2AXZA

Crystal structure of prgx/ccf10 complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
306
structure length
306
Chain Sequence
b'MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 110
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axzA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axzA02
3MLFA 3KJXA 4YBAA 4F8DA 1IC8A 2PUDA 2AXUA 1SQ8A 4O8BA 3L1PA 3H5TA 2EBYA 4PU4C 3SCGA 2PUAA 4J1XA 4Z58A 1PNRA 1ZPQA 2KEKA 1AU7A 4NDWA 1WETA 2CSFA 1BDIA 1UXCA 1X2LA 1ZZBA 3FYAA 3EUSA 3UFDA 4FN3A 3HZIB 1UTXA 4IWRA 2PIJA 3KZ3A 4I8TA 3CECA 4I6TA 3R1FA 1Y7YA 2PUCA 3OQOA 4J1WA 1LQCA 2HSGA 4X4HA 3JXCL 2MQKA 1NEQA 1DW9A 3QF3A 3U3WA 1UXDA 1RZRA 2KEIA 1Y9QA 1POUA 2FJRA 3BDNA 2PUFA 3LISA 2D5VA 2A6CA 4MCXA 2IVQA 2WUSR 2XSDC 3QYXA 3OQMA 4Z5CA 2CROA 3ZHMA 3B7HA 3G5GA 3QWGA 1ZZ9A 4X4IA 2LYLA 3OQNA 1QP4A 3FMYA 2LYQA 2WIUB 1RIOA 2PUGA 2XJ3A 3VK0A 2LCVA 2BNOA 3DNVB 3GN5A 4Z5DA 2R1JL 1RZSA 4YG1A 2BJCA 2H8RA 1OSLA 2IV1A 3FYMA 4PU3C 1B0NA 3CLCA 4X4EA 2BNMA 2OR1L 1WIZA 3IVPA 4X4CA 1QP7A 1JFSA 4IVZA 1PERL 2B5AA 3CROL 2AXZA 2AWIA 4MCTA 3QQ6A 4I6UA 1ZZ7A 1L1MA 1RPEL 1ZAYA 1PRUA 1ZZCA 4YG4A 4JQDA 1BDHA 2GRMA 2ICTA 4GHJA 1GT0C 3D1NI 3BD1A 5A7LA 2EF8A 1R69A 2LYRA 1QP0A 1OCTC 1LMB3 1WH6A 5K98B 1JFTA 2PUEA 4X4FA 3S8QA 1ZZ6A 4YG7B 3GBFA 4FBIA 4IA8A 2O4AA 2PE5A 4X4GA 2IU7A 2AW6A 1QQBA 4GQMA 1ZS4A 1NERA 1ZVVA 2HINA 1E3OC 2GRLA 1JWLA 2IVBA 1JH9A 1LCDA 1ADRA 2XCJA 1CJGA 2AUWA 3ZKCA 2PUBA 1VPWA 1ZUGA 3F52A 1PRVA 2OFYA 2L8NA 4JCYA 3OMTA 1PRAA 2BNNA 3JXDL 3TRBA 1CQTA 2GZUA 3BS3A 3GN5B 2LYSA 1DWKA 2XI8A 2KZ8A 4PU8A 4YARA 2EWTA 2PPXA 2R63A 4JCXA 3O9XA 1RZRD 2LYJA 3G7DA 1XWRA 1ZZ8A 1QPZA 1LCCA 1EFAA 1WH8A 3LFPA 2LYPA 3KXAA 1X57A 2O38A 2AXVA 1R63A 2JVLA 1HF0A 3F6WA 2IVGA 3PXPA 4I6RA 4X4DA 2MEZA 2XIUA 3JXBC 3OP9A 1LLIA 2IUOA 4PU7A 2LYKA 4OB4A 1QQAA 3F51A 3RZZA 4Y42A 3ZHIA 4Z59A 2ICPA 2L49A 4Z5HA 2JCGA 2O49A 1YSEA 4X4BA 1O4XA 1S7EA 3SCFA 3SCHA 2KEJA 2KPJA
chains in the Genus database with same CATH superfamily
4N5CA 4GYYA 1IXVA 3DXMG 4U8YD 5C1DA 4A1SA 1DC2A 1AU7A 1N4RA 4HRAA 2V0PA 2EQXA 4MBGA 3HXDA 4L2YA 3R1FA 3MCXA 3RRMB 1H2UA 3IBEA 4UI9C 1E8WA 3FWVA 1MHQA 4EECA 3JXJA 3EHMA 2CROA 3TEPA 4C9BB 2GW1A 4WUYA 4YVOA 5ENTD 4GCNA 1EDUA 2ODRD 2I9CA 4PU3C 1AP7A 3AG4E 2PXUA 1NA0A 5AAOA 2AXZA 1NZNA 3NZLA 2ZGGA 3L08A 3RKVA 5K98B 1O1RA 4I1AA 4YG7B 3EHQA 2ETBA 4U04A 2KM4A 3D9JA 3URZA 3ZPXA 4AP2A 3QJZA 5CRUA 1ADRA 3KD7A 1VPWA 3Q79A 2Y3AA 4TXRA 2PXTA 4TRQA 4GTTA 1DWKA 4HOUA 1N4QA 3T5VA 3CSFA 4RVBA 3FULA 3QNKA 3FUKA 3E33A 3JQ1A 3MV3B 1D9SA 2XIUA 3JXBC 4G2VA 4TV3A 4TUUA 2XXPA 4PU7A 3OXGA 4I9CA 1JCQA 2JLBA 1X81A 4DX6D 5ARFA 3V2XA 4B94A 4H7YA 3ZNGA 1WDYA 4HRMB 4NIKA 1LF8A 3C72A 3MEJA 1BDIA 4MKTA 5M72A 3CECA 2WXQA 1RW2A 3L22A 4EKGA 2KXPC 2I1JA 3CSTA 3BQOA 4TXQA 1N0QA 4L7TA 1N4PA 1SA5A 3S7BA 1Z3XA 3A9YA 2WXMA 2HFZA 4OYSA 2KBXA 3LJ3A 4XX5A 4B89A 2HCSA 2QYUA 1WIZA 5D0OD 5T4YA 3WG7E 2B5AA 1N52A 2R03A 2HM8A 1JCRA 4YVQC 2LSVA 3ZRHA 2XENA 1FT1A 1HG2A 2PE5A 4X4GA 4BT8A 1SZ9A 2DVWA 2WXJA 2GRNB 4K5CA 2CFUA 3ULQA 4Y6CA 3VLDA 2AVPA 3JXDL 4GZ6A 3C98A 2KZ8A 3PE5A 4J8YA 3CVQA 5FIOA 3ZVVA 3PH0C 3IHVA 4XI9A 2LYPA 4F7AA 2DWZA 3Q4AB 3TWXA 1JUQA 1OY3D 3PXPA 4I6RA 4EZIA 3ASNE 1H6OA 1BLXB 3D9NA 3F51A 3RZZA 3PVLA 1H19A 4N3CA 3L54A 3TGOA 4O1PA 4U63A 3O48A 1YSEA 1JPLA 3EU5A 3SCFA 2KEJA 3ZHEB 4O60A 5D2MC 3TXMA 5CBNA 3W9GA 3H5TA 3OXLA 4KYOB 5ENQD 5AIJA 1ZPQA 1WETA 1KT0A 1K3ZD 1ZZBA 1TYQG 3SD5A 3EUSA 3JUEA 2IJGX 5EYLA 1HE8A 3DBSA 4RLYA 2MQKA 2LLVA 3HVEB 2F8YA 2FF4A 2XSDC 3CVWA 3ZHMA 1UG3A 3OQNA 3C3OA 3ZYLA 3DNVB 3HHMA 2H8RA 1OSLA 3ZEFA 5EX3A 3ZGQA 2BNMA 5G05C 1UJJA 2VGXB 3CHQA 4XE0A 3QQ6A 4YG4A 2J8SD 2WM9A 1YCSB 5KJKA 1QP0A 2M4HA 2FULA 1DULA 1HH8A 2LAIA 5CBOA 4DLQA 4LSZE 5T8IA 2J4BA 1YA0A 4JPSA 4F6RD 1Y6IA 2WXIA 3Q73A 2YNQA 1V54E 4J8SA 3RO2A 3MV2B 3ZXPA 2PPXA 3PZ4A 3CVVA 4F53A 1LCCA 3LQXA 3FH8A 3ZFWA 3C3QA 1TJCA 1S63A 2DBAA 5CCLA 1BD8A 3OP9A 5DTQA 4JEUA 2M63A 2KATA 1O5MA 3UKUG 3RIBA 4G26A 3RO3A 4KZ0A 1VDYA 4BETA 2OOEA 1BPOA 3DPDA 2ZU6B 4L1BA 1HF8A 5FZSA 2WXKA 3SO8A 4ER7A 1TEZA 4IWRA 4LNUD 3T8MA 2J08A 3G2TA 3I3NA 4KT6B 2CHWA 3KAEA 4X4HA 1E7VA 1NEQA 3G0TA 1Y9QA 4JHJA 3I5PA 2P9PG 3M9LA 3RJVA 3PRZA 4GMJA 3TL5A 4DE9A 2FBNA 3L17A 4YG1A 2LNMA 3PNLB 2IY0C 4OVUA 2Y0BG 1LD8A 2PM6A 4RG6A 2L1PA 1MX2A 4GTMA 2AWIA 1ZAYA 2C0MA 3CHSA 3FTYA 4GTRA 5HI7A 5DTRA 2XEHA 4ZHBA 3MX3A 4AXHA 3ZIMA 2X6IA 2XXAA 3ULYA 1ZVVA 4HS2A 1E3OC 2B0OE 1CJGA 3ZKCA 3ZU7B 3F52A 1L5JA 4J8DA 5CRVA 1B89A 1CQTA 4H7XA 1ELKA 3W9FA 2XPYA 4HRNA 5LX8A 2VSXE 3IV0A 1TNZA 3S7FA 5JJ7A 3D3MA 3TJPA 3FUDA 3PZ3A 5LP0A 2DYSE 2F0YA 3S2AA 2V5FA 1LLIA 3EHNA 4K0RA 1E96B 3SHFA 1E7UA 3ZN3A 3ZHIA 3ASOE 2WXFA 3TWQA 5LCWJ 3LS8A 1X5BA 2L6JA 1O4XA 1NFIE 2WXOA 4UQZA 3MEKA 4NQ0A 3L1PA 2RFMA 3SI5A 4FP7A 3U66A 1PNRA 5CECB 3C5RA 5DRYA 4XKBA 1OT8A 3KZ3A 3QB2A 5KWDA 3EIQC 2AJAA 4I17A 5E75A 4EZKA 4LG6A 2KCVA 3S7DA 3OQMA 5D66A 3CKCA 4A3VA 2OCCE 3QDNA 2XGOA 2ETCA 3KSLA 1MQSA 3GN5A 3APDA 3TWUA 4DJAA 4HORA 3WXXA 2IV1A 4WAFA 1MZCA 2RG8A 3EHRA 3CR3A 3FUNA 1TN7A 1RPEL 4ANXA 3DXKG 4I43A 3SFXA 4QQIA 4LRZA 4CEMA 5KJLA 1DCEA 2XEVA 1NL4A 2JEKA 2XQ0A 3R7QA 4EBAA 4G23A 2VTBB 3TWWA 1DVPA 2F37A 2HINA 4YNDA 2LUHA 4FA6A 2E2EA 3U9WA 3V2OA 1TNOA 2PZIA 4GZ3A 4ZFHA 4DX7D 4I6EA 3CVLA 5A23A 1OWPA 3O9XA 2CG3A 3JUIA 4LERA 3LY7A 3KXAA 5ENPD 3IXEA 3S7JA 3CK9A 2WQ6A 5EN5D 2QYJA 3UMVA 4DUIA 3ESKA 1N9AA 4Y6WA 1OCRE 1QZXA 4OB4A 3JCKC 4U96D 4JXTA 3R9AB 2PXLA 4GZDA 3ZXSA 4I9EA 1S7EA 5KNHD 3RRNB 2KPJA 2HO1A 1IC8A 4GTPA 4GTVA 4GTQA 1A5EA 1H2TC 3V30A 4CRWA 2ZXWE 4Q96A 1UXCA 3QKYA 5FQ8A 5ENSD 2R2LA 5CMWA 3UKRG 5JMND 4I2WA 1NP7A 3NBNB 1N4SA 1BI8B 2FJRA 2J7WA 4B93B 4FJZA 3ASGA 4JVSA 3RRUA 3FUMA 3SFZA 1KZOA 1D8EA 1K8KG 3DSTA 5AARA 4Q69A 3CLCA 2P9SG 4J8FA 2BF0X 2DCPA 4GTSA 2YBDA 4HLEA 3ABKE 1FT2A 3X2QE 4EZLA 1Z6TA 2MOWA 2Y4TA 3TXNA 3CHRA 1LCDA 3NAWA 3DSVA 5AQ9A 3MGBA 4EK9A 4MLPA 3RK6A 2X3MA 2V4HC 4XI0A 1PRAA 5DT2A 3TRBA 1UJKA 3LVQE 1PC2A 3EIJA 3ISMC 2J9QA 1WH8A 1HZ4A 1OWNA 4RSYA 5E76A 1IHBA 1X57A 4C48B 3FU6A 4Z68A 3G2SA 3QAQA 2CHXA 2P9KG 4A55A 2LYKA 4BT9A 5ANLA 2XS1A 5BNWA 3FTUA 4X4BA 5FT9A 2XRZA 1O1SA 5DTMA 4V3IA 2WXHA 4JA7A 3MKRA 3FEYA 2J07A 2PXVA 3APFA 3HZIB 3CK8A 3ASHA 5AQ7A 2WVIA 1IHGA 4I8TA 3FUFA 2XRYA 3OQOA 1E90A 1LQCA 1S0PA 4CYMD 2PXEA 1DW9A 4KXKB 3FDHA 2EIJE 2X6KA 2XJ3A 3E32A 3PZ1A 3MJWA 2PL2A 3FU0A 1IKND 4DX1A 