5AJYA 3QOWA 1FNBA 2PUJA 4E3ZA 2DE0X 3PHBE 3PHHA 1V6CA 2IOHA 5FBWB 2HMAA 1AKQA 3R5KA 3Q5EA 1NIPA 1VG1A 5ALDA 1YR6A 2YN2A 1VPWA 1J06A 1K8RA 1TJPB 1N3IA 1GRVA 3HJGA 3RYCA 1P1IA 3C3KA 2H2WA 3H3FA 2OO7A 4KN8A 3ITKA 4UFPA 1TQDA 1DUIA 2WVGA 2OEPA 1H66A 3MTEA 4DS3A 4EJSA 2ZTSA 4K6GA 1RBQA 5F4ZA 2PBLA 3M6LA 3I9V6 2A0KA 3MJTA 1G4AE 2CXPA 3D4NA 3DVAB 1DTWA 1X2LA 1K0FA 2XOKD 3E9RA 4NSNA 5A9TA 2PMEA 4CLOA 1JI0A 3DP9A 3PQ7A 4JDUA 3AY0A 4LFAB 3W7BA 1PKXA 5HFNA 3DFZA 3Q7QA 3L6RA 4WGGA 3AEKB 4B3RB 1YNOA 3DLHA 2YHBA 1YMVA 4K9RA 1K8QA 3EF1A 3OFND 4QDUA 3QY9A 4YJHA 3PPYA 3HJTA 2J5KA 1NVDA 3ELUA 3ANLA 3H84A 1NAIA 4OJTA 4JJAA 4CF5A 1UWCA 3BG5A 3WGYA 3B1FA 2FW9A 3SHFA 3BQMB 1QLWA 2LNMA 1TJ4A 3K4QA 3RRXA 3VSBA 3AZOA 1ANKA 5JDIC 1EP1B 4F60A 2AJTA 1UT8A 2C9MA 2OHXA 3CSDA 4D4GA 5F52A 3GT4A 3QBVA 4QXAA 4X7MA 4IZIA 1P9WA 4RV9A 4MVYA 2CDAA 1SQ8A 2FLVA 3I5XA 3U7HB 3JQQA 3CKKA 5HUQA 1E9RA 2UZAA 5FWDA 1EQ2A 1OXMA 1YRAA 3TW8A 1OCEA 2E6UX 1NVVR 2Q8NA 4ISBA 4RMIA 3E35A 5F3WB 4B4UA 3RS8A 2BZSA 4YCJA 3ZVLA 4CETA 3GT0A 4B3GA 1NF9A 2AFIA 1CHNA 3NXKA 2WTNA 3T4XA 1UJMA 3IAAA 3A6ZA 4YCLA 2DC1A 4CQMD 5ES4B 2ICTA 2C2XA 2CBZA 3DZIA 4MV9A 2JIDA 2A86A 4G25A 4GLLA 1G9SA 1BWPA 3PSHA 1AU9A 4Z8XA 4H1UA 1ORRA 2FWPA 3AVPA 4J7AA 3G6KA 4GWGA 4QGBA 4E2FA 5C8YB 1REQA 2XVXA 5JSFA 2C42A 2ZS8A 3WL7A 3DDOA 3QUAA 2JFHA 3G5AA 3LHSA 4OOFA 2NSYA 4CG2A 5FORA 5BSKA 2B7CA 4MQ5A 2CBXA 2GZAA 4OAQA 1WSAA 1VBFA 4JYMA 2X8JB 5BV8A 1KY5A 3EZXA 5JS8A 2VTKA 1AQNA 3EXG1 3H6GA 3GLFB 1A7AA 4ZO6A 2FX5A 3K32A 1B4DA 2XLCA 1ZN9A 3ZVNA 4KH0A 1NOIA 2POQX 2BGLA 3HH8A 4WQMA 2D1QA 4YJDA 1F0NA 5ALTA 3NAQA 1FU8A 3SZUA 3QBDA 4DSNA 4Y9DA 4EPWA 1OBFO 3CE9A 4WBSA 1ODSA 3P2IA 7MHTA 1KDRA 2NUPB 4IDOA 1GJRA 4ESHA 2I91A 2Z9DA 5GJBA 5TMBA 2NAFA 2BP7A 4HAUA 3EXEA 4QOJA 1HT3A 2GO7A 3UWKA 1XK6A 1E2LA 3R9WA 2IODA 4JR1A 3KSDO 5ALIA 1MDFA 4ECEA 2CSXA 2VNKA 4DCJA 2WJGA 4XJVA 2AQHA 5I3CA 2ZJ8A 1A82A 1JHMA 2OBFA 2V6JA 2OL4A 3TBHA 1EI9A 1P7VA 2XNJA 4ZVVA 3KNZA 3LQ2A 3V9AA 3PTAA 1CEXA 2DBZA 4MUFA 4I3HA 4IJ5A 2F3TA 3R0JA 1E9BA 1V8FA 1J1ZA 3B53X 4IIHA 3DP7A 3V7YA 3SHQA 1EXWA 5TMEA 1NF3A 1KDYA 1XNQB 4R51A 1CQWA 2EJVA 3H5IA 4KQIA 3JYLA 1K08A 4RW0A 4JCCA 4JX9A 1KQOA 4UUOA 1FUUA 1R3DA 2BM0A 4LMBA 4BDSA 3HCAA 4ZYTA 1MO6A 1SOAA 1RVV1 1ETHA 1I7NA 1WDMA 4AT1A 2YJ6A 4H08A 4UU7A 2ZWPA 3LFTA 2BN4A 3RYFA 5AVWA 2OCGA 1NXOA 3SLGA 4GNKA 5EQDA 2VHUA 4RJLA 4DLNA 4F21A 4ESOA 5CIYA 2GKSA 3OIVA 2Q3BA 4FKBA 5LC1A 4UHDA 1L9XA 4A0RA 1OH6A 1LK0A 3CPSA 4RQAA 4IHAA 4ZEWA 1WB6A 3TCNA 4ZT2A 3LKBA 4W63A 1CUIA 3SKYA 3LT5A 1M6VB 1UXIA 1XTIA 3FJOA 2ZT7A 2J6IA 2J3KA 2PK3A 1LI4A 4C05A 1FP1D 3FMGA 3UAVA 1YZHA 1GZ6A 3H75A 3PGJA 5IBCA 3AYZB 1T29A 2V4ZA 3ER8A 5F78A 4GQMA 4PFSA 1G9XA 4X7PA 1N2CE 1PUJA 1XKXA 3AC0A 1U80A 3F67A 3N2LA 3AT1A 2OGWA 2FE4A 2G9VA 1IZ8A 3H16A 2C4HA 3BJMA 3FKQA 3LUBA 3Q2OA 4OJNA 3GDGA 1FB5A 3GA0A 3EEQA 4WZAB 4BKOA 1VJ0A 4EKEA 2R8PA 5DYWA 3UC5A 4YRSA 2BZ1A 4W5WA 5I47A 2R1TB 2G71A 3ZCTA 5JYEA 1M5TA 3HCCA 3IFSA 4FGKA 2HHCA 4U2DA 5DWVA 4E07A 3IIEA 3CNBA 1FYEA 1T5LA 1Z56C 3OE7D 4OSEA 3A25A 4A1FA 3LS2A 1OAKA 3JZDA 2X6RA 1PR3A 4L5IA 4RH1A 2KEIA 4RA6B 3G2HA 2P2CA 2Q0QA 4RF4A 4B8WA 1DXQA 2EKZA 5H81A 3SE7A 1NNI1 3VR5D 3ZHTA 2CLOB 2RD2A 3S2YA 4MW9A 1W36D 2QRMA 