2AXZA

Crystal structure of prgx/ccf10 complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
306
structure length
306
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 110
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axzA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axzA02
3ZKCA 2BJCA 2XIUA 3D1NI 1YSEA 2AXUA 3QWGA 1GT0C 1OCTC 4JCYA 4JQDA 2WIUB 2ICTA 1WETA 3R1FA 2KEJA 1JH9A 3F51A 2JCGA 1QPZA 1PRVA 2PUDA 1UXDA 3GN5B 3LISA 1LMB3 1CJGA 3F52A 2PIJA 2KZ8A 2CSFA 2XCJA 4Z59A 3PXPA 1ZS4A 1AU7A 3ZHMA 1ZZBA 4X4FA 2IU7A 3BS3A 4Z5HA 1QP7A 2PUAA 1ADRA 4FBIA 2GZUA 2LYJA 3ZHIA 2PUFA 2MEZA 2LYLA 2KEIA 1JWLA 3GN5A 2HSGA 2PPXA 1SQ8A 4IVZA 4Z5CA 1VPWA 2WUSR 3LFPA 4YBAA 4Z58A 3U3WA 1R69A 3EUSA 3KXAA 4X4GA 4I6RA 3BDNA 4I6UA 1L1MA 3BD1A 4X4IA 4X4DA 1RZRA 1OSLA 2EBYA 1POUA 2OR1L 2XI8A 3FYMA 2AUWA 3L1PA 1DW9A 3SCFA 3HZIB 1ZZCA 4MCXA 1BDIA 1LCDA 1XWRA 1CQTA 1BDHA 2IVQA 2IVBA 3F6WA 2IUOA 2FJRA 2L49A 2A6CA 2GRMA 2GRLA 1X57A 1RPEL 3CROL 1WH6A 2PUEA 1ZAYA 2O38A 1DWKA 2LYRA 3JXDL 3DNVB 3QYXA 4X4CA 3KZ3A 2AXZA 1UTXA 1WIZA 1QQAA 1JFSA 3SCGA 1O4XA 3O9XA 4Y42A 2XJ3A 1LCCA 3OQMA 2EF8A 3G7DA 4FN3A 4OB4A 2LYSA 3H5TA 3OP9A 4PU4C 3SCHA 3CECA 2PE5A 4X4EA 3FMYA 1PNRA 4JCXA 2R63A 1WH8A 2CROA 2XSDC 4MCTA 3KJXA 1S7EA 1ZZ7A 1LQCA 4J1XA 3JXBC 1NERA 4GHJA 2H8RA 5K98B 4GQMA 1B0NA 2HINA 2BNOA 2MQKA 1HF0A 3QQ6A 2O4AA 3CLCA 1ZZ6A 2IVGA 2LCVA 4IA8A 1X2LA 2LYKA 4O8BA 3GBFA 3S8QA 1Y9QA 1RZRD 1QQBA 2B5AA 2LYPA 1ZZ8A 3TRBA 2ICPA 3OMTA 4YARA 1QP4A 4YG1A 2O49A 4I8TA 2AWIA 4YG4A 1NEQA 3G5GA 1RIOA 1JFTA 2L8NA 2R1JL 1PERL 4X4HA 3QF3A 4PU3C 1EFAA 3B7HA 4PU7A 5A7LA 3JXCL 1LLIA 1ZZ9A 4F8DA 1UXCA 1ZPQA 2KPJA 3MLFA 3UFDA 1PRUA 4YG7B 2AXVA 2PUCA 2KEKA 4PU8A 1R63A 2PUBA 2IV1A 1IC8A 1RZSA 2AW6A 1E3OC 4IWRA 2EWTA 3IVPA 1ZVVA 3OQOA 1Y7YA 2OFYA 3VK0A 3OQNA 1ZUGA 4Z5DA 2JVLA 1QP0A 2BNMA 2D5VA 3RZZA 2PUGA 2BNNA 4I6TA 4NDWA 1PRAA 4X4BA 3FYAA 4J1WA 2LYQA
chains in the Genus database with same CATH superfamily
3ZKCA 4GZCA 2QFCA 1OCTC 5CBOA 5A6CA 1YYHA 4YDWA 2ICTA 4J8FA 3CR3A 4Y6WA 4HXIA 2IFUA 1TNBA 3ZW3A 1RW2A 2V4LA 4AVXA 3ASDA 3C72A 2ZGDA 3GZDC 1BD8A 4G1TA 3ZPJA 3SI5A 5CEAA 1HG2A 2WUSR 4Z58A 3U3WA 3FUJA 4I6JA 1N95A 1RZRA 1PC2A 3PS6A 2LNIA 3F6QA 5KJMA 4EZJA 3FWVA 5EILA 1YMPA 3BU8A 4UI9J 1LCDA 4B8CB 2GRLA 2ILRA 3L54A 2PXVA 1K8KG 5DBKA 4AEZC 4I2WA 2IOLA 3MCXA 2LYRA 3MGBA 4ILIA 3LCAA 3DWLG 5D0OD 3SR4A 1YCSB 3MX3A 4Q94A 3H5TA 4PU4C 4A55A 4WWPA 2EIME 4N3BA 1PNRA 4JCXA 2LLWA 4IULA 4ACLA 4DX2A 1N0RA 2PZIA 1OWOA 1ZZ7A 3NOCD 4CDNA 4XX5A 4AXHA 3BG1B 2Y4UA 3V31A 3JUIA 5CEDB 1Y9QA 3CK9A 2XXQA 1AP7A 3RO2A 2WQ7A 1N0QA 4FLBA 3MJWA 5JUWA 2AWIA 2HE0A 5EYPF 4X4HA 4PU3C 1X5BA 3S7DA 4U8VD 3ONKA 4PU8A 1Z6TA 3ESLA 2ETCA 4GB9A 3SBTB 1JWGA 1E8ZA 5JA4D 1QP0A 2QYUA 3JQ0A 3LYAA 5G05C 2BNMA 2DVWA 1BU9A 3DSWA 1EPUA 4ILGA 1E8XA 3E32A 3UM1A 2LYQA 4JB8P 3FHEA 2UY1A 3T5XA 5KJLA 4JL0A 1DCQA 2VQ2A 2J7WA 4U8HA 3CKCA 5LP0A 2IU7A 3M9LA 2YINA 2KXPC 2R02A 2Y1LE 5EX0A 1U3CA 2C2LA 2WB2A 3ONLA 1N11A 5CECB 4AIFA 1UJKA 4PH4B 1XWRA 2IUOA 4UQXA 1TYQG 2WXJA 2EQXA 3PZ4A 4U0ZA 2MOWA 5GAGi 1QQAA 1HO8A 3OP9A 1WDYA 4X8QA 1IKND 2FULA 2XSDC 4ANVA 2M4HA 3LXUX 4FHJA 3FU5A 3ZXSA 3RIBA 4PS3A 2YQ8A 3S8QA 3DPYA 4F1SA 3DRAA 2WXOA 3GZ1A 2UY1B 2KZTA 3TXNA 4YG4A 1D8EA 4RLYA 4EZIA 5KJKA 1UXCA 4EHMA 4GMJA 3APCA 4CCAA 2DCPA 1UG3A 3D9OA 2L0IA 1G3NB 4U95D 1HFAA 5DRTA 3LKUA 2VGEA 3NZUA 4TV3A 1OXJA 4TRQA 4IYPA 2CFZA 4EPZA 2XQ0A 3TELA 3SHFA 2LSUA 3HVEB 1BI7B 2J4BA 3FTZA 1QPZA 1TR4A 1QQEA 4EK9A 2X6FA 4DE9A 5HRYA 4ER0A 1TN8A 1HH8A 3UM2A 2ZXWE 1JCRA 3UT4A 4HOTA 3ASNE 3CHQA 1HU3A 4Q69A 1JWLA 4BX9A 3ASGA 3EUSA 5FZSA 3BG0B 4UI9C 4HQDA 3KEAA 3SCFA 2PM6A 5JJ7A 3NBNB 5J08A 2QYJA 4B8AA 4G23A 4A1GA 1WH6A 2PXBA 4GZ5A 3UI2A 2VGYA 3Q15A 1QZ2A 3FTXA 4V3IA 2CROA 1H6KA 3S7BA 3B7BA 4EBAG 3JXBC 4QFVA 4TUUA 4W9RA 4GQMA 2RKKA 1Q2ZA 4YDYA 3LJ3A 3CHOA 1D8DA 5CMYA 3ME5A 3B7UX 2XZDG 2IVGA 3DSTA 1QQBA 4FLHA 1OCZE 3PVLA 4YARA 3ZYKA 1DNPA 4BY6A 3GZDA 2R1JL 1SVXA 3UPVA 4GAAA 2H6IA 2HFZA 2VSYA 4XKBA 4APFA 3HVEA 3RO3A 2WXMA 2YNQA 1TN7A 2P9NG 4KZCA 5JHAA 4X4BA 4RSYA 2XHEA 5KNGA 3U64A 3UIOC 4PDXA 3BUAA 4GA2A 2HM8A 1N4PA 1HF8A 4Z59A 5AARA 1JPLA 3LPZA 4XEIG 2J08A 1MHQA 2HSGA 4IVZA 3AS5A 1UW4B 4I1AA 2IJGX 3KXAA 2C0LA 3BD1A 4X4IA 5AYWD 3CVWA 3CHMA 3Q4AB 3G2VA 2IVQA 2FJRA 3EUVA 2GRMA 3LY8A 3Q7FA 3DM5A 4KXKB 3CVQA 4UQYA 3ML9A 3UXGA 4HBDA 5ARFA 3G7DA 4NURA 3S7FA 3SFZA 4B94A 2VYIA 4P29A 2FO7A 3LVQE 3EIQC 3MV2B 2EIJE 4WNFA 1HF0A 2O4AA 2IQCA 2OV8A 5BXOA 3Q49B 2MXDA 4K5CA 2HR2A 3SY2A 2O49A 3FUFA 3UIPC 4PUCA 2QY7A 4DE8A 3ABME 2XRZA 3C5RA 1H6PA 2V5FA 2AJAA 2KEKA 3IHYA 2P9KG 3PDNA 3D9KA 3RAUA 4RG9A 4GYYA 4LNUD 4KT6B 3TWXA 1HS6A 4G25A 1OWNA 3KSLA 3QAQA 3QNKA 3A9ZA 2DIWA 2BKGA 3TEPA 4TUMA 3X2QE 5BW8C 3PRZA 2DBAA 4URKA 4FHKA 3QOXA 4I9CA 3Q79A 3L16A 3OKZA 4I6RA 3SQVA 2EBYA 4G26A 3J5PA 5B1BE 4ANUA 4O1PA 2JABA 3DEPA 4DPRA 3TXMA 5D66A 1ELKA 2A6CA 5CBNA 1SZAA 5BT1A 2BTDA 3V79K 3JXDL 2IO3C 2GGFA 4I1MA 5CERB 3UT7A 2OCCE 4XE0A 4XI9A 3LQXA 3SD5A 4WNEA 4N3AA 5EYLA 3QKYA 3EHMA 3OWQA 2PXEA 4O8BA 3GBFA 1OT8A 5D2MC 5BV1A 3UWPA 4JHKA 5ENRD 5AJDA 1Y8MA 3PNTB 2P58C 3G5GA 3QF3A 1Z5SC 2RD0A 4YG7B 1SA5A 2EWTA 4IRUA 1SQMA 1NP7A 2OVFA 5M72A 4I6TA 4GZ6A 3ZUVB 4APOA 3LVRE 2YHCA 4EQZA 1NZNA 4JQDA 5HKPA 2WIUB 3CHSA 3T5VA 1N4SA 2V4HC 3ASFA 4ATGA 2CSFA 5FT9A 3EU5A 5FIOA 3PREA 2YHEA 1ZZBA 4YVOA 3ZHIA 3CVVA 4EKIA 1WAO1 3CVXA 3OXFA 2KM4A 4GTQA 3TWUA 4UWLA 4FJYA 4GCOA 4BT8A 3EU9A 2XI8A 3CGHA 3FYMA 3L1PA 2X6JA 4AJWA 1MZCA 1ZZCA 3EIJA 5EKQD 4O6FA 2X38A 3PH0C 3F6WA 4YDOA 3RK6A 2LUHA 4M7CA 4L7TA 3DNVB 2KC7A 4JC8A 4JEHA 3PE3A 4XKCA 1JCSA 4ER5A 3O9XA 2V8SE 1LCCA 4WVLA 4HOSA 1H0AA 4X4EA 4LSZE 4MCTA 3RRNB 3IEGA 3U9WA 2NYJA 4L23A 3SNXA 3FDHA 1KZPA 1H19A 2PXFA 5H7PA 2V0PA 3AU5A 5ANLA 1JFTA 2L8NA 2PXTA 4GPMA 4HLLA 5AQ7A 5DIZA 3UM0A 5EIBE 3HXFA 5EN5D 1JWFA 5ENPD 4MRUA 3UFDA 3AS8A 4A63B 2AXVA 3KAEA 3S7JA 3HHMA 4IWRA 4E6HA 4UWFA 4EZLA 2WQ6A 4FADA 2I6HA 3C3QA 1ZUGA 4WWOA 2F37A 3FUMA 1PRAA 1ZB1A 3R09A 2GRQB 2WM9A 4JHRA 5FQ6A 3FUKA 3PZ2A 1JH9A 3FUEA 1QYMA 4OVVA 2WPVA 3E37A 3E34A 3ZHMA 4K0RA 1NA3A 1K3ZD 1N94A 4CZ2D 4F1PA 3ULYA 1SQ8A 2PL2A 5ENQD 1PAQA 3EJNA 4N2SA 1OSLA 1MX2A 1A17A 2J07A 4HS2A 3TWVA 2P9UG 2WXKA 3CVYA 4N2QA 1BDHA 2XGOA 4N5CA 3G2SA 3CROL 1BLXB 3L82A 1ZU2A 4AM9A 2J09A 3DPDA 4MKTA 4DX7D 4B93B 3AS4A 4CEMA 3D9HA 2A5EA 1S64A 2WVIA 