3SX0A 1ZBPA 2OVFA 4ANUA 1ZZ7A 1L1MA 4PDXA 3UM3A 1KLXA 4GHJA 4EPZA 4G25A 3S8QA 1ZZ6A 2JQEA 2WMNA 2WQ7A 4BY6A 2IOSA 2IU7A 3PDNA 3FTWA 3AU4A 2HYZA 1JWLA 5G2NA 4E85A 2IF4A 3CHOA 2J4DA 1IQRA 3SBTB 3P1UA 1U3CA 3ULEG 4HNAD 5KCMA 1JWFA 1QPZA 2IFUA 2XGSA 3EDTB 4GCOA 3Q15A 2IONA 4B8AA 4JHRA 1H6KA 2EILE 4EQFA 2DYRE 4Y42A 4DX2A 4BTAA 2JCGA 2R59A 1Z3YA 2H6IA 3SCHA 4N3BA 3AU5A 1Y8MA 1GW6A 3FU5A 3KJXA 3GZ2A 1MJ0A 2PUDA 3PEUB 2P9LG 4ER5A 2EBYA 4PU4C 1HQ1A 2GROB 5CCMA 4NDWA 2I1KA 1SW6A 4DE8A 1JCSA 1G3NB 4AEZC 4J0UA 4LNGA 4JW1A 3HDXA 3SGHA 4I6TA 1Y7YA 2V8SE 4ILIA 4I2ZA 3ML9A 4B8CB 3GZSA 3NROA 2IEJA 1HX8A 2WUSR 3QYXA 3QWGA 2BEDA 5G55A 2Y69E 3ESLA 5AYWD 3R7RA 2KZTA 2VSYA 2YINA 4U0UA 4L23A 2BJCA 1XGWA 2R5SA 4YDYA 3FYMA 2WPVA 1HXIA 2WMOA 5IY5E 4X4CA 3BUAA 4CDNA 1PERL 5BUZA 4I6UA 4FJYA 1PRUA 3DSUA 4J7WA 1NA3A 3HXFA 4UWLA 2XZTG 5BT1A 3OWQA 2QZAA 1TJFA 3GZDC 3OXFA 3J5QB 3UT4A 1H2VC 4RQIA 4EZJA 4X8QA 1MYOA 2AUWA 2X6JA 4I6GA 2BNNA 2XXQA 2GGFA 3ZYQA 3BS3A 2XCBA 3B13A 2B6CA 1OWLA 1XWRA 1MX6A 4OVVA 1YMPA 5CEAA 2QY7A 2ONDA 4O1OA 2I6HA 5EYPF 3FHEA 3Q5MA 2X6HA 1HG5A 3E4BA 4HOQA 4JD2G 1QQEA 4HI8A 3UT7A 4UWFA 1XNFA 1N0RA 3DEOA 3A9ZA 3ABLE 1AWCB 1SQ8A 3O4ZA 5J08A 4GU5A 2PUAA 2R02A 3CQCB 4F1SA 4AOFA 4ANVA 1UOHA 2LAHA 5ANRA 3SBSA 4ABNA 4FN3A 3PZ2A 2J7UA 3PEVB 4LNBA 2PUCA 1YYHA 2NYJA 4U07A 2VQ2A 3MKQB 5J90A 4JA9A 2IOLA 3GYZA 1K1AA 1RIOA 1TNBA 1UN9A 3FP3A 2PXPA 4K03A 4A63B 2J09A 2JABA 1EYHA 3BU8A 4LCTA 4A1GA 2C2LA 4G1TA 4UWKA 3Q78A 3T8KA 4D10C 2KCLA 2YHCA 2QFCA 3GZDA 3D1NI 1KT1A 3HRAA 3LY8A 4OAUC 3LJNA 5AN8A 3UIPC 4HOSA 4FBIA 4F3VA 1TN6A 2P2CP 5G04J 2OFYA 4JCYA 2PXBA 1E8YA 1KPSB 2J49A 3UI2A 4E6HA 3DSSA 3I4GA 1SZAA 3OKZA 3L13A 1WY6A 4FLHA 2DIWA 4HOTA 4PS3A 2JVLA 1HF0A 3HVEA 4OAVB 3FTSA 2H6HA 3C3RA 5EKQD 2VYIA 4FHJA 3EU9A 2V5QC 3TAXA 2WXNA 3ASDA 2IU1A 3D9IA 3AS5A 4GTOA 2VGXA 3D9LA 4MS6A 2KEKA 4P29A 2CSFA 2LO6A 4IRUA 4GPMA 2LXMA 3NOCD 2XZDG 2HSGA 3JXCL 3FTVA 4WNDA 4CT4A 2KEIA 4G8KA 4U0ZA 4MCXA 3UM0A 4HRLA 3BEEA 4U0SA 1ZZ9A 2PUGA 1WAO1 2BNOA 5ENRD 4BX8A 2R1JL 2LSUA 4NACA 3CLJA 2FO7A 3Q49B 4KBQA 5LCWC 4HBDA 1JWGA 3PS6A 4UQYA 5LOZA 4ER0A 3CROL 4UWHA 2CG2A 4XIFA 4AV7A 2X38A 4J6IA 2PUEA 4A3TA 4ACLA 1HFAA 1U3DA 2QC9A 3G2VA 4G8LA 3AAAC 3V31A 4OBMA 2WXLA 2WB2A 4GQMA 1NERA 4ER6A 2EINE 4UWGA 2C0LA 3NXHA 1ZUGA 3NDBB 5B1AE 3TWVA 4YARA 2EWTA 2P9IG 1NW3A 2LYJA 3VWSA 3ML8A 4URKA 3P2BA 2Y1LE 3RAUA 3T5XA 4BWRA 3B7TA 3CKBA 2MEZA 4WNEA 3E37A 2IO3C 4UUCA 4NRHB 3U64A 3ZPJA 4BTBA 2VEOA 4Z5HA 2O49A 4GB9A 1QYMA 4IULA 2UY1A 3BG1B 3D9HA 3DM5A 3OTNA 1V55E 4TUMA 4EQZA 3SCGA 3CEQA 3ZW3A 4J1XA 2VSOE 2NC9A 3UFDA 3SF4A 3KEZA 4G24A 5BW8C 3CIAA 4FU3A 2Q7FA 5A7DB 5D0QD 3FTZA 5ITZF 4W9RA 2P58C 1OCOE 3QOUA 2DZNA 1UXDA 1DCQA 3JYSA 4HI9A 2OEWA 1MFQC 3LISA 4ATGA 4GAAA 2LYLA 5H7PA 1WG0A 3L9TA 4FADA 2PM7A 3EUVA 2PXFA 5FQ6A 4PS8A 3AS8A 4C0MA 4ANWA 1R69A 2BUGA 1JFTA 4YDOA 4FC8A 3PUJA 3CVXA 4LEUA 3SFYA 3QFIA 2GRLA 1N94A 1Q2ZA 4XKCA 4WWNA 4KVOA 3HG0D 2A5EA 4GMLA 2GZUA 2LYSA 2R63A 3D9OA 3CVNA 4MRUA 2ETAA 3UINC 1SVXA 3KL4A 4ME2A 3CVYA 4FLBA 4UI9J 2IVGA 5FQ4A 4KMOA 2HE0A 3IHYA 2IUOA 1DNPA 4JZYA 2RD0A 1P5QA 5FZRA 3TWTA 3ONKA 3Q47B 3VLFA 1UN8A 1HU3A 4HQDA 2H6GA 2R17C 3AJIA 3QWPA 4GYWA 5JJ6A 3IKOB 2FI7A 3JXIA 1TR4A 2PIJA 3FH7A 1O1TA 2EIME 5KBAA 3VTXA 3HXBA 2VTBA 3GZCA 5CEDB 1BI7B 1U2VG 2FO1E 3FFLA 4EKIA 4PUCA 1QBQA 5AQBA 4Z5CA 1TNUA 3G5GA 4ATZD 1QP4A 5EILA 4EBAG 2LCVA 5BV0A 1QB2A 2E0IA 2OVBA 5EX0A 2KZTB 3IVPA 1QP7A 5LFAA 1JFSA 3CHMA 1W3BA 3SQVA 2KCKA 3NB2A 4I6JA 4JQDA 4JHKA 2ICTA 3BD1A 2EF8A 3NQPA 5JJTA 2EIKE 5KJNA 1LMB3 4X4FA 2DZOA 3DEPA 4AIFA 1ZB1A 3Q9NC 3V79K 4F1PA 2IVBA 2RFAA 3D9PA 2PUBA 2Y4UA 4R7LA 4CZ2D 2L8NA 4N2SA 5BXOA 1Z5SC 3T9KA 2P9UG 4JCXA 5A6CA 4K5BA 3VLEA 1EFAA 4CGVA 5ENNA 3B7BA 4U7EB 2O38A 3ASFA 2NXPA 3B7UX 1KZPA 5JHBA 3FU3A 1N54A 4RG9A 1QQAA 3CV0A 4Z59A 3G2UA 5HQ8A 5FTPA 1OWOA 1NI1A 2LXLA 3L82A 4BESA 3DPYA 3VTYA 3HYMB 1U2ZA 2PXDA 5CERB 4YDEA 4YDWA 2PNNA 4L9PA 2AXUA 4O8BA 2GRPB 5CHEE 4XZ4A 5FQ7A 3FYAA 3BG0B 2R05A 5KNGA 1UW4B 5HRYA 5JHAA 2BKKB 4I1MA 3U4TA 3QOXA 3Q7AA 1RZRA 5B1BE 4CDRA 2PQRA 1FVHA 2D5VA 2A6CA 4U8HA 2HR2A 3TELA 2HCNA 4KVMA 4AJWA 4CCAA 3B7RL 4Z5DA 3R09A 3FY4A 4U95D 1B0NA 1OCZE 2MHKA 2XEEA 3SY2A 3RSEG 4L2LA 1PY1A 5DIZA 3DSWA 2X6FA 2MYOA 4XEIG 3PNTB 1IQUA 1FCHA 5DSXA 2MXDA 3FTXA 2AW6A 3I4RB 5EIBE 2VJ8A 5AENA 1FPPA 1JH9A 1LD7A 2XCJA 2WXPA 3LEWA 4N3AA 4ACKA 3OMTA 1S70B 4AY5A 1H6PA 3E30A 4APFA 2LLWA 3SR4A 3ONLA 3UT8A 3NZSA 3MZLB 3APCA 4O6FA 3TWSA 1R63A 3CK7A 3ABME 2XPZA 4FHKA 3NF1A 5CMYA 4X4DA 3ZKJA 4CT0A 4JEHA 4GA1A 3UWPA 4CGWA 3R9MA 4CDMA 5EDSA 2YQ8A 3PUKA 3TG4A 3A9XA 4NURA 4Q94A 3HXCA 5GAGi 5G05J 4ILGA 4BFRA 4WWOA 3AS4A 4Z58A 5FWQA 3GUUA 5FINA 4ER3A 2PXQA 1UTXA 1IYGA 3LPZA 4N2QA 2A4ZA 4J1WA 3FUEA 2P9NG 2H6FA 3ZUVB 2XGMA 3B7SA 3F6QA 2PQNA 2UWJG 3KSQA 3BDNA 2PUFA 1SQMA 5BV1A 4GA2A 4X4IA 1BU9A 5DBKA 3FMYA 2WIUB 3VK0A 3LXUX 2LNIA 3OAWA 3GZ1A 3AG2E 3LDZA 1OUVA 4JC8A 5B3SE 4X4EA 5ENOD 3UM2A 3J5PA 4IVZA 3LVRE 1A17A 4M3OA 3IEGA 2I2OA 1OWMA 1GT0C 2LYRA 1OCTC 3UUXA 1WH6A 4ILHB 3GBFA 4GPKA 4IA8A 2V3CC 2O4AA 2FFHA 2WXRA 1S64A 4PS7A 3HXEA 2CHZA 2PXKA 3FUIA 4C0EA 2MRIA 5DRTA 4HFGA 3JQ0A 4M7CA 3NZUA 3GN5B 1N11A 4N5QA 4BSZB 2RKKA 4DK5A 3LFPA 1INZA 4B0ZA 1LTXA 4UI9K 3UIOC 3UM1A 2AXVA 3F6WA 5BPPA 1FVFA 1D8DA 3ZHEA 2L49A 5BXUA 2VGYA 4K5AB 4DI3A 4KZCA 4DPRA 3QARA 4BERA 3SZ7A 4YBAA 5G04C 4TXPA 3ENEA 2WXGA 3CQGB 4AM9A 5EIDA 2UY1B 3UXGA 5JUWA 3PREA 1N95A 1WM5A 1ELWA 2GRRB 1E8ZA 1H0AA 3DSXA 4HVBA 2KC7A 3DWLG 1ZU2A 4DRXE 3N71A 2OEVA 3UPVA 3KS2A 3U3WA 1POUA 2ZISA 3LYAA 2VSNA 4JB8P 1SA4A 2YHEA 2LYQA 3D9KA 5FZQA 5C2YA 1RZSA 3Q7FA 3ZYKA 3QWVA 4WWPA 3FEXA 4DI4A 4AVXA 3QOWA 4HB5A 2XCCA 1OCCE 2F8XK 2ZIRA 4DX5D 4EHMA 4GYOA 3PZDA 4WVLA 1BDHA 2GRMA 1EPUA 4QFVA 3KEAA 5FJYA 4IN3B 2XPIA 4GA0A 1QQBA 3L16A 4LUNU 2BKGA 2BTDA 3CGHA 4J8EA 4Q2JA 4PU8A 3NOGD 5GAHi 1ZZ8A 3GW4A 3QWWA 3AG3E 4U8VD 4UQXA 2L0TB 3ME5A 3FUHA 2XS8A 1E8XA 1TNYA 3HIZA 3UTMA 4BX9A 3RU0A 4WNFA 3AG1E 4DLOA 2FEZA 3MKQA 3CHPA 5ARGA 3QC1A 3Q75A 1K1BA 1RZ4A 3MLFA 2NSZA 4F8DA 3LCAA 2IQCA 4HXIA 3G2WA 3LY9A 2IO2C 1X2LA 2L9BA 3D9MA 3DRAA 3TG5A 3FUJA 4IYPA 1HO8A 3QF3A 2CFZA 3TFLA 4HLLA 3PE4A 3LKUA 2IVQA 3B7HA 2VGEA 4JL0A 3Q9UC 1EF1C 3B95A 5AJLA 4WNGA 5HS0A 2OR1L 3CVPA 1QNFA 3E34A 2OV8A 4GMRA 4MCTA 4PH4B 3UQ3A 4BSXA 1ZZCA 3PE3A 5A7LA 1HS6A 1MX4A 5T3RA 2ZGDA 2V4LA 5AJDA 4BEPA 2GRQB 4G11A 5AQAA 3UX4A 3CVUA 1ZS4A 2WQHA 2L6BA 3SNXA 1PRVA 5HKPA 3MYVA 3TWRA 2XI8A 2L0IA 2ILRA 1ELRA 1RZRD 3G7DA 3QK0A 4APOA 3EJNA 1PAQA 3ZYMA 1QZ2A 4GZ5A 3L6AA 4GZCA 4FULA 1TN8A 3MA5A 2XHEA 3K9IA 4N39A 2ICPA 5JA4D 1OXJA 4AY6A 2A5UA 4I1OB 5KJMA 3FH5A
