2AXZA

Crystal structure of prgx/ccf10 complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
306
structure length
306
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 110
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axzA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axzA02
2KPJA 2XJ3A 1BDIA 1LLIA 4X4HA 1IC8A 3CROL 2O49A 1UXCA 1B0NA 2IVQA 4X4CA 2GRMA 1SQ8A 4Z59A 4YG1A 2AXUA 4IA8A 2LYKA 3L1PA 4GHJA 3OMTA 4I6RA 1RZRA 2XSDC 4X4IA 1UXDA 3ZKCA 1CJGA 2MEZA 1ZVVA 1RPEL 2OR1L 4X4EA 4Z58A 1ZZCA 1S7EA 1ZZ7A 2BNNA 1PERL 2EBYA 3GN5B 2LYRA 4Z5HA 2AXZA 1NERA 4Z5DA 3QQ6A 4FN3A 4I6TA 2LYLA 3GBFA 1JWLA 1NEQA 3O9XA 4F8DA 1CQTA 2B5AA 4X4BA 4I6UA 2AWIA 3HZIB 2IVGA 4OB4A 1PRAA 1LQCA 3F51A 1PRUA 1UTXA 2GRLA 3QF3A 3OQNA 1VPWA 3G7DA 2PUDA 1POUA 3RZZA 1PNRA 3G5GA 3F6WA 2AW6A 1QPZA 3JXDL 3MLFA 1Y9QA 2EF8A 1E3OC 4J1WA 3H5TA 2FJRA 4JCYA 3EUSA 1X57A 1ZPQA 4YG4A 3CLCA 2KEIA 3KJXA 4PU3C 5K98B 3KXAA 3LISA 2ICTA 3BD1A 4YG7B 1QP7A 4MCXA 1JFSA 2BNOA 3ZHMA 1ZS4A 2WUSR 2AXVA 4JQDA 1AU7A 1RZSA 1PRVA 2WIUB 3KZ3A 1L1MA 1HF0A 3CECA 2OFYA 2IV1A 2O4AA 2IUOA 3QYXA 2LYSA 3SCHA 1OSLA 3PXPA 3R1FA 1LCCA 2HINA 1WIZA 2HSGA 2BJCA 1WETA 2PUAA 2PUCA 2PUEA 2PUGA 2IVBA 4X4FA 2KZ8A 1X2LA 4YBAA 3ZHIA 3VK0A 3U3WA 1XWRA 3IVPA 4Y42A 3BDNA 3S8QA 4IWRA 2R1JL 1JFTA 2MQKA 1DW9A 1BDHA 2XCJA 2PPXA 2GZUA 1QP4A 4PU4C 4MCTA 4X4DA 2XIUA 1YSEA 3SCFA 5A7LA 3FYAA 1O4XA 2R63A 4NDWA 1LCDA 2CSFA 3JXCL 2LCVA 1R63A 3B7HA 4IVZA 3OQOA 2AUWA 4J1XA 3D1NI 4I8TA 3UFDA 1ZZ8A 3OP9A 1ZUGA 2LYJA 3JXBC 1GT0C 1DWKA 1OCTC 1Y7YA 3F52A 2BNMA 1JH9A 4YARA 1ZZBA 3SCGA 2LYPA 3GN5A 3FYMA 1QQAA 1ADRA 3TRBA 1EFAA 3FMYA 1ZZ9A 3LFPA 2XI8A 4O8BA 3DNVB 3BS3A 3OQMA 1ZAYA 2ICPA 1ZZ6A 2O38A 3QWGA 2PUBA 4FBIA 1R69A 2KEKA 1LMB3 1QP0A 2A6CA 4X4GA 2PE5A 2H8RA 2IU7A 1WH8A 4Z5CA 2KEJA 1RZRD 1QQBA 2PUFA 2L49A 2CROA 2LYQA 2JVLA 2EWTA 2JCGA 2L8NA 4GQMA 4PU8A 1WH6A 4PU7A 1RIOA 2PIJA 2D5VA 4JCXA
chains in the Genus database with same CATH superfamily
5FJYA 5KJLA 3PEVB 3TGOA 4G23A 2P9KG 5KNHD 3HG0D 4I6RA 2F37A 4JHKA 3KEAA 3S2AA 1UW4B 2IONA 2F8XK 2KBXA 3QC1A 2BF0X 1LD8A 3LXUX 3D9PA 2J7UA 5E75A 3O48A 4WVLA 3HZIB 4YNDA 3ZYQA 2OEWA 1TJCA 1QPZA 5ENNA 2EF8A 5FQ4A 3RO2A 5B1AE 3BU8A 4PU3C 3PE3A 2VJ8A 2GRPB 4RLYA 3L08A 2PM6A 3UQ3A 2QYJA 4O1PA 4F6RD 4JEHA 3APFA 3Q9UC 1HG2A 4GZCA 1OUVA 4HQDA 1WIZA 2WQ6A 3MJWA 4JHJA 2RD0A 3BDNA 3ME5A 3MEKA 5LX8A 5HI7A 5GAGi 3HXFA 4EECA 4JXTA 4NIKA 4JB8P 1YCSB 3AAAC 2XQ0A 3KSQA 3JXBC 1PY1A 3NOGD 1N0QA 1MZCA 3W9FA 3QWVA 2L6JA 2FEZA 2RG8A 3ZPJA 3Q73A 2ICPA 3GZSA 4GB9A 3SHFA 2FFHA 2ZIRA 3MZLB 4HOTA 3FY4A 3FU5A 2B6CA 2IOLA 1H2TC 1N4SA 2NXPA 2PIJA 3ASHA 5EX3A 3GYZA 1SQ8A 3EIJA 3S7BA 1JWFA 2PQNA 4I1OB 5C1DA 1DCEA 4XIFA 1TN7A 2PXUA 3HXCA 4G8KA 5AENA 5JUWA 4CYMD 4GMRA 1OY3D 1JWLA 3TWUA 5LOZA 3SFZA 3D3MA 4FULA 3UT4A 1N94A 2GRNB 2WVIA 4UI9C 4JPSA 3FH8A 4GYWA 4GZDA 3CHRA 3LISA 4EZLA 2HM8A 1JWGA 3PDNA 4BTAA 3DSTA 2O4AA 2LYSA 4XZ4A 5EX0A 1EF1C 