3OQMA 2VEOA 1OWLA 3HIZA 3O4ZA 3SFYA 4I43A 3FH7A 3K9IA 1WH8A 5GAHi 3LEWA 3VTXA 1KLXA 3EHNA 1V54E 4A3VA 2LYPA 3TRBA 3NXHA 2XCCA 2WXHA 4QQIA 3HXCA 3DBSA 1NEQA 3FU3A 2CG2A 3QK0A 4H7XA 3MKQB 2CHZA 3B7HA 2IONA 4PU7A 3JXCL 1H2VC 4JEUA 2XS8A 1W3BA 4DX6D 2ETAA 2VGXB 3MV3B 2R2LA 3NB2A 4KZ0A 1Z3YA 4JA7A 4JXTA 3E4BA 4Q96A 2BJCA 5CCLA 1YSEA 2P9PG 4JCYA 2XEHA 2ETBA 4C0MA 2ZISA 2JCGA 2PUDA 2B0OE 2XENA 2BEDA 3KD7A 5CHEE 4Z68A 1UN9A 4N39A 1D9SA 2PXQA 4X4FA 3T9KA 4YNDA 3UT8A 3D3MA 2KEIA 3B7TA 4YBAA 1QNFA 3UMVA 1R69A 2PNNA 1H2TC 4OAUC 2RFMA 2XGSA 1MQSA 4DK5A 4M3OA 3UUXA 3ENEA 3HZIB 4L1BA 4F7AA 1IHBA 3NROA 2O38A 1FVFA 2HYZA 4FC8A 4GA0A 4DJAA 3FU0A 2ZGGA 3KSQA 2IF4A 3GZSA 3VLEA 3ZIMA 3NZLA 1QBQA 3RSEG 3CHPA 2M63A 3JXIA 3QWPA 4GTRA 2PQNA 2R63A 3OXLA 5C2YA 4GA1A 3ZNGA 4JW1A 4CGWA 3IKOB 2FI7A 4EKGA 5DTQA 3U4TA 1KZOA 4I8TA 3RJVA 2XXAA 2WXFA 5T4YA 4LRZA 3DXKG 4O60A 5A7LA 5EDSA 2NC9A 3NAWA 3FTSA 3J5QB 4K5BA 4U96D 2E0IA 3FUIA 3Q73A 1TNZA 4L9PA 3UINC 5KCMA 4KVOA 3GUUA 4DX1A 1N4QA 2JVLA 2Y4TA 3AG4E 1V55E 1INZA 1MX6A 4ZHBA 2NSZA 4FULA 2LXLA 4GTTA 3W9FA 4Y6CA 2EIKE 3CQCB 4J7WA 4WNDA 3I5PA 2BUGA 3L22A 4KBQA 5LFAA 3F52A 3O48A 5FWQA 3CVLA 5BXUA 4BFRA 3FEXA 5HI7A 5HQ8A 2A4ZA 3GN5A 1E96B 5LX8A 3BDNA 3OXGA 3V2OA 2AUWA 4C9BB 1DW9A 3MYVA 2FFHA 1DC2A 4MS6A 3ZVVA 3MKQA 1U2ZA 2L49A 1LD8A 3FY4A 4GYWA 3ML8A 3SGHA 1U2VG 4X4CA 3UX4A 3KZ3A 2AXZA 4GTSA 3ZHEA 1O4XA 3CVNA 2FO1E 3CHRA 1BI8B 5HS0A 2JQEA 2WXLA 1S7EA 3U66A 4J1XA 2I1JA 4O1OA 2L9BA 2C0MA 1EYHA 3FULA 2B5AA 2BKKB 4HFGA 4BERA 2JEKA 2MRIA 4DUIA 2YBDA 5CRUA 3WXXA 5A23A 3APDA 5ENSD 2PUBA 2IV1A 3LDZA 1IC8A 3IVPA 4ILHB 2GRPB 3VK0A 4AP2A 3FUHA 3D9JA 3FP3A 4HRMB 1IYGA 1NI1A 3IBEA 3KS2A 4ER7A 2IEJA 3FFLA 2XIUA 3D1NI 3L6AA 2ZIRA 4WAFA 1QZXA 5LOZA 5T8IA 3DEOA 1FVHA 1PRVA 3B13A 4K03A 4ATZD 4XIFA 2XCJA 1ZS4A 4GZDA 3EHQA 4HB5A 4BEPA 3QDNA 2IO2C 4PS7A 3HXEA 1A5EA 3N71A 2BF0X 1GW6A 1E7VA 3Q78A 4X4DA 2QZAA 5FZRA 4ZFHA 3R7QA 2WXQA 2V5QC 2DZNA 1DWKA 3L13A 2KZTB 4BTAA 4WWNA 3AG2E 3IHVA 4BX8A 4CDRA 5JJ6A 3UKRG 4BSZB 4LG6A 4YDEA 4GMLA 3KJXA 5FJYA 1LQCA 3JQ1A 2XXPA 1P5QA 4I6EA 1AWCB 2L0TB 3CLCA 1KT0A 1OWMA 4JZYA 1KT1A 4CT0A 1K1AA 2DWZA 4A3TA 1NFIE 1EDUA 2ICPA 3OMTA 4F6RD 1QP4A 2XEVA 1OY3D 3A9XA 3KL4A 2EILE 2AVPA 2J7UA 3FEYA 3TGOA 4BWRA 4F8DA 4U04A 2KPJA 1YA0A 3PE5A 5DTRA 3NF1A 3MEJA 2L6BA 1RZSA 2GRRB 1TEZA 4NRHB 2HCSA 3L9TA 2J4DA 2L6JA 4J8SA 4UWKA 4JA9A 4RQIA 3R9MA 4H7YA 3UKUG 3EDTB 4RG6A 3AG3E 1EF1C 3PUKA 4U07A 1DVPA 2OOEA 4I6GA 3PXPA 4GU5A 3ASOE 1AU7A 3NZSA 1SZ9A 2Q7FA 1ADRA 3T8MA 3MKRA 2PUAA 4GZ3A 2VSXE 2GZUA 3ZU7B 4Z5CA 3DSXA 1MX4A 1B89A 5DT2A 3SO8A 3R9AB 5G05J 2GRNB 1NA0A 4HOUA 5AIJA 1IXVA 3QB2A 3URZA 3QARA 3TG5A 4LEUA 3ZEFA 5JMND 1E7UA 1WIZA 2XJ3A 4FN3A 2R5SA 4U7EB 3CECA 2PE5A 4EECA 5BUZA 5ARGA 1ZBPA 1DCEA 5BNWA 5IY5E 3TJPA 2Y3AA 3HXBA 1RZRD 4HORA 4FU3A 2LAHA 5ENNA 1ELRA 5EX3A 4B0ZA 2KCKA 4U63A 4NQ0A 2MHKA 3DSVA 2VTBB 2X6KA 2OVBA 5T3RA 3ZRHA 3E33A 2PXUA 4MBGA 4TXQA 4ABNA 4EBAA 3FYAA 3MEKA 2A5UA 3HXDA 1FPPA 3QWWA 1GT0C 1TNOA 1O1TA 4GTOA 1O5MA 2KEJA 2PXPA 2WXIA 5BV0A 1XGWA 5D0QD 1CJGA 3V2XA 2PXKA 5E75A 5CMWA 2VTBA 2CFUA 2EINE 4Z5HA 3CVUA 4FBIA 1HXIA 1OCRE 4LNBA 3CEQA 3UQ3A 3D9MA 5AN8A 3Q9UC 2WXGA 5ENTD 2KCVA 4WUYA 3PE4A 4R7LA 2VSOE 2XPYA 3LY9A 3QYXA 2DZOA 4I9EA 5FQ8A 3CKBA 3ZN3A 3PZ1A 5KJNA 4NIKA 4F3VA 4KYOB 1HZ4A 3FMYA 3ESKA 3TWSA 3VWSA 3FUNA 4J0UA 4I1OB 1BPOA 4C0EA 1OWPA 3QQ6A 1XNFA 2Y0BG 4YVQC 3MZLB 3PZ3A 3Q75A 1O1RA 4N3CA 2XGMA 3CK8A 2VGXA 5DRYA 3GW4A 5JHBA 1VDYA 3C3OA 5ENOD 1ZZ9A 2LLVA 3UTMA 1HE8A 1ZPQA 3MLFA 4CGVA 4E85A 1R63A 1KPSB 2JLBA 3FTWA 4ER3A 5KNHD 2CG3A 3ABLE 5JJTA 1OCOE 3OQNA 3FTVA 3Q5MA 3TG4A 3HDXA 1SW6A 2BNNA 5C1DA 4NDWA 1N54A 3QFIA 3Q7AA 2X6HA 2AXUA 1N52A 3PEVB 4Q2JA 3F51A 2F0YA 2I1KA 4G2VA 4I17A 4XI0A 1LMB3 1Y6IA 4TXPA 1DULA 1UOHA 1QP7A 3GYZA 1HQ1A 3NDBB 5FTPA 2LYJA 1MFQC 3MA5A 2PQRA 4ACKA 4LCTA 1LD7A 3D9PA 3SX0A 4X4GA 4G8KA 3JUEA 4HRNA 3OAWA 2FF4A 5FZQA 4BSXA 4LNGA 2IOSA 4BTBA 4MCXA 1CQTA 3VLDA 4ME2A 1L5JA 3B7SA 1QB2A 2WMNA 2R03A 3HYMB 3QJZA 2PM7A 1UTXA 2V3CC 2MYOA 4G8LA 2P9LG 4WNGA 3ZGQA 2RFAA 1TN6A 2IU1A 1WG0A 1TNUA 4AY6A 3G2WA 4HNAD 5K98B 3G0TA 2BNOA 4CYMD 3VLFA 1N9AA 4GTVA 5ITZF 2LCVA 3JCKC 3RRMB 3D9IA 4HRAA 3T8KA 4OYSA 1MJ0A 1ZZ8A 3S2AA 4CDMA 4D10C 3IXEA 3I4GA 4ANWA 2WXPA 3PZDA 3ZYMA 1MYOA 2P2CP 2P9IG 5FQ4A 3ULEG 1HX8A 1NL4A 3CSFA 3CSTA 3PEUB 1PRUA 3UM3A 3GZCA 2PUCA 3SF4A 1IHGA 1UJJA 3V30A 5CCMA 1ZVVA 2LXMA 2NXPA 3FTYA 4K5AB 3RZZA 2I9CA 4RVBA 1FT1A 3G2TA 4C48B 4J1WA 1PY1A 1Z3XA 3QWGA 4KVMA 3TWWA 1FT2A 3R1FA 4OAVB 3QOWA 4NACA 3P2BA 4FA6A 3GN5B 3JYSA 4ANXA 2PIJA 3CLJA 4OVUA 1S63A 4J8EA 4MLPA 3BS3A 2OEWA 3JXJA 5DTMA 2F8XK 2MEZA 2LYLA 4U0UA 2PPXA 5ANRA 1JUQA 2I2OA 4I6UA 1L1MA 4OBMA 2OEVA 1TNYA 1X81A 2VSNA 3Q9NC 3TWQA 4DLOA 3RU0A 3I3NA 3FH8A 3CV0A 3TWRA 1IQRA 4FJZA 3BQOA 2IVBA 1X57A 1UN8A 1ZAYA 4DRXE 4GPKA 3NOGD 4F53A 4TXRA 2WMOA 2X3MA 2EF8A 5AJLA 4U0SA 2DYRE 3AAAC 5KWDA 1HG5A 3ISMC 3DXMG 4CRWA 1N4RA 1TJCA 3AU4A 4L2YA 2P9SG 2J8SD 4HVBA 1B0NA 2HINA 4AY5A 5AQBA 3LY7A 1ZZ6A 3AJIA 4JVSA 4IA8A 3DSUA 1OCCE 3VTYA 3ZYQA 5DSXA 1E90A 4G11A 2UWJG 2QC9A 3TFLA 5G04C 3ZHEB 2XPIA 5J90A 4EQFA 3CK7A 3L08A 4GCNA 1EFAA 4UQZA 1LLIA 3OTNA 2VJ8A 3ZXPA 4GYOA 2LAIA 2H6HA 2H6FA 2R05A 2F8YA 2AW6A 3WG7E 4GTPA 4UWHA 3OQOA 4AV7A 2FBNA 4KMOA 2KBXA 4HI9A 4DLQA 2LSVA 2WQHA 3B95A 3LJNA 3NQPA 2RG8A 2CHXA 5KBAA 2XCBA 2HCNA 3CQGB 2XZTG 3ABKE 3A9YA 3FH5A 2KZ8A 5A7DB 1ELWA 1S0PA 1SA4A 2XRYA 3G2UA 2PXDA 3I4RB 1VPWA 3FTUA 2HO1A 1POUA 3B7RL 2X6IA 2R17C 3C98A 1BDIA 2R59A 1JCQA 4BESA 1RPEL 3KEZA 2LNMA 3C3RA 5CRVA 2XS1A 5FQ7A 2J9QA 3EHRA 1NW3A 4AOFA 4HOQA 4N5QA 3SCGA 4DI4A 3DSSA 4PS8A 1S70B 4LUNU 4OB4A 3TL5A 3SCHA 2E2EA 3PNLB 5BPPA 3TWTA 4JD2G 4IN3B 4L2LA 1NERA 4GHJA 5AAOA 3CIAA 2MQKA 2XPZA 4GTMA 1O1SA 1IQUA 4ER6A 4UWGA 5AENA 4LERA 2H6GA 1RIOA 1PERL 3ASHA 3QOUA 5G04J 3HG0D 2GW1A 2J49A 3SFXA 3APFA 2ZU6B 2GROB 3CVPA 2PXLA 4I2ZA 3W9GA 3ZYLA 5AQ9A 2OFYA 4UI9K 3RKVA 2ODRD 2WXNA 2D5VA 2PUGA 4A1SA 2FEZA 4G24A 1TJFA 3FUDA 4J6IA 4XZ4A 1WETA 1WY6A 4DI3A 1UXDA 3LISA 2Y69E 4GMRA 3AG1E 5LCWC 1U3DA 5EIDA 3IV0A 3PUJA 4FP7A 2ONDA 5E76A 4DX5D 2PUFA 3ZPXA 4J8YA 3LFPA 1LF8A 2WXRA 2OR1L 3BEEA 3GZ2A 4BETA 3SBSA 2LO6A 3R7RA 4HLEA 5LCWJ 2DYSE 1LTXA 1H6OA 5FINA 2IY0C 3RRUA 3QWVA 3SZ7A 5AQAA 4JHJA 2PUEA 3TAXA 3D9NA 2L1PA 1JFSA 4Y42A 2KCLA 2LYSA 4B89A 5B3SE 1E8WA 3D9LA 4HRLA 4EZKA 2B6CA 4JPSA 3ULQA 4BT9A 2KATA 2H8RA 4CT4A 3P1UA 4HI8A 1X2LA 2LYKA 2CHWA 1OUVA 4YG1A 3LS8A 1FCHA 3ZFWA 1RZ4A 4UUCA 5B1AE 3Q47B 1E8YA 4U8YD 3QC1A 1H2UA 5G55A 3ZKJA 2XEEA 1E3OC 3E30A 1Y7YA 5G2NA 4J8DA 3L17A 4Z5DA 1WM5A 1K1BA 3FU6A 3HRAA