chains in the Genus database with same CATH topology
4N5CA 4GYYA 2AXUA 1SQ8A 4O8BA 3O4ZA 3L1PA 5C1DA 4A1SA 5J08A 4GU5A 2PUAA 3CQCB 3SI5A 4F1SA 4FP7A 3U66A 1PNRA 1AU7A 5CHEE 4AOFA 4XZ4A 4ANVA 2LAHA 2V0PA 2EQXA 3FYAA 5ANRA 5FQ7A 3SBSA 4ABNA 4FN3A 3BG0B 4XKBA 1UW4B 3KZ3A 3PEVB 3QB2A 4L2YA 5JHAA 3R1FA 2PUCA 3MCXA 3RRMB 1H2UA 3IBEA 4I1MA 4UI9C 3U4TA 1E8WA 3EIQC 3FWVA 4I17A 5E75A 1MHQA 4EZKA 4U07A 1RZRA 4CDRA 4EECA 2VQ2A 2PQRA 1FVHA 2D5VA 3MKQB 2A6CA 3EHMA 2KCVA 2HR2A 4U8HA 3S7DA 5J90A 3OQMA 2CROA 2IOLA 4JA9A 4C9BB 3GYZA 3CKCA 4A3VA 1RIOA 1UN9A 3FP3A 3QDNA 2XGOA 4KVMA 2GW1A 4AJWA 4K03A 4WUYA 1MQSA 4YVOA 4CCAA 2J09A 3GN5A 4Z5DA 3APDA 3B7RL 4DJAA 1EYHA 4GCNA 4LCTA 2IV1A 1EDUA 3WXXA 4A1GA 4HORA 2I9CA 3FY4A 4WAFA 4PU3C 2RG8A 1B0NA 2MHKA 2C2LA 1NA0A 4G1TA 4UWKA 3CR3A 3FUNA 4L2LA 1PY1A 2AXZA 4D10C 2KCLA 1NZNA 2YHCA 1RPEL 2QFCA 4ANXA 5DIZA 3L08A 2X6FA 4I43A 3RKVA 3D1NI 4LRZA 4CEMA 1KT1A 3LY8A 5KJLA 5K98B 3PNTB 1IQUA 1FCHA 2XEVA 4I1AA 4HOSA 4YG7B 4FBIA 4F3VA 2JEKA 2XQ0A 3R7QA 4EBAA 4U04A 2KM4A 3D9JA 3FTXA 4G23A 3URZA 2VTBB 1DVPA 2AW6A 4AP2A 3I4RB 2VJ8A 3QJZA 2HINA 5AENA 4YNDA 1JH9A 1ADRA 3KD7A 2XCJA 2WXPA 3LEWA 1VPWA 4N3AA 5G04J 4FA6A 2OFYA 4JCYA 2E2EA 3U9WA 4ACKA 3OMTA 2Y3AA 1E8YA 2PZIA 4GZ3A 4AY5A 4TRQA 1DWKA 4I6EA 4APFA 2J49A 3CVLA 4HOUA 4E6HA 5A23A 3I4GA 1OWPA 3O9XA 1SZAA 3ONLA 3UT8A 2CG3A 3NZSA 3JUIA 3MZLB 4LERA 3T5VA 3LY7A 3KXAA 3CSFA 3L13A 1WY6A 4RVBA 3APCA 3FULA 4FLHA 3QNKA 2DIWA 4HOTA 4O6FA 1R63A 3CK9A 4PS3A 3S7JA 3FUKA 2JVLA 1HF0A 3CK7A 2WQ6A 3SF4A 2XPZA 3JQ1A 4FHKA 3NF1A 5CMYA 3UMVA 3MV3B 4X4DA 2XIUA 3JXBC 3ESKA 4G2VA 4Y6WA 4CT0A 3HVEA 4JEHA 4GA1A 4TV3A 4TUUA 4PU7A 4OB4A 3FTSA 3JCKC 4CGWA 4JXTA 3OXGA 4CDMA 3R9AB 5EDSA 2YQ8A 4I9CA 5EKQD 2VYIA 4FHJA 3PUKA 4GZDA 3TG4A 2JLBA 3ZXSA 3TAXA 4I9EA 4NURA 4Q94A 5ARFA 2WXNA 1S7EA 3ASDA 3RRNB 2KPJA 4B94A 2HO1A 2IU1A 5G05J 4H7YA 1IC8A 4ILGA 3D9IA 4BFRA 4WWOA 3AS5A 1LF8A 3AS4A 2VGXA 4Z58A 1H2TC 3D9LA 4MS6A 2KEKA 5FWQA 4CRWA 4P29A 4Q96A 2CSFA 1BDIA 1UXCA 2LO6A 3QKYA 1UTXA 4MKTA 5FQ8A 5M72A 1IYGA 3CECA 2WXQA 3LPZA 3L22A 4IRUA 2A4ZA 4N2QA 4J1WA 3FUEA 5CMWA 2HSGA 3JXCL 2I1JA 2XGMA 3B7SA 3CSTA 3FTVA 2PQNA 4WNDA 4CT4A 2UWJG 4I2WA 2KEIA 1NP7A 2FJRA 3BDNA 2PUFA 1SQMA 5BV1A 4U0ZA 4MCXA 3BEEA 4U0SA 4GA2A 1ZZ9A 4X4IA 4L7TA 5DBKA 4FJZA 3FMYA 2PUGA 2WIUB 3ASGA 1WAO1 3VK0A 4JVSA 3RRUA 2BNOA 1Z3XA 2LNIA 3FUMA 3LXUX 2WXMA 3OAWA 3S7BA 3SFZA 4BX8A 2R1JL 2LSUA 4NACA 3CLJA 2FO7A 3GZ1A 3Q49B 4KBQA 3LDZA 5LCWC 1OUVA 4OYSA 1JWGA 3LJ3A 3PS6A 4JC8A 4XX5A 4Q69A 4B89A 3CLCA 4X4EA 1WIZA 4UQYA 5D0OD 5LOZA 5T4YA 4IVZA 3CROL 2B5AA 3LVRE 4UWHA 1A17A 1N52A 4J8FA 2BF0X 4M3OA 2DCPA 2HM8A 3IEGA 2I2OA 4HLEA 4YVQC 2CG2A 4XIFA 1OWMA 1GT0C 2LSVA 4AV7A 2X38A 2LYRA 1OCTC 3UUXA 1WH6A 4J6IA 3ZRHA 2PUEA 4A3TA 4ACLA 4ILHB 1HFAA 3GBFA 1U3DA 3G2VA 4GPKA 4IA8A 4EZLA 1Z6TA 2O4AA 1HG2A 2MOWA 2PE5A 4X4GA 2WXRA 2Y4TA 2WXLA 4PS7A 4BT8A 3TXNA 4GQMA 3CHRA 2WB2A 2CHZA 1NERA 1SZ9A 3FUIA 1LCDA 4C0EA 2MRIA 2WXJA 3MGBA 4UWGA 4HFGA 3JQ0A 2C0LA 4MLPA 3RK6A 1ZUGA 2X3MA 2CFUA 4XI0A 4Y6CA 3ULQA 3VLDA 1PRAA 2AVPA 3JXDL 3NZUA 3TRBA 3GN5B 1UJKA 3LVQE 4GZ6A 3C98A 2KZ8A 4YARA 2EWTA 3CVQA 2LYJA 1PC2A 3EIJA 3ZVVA 2J9QA 3PH0C 3IHVA 4XI9A 1WH8A 3LFPA 1HZ4A 4DK5A 2LYPA 1OWNA 4RSYA 1INZA 3ML8A 4B0ZA 4UI9K 5E76A 3P2BA 1X57A 4URKA 4F7AA 2AXVA 3FU6A 3Q4AB 3T5XA 4BWRA 3F6WA 1JUQA 3B7TA 3G2SA 3CKBA 3PXPA 4I6RA 3QAQA 5BPPA 2MEZA 2CHXA 4WNEA 4A55A 1FVFA 2LYKA 3D9NA 4BT9A 3F51A 3RZZA 3PVLA 1H19A 4N3CA 4NRHB 5ANLA 3U64A 3ZHEA 3ZPJA 2L49A 3L54A 4BTBA 5BNWA 2VGYA 4Z5HA 4DI3A 3TGOA 4KZCA 2O49A 4U63A 4DPRA 4GB9A 3O48A 1YSEA 3QARA 3FTUA 4X4BA 4IULA 5FT9A 1JPLA 3SCFA 2UY1A 3BG1B 2KEJA 2XRZA 3OTNA 3ZHEB 3SZ7A 4YBAA 5G04C 3TXMA 4V3IA 3ENEA 2WXGA 3H5TA 2WXHA 3SCGA 3OXLA 4JA7A 4KYOB 3CEQA 3CQGB 4J1XA 4AM9A 3ZW3A 5AIJA 1ZPQA 3MKRA 1WETA 2UY1B 3FEYA 1KT0A 2VSOE 2J07A 1ZZBA 3APFA 2NC9A 3EUSA 3UFDA 3PREA 2IJGX 3KEZA 3HZIB 4G24A 1WM5A 3ASHA 3CIAA 3CK8A 2Q7FA 2WVIA 1HE8A 4FU3A 5BW8C 5A7DB 1ELWA 1IHGA 4I8TA 3FUFA 1E8ZA 1H0AA 2XRYA 3DBSA 3FTZA 5D0QD 4HVBA 2KC7A 3OQOA 1E90A 1LQCA 4W9RA 2P58C 1ZU2A 1S0PA 3N71A 3UPVA 2MQKA 3KS2A 3U3WA 1DW9A 3HVEB 3QOUA 1UXDA 1POUA 3JYSA 3LYAA 4KXKB 2FF4A 3LISA 4ATGA 3FDHA 4GAAA 2XSDC 2VSNA 3CVWA 3ZHMA 1UG3A 2LYLA 3OQNA 2YHEA 2X6KA 2LYQA 3ZYLA 2XJ3A 3D9KA 3MJWA 3DNVB 3HHMA 5FZQA 5C2YA 2PL2A 1RZSA 2H8RA 1OSLA 3ZYKA 3QWVA 3ZEFA 4WWPA 3FU0A 4FADA 3FEXA 4DI4A 2PM7A 5EX3A 4AVXA 3ZGQA 2BNMA 1ZBPA 2OVFA 5FQ6A 4ANUA 4PS8A 5G05C 1UJJA 2VGXB 2XCCA 3CHQA 4XE0A 3QQ6A 4GYOA 1ZZ7A 1L1MA 3PZDA 4PDXA 4YG4A 3AS8A 1BDHA 1KLXA 2GRMA 4GHJA 2WM9A 1EPUA 4C0MA 4ANWA 4EPZA 5KJKA 1R69A 1QP0A 4G25A 2BUGA 4QFVA 1JFTA 3S8QA 2FULA 1ZZ6A 2WMNA 4FC8A 5FJYA 3PUJA 2WQ7A 1HH8A 2LAIA 3CVXA 4IN3B 4LEUA 4DLQA 4BY6A 2XPIA 4GA0A 2IOSA 2IU7A 3SD5A 3PDNA 3FTWA 1QQBA 3AU4A 2HYZA 3L16A 5T8IA 2J4BA 2GRLA 1JWLA 4LUNU 1YA0A 5G2NA 4XKCA 4WWNA 2BTDA 4KVOA 4JPSA 4E85A 2IF4A 3CGHA 3CHOA 2J4DA 4GMLA 4J8EA 1IQRA 1Y6IA 2WXIA 2YNQA 3SBTB 2GZUA 2LYSA 3P1UA 4J8SA 3RO2A 4PU8A 3MV2B 2PPXA 2R63A 1U3CA 5KCMA 3CVVA 1JWFA 1ZZ8A 4F53A 1QPZA 1LCCA 2IFUA 3D9OA 2XGSA 3FH8A 3GW4A 3QWWA 3ZFWA 3CVNA 4MRUA 3EDTB 4GCOA 4ME2A 3CVYA 4FLBA 4UI9J 4UQXA 2L0TB 1TJCA 3FUHA 3Q15A 2IONA 1E8XA 2DBAA 2IVGA 3HIZA 5FQ4A 4KMOA 4B8AA 4JHRA 5CCLA 4BX9A 3OP9A 3IHYA 3RU0A 2IUOA 1H6KA 4WNFA 4EQFA 4DLOA 1DNPA 2FEZA 2M63A 4JEUA 4JZYA 3MKQA 2RD0A 2KATA 4Y42A 3CHPA 1P5QA 3RIBA 5FZRA 5ARGA 3QC1A 4BTAA 3ONKA 3Q47B 3VLFA 2JCGA 2R59A 1UN8A 1HU3A 1Z3YA 4G26A 3RO3A 3SCHA 4N3BA 3AU5A 1Y8MA 1GW6A 3FU5A 3MLFA 4KZ0A 3KJXA 2NSZA 3GZ2A 4F8DA 3LCAA 1VDYA 2PUDA 3PEUB 2IQCA 2R17C 2EBYA 3QWPA 4PU4C 4HXIA 3G2WA 2OOEA 1BPOA 3DPDA 2ZU6B 4L1BA 1HF8A 5FZSA 2WXKA 3LY9A 4NDWA 2I1KA 4GYWA 5JJ6A 3IKOB 5CCMA 1X2LA 2L9BA 3D9MA 4AEZC 4J0UA 1TEZA 4IWRA 2FI7A 4JW1A 3FH7A 2PIJA 3HDXA 3T8MA 2J08A 3G2TA 4I6TA 3SGHA 3I3NA 1Y7YA 3TG5A 3FUJA 4KT6B 2CHWA 3KAEA 4IYPA 1HO8A 4X4HA 2V8SE 4ILIA 1E7VA 4I2ZA 3VTXA 1NEQA 3QF3A 2CFZA 2VTBA 3ML9A 3PE4A 1Y9QA 4B8CB 3GZSA 3I5PA 4JHJA 1HX8A 3LKUA 3FFLA 2IVQA 2WUSR 4PUCA 3RJVA 3QYXA 3PRZA 4Z5CA 