5J9FA 3FWKA 3WI7A 3D4IA 2GCPA 2ZTHA 3VX3A 5GJWC 1IBLB 2C83A 4NHOA 1KI6B 3DFKA 3EZ7A 3ZDYB 1RPZA 4QYTA 3KWJA 4EUSA 1F06A 5AVRA 5LZ7A 3UMFA 5M5BA 1HDCA 1WW2A 4WUTA 4GU5A 1OX4B 4LC1A 4CMCA 3PQEA 4HAOA 2DY0A 1W93A 1AV7A 3KPVA 4N8EA 3X1XA 2BFOA 5FOXA 5CXUA 1TUIA 1XTKA 4FXPA 2NU8B 3FR7A 4IIFA 1QFSA 4BZPA 3WIUA 1EYZA 3LUKA 3MTIA 2JIPA 3P9SA 4CDNA 3W3AA 2OUKA 4FDAA 2AOWA 4NAVA 5C7YA 3WYFA 3AKYA 1DX9A 3CNHA 5EXSA 4BLUA 2GBLC 2K2WA 1JW9B 3TBKA 4TMWA 1Z35A 4MRRA 1G18A 1PGQA 1XAIA 4LJ9A 3HDVA 3A9YA 1V95A 3O1LA 2Z1MA 3T0GA 5HJEA 1KYWA 4Z4HA 1FUYB 1WS6A 2P67A 1A4RA 1SB8A 2QYTA 1F20A 3DR3A 4BLQA 3CRRA 4BAUA 4DLKA 1CEEA 1CRWG 2LLVA 1N8SA 1OJLA 2JEZA 3ASUA 4P82A 5KOHA 2QQ5A 3SJZA 1X9HA 2AQKA 1V11B 4D4LA 4J0EA 4FNAA 2RCYA 5EL0A 5BP7A 2C5FA 1G8AA 5IP5A 2YWHA 2HTEA 4A6XA 4B87A 4ZDIA 5I7RA 1UJ5A 3I34X 4N1AA 5JYCA 3A4YA 4KVFA 2VCEA 4YALA 1IYZA 3QOFA 5HKAA 1CRPA 3OZAA 1I3OA 2OZLA 3GUYA 5GOTA 3HI4A 3A9ZA 2I6TA 4RESA 2BCJQ 3N86A 3OT4A 4FMPA 4WACA 2HCRA 3U4AA 5B4TA 1VE1A 4IVPA 4KQMA 2IVQA 1T2EA 1ZW6A 1VXOA 2A9JA 2R4QA 4LZLA 2JEYA 4UVIA 4WA7A 2YR0A 4RV5A 3WMRA 3MIZA 4JVLA 3WJAA 3ZLTA 5AUPB 2Y76A 3RTGA 3M6UA 5HPYB 1H9BA 5HRCA 3IX7A 3LH5A 4E6EA 1FQWA 2PR2A 4JUAA 1GD1O 3CO5A 5FDFA 2H2AA 1JXMA 3D1JA 1U8EA 3WXBA 2C7VA 4JXJA 4F1KA 3L41A 2JJ8A 4IIDA 3C6YA 3UV7A 3I62A 3OOJA 3JQPA 4M0PA 4Z5DA 2P5SA 2BGNA 3A6DA 2FZCA 2P0EA 1K0UA 3BX1A 5LKRA 1D8TA 1K7SN 4J16A 4LBYA 5EWJA 2F9LA 2ZRNA 2EFCB 2PCJA 3PLAE 2X2PA 4I2NA 1UH5A 2FSIA 2IEZA 3PQCA 4NBVA 5JY6A 4FU0A 3AHHA 5FLXA 4WZAE 1B0UA 1RE0A 1I6WA 4G1CA 3I2GA 1YZTA 2G5PA 2X5OA 3LV8A 2CXRA 4IEEA 4HNRA 1X80B 1E1CA 2QN7A 1RMYA 4JSTA 3TTUA 3K35A 1GAXA 4FS8A 4HB3A 4DPKA 5IDXA 4DRYA 2YJTD 2I7VA 1IRIA 1NBHA 3QFSA 1E5XA 1YXMA 1V5WA 1XDSA 1ADRA 2HSJA 2DTXA 3B2QA 3PDJA 3TRKA 3AEZA 2A0FA 2ODEA 2VLIA 4PLFA 4Z2YA 3FSJX 1XR3A 1RYDA 3D6JA 1UZUA 4Q4DA 1RVDA 4C1BA 5IS2A 3E9QA 2AJBA 3E3AA 4XFKA 2XWJI 4HADA 3UPDA 2WHXA 4QYMA 4PAQA 1XKQA 2ZITA 3O91A 4P3KA 2C8JA 3LLCA 4RM3A 3S2IA 3CISA 1FFBA 3ZLUA 3IA7A 3GO4A 3OX4A 5M29A 3GYBA 3GGDA 2RK3A 2IXTA 3N75A 2Z6UA 3RIMA 3LIIA 9ABPA 5JCZA 1EBBA 1LXCA 1MR3F 3LXUX 1LLQA 5FV4A 3TTYA 3WZLA 2AFHA 3OT5A 2JFQA 1E7SA 2H06A 5C3MA 3L8GA 1VHQA 4RQUA 2GBPA 2IHTA 3OZRA 4UEKA 2QX8A 4AJLA 4BN4A 4GPD1 1USWA 3S55A 1TDJA 3K6SA 2PV7A 1OLXA 2EWWA 2QG9A 5A5FA 1X8LA 4MUKA 3UQYS 3A2MA 4RLSA 4MJ3A 2P9QA 3OMXA 1OHHD 2WUFA 3MGAA 3WLTA 1E2IA 1GKUB 1RYMA 2PZBA 2VHCA 5I9LA 4W4TA 3GPCA 1N6LA 3I30X 4ZKEA 2QQGA 1WW8A 3F5DA 4U2BA 1YJAA 3ZZMA 3ZBTA 5EZSA 4JKIA 1Y6GA 1B74A 3P8ZA 2WTMA 1OA0A 4FMCF 4G0PA 3PX3A 3W2IA 1DXOA 1XX6A 5FBKA 3WJ1A 2ZSAA 3LY7A 4HEHA 3PDCA 1LX7A 2FUCA 2H07A 4QU5A 1P3DA 4LXYA 4RETA 4YFVA 4AUMA 4DWOA 2J9XB 2Z04A 3R0ZA 4FMDF 1N32B 1S7EA 3AF0A 1Z0DA 2IELA 2OGSA 2ZIUB 4FGLA 3PPXA 4L3OA 3GLVA 2HPHA 1VHWA 3D8TA 4DJEC 5A4FS 4Z4CA 4I1VA 4HTFB 2B69A 2OXFA 4DC0A 4EEZA 2WNHA 3ZIAA 4DA0A 4IL5A 2JGEA 1FJHA 3STVA 5JSHA 3Q3GE 4DSZA 1II8A 4X8HA 4OATA 3ZZ1A 3VGPA 3WGGA 1FW6A 2X0RA 2H29A 3MTAA 3FRIA 5EGSA 5JS7A 4YRZA 1LPPA 4MRMB 2RKOA 1Z0JA 4JD5A 3TSZA 1M7GA 3RVKA 4B6QA 4BMOB 2GRAA 2IEIA 4KIUA 5JNWA 3QKWA 1NF2A 5EZYB 1I13A 4FWTA 2CHVA 2PZFA 3C1TA 1C14A 4IX1A 3RF7A 2LVBA 1N6RA 2GSDA 3UCFA 2J0QA 4JSYA 4U2CA 3H17A 1QUFA 5FO1A 