chains in the Genus database with same CATH topology
3ZKCA 2X6HA 4FULA 4GZCA 2AXUA 1OCTC 2QFCA 5A6CA 1HS6A 4Y6CA 2ICTA 4J8FA 1N52A 3CR3A 3CQCB 3PEVB 4Y6WA 4G25A 4HXIA 4WNDA 1OWNA 2IFUA 3QAQA 3F51A 2BUGA 2I1KA 3I5PA 3L22A 3QNKA 4G2VA 4I17A 4KBQA 3ZW3A 5LFAA 4XI0A 1LMB3 2DIWA 3F52A 1Y6IA 2V4LA 4AVXA 3O48A 5FWQA 3ASDA 3CVLA 5BW8C 3PRZA 1QP7A 2DBAA 3GYZA 4URKA 4G1TA 4FHKA 4BFRA 3FEXA 5HI7A 3ZPJA 5HQ8A 5FTPA 3SI5A 2LYJA 3MA5A 2PQRA 2A4ZA 4I9CA 4ACKA 3GN5A 1E96B 1HG2A 4LCTA 5LX8A 2WUSR 4Z58A 3D9PA 3U3WA 3L16A 3BDNA 3FUJA 4X4GA 4I6JA 4I6RA 3OXGA 1RZRA 2EBYA 4G26A 1PC2A 3OAWA 2FF4A 3PS6A 2LNIA 5FZQA 4ANUA 2AUWA 4BSXA 4C9BB 1TEZA 5KJMA 1DW9A 3MYVA 4EZJA 3FWVA 2IOSA 3TXMA 4UI9J 4MCXA 4BTBA 4DPRA 1LCDA 1CQTA 3VLDA 4MS6A 3ZVVA 4B8CB 3MKQA 4ME2A 1L5JA 2L49A 2A6CA 2GRLA 1ELKA 2ILRA 3B7SA 3FY4A 1SZAA 3L54A 5DBKA 4GYWA 4AEZC 5BT1A 4I2WA 3ML8A 2IOLA 3MCXA 2BTDA 2LYRA 3JXDL 3MGBA 2WMNA 4X4CA 4ILIA 3SGHA 3UX4A 3KZ3A 3LCAA 3HYMB 2AXZA 3QJZA 2PM7A 1UTXA 5D0OD 3ZHEA 1O4XA 3CVNA 3CHRA 3MX3A 4Q94A 4WNGA 3H5TA 4PU4C 2GGFA 3ZGQA 4A55A 2IU1A 4I1MA 4WWPA 3UT7A 4N3BA 1PNRA 4JCXA 4IULA 4XE0A 4XI9A 4ACLA 4EBAG 2WXLA 3SD5A 2PZIA 4WNEA 1OWOA 4AY6A 1S7EA 1ZZ7A 3U66A 4J1XA 3G2WA 2I1JA 5K98B 4N3AA 4XX5A 4CDNA 4AXHA 2BNOA 2L9BA 3BG1B 2C0MA 2Y4UA 3VLFA 3QKYA 3EHMA 2LCVA 3JUIA 4O8BA 3GBFA 3D9IA 1Y9QA 3JCKC 3RRMB 1EYHA 3CK9A 3FULA 2B5AA 5BV1A 4OYSA 1ZZ8A 4JHKA 5AJDA 3S2AA 4CDMA 1Y8MA 3RO2A 4D10C 3PNTB 2WQ7A 3I4GA 4HFGA 4FLBA 2WXPA 2P58C 3MJWA 4ANWA 2AWIA 3PZDA 3ZYMA 3G5GA 5FQ4A 4X4HA 3QF3A 4PU3C 1X5BA 2JEKA 3S7DA 2MRIA 1HX8A 3CSFA 3CSTA 3PEUB 1PRUA 2RD0A 3ONKA 3WXXA 4YG7B 2PUCA 3SF4A 4PU8A 5A23A 1Z6TA 3APDA 3ESLA 1IHGA 2PUBA 2IV1A 3LDZA 1IC8A 4GB9A 1UJJA 3SBTB 5CCMA 2EWTA 3IVPA 1ZVVA 1E8ZA 1JWGA 4ILHB 4IRUA 1SQMA 4AP2A 3VK0A 2NXPA 3FTYA 1QP0A 3JQ0A 3FUHA 3LYAA 5G05C 2BNMA 1NP7A 3RZZA 2I9CA 2OVFA 3D9JA 3FP3A 5M72A 1IYGA 1EPUA 4I6TA 3IBEA 4GZ6A 3KS2A 4ILGA 4RVBA 3G2TA 1E8XA 3FFLA 4APOA 1PY1A 4J1WA 2LYQA 1Z3XA 3LVRE 2XIUA 2YHCA 3D1NI 3QWGA 1NZNA 3FHEA 4JQDA 3L6AA 4WAFA 2WIUB 3CHSA 4KVMA 5LOZA 5T8IA 3T5VA 3R1FA 2UY1A 3T5XA 4NACA 5KJLA 4JL0A 3P2BA 1FVHA 1PRVA 2VQ2A 3B13A 4K03A 3GN5B 4FA6A 3ASFA 3JYSA 4XIFA 4ANXA 2PIJA 4U8HA 2CSFA 2XCJA 4ATGA 5FT9A 3CLJA 1ZS4A 3PREA 4GZDA 4OVUA 3CKCA 4J8EA 2YHEA 1ZZBA 3QDNA 4MLPA 2IU7A 3BS3A 4PS7A 4YVOA 5LP0A 2YINA 3ZHIA 3CVVA 2MEZA 2LYLA 4U0UA 3N71A 1WAO1 2PPXA 5ANRA 3CVXA 3OXFA 1JUQA 2BF0X 2KM4A 1GW6A 2I2OA 1E7VA 4I6UA 1L1MA 4FJYA 4UWLA 4X4DA 5EX0A 4GCOA 1U3CA 2C2LA 4BT8A 2WB2A 2XI8A 2VSNA 3CGHA 3FYMA 5FZRA 3ONLA 4DLOA 3L1PA 2X6JA 4AJWA 3RU0A 4AIFA 3I3NA 1UJKA 1ZZCA 3FH8A 3CV0A 3EIJA 4PH4B 1XWRA 1IQRA 4FJZA 4O6FA 5EKQD 2X38A 2IVBA 3PH0C 3F6WA 2IUOA 4UQXA 2WXQA 3RK6A 1X57A 2WXJA 1UN8A 1ZAYA 2EQXA 1DWKA 4L7TA 3L13A 4GPKA 3DNVB 2KZTB 4BTAA 2KC7A 4JC8A 4F53A 4JEHA 3PE3A 4U0ZA 4XKCA 2MOWA 4WWNA 1QQAA 3IHVA 4BX8A 4CDRA 3O9XA 2WMOA 1HO8A 2V8SE 2X3MA 1LCCA 2EF8A 5JJ6A 5AJLA 4HOSA 3OP9A 4U0SA 1H0AA 1HG5A 4X4EA 3R7QA 4CRWA 1TJCA 3AU4A 2FULA 4GMLA 2XSDC 4MCTA 4L2YA 3KJXA 5FJYA 4ANVA 3RRNB 3LXUX 1LQCA 3IEGA 3JQ1A 4FHJA 3U9WA 3FU5A 4L23A 4HVBA 1B0NA 2HINA 1P5QA 4I6EA 3ZXSA 2L0TB 3SNXA 3CLCA 4AY5A 3FDHA 1ZZ6A 1KT0A 1OWMA 3LY7A 3RIBA 4JVSA 4IA8A 4PS3A 2YQ8A 4JZYA 3S8QA 1H19A 1KT1A 3VTYA 3ZYQA 4CT0A 4F1SA 2V0PA 1E90A 2WXOA 4G11A 2UWJG 4A3TA 3GZ1A 1EDUA 2ICPA 2UY1B 3OMTA 2KZTA 3AU5A 3TXNA 1QP4A 5G04C 2XEVA 2XPIA 3ZHEB 4YG4A 5ANLA 1JFTA 4EQFA 2L8NA 5J90A 2AVPA 3CK7A 3L08A 4GCNA 5DIZA 1EFAA 3FEYA 3TGOA 4UQZA 1LLIA 3OTNA 2VJ8A 4F8DA 4U04A 1JWFA 1UXCA 4BWRA 2KPJA 4MRUA 3UFDA 5KJKA 1YA0A 3AS8A 4GMJA 3APCA 4GYOA 4CCAA 2DCPA 2LAIA 2AXVA 1UG3A 3D9OA 3KAEA 3S7JA 3NF1A 2L0IA 1RZSA 2AW6A 3HHMA 4IWRA 1HFAA 4UWFA 4E6HA 4UWHA 3OQOA 4NRHB 3LKUA 4EZLA 4AV7A 2FBNA 4KMOA 2WQ6A 3NZUA 4FADA 2J4DA 2I6HA 4TV3A 1ZUGA 4DLQA 4TRQA 2LSVA 2WQHA 2CFZA 4IYPA 4WWOA 2L6JA 4J8SA 4UWKA 4EPZA 3FUMA 1PRAA 4JA9A 3NQPA 2RG8A 2XQ0A 2CHXA 2WM9A 4JHRA 5FQ6A 2XCBA 4H7YA 3SHFA 2LSUA 3EDTB 4RG6A 3CQGB 3FUKA 3HVEB 1EF1C 2J4BA 3FTZA 1JH9A 3PUKA 1QPZA 4U07A 1DVPA 3FUEA 3FH5A 2KZ8A 4OVVA 2OOEA 1QQEA 2WPVA 5A7DB 4I6GA 2X6FA 3PXPA 4GU5A 1AU7A 1HH8A 3NZSA 1SZ9A 3ZHMA 1ELWA 2Q7FA 4K0RA 1S0PA 1ADRA 1NA3A 3T8MA 3MKRA 2PUAA 4GZ3A 2VSXE 2XRYA 3G2UA 2GZUA 3UT4A 4HOTA 3CHQA 1HU3A 4Q69A 1JWLA 4BX9A 4Z5CA 1SQ8A 3I4RB 2PL2A 1VPWA 3ASGA 3EUSA 5FZSA 1PAQA 3EJNA 4N2SA 3FTUA 2HO1A 1OSLA 3BG0B 1A17A 1POUA 2J07A 3B7RL 4HS2A 4UI9C 2X6IA 2WXKA 2R17C 3CVYA 1B89A 3C98A 3SCFA 2PM6A 5JJ7A 4N2QA 1BDIA 5J08A 2R59A 1BDHA 2XGOA 4N5CA 3G2SA 3CROL 4B8AA 3R9AB 1ZU2A 5G05J 1RPEL 2J09A 4G23A 4AM9A 3KEZA 3DPDA 1WH6A 4MKTA 4A1GA 1NA0A 4HOUA 5AIJA 3QB2A 3FU6A 5FQ7A 3URZA 4GZ5A 3QARA 2J9QA 4LEUA 3TG5A 3ZEFA 3AS4A 4CEMA 1E7UA 4AOFA 1WIZA 3UMVA 4HOQA 3SCGA 4DI4A 2VGYA 2XJ3A 2WVIA 3OQMA 4FN3A 2R5SA 3Q15A 4LUNU 4OB4A 4PS8A 1OWLA 3TL5A 3HIZA 3SCHA 3CECA 2PE5A 2E2EA 1QZ2A 4EECA 3PNLB 3O4ZA 4I43A 3FTXA 5BUZA 3FH7A 4V3IA 3K9IA 5ARGA 5BPPA 1WH8A 2CROA 1H6KA 3S7BA 4IN3B 1ZBPA 3LEWA 3JXBC 4L2LA 4QFVA 3UQ3A 1NERA 4TUUA 4GHJA 3VTXA 4W9RA 4GQMA 1KLXA 3EHNA 5BNWA 3CIAA 2MQKA 3LJ3A 3CHOA 5CMYA 3TJPA 3B7UX 2XPZA 2Y3AA 2IVGA 1QQBA 1RZRD 4FLHA 1IQUA 4A3VA 3PVLA 4HORA 2LYPA 4UWGA 3TRBA 4FU3A 5AENA 2XCCA 2LAHA 4YARA 3ZYKA 2WXHA 4LERA 1DNPA 5ENNA 1ELRA 3DBSA 5EX3A 4B0ZA 1NEQA 1RIOA 1PERL 2KCKA 2R1JL 2CG2A 3ASHA 3FU3A 3QK0A 4H7XA 3MKQB 2CHZA 3B7HA 2IONA 3QOUA 4U63A 4PU7A 3JXCL 1H2VC 5G04J 3UPVA 4GAAA 4NQ0A 4JEUA 1W3BA 2MHKA 2GW1A 2J49A 3APFA 2ZU6B 2VGXB 3CVPA 3MV3B 2VSYA 4I2ZA 2VTBB 2X6KA 3ZYLA 4XKBA 4APFA 3HVEA 2OFYA 2OVBA 5T3RA 2WXMA 3RO3A 2YNQA 4KZ0A 4UI9K 1Z3YA 4JA7A 3RKVA 3ZRHA 2WXNA 4JXTA 4KZCA 2D5VA 5JHAA 2PUGA 3E4BA 4Q96A 4X4BA 4A1SA 2FEZA 4G24A 4ABNA 4EBAA 1TJFA 3FYAA 3MEKA 4RSYA 2A5UA 2BJCA 3QWWA 5CCLA 1YSEA 1GT0C 2XHEA 3FUDA 4JCYA 3U64A 4J6IA 4XZ4A 1WETA 1WY6A 4C0MA 4PDXA 4GA2A 2KEJA 2HM8A 4DI3A 2WXIA 5BV0A 2JCGA 2PUDA 1XGWA 5D0QD 1UXDA 3LISA 1HF8A 1CJGA 5LCWC 3KD7A 1U3DA 5CHEE 1UN9A 4N39A 5CMWA 4Z59A 5E75A 2VTBA 3IV0A 2CFUA 3PUJA 1JPLA 3LPZA 4FP7A 4X4FA 4Z5HA 2ONDA 3CVUA 4FBIA 5E76A 4YNDA 1HXIA 