4GMJA 3B7HA 3G5GA 3QWGA 5G55A 3TL5A 1QP4A 3ESLA 5AYWD 3R7RA 4EBAG 2KZTA 2LCVA 2VSYA 2FBNA 5BV0A 2YINA 4U0UA 3L17A 4JL0A 4L23A 4YG1A 2BJCA 3PNLB 1XGWA 2R5SA 1EF1C 3FYMA 2E0IA 2WPVA 4OVUA 2OVBA 1HXIA 5AJLA 2WMOA 4WNGA 2PM6A 2KZTB 2OR1L 3IVPA 4RG6A 3CVPA 5EX0A 4X4CA 1QP7A 1QNFA 5LFAA 4CDNA 1JFSA 1PERL 2OV8A 3CHMA 4MCTA 2AWIA 1W3BA 4PH4B 5BUZA 4I6UA 4FJYA 2KCKA 3UQ3A 1ZAYA 4BSXA 1PRUA 1ZZCA 4I6JA 4JQDA 2C0MA 3PE3A 4JHKA 2ICTA 3CHSA 3BD1A 5A7LA 1HS6A 2EF8A 1NA3A 3NQPA 5T3RA 5JJTA 3FTYA 5KJNA 1LMB3 5HI7A 4UWLA 2V4LA 4X4FA 5AJDA 4G11A 5BT1A 3MX3A 4AXHA 3UX4A 3ZIMA 2X6IA 3CVUA 1TJFA 3OXFA 4AIFA 1ZS4A 3UT4A 1H2VC 1ZVVA 4HS2A 1E3OC 4EZJA 2IVBA 2WQHA 3D9PA 1CJGA 2AUWA 3ZKCA 2PUBA 2X6JA 3SNXA 2Y4UA 3F52A 1PRVA 4I6GA 2L8NA 1L5JA 4R7LA 4N2SA 3MYVA 2BNNA 2GGFA 1B89A 4J8DA 1CQTA 3ZYQA 3BS3A 2XCBA 2XI8A 4H7XA 3B13A 2L0IA 2ILRA 1ELRA 1ELKA 4JCXA 1RZRD 3G7DA 2XPYA 1OWLA 3QK0A 1XWRA 5A6CA 5LX8A 3VLEA 1EFAA 4OVVA 2VSXE 4CGVA 3IV0A 5ENNA 4APOA 3EJNA 3S7FA 5JJ7A 3D3MA 1PAQA 3TJPA 3FUDA 2O38A 3ZYMA 1QZ2A 3ASFA 5LP0A 2QY7A 2ONDA 2NXPA 3B7UX 4GZ5A 3S2AA 2V5FA 1LLIA 3L6AA 3EHNA 2I6HA 4GZCA 4K0RA 5JHBA 1E96B 3FU3A 1N54A 3FHEA 4FULA 1QQAA 4RG9A 3Q5MA 2X6HA 3SHFA 3MA5A 1E7UA 1HG5A 3ZN3A 2XHEA 3CV0A 3E4BA 3ZHIA 4Z59A 3K9IA 2ICPA 4HOQA 4N39A 4AY6A 1QQEA 2WXFA 3G2UA 5HQ8A 5FTPA 2A5UA 3UT7A 5LCWJ 4I1OB 1OWOA 3LS8A 4UWFA 1X5BA 2L6JA 1XNFA 1O4XA 2WXOA 4UQZA 3HYMB 3VTYA 3MEKA 3FH5A 5KJMA 4NQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MLF A;  3KJX A;  4YBA A;  4F8D A;  1IC8 A;  2PUD A;  2AXU A;  1SQ8 A;  4O8B A;  3L1P A;  3H5T A;  2EBY A;  4PU4 C;  3SCG A;  2PUA A;  4J1X A;  4Z58 A;  1PNR A;  1ZPQ A;  2KEK A;  1AU7 A;  4NDW A;  1WET A;  2CSF A;  1BDI A;  1UXC A;  1X2L A;  1ZZB A;  3FYA A;  3EUS A;  3UFD A;  4FN3 A;  3HZI B;  1UTX A;  4IWR A;  2PIJ A;  3KZ3 A;  4I8T A;  3CEC A;  4I6T A;  3R1F A;  1Y7Y A;  2PUC A;  3OQO A;  4J1W A;  1LQC A;  2HSG A;  4X4H A;  3JXC L;  2MQK A;  1NEQ A;  1DW9 A;  3QF3 A;  3U3W A;  1UXD A;  1RZR A;  2KEI A;  1Y9Q A;  1POU A;  2FJR A;  3BDN A;  2PUF A;  3LIS A;  2D5V A;  2A6C A;  4MCX A;  2IVQ A;  2WUS R;  2XSD C;  3QYX A;  3OQM A;  4Z5C A;  2CRO A;  3ZHM A;  3B7H A;  3G5G A;  3QWG A;  1ZZ9 A;  4X4I A;  2LYL A;  3OQN A;  1QP4 A;  3FMY A;  2LYQ A;  2WIU B;  1RIO A;  2PUG A;  2XJ3 A;  3VK0 A;  2LCV A;  2BNO A;  3DNV B;  3GN5 A;  4Z5D A;  2R1J L;  1RZS A;  4YG1 A;  2BJC A;  2H8R A;  1OSL A;  2IV1 A;  3FYM A;  4PU3 C;  1B0N A;  3CLC A;  4X4E A;  2BNM A;  2OR1 L;  1WIZ A;  3IVP A;  4X4C A;  1QP7 A;  1JFS A;  4IVZ A;  1PER L;  2B5A A;  3CRO L;  2AXZ A;  2AWI A;  4MCT A;  3QQ6 A;  4I6U A;  1ZZ7 A;  1L1M A;  1RPE L;  1ZAY A;  1PRU A;  1ZZC A;  4YG4 A;  4JQD A;  1BDH A;  2GRM A;  2ICT A;  4GHJ A;  1GT0 C;  3D1N I;  3BD1 A;  5A7L A;  2EF8 A;  1R69 A;  2LYR A;  1QP0 A;  1OCT C;  1LMB 3;  1WH6 A;  5K98 B;  1JFT A;  2PUE A;  4X4F A;  3S8Q A;  1ZZ6 A;  4YG7 B;  3GBF A;  4FBI A;  4IA8 A;  2O4A A;  2PE5 A;  4X4G A;  2IU7 A;  2AW6 A;  1QQB A;  4GQM A;  1ZS4 A;  1NER A;  1ZVV A;  2HIN A;  1E3O C;  2GRL A;  1JWL A;  2IVB A;  1JH9 A;  1LCD A;  1ADR A;  2XCJ A;  1CJG A;  2AUW A;  3ZKC A;  2PUB A;  1VPW A;  1ZUG A;  3F52 A;  1PRV A;  2OFY A;  2L8N A;  4JCY A;  3OMT A;  1PRA A;  2BNN A;  3JXD L;  3TRB A;  1CQT A;  2GZU A;  3BS3 A;  3GN5 B;  2LYS A;  1DWK A;  2XI8 A;  2KZ8 A;  4PU8 A;  4YAR A;  2EWT A;  2PPX A;  2R63 A;  4JCX A;  3O9X A;  1RZR D;  2LYJ A;  3G7D A;  1XWR A;  1ZZ8 A;  1QPZ A;  1LCC A;  1EFA A;  1WH8 A;  3LFP A;  2LYP A;  3KXA A;  1X57 A;  2O38 A;  2AXV A;  1R63 A;  2JVL A;  1HF0 A;  3F6W A;  2IVG A;  3PXP A;  4I6R A;  4X4D A;  2MEZ A;  2XIU A;  3JXB C;  3OP9 A;  1LLI A;  2IUO A;  4PU7 A;  2LYK A;  4OB4 A;  1QQA A;  3F51 A;  3RZZ A;  4Y42 A;  3ZHI A;  4Z59 A;  2ICP A;  2L49 A;  4Z5H A;  2JCG A;  2O49 A;  1YSE A;  4X4B A;  1O4X A;  1S7E A;  3SCF A;  3SCH A;  2KEJ A;  2KPJ A; 
#chains in the Genus database with same CATH topology
 4N5C A;  4GYY A;  1IXV A;  3DXM G;  4U8Y D;  5C1D A;  4A1S A;  1DC2 A;  1AU7 A;  1N4R A;  4HRA A;  2V0P A;  2EQX A;  4MBG A;  3HXD A;  4L2Y A;  3R1F A;  3MCX A;  3RRM B;  1H2U A;  3IBE A;  4UI9 C;  1E8W A;  3FWV A;  1MHQ A;  4EEC A;  3JXJ A;  3EHM A;  2CRO A;  3TEP A;  4C9B B;  2GW1 A;  4WUY A;  4YVO A;  5ENT D;  4GCN A;  1EDU A;  2ODR D;  2I9C A;  4PU3 C;  1AP7 A;  3AG4 E;  2PXU A;  1NA0 A;  5AAO A;  2AXZ A;  1NZN A;  3NZL A;  2ZGG A;  3L08 A;  3RKV A;  5K98 B;  1O1R A;  4I1A A;  4YG7 B;  3EHQ A;  2ETB A;  4U04 A;  2KM4 A;  3D9J A;  3URZ A;  3ZPX A;  4AP2 A;  3QJZ A;  5CRU A;  1ADR A;  3KD7 A;  1VPW A;  3Q79 A;  2Y3A A;  4TXR A;  2PXT A;  4TRQ A;  4GTT A;  1DWK A;  4HOU A;  1N4Q A;  3T5V A;  3CSF A;  4RVB A;  3FUL A;  3QNK A;  3FUK A;  3E33 A;  3JQ1 A;  3MV3 B;  1D9S A;  2XIU A;  3JXB C;  4G2V A;  4TV3 A;  4TUU A;  2XXP A;  4PU7 A;  3OXG A;  4I9C A;  1JCQ A;  2JLB A;  1X81 A;  4DX6 D;  5ARF A;  3V2X A;  4B94 A;  4H7Y A;  3ZNG A;  1WDY A;  4HRM B;  4NIK A;  1LF8 A;  3C72 A;  3MEJ A;  1BDI A;  4MKT A;  5M72 A;  3CEC A;  2WXQ A;  1RW2 A;  3L22 A;  4EKG A;  2KXP C;  2I1J A;  3CST A;  3BQO A;  4TXQ A;  1N0Q A;  4L7T A;  1N4P A;  1SA5 A;  3S7B A;  1Z3X A;  3A9Y A;  2WXM A;  2HFZ A;  4OYS A;  2KBX A;  3LJ3 A;  4XX5 A;  4B89 A;  2HCS A;  2QYU A;  1WIZ A;  5D0O D;  5T4Y A;  3WG7 E;  2B5A A;  1N52 A;  2R03 A;  2HM8 A;  1JCR A;  4YVQ C;  2LSV A;  3ZRH A;  2XEN A;  1FT1 A;  1HG2 A;  2PE5 A;  4X4G A;  4BT8 A;  1SZ9 A;  2DVW A;  2WXJ A;  2GRN B;  4K5C A;  2CFU A;  3ULQ A;  4Y6C A;  3VLD A;  2AVP A;  3JXD L;  4GZ6 A;  3C98 A;  2KZ8 A;  3PE5 A;  4J8Y A;  3CVQ A;  5FIO A;  3ZVV A;  3PH0 C;  3IHV A;  4XI9 A;  2LYP A;  4F7A A;  2DWZ A;  3Q4A B;  3TWX A;  1JUQ A;  1OY3 D;  3PXP A;  4I6R A;  4EZI A;  3ASN E;  1H6O A;  1BLX B;  3D9N A;  3F51 A;  3RZZ A;  3PVL A;  1H19 A;  4N3C A;  3L54 A;  3TGO A;  4O1P A;  4U63 A;  3O48 A;  1YSE A;  1JPL A;  3EU5 A;  3SCF A;  2KEJ A;  3ZHE B;  4O60 A;  5D2M C;  3TXM A;  5CBN A;  3W9G A;  3H5T A;  3OXL A;  4KYO B;  5ENQ D;  5AIJ A;  1ZPQ A;  1WET A;  1KT0 A;  1K3Z D;  1ZZB A;  1TYQ G;  3SD5 A;  3EUS A;  3JUE A;  2IJG X;  5EYL A;  1HE8 A;  3DBS A;  4RLY A;  2MQK A;  2LLV A;  3HVE B;  2F8Y A;  2FF4 A;  2XSD C;  3CVW A;  3ZHM A;  1UG3 A;  3OQN A;  3C3O A;  3ZYL A;  3DNV B;  3HHM A;  2H8R A;  1OSL