2WBLC 4TMTA 5CFZA 2I6UA 3GCZA 4CKCB 1GT0C 1G0NA 4M1WA 3PX2A 4QXMA 2ZSIA 4WK0B 4R2LA 5BYBA 3NVDA 2PX3A 1JEOA 3GEPA 4N0PA 3R7WB 3W5HA 2KQUA 2AYYA 4NMLA 4LDPA 5EWLB 2ICPA 1X39A 3CR8A 2E49A 1LW7A 3B8HA 3MMSA 4JVMA 4BJ3A 4BIMA 1P29A 2ZB3A 2YFHA 1C9MA 1Z6XA 3B2EA 2ET6A 1SKYB 3BFJA 1KKLA 1H23A 2HA0A 3L6EA 2H5IA 1C1XA 1ZVQA 2BC9A 1MVOA 3KFXA 3L7CA 3OLVA 4L5JA 4PAOA 5GIOE 1LNZA 1AT1A 1G2PA 1N6OA 1VGRA 3FPGA 4NPAA 2D4HA 4ZP1A 4CMJA 4DRXB 3EH1A 4AWXA 4EMSA 5JH7B 4BX9A 1ORWA 4H35A 3RM3A 1UODA 4LMRA 3TLYA 1G42A 1T6ZA 2CFOA 4P6VF 1OI2A 2CFIA 3ZHSA 1VHTA 3O2SB 4Q4JA 5AVUA 1HOTA 1X1QA 4OVKA 3HN7A 3R9KA 3NTQA 4MQLA 2W6JD 1E3WA 3FPJA 4AJHA 4ZI7F 5M34A 1PQ4A 4R5HA 3TYXA 1WP9A 3BMQB 1WM1A 4F56A 3BRSA 4YPFA 2CDRA 2DWQA 3GLGB 4V0OA 4XLZA 5LWHA 1DWKA 1OZFA 1MB2A 1TC2A 4K3UA 3C5WP 1WCYA 4MKRA 1I33A 3NHSA 1HOXA 1UKAA 4PU4C 3QV2A 1FDOA 3RS2A 2PMDA 1QAMA 4AF8A 4KK4A 4DDTA 3W8DA 3JYOA 3HWRA 2FPGB 3IILA 3MCTA 2VT2A 4K9LA 1TYZA 4DLZA 4WESB 5LOVB 5DM2A 4NNJA 1YZKA 1HLPA 1C3VA 4R8RA 5JEDA 4JS0A 1ZGHA 2XE8A 3MNFA 2WZCA 2ZAYA 4TYWA 3UHJA 4ND2A 4G5XA 1Z28A 2IIBA 4MYRA 1JLHA 4HN2A 1UC8A 4C7MA 4MQMA 3K0FB 5LBUA 1JKJB 1T2DA 5F21A 3UB3A 2OAQ1 5A62A 2QPTA 4IIYA 3JASA 1VLQA 2NV0A 2ZWVA 3ZJTA 1NFQA 1V7QA 4E2ZA 1NRXA 1Z7BA 2EATA 3G7NA 2I3AA 2TMGA 3AO0B 4H3KB 2WQZA 3SQLA 2X5XA 3NWBA 3VO1A 1RKQA 4JWKA 2XGSA 1DEOA 2H7CA 4G4GA 4O4LB 2NMVA 4BC0A 2HV8A 2PVSA 4NMHA 1GRNA 1TKBA 4HGOA 1V5EA 4EB0A 1MC1A 1ZD2P 2JAQA 2QE7D 2P90A 2AFVA 4H4DA 4I4IA 2XE6A 1MFQC 5AKJA 3H8SA 2BBSA 4R69A 4BN5A 3T3GA 4D92A 5G4KA 4Y6SA 1H8HA 4DARA 4JLWA 1CY4A 2DUWA 3V4LA 1H0KA 1RJDA 2F1HA 2FP4B 1WVGA 1HF3A 5ESDA 4MWTA 4RCVA 3ONDA 4OB7A 3KT3A 4JXXA 2BUBA 2O19A 2VCYA 1CUFA 1QPBA 1QK3A 2HRCA 3LKVA 4S0XA 1L9KA 5FBHA 1L5HB 3LTNC 2QK4A 1EX7A 1P45A 1FS5A 1PFYA 2R7AA 2ZTLA 3H8JA 2FH5B 3MLAA 3CX4A 1K3UB 3O6VA 4XGIA 4YR9A 2VDWA 2YYAA 4J1TC 4YO8A 3SD7A 1Y37A 2VJDA 3C3DA 3CR3C 3IVCA 2R8XA 1KPGA 3VZQA 4EG7A 2F8TA 2Y0CA 2V7VA 4TLCA 4WAUA 1X19A 3NGLA 2H1CA 5CA0A 3V46A 4RTKA 4WV3A 4BMPB 1ITZA 4UPDA 4XTRA 5CVUA 3VYUB 4D8VA 1NI4A 2J9GA 3B5JA 1XL0A 3I9MA 3LLVA 4NMWA 4RZXA 4L8GA 4KQFA 4ZC1A 4DG8A 1R0KA 4WERA 1EFCA 4PZEA 4CR6A 2PUAA 3VPDA 5CFQA 3WIEA 4CKWB 2VUSA 1YWGO 4AECA 3H7IA 4NOJA 4JI5B 5FF9A 2WHYA 3URKA 1W49A 5KX5B 2O8BA 5HE8A 3ABSB 1ZIDA 2F1IA 3QVMA 4U02A 1VE6A 3VI4B 3GP3A 3W05A 2YY7A 2VDWB 3JARA 1D6MA 4ALJA 3K1YA 3T5CA 2YHIA 1HLFA 1JG6A 3OEWA 3GI1A 5HQ3B 5TF4A 2B36A 1XMIA 4QULA 4ZYXA 5C7IO 1EVIA 3CX8A 3I05A 2GEDA 1RLMA 1UDAA 1ZZGA 3P52A 4EJFA 2QMEA 4JBIA 3BXXA 3MJVA 2WE8A 1R16A 3T9CA 1HH4A 2QV7A 5JMOA 1TX4B 3F4KA 1A8SA 1P2VA 4Q4AB 3QUSA 3PF9A 4N9WA 1ORVA 2XXAB 2A5DA 1QHSA 2X8AA 3LRPA 1KY4A 1B6RA 1Z38A 3SZGA 3ZR4B 3IOCA 4HWOA 3K96A 1N7IA 3KOUA 3RYHA 2ERXA 4MKFA 4JA2A 1XTRA 1A77A 2JKYA 1KSGA 3S2GA 2JD2A 2IZ7A 1BXZA 2I4LA 3ZHIA 4OHUA 1FVXA 5FHQA 1EVQA 2QR5A 4AJOA 1FSGA 1UMCA 1ID1A 2XKAA 5KREA 3VUFA 1SC6A 2UZ3A 2HQOA 1Y3CE 2ZDQA 1ILWA 2I4NA 3D2LA 4LRSB 4QODA 1D2GA 2R6GA 1DIRA 1YTLA 4M38A 3O73A 4XXHA 1I3LA 4K9SA 3V1MA 4EA9A 4QASA 1P5ZB 1VLZA 3UMMA 1US8A 2QTHA 1E6CA 4KO3S 2PPXA 1TT5A 2PUEA 4TTAA 1RSZA 3AEYA 1SN7A 1YZ3A 3SJ7A 5I5EA 1NATA 2PDAA 5BUZA 1OJ7A 2HA6A 1T10A 4IDAA 1A9PA 3K9LA 4C87A 3IQDB 4BFWA 2XMBA 5FH9A 2FR8C 