3UT8A 2J08A 2PUFA 3D3MA 2KEIA 1MHQA 2HSGA 4IVZA 3B7TA 3AS5A 1UW4B 3LFPA 4YBAA 1LF8A 1QNFA 2WXRA 2IJGX 3CEQA 4I1AA 1R69A 3KXAA 2OR1L 2C0LA 3D9MA 1H2TC 3BEEA 3BD1A 4X4IA 3GZ2A 5AYWD 2XGSA 2WXGA 3SBSA 1MQSA 2LO6A 3R7RA 3CHMA 4DK5A 4HLEA 5LCWJ 3CVWA 4M3OA 2KCVA 3UUXA 3ENEA 3HZIB 3Q4AB 4L1BA 4BY6A 3RRUA 3QWVA 4WUYA 3SZ7A 3G2VA 3PE4A 2IVQA 4F7AA 4R7LA 2VSOE 2FJRA 4JHJA 2GRMA 3LY8A 2PUEA 2XPYA 2O38A 3LY9A 1FVFA 2HYZA 4FC8A 4KXKB 3QYXA 3CVQA 3D9NA 3TAXA 4GA0A 4UQYA 3FU0A 4DJAA 3ML9A 4I9EA 1JFSA 4Y42A 2IF4A 3GZSA 5FQ8A 5ARFA 3VLEA 3G7DA 4NURA 3S7FA 3ZIMA 2KCLA 2LYSA 3CKBA 3ZN3A 1E8WA 4B89A 3SFZA 5KJNA 3D9LA 4F3VA 4B94A 1HZ4A 2VYIA 2M63A 3FMYA 3CHPA 3ESKA 3QWPA 4KYOB 2FO7A 4P29A 4EZKA 2PQNA 2R63A 4JPSA 3ULQA 3OXLA 5C2YA 4BT9A 2KATA 3LVQE 3EIQC 2H8RA 3FUNA 3MV2B 4GA1A 4I1OB 4J0UA 1BPOA 4WNFA 4CT4A 4C0EA 1OWPA 1HF0A 3P1UA 3QQ6A 2O4AA 1XNFA 4JW1A 4YVQC 3MZLB 1X2LA 2LYKA 2IQCA 2OV8A 4CGWA 3IKOB 2XGMA 4N3CA 2CHWA 3Q49B 1OUVA 2FI7A 3CK8A 2HR2A 2O49A 4YG1A 3FUFA 2VGXA 3LS8A 4PUCA 4I8TA 1FCHA 3GW4A 3U4TA 2QY7A 5JHBA 3RJVA 1VDYA 2WXFA 5T4YA 3ZFWA 2XRZA 4LRZA 5A7LA 5EDSA 1ZZ9A 2NC9A 1HE8A 2V5FA 3FTSA 1ZPQA 3Q47B 3MLFA 4CGVA 1E8YA 3QC1A 4E85A 2KEKA 1H2UA 1R63A 2JLBA 3IHYA 2E0IA 5G55A 3FTWA 3FUIA 3PDNA 3D9KA 1E3OC 1Y7YA 4RG9A 4GYYA 5G2NA 5KCMA 2CG3A 4J8DA 4KVOA 3L17A 5JJTA 4KT6B 3OQNA 3FTVA 4Z5DA 2JVLA 2Y4TA 3HDXA 3Q5MA 3TG4A 1INZA 2BNNA 1WM5A 5C1DA 4NDWA 1N54A 2NSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZKC A;  2BJC A;  2XIU A;  3D1N I;  1YSE A;  2AXU A;  3QWG A;  1GT0 C;  1OCT C;  4JCY A;  4JQD A;  2WIU B;  2ICT A;  1WET A;  3R1F A;  2KEJ A;  1JH9 A;  3F51 A;  2JCG A;  1QPZ A;  1PRV A;  2PUD A;  1UXD A;  3GN5 B;  3LIS A;  1LMB 3;  1CJG A;  3F52 A;  2PIJ A;  2KZ8 A;  2CSF A;  2XCJ A;  4Z59 A;  3PXP A;  1ZS4 A;  1AU7 A;  3ZHM A;  1ZZB A;  4X4F A;  2IU7 A;  3BS3 A;  4Z5H A;  1QP7 A;  2PUA A;  1ADR A;  4FBI A;  2GZU A;  2LYJ A;  3ZHI A;  2PUF A;  2MEZ A;  2LYL A;  2KEI A;  1JWL A;  3GN5 A;  2HSG A;  2PPX A;  1SQ8 A;  4IVZ A;  4Z5C A;  1VPW A;  2WUS R;  3LFP A;  4YBA A;  4Z58 A;  3U3W A;  1R69 A;  3EUS A;  3KXA A;  4X4G A;  4I6R A;  3BDN A;  4I6U A;  1L1M A;  3BD1 A;  4X4I A;  4X4D A;  1RZR A;  1OSL A;  2EBY A;  1POU A;  2OR1 L;  2XI8 A;  3FYM A;  2AUW A;  3L1P A;  1DW9 A;  3SCF A;  3HZI B;  1ZZC A;  4MCX A;  1BDI A;  1LCD A;  1XWR A;  1CQT A;  1BDH A;  2IVQ A;  2IVB A;  3F6W A;  2IUO A;  2FJR A;  2L49 A;  2A6C A;  2GRM A;  2GRL A;  1X57 A;  1RPE L;  3CRO L;  1WH6 A;  2PUE A;  1ZAY A;  2O38 A;  1DWK A;  2LYR A;  3JXD L;  3DNV B;  3QYX A;  4X4C A;  3KZ3 A;  2AXZ A;  1UTX A;  1WIZ A;  1QQA A;  1JFS A;  3SCG A;  1O4X A;  3O9X A;  4Y42 A;  2XJ3 A;  1LCC A;  3OQM A;  2EF8 A;  3G7D A;  4FN3 A;  4OB4 A;  2LYS A;  3H5T A;  3OP9 A;  4PU4 C;  3SCH A;  3CEC A;  2PE5 A;  4X4E A;  3FMY A;  1PNR A;  4JCX A;  2R63 A;  1WH8 A;  2CRO A;  2XSD C;  4MCT A;  3KJX A;  1S7E A;  1ZZ7 A;  1LQC A;  4J1X A;  3JXB C;  1NER A;  4GHJ A;  2H8R A;  5K98 B;  4GQM A;  1B0N A;  2HIN A;  2BNO A;  2MQK A;  1HF0 A;  3QQ6 A;  2O4A A;  3CLC A;  1ZZ6 A;  2IVG A;  2LCV A;  4IA8 A;  1X2L A;  2LYK A;  4O8B A;  3GBF A;  3S8Q A;  1Y9Q A;  1RZR D;  1QQB A;  2B5A A;  2LYP A;  1ZZ8 A;  3TRB A;  2ICP A;  3OMT A;  4YAR A;  1QP4 A;  4YG1 A;  2O49 A;  4I8T A;  2AWI A;  4YG4 A;  1NEQ A;  3G5G A;  1RIO A;  1JFT A;  2L8N A;  2R1J L;  1PER L;  4X4H A;  3QF3 A;  4PU3 C;  1EFA A;  3B7H A;  4PU7 A;  5A7L A;  3JXC L;  1LLI A;  1ZZ9 A;  4F8D A;  1UXC A;  1ZPQ A;  2KPJ A;  3MLF A;  3UFD A;  1PRU A;  4YG7 B;  2AXV A;  2PUC A;  2KEK A;  4PU8 A;  1R63 A;  2PUB A;  2IV1 A;  1IC8 A;  1RZS A;  2AW6 A;  1E3O C;  4IWR A;  2EWT A;  3IVP A;  1ZVV A;  3OQO A;  1Y7Y A;  2OFY A;  3VK0 A;  3OQN A;  1ZUG A;  4Z5D A;  2JVL A;  1QP0 A;  2BNM A;  2D5V A;  3RZZ A;  2PUG A;  2BNN A;  4I6T A;  4NDW A;  1PRA A;  4X4B A;  3FYA A;  4J1W A;  2LYQ A; 
#chains in the Genus database with same CATH topology
 3ZKC A;  4GZC A;  2QFC A;  1OCT C;  5CBO A;  5A6C A;  1YYH A;  4YDW A;  2ICT A;  4J8F A;  3CR3 A;  4Y6W A;  4HXI A;  2IFU A;  1TNB A;  3ZW3 A;  1RW2 A;  2V4L A;  4AVX A;  3ASD A;  3C72 A;  2ZGD A;  3GZD C;  1BD8 A;  4G1T A;  3ZPJ A;  3SI5 A;  5CEA A;  1HG2 A;  2WUS R;  4Z58 A;  3U3W A;  3FUJ A;  4I6J A;  1N95 A;  1RZR A;  1PC2 A;  3PS6 A;  2LNI A;  3F6Q A;  5KJM A;  4EZJ A;  3FWV A;  5EIL A;  1YMP A;  3BU8 A;  4UI9 J;  1LCD A;  4B8C B;  2GRL A;  2ILR A;  3L54 A;  2PXV A;  1K8K G;  5DBK A;  4AEZ C;  4I2W A;  2IOL A;  3MCX A;  2LYR A;  3MGB A;  4ILI A;  3LCA A;  3DWL G;  5D0O D;  3SR4 A;  1YCS B;  3MX3 A;  4Q94 A;  3H5T A;  4PU4 C;  4A55 A;  4WWP A;  2EIM E;  4N3B A;  1PNR A;  4JCX A;  2LLW A;  4IUL A;  4ACL A;  4DX2 A;  1N0R A;  2PZI A;  1OWO A;  1ZZ7 A;  3NOC D;  4CDN A;  4XX5 A;  4AXH A;  3BG1 B;  2Y4U A;  3V31 A;  3JUI A;  5CED B;  1Y9Q A;  3CK9 A;  2XXQ A;  1AP7 A;  3RO2 A;  2WQ7 A;  1N0Q A;  4FLB A;  3MJW A;  5JUW A;  2AWI A;  2HE0 A;  5EYP F;  4X4H A;  4PU3 C;  1X5B A;  3S7D A;  4U8V D;  3ONK A;  4PU8 A;  1Z6T A;  3ESL A;  2ETC A;  4GB9 A;  3SBT B;  1JWG A;  1E8Z A;  5JA4 D;  1QP0 A;  2QYU A;  3JQ0 A;  3LYA A;  5G05 C;  2BNM A;  2DVW A;  1BU9 A;  3DSW A;  1EPU A;  4ILG A;  1E8X A;  3E32 A;  3UM1 A;  2LYQ A;  4JB8 P;  3FHE A;  2UY1 A;  3T5X A;  5KJL A;  4JL0 A;  1DCQ A;  2VQ2 A;  2J7W A;  4U8H A;  3CKC A;  5LP0 A;  2IU7 A;  3M9L A;  2YIN A;  2KXP C;  2R02 A;  2Y1L E;  5EX0 A;  1U3C A;  2C2L A;  2WB2 A;  3ONL A;  1N11 A;  5CEC B;  4AIF A;  1UJK A;  4PH4 B;  1XWR A;  2IUO A;  4UQX A;  1TYQ G;  2WXJ A;  2EQX A;  3PZ4 A;  4U0Z A;  2MOW A;  5GAG i;  1QQA A;  1HO8 A;  3OP9 A;  1WDY A;  4X8Q A;  1IKN D;  2FUL A;  2XSD C;  4ANV A;  2M4H A;  3LXU X;  4FHJ A;  3FU5 A;  3ZXS A;  3RIB A;  4PS3 A;  2YQ8 A;  3S8Q A;  3DPY A;  4F1S A;  3DRA A;  2WXO A;  3GZ1 A;  2UY1 B;  2KZT A;  3TXN A;  4YG4 A;  1D8E A;  4RLY A;  4EZI A;  5KJK A;  1UXC A;  4EHM A;  4GMJ A;  3APC A;  4CCA A;  2DCP A;  1UG3 A;  3D9O A;  2L0I A;  1G3N B;  4U95 D;  1HFA A;  5DRT A;  3LKU A;  2VGE A;  3NZU A;  4TV3 A;  1OXJ A;  4TRQ A;  4IYP A;  2CFZ A;  4EPZ A;  2XQ0 A;  3TEL A;  3SHF A;  2LSU A;  3HVE B;  1BI7 B;  2J4B A;  3FTZ A;  1QPZ A;  1TR4 A;  1QQE A;  4EK9 A;  2X6F A;  4DE9 A;  5HRY A;  4ER0 A;  1TN8 A;  1HH8 A;  3UM2 A;  2ZXW E;  1JCR A;  3UT4 A;  4HOT