3U3WA 2I2OA 1MHQA 3DPYA 3ZHEB 3EHQA 3PE4A 1XNFA 3AS4A 4GTVA 4XX5A 5JMND 1DWKA 3UXGA 4GTOA 1JH9A 4YARA 2PXBA 3NBNB 3SNXA 3JQ0A 4ANVA 1IYGA 3FMYA 2WXMA 3RSEG 2I1JA 4LNBA 2O38A 1ZZ6A 1QP0A 3ISMC 5CCMA 4U8HA 1QBQA 3JUEA 5FQ7A 3KSLA 3NQPA 3SGHA 4PUCA 4F3VA 4IYPA 4GZ6A 3SBTB 4WAFA 3LYAA 1H0AA 1DCQA 1INZA 3CVUA 5CMWA 3R9MA 3OMTA 4B94A 4HLEA 4E85A 4QQIA 4EZIA 2HCNA 4FHKA 1S64A 3DEOA 1S7EA 3FTVA 2AXZA 4DX7D 3L22A 2LYLA 3AG3E 3APDA 3G2SA 3QNKA 3QWPA 4OAUC 3TWXA 3T8KA 3OQNA 4HVBA 4LNGA 4WNDA 4UI9J 4U95D 5G55A 4C48B 1ZPQA 1QB2A 4DI4A 3QAQA 3CK8A 4BWRA 3N71A 3V30A 5GAHi 4OVUA 3FTWA 1JUQA 4LUNU 3KS2A 4DX2A 2Y3AA 4B89A 2CFUA 3SCHA 2KM4A 3MEJA 3G0TA 4LERA 4N2SA 3BUAA 1Z3XA 4E6HA 3CVYA 2VSYA 2Y4TA 3PZ2A 2OVFA 2EQXA 2AUWA 2CHZA 4O1OA 3FTXA 1MX6A 4ER0A 3CK9A 4HRNA 3L82A 1DULA 2FBNA 4GA2A 1ELWA 2WXJA 3MCXA 3NOCD 4UWFA 1EFAA 5C2YA 2XI8A 1HE8A 4MKTA 1R69A 1HH8A 4JC8A 3U66A 2ETCA 4BSZB 2H8RA 1IKND 1B89A 2WB2A 5CRUA 5JJ7A 3Q7FA 5CBNA 2L8NA 3TWQA 4Q96A 5CBOA 5FT9A 2P9SG 2AXUA 4KMOA 1KLXA 1N9AA 4CCAA 3MKRA 2F8YA 1PERL 3LPZA 3I4GA 5HS0A 3CHQA 5FWQA 4KZ0A 4I6UA 4GTMA 1UTXA 2KC7A 1TJFA 3RAUA 3ASOE 4BT9A 2FJRA 4ZFHA 2PXVA 2WXFA 2V4LA 2IO3C 5A6CA 4FJYA 3D9NA 4DX5D 2C0LA 1K3ZD 3B13A 4CGVA 3C3RA 2GW1A 3CLJA 2XCCA 4MRUA 3FU3A 2HINA 5G04C 1OWMA 2I1KA 4WUYA 1HO8A 3ZHIA 4HOSA 2MQKA 1E8YA 2WXGA 4X4DA 3CVQA 4PH4B 4HXIA 2ETBA 5DT2A 2BEDA 3TWRA 4NDWA 5G05C 5ENTD 3MV2B 4YDOA 1TR4A 1SZAA 2X6IA 2XGOA 1FVHA 1ADRA 4YDEA 1DNPA 1SA5A 1MQSA 1BI7B 3QWGA 2PUBA 2LNMA 4BETA 2MYOA 3EHNA 2HFZA 3E30A 3PXPA 1LLIA 4DE9A 1IC8A 5CECB 4AXHA 3T8MA 3UTMA 5FZSA 4B8AA 2YBDA 4NURA 2KZTB 1U3CA 3ML8A 2VYIA 1ZZCA 1IHBA 3HIZA 3LJ3A 3FTSA 3HYMB 4Z5DA 4I6TA 4DI3A 3AG4E 3PRZA 4DLOA 2QFCA 2OV8A 1EDUA 5JJTA 2KXPC 3F6WA 4MBGA 3ZRHA 4NQ0A 2CG3A 3ENEA 4B8CB 5T8IA 3BG0B 4Q94A 4G11A 4UWKA 1TN6A 2WUSR 3UWPA 1HF0A 2OFYA 2IV1A 2WXOA 3DRAA 4GYYA 3SX0A 3SFXA 4J8DA 2FO7A 1BDHA 2XCJA 1D9SA 4PU4C 1N95A 4AIFA 5G05J 4FC8A 1QQEA 2PL2A 3A9YA 4KYOB 3FP3A 1OCOE 4DK5A 3NZLA 1IQRA 3T9KA 4HNAD 3R7RA 2WXPA 3LFPA 3ZEFA 4HBDA 1H6PA 4TV3A 2H6IA 3G2TA 2GGFA 3D9LA 5ENOD 3SR4A 3L1PA 4I9EA 4HOUA 5AAOA 2P2CP 3OXFA 4EZJA 4BX9A 1B0NA 2PXEA 3AJIA 4YG1A 3T5XA 4FJZA 4L23A 2H6FA 2Y4UA 2IFUA 3C3QA 5DRYA 2MEZA 3I5PA 4TUUA 3CHMA 4GTPA 2LYRA 4PS7A 1KPSB 3ZIMA 3GBFA 4F8DA 3PS6A 3GZ2A 4F1PA 1FPPA 4CRWA 5J08A 2PZIA 4L7TA 2LXMA 2PUDA 4JZYA 1NI1A 3APCA 5DTRA 3CLCA 1KT1A 5EN5D 1MX2A 3Q78A 1BLXB 3KZ3A 4OAVB 4LSZE 1ELKA 3UT8A 2FO1E 5AIJA 3PNLB 3I3NA 2IOSA 3C98A 3J5PA 4CGWA 3I4RB 3JXJA 4U8VD 3V31A 3L9TA 1ZU2A 3TXMA 2QZAA 5A23A 3ZGQA 2X6HA 3ZN3A 3FYAA 3FUDA 5KJNA 1Z5SC 2LCVA 2ODRD 2PXPA 5EDSA 4AM9A 3OP9A 3Q47B 2Y1LE 4JL0A 4HRLA 2DVWA 4JD2G 4L2YA 3BS3A 2A4ZA 2A6CA 2MXDA 3OAWA 4JA9A 4A55A 5ENRD 3LY7A 2XGSA 3E4BA 2JCGA 1EPUA 2WXNA 1OWPA 3RIBA 4P29A 1SZ9A 2J07A 5FQ8A 3OWQA 2KCLA 2J4BA 3DBSA 3CVVA 3NZSA 2DCPA 1Y8MA 2XSDC 5LFAA 2EIME 4UQZA 4WWPA 5FINA 2DYRE 3O4ZA 1HX8A 4N3CA 1NERA 2X6FA 2LSVA 