2QPOA 1E5VA 1KGSA 4S0ZA 5KHAA 1K88A 3K9GA 3DH0A 4HDNB 3PUZA 3KVNA 1SHLA 3VTAA 3RU2A 4IJ6A 1U1CA 5EYPA 1NTRA 5KQRA 1Z62A 2BKAA 3GLGA 4X71A 5TX7A 1FCJA 5K2OA 4COKA 2OMKA 4LVNA 5FL3A 2QJWA 1Y89A 1DWUA 3SHVA 5DP1A 1ZK0A 2R7NA 1GG5A 2IUYA 3MLFA 1E69A 4V38A 5ALUA 2HMTA 4NR0A 5KJ6A 2Q1WA 1XTBA 5K3DA 3QU5A 5FUWA 2XMPA 3ETGA 2VHJA 1UBHS 2G1KA 2AX4A 3N7AA 4US1R 3PVZA 1SY7A 4M87A 4NCNA 2JIMA 4RKQA 4J1SA 5JCPA 3BDVA 4DRXA 4UXHA 3V1TC 2FN7A 4MQBA 2PUGA 4AZ0A 2I2FA 4RPGA 3VJRA 3ONNA 1KI3A 1JDVA 2CMKA 4MQ6A 2XVAA 3NV9A 4MV5A 2DY1A 3F8TA 1NVEA 3HJCA 3MMNA 3MGGA 1Q0TA 4N6NA 2H4ZA 4QJ4A 5C2JB 4YUVA 1Z83A 3F90A 3EN0A 3KT0A 3O7MA 4BNMA 2KJQA 4ZI3A 3JRXA 2X1LA 4FIZA 4X1IA 4GOMD 3WP0A 4CR8A 1YOVB 2NX2A 2VQFB 1SFRA 3DHNA 1C9DB 3HDGA 2RBEA 2IF2A 4N9QA 3CA8A 1F5NA 2LDXA 4ZEOA 3LBIA 3UWOA 4LF4B 1SVLA 2FJPA 4LY9A 1KO7A 1T6YA 1YA6A 2CZQA 3MCUA 4CLEA 4ZOQI 4M1ZA 3P9XA 3EA4A 3TINA 3WWPA 3FPCA 2GOYA 4DUGD 5GPBA 4UTXA 4A7PA 4YMTA 3D7NA 3MCWA 3BHMA 4MRMA 1JIVA 5CURA 4EW1A 2GRLA 2W2LD 1SKMA 4OKNA 4PX3A 2JVKA 2VP9A 3PPIA 4CI9A 4EHLA 3X1WA 2FSSA 1CSEE 3AJEA 2P62A 1JAXA 1AXRA 3H2JA 2HY7A 1DRVA 1KXJA 2J4DA 4JOBA 1RWXA 3H9QA 5EXEA 1T6NA 4F4JA 2YMLA 3E03A 5IYZB 2HDHA 1TUGA 3DWFA 3GAAA 3GRZA 2NTJA 2XBMA 2JH8A 2YIMA 2VK2A 4UBKA 2J5BA 2XUQA 4MHSA 3W5IA 3OLCX 2PMWB 3GLKA 1WZCA 4IXWA 2Q99A 1NQUA 4N82A 3EPJA 3HO1A 1ENYA 5IWCA 3PPVA 4QNMA 4FYJA 4TUYF 2M6RA 4LWPA 3I6BA 5AOCA 4C29A 2ZRJA 5E6UB 2BZGA 1TQ6A 1WXEA 4CF7A 4B3TB 1KOFA 2B99A 1NT2A 1XVVA 2X9LA 4HT3B 4BUJA 4HH3C 4DLAA 2QAGB 3DVLA 4BX2A 3MELA 1XCLA 1RCUA 3TQIA 3BE6A 4MMZB 2R48A 3DE1X 3KKZA 4GGOA 5D1NA 1D4ZA 1TECE 3UJ9A 1HQCA 1JFFB 2Z2YA 4IW3B 3E22A 2BJHA 16PKA 5LJLA 2IOYA 2P9GA 3C3CA 1DDIA 3D6TB 3BSSA 1RE1A 3EEBA 3EE6A 1XLUA 4OXKA 3DB1A 3ZH9B 4CM9D 4BP9A 4WXYB 3TGPA 2UXDB 5J59A 3GZTB 4DMUB 4B3SB 1JEQA 3EVTA 3QNMA 2RSLA 3RRJA 5IN5A 4HH1A 4QBKA 4I2VA 1OTYA 4HQNA 3BD7A 4CV0A 1ZVMA 3RSFA 2PLFA 1E0JA 4MJLA 3R5JA 5DASA 4D9GA 1ISGA 2XWBF 3L6CA 4BZWA 4CMKA 1SIWA 3DLBA 1IAVA 5IXJA 3QXHA 1UDBA 1QQBA 4OP3A 5JSKA 2HK6A 2CJXA 1E77A 3CEPB 3F5FA 3OD5A 4L78A 3UW1A 3Q9UA 2EKLA 1EGAA 1RRPA 4EJSC 1OX5A 1CY1A 3FJ1A 3UPTA 5K4AA 2E7ZA 1VLHA 4YRJA 5DHPA 1TLFA 3UKJA 4CXMA 1CUAA 5IKOA 1XTJA 3WLSA 2RIPA 2Q3HA 3HBJA 1GQRA 3NIGB 4WZBB 3KBBA 4FZ3A 3ZW7A 3FX2A 1VSVA 1LDYA 3LHKA 4WFKA 4BVFA 4P5PA 2JLUA 3AR7A 1AHHA 1Z17A 4HV4A 3OLYA 3BMNA 2P4SA 2W4QA 2QM8A 1Q95A 3K6KA 4F4DA 1G0OA 5HRUA 1Y5MA 4BNFA 3BWXA 5DK6A 1PLKA 1SB9A 4BQIA 5TGDA 3RUAA 2GDZA 1L5ZA 4CIXA 3D6AA 3T1HB 1W29A 4V0SA 4X5OA 4GLBA 4PM4A 5T7BA 1E3OC 3O84A 4IR7A 2ZZMA 1DAEA 3IEUA 1CLEA 1UBJS 2AEJA 3EXHC 2PKWA 3UKDA 1P33A 1MTZA 4OQEA 1VKHA 2LYRA 2WK1A 3KCNA 3OKCA 4W8OA 5IVPA 3D9QX 2E5WA 2OWDA 4LF7B 1Q50A 5LXTA 1M9NA 1WOYA 4HDMB 5C1DA 2LPMA 5GJVC 5K8VA 4XB1A 1RMTA 2A9QA 3R6DA 5TARA 2JI8A 1PHRA 4ZOLB 3UJDA 5EQFA 1Z4KA 4DNFA 4Q7JB 5IKEA 3RKRA 2YHUA 3IAXA 3DE0X 3V1YA 3VTFA 1MAVA 1Z7YA 3Q3IA 3QWIA 5BR8B 1CUVA 2ECKA 1W5AA 1ZPDA 2A6PA 1DMSA 5DM70 4C2UA 2E4UA 2FRVA 4M6WB 1XXHB 3EGCA 3VPGA 1Y5RA 3VPHA 2LBPA 4M0UA 4ZGWA 3KG2A 2A1UA 2HL6A 4C0AC 3AVYA 2ZWMA 2OHOA 1JSCA 4TMZA 5NULA 4EYKA 4XQEA 2A2ZA 4QDJA 9LDBA 1QG6A 1YT5A 1L5SA 1Z5ZA 4M3NA 3SF8A 3OEYA 1GTG1 1Z25A 1ZVVA 2ZK7A 1T0HB 3WL3A 4YMLA 3QPWA 