A;  3ASN E;  3CHQ A;  1HU3 A;  4Q69 A;  1JWL A;  4BX9 A;  3ASG A;  3EUS A;  5FZS A;  3BG0 B;  4UI9 C;  4HQD A;  3KEA A;  3SCF A;  2PM6 A;  5JJ7 A;  3NBN B;  5J08 A;  2QYJ A;  4B8A A;  4G23 A;  4A1G A;  1WH6 A;  2PXB A;  4GZ5 A;  3UI2 A;  2VGY A;  3Q15 A;  1QZ2 A;  3FTX A;  4V3I A;  2CRO A;  1H6K A;  3S7B A;  3B7B A;  4EBA G;  3JXB C;  4QFV A;  4TUU A;  4W9R A;  4GQM A;  2RKK A;  1Q2Z A;  4YDY A;  3LJ3 A;  3CHO A;  1D8D A;  5CMY A;  3ME5 A;  3B7U X;  2XZD G;  2IVG A;  3DST A;  1QQB A;  4FLH A;  1OCZ E;  3PVL A;  4YAR A;  3ZYK A;  1DNP A;  4BY6 A;  3GZD A;  2R1J L;  1SVX A;  3UPV A;  4GAA A;  2H6I A;  2HFZ A;  2VSY A;  4XKB A;  4APF A;  3HVE A;  3RO3 A;  2WXM A;  2YNQ A;  1TN7 A;  2P9N G;  4KZC A;  5JHA A;  4X4B A;  4RSY A;  2XHE A;  5KNG A;  3U64 A;  3UIO C;  4PDX A;  3BUA A;  4GA2 A;  2HM8 A;  1N4P A;  1HF8 A;  4Z59 A;  5AAR A;  1JPL A;  3LPZ A;  4XEI G;  2J08 A;  1MHQ A;  2HSG A;  4IVZ A;  3AS5 A;  1UW4 B;  4I1A A;  2IJG X;  3KXA A;  2C0L A;  3BD1 A;  4X4I A;  5AYW D;  3CVW A;  3CHM A;  3Q4A B;  3G2V A;  2IVQ A;  2FJR A;  3EUV A;  2GRM A;  3LY8 A;  3Q7F A;  3DM5 A;  4KXK B;  3CVQ A;  4UQY A;  3ML9 A;  3UXG A;  4HBD A;  5ARF A;  3G7D A;  4NUR A;  3S7F A;  3SFZ A;  4B94 A;  2VYI A;  4P29 A;  2FO7 A;  3LVQ E;  3EIQ C;  3MV2 B;  2EIJ E;  4WNF A;  1HF0 A;  2O4A A;  2IQC A;  2OV8 A;  5BXO A;  3Q49 B;  2MXD A;  4K5C A;  2HR2 A;  3SY2 A;  2O49 A;  3FUF A;  3UIP C;  4PUC A;  2QY7 A;  4DE8 A;  3ABM E;  2XRZ A;  3C5R A;  1H6P A;  2V5F A;  2AJA A;  2KEK A;  3IHY A;  2P9K G;  3PDN A;  3D9K A;  3RAU A;  4RG9 A;  4GYY A;  4LNU D;  4KT6 B;  3TWX A;  1HS6 A;  4G25 A;  1OWN A;  3KSL A;  3QAQ A;  3QNK A;  3A9Z A;  2DIW A;  2BKG A;  3TEP A;  4TUM A;  3X2Q E;  5BW8 C;  3PRZ A;  2DBA A;  4URK A;  4FHK A;  3QOX A;  4I9C A;  3Q79 A;  3L16 A;  3OKZ A;  4I6R A;  3SQV A;  2EBY A;  4G26 A;  3J5P A;  5B1B E;  4ANU A;  4O1P A;  2JAB A;  3DEP A;  4DPR A;  3TXM A;  5D66 A;  1ELK A;  2A6C A;  5CBN A;  1SZA A;  5BT1 A;  2BTD A;  3V79 K;  3JXD L;  2IO3 C;  2GGF A;  4I1M A;  5CER B;  3UT7 A;  2OCC E;  4XE0 A;  4XI9 A;  3LQX A;  3SD5 A;  4WNE A;  4N3A A;  5EYL A;  3QKY A;  3EHM A;  3OWQ A;  2PXE A;  4O8B A;  3GBF A;  1OT8 A;  5D2M C;  5BV1 A;  3UWP A;  4JHK A;  5ENR D;  5AJD A;  1Y8M A;  3PNT B;  2P58 C;  3G5G A;  3QF3 A;  1Z5S C;  2RD0 A;  4YG7 B;  1SA5 A;  2EWT A;  4IRU A;  1SQM A;  1NP7 A;  2OVF A;  5M72 A;  4I6T A;  4GZ6 A;  3ZUV B;  4APO A;  3LVR E;  2YHC A;  4EQZ A;  1NZN A;  4JQD A;  5HKP A;  2WIU B;  3CHS A;  3T5V A;  1N4S A;  2V4H C;  3ASF A;  4ATG A;  2CSF A;  5FT9 A;  3EU5 A;  5FIO A;  3PRE A;  2YHE A;  1ZZB A;  4YVO A;  3ZHI A;  3CVV A;  4EKI A;  1WAO 1;  3CVX A;  3OXF A;  2KM4 A;  4GTQ A;  3TWU A;  4UWL A;  4FJY A;  4GCO A;  4BT8 A;  3EU9 A;  2XI8 A;  3CGH A;  3FYM A;  3L1P A;  2X6J A;  4AJW A;  1MZC A;  1ZZC A;  3EIJ A;  5EKQ D;  4O6F A;  2X38 A;  3PH0 C;  3F6W A;  4YDO A;  3RK6 A;  2LUH A;  4M7C A;  4L7T A;  3DNV B;  2KC7 A;  4JC8 A;  4JEH A;  3PE3 A;  4XKC A;  1JCS A;  4ER5 A;  3O9X A;  2V8S E;  1LCC A;  4WVL A;  4HOS A;  1H0A A;  4X4E A;  4LSZ E;  4MCT A;  3RRN B;  3IEG A;  3U9W A;  2NYJ A;  4L23 A;  3SNX A;  3FDH A;  1KZP A;  1H19 A;  2PXF A;  5H7P A;  2V0P A;  3AU5 A;  5ANL A;  1JFT A;  2L8N A;  2PXT A;  4GPM A;  4HLL A;  5AQ7 A;  5DIZ A;  3UM0 A;  5EIB E;  3HXF A;  5EN5 D;  1JWF A;  5ENP D;  4MRU A;  3UFD A;  3AS8 A;  4A63 B;  2AXV A;  3KAE A;  3S7J A;  3HHM A;  4IWR A;  4E6H A;  4UWF A;  4EZL A;  2WQ6 A;  4FAD A;  2I6H A;  3C3Q A;  1ZUG A;  4WWO A;  2F37 A;  3FUM A;  1PRA A;  1ZB1 A;  3R09 A;  2GRQ B;  2WM9 A;  4JHR A;  5FQ6 A;  3FUK A;  3PZ2 A;  1JH9 A;  3FUE A;  1QYM A;  4OVV A;  2WPV A;  3E37 A;  3E34 A;  3ZHM A;  4K0R A;  1NA3 A;  1K3Z D;  1N94 A;  4CZ2 D;  4F1P A;  3ULY A;  1SQ8 A;  2PL2 A;  5ENQ D;  1PAQ A;  3EJN A;  4N2S A;  1OSL A;  1MX2 A;  1A17 A;  2J07 A;  4HS2 A;  3TWV A;  2P9U G;  2WXK A;  3CVY A;  4N2Q A;  1BDH A;  2XGO A;  4N5C A;  3G2S A;  3CRO L;  1BLX B;  3L82 A;  1ZU2 A;  4AM9 A;  2J09 A;  3DPD A;  4MKT A;  4DX7 D;  4B93 B;  3AS4 A;  4CEM A;  3D9H A;  2A5E A;  1S64 A;  2WVI A;  3OQM A;  2VEO A;  1OWL A;  3HIZ A;  3O4Z A;  3SFY A;  4I43 A;  3FH7 A;  3K9I A;  1WH8 A;  5GAH i;  3LEW A;  3VTX A;  1KLX A;  3EHN A;  1V54 E;  4A3V A;  2LYP A;  3TRB A;  3NXH A;  2XCC A;  2WXH A;  4QQI A;  3HXC A;  3DBS A;  1NEQ A;  3FU3 A;  2CG2 A;  3QK0 A;  4H7X A;  3MKQ B;  2CHZ A;  3B7H A;  2ION A;  4PU7 A;  3JXC L;  1H2V C;  4JEU A;  2XS8 A;  1W3B A;  4DX6 D;  2ETA A;  2VGX B;  3MV3 B;  2R2L A;  3NB2 A;  4KZ0 A;  1Z3Y A;  4JA7 A;  4JXT A;  3E4B A;  4Q96 A;  2BJC A;  5CCL A;  1YSE A;  2P9P G;  4JCY A;  2XEH A;  2ETB A;  4C0M A;  2ZIS A;  2JCG A;  2PUD A;  2B0O E;  2XEN A;  2BED A;  3KD7 A;  5CHE E;  4Z68 A;  1UN9 A;  4N39 A;  1D9S A;  2PXQ A;  4X4F A;  3T9K A;  4YND A;  3UT8 A;  3D3M A;  2KEI A;  3B7T A;  4YBA A;  1QNF A;  3UMV A;  1R69 A;  2PNN A;  1H2T C;  4OAU C;  2RFM A;  2XGS A;  1MQS A;  4DK5 A;  4M3O A;  3UUX A;  3ENE A;  3HZI B;  4L1B A;  4F7A A;  1IHB A;  3NRO A;  2O38 A;  1FVF A;  2HYZ A;  4FC8 A;  4GA0 A;  4DJA A;  3FU0 A;  2ZGG A;  3KSQ A;  2IF4 A;  3GZS A;  3VLE A;  3ZIM A;  3NZL A;  1QBQ A;  3RSE G;  3CHP A;  2M63 A;  3JXI A;  3QWP A;  4GTR A;  2PQN A;  2R63 A;  3OXL A;  5C2Y A;  4GA1 A;  3ZNG A;  4JW1 A;  4CGW A;  3IKO B;  2FI7 A;  4EKG A;  5DTQ A;  3U4T A;  1KZO A;  4I8T A;  3RJV A;  2XXA A;  2WXF A;  5T4Y A;  4LRZ A;  3DXK G;  4O60 A;  5A7L A;  5EDS A;  2NC9 A;  3NAW A;  3FTS A;  3J5Q B;  4K5B A;  4U96 D;  2E0I A;  3FUI A;  3Q73 A;  1TNZ A;  4L9P A;  3UIN C;  5KCM A;  4KVO A;  3GUU A;  4DX1 A;  1N4Q A;  2JVL A;  2Y4T A;  3AG4 E;  1V55 E;  1INZ A;  1MX6 A;  4ZHB A;  2NSZ A;  4FUL A;  2LXL A;  4GTT A;  3W9F A;  4Y6C A;  2EIK E;  3CQC B;  4J7W A;  4WND A;  3I5P A;  2BUG A;  3L22 A;  4KBQ A;  5LFA A;  3F52 A;  3O48 A;  5FWQ A;  3CVL A;  5BXU A;  4BFR A;  3FEX A;  5HI7 A;  5HQ8 A;  2A4Z A;  3GN5 A;  1E96 B;  5LX8 A;  3BDN A;  3OXG A;  3V2O A;  2AUW A;  4C9B B;  1DW9 A;  3MYV A;  2FFH A;  1DC2 A;  4MS6 A;  3ZVV A;  3MKQ A;  1U2Z A;  2L49 A;  1LD8 A;  3FY4 A;  4GYW A;  3ML8 A;  3SGH A;  1U2V G;  4X4C A;  3UX4 A;  3KZ3 A;  2AXZ A;  4GTS A;  3ZHE A;  1O4X A;  3CVN A;  2FO1 E;  3CHR A;  1BI8 B;  5HS0 A;  2JQE A;  2WXL A;  