4YVQC 3FU6A 3ASGA 5AJDA 2DIWA 4FU3A 2ZGDA 2GRQB 1HQ1A 3CVPA 1X81A 3UMVA 1W3BA 1POUA 3WG7E 4GU5A 2GRRB 4U0SA 3PZ4A 3OTNA 3KXAA 5BNWA 4YG7B 3NAWA 2JQEA 2J7WA 4KZCA 2R05A 2WIUB 3CECA 3GZ1A 1YA0A 3ABKE 4J8SA 2BJCA 4L9PA 2XZTG 2RKKA 3VLDA 3B7SA 1IXVA 3S8QA 4IWRA 1V55E 2E0IA 4G26A 5A7LA 4GZ5A 4TXPA 2JLBA 3FULA 3FUMA 3ASNE 1R63A 3TWTA 3E37A 1O1RA 2V5QC 3DSVA 1Y7YA 3PH0C 1TNBA 3FFLA 1K1AA 3C5RA 4AP2A 1S0PA 1HZ4A 1H6KA 4N3BA 3IBEA 3EHRA 3UI2A 3J5QB 4HLLA 2UWJG 3Q5MA 4X4GA 1OCRE 2IU7A 3JCKC 4BERA 3ZNGA 4GMJA 2XZDG 4ANWA 1UJJA 3L17A 4XE0A 5BXUA 5LCWC 3G2WA 3B7BA 4BT8A 2R59A 4K5CA 5BV1A 5BW8C 4FLHA 2P9LG 3DWLG 2J8SD 5B1BE 1UN8A 1N54A 1DVPA 3MX3A 1ZVVA 3S7JA 2OR1L 3CQGB 1Z6TA 3ZVVA 4YDYA 4EHMA 2A5UA 2WXKA 1S63A 1NA0A 4OB4A 1D8EA 2OEVA 2WXLA 4LEUA 3L16A 3LY8A 3MLFA 1N4QA 1GW6A 3QFIA 4JW1A 3UPVA 3ULEG 3UIOC 2I9CA 4CT0A 1JFSA 4Q2JA 3ZHMA 3P2BA 1PAQA 1PRVA 5KJKA 4XKBA 3UX4A 3K9IA 3VWSA 2C0MA 2VSNA 3ONKA 3KL4A 1OSLA 3X2QE 2PUEA 1H2UA 2PUAA 3JUIA 4O6FA 4KBQA 1X2LA 4YBAA 5BUZA 3PUJA 4J6IA 4C9BB 2R1JL 3L54A 3FH7A 2XIUA 3CEQA 5DTQA 4PDXA 1N11A 4I43A 3KD7A 2R03A 3S7DA 1H2VC 3QJZA 3BQOA 1OCTC 5EYLA 4B93B 1OXJA 4AEZC 1FCHA 2WXRA 2KEKA 4N39A 2WXIA 2KEJA 3D9OA 4I6JA 3BEEA 5JA4D 5AQBA 2L49A 2JVLA 3CHOA 5JJ6A 2PXDA 2R17C 4GPMA 3ONLA 3E33A 2XEHA 5LCWJ 2WXQA 4GTQA 3V79K 5E76A 1KZPA 4OYSA 5CEAA 2LYKA 2OOEA 2A5EA 4FLBA 2EIJE 4OVVA 3IHVA 3UKRG 3ML9A 4L1BA 3GN5B 1TNYA 3ZYMA 1OCZE 2MRIA 1IHGA 3RU0A 4EQFA 2DWZA 2JABA 3D9HA 2IEJA 3Q49B 3ZUVB 3FTZA 3ABLE 2VQ2A 1PRAA 4Q69A 4RG6A 4D10C 4EBAG 1Y9QA 5T4YA 3ZFWA 2F0YA 4QFVA 3H5TA 3MKQA 5K98B 4ANUA 2ICTA 1QP7A 4W9RA 4DJAA 1L1MA 3LJNA 2LNIA 4G8LA 2VSOE 5M72A 3D9JA 3CIAA 4JVSA 4UWHA 2HR2A 3HRAA 2VTBB 1BD8A 4ZHBA 1D8DA 1XWRA 2XPYA 3DSSA 3TJPA 2PPXA 2LSUA 3DSWA 1LCDA 2CSFA 4WWNA 3B7HA 1FT1A 5BXOA 3LQXA 2KZTA 3D1NI 3TWWA 3D9IA 3HVEA 1ZZ8A 3DM5A 1QNFA 2YHEA 3SFYA 3DPDA 3F52A 3IXEA 2X38A 1TNUA 3CVWA 4UWGA 3AS5A 3FUJA 4N3AA 1YMPA 1P5QA 4FBIA 1U3DA 2V3CC 2XXAA 4LG6A 1ELRA 2XS8A 3TEPA 2YHCA 2KPJA 3RRMB 2Q7FA 5ITZF 2H6HA 3GZCA 4IA8A 4JEUA 1N0RA 1JCQA 3B95A 4EK9A 1E7VA 2H6GA 2EIKE 2EBYA 4BESA 4ILHB 2VGXB 2M4HA 4FN3A 2IY0C 2HE0A 3Q7AA 2B5AA 1LQCA 3UM0A 1PRUA 4K5AB 3CKBA 4DE8A 2XPIA 3ZU7B 3EDTB 2KCVA 4J1WA 3TWSA 1X57A 4PS8A 2KEIA 3ESKA 5FZQA 5J90A 3SD5A 3QDNA 1OWLA 2BNOA 2ZISA 2WXHA 1RZSA 4NRHB 2LUHA 3FUKA 2IUOA 3FDHA 3VLFA 4AJWA 2QYUA 3CHPA 3ZXSA 3SO8A 1UG3A 2KZ8A 3LKUA 4UWLA 5ARFA 3V2OA 2Y69E 2XEVA 1HS6A 4MCTA 1YSEA 2ILRA 2PXTA 4IVZA 3L13A 5AN8A 3ASFA 3PREA 5ENPD 1GT0C 1QZ2A 1KZOA 5AQ9A 4N2QA 2XENA 3UM3A 3SCGA 4CDRA 2P9UG 3FYMA 5G04J 3B7UX 4HI8A 3CHSA 4ER6A 4GAAA 3DNVB 3URZA 1HFAA 2V8SE 5EIBE 3TL5A 2UY1B 3G2VA 2WMNA 1WH8A 1HU3A 3TFLA 3FUIA 4F53A 3RRNB 3CGHA 2YQ8A 4BY6A 4JCXA 4HS2A 1BDIA 4XI0A 4CEMA 1BPOA 2VEOA 4AY6A 4X4CA 3SI5A 3DSXA 2L1PA 1CJGA 5JHAA 3VLEA 1RPEL 4XI9A 2OVBA 3FUFA 2P9NG 1ZZ7A 3NB2A 2BNNA 5D0OD 1NL4A 4N5CA 3ABME 2LXLA 1NP7A 4GYOA 3ESLA 3F51A 3QF3A 