A;  3ZEF A;  5EX3 A;  3ZGQ A;  2BNM A;  5G05 C;  1UJJ A;  2VGX B;  3CHQ A;  4XE0 A;  3QQ6 A;  4YG4 A;  2J8S D;  2WM9 A;  1YCS B;  5KJK A;  1QP0 A;  2M4H A;  2FUL A;  1DUL A;  1HH8 A;  2LAI A;  5CBO A;  4DLQ A;  4LSZ E;  5T8I A;  2J4B A;  1YA0 A;  4JPS A;  4F6R D;  1Y6I A;  2WXI A;  3Q73 A;  2YNQ A;  1V54 E;  4J8S A;  3RO2 A;  3MV2 B;  3ZXP A;  2PPX A;  3PZ4 A;  3CVV A;  4F53 A;  1LCC A;  3LQX A;  3FH8 A;  3ZFW A;  3C3Q A;  1TJC A;  1S63 A;  2DBA A;  5CCL A;  1BD8 A;  3OP9 A;  5DTQ A;  4JEU A;  2M63 A;  2KAT A;  1O5M A;  3UKU G;  3RIB A;  4G26 A;  3RO3 A;  4KZ0 A;  1VDY A;  4BET A;  2OOE A;  1BPO A;  3DPD A;  2ZU6 B;  4L1B A;  1HF8 A;  5FZS A;  2WXK A;  3SO8 A;  4ER7 A;  1TEZ A;  4IWR A;  4LNU D;  3T8M A;  2J08 A;  3G2T A;  3I3N A;  4KT6 B;  2CHW A;  3KAE A;  4X4H A;  1E7V A;  1NEQ A;  3G0T A;  1Y9Q A;  4JHJ A;  3I5P A;  2P9P G;  3M9L A;  3RJV A;  3PRZ A;  4GMJ A;  3TL5 A;  4DE9 A;  2FBN A;  3L17 A;  4YG1 A;  2LNM A;  3PNL B;  2IY0 C;  4OVU A;  2Y0B G;  1LD8 A;  2PM6 A;  4RG6 A;  2L1P A;  1MX2 A;  4GTM A;  2AWI A;  1ZAY A;  2C0M A;  3CHS A;  3FTY A;  4GTR A;  5HI7 A;  5DTR A;  2XEH A;  4ZHB A;  3MX3 A;  4AXH A;  3ZIM A;  2X6I A;  2XXA A;  3ULY A;  1ZVV A;  4HS2 A;  1E3O C;  2B0O E;  1CJG A;  3ZKC A;  3ZU7 B;  3F52 A;  1L5J A;  4J8D A;  5CRV A;  1B89 A;  1CQT A;  4H7X A;  1ELK A;  3W9F A;  2XPY A;  4HRN A;  5LX8 A;  2VSX E;  3IV0 A;  1TNZ A;  3S7F A;  5JJ7 A;  3D3M A;  3TJP A;  3FUD A;  3PZ3 A;  5LP0 A;  2DYS E;  2F0Y A;  3S2A A;  2V5F A;  1LLI A;  3EHN A;  4K0R A;  1E96 B;  3SHF A;  1E7U A;  3ZN3 A;  3ZHI A;  3ASO E;  2WXF A;  3TWQ A;  5LCW J;  3LS8 A;  1X5B A;  2L6J A;  1O4X A;  1NFI E;  2WXO A;  4UQZ A;  3MEK A;  4NQ0 A;  3L1P A;  2RFM A;  3SI5 A;  4FP7 A;  3U66 A;  1PNR A;  5CEC B;  3C5R A;  5DRY A;  4XKB A;  1OT8 A;  3KZ3 A;  3QB2 A;  5KWD A;  3EIQ C;  2AJA A;  4I17 A;  5E75 A;  4EZK A;  4LG6 A;  2KCV A;  3S7D A;  3OQM A;  5D66 A;  3CKC A;  4A3V A;  2OCC E;  3QDN A;  2XGO A;  2ETC A;  3KSL A;  1MQS A;  3GN5 A;  3APD A;  3TWU A;  4DJA A;  4HOR A;  3WXX A;  2IV1 A;  4WAF A;  1MZC A;  2RG8 A;  3EHR A;  3CR3 A;  3FUN A;  1TN7 A;  1RPE L;  4ANX A;  3DXK G;  4I43 A;  3SFX A;  4QQI A;  4LRZ A;  4CEM A;  5KJL A;  1DCE A;  2XEV A;  1NL4 A;  2JEK A;  2XQ0 A;  3R7Q A;  4EBA A;  4G23 A;  2VTB B;  3TWW A;  1DVP A;  2F37 A;  2HIN A;  4YND A;  2LUH A;  4FA6 A;  2E2E A;  3U9W A;  3V2O A;  1TNO A;  2PZI A;  4GZ3 A;  4ZFH A;  4DX7 D;  4I6E A;  3CVL A;  5A23 A;  1OWP A;  3O9X A;  2CG3 A;  3JUI A;  4LER A;  3LY7 A;  3KXA A;  5ENP D;  3IXE A;  3S7J A;  3CK9 A;  2WQ6 A;  5EN5 D;  2QYJ A;  3UMV A;  4DUI A;  3ESK A;  1N9A A;  4Y6W A;  1OCR E;  1QZX A;  4OB4 A;  3JCK C;  4U96 D;  4JXT A;  3R9A B;  2PXL A;  4GZD A;  3ZXS A;  4I9E A;  1S7E A;  5KNH D;  3RRN B;  2KPJ A;  2HO1 A;  1IC8 A;  4GTP A;  4GTV A;  4GTQ A;  1A5E A;  1H2T C;  3V30 A;  4CRW A;  2ZXW E;  4Q96 A;  1UXC A;  3QKY A;  5FQ8 A;  5ENS D;  2R2L A;  5CMW A;  3UKR G;  5JMN D;  4I2W A;  1NP7 A;  3NBN B;  1N4S A;  1BI8 B;  2FJR A;  2J7W A;  4B93 B;  4FJZ A;  3ASG A;  4JVS A;  3RRU A;  3FUM A;  3SFZ A;  1KZO A;  1D8E A;  1K8K G;  3DST A;  5AAR A;  4Q69 A;  3CLC A;  2P9S G;  4J8F A;  2BF0 X;  2DCP A;  4GTS A;  2YBD A;  4HLE A;  3ABK E;  1FT2 A;  3X2Q E;  4EZL A;  1Z6T A;  2MOW A;  2Y4T A;  3TXN A;  3CHR A;  1LCD A;  3NAW A;  3DSV A;  5AQ9 A;  3MGB A;  4EK9 A;  4MLP A;  3RK6 A;  2X3M A;  2V4H C;  4XI0 A;  1PRA A;  5DT2 A;  3TRB A;  1UJK A;  3LVQ E;  1PC2 A;  3EIJ A;  3ISM C;  2J9Q A;  1WH8 A;  1HZ4 A;  1OWN A;  4RSY A;  5E76 A;  1IHB A;  1X57 A;  4C48 B;  3FU6 A;  4Z68 A;  3G2S A;  3QAQ A;  2CHX A;  2P9K G;  4A55 A;  2LYK A;  4BT9 A;  5ANL A;  2XS1 A;  5BNW A;  3FTU A;  4X4B A;  5FT9 A;  2XRZ A;  1O1S A;  5DTM A;  4V3I A;  2WXH A;  4JA7 A;  3MKR A;  3FEY A;  2J07 A;  2PXV A;  3APF A;  3HZI B;  3CK8 A;  3ASH A;  5AQ7 A;  2WVI A;  1IHG A;  4I8T A;  3FUF A;  2XRY A;  3OQO A;  1E90 A;  1LQC A;  1S0P A;  4CYM D;  2PXE A;  1DW9 A;  4KXK B;  3FDH A;  2EIJ E;  2X6K A;  2XJ3 A;  3E32 A;  3PZ1 A;  3MJW A;  2PL2 A;  3FU0 A;  1IKN D;  4DX1 A;  3SX0 A;  1ZBP A;  2OVF A;  4ANU A;  1ZZ7 A;  1L1M A;  4PDX A;  3UM3 A;  1KLX A;  4GHJ A;  4EPZ A;  4G25 A;  3S8Q A;  1ZZ6 A;  2JQE A;  2WMN A;  2WQ7 A;  4BY6 A;  2IOS A;  2IU7 A;  3PDN A;  3FTW A;  3AU4 A;  2HYZ A;  1JWL A;  5G2N A;  4E85 A;  2IF4 A;  3CHO A;  2J4D A;  1IQR A;  3SBT B;  3P1U A;  1U3C A;  3ULE G;  4HNA D;  5KCM A;  1JWF A;  1QPZ A;  2IFU A;  2XGS A;  3EDT B;  4GCO A;  3Q15 A;  2ION A;  4B8A A;  4JHR A;  1H6K A;  2EIL E;  4EQF A;  2DYR E;  4Y42 A;  4DX2 A;  4BTA A;  2JCG A;  2R59 A;  1Z3Y A;  2H6I A;  3SCH A;  4N3B A;  3AU5 A;  1Y8M A;  1GW6 A;  3FU5 A;  3KJX A;  3GZ2 A;  1MJ0 A;  2PUD A;  3PEU B;  2P9L G;  4ER5 A;  2EBY A;  4PU4 C;  1HQ1 A;  2GRO B;  5CCM A;  4NDW A;  2I1K A;  1SW6 A;  4DE8 A;  1JCS A;  1G3N B;  4AEZ C;  4J0U A;  4LNG A;  4JW1 A;  3HDX A;  3SGH A;  4I6T A;  1Y7Y A;  2V8S E;  4ILI A;  4I2Z A;  3ML9 A;  4B8C B;  3GZS A;  3NRO A;  2IEJ A;  1HX8 A;  2WUS R;  3QYX A;  3QWG A;  2BED A;  5G55 A;  2Y69 E;  3ESL A;  5AYW D;  3R7R A;  2KZT A;  2VSY A;  2YIN A;  4U0U A;  4L23 A;  2BJC A;  1XGW A;  2R5S A;  4YDY A;  3FYM A;  2WPV A;  1HXI A;  2WMO A;  5IY5 E;  4X4C A;  3BUA A;  4CDN A;  1PER L;  5BUZ A;  4I6U A;  4FJY A;  1PRU A;  3DSU A;  4J7W A;  1NA3 A;  3HXF A;  4UWL A;  2XZT G;  5BT1 A;  3OWQ A;  2QZA A;  1TJF A;  3GZD C;  3OXF A;  3J5Q B;  3UT4 A;  1H2V C;  4RQI A;  4EZJ A;  4X8Q A;  1MYO A;  2AUW A;  2X6J A;  4I6G A;  2BNN A;  2XXQ A;  2GGF A;  3ZYQ A;  3BS3 A;  2XCB A;  3B13 A;  2B6C A;  1OWL A;  1XWR A;  1MX6 A;  4OVV A;  1YMP A;  5CEA A;  2QY7 A;  2OND A;  4O1O A;  2I6H A;  5EYP F;  3FHE A;  3Q5M A;  2X6H A;  1HG5 A;  3E4B A;  4HOQ A;  4JD2 G;  1QQE A;  4HI8 A;  3UT7 A;  4UWF A;  1XNF A;  1N0R A;  3DEO A;  3A9Z A;  3ABL E;  1AWC B;  1SQ8 A;  3O4Z A;  5J08 A;  4GU5 A;  2PUA A;  2R02 A;  3CQC B;  4F1S A;  4AOF A;  4ANV A;  1UOH A;  2LAH A;  5ANR A;  3SBS A;  4ABN A;  4FN3 A;  3PZ2 A;  2J7U A;  3PEV B;  4LNB A;  2PUC A;  1YYH A;  2NYJ A;  4U07 A;  2VQ2 A;  3MKQ B;  5J90 A;  4JA9 A;  2IOL A;  3GYZ A;  1K1A A;  1RIO A;  1TNB A;  1UN9 A;  3FP3 A;  2PXP A;  4K03 A;  4A63 B;  2J09 A;  2JAB A;  1EYH A;  3BU8 A;  4LCT A;  4A1G A;  2C2L