1YR7A 3CCFA 1X7GA 3RBAA 1OT3A 2OQRA 4ZOCA 3ZE7A 3W4KA 3FAZA 5C34B 1HNNA 1JTEA 1JIUA 1YS1X 2FEXA 2X8WA 4YDRA 3V33A 5AP9A 2AD5A 3G0OA 4YAGA 4YXWD 4C6RA 2GXQA 1P6UA 2C4VA 1BVUA 1VIDA 2OCXA 3DDSA 3R3UA 5EAIA 3NT5A 2OO5C 2RHMA 4LY0A 3IVGA 4FWBA 2H17A 4MQEA 5L3ZA 3WR5A 2BGGA 1IDOA 1LKZA 2XCOA 2WR8A 1Y8QA 4DCNA 2A1UB 2CD7A 3IHWA 3VC1A 3G2JA 2GKGA 1D2RA 3BKXA 3O47A 2QZ4A 3DWGA 5BURA 1UMKA 2ZYTX 1HYEA 1JXOA 1Z3IX 3EVAA 1GLGA 2W2NA 1FNNA 4XA8A 3REQA 4BVLA 4R6WA 1C8KA 3JYQA 4JITA 4UOZA 2FDCA 1PFUA 1SAYA 1POWA 2A94A 2F3SA 3KQYA 3PYXA 5FFNA 4BZXA 4E11A 5HS4A 2P2LA 4BCBA 5FOQA 4OY3A 1QGZA 4B46A 1Z6QA 4U3JA 4UCXA 1MB4A 2YMPA 5GTDA 1NHGA 2V9PA 3BWMA 1QZZA 4GAEA 2H18A 2WJIA 4KQEA 4X84A 2HADA 4K9NA 4K9PA 4RWEA 5HJ5A 4MUJA 3G2LA 1UFVA 3GRPA 3RCBA 1IWPB 1GVHA 1R9GA 4FFBB 2YL2A 1L4YA 4GOOD 4HB0A 2GD2A 3WIDA 5HR5A 3NOXA 1B16A 4IMIB 5E3IA 4ZICA 3CRMA 4M53A 5CDGA 3GLFE 4FZ5A 4AMZA 5L4NA 1TJNA 3A2NA 3X2FA 1SWWA 4URVR 4HAVA 4ZYYA 4KB5A 2WM9B 3QVOA 3AY6A 3ZBPA 4DYDA 2QX7A 2OD2A 4NULA 4WZAA 2HWKA 1YQEA 4W8HA 1VE7A 1X7XB 2HYDA 1UOPA 4P81A 2QDKA 2R5WA 1YI8A 2P3QA 1D2CA 1Y1SA 4H7KA 1QVVA 1EQAA 1JB9A 1I1HA 4IHJF 3OC0A 3ZK8A 5J4KA 3OTQA 4FQ5A 4PRZA 1RKUA 1QM5A 2IQ5A 4YRQA 1RPEL 3ETCA 4QAJA 2H6EA 5JSZA 1QDLB 1U94A 4FEGA 5FLYA 2A0XA 3AXSA 1IY0A 2ONZA 4MUGA 5D5HA 4A8PA 2I9PA 1WXWA 2CN1A 4ENSA 2I2CA 2NTYC 4RPKA 4FK8A 3RV4A 4AIRA 3L7KA 3KR2A 4ZU6X 3MERA 3DVQX 5K0TA 4R1LA 3E70C 2IV1A 4ZAFA 3PGA1 5CA1F 3LP6A 1RCTE 3LWDA 3WQSB 2VG8A 4CQNA 5L6LB 2PX6A 3LKDA 4B7XA 1KEUA 3WRXA 3PQ8A 3KPYA 3KLOA 4ENVA 1W4RA 1Y7PA 3E4CA 1O58A 7ADHA 4JI2B 3NBAA 2DHRA 3B51X 3P4YA 4OGWA 5JRJA 2FE1A 1UWKA 4HBZA 4MW1A 3ECCA 4B3DA 3HXQA 1O96A 2QD5A 1KO1A 4BQNA 4HEA1 3DMGA 1XEXB 4XUEA 1E8MA 1WH8A 5CYPA 5EIEA 1ZNWA 2BGJA 3TPFA 4LTNA 1C9EA 1IEXA 1YACA 3ZU4A 3T9FA 1UL1X 2AJCA 1QQ7A 1DIHA 1RC0A 2IY8A 3BMOA 3K9HA 2A6CA 4NBRA 4V0QA 3RB8A 4KQ2A 3GNQA 2H2DA 3LWBA 4QUHA 4XIGS 4LMAA 3LYAA 5AW8A 3PWZA 4JVNA 4ND6A 4UU0A 1P3JA 4LHWA 1T1JA 4U9UA 1JQJC 2JFZA 4Y2VA 2GT1A 4FP9A 3I6ZA 3U4CA 1CVLA 1ZMRA 3EXEB 1PF7E 3O74A 4FHFA 1QOPB 2C1XA 3T7EA 5T3YA 1J6UA 1I7QB 3FDFA 3PE5A 1YK0A 1ZJ5A 4V0RA 3SFZA 4YRGA 4Z54A 1YQWA 1NVTA 1Z2PX 3WB9A 4ENQA 4TZTA 2PANA 1ZLYA 4KWHA 4EG1A 1PIWA 2XYHA 4QUBA 2CEAA 3E9ZA 2EZ8A 2R79A 2QRHA 2IIPA 4EW3A 3MOGA 3B1YA 5C8XA 3CKMA 4YAKA 3K0KA 5GGYA 4ZJZA 1H2HA 1QB7A 1Z6GA 3NEYA 1R37A 2IYVA 5LUBA 2ZRIA 1JNYA 1IB0A 3HUDA 3BK2A 1G8GA 4AX4A 2YQ5A 4Q1CA 4KR0A 4PNZA 2IP2A 3A1TA 4OQLA 1M1NB 2JH3A 3JD0A 1YOVA 3RBZA 4YYEA 4AS2A 4X1IB 5AK6A 2GSWA 3OCWA 4G37A 2Y1CA 4I55B 4GZMA 4UBNA 3ROKA 2ID8A 5U4XA 3T94A 1OLOA 1MVLA 4GLOA 2XRFA 4R2MA 5DXJA 5FX2A 5KX5F 1DVRA 2JGNA 3KAQA 4HDCA 4R1MA 1WUKS 5KJ1A 1ZUD1 1Y6ZA 4LZZA 1CUZA 1L8LA 1Z9BA 5GONA 4P3YA 3D59A 1G1AA 1SD2A 2VF4X 3ZLVA 4AZ0B 3GPBA 2H1HA 4POOA 2C2YA 4AS1A 5ERGB 2FJRA 4RK4A 4H16A 4UZSA 4BFTA 1M34A 4HFMA 1T13A 4XYGA 1C1DB 5HBRA 5K5EA 1WD5A 1QIMA 2A9KA 2ONJA 1WL8A 1FZTA 3MPOA 1EFUA 3CW2A 3LXRA 4Y6RA 2OBBA 4I6EA 1THTA 1Y3AA 5K0SA 3O9ZA 4YN3A 4QOEA 3IOEA 5CNMA 3MMXA 1PT7A 4NCXA 2GF2A 5SYMA 4LRQA 2NUTA 1MMFB 1NXVA 2WFZA 2AV6A 3E3NA 1MO4A 4FXOA 3FM9A 5EYPB 2VWHA 4WKOA 4B85A 1LZLA 3CVJA 5CEFA 2ODQA 3CJTA 3CVYA 3UTDA 2OBXA 3EBPA 1T0IA 1JYEA 1KO5A 1U28A 2AR0A 