5DIZA 2XXPA 2AW6A 2JEKA 3C72A 2V0PA 4I9CA 4YG4A 1HF8A 5DTMA 1QYMA 3QOWA 1AU7A 4BX8A 4MLPA 4I1MA 2LLVA 2VSXE 5B3SE 1IQUA 3DXKG 3MV3B 1HG5A 3F6QA 4LCTA 5ENSD 1WDYA 2KCKA 3L6AA 5DBKA 1QP4A 3U64A 2LAHA 4BFRA 2CHWA 5BT1A 3NXHA 4UQYA 1E8WA 1WAO1 5ANRA 4GTTA 1VDYA 1ZB1A 4EKGA 3OXLA 3JXIA 4GCOA 3ZW3A 4H7XA 4J8EA 2RFMA 1NW3A 3TG4A 1RZRD 4C0EA 2CROA 3EHMA 1A17A 1FVFA 5FZRA 2D5VA 3G2UA 2O49A 3ZXPA 1NFIE 5AYWD 1O5MA 2VGYA 3BG1B 5HQ8A 2E2EA 2WPVA 1RZRA 3FEXA 3CVLA 3MYVA 4M7CA 2ONDA 4X4IA 3ZKCA 4TXRA 1UOHA 4Z58A 1XGWA 2WMOA 3CSFA 4WWOA 4Z5HA 1MYOA 3QQ6A 5ARGA 1NEQA 4KT6B 2J08A 2AWIA 4JA7A 2R2LA 1WM5A 1NZNA 4N5QA 3ZYKA 3FUEA 1E7UA 4A3VA 4FP7A 2R5SA 2BKGA 5D0QD 3FEYA 4L2LA 5AQAA 4XKCA 2XHEA 3IV0A 2NC9A 2HO1A 2XEEA 4U07A 4JQDA 2HYZA 1ZBPA 1SQMA 2EINE 2ZXWE 4EPZA 3ZHEA 1UN9A 4I17A 1WG0A 4X4FA 4K5BA 3VK0A 3JQ1A 3IVPA 5EIDA 3V2XA 1DW9A 3SCFA 3AU5A 1O4XA 3FUHA 3JXCL 4HORA 4ATZD 3OQOA 4UUCA 4I8TA 4RQIA 1V54E 4R7LA 2AJAA 2WQ7A 4GCNA 1ZZBA 2CFZA 1TN8A 4WNFA 4CZ2D 1U2ZA 2XCBA 4G1TA 2IO2C 2FF4A 4J0UA 4ILGA 3QK0A 4ER7A 2QC9A 5EILA 3NDBB 4MS6A 3Q9NC 3CQCB 2DZNA 4GQMA 4YDWA 2J09A 1H19A 3PZ3A 4IULA 3T5VA 3RK6A 2X3MA 3UUXA 2WQHA 3SF4A 2IVQA 4ATGA 1H6OA 1SVXA 3UM2A 4U0ZA 1LF8A 1SA4A 4ANXA 1FT2A 4CDNA 1MFQC 2V4HC 2QY7A 3MGBA 3EU9A 1TEZA 3RKVA 4TUMA 3DXMG 3HXEA 2M63A 4IN3B 4HRAA 3M9LA 2LO6A 3P1UA 2IVGA 3ZKJA 3SBSA 1JCRA 3ZYLA 1E8ZA 3RZZA 3G5GA 3PUKA 4JCYA 3U4TA 3EUSA 1K8KG 3KJXA 4AY5A 3LDZA 2LLWA 1E90A 3U9WA 4XEIG 1DC2A 2FI7A 2AXVA 2XRYA 3ASDA 2ETAA 2PXLA 3S7FA 5EKQD 4LNUD 1TNZA 3FHEA 3QYXA 4M3OA 3EIQC 3UT7A 2L9BA 3WXXA 5AJLA 2HSGA 1Y6IA 4U0UA 2IVBA 4ER5A 4DPRA 2GZUA 4AV7A 3UIPC 2AVPA 4U8YD 2IQCA 3NZUA 4APOA 1K1BA 2XRZA 5DRTA 4K03A 3AU4A 3EUVA 4A63B 5BPPA 1PC2A 3RO3A 4GZ3A 2LYPA 3GN5A 3ULYA 3VTYA 5IY5E 4AOFA 1ZZ9A 4F7AA 2ZGGA 5CMYA 3GZDA 1LMB3 2J9QA 2PE5A 4I2ZA 2HCSA 1QQBA 3KAEA 2LYQA 2EWTA 4EQZA 2RFAA 3D9KA 1WH6A 1N4RA 2XJ3A 3CROL 3UINC 1X5BA 4DUIA 4Z59A 3QOUA 5HKPA 4GHJA 4ACKA 2XGMA 1NA3A 1UXDA 3CK7A 4GA0A 3LVRE 2BTDA 3CV0A 3QKYA 4GTRA 1O1SA 5G2NA 4Z68A 2CG2A 2VTBA 2DZOA 1CQTA 2L0TB 2KATA 4WNEA 1O1TA 3JYSA 3GUUA 4FADA 4UI9K 1PNRA 3NROA 3PNTB 1OWOA 3PEUB 4LRZA 3BD1A 4ER3A 5ANLA 2P9PG 1ZS4A 3A9ZA 3TELA 2X6KA 2PNNA 3MA5A 1MX4A 1WETA 4OBMA 4I2WA 1MJ0A 5HRYA 1JFTA 2VGEA 5FIOA 3RRUA 3ZPXA 5CHEE 2R63A 5AQ7A 4HFGA 4BEPA 2IU1A 5ENQD 4DLQA 4G24A 5KJMA 2Y0BG 4ACLA 1LD7A 2BNMA 1E8XA 2IJGX 3CVNA 3FTYA 1QQAA 2NYJA 3TRBA 2VGXA 5AARA 3DEPA 1N52A 1U2VG 4O8BA 4J8FA 3SY2A 3QARA 3IEGA 4ME2A 4GA1A 3TWVA 2PUFA 4DX6D 1YYHA 3HDXA 4PU8A 4RG9A 4U96D 1RW2A 4KVMA 4PU7A 1A5EA 4G25A 1UXCA 4ABNA 3HHMA 3CKCA 3B7RL 1Z3YA 3QWWA 3PE5A 5CRVA 2P9IG 2IF4A 4HOQA 3EJNA 4X4EA 3FH5A 5KCMA 3PVLA 3O9XA 2CHXA 2DYSE 3PZ1A 4A1GA 3G7DA 3HXBA 2GROB 3DSUA 2OCCE 3JXDL 3Q4AB 3AG2E 4U63A 1QZXA 4EZKA 1JPLA 2PXQA 4H7YA 4Y6WA 5T3RA 2XS1A 3UKUG 4UQXA 3MKQB 3TXNA 1TNOA 2BUGA 4K0RA 2XPZA 3W9GA 3TAXA 3R1FA 1LCCA 2UY1A 2PUGA 3LCAA 5H7PA 4ILIA 1TYQG 