A;  4G1T A;  4UWK A;  3Q78 A;  3T8K A;  4D10 C;  2KCL A;  2YHC A;  2QFC A;  3GZD A;  3D1N I;  1KT1 A;  3HRA A;  3LY8 A;  4OAU C;  3LJN A;  5AN8 A;  3UIP C;  4HOS A;  4FBI A;  4F3V A;  1TN6 A;  2P2C P;  5G04 J;  2OFY A;  4JCY A;  2PXB A;  1E8Y A;  1KPS B;  2J49 A;  3UI2 A;  4E6H A;  3DSS A;  3I4G A;  1SZA A;  3OKZ A;  3L13 A;  1WY6 A;  4FLH A;  2DIW A;  4HOT A;  4PS3 A;  2JVL A;  1HF0 A;  3HVE A;  4OAV B;  3FTS A;  2H6H A;  3C3R A;  5EKQ D;  2VYI A;  4FHJ A;  3EU9 A;  2V5Q C;  3TAX A;  2WXN A;  3ASD A;  2IU1 A;  3D9I A;  3AS5 A;  4GTO A;  2VGX A;  3D9L A;  4MS6 A;  2KEK A;  4P29 A;  2CSF A;  2LO6 A;  4IRU A;  4GPM A;  2LXM A;  3NOC D;  2XZD G;  2HSG A;  3JXC L;  3FTV A;  4WND A;  4CT4 A;  2KEI A;  4G8K A;  4U0Z A;  4MCX A;  3UM0 A;  4HRL A;  3BEE A;  4U0S A;  1ZZ9 A;  2PUG A;  1WAO 1;  2BNO A;  5ENR D;  4BX8 A;  2R1J L;  2LSU A;  4NAC A;  3CLJ A;  2FO7 A;  3Q49 B;  4KBQ A;  5LCW C;  4HBD A;  1JWG A;  3PS6 A;  4UQY A;  5LOZ A;  4ER0 A;  3CRO L;  4UWH A;  2CG2 A;  4XIF A;  4AV7 A;  2X38 A;  4J6I A;  2PUE A;  4A3T A;  4ACL A;  1HFA A;  1U3D A;  2QC9 A;  3G2V A;  4G8L A;  3AAA C;  3V31 A;  4OBM A;  2WXL A;  2WB2 A;  4GQM A;  1NER A;  4ER6 A;  2EIN E;  4UWG A;  2C0L A;  3NXH A;  1ZUG A;  3NDB B;  5B1A E;  3TWV A;  4YAR A;  2EWT A;  2P9I G;  1NW3 A;  2LYJ A;  3VWS A;  3ML8 A;  4URK A;  3P2B A;  2Y1L E;  3RAU A;  3T5X A;  4BWR A;  3B7T A;  3CKB A;  2MEZ A;  4WNE A;  3E37 A;  2IO3 C;  4UUC A;  4NRH B;  3U64 A;  3ZPJ A;  4BTB A;  2VEO A;  4Z5H A;  2O49 A;  4GB9 A;  1QYM A;  4IUL A;  2UY1 A;  3BG1 B;  3D9H A;  3DM5 A;  3OTN A;  1V55 E;  4TUM A;  4EQZ A;  3SCG A;  3CEQ A;  3ZW3 A;  4J1X A;  2VSO E;  2NC9 A;  3UFD A;  3SF4 A;  3KEZ A;  4G24 A;  5BW8 C;  3CIA A;  4FU3 A;  2Q7F A;  5A7D B;  5D0Q D;  3FTZ A;  5ITZ F;  4W9R A;  2P58 C;  1OCO E;  3QOU A;  2DZN A;  1UXD A;  1DCQ A;  3JYS A;  4HI9 A;  2OEW A;  1MFQ C;  3LIS A;  4ATG A;  4GAA A;  2LYL A;  5H7P A;  1WG0 A;  3L9T A;  4FAD A;  2PM7 A;  3EUV A;  2PXF A;  5FQ6 A;  4PS8 A;  3AS8 A;  4C0M A;  4ANW A;  1R69 A;  2BUG A;  1JFT A;  4YDO A;  4FC8 A;  3PUJ A;  3CVX A;  4LEU A;  3SFY A;  3QFI A;  2GRL A;  1N94 A;  1Q2Z A;  4XKC A;  4WWN A;  4KVO A;  3HG0 D;  2A5E A;  4GML A;  2GZU A;  2LYS A;  2R63 A;  3D9O A;  3CVN A;  4MRU A;  2ETA A;  3UIN C;  1SVX A;  3KL4 A;  4ME2 A;  3CVY A;  4FLB A;  4UI9 J;  2IVG A;  5FQ4 A;  4KMO A;  2HE0 A;  3IHY A;  2IUO A;  1DNP A;  4JZY A;  2RD0 A;  1P5Q A;  5FZR A;  3TWT A;  3ONK A;  3Q47 B;  3VLF A;  1UN8 A;  1HU3 A;  4HQD A;  2H6G A;  2R17 C;  3AJI A;  3QWP A;  4GYW A;  5JJ6 A;  3IKO B;  2FI7 A;  3JXI A;  1TR4 A;  2PIJ A;  3FH7 A;  1O1T A;  2EIM E;  5KBA A;  3VTX A;  3HXB A;  2VTB A;  3GZC A;  5CED B;  1BI7 B;  1U2V G;  2FO1 E;  3FFL A;  4EKI A;  4PUC A;  1QBQ A;  5AQB A;  4Z5C A;  1TNU A;  3G5G A;  4ATZ D;  1QP4 A;  5EIL A;  4EBA G;  2LCV A;  5BV0 A;  1QB2 A;  2E0I A;  2OVB A;  5EX0 A;  2KZT B;  3IVP A;  1QP7 A;  5LFA A;  1JFS A;  3CHM A;  1W3B A;  3SQV A;  2KCK A;  3NB2 A;  4I6J A;  4JQD A;  4JHK A;  2ICT A;  3BD1 A;  2EF8 A;  3NQP A;  5JJT A;  2EIK E;  5KJN A;  1LMB 3;  4X4F A;  2DZO A;  3DEP A;  4AIF A;  1ZB1 A;  3Q9N C;  3V79 K;  4F1P A;  2IVB A;  2RFA A;  3D9P A;  2PUB A;  2Y4U A;  4R7L A;  4CZ2 D;  2L8N A;  4N2S A;  5BXO A;  1Z5S C;  3T9K A;  2P9U G;  4JCX A;  5A6C A;  4K5B A;  3VLE A;  1EFA A;  4CGV A;  5ENN A;  3B7B A;  4U7E B;  2O38 A;  3ASF A;  2NXP A;  3B7U X;  1KZP A;  5JHB A;  3FU3 A;  1N54 A;  4RG9 A;  1QQA A;  3CV0 A;  4Z59 A;  3G2U A;  5HQ8 A;  5FTP A;  1OWO A;  1NI1 A;  2LXL A;  3L82 A;  4BES A;  3DPY A;  3VTY A;  3HYM B;  1U2Z A;  2PXD A;  5CER B;  4YDE A;  4YDW A;  2PNN A;  4L9P A;  2AXU A;  4O8B A;  2GRP B;  5CHE E;  4XZ4 A;  5FQ7 A;  3FYA A;  3BG0 B;  2R05 A;  5KNG A;  1UW4 B;  5HRY A;  5JHA A;  2BKK B;  4I1M A;  3U4T A;  3QOX A;  3Q7A A;  1RZR A;  5B1B E;  4CDR A;  2PQR A;  1FVH A;  2D5V A;  2A6C A;  4U8H A;  2HR2 A;  3TEL A;  2HCN A;  4KVM A;  4AJW A;  4CCA A;  3B7R L;  4Z5D A;  3R09 A;  3FY4 A;  4U95 D;  1B0N A;  1OCZ E;  2MHK A;  2XEE A;  3SY2 A;  3RSE G;  4L2L A;  1PY1 A;  5DIZ A;  3DSW A;  2X6F A;  2MYO A;  4XEI G;  3PNT B;  1IQU A;  1FCH A;  5DSX A;  2MXD A;  3FTX A;  2AW6 A;  3I4R B;  5EIB E;  2VJ8 A;  5AEN A;  1FPP A;  1JH9 A;  1LD7 A;  2XCJ A;  2WXP A;  3LEW A;  4N3A A;  4ACK A;  3OMT A;  1S70 B;  4AY5 A;  1H6P A;  3E30 A;  4APF A;  2LLW A;  3SR4 A;  3ONL A;  3UT8 A;  3NZS A;  3MZL B;  3APC A;  4O6F A;  3TWS A;  1R63 A;  3CK7 A;  3ABM E;  2XPZ A;  4FHK A;  3NF1 A;  5CMY A;  4X4D A;  3ZKJ A;  4CT0 A;  4JEH A;  4GA1 A;  3UWP A;  4CGW A;  3R9M A;  4CDM A;  5EDS A;  2YQ8 A;  3PUK A;  3TG4 A;  3A9X A;  4NUR A;  4Q94 A;  3HXC A;  5GAG i;  5G05 J;  4ILG A;  4BFR A;  4WWO A;  3AS4 A;  4Z58 A;  5FWQ A;  3GUU A;  5FIN A;  4ER3 A;  2PXQ A;  1UTX A;  1IYG A;  3LPZ A;  4N2Q A;  2A4Z A;  4J1W A;  3FUE A;  2P9N G;  2H6F A;  3ZUV B;  2XGM A;  3B7S A;  3F6Q A;  2PQN A;  2UWJ G;  3KSQ A;  3BDN A;  2PUF A;  1SQM A;  5BV1 A;  4GA2 A;  4X4I A;  1BU9 A;  5DBK A;  3FMY A;  2WIU B;  3VK0 A;  3LXU X;  2LNI A;  3OAW A;  3GZ1 A;  3AG2 E;  3LDZ A;  1OUV A;  4JC8 A;  5B3S E;  4X4E A;  5ENO D;  3UM2 A;  3J5P A;  4IVZ A;  3LVR E;  1A17 A;  4M3O A;  3IEG A;  2I2O A;  1OWM A;  1GT0 C;  2LYR A;  1OCT C;  3UUX A;  1WH6 A;  4ILH B;  3GBF A;  4GPK A;  4IA8 A;  2V3C C;  2O4A A;  2FFH A;  2WXR A;  1S64 A;  4PS7 A;  3HXE A;  2CHZ A;  2PXK A;  3FUI A;  4C0E A;  2MRI A;  5DRT A;  4HFG A;  3JQ0 A;  4M7C A;  3NZU A;  3GN5 B;  1N11 A;  4N5Q A;  4BSZ B;  2RKK A;  4DK5 A;  3LFP A;  1INZ A;  4B0Z A;  1LTX A;  4UI9 K;  3UIO C;  3UM1 A;  2AXV A;  3F6W A;  5BPP A;  1FVF A;  1D8D A;  3ZHE A;  2L49 A;  5BXU A;  2VGY A;  4K5A B;  4DI3 A;  4KZC A;  4DPR A;  3QAR A;  4BER A;  3SZ7 A;  4YBA A;  5G04 C;  4TXP A;  3ENE A;  2WXG A;  3CQG B;  4AM9 A;  5EID A;  2UY1 B;  3UXG A;  5JUW A;  3PRE A;  1N95 A;  1WM5 A;  1ELW A;  2GRR B;  1E8Z A;  1H0A A;  3DSX A;  4HVB A;  2KC7 A;  3DWL G;  1ZU2 A;  4DRX E;  3N71 A;  2OEV A;  3UPV A;  3KS2 A;  3U3W A;  1POU A;  2ZIS A;  3LYA A;  2VSN A;  4JB8 P;  1SA4 A;  2YHE A;  2LYQ A;  3D9K A;  5FZQ A;  5C2Y A;  1RZS A;  3Q7F A;  3ZYK A;  3QWV A;  4WWP A;  3FEX A;  4DI4 A;  4AVX A;  3QOW A;  4HB5 A;  2XCC A;  1OCC E;  2F8X K;  2ZIR A;  4DX5 D;  4EHM