1S7E A;  3U66 A;  4J1X A;  2I1J A;  4O1O A;  2L9B A;  2C0M A;  1EYH A;  3FUL A;  2B5A A;  2BKK B;  4HFG A;  4BER A;  2JEK A;  2MRI A;  4DUI A;  2YBD A;  5CRU A;  3WXX A;  5A23 A;  3APD A;  5ENS D;  2PUB A;  2IV1 A;  3LDZ A;  1IC8 A;  3IVP A;  4ILH B;  2GRP B;  3VK0 A;  4AP2 A;  3FUH A;  3D9J A;  3FP3 A;  4HRM B;  1IYG A;  1NI1 A;  3IBE A;  3KS2 A;  4ER7 A;  2IEJ A;  3FFL A;  2XIU A;  3D1N I;  3L6A A;  2ZIR A;  4WAF A;  1QZX A;  5LOZ A;  5T8I A;  3DEO A;  1FVH A;  1PRV A;  3B13 A;  4K03 A;  4ATZ D;  4XIF A;  2XCJ A;  1ZS4 A;  4GZD A;  3EHQ A;  4HB5 A;  4BEP A;  3QDN A;  2IO2 C;  4PS7 A;  3HXE A;  1A5E A;  3N71 A;  2BF0 X;  1GW6 A;  1E7V A;  3Q78 A;  4X4D A;  2QZA A;  5FZR A;  4ZFH A;  3R7Q A;  2WXQ A;  2V5Q C;  2DZN A;  1DWK A;  3L13 A;  2KZT B;  4BTA A;  4WWN A;  3AG2 E;  3IHV A;  4BX8 A;  4CDR A;  5JJ6 A;  3UKR G;  4BSZ B;  4LG6 A;  4YDE A;  4GML A;  3KJX A;  5FJY A;  1LQC A;  3JQ1 A;  2XXP A;  1P5Q A;  4I6E A;  1AWC B;  2L0T B;  3CLC A;  1KT0 A;  1OWM A;  4JZY A;  1KT1 A;  4CT0 A;  1K1A A;  2DWZ A;  4A3T A;  1NFI E;  1EDU A;  2ICP A;  3OMT A;  4F6R D;  1QP4 A;  2XEV A;  1OY3 D;  3A9X A;  3KL4 A;  2EIL E;  2AVP A;  2J7U A;  3FEY A;  3TGO A;  4BWR A;  4F8D A;  4U04 A;  2KPJ A;  1YA0 A;  3PE5 A;  5DTR A;  3NF1 A;  3MEJ A;  2L6B A;  1RZS A;  2GRR B;  1TEZ A;  4NRH B;  2HCS A;  3L9T A;  2J4D A;  2L6J A;  4J8S A;  4UWK A;  4JA9 A;  4RQI A;  3R9M A;  4H7Y A;  3UKU G;  3EDT B;  4RG6 A;  3AG3 E;  1EF1 C;  3PUK A;  4U07 A;  1DVP A;  2OOE A;  4I6G A;  3PXP A;  4GU5 A;  3ASO E;  1AU7 A;  3NZS A;  1SZ9 A;  2Q7F A;  1ADR A;  3T8M A;  3MKR A;  2PUA A;  4GZ3 A;  2VSX E;  2GZU A;  3ZU7 B;  4Z5C A;  3DSX A;  1MX4 A;  1B89 A;  5DT2 A;  3SO8 A;  3R9A B;  5G05 J;  2GRN B;  1NA0 A;  4HOU A;  5AIJ A;  1IXV A;  3QB2 A;  3URZ A;  3QAR A;  3TG5 A;  4LEU A;  3ZEF A;  5JMN D;  1E7U A;  1WIZ A;  2XJ3 A;  4FN3 A;  2R5S A;  4U7E B;  3CEC A;  2PE5 A;  4EEC A;  5BUZ A;  5ARG A;  1ZBP A;  1DCE A;  5BNW A;  5IY5 E;  3TJP A;  2Y3A A;  3HXB A;  1RZR D;  4HOR A;  4FU3 A;  2LAH A;  5ENN A;  1ELR A;  5EX3 A;  4B0Z A;  2KCK A;  4U63 A;  4NQ0 A;  2MHK A;  3DSV A;  2VTB B;  2X6K A;  2OVB A;  5T3R A;  3ZRH A;  3E33 A;  2PXU A;  4MBG A;  4TXQ A;  4ABN A;  4EBA A;  3FYA A;  3MEK A;  2A5U A;  3HXD A;  1FPP A;  3QWW A;  1GT0 C;  1TNO A;  1O1T A;  4GTO A;  1O5M A;  2KEJ A;  2PXP A;  2WXI A;  5BV0 A;  1XGW A;  5D0Q D;  1CJG A;  3V2X A;  2PXK A;  5E75 A;  5CMW A;  2VTB A;  2CFU A;  2EIN E;  4Z5H A;  3CVU A;  4FBI A;  1HXI A;  1OCR E;  4LNB A;  3CEQ A;  3UQ3 A;  3D9M A;  5AN8 A;  3Q9U C;  2WXG A;  5ENT D;  2KCV A;  4WUY A;  3PE4 A;  4R7L A;  2VSO E;  2XPY A;  3LY9 A;  3QYX A;  2DZO A;  4I9E A;  5FQ8 A;  3CKB A;  3ZN3 A;  3PZ1 A;  5KJN A;  4NIK A;  4F3V A;  4KYO B;  1HZ4 A;  3FMY A;  3ESK A;  3TWS A;  3VWS A;  3FUN A;  4J0U A;  4I1O B;  1BPO A;  4C0E A;  1OWP A;  3QQ6 A;  1XNF A;  2Y0B G;  4YVQ C;  3MZL B;  3PZ3 A;  3Q75 A;  1O1R A;  4N3C A;  2XGM A;  3CK8 A;  2VGX A;  5DRY A;  3GW4 A;  5JHB A;  1VDY A;  3C3O A;  5ENO D;  1ZZ9 A;  2LLV A;  3UTM A;  1HE8 A;  1ZPQ A;  3MLF A;  4CGV A;  4E85 A;  1R63 A;  1KPS B;  2JLB A;  3FTW A;  4ER3 A;  5KNH D;  2CG3 A;  3ABL E;  5JJT A;  1OCO E;  3OQN A;  3FTV A;  3Q5M A;  3TG4 A;  3HDX A;  1SW6 A;  2BNN A;  5C1D A;  4NDW A;  1N54 A;  3QFI A;  3Q7A A;  2X6H A;  2AXU A;  1N52 A;  3PEV B;  4Q2J A;  3F51 A;  2F0Y A;  2I1K A;  4G2V A;  4I17 A;  4XI0 A;  1LMB 3;  1Y6I A;  4TXP A;  1DUL A;  1UOH A;  1QP7 A;  3GYZ A;  1HQ1 A;  3NDB B;  5FTP A;  2LYJ A;  1MFQ C;  3MA5 A;  2PQR A;  4ACK A;  4LCT A;  1LD7 A;  3D9P A;  3SX0 A;  4X4G A;  4G8K A;  3JUE A;  4HRN A;  3OAW A;  2FF4 A;  5FZQ A;  4BSX A;  4LNG A;  2IOS A;  4BTB A;  4MCX A;  1CQT A;  3VLD A;  4ME2 A;  1L5J A;  3B7S A;  1QB2 A;  2WMN A;  2R03 A;  3HYM B;  3QJZ A;  2PM7 A;  1UTX A;  2V3C C;  2MYO A;  4G8L A;  2P9L G;  4WNG A;  3ZGQ A;  2RFA A;  1TN6 A;  2IU1 A;  1WG0 A;  1TNU A;  4AY6 A;  3G2W A;  4HNA D;  5K98 B;  3G0T A;  2BNO A;  4CYM D;  3VLF A;  1N9A A;  4GTV A;  5ITZ F;  2LCV A;  3JCK C;  3RRM B;  3D9I A;  4HRA A;  3T8K A;  4OYS A;  1MJ0 A;  1ZZ8 A;  3S2A A;  4CDM A;  4D10 C;  3IXE A;  3I4G A;  4ANW A;  2WXP A;  3PZD A;  3ZYM A;  1MYO A;  2P2C P;  2P9I G;  5FQ4 A;  3ULE G;  1HX8 A;  1NL4 A;  3CSF A;  3CST A;  3PEU B;  1PRU A;  3UM3 A;  3GZC A;  2PUC A;  3SF4 A;  1IHG A;  1UJJ A;  3V30 A;  5CCM A;  1ZVV A;  2LXM A;  2NXP A;  3FTY A;  4K5A B;  3RZZ A;  2I9C A;  4RVB A;  1FT1 A;  3G2T A;  4C48 B;  4J1W A;  1PY1 A;  1Z3X A;  3QWG A;  4KVM A;  3TWW A;  1FT2 A;  3R1F A;  4OAV B;  3QOW A;  4NAC A;  3P2B A;  4FA6 A;  3GN5 B;  3JYS A;  4ANX A;  2PIJ A;  3CLJ A;  4OVU A;  1S63 A;  4J8E A;  4MLP A;  3BS3 A;  2OEW A;  3JXJ A;  5DTM A;  2F8X K;  2MEZ A;  2LYL A;  4U0U A;  2PPX A;  5ANR A;  1JUQ A;  2I2O A;  4I6U A;  1L1M A;  4OBM A;  2OEV A;  1TNY A;  1X81 A;  2VSN A;  3Q9N C;  3TWQ A;  4DLO A;  3RU0 A;  3I3N A;  3FH8 A;  3CV0 A;  3TWR A;  1IQR A;  4FJZ A;  3BQO A;  2IVB A;  1X57 A;  1UN8 A;  1ZAY A;  4DRX E;  4GPK A;  3NOG D;  4F53 A;  4TXR A;  2WMO A;  2X3M A;  2EF8 A;  5AJL A;  4U0S A;  2DYR E;  3AAA C;  5KWD A;  1HG5 A;  3ISM C;  3DXM G;  4CRW A;  1N4R A;  1TJC A;  3AU4 A;  4L2Y A;  2P9S G;  2J8S D;  4HVB A;  1B0N A;  2HIN A;  4AY5 A;  5AQB A;  3LY7 A;  1ZZ6 A;  3AJI A;  4JVS A;  4IA8 A;  3DSU A;  1OCC E;  3VTY A;  3ZYQ A;  5DSX A;  1E90 A;  4G11 A;  2UWJ G;  2QC9 A;  3TFL A;  5G04 C;  3ZHE B;  2XPI A;  5J90 A;  4EQF A;  3CK7 A;  3L08 A;  4GCN A;  1EFA A;  4UQZ A;  1LLI A;  3OTN A;  2VJ8 A;  3ZXP A;  4GYO A;  2LAI A;  2H6H A;  2H6F A;  2R05 A;  2F8Y A;  2AW6 A;  3WG7 E;  4GTP A;  4UWH A;  3OQO A;  4AV7 A;  2FBN A;  4KMO A;  2KBX A;  4HI9 A;  4DLQ A;  2LSV A;  2WQH A;  3B95 A;  3LJN A;  3NQP A;  2RG8 A;  2CHX A;  5KBA A;  2XCB A;  2HCN A;  3CQG B;  2XZT G;  3ABK E;  3A9Y A;  3FH5 A;  2KZ8 A;  5A7D B;  1ELW A;  1S0P A;  1SA4 A;  2XRY A;  3G2U A;  2PXD A;  3I4R B;  1VPW A;  3FTU A;  2HO1 A;  1POU A;  3B7R L;  2X6I A;  2R17 C;  3C98 A;  1BDI A;  2R59 A;  1JCQ A;  4BES A;  1RPE L;  3KEZ A;  2LNM A;  3C3R A;  5CRV A;  2XS1 A;  5FQ7 A;  2J9Q A;  3EHR A;  1NW3 A;  4AOF A;  4HOQ A;  4N5Q A;  3SCG A;  4DI4 A;  3DSS A;  4PS8 A;  1S70 B;  4LUN U;  4OB4 A;  3TL5 A;  3SCH A;  2E2E A;  3PNL B;  5BPP A;  