4DRXE 3FWVA 4U7EB 5LP0A 3C3OA 2PQRA 5D66A 4Y6CA 4BSXA 4RSYA 4J1XA 3IHYA 4TRQA 4APFA 4A1SA 2BKKB 1ZUGA 4V3IA 2R02A 3FU0A 3A9XA 3PZDA 4TXQA 4A3TA 4GTSA 4KXKB 3HVEB 3GW4A 5KNGA 1UJKA 2MHKA 2PM7A 5KWDA 2J4DA 5CERB 1Q2ZA 2NSZA 1S70B 3CVXA 5FQ6A 2DBAA 1WY6A 3Q75A 5KBAA 3GZDC 2PXKA 4PS3A 5DSXA 4X4HA 2C2LA 2YINA 4J7WA 2GRMA 3LEWA 4O60A 4URKA 3Q79A 1OT8A 2B0OE 2L6BA 4I1AA 1AWCB 3UM1A 5JHBA 3R9AB 3OXGA 3QB2A 3HXDA 5BV0A 3E34A 4X4BA 3OKZA 4CDMA 1OCCE 4X8QA 2GRLA 3QOXA 1VPWA 1RZ4A 3E32A 1G3NB 4WNGA 4GMLA 1OWNA 4HI9A 2FULA 1E3OC 3LY9A 2LAIA 4I6EA 4FA6A 5D2MC 2J49A 2X6JA 1KT0A 3SQVA 5EYPF 4MCXA 4YVOA 3AG1E 4U04A 2WM9A 4I6GA 3RJVA 1AP7A 1EYHA 2I6HA 2PXFA 2XXQA 3R7QA 4B0ZA 3CR3A 3TG5A 3B7TA 4BTBA 4C0MA 4RVBA 4J8YA 2PUCA 3R09A 4DX1A 4IRUA 1SW6A 3KEZA 4JHRA 4Y42A 3CSTA 4G2VA 1HXIA 3FTUA 5CEDB 3NF1A 3SZ7A 4NACA 1N4PA 2P58C 4F1SA 3LVQE 1BI8B 3EU5A 4KVOA 3UFDA 2L0IA 2YNQA 4EKIA 2ZU6B 3IKOB 1BU9A 2LYJA 3Q15A 1E96B 3VTXA 4HRMB 3D9MA 5A7DB 5FTPA 3FUNA 4GPKA 1ZAYA 3OQMA 3LS8A 4EBAA 3ULQA 3AS8A 2EILE 4AVXA 4HB5A 4Z5CA 2MOWA 5CCLA 1JCSA 1LTXA 4FHJA 4CT4A 1L5JA 2V5FA 1RIOA
chains in the Genus database with same CATH topology
1LLIA 5FJYA 3ONLA 3RK6A 5KJLA 2X3MA 1IC8A 3UUXA 3PEVB 2WQHA 3T8MA 3SF4A 4AXHA 2WXQA 4G23A 2IVQA 5LCWJ 5FZSA 4ATGA 5KCMA 5E76A 4B8AA 4OYSA 4NURA 2LYKA 2KZTB 1U3CA 4I6RA 2OOEA 4FLBA 4JHKA 4U0ZA 1LF8A 4ANXA 4OVVA 3IHVA 3S2AA 4CDNA 1UW4B 2VYIA 3ML8A 2IONA 1ZZCA 3QC1A 2BF0X 3LXUX 3ML9A 4L1BA 2QY7A 3MGBA 3HIZA 3GN5B 3LJ3A 3D9PA 3FTSA 3ZYMA 3HYMB 2MRIA 5E75A 1TEZA 4Z5DA 3RKVA 4I6TA 1IHGA 4DI3A 3RU0A 3O48A 2M63A 4IN3B 3PRZA 4EQFA 3P1UA 2LO6A 4DLOA 3HZIB 3Q49B 2IVGA 2QFCA 3FTZA 4YNDA 2OV8A 2VQ2A 3SBSA 3ZYQA 1EDUA 1PRAA 4Q69A 5JJTA 4RG6A 3ZYLA 1TJCA 1E8ZA 3RZZA 3G5GA 3F6WA 4D10C 1QPZA 5ENNA 4EBAG 3ZRHA 1Y9QA 2EF8A 4NQ0A 2CG3A 5T4YA 3ZFWA 3PUKA 4QFVA 5FQ4A 3H5TA 3ENEA 4JCYA 3RO2A 3EUSA 3U4TA 4B8CB 5T8IA 3KJXA 3BG0B 4PU3C 5K98B 3MKQA 3PE3A 4Q94A 4AY5A 4ANUA 3LDZA 2VJ8A 2ICTA 3L08A 1QP7A 1E90A 4W9RA 2PM6A 4G11A 3U9WA 4DJAA 4UWKA 2FI7A 2WUSR 2AXVA 3UQ3A 2XRYA 3ASDA 1L1MA 1HF0A 3S7FA 5EKQD 2LNIA 2OFYA 2IV1A 2WXOA 4M3OA 3FHEA 3QYXA 4JEHA 3APFA 3EIQC 3UT7A 2VSOE 2L9BA 5M72A 1HG2A 4GZCA 3D9JA 1OUVA 3WXXA 3CIAA 4GYYA 1WIZA 2HSGA 1Y6IA 4JVSA 4U0UA 4UWHA 3MJWA 2HR2A 2WQ6A 2VTBB 2IVBA 4JHJA 2RD0A 1XWRA 3BDNA 2XPYA 4J8DA 2FO7A 1BDHA 3TJPA 2XCJA 3MEKA 4DPRA 2PPXA 2GZUA 5HI7A 4AV7A 5LX8A 4PU4C 4EECA 4JXTA 2LSUA 2AVPA 1LCDA 4AIFA 2CSFA 2IQCA 3NZUA 4WWNA 3B7HA 4FC8A 5G05J 2KZTA 1QQEA 2PL2A 3D1NI 4APOA 4KYOB 2XQ0A 3D9IA 3FP3A 2XRZA 3HVEA 1ZZ8A 4K03A 1QNFA 3JXBC 1PY1A 2YHEA 3AU4A 3DPDA 3F52A 2X38A 3CVWA 5BPPA 4UWGA 1PC2A 4DK5A 3RO3A 4GZ3A 1IQRA 2LYPA 3GN5A 3VTYA 3R7RA 2WXPA 2L6JA 3QWVA 3AS5A 4AOFA 3FUJA 1ZZ9A 3LFPA 4N3AA 3ZEFA 1P5QA 2FEZA 2RG8A 3ZPJA 4F7AA 2ICPA 3GZSA 4GB9A 5CMYA 4FBIA 1LMB3 3SHFA 1U3DA 2J9QA 3MZLB 4HOTA 3FY4A 3FU5A 2PE5A 4TV3A 1ELRA 4I2ZA 1QQBA 2IOLA 1H2TC 3G2TA 3KAEA 2LYQA 2EWTA 