A;  4GYO A;  3PZD A;  4WVL A;  1BDH A;  2GRM A;  1EPU A;  4QFV A;  3KEA A;  5FJY A;  4IN3 B;  2XPI A;  4GA0 A;  1QQB A;  3L16 A;  4LUN U;  2BKG A;  2BTD A;  3CGH A;  4J8E A;  4Q2J A;  4PU8 A;  3NOG D;  5GAH i;  1ZZ8 A;  3GW4 A;  3QWW A;  3AG3 E;  4U8V D;  4UQX A;  2L0T B;  3ME5 A;  3FUH A;  2XS8 A;  1E8X A;  1TNY A;  3HIZ A;  3UTM A;  4BX9 A;  3RU0 A;  4WNF A;  3AG1 E;  4DLO A;  2FEZ A;  3MKQ A;  3CHP A;  5ARG A;  3QC1 A;  3Q75 A;  1K1B A;  1RZ4 A;  3MLF A;  2NSZ A;  4F8D A;  3LCA A;  2IQC A;  4HXI A;  3G2W A;  3LY9 A;  2IO2 C;  1X2L A;  2L9B A;  3D9M A;  3DRA A;  3TG5 A;  3FUJ A;  4IYP A;  1HO8 A;  3QF3 A;  2CFZ A;  3TFL A;  4HLL A;  3PE4 A;  3LKU A;  2IVQ A;  3B7H A;  2VGE A;  4JL0 A;  3Q9U C;  1EF1 C;  3B95 A;  5AJL A;  4WNG A;  5HS0 A;  2OR1 L;  3CVP A;  1QNF A;  3E34 A;  2OV8 A;  4GMR A;  4MCT A;  4PH4 B;  3UQ3 A;  4BSX A;  1ZZC A;  3PE3 A;  5A7L A;  1HS6 A;  1MX4 A;  5T3R A;  2ZGD A;  2V4L A;  5AJD A;  4BEP A;  2GRQ B;  4G11 A;  5AQA A;  3UX4 A;  3CVU A;  1ZS4 A;  2WQH A;  2L6B A;  3SNX A;  1PRV A;  5HKP A;  3MYV A;  3TWR A;  2XI8 A;  2L0I A;  2ILR A;  1ELR A;  1RZR D;  3G7D A;  3QK0 A;  4APO A;  3EJN A;  1PAQ A;  3ZYM A;  1QZ2 A;  4GZ5 A;  3L6A A;  4GZC A;  4FUL A;  1TN8 A;  3MA5 A;  2XHE A;  3K9I A;  4N39 A;  2ICP A;  5JA4 D;  1OXJ A;  4AY6 A;  2A5U A;  4I1O B;  5KJM A;  3FH5 A; 
#chains in the Genus database with same CATH homology
 4N5C A;  4GYY A;  2AXU A;  1SQ8 A;  4O8B A;  3O4Z A;  3L1P A;  5C1D A;  4A1S A;  5J08 A;  4GU5 A;  2PUA A;  3CQC B;  3SI5 A;  4F1S A;  4FP7 A;  3U66 A;  1PNR A;  1AU7 A;  5CHE E;  4AOF A;  4XZ4 A;  4ANV A;  2LAH A;  2V0P A;  2EQX A;  3FYA A;  5ANR A;  5FQ7 A;  3SBS A;  4ABN A;  4FN3 A;  3BG0 B;  4XKB A;  1UW4 B;  3KZ3 A;  3PEV B;  3QB2 A;  4L2Y A;  5JHA A;  3R1F A;  2PUC A;  3MCX A;  3RRM B;  1H2U A;  3IBE A;  4I1M A;  4UI9 C;  3U4T A;  1E8W A;  3EIQ C;  3FWV A;  4I17 A;  5E75 A;  1MHQ A;  4EZK A;  4U07 A;  1RZR A;  4CDR A;  4EEC A;  2VQ2 A;  2PQR A;  1FVH A;  2D5V A;  3MKQ B;  2A6C A;  3EHM A;  2KCV A;  2HR2 A;  4U8H A;  3S7D A;  5J90 A;  3OQM A;  2CRO A;  2IOL A;  4JA9 A;  4C9B B;  3GYZ A;  3CKC A;  4A3V A;  1RIO A;  1UN9 A;  3FP3 A;  3QDN A;  2XGO A;  4KVM A;  2GW1 A;  4AJW A;  4K03 A;  4WUY A;  1MQS A;  4YVO A;  4CCA A;  2J09 A;  3GN5 A;  4Z5D A;  3APD A;  3B7R L;  4DJA A;  1EYH A;  4GCN A;  4LCT A;  2IV1 A;  1EDU A;  3WXX A;  4A1G A;  4HOR A;  2I9C A;  3FY4 A;  4WAF A;  4PU3 C;  2RG8 A;  1B0N A;  2MHK A;  2C2L A;  1NA0 A;  4G1T A;  4UWK A;  3CR3 A;  3FUN A;  4L2L A;  1PY1 A;  2AXZ A;  4D10 C;  2KCL A;  1NZN A;  2YHC A;  1RPE L;  2QFC A;  4ANX A;  5DIZ A;  3L08 A;  2X6F A;  4I43 A;  3RKV A;  3D1N I;  4LRZ A;  4CEM A;  1KT1 A;  3LY8 A;  5KJL A;  5K98 B;  3PNT B;  1IQU A;  1FCH A;  2XEV A;  4I1A A;  4HOS A;  4YG7 B;  4FBI A;  4F3V A;  2JEK A;  2XQ0 A;  3R7Q A;  4EBA A;  4U04 A;  2KM4 A;  3D9J A;  3FTX A;  4G23 A;  3URZ A;  2VTB B;  1DVP A;  2AW6 A;  4AP2 A;  3I4R B;  2VJ8 A;  3QJZ A;  2HIN A;  5AEN A;  4YND A;  1JH9 A;  1ADR A;  3KD7 A;  2XCJ A;  2WXP A;  3LEW A;  1VPW A;  4N3A A;  5G04 J;  4FA6 A;  2OFY A;  4JCY A;  2E2E A;  3U9W A;  4ACK A;  3OMT A;  2Y3A A;  1E8Y A;  2PZI A;  4GZ3 A;  4AY5 A;  4TRQ A;  1DWK A;  4I6E A;  4APF A;  2J49 A;  3CVL A;  4HOU A;  4E6H A;  5A23 A;  3I4G A;  1OWP A;  3O9X A;  1SZA A;  3ONL A;  3UT8 A;  2CG3 A;  3NZS A;  3JUI A;  3MZL B;  4LER A;  3T5V A;  3LY7 A;  3KXA A;  3CSF A;  3L13 A;  1WY6 A;  4RVB A;  3APC A;  3FUL A;  4FLH A;  3QNK A;  2DIW A;  4HOT A;  4O6F A;  1R63 A;  3CK9 A;  4PS3 A;  3S7J A;  3FUK A;  2JVL A;  1HF0 A;  3CK7 A;  2WQ6 A;  3SF4 A;  2XPZ A;  3JQ1 A;  4FHK A;  3NF1 A;  5CMY A;  3UMV A;  3MV3 B;  4X4D A;  2XIU A;  3JXB C;  3ESK A;  4G2V A;  4Y6W A;  4CT0 A;  3HVE A;  4JEH A;  4GA1 A;  4TV3 A;  4TUU A;  4PU7 A;  4OB4 A;  3FTS A;  3JCK C;  4CGW A;  4JXT A;  3OXG A;  4CDM A;  3R9A B;  5EDS A;  2YQ8 A;  4I9C A;  5EKQ D;  2VYI A;  4FHJ A;  3PUK A;  4GZD A;  3TG4 A;  2JLB A;  3ZXS A;  3TAX A;  4I9E A;  4NUR A;  4Q94 A;  5ARF A;  2WXN A;  1S7E A;  3ASD A;  3RRN B;  2KPJ A;  4B94 A;  2HO1 A;  2IU1 A;  5G05 J;  4H7Y A;  1IC8 A;  4ILG A;  3D9I A;  4BFR A;  4WWO A;  3AS5 A;  1LF8 A;  3AS4 A;  2VGX A;  4Z58 A;  1H2T C;  3D9L A;  4MS6 A;  2KEK A;  5FWQ A;  4CRW A;  4P29 A;  4Q96 A;  2CSF A;  1BDI A;  1UXC A;  2LO6 A;  3QKY A;  1UTX A;  4MKT A;  5FQ8 A;  5M72 A;  1IYG A;  3CEC A;  2WXQ A;  3LPZ A;  3L22 A;  4IRU A;  2A4Z A;  4N2Q A;  4J1W A;  3FUE A;  5CMW A;  2HSG A;  3JXC L;  2I1J A;  2XGM A;  3B7S A;  3CST A;  3FTV A;  2PQN A;  4WND A;  4CT4 A;  2UWJ G;  4I2W A;  2KEI A;  1NP7 A;  2FJR A;  3BDN A;  2PUF A;  1SQM A;  5BV1 A;  4U0Z A;  4MCX A;  3BEE A;  4U0S A;  4GA2 A;  1ZZ9 A;  4X4I A;  4L7T A;  5DBK A;  4FJZ A;  3FMY A;  2PUG A;  2WIU B;  3ASG A;  1WAO 1;  3VK0 A;  4JVS A;  3RRU A;  2BNO A;  1Z3X A;  2LNI A;  3FUM A;  3LXU X;  2WXM A;  3OAW A;  3S7B A;  3SFZ A;  4BX8 A;  2R1J L;  2LSU A;  4NAC A;  3CLJ A;  2FO7 A;  3GZ1 A;  3Q49 B;  4KBQ A;  3LDZ A;  5LCW C;  1OUV A;  4OYS A;  1JWG A;  3LJ3 A;  3PS6 A;  4JC8 A;  4XX5 A;  4Q69 A;  4B89 A;  3CLC A;  4X4E A;  1WIZ A;  4UQY A;  5D0O D;  5LOZ A;  5T4Y A;  4IVZ A;  3CRO L;  2B5A A;  3LVR E;  4UWH A;  1A17 A;  1N52 A;  4J8F A;  2BF0 X;  4M3O A;  2DCP A;  2HM8 A;  3IEG A;  2I2O A;  4HLE A;  4YVQ C;  2CG2 A;  4XIF A;  1OWM A;  1GT0 C;  2LSV A;  4AV7 A;  2X38 A;  2LYR A;  1OCT C;  3UUX A;  1WH6 A;  4J6I A;  3ZRH A;  2PUE A;  4A3T A;  4ACL A;  4ILH B;  1HFA A;  3GBF A;  1U3D A;  3G2V A;  4GPK A;  4IA8 A;  4EZL A;  1Z6T A;  2O4A A;  1HG2 A;  2MOW A;  2PE5 A;  4X4G A;  2WXR A;  2Y4T A;  2WXL A;  4PS7 A;  4BT8 A;  3TXN A;  4GQM A;  3CHR A;  2WB2 A;  2CHZ A;  1NER A;  1SZ9 A;  3FUI A;  1LCD A;  4C0E A;  2MRI A;  2WXJ A;  3MGB A;  4UWG A;  4HFG A;  3JQ0 A;  2C0L A;  4MLP A;  3RK6 A;  1ZUG A;  2X3M A;  2CFU A;  4XI0 A;  4Y6C A;  3ULQ A;  3VLD A;  1PRA A;  2AVP A;  3JXD L;  3NZU A;  3TRB A;  3GN5 B;  1UJK A;  3LVQ E;  4GZ6 A;  3C98 A;  2KZ8 A;  4YAR A;  2EWT A;  3CVQ A;  2LYJ A;  1PC2 A;  3EIJ A;  3ZVV A;  2J9Q A;  3PH0 C;  3IHV A;  4XI9 A;  1WH8 A;  3LFP A;  1HZ4 A;  4DK5 A;  2LYP A;  1OWN A;  4RSY A;  1INZ A;  3ML8 A;  4B0Z A;  4UI9 K;  5E76 A;  3P2B A;  1X57 A;  4URK A;  4F7A A;  2AXV A;  3FU6 A;  3Q4A