3TWT A;  4JD2 G;  4IN3 B;  4L2L A;  1NER A;  4GHJ A;  5AAO A;  3CIA A;  2MQK A;  2XPZ A;  4GTM A;  1O1S A;  1IQU A;  4ER6 A;  4UWG A;  5AEN A;  4LER A;  2H6G A;  1RIO A;  1PER L;  3ASH A;  3QOU A;  5G04 J;  3HG0 D;  2GW1 A;  2J49 A;  3SFX A;  3APF A;  2ZU6 B;  2GRO B;  3CVP A;  2PXL A;  4I2Z A;  3W9G A;  3ZYL A;  5AQ9 A;  2OFY A;  4UI9 K;  3RKV A;  2ODR D;  2WXN A;  2D5V A;  2PUG A;  4A1S A;  2FEZ A;  4G24 A;  1TJF A;  3FUD A;  4J6I A;  4XZ4 A;  1WET A;  1WY6 A;  4DI3 A;  1UXD A;  3LIS A;  2Y69 E;  4GMR A;  3AG1 E;  5LCW C;  1U3D A;  5EID A;  3IV0 A;  3PUJ A;  4FP7 A;  2OND A;  5E76 A;  4DX5 D;  2PUF A;  3ZPX A;  4J8Y A;  3LFP A;  1LF8 A;  2WXR A;  2OR1 L;  3BEE A;  3GZ2 A;  4BET A;  3SBS A;  2LO6 A;  3R7R A;  4HLE A;  5LCW J;  2DYS E;  1LTX A;  1H6O A;  5FIN A;  2IY0 C;  3RRU A;  3QWV A;  3SZ7 A;  5AQA A;  4JHJ A;  2PUE A;  3TAX A;  3D9N A;  2L1P A;  1JFS A;  4Y42 A;  2KCL A;  2LYS A;  4B89 A;  5B3S E;  1E8W A;  3D9L A;  4HRL A;  4EZK A;  2B6C A;  4JPS A;  3ULQ A;  4BT9 A;  2KAT A;  2H8R A;  4CT4 A;  3P1U A;  4HI8 A;  1X2L A;  2LYK A;  2CHW A;  1OUV A;  4YG1 A;  3LS8 A;  1FCH A;  3ZFW A;  1RZ4 A;  4UUC A;  5B1A E;  3Q47 B;  1E8Y A;  4U8Y D;  3QC1 A;  1H2U A;  5G55 A;  3ZKJ A;  2XEE A;  1E3O C;  3E30 A;  1Y7Y A;  5G2N A;  4J8D A;  3L17 A;  4Z5D A;  1WM5 A;  1K1B A;  3FU6 A;  3HRA A; 
#chains in the Genus database with same CATH homology
 3ZKC A;  2X6H A;  4FUL A;  4GZC A;  2AXU A;  1OCT C;  2QFC A;  5A6C A;  1HS6 A;  4Y6C A;  2ICT A;  4J8F A;  1N52 A;  3CR3 A;  3CQC B;  3PEV B;  4Y6W A;  4G25 A;  4HXI A;  4WND A;  1OWN A;  2IFU A;  3QAQ A;  3F51 A;  2BUG A;  2I1K A;  3I5P A;  3L22 A;  3QNK A;  4G2V A;  4I17 A;  4KBQ A;  3ZW3 A;  5LFA A;  4XI0 A;  1LMB 3;  2DIW A;  3F52 A;  1Y6I A;  2V4L A;  4AVX A;  3O48 A;  5FWQ A;  3ASD A;  3CVL A;  5BW8 C;  3PRZ A;  1QP7 A;  2DBA A;  3GYZ A;  4URK A;  4G1T A;  4FHK A;  4BFR A;  3FEX A;  5HI7 A;  3ZPJ A;  5HQ8 A;  5FTP A;  3SI5 A;  2LYJ A;  3MA5 A;  2PQR A;  2A4Z A;  4I9C A;  4ACK A;  3GN5 A;  1E96 B;  1HG2 A;  4LCT A;  5LX8 A;  2WUS R;  4Z58 A;  3D9P A;  3U3W A;  3L16 A;  3BDN A;  3FUJ A;  4X4G A;  4I6J A;  4I6R A;  3OXG A;  1RZR A;  2EBY A;  4G26 A;  1PC2 A;  3OAW A;  2FF4 A;  3PS6 A;  2LNI A;  5FZQ A;  4ANU A;  2AUW A;  4BSX A;  4C9B B;  1TEZ A;  5KJM A;  1DW9 A;  3MYV A;  4EZJ A;  3FWV A;  2IOS A;  3TXM A;  4UI9 J;  4MCX A;  4BTB A;  4DPR A;  1LCD A;  1CQT A;  3VLD A;  4MS6 A;  3ZVV A;  4B8C B;  3MKQ A;  4ME2 A;  1L5J A;  2L49 A;  2A6C A;  2GRL A;  1ELK A;  2ILR A;  3B7S A;  3FY4 A;  1SZA A;  3L54 A;  5DBK A;  4GYW A;  4AEZ C;  5BT1 A;  4I2W A;  3ML8 A;  2IOL A;  3MCX A;  2BTD A;  2LYR A;  3JXD L;  3MGB A;  2WMN A;  4X4C A;  4ILI A;  3SGH A;  3UX4 A;  3KZ3 A;  3LCA A;  3HYM B;  2AXZ A;  3QJZ A;  2PM7 A;  1UTX A;  5D0O D;  3ZHE A;  1O4X A;  3CVN A;  3CHR A;  3MX3 A;  4Q94 A;  4WNG A;  3H5T A;  4PU4 C;  2GGF A;  3ZGQ A;  4A55 A;  2IU1 A;  4I1M A;  4WWP A;  3UT7 A;  4N3B A;  1PNR A;  4JCX A;  4IUL A;  4XE0 A;  4XI9 A;  4ACL A;  4EBA G;  2WXL A;  3SD5 A;  2PZI A;  4WNE A;  1OWO A;  4AY6 A;  1S7E A;  1ZZ7 A;  3U66 A;  4J1X A;  3G2W A;  2I1J A;  5K98 B;  4N3A A;  4XX5 A;  4CDN A;  4AXH A;  2BNO A;  2L9B A;  3BG1 B;  2C0M A;  2Y4U A;  3VLF A;  3QKY A;  3EHM A;  2LCV A;  3JUI A;  4O8B A;  3GBF A;  3D9I A;  1Y9Q A;  3JCK C;  3RRM B;  1EYH A;  3CK9 A;  3FUL A;  2B5A A;  5BV1 A;  4OYS A;  1ZZ8 A;  4JHK A;  5AJD A;  3S2A A;  4CDM A;  1Y8M A;  3RO2 A;  4D10 C;  3PNT B;  2WQ7 A;  3I4G A;  4HFG A;  4FLB A;  2WXP A;  2P58 C;  3MJW A;  4ANW A;  2AWI A;  3PZD A;  3ZYM A;  3G5G A;  5FQ4 A;  4X4H A;  3QF3 A;  4PU3 C;  1X5B A;  2JEK A;  3S7D A;  2MRI A;  1HX8 A;  3CSF A;  3CST A;  3PEU B;  1PRU A;  2RD0 A;  3ONK A;  3WXX A;  4YG7 B;  2PUC A;  3SF4 A;  4PU8 A;  5A23 A;  1Z6T A;  3APD A;  3ESL A;  1IHG A;  2PUB A;  2IV1 A;  3LDZ A;  1IC8 A;  4GB9 A;  1UJJ A;  3SBT B;  5CCM A;  2EWT A;  3IVP A;  1ZVV A;  1E8Z A;  1JWG A;  4ILH B;  4IRU A;  1SQM A;  4AP2 A;  3VK0 A;  2NXP A;  3FTY A;  1QP0 A;  3JQ0 A;  3FUH A;  3LYA A;  5G05 C;  2BNM A;  1NP7 A;  3RZZ A;  2I9C A;  2OVF A;  3D9J A;  3FP3 A;  5M72 A;  1IYG A;  1EPU A;  4I6T A;  3IBE A;  4GZ6 A;  3KS2 A;  4ILG A;  4RVB A;  3G2T A;  1E8X A;  3FFL A;  4APO A;  1PY1 A;  4J1W A;  2LYQ A;  1Z3X A;  3LVR E;  2XIU A;  2YHC A;  3D1N I;  3QWG A;  1NZN A;  3FHE A;  4JQD A;  3L6A A;  4WAF A;  2WIU B;  3CHS A;  4KVM A;  5LOZ A;  5T8I A;  3T5V A;  3R1F A;  2UY1 A;  3T5X A;  4NAC A;  5KJL A;  4JL0 A;  3P2B A;  1FVH A;  1PRV A;  2VQ2 A;  3B13 A;  4K03 A;  3GN5 B;  4FA6 A;  3ASF A;  3JYS A;  4XIF A;  4ANX A;  2PIJ A;  4U8H A;  2CSF A;  2XCJ A;  4ATG A;  5FT9 A;  3CLJ A;  1ZS4 A;  3PRE A;  4GZD A;  4OVU A;  3CKC A;  4J8E A;  2YHE A;  1ZZB A;  3QDN A;  4MLP A;  2IU7 A;  3BS3 A;  4PS7 A;  4YVO A;  5LP0 A;  2YIN A;  3ZHI A;  3CVV A;  2MEZ A;  2LYL A;  4U0U A;  3N71 A;  1WAO 1;  2PPX A;  5ANR A;  3CVX A;  3OXF A;  1JUQ A;  2BF0 X;  2KM4 A;  1GW6 A;  2I2O A;  1E7V A;  4I6U A;  1L1M A;  4FJY A;  4UWL A;  4X4D A;  5EX0 A;  4GCO A;  1U3C A;  2C2L A;  4BT8 A;  2WB2 A;  2XI8 A;  2VSN A;  3CGH A;  3FYM A;  5FZR A;  3ONL A;  4DLO A;  3L1P A;  2X6J A;  4AJW A;  3RU0 A;  4AIF A;  3I3N A;  1UJK A;  1ZZC A;  3FH8 A;  3CV0 A;  3EIJ A;  4PH4 B;  1XWR A;  1IQR A;  4FJZ A;  4O6F A;  5EKQ D;  2X38 A;  2IVB A;  3PH0 C;  3F6W A;  2IUO A;  4UQX A;  2WXQ A;  3RK6 A;  1X57 A;  2WXJ A;  1UN8 A;  1ZAY A;  2EQX A;  1DWK A;  4L7T A;  3L13 A;  4GPK A;  3DNV B;  2KZT B;  4BTA A;  2KC7 A;  4JC8 A;  4F53 A;  4JEH A;  3PE3 A;  4U0Z A;  4XKC A;  2MOW A;  4WWN A;  1QQA A;  3IHV A;  4BX8 A;  4CDR A;  3O9X A;  2WMO A;  1HO8 A;  2V8S E;  2X3M A;  1LCC A;  2EF8 A;  5JJ6 A;  5AJL A;  4HOS A;  3OP9 A;  4U0S A;  1H0A A;  1HG5 A;  4X4E A;  3R7Q A;  4CRW A;  1TJC A;  3AU4 A;  2FUL A;  4GML A;  2XSD C;  4MCT A;  4L2Y A;  3KJX A;  5FJY A;  4ANV A;  3RRN B;  3LXU X;  1LQC A;  3IEG A;  3JQ1 A;  4FHJ A;  3U9W A;  3FU5 A;  4L23 A;  4HVB A;  1B0N A;  2HIN A;  1P5Q A;  4I6E A;  3ZXS A;  2L0T B;  3SNX A;  3CLC A;  4AY5 A;  3FDH A;  1ZZ6 A;  1KT0 A;  1OWM A;  3LY7 A;  3RIB A;  4JVS A;  4IA8 A;  4PS3 A;  2YQ8 A;  4JZY A;  3S8Q A;  1H19 A;  1KT1 A;  3VTY A;  3ZYQ A;  4CT0 A;  4F1S A;  2V0P A;  1E90 A;  2WXO A;  4G11 A;  2UWJ G;  4A3T A;  3GZ1 A;  1EDU A;  2ICP A;  2UY1 B;  3OMT A;  2KZT A;  3AU5 A;  3TXN A;  1QP4 A;  5G04 C;  2XEV A;  2XPI A;  3ZHE B;  4YG4 A;  5ANL A;  1JFT A;  4EQF A;  2L8N A;  5J90 A;  2AVP A;  3CK7 A;  3L08 A;  4GCN A;  5DIZ A;  1EFA A;  3FEY A;  3TGO A;  4UQZ A;  1LLI A;  3OTN A;  2VJ8 A;  4F8D A;  4U04 A;  1JWF A;  1UXC A;  4BWR A;  2KPJ A;  4MRU A;  3UFD A;  5KJK A;  1YA0 A;  3AS8 A;  4GMJ A;  3APC A;  4GYO A;  4CCA A;  2DCP A;  2LAI A;  2AXV A;  1UG3 A;  3D9O A;  3KAE A;  3S7J A;  3NF1 A;  2L0I A;  1RZS A;  2AW6 A;  3HHM A;  4IWR A;  1HFA A;  4UWF A;  4E6H A;  4UWH A;  3OQO A;  4NRH B;  3LKU A;  4EZL A;  4AV7 A;  2FBN A;  4KMO A;  2WQ6 A;  3NZU A;  4FAD A;  2J4D A;  2I6H A;  4TV3 A;  1ZUG A;  4DLQ A;  4TRQ A;  2LSV A;  2WQH A;  2CFZ A;  4IYP A;  4WWO A;  2L6J A;  4J8S A;  4UWK A;  4EPZ A;  3FUM A;  1PRA A;  4JA9 A;  3NQP A;  2RG8 A;  2XQ0 A;  2CHX A;  2WM9 A;  4JHR A;  5FQ6 A;  2XCB A;  4H7Y A;  3SHF A;  2LSU A;  3EDT B;  4RG6 A;  3CQG B;  3FUK A;  3HVE B;  1EF1 C;  2J4B A;  3FTZ A;  1JH9 A;  3PUK A;  1QPZ A;  4U07 A;  1DVP A;  3FUE A;  3FH5 A;  2KZ8 A;  4OVV A;  2OOE A;  1QQE A;  2WPV A;  5A7D B;  4I6G A;  2X6F A;  3PXP A;  4GU5 A;  1AU7 A;  1HH8 A;  3NZS A;  1SZ9 A;  3ZHM A;  1ELW A;  2Q7F A;  4K0R A;  1S0P A;  1ADR A;  1NA3 A;  3T8M A;  3MKR A;  2PUA A;  4GZ3 A;  2VSX E;  2XRY A;  3G2U A;  2GZU A;  3UT4 A;  4HOT A;  3CHQ A;  1HU3 A;  4Q69 A;  1JWL A;  4BX9 A;  4Z5C A;  1SQ8 A;  3I4R B;  2PL2 A;  1VPW A;  3ASG A;  3EUS A;  5FZS A;  1PAQ A;  3EJN A;  4N2S A;  3FTU A;  2HO1 A;  1OSL A;  3BG0 B;  1A17 A;  1POU A;  2J07 A;  3B7R L;  4HS2 A;  4UI9 C;  2X6I A;  2WXK A;  2R17 C;  3CVY A;  1B89 A;  3C98 A;  3SCF A;  2PM6 A;  5JJ7 A;  4N2Q A;  1BDI A;  5J08 A;  2R59 A;  1BDH A;  2XGO A;  4N5C A;  3G2S A;  3CRO L;  4B8A A;  3R9A B;  1ZU2 A;  5G05 J;  1RPE L;  2J09 A;  4G23 A;  4AM9 A;  3KEZ A;  3DPD A;  1WH6 A;  4MKT A;  4A1G A;  1NA0 A;  4HOU A;  5AIJ A;  3QB2 A;  3FU6 A;  5FQ7 A;  3URZ A;  4GZ5 A;  3QAR A;  2J9Q A;  4LEU A;  3TG5 A;  3ZEF A;  3AS4 A;  4CEM A;  1E7U A;  4AOF A;  1WIZ A;  3UMV A;  4HOQ A;  3SCG A;  4DI4 A;  2VGY A;  2XJ3 A;  2WVI A;  3OQM A;  4FN3 A;  2R5S A;  3Q15 A;  4LUN U;  4OB4 A;  4PS8 A;  1OWL A;  3TL5 A;  3HIZ A;  3SCH A;  3CEC A;  2PE5 A;  2E2E A;  1QZ2 A;  4EEC A;  3PNL B;  3O4Z A;  4I43 A;  3FTX A;  5BUZ A;  3FH7 A;  4V3I A;  3K9I A;  5ARG A;  5BPP A;  1WH8 A;  2CRO A;  1H6K A;  3S7B A;  4IN3 B;  1ZBP A;  3LEW A;  3JXB C;  4L2L A;  4QFV A;  3UQ3 A;  1NER A;  4TUU A;  4GHJ A;  3VTX A;  4W9R A;  4GQM A;  1KLX A;  3EHN A;  5BNW A;  3CIA A;  2MQK A;  3LJ3 A;  3CHO A;  5CMY A;  3TJP A;  3B7U X;  2XPZ A;  2Y3A A;  2IVG A;  1QQB A;  1RZR D;  4FLH A;  1IQU A;  4A3V A;  3PVL A;  4HOR A;  2LYP A;  4UWG A;  3TRB A;  4FU3 A;  5AEN A;  2XCC A;  2LAH A;  4YAR A;  3ZYK A;  2WXH A;  4LER A;  1DNP A;  5ENN A;  1ELR A;  3DBS A;  5EX3 A;  4B0Z A;  1NEQ A;  1RIO A;  1PER L;  2KCK A;  2R1J L;  2CG2 A;  3ASH A;  3FU3 A;  3QK0 A;  4H7X A;  3MKQ B;  2CHZ A;  3B7H A;  2ION A;  3QOU A;  4U63 A;  4PU7 A;  3JXC L;  1H2V C;  5G04 J;  3UPV A;  4GAA A;  4NQ0 A;  4JEU A;  1W3B A;  2MHK A;  2GW1 A;  2J49 A;  3APF A;  2ZU6 B;  2VGX B;  3CVP A;  3MV3 B;  2VSY A;  4I2Z A;  2VTB B;  2X6K A;  3ZYL A;  4XKB A;  4APF A;  3HVE A;  2OFY A;  2OVB A;  5T3R A;  2WXM A;  3RO3 A;  2YNQ A;  4KZ0 A;  4UI9 K;  1Z3Y A;  4JA7 A;  3RKV A;  3ZRH A;  2WXN A;  4JXT A;  4KZC A;  2D5V A;  5JHA A;  2PUG A;  3E4B A;  4Q96 A;  4X4B A;  4A1S A;  2FEZ A;  4G24 A;  4ABN A;  4EBA A;  1TJF A;  3FYA A;  3MEK A;  4RSY A;  2A5U A;  2BJC A;  3QWW A;  5CCL A;  1YSE A;  1GT0 C;  2XHE A;  3FUD A;  4JCY A;  3U64 A;  4J6I A;  4XZ4 A;  1WET A;  1WY6 A;  4C0M A;  4PDX A;  4GA2 A;  2KEJ A;  2HM8 A;  4DI3 A;  2WXI A;  5BV0 A;  2JCG A;  2PUD A;  1XGW A;  5D0Q D;  1UXD A;  3LIS A;  1HF8 A;  1CJG A;  5LCW C;  3KD7 A;  1U3D A;  5CHE E;  1UN9 A;  4N39 A;  5CMW A;  4Z59 A;  5E75 A;  2VTB A;  3IV0 A;  2CFU A;  3PUJ A;  1JPL A;  3LPZ A;  4FP7 A;  4X4F A;  4Z5H A;  2OND A;  3CVU A;  4FBI A;  5E76 A;  4YND A;  1HXI A;  3UT8 A;  2J08 A;  2PUF A;  3D3M A;  2KEI A;  1MHQ A;  2HSG A;  4IVZ A;  3B7T A;  3AS5 A;  1UW4 B;  3LFP A;  4YBA A;  1LF8 A;  1QNF A;  2WXR A;  2IJG X;  3CEQ A;  4I1A A;  1R69 A;  3KXA A;  2OR1 L;  2C0L A;  3D9M A;  1H2T C;  3BEE A;  3BD1 A;  4X4I A;  3GZ2 A;  5AYW D;  2XGS A;  2WXG A;  3SBS A;  1MQS A;  2LO6 A;  3R7R A;  3CHM A;  4DK5 A;  4HLE A;  5LCW J;  3CVW A;  4M3O A;  2KCV A;  3UUX A;  3ENE A;  3HZI B;  3Q4A B;  4L1B A;  4BY6 A;  3RRU A;  3QWV A;  4WUY A;  3SZ7 A;  3G2V A;  3PE4 A;  2IVQ A;  4F7A A;  4R7L A;  2VSO E;  2FJR A;  4JHJ A;  2GRM A;  3LY8 A;  2PUE A;  2XPY A;  2O38 A;  3LY9 A;  1FVF A;  2HYZ A;  4FC8 A;  4KXK B;  3QYX A;  3CVQ A;  3D9N A;  3TAX A;  4GA0 A;  4UQY A;  3FU0 A;  4DJA A;  3ML9 A;  4I9E A;  1JFS A;  4Y42 A;  2IF4 A;  3GZS A;  5FQ8 A;  5ARF A;  3VLE A;  3G7D A;  4NUR A;  3S7F A;  3ZIM A;  2KCL A;  2LYS A;  3CKB A;  3ZN3 A;  1E8W A;  4B89 A;  3SFZ A;  5KJN A;  3D9L A;  4F3V A;  4B94 A;  1HZ4 A;  2VYI A;  2M63 A;  3FMY A;  3CHP A;  3ESK A;  3QWP A;  4KYO B;  2FO7 A;  4P29 A;  4EZK A;  2PQN A;  2R63 A;  4JPS A;  3ULQ A;  3OXL A;  5C2Y A;  4BT9 A;  2KAT A;  3LVQ E;  3EIQ C;  2H8R A;  3FUN A;  3MV2 B;  4GA1 A;  4I1O B;  4J0U A;  1BPO A;  4WNF A;  4CT4 A;  4C0E A;  1OWP A;  1HF0 A;  3P1U A;  3QQ6 A;  2O4A A;  1XNF A;  4JW1 A;  4YVQ C;  3MZL B;  1X2L A;  2LYK A;  2IQC A;  2OV8 A;  4CGW A;  3IKO B;  2XGM A;  4N3C A;  2CHW A;  3Q49 B;  1OUV A;  2FI7 A;  3CK8 A;  2HR2 A;  2O49 A;  4YG1 A;  3FUF A;  2VGX A;  3LS8 A;  4PUC A;  4I8T A;  1FCH A;  3GW4 A;  3U4T A;  2QY7 A;  5JHB A;  3RJV A;  1VDY A;  2WXF A;  5T4Y A;  3ZFW A;  2XRZ A;  4LRZ A;  5A7L A;  5EDS A;  1ZZ9 A;  2NC9 A;  1HE8 A;  2V5F A;  3FTS A;  1ZPQ A;  3Q47 B;  3MLF A;  4CGV A;  1E8Y A;  3QC1 A;  4E85 A;  2KEK A;  1H2U A;  1R63 A;  2JLB A;  3IHY A;  2E0I A;  5G55 A;  3FTW A;  3FUI A;  3PDN A;  3D9K A;  1E3O C;  1Y7Y A;  4RG9 A;  4GYY A;  5G2N A;  5KCM A;  2CG3 A;  4J8D A;  4KVO A;  3L17 A;  5JJT A;  4KT6 B;  3OQN A;  3FTV A;  4Z5D A;  2JVL A;  2Y4T A;  3HDX A;  3Q5M A;  3TG4 A;  1INZ A;  2BNN A;  1WM5 A;  5C1D A;  4NDW A;  1N54 A;  2NSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...