2YHCA 2GGFA 3D9LA 3D9KA 3L1PA 1WH6A 2NXPA 4HOUA 2PIJA 3ASHA 4I9EA 2KPJA 2XJ3A 5EX3A 3RRMB 3CROL 3OXFA 4EZJA 1X5BA 4BX9A 1B0NA 3GYZA 2Q7FA 1SQ8A 4Z59A 4YG1A 3EIJA 4IA8A 4JEUA 3T5XA 3QOUA 4FJZA 1JWFA 2PQNA 4I1OB 3S7BA 5C1DA 4GHJA 4L23A 4ACKA 2XGMA 2Y4UA 2IFUA 1NA3A 4XIFA 1UXDA 3CK7A 4GA0A 2MEZA 3I5PA 3LVRE 1E7VA 2BTDA 4TUUA 3CHMA 3CV0A 5AENA 3QKYA 2EBYA 2LYRA 4PS7A 4ILHB 5G2NA 2VGXB 2CG2A 4FN3A 3ZIMA 2VTBA 3GBFA 1JWLA 4F8DA 1CQTA 5LOZA 2B5AA 2L0TB 3GZ2A 3PS6A 3SFZA 2KATA 3D3MA 4WNEA 4FULA 4CRWA 3JYSA 5J08A 2PZIA 1LQCA 4L7TA 1PRUA 3UT4A 4FADA 2J09A 2PUDA 4UI9K 4JZYA 1PNRA 3CKBA 2WVIA 2XPIA 4UI9C 3EDTB 2KCVA 3PNTB 4J1WA 3APCA 4JPSA 3FH8A 3T5VA 1OWOA 4GYWA 1X57A 3CLCA 1KT1A 3PEUB 4PS8A 4GZDA 2KEIA 3ESKA 5FZQA 3CHRA 5J90A 3SD5A 3LISA 4LRZA 3BD1A 3QDNA 5ANLA 1OWLA 4EZLA 2BNOA 1ZS4A 2HM8A 1JWGA 2WXHA 3PDNA 1RZSA 2X6KA 4NRHB 4BTAA 3KZ3A 3FUKA 1ELKA 3UT8A 3MA5A 2O4AA 2IUOA 2LYSA 3FDHA 4XZ4A 3VLFA 4AJWA 5AIJA 3PNLB 3I3NA 2IOSA 3C98A 5EX0A 4CGWA 1WETA 4I2WA 3CHPA 3I4RB 3ZXSA 1EF1C 1UG3A 2KZ8A 3LKUA 4UWLA 3U3WA 5ARFA 2I2OA 1MHQA 1JFTA 2XEVA 1HS6A 1ZU2A 3TGOA 3TXMA 5A23A 3ZHEB 5AJLA 3RRUA 3ZGQA 4MCTA 2X6HA 1YSEA 3PE4A 2ILRA 3ZN3A 5CHEE 3FYAA 3FUDA 2R63A 5KJNA 2LCVA 1XNFA 3AS4A 4IVZA 3L13A 2IU1A 4HFGA 4DLQA 4XX5A 4G24A 5KJMA 3ASFA 4ACLA 5EDSA 3PREA 4AM9A 3OP9A 1GT0C 1QZ2A 1DWKA 4BY6A 4N2QA 2BNMA 1E8XA 1JH9A 4YARA 2IJGX 3Q47B 3SCGA 3CVNA 3SNXA 3FTYA 4CDRA 3JQ0A 4ANVA 3FYMA 1QQAA 4JL0A 1IYGA 5G04J 3TRBA 3B7UX 2VGXA 3CHSA 3FMYA 4L2YA 1N52A 2WXMA 4GAAA 4O8BA 3DNVB 3BS3A 4J8FA 2I1JA 3QARA 2O38A 1ZZ6A 3URZA 3IEGA 1HFAA 2A4ZA 1QP0A 2V8SE 4ME2A 2A6CA 3OAWA 4JA9A 3TL5A 5CCMA 4A55A 2UY1B 3G2VA 4U8HA 4GA1A 2WMNA 5FQ7A 1WH8A 2PUFA 1HU3A 3LY7A 3NQPA 4F3VA 2XGSA 3E4BA 2JCGA 1EPUA 3HDXA 4PU8A 2WXNA 3FUIA 1OWPA 4RG9A 4KVMA 4PUCA 3CGHA 3RIBA 3RRNB 4PU7A 3SGHA 2YQ8A 4P29A 4JCXA 1SZ9A 2J07A 1BDIA 4HS2A 4XI0A 4IYPA 4GZ6A 5FQ8A 4CEMA 1BPOA 3SBTB 4G25A 1UXCA 3LYAA 4X4CA 1H0AA 4WAFA 3HHMA 3SI5A 4ABNA 4AY6A 1INZA 2KCLA 2J4BA 5CMWA 3DBSA 3CVUA 3CKCA 3CVVA 3NZSA 3OMTA 2DCPA 1Y8MA 3B7RL 4B94A 2XSDC 1Z3YA 3QWWA 4HLEA 5LFAA 4E85A 1CJGA 5JHAA 4UQZA 2IF4A 4FHKA 1RPEL 4WWPA 4HOQA 3EJNA 4XI9A 3VLEA 4X4EA 2OVBA 1S7EA 3FUFA 1ZZ7A 3O4ZA 2BNNA 1HX8A 5D0OD 4N3CA 3FTVA 2AXZA 3FH5A 1NERA 4N5CA 3L22A 2LYLA 2X6FA 2LSVA 3PVLA 3O9XA 2CHXA 3ASGA 3FU6A 5AJDA 4YVQC 2DIWA 1NP7A 3APDA 3G2SA 4GYOA 3QNKA 3QWPA 4FU3A 3ESLA 3CVPA 3UMVA 4A1GA 1W3BA 3F51A 3QF3A 3OQNA 3G7DA 1POUA 4HVBA 4GU5A 4WNDA 5DIZA 4U0SA 2AW6A 2JEKA 3JXDL 3Q4AB 2V0PA 4UI9J 4U63A 5G55A 4I9CA 1ZPQA 4YG4A 4EZKA 1HF8A 1JPLA 4DI4A 3OTNA 3KXAA 3CK8A 3QAQA 4YG7B 5BNWA 4BWRA 3N71A 4H7YA 4Y6WA 4OVUA 5T3RA 1AU7A 3FTWA 4KZCA 4BX8A 4MLPA 3CVYA 2WIUB 4UQXA 3MKQB 1JUQA 4LUNU 3CECA 3KS2A 3TXNA 4I1MA 3GZ1A 2Y3AA 2BUGA 2VSXE 4K0RA 4B89A 1IQUA 1YA0A 3SCHA 2CFUA 2XPZA 3MV3B 4J8SA 3R1FA 1LCCA 1HG5A 2KM4A 2BJCA 3TAXA 2UY1A 4LERA 4LCTA 2PUGA 3LCAA 4N2SA 4ILIA 3VLDA 2KCKA 3L6AA 