B;  3T5X A;  4BWR A;  3F6W A;  1JUQ A;  3B7T A;  3G2S A;  3CKB A;  3PXP A;  4I6R A;  3QAQ A;  5BPP A;  2MEZ A;  2CHX A;  4WNE A;  4A55 A;  1FVF A;  2LYK A;  3D9N A;  4BT9 A;  3F51 A;  3RZZ A;  3PVL A;  1H19 A;  4N3C A;  4NRH B;  5ANL A;  3U64 A;  3ZHE A;  3ZPJ A;  2L49 A;  3L54 A;  4BTB A;  5BNW A;  2VGY A;  4Z5H A;  4DI3 A;  3TGO A;  4KZC A;  2O49 A;  4U63 A;  4DPR A;  4GB9 A;  3O48 A;  1YSE A;  3QAR A;  3FTU A;  4X4B A;  4IUL A;  5FT9 A;  1JPL A;  3SCF A;  2UY1 A;  3BG1 B;  2KEJ A;  2XRZ A;  3OTN A;  3ZHE B;  3SZ7 A;  4YBA A;  5G04 C;  3TXM A;  4V3I A;  3ENE A;  2WXG A;  3H5T A;  2WXH A;  3SCG A;  3OXL A;  4JA7 A;  4KYO B;  3CEQ A;  3CQG B;  4J1X A;  4AM9 A;  3ZW3 A;  5AIJ A;  1ZPQ A;  3MKR A;  1WET A;  2UY1 B;  3FEY A;  1KT0 A;  2VSO E;  2J07 A;  1ZZB A;  3APF A;  2NC9 A;  3EUS A;  3UFD A;  3PRE A;  2IJG X;  3KEZ A;  3HZI B;  4G24 A;  1WM5 A;  3ASH A;  3CIA A;  3CK8 A;  2Q7F A;  2WVI A;  1HE8 A;  4FU3 A;  5BW8 C;  5A7D B;  1ELW A;  1IHG A;  4I8T A;  3FUF A;  1E8Z A;  1H0A A;  2XRY A;  3DBS A;  3FTZ A;  5D0Q D;  4HVB A;  2KC7 A;  3OQO A;  1E90 A;  1LQC A;  4W9R A;  2P58 C;  1ZU2 A;  1S0P A;  3N71 A;  3UPV A;  2MQK A;  3KS2 A;  3U3W A;  1DW9 A;  3HVE B;  3QOU A;  1UXD A;  1POU A;  3JYS A;  3LYA A;  4KXK B;  2FF4 A;  3LIS A;  4ATG A;  3FDH A;  4GAA A;  2XSD C;  2VSN A;  3CVW A;  3ZHM A;  1UG3 A;  2LYL A;  3OQN A;  2YHE A;  2X6K A;  2LYQ A;  3ZYL A;  2XJ3 A;  3D9K A;  3MJW A;  3DNV B;  3HHM A;  5FZQ A;  5C2Y A;  2PL2 A;  1RZS A;  2H8R A;  1OSL A;  3ZYK A;  3QWV A;  3ZEF A;  4WWP A;  3FU0 A;  4FAD A;  3FEX A;  4DI4 A;  2PM7 A;  5EX3 A;  4AVX A;  3ZGQ A;  2BNM A;  1ZBP A;  2OVF A;  5FQ6 A;  4ANU A;  4PS8 A;  5G05 C;  1UJJ A;  2VGX B;  2XCC A;  3CHQ A;  4XE0 A;  3QQ6 A;  4GYO A;  1ZZ7 A;  1L1M A;  3PZD A;  4PDX A;  4YG4 A;  3AS8 A;  1BDH A;  1KLX A;  2GRM A;  4GHJ A;  2WM9 A;  1EPU A;  4C0M A;  4ANW A;  4EPZ A;  5KJK A;  1R69 A;  1QP0 A;  4G25 A;  2BUG A;  4QFV A;  1JFT A;  3S8Q A;  2FUL A;  1ZZ6 A;  2WMN A;  4FC8 A;  5FJY A;  3PUJ A;  2WQ7 A;  1HH8 A;  2LAI A;  3CVX A;  4IN3 B;  4LEU A;  4DLQ A;  4BY6 A;  2XPI A;  4GA0 A;  2IOS A;  2IU7 A;  3SD5 A;  3PDN A;  3FTW A;  1QQB A;  3AU4 A;  2HYZ A;  3L16 A;  5T8I A;  2J4B A;  2GRL A;  1JWL A;  4LUN U;  1YA0 A;  5G2N A;  4XKC A;  4WWN A;  2BTD A;  4KVO A;  4JPS A;  4E85 A;  2IF4 A;  3CGH A;  3CHO A;  2J4D A;  4GML A;  4J8E A;  1IQR A;  1Y6I A;  2WXI A;  2YNQ A;  3SBT B;  2GZU A;  2LYS A;  3P1U A;  4J8S A;  3RO2 A;  4PU8 A;  3MV2 B;  2PPX A;  2R63 A;  1U3C A;  5KCM A;  3CVV A;  1JWF A;  1ZZ8 A;  4F53 A;  1QPZ A;  1LCC A;  2IFU A;  3D9O A;  2XGS A;  3FH8 A;  3GW4 A;  3QWW A;  3ZFW A;  3CVN A;  4MRU A;  3EDT B;  4GCO A;  4ME2 A;  3CVY A;  4FLB A;  4UI9 J;  4UQX A;  2L0T B;  1TJC A;  3FUH A;  3Q15 A;  2ION A;  1E8X A;  2DBA A;  2IVG A;  3HIZ A;  5FQ4 A;  4KMO A;  4B8A A;  4JHR A;  5CCL A;  4BX9 A;  3OP9 A;  3IHY A;  3RU0 A;  2IUO A;  1H6K A;  4WNF A;  4EQF A;  4DLO A;  1DNP A;  2FEZ A;  2M63 A;  4JEU A;  4JZY A;  3MKQ A;  2RD0 A;  2KAT A;  4Y42 A;  3CHP A;  1P5Q A;  3RIB A;  5FZR A;  5ARG A;  3QC1 A;  4BTA A;  3ONK A;  3Q47 B;  3VLF A;  2JCG A;  2R59 A;  1UN8 A;  1HU3 A;  1Z3Y A;  4G26 A;  3RO3 A;  3SCH A;  4N3B A;  3AU5 A;  1Y8M A;  1GW6 A;  3FU5 A;  3MLF A;  4KZ0 A;  3KJX A;  2NSZ A;  3GZ2 A;  4F8D A;  3LCA A;  1VDY A;  2PUD A;  3PEU B;  2IQC A;  2R17 C;  2EBY A;  3QWP A;  4PU4 C;  4HXI A;  3G2W A;  2OOE A;  1BPO A;  3DPD A;  2ZU6 B;  4L1B A;  1HF8 A;  5FZS A;  2WXK A;  3LY9 A;  4NDW A;  2I1K A;  4GYW A;  5JJ6 A;  3IKO B;  5CCM A;  1X2L A;  2L9B A;  3D9M A;  4AEZ C;  4J0U A;  1TEZ A;  4IWR A;  2FI7 A;  4JW1 A;  3FH7 A;  2PIJ A;  3HDX A;  3T8M A;  2J08 A;  3G2T A;  4I6T A;  3SGH A;  3I3N A;  1Y7Y A;  3TG5 A;  3FUJ A;  4KT6 B;  2CHW A;  3KAE A;  4IYP A;  1HO8 A;  4X4H A;  2V8S E;  4ILI A;  1E7V A;  4I2Z A;  3VTX A;  1NEQ A;  3QF3 A;  2CFZ A;  2VTB A;  3ML9 A;  3PE4 A;  1Y9Q A;  4B8C B;  3GZS A;  3I5P A;  4JHJ A;  1HX8 A;  3LKU A;  3FFL A;  2IVQ A;  2WUS R;  4PUC A;  3RJV A;  3QYX A;  3PRZ A;  4Z5C A;  4GMJ A;  3B7H A;  3G5G A;  3QWG A;  5G55 A;  3TL5 A;  1QP4 A;  3ESL A;  5AYW D;  3R7R A;  4EBA G;  2KZT A;  2LCV A;  2VSY A;  2FBN A;  5BV0 A;  2YIN A;  4U0U A;  3L17 A;  4JL0 A;  4L23 A;  4YG1 A;  2BJC A;  3PNL B;  1XGW A;  2R5S A;  1EF1 C;  3FYM A;  2E0I A;  2WPV A;  4OVU A;  2OVB A;  1HXI A;  5AJL A;  2WMO A;  4WNG A;  2PM6 A;  2KZT B;  2OR1 L;  3IVP A;  4RG6 A;  3CVP A;  5EX0 A;  4X4C A;  1QP7 A;  1QNF A;  5LFA A;  4CDN A;  1JFS A;  1PER L;  2OV8 A;  3CHM A;  4MCT A;  2AWI A;  1W3B A;  4PH4 B;  5BUZ A;  4I6U A;  4FJY A;  2KCK A;  3UQ3 A;  1ZAY A;  4BSX A;  1PRU A;  1ZZC A;  4I6J A;  4JQD A;  2C0M A;  3PE3 A;  4JHK A;  2ICT A;  3CHS A;  3BD1 A;  5A7L A;  1HS6 A;  2EF8 A;  1NA3 A;  3NQP A;  5T3R A;  5JJT A;  3FTY A;  5KJN A;  1LMB 3;  5HI7 A;  4UWL A;  2V4L A;  4X4F A;  5AJD A;  4G11 A;  5BT1 A;  3MX3 A;  4AXH A;  3UX4 A;  3ZIM A;  2X6I A;  3CVU A;  1TJF A;  3OXF A;  4AIF A;  1ZS4 A;  3UT4 A;  1H2V C;  1ZVV A;  4HS2 A;  1E3O C;  4EZJ A;  2IVB A;  2WQH A;  3D9P A;  1CJG A;  2AUW A;  3ZKC A;  2PUB A;  2X6J A;  3SNX A;  2Y4U A;  3F52 A;  1PRV A;  4I6G A;  2L8N A;  1L5J A;  4R7L A;  4N2S A;  3MYV A;  2BNN A;  2GGF A;  1B89 A;  4J8D A;  1CQT A;  3ZYQ A;  3BS3 A;  2XCB A;  2XI8 A;  4H7X A;  3B13 A;  2L0I A;  2ILR A;  1ELR A;  1ELK A;  4JCX A;  1RZR D;  3G7D A;  2XPY A;  1OWL A;  3QK0 A;  1XWR A;  5A6C A;  5LX8 A;  3VLE A;  1EFA A;  4OVV A;  2VSX E;  4CGV A;  3IV0 A;  5ENN A;  4APO A;  3EJN A;  3S7F A;  5JJ7 A;  3D3M A;  1PAQ A;  3TJP A;  3FUD A;  2O38 A;  3ZYM A;  1QZ2 A;  3ASF A;  5LP0 A;  2QY7 A;  2OND A;  2NXP A;  3B7U X;  4GZ5 A;  3S2A A;  2V5F A;  1LLI A;  3L6A A;  3EHN A;  2I6H A;  4GZC A;  4K0R A;  5JHB A;  1E96 B;  3FU3 A;  1N54 A;  3FHE A;  4FUL A;  1QQA A;  4RG9 A;  3Q5M A;  2X6H A;  3SHF A;  3MA5 A;  1E7U A;  1HG5 A;  3ZN3 A;  2XHE A;  3CV0 A;  3E4B A;  3ZHI A;  4Z59 A;  3K9I A;  2ICP A;  4HOQ A;  4N39 A;  4AY6 A;  1QQE A;  2WXF A;  3G2U A;  5HQ8 A;  5FTP A;  2A5U A;  3UT7 A;  5LCW J;  4I1O B;  1OWO A;  3LS8 A;  4UWF A;  1X5B A;  2L6J A;  1XNF A;  1O4X A;  2WXO A;  4UQZ A;  3HYM B;  3VTY A;  3MEK A;  3FH5 A;  5KJM A;  4NQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...