2ZFUA 3F5SA 1E2KA 2HRBA 1KYIA 4DR3B 1L6RA 2VXCA 1P44A 2LZ0A 2JVJA 3GRUA 3GWZA 3TZ6A 5CFNA 3KJXA 1SC4A 2G04A 2J09A 4Q9KA 4MWGA 1IUNA 4DLBA 1JPNA 2G76A 1ZL2A 2I2XB 3BE5A 4H3HB 4RSRA 3FCAA 4LV8B 4TLLB 5JT1A 3UMYA 4HWPA 3UPUA 4W5OA 2J3QA 1YR8A 2LYJA 1J8DA 3SNKA 1WMAA 5LYJB 1B14A 2GNAA 1IH8A 1JYFA 3I9OA 4KDCA 3NS7A 2N3ZA 1LDBA 5BPHA 1KWKA 2YY6A 1DOAA 5CR9A 5TVKA 3FSRA 2B4RO 1ZVJA 4AMVA 2DCUA 4HAXA 1JFTA 3NP9A 1JXAA 3LQYA 5E6RA 1WXHA 2PMCA 4EPTA 1T9CA 1QZXA 4P7FA 5ALOA 4J90A 1EWYA 3ORSA 4HQLA 4OL9A 4OQNA 5EKXA 1JSRA 2XGGA 3CT4A 4EK9A 1R00A 3R41A 4MRVA 4KR6A 2MWMA 3DCJA 2FCAA 4EQ6A 4F86A 1AF7A 1PWYE 3RAFC 4OJQA 2DKNA 3BBLA 3OQNA 1GN8A 4HGQA 2C7QA 2IPAB 4JBNA 2PD6A 5LD2B 2XQJA 3SCZA 4ANFA 1VJTA 1I5EA 4K2HA 3EC1A 1P2SA 4PYKA 4ZT6A 1JH8A 2X7JA 4RVOA 3THYB 2Q3LA 4F97A 2XGJA 3D3WB 4JB0A 4W5RA 2AZDA 1PFVA 3NHWA 1ODTC 1JEQB 1FDUA 2MMCA 3L8HA 2BR4A 1AKYA 2D8AA 4D8WA 1T9GS 2X4LA 4JR0A 4JP8A 5DGIA 1SU4A 5AM4A 2QZSA 1H65A 3Q41A 2Q5FA 4IQ8A 3M3PA 4YIKA 3QYAA 5KKCA 3DD5A 3E22B 5CJPA 3LPCA 3LQ4A 3QELA 3EFEA 4DNQA 1GO2A 3NBUA 1O4XA 4MUYA 5FTWA 1C3OA 1V25A 2R62A 2Z2XA 4IHJB 1WAMA 3GA5A 3KD2A 5D3MA 5L3QB 3DV0B 3IEKA 5AOBA 3BCUA 2HLDA 1NN3A 2Z9CA 3KLBA 4F3YA 5BY2A 1QX4A 3V34A 3TIGA 5DGDA 4QT4A 4GPTA 3FDZA 2CL7X 3LQQA 4HFJA 2WM3A 1RXWA 3KDAA 4TMYA 1SIOA 3AH8A 5KSOA 4KE7A 5LD2C 2Y71A 3C3PA 3GCGA 4YA6A 1D0SA 1TVEA 2XYRA 3UB4A 5E6UA 4AZSA 1A0OA 1S7GA 2JA2A 4F1JA 2PBRA 4ZANA 4DM3A 4HXFB 1XZMA 2QYSA 4EKDA 1U0JA 2UYCA 4WT7A 2EKBA 1GN9A 1QFJA 2J32A 1ZK3A 2QVZX 3C3BA 3C6MA 4Q5IA 3W6ZA 1F6DA 1U8TA 1XDGA 6ABPA 1DXHA 2ZZKA 4DCOA 1N36B 4GE3A 1GU1A 4TT3A 1PK9A 2P5UA 3E8MA 4HNAB 3HN2A 4I5DA 5IYZA 1G5RA 2G5GX 2Y77A 2UUPA 4MAFA 2VWGA 5JASA 1TCBA 1XCJA 1MKYA 3ELBA 4AG6A 4J2HA 1BFUA 1K7EB 2YOGA 3FOFC 4YJ3A 5H16A 1YVDA 3SXJA 1ZMXA 1IZZA 1WQ1R 1UDRA 3BL8A 3GN1A 3MB8A 4XEHA 4C4RA 2WDZA 3HEBA 3UWDA 3T5PA 4DKXA 1ECJA 1XGKA 2FP4A 3ZKCA 5JBQA 2AOVA 3O8NA 5JTUA 2O5VA 3W79A 4JYZA 1DJPA 2DUUA 1K8XB 2HUNA 1DELA 2ZUBA 5CVDA 1NV9A 4Z99A 5AO9A 3SLKA 4TKUB 5EZ6B 2WI8A 2F64A 4BJ1A 4ADSG 1IN8A 1V6AA 3L77A 3DAOA 5K3CA 2M6KA 3AKEA 3CZAA 3UCEA 1ZJ4A 1KK0A 2PLAA 1I3CA 4Q3BA 4PCLA 4DC1A 1NYLA 3MT7A 4QGFA 3USZA 4JC8A 5AD1A 4N76A 4L9AA 2Q5OA 5CDHA 1FNDA 2RCNA 4LJKA 3O8RA 5DX1A 1UMBB 2GVNA 2WTEA 1RAFA 3G9ZA 1YF3A 4UUNA 1S1MA 2GAOA 4YAEA 5F12A 5IDWA 1ODJA 1JQLB 5DM1A 1D4FA 5EP1A 4LX8A 1PR4A 2PEYA 4D6XA 3FGNA 1N1GA 1Q2XA 2AE2A 2QW8A 1OBHA 1XF9A 4JH0A 1H3NA 2YVAA 1V47A 4X66B 3ROMA 3SEAA 2HIMA 1GL9B 3JQ8B 3CHYA 4QNNA 3E81A 3HKCB 2PFSA 1EK1A 2P30A 2VA9A 4DDKA 4P08A 1W4LA 4KPFC 4IDPA 1XZAA 2B82A 3NJ8A 2PZEA 2M2IA 4O2AB 1XVUA 4FHEA 4BGEA 4GBGA 2XNCA 1JLLB 1SURA 3AUFA 3C5EA 3IKLA 2Z56A 1F7VA 4A2QA 2ZAMA 1WMSA 5CLIA 1I9GA 1Z0KA 2H0QA 4Z49A 4Z51A 2HJWA 2LXNA 2ZULA 4YRRA 1B8OA 4J1NA 4A6EA 3OSUA 2HCNA 1BE8A 2FK7A 1Y1TA 4EB6A 3BMQA 4Q9LA 2Q27A 3E7FA 5K0JA 1C2YA 3D8HA 1EUZA 3U7IA 5JQWA 2ZJ5A 2IVFA 3KEQA 1QQAA 4OM7A 4GEGA 4PYNA 3ZEAA 3RRFA 1WMEA 2Q3FA 1W36C 5HIJA 1NGSA 4O2AA 1X70A 4QOHA 4OFWA 4EATA 2XHZA 2ZLBA 3VZDA 5LPNA 4CMHA 4EY5A 1QNLA 3GJ4A 4PICA 3M70A 4G67A 2QNRA 5HW0A 3Q0EA 4CKEA 4JEHA 1DKUA 4QU0A 2DG2A 2PXDA 1JFLA 2P3OA 4AURA 5EIOA 3LPLA 1ULUA 3PXUA 4GKBA 2MSWA 4M8NE 5HUJA 3NO4A 3QXXA 5C35A 