3B7SA 3S8QA 4IWRA 2E0IA 5DBKA 3FWVA 4G26A 1QP4A 1Z3XA 5LP0A 3U64A 2PQRA 4E6HA 5A7LA 4F53A 2LAHA 2VSYA 4GZ5A 2Y4TA 2CHWA 4BFRA 5BT1A 4Y6CA 4UQYA 2JLBA 2OVFA 3FULA 3FUMA 2EQXA 1R63A 1E8WA 4BSXA 4RSYA 2AUWA 4J1XA 3IHYA 4TRQA 1WAO1 2CHZA 3FTXA 5ANRA 4APFA 4A1SA 1ZUGA 3CK9A 1Y7YA 1VDYA 3PH0C 4V3IA 3FU0A 2FBNA 3FFLA 1ELWA 2WXJA 3PZDA 3OXLA 4GA2A 4A3TA 3MCXA 4KXKB 4GCOA 4UWFA 3HVEB 4AP2A 1S0PA 1EFAA 1HZ4A 4H7XA 5C2YA 3ZW3A 4J8EA 1H6KA 2XI8A 1HE8A 4N3BA 3IBEA 3GW4A 1R69A 4MKTA 1HH8A 2UWJG 1UJKA 4JC8A 2MHKA 3Q5MA 3U66A 2PM7A 3TG4A 4X4GA 2H8RA 2J4DA 1B89A 2IU7A 2WB2A 3JCKC 1RZRD 2NSZA 5JJ7A 4C0EA 3CVXA 2CROA 2L8NA 5FQ6A 2DBAA 4GMJA 3EHMA 1A17A 1FVFA 1WY6A 5FZRA 4ANWA 1UJJA 3L17A 4XE0A 2D5VA 4Q96A 4PS3A 5LCWC 3G2UA 4X4HA 2O49A 2C2LA 2R59A 3G2WA 5AYWD 4BT8A 2YINA 5FT9A 2VGYA 2GRMA 5BV1A 3BG1B 5HQ8A 2E2EA 2AXUA 3LEWA 5BW8C 4FLHA 4URKA 2WPVA 1RZRA 3FEXA 3CVLA 3MYVA 4KMOA 2ONDA 4X4IA 1UN8A 3ZKCA 1DVPA 1N54A 3MX3A 1ZVVA 1KLXA 4I1AA 3S7JA 2OR1L 4CCAA 4Z58A 5JHBA 3R9AB 3CQGB 3MKRA 1XGWA 2WMOA 1PERL 1Z6TA 3CSFA 3LPZA 3ZVVA 3OXGA 3I4GA 4Z5HA 4WWOA 3QQ6A 3CHQA 2A5UA 1NEQA 2WXKA 3QB2A 4KT6B 4KZ0A 5ARGA 5FWQA 5BV0A 2J08A 4X4BA 4I6UA 4CDMA 2AWIA 4JA7A 1NA0A 4OB4A 1WM5A 2GRLA 1UTXA 1VPWA 1NZNA 3ZYKA 3FUEA 1E7UA 2KC7A 4WNGA 4FP7A 2WXLA 4GMLA 1OWNA 4A3VA 1TJFA 2R5SA 4LEUA 3L16A 2FULA 3LY8A 3MLFA 4BT9A 1E3OC 3LY9A 1GW6A 3FEYA 2LAIA 5D0QD 2FJRA 4L2LA 4JW1A 4I6EA 4FA6A 3UPVA 2J49A 2WXFA 2I9CA 1KT0A 2X6JA 4XKCA 2V4LA 2XHEA 3IV0A 5A6CA 4CT0A 2NC9A 2HO1A 4MCXA 1JFSA 4FJYA 4U07A 4YVOA 3ZHMA 3P2BA 4U04A 1RIOA 4JQDA 2HYZA 2WM9A 3D9NA 4I6GA 3RJVA 1EYHA 1PAQA 1PRVA 2C0LA 2I6HA 1ZBPA 4XKBA 5KJKA 3UX4A 3K9IA 1SQMA 3B13A 3R7QA 4B0ZA 4CGVA 2C0MA 3CR3A 2GW1A 3CLJA 2VSNA 2XCCA 3B7TA 3ONKA 4MRUA 3FU3A 1OSLA 3TG5A 4BTBA 4C0MA 4EPZA 3ZHEA 1H2UA 2HINA 2PUEA 2PUCA 2PUAA 1UN9A 4I17A 4RVBA 5G04C 1OWMA 2I1KA 3JUIA 4IRUA 4WUYA 3KEZA 4X4FA 1HO8A 1X2LA 4YBAA 3ZHIA 4JHRA 3VK0A 3JQ1A 4KBQA 4O6FA 4Y42A 3IVPA 3CSTA 3PUJA 1HXIA 4G2VA 5BUZA 3FTUA 4J6IA 2R1JL 4C9BB 3NF1A 2MQKA 1DW9A 1E8YA 3L54A 3SZ7A 2WXGA 4HOSA 4X4DA 3FH7A 2XIUA 3CVQA 4NACA 3SCFA 3AU5A 3CEQA 4PH4B 4HXIA 4PDXA 2P58C 4F1SA 1O4XA 4NDWA 3FUHA 3LVQE 5G05C 4I43A 3JXCL 3KD7A 4HORA 3MV2B 4KVOA 3OQOA 4I8TA 3S7DA 1H2VC 3UFDA 4R7LA 2L0IA 2YNQA 2ZU6B 3QJZA 3IKOB 2LYJA 3Q15A 1E96B 1OCTC 1SZAA 2WQ7A 3VTXA 4GCNA 2X6IA 1ZZBA 2CFZA 2XGOA 4WNFA 1FVHA 2XCBA 1ADRA 3D9MA 4G1TA 5A7DB 2FF4A 1DNPA 4ILGA 3QK0A 1MQSA 4J0UA 3FUNA 5FTPA 4AEZC 1FCHA 1ZAYA 4GPKA 3OQMA 3QWGA 2PUBA 3LS8A 2WXRA 2KEKA 4MS6A 4N39A 4EBAA 3ULQA 3AS8A 4AVXA 2WXIA 3CQCB 4Z5CA 2KEJA 2MOWA 3BEEA 3D9OA 4I6JA 2L49A 2JVLA 3CHOA 4FHJA 5JJ6A 3EHNA 4GQMA 4CT4A 5CCLA 1L5JA 2V5FA 3PXPA 1H19A 2R17C 4IULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPJ A;  2XJ3 A;  1BDI A;  1LLI A;  4X4H A;  1IC8 A;  3CRO L;  2O49 A;  1UXC A;  1B0N A;  2IVQ A;  4X4C A;  2GRM A;  1SQ8 A;  4Z59 A;  4YG1 A;  2AXU A;  4IA8 A;  2LYK