5CNIA 4L4RA 2TECE 2W2LA 3IR5A 4DNPA 4U39A 4YJ3F 1V8OA 1X1CA 2FUG6 2RJOA 2VZ0A 4YONB 4J07A 1BVHA 4MVJD 4MYDA 1SOVA 4GM0A 3HXPA 2B1IA 2M32A 4BPBA 4ETIA 3DUFA 4LK3A 3GXOA 2IOQA 3QPBA 3D43A 4MKZA 3REGA 2OXRA 4E31A 4V39A 2ODNA 3P2MA 2QJTA 3C1OA 3R44A 4X64B 2XXAA 3W7VA 2Q3CA 1TTPB 3GRYA 3HQ4O 4DE5A 1E6EA 1VPEA 2JGDA 3KJEA 4A27A 2QLFA 4UTNA 1A98A 1E5QA 1THZA 1GGKA 3NDJA 2XZTA 5TDHA 1XRNA 4RF5A 2OK8A 3DZDA 3RC3A 5CDSA 1OQAA 4C1NA 3HU5A 3HZIB 2DRIA 3D7SA 4G86A 3WKAA 2R86A 4A36A 3M8KA 3RSGA 1D09A 2YHIB 3DKVA 2EC5A 4ACBA 2ODTX 3IELA 4B09A 1ZN7A 4IX9A 2O48X 1PLLA 1IUOA 4F5WA 1WQ3A 4MWDA 4XQ0A 4J1XA 2SICE 3OUZA 4X94A 4FFNA 2QI9F 1RXCA 2HOQA 3OTGA 1S89A 4GICA 5K3SA 1FDSA 4YXFA 1QZUA 2VDMB 3WJ7A 3PYMA 2CT8A 2OESA 3LC1O 5ALSA 2GLUA 1OE0A 3F2VA 1TOAA 4M86A 2JLYA 3D1VA 3QMPA 4G5SA 4TYPA 2R4UA 5IARA 1KRWA 1DJOA 1ICIA 4H7EA 1W2HA 1SXJC 3FSEA 5BSWA 3WSWA 1ELOA 2G9QA 1O95C 4EPXA 5LNK6 3K2BA 2DT5A 3FLAA 2XNDA 5B37A 1SK9A 3CRZA 3DYIA 5JATA 1XZQA 3BL5A 4D3YA 2E18A 4IOLA 4P4NA 1P80A 1VKOA 6CHYA 1YFZA 5HEKA 3ZQ4A 3BJZA 3MGBA 2EU8A 2AFHB 1PEKE 2XMZA 2PRIA 1EUCB 2J4FA 4DGQA 1HF0A 1BG6A 4B6PA 2BAGA 3DM9B 1X8JA 1E92A 1YQXA 4IIJB 4UD6A 1RJ9A 3UAYA 1X9GA 4B3JA 3MTBA 3GDOA 2Y1FA 4Z4QA 2EQBA 4X4BA 2Z58A 1PR6A 3PXBA 2UU9B 1UR5A 3IE1A 2E3JA 1Z3CA 2IV3A 2CCKA 3WGZA 2WJWA 4NYIR 5KDDA 1ZCZA 1Z88A 1D07A 1UXJA 1BGVA 1N2ZA 2J7PD 2CV0A 1VPLA 1H8ED 2BWJA 1AM4D 2AK3A 3EWAA 3K1AB 1CPYA 4OGKA 3UT5B 3TLEA 4EB6B 1M2FA 3P1JA 4OYYA 2DCMA 5K7SA 4AZVA 1J2JA 1S8NA 3C2QA 5JI2E 5TV2A 1HDXA 3PXCX 3QEBZ 5BXQC 3T95A 3GARA 2GJSA 4JT9A 1GEEA 3G2PA 3LOQA 5D85A 3Q8MA 1E1CB 2XZPA 3R1IA 3SIRA 1UUFA 1WY7A 4EMTA 5JVDA 4MPPA 4FBGA 3GBFA 1EFTA 2IBTA 1P1CA 1P9NA 4LYJA 4B9AA 4B40A 4KAFA 2PSSA 3KVOA 2IU6A 4PU7A 3ITNA 2J7UA 1PL0A 2HV9A 5EWJB 3M6VA 4BE4A 1BHSA 4EHFA 4NOLA 4EA8A 4H77A 1NX6A 1E9CA 3NBZC 3V4VB 1Y4UA 5ALMA 2K5UA 5ALYA 2CHFA 2DMRA 4JBHA 3WNDA 2AG1A 3I52A 1FNSA 2DWPA 1IWBB 3C4JA 4HUQA 4L15A 1JR6A 1XJQA 1SCJA 3IQWA 2QV0A 3W3AD 1T5HX 3VMMA 3MXOA 4BB6A 3SHWA 3L4JA 4ZVOA 1E2MA 2FZGA 4ZU1X 3RAGA 2DPMA 3FN4A 1Y80A 3IUSA 4BV2A 2QUKA 4H31A 5DNCA 5DHUA 2CNNA 4FTWA 2PT5A 3TQSA 5JY1A 1M2KA 2NUTB 2D1RA 3VU0A 1VHJA 1O6ZA 2BEWB 3EHEA 3I73A 1WIWA 2QYOA 4BVJA 4JJIA 4MXDA 4LAFA 3D0QA 4WOCA 3A3KA 1NW3A 1LW6E 4QARA 2CEKA 1M5UA 3FMYA 5EE1A 5CLGA 3R3ZA 1IAQA 2DBYA 4PYQA 5JCXA 1DHTA 3OKZA 5KTTA 1B3BA 1PFWA 1Q11A 4RL4A 5T4HA 3CNLA 2OA0A 4CL8A 5JH7A 5KNCH 1PTJA 1YRLA 4CT0A 1XNJA 4LYDA 4MB0A 3OMWA 4QIHA 1V11A 5GVRA 2XXPA 3K2QA 1XLWA 1XRJA 4J43A 1UP7A 3BRWA 2CFSA 3DL4A 1G17A 10MHA 1A27A 3AL0C 1ZGBA 1KEWA 2PQ6A 2Q5IA 1QFMA 1W30A 1S4QA 2B83A 3IEPA 3OP1A 3QG1A 3ELYA 5TQ2B 4EUFA 5EWLA 1ZNYA 1TJ3A 2P7IA 2PRKA 2X5JO 2MR6A 1B1CA 5HNKA 4JHXA 5BSUA 1ZNXA 4YO7A 2OYCA 3RUPA 4G0YA 4PO1A 4EUEA 2EX4A 3OBIA 1F7UA 3PJEA 2FG6C 4LX0A 2XUKA 2ZBDA 4EI8A 3EGOA 3OCYA 5B3AA 1AGXA 1S4MA 2Y0DA 1EGQA 3C87A 1SKAA 3U5ZB 8MHTA 3WO1A 1VI2A 3CPEA 4HWKA 1QIKA 2I99A 2G7ZA 1K97A 2Y8EA 3N0TA 4X95A 3LGXA 4J0HA 3PG5A 3DCIA 2ZW9A 3U7GA 1A04A 3QHPA 1Z26A 5HGJA 2CMHA 4ALMA 1GKLA 1J7JA 5TRTA 3KQQA 2OC4A 4JLPA 2DVMA 1FLVA 2PS0A 2IBSA 3C5VA 1U8CB 3S28A 2DTEA 3F6YA 1DTSA 1MO2A 1OGJA 1U5AA 3HY4A 4UBMA 2YS7A 4FQ7A 4ARSA 5DYTA 3C24A 3T7IA 5AI4A 4JU8A 1OPRA 1EZ1A 4NJEA 3VH3A 1RAEA 4N3GA 3RQSA 4FBIA 4D74A 5EPOA 1ZHFA 3WDLA 2VDUE 3AIIA 1HEUA 1J0AA 1UJNA 3B89A 3CNOA 4P34A 1NBOA 5TMDA 4G5GA 4UM5A 4B4VA 5JJ5A 5JROA 3TNYA 1WPGA 3FWZA 2ARKA 2QKYA 3Q5DA 4Y8VA 3UHAA 2C1EA 3IXQA 1T3LA 3C70A 1C7EA 1N5IA 2IUEA 1H5NA 5FEUA 4FD2A 3MJEA 2FMXA 3EBOA 2H85A 2B2XA 2J7PA 3P9YA 2IV7A 3SX4A 3TRDA 1FW8A 4KSYA 4B4WA 3PB3A 1J00A 1VKZA 5ARCA 1GLNA 3QELB 3KPWA 1QRRA 1I24A 1YDGA 2FRXA 2HLNA 4RX1A 2VRWA 2HA3A 4DV1B 2H4FA 1OC2A 5GZ6A 3OOYA 5TGZA 1N0HA 4IS3A 3IVMA 4ND3A 1QYIA 4LXQA 1TIPA 4YAIA 3M81A 2GUGA 1NJFA 1CNEA 4DL9A 2F59A 1TRKA 5HIMA 3JATA 2IZZA 2C99A 5F35A 4CODB 3ZZ0A 2V1XA 5CBPA 1PGPA 3DHWC 2HH9A 5G40A 3RYFB 3UWSA 5I8PA 4PZUA 1R50A 4PANA 2C78A 1XB2A 4LE1A 1BFDA 1M1ZA 1YUBA 3DC7A 2P0YA 4YXWA 4ZVUA 1H1TA 2R8RA 5L8VA 2AWNA 2XB9A 3Q3VA 1N4DA 4QJ3A 2A9FA 4KEAA 5KNBH 3KE8A 1EFAA 5JNUA 3CLRC 1XN4A 5HF6A 3PRYA 5HGXA 5E6RB 3O9XA 1R4MB 3W5BA 1YDEA 1NJ6A 1X80A 5JV5A 1NJ8A 4OM8A 1WX1A 1DWOA 3D64A 1IN5A 3WNBA 1B2LA 2RH8A 2ZUDA 5E7IA 2XCQA 3TZBA 1PSZA 3BE4A 3TW6A 4KUHA 2ISCA 1ZIPA 3BERA 4LJ8A 2PYIA 1FUKA 4D9FA 2R2GA 1P6QA 1Q1QA 2L17A 3A2KA 5LIRA 1EHYA 2C5BA 2X3YA 4PHGA 3RJTA 1RXYA 1ZMTA 2Q0SA 3GY0A 5K2MA 3SYTA 2W5UA 4CHTA 4EF5A 3TPZA 1HR0B 3E1SA 5GINE 2C3YA 3A3PA 4ND1A 3FOEC 1NBEA 2F1JA 2C98A 2IYLD 3DS8A 4FFBA 1E9FA 1DNPA 4FYIA 4B17A 5CLHA 1H6AA 4IUCS 4NCJA 3DG9A 3SHOA 2GA9A 4A4DA 5I7FA 1ADJA 2J85A 1T1GA 2VTDA 2P1ZA 5ECDA 1WH6A 5DP2A 5F77A 3RYTC 1N5DA 2PS3A 2PM8A 2ILVA 4Z9XA 4F71A 4QYWA 4JY7A 4BAZA 5IANA 5LZ5A 4UEQA 1DG9A 4H60A 4CCWA 2ZE6A 1IHDA 4IDHA 1W73A 2ZIFA 4M8KA 5HIAA 1Q7EA 2FZEA 3ROGA 4E08A 5AW6A 4H4EA 2HKIA 5EQTA 1Y8QB 2W6PA 4KAAA 2AN4A 3SP1A 5JJLA 3PP8A 1EXNA 2YBDA 5ULLA 4M0LA 2CWWA 1ZOIA 2KZ8A 3IMFA 4JJGA 3U0BA 1ZI9A 5JJBA 2C94A 2W2KA 1WB4A 2Q07A 3PKJA 1T0JB 3CUWA 4EMBA 2D1SA 3AFNA 4CDRA 5H9VA 2AJLI 1UBEA 4OQYA 5AJHA 3T9BA 3ZDBA 3CRQA 2WV7A 3S40A 4KHPB 2OCYC 1QKIA 1X1EA 2JLRA 1IBCA 1SHTX 1KAEA 2GARA 3EIOA 1HT1E 4XSVA 1D5CA 1HKHA 1Q7BA 3P5BA 4LJAA 3OX3A 5IUNC 4RSHA 3AGPA 1J42A 4ZCTA 2BTEA 1RRCA 2BMJA 3C1UA 2IWHA 2R00A 3ABZA 4RDXA 4JI1B 3R09A 3LSTA 1SXQA 1G8MA 2XVYA 1SOUA 3IIMA 2PSDA 3ZOZA 4AMUA 3ETEA 3H5LA 2OG2A 4QTTB 3NONA 2C54A 2DWOA 2GAJA 3R5HA 1Q3HA 2ZRHA 5DBFA 4UUBA 5CW2A 4YJHB 3W8NA 1TTQB 2ORYA 1HDIA 4G0OA 2LD4A 4D57A 1BMTA 1XDUA 3DW1X 3GPIA 2I4OA 1HG0A 4QBGB 4R1OA 3AF1A 3TFOA 1KYVA 1OZHA 2NZWA 3ZCXA 1AH2A 4RDIA 4TTIA 3KUKA 2FW7A 5F3RA 3NCTA 5LXTB 3AZQA 1V45E 1OSLA 3GXBA 3D4PA 3IP3A 4E1VA 3P20A 4NAUA 5ADUS 1QKJA 2OB1A 4H1VA 2C3MA 3ENQA 3IUJA 4IUDS 1DTWB 3G68A 3I5AA 5C4MA 2UYQA 2ZUFA 3NDBB 1K3TA 2JIQA 4YHHB 3F3MA 2QIOA 4BZZA 5SYNA 2R44A 3D6VA 3DEJA 2FLKA 3IE0A 3EPRA 3NQ41 5COQA 4PLWA 4YPOA 1K4MA 2ZATA 1LQCA 1NYQA 3OJ0A 1HDEA 3AY3A 1LPBB 3NRCA 3FF4A 4BTLA 1SNYA 1QH1B 2DFPA 2P5YA 3AI2A 2Z8ZA 1N0WA 4MA0A 4AJEA 5FOTA 4C0JA 5KB3A 2NO9A 2JGAA 1SJ9A 3N8NA 1JEYB 1BS9A 1JR3D 1NHWA 2X4DA 4YP9A 4WZBA 4IWNA 2BBTA 1TYEB 4QPZA 4AJ2A 3TMYA 3OWOA 3ZWQA 4KRYA 4G0QA 1QDUA 5THQA 3ZEIA 2NW6A 1DULA 4S04A 3CEMA 3DXZA 2X77A 3WNZA 1R8QA 2AI1A 3UAXA 3F7OA 1O8BA 3EIEA 1J97A 2M1XA 4ZI5A 1CEQA 3SJBA 2W4IA 2XCRB 1ZCAA 3D5EA 2Z0MA 2FX3A 4ZODA 1RWMA 1YDHA 3IKTA 1P2TA 3CXUA 4RE6A 1G5PA 1ABEA 4Q9JA 1U8XX 2GN1A 1Y6FA 4Q3OA 3T7KA