A;  3L1P A;  4GHJ A;  3OMT A;  4I6R A;  1RZR A;  2XSD C;  4X4I A;  1UXD A;  3ZKC A;  1CJG A;  2MEZ A;  1ZVV A;  1RPE L;  2OR1 L;  4X4E A;  4Z58 A;  1ZZC A;  1S7E A;  1ZZ7 A;  2BNN A;  1PER L;  2EBY A;  3GN5 B;  2LYR A;  4Z5H A;  2AXZ A;  1NER A;  4Z5D A;  3QQ6 A;  4FN3 A;  4I6T A;  2LYL A;  3GBF A;  1JWL A;  1NEQ A;  3O9X A;  4F8D A;  1CQT A;  2B5A A;  4X4B A;  4I6U A;  2AWI A;  3HZI B;  2IVG A;  4OB4 A;  1PRA A;  1LQC A;  3F51 A;  1PRU A;  1UTX A;  2GRL A;  3QF3 A;  3OQN A;  1VPW A;  3G7D A;  2PUD A;  1POU A;  3RZZ A;  1PNR A;  3G5G A;  3F6W A;  2AW6 A;  1QPZ A;  3JXD L;  3MLF A;  1Y9Q A;  2EF8 A;  1E3O C;  4J1W A;  3H5T A;  2FJR A;  4JCY A;  3EUS A;  1X57 A;  1ZPQ A;  4YG4 A;  3CLC A;  2KEI A;  3KJX A;  4PU3 C;  5K98 B;  3KXA A;  3LIS A;  2ICT A;  3BD1 A;  4YG7 B;  1QP7 A;  4MCX A;  1JFS A;  2BNO A;  3ZHM A;  1ZS4 A;  2WUS R;  2AXV A;  4JQD A;  1AU7 A;  1RZS A;  1PRV A;  2WIU B;  3KZ3 A;  1L1M A;  1HF0 A;  3CEC A;  2OFY A;  2IV1 A;  2O4A A;  2IUO A;  3QYX A;  2LYS A;  3SCH A;  1OSL A;  3PXP A;  3R1F A;  1LCC A;  2HIN A;  1WIZ A;  2HSG A;  2BJC A;  1WET A;  2PUA A;  2PUC A;  2PUE A;  2PUG A;  2IVB A;  4X4F A;  2KZ8 A;  1X2L A;  4YBA A;  3ZHI A;  3VK0 A;  3U3W A;  1XWR A;  3IVP A;  4Y42 A;  3BDN A;  3S8Q A;  4IWR A;  2R1J L;  1JFT A;  2MQK A;  1DW9 A;  1BDH A;  2XCJ A;  2PPX A;  2GZU A;  1QP4 A;  4PU4 C;  4MCT A;  4X4D A;  2XIU A;  1YSE A;  3SCF A;  5A7L A;  3FYA A;  1O4X A;  2R63 A;  4NDW A;  1LCD A;  2CSF A;  3JXC L;  2LCV A;  1R63 A;  3B7H A;  4IVZ A;  3OQO A;  2AUW A;  4J1X A;  3D1N I;  4I8T A;  3UFD A;  1ZZ8 A;  3OP9 A;  1ZUG A;  2LYJ A;  3JXB C;  1GT0 C;  1DWK A;  1OCT C;  1Y7Y A;  3F52 A;  2BNM A;  1JH9 A;  4YAR A;  1ZZB A;  3SCG A;  2LYP A;  3GN5 A;  3FYM A;  1QQA A;  1ADR A;  3TRB A;  1EFA A;  3FMY A;  1ZZ9 A;  3LFP A;  2XI8 A;  4O8B A;  3DNV B;  3BS3 A;  3OQM A;  1ZAY A;  2ICP A;  1ZZ6 A;  2O38 A;  3QWG A;  2PUB A;  4FBI A;  1R69 A;  2KEK A;  1LMB 3;  1QP0 A;  2A6C A;  4X4G A;  2PE5 A;  2H8R A;  2IU7 A;  1WH8 A;  4Z5C A;  2KEJ A;  1RZR D;  1QQB A;  2PUF A;  2L49 A;  2CRO A;  2LYQ A;  2JVL A;  2EWT A;  2JCG A;  2L8N A;  4GQM A;  4PU8 A;  1WH6 A;  4PU7 A;  1RIO A;  2PIJ A;  2D5V A;  4JCX A; 
#chains in the Genus database with same CATH topology
 5FJY A;  5KJL A;  3PEV B;  3TGO A;  4G23 A;  2P9K G;  5KNH D;  3HG0 D;  4I6R A;  2F37 A;  4JHK A;  3KEA A;  3S2A A;  1UW4 B;  2ION A;  2F8X K;  2KBX A;  3QC1 A;  2BF0 X;  1LD8 A;  3LXU X;  3D9P A;  2J7U A;  5E75 A;  3O48 A;  4WVL A;  3HZI B;  4YND A;  3ZYQ A;  2OEW A;  1TJC A;  1QPZ A;  5ENN A;  2EF8 A;  5FQ4 A;  3RO2 A;  5B1A E;  3BU8 A;  4PU3 C;  3PE3 A;  2VJ8 A;  2GRP B;  4RLY A;  3L08 A;  2PM6 A;  3UQ3 A;  2QYJ A;  4O1P A;  4F6R D;  4JEH A;  3APF A;  3Q9U C;  1HG2 A;  4GZC A;  1OUV A;  4HQD A;  1WIZ A;  2WQ6 A;  3MJW A;  4JHJ A;  2RD0 A;  3BDN A;  3ME5 A;  3MEK A;  5LX8 A;  5HI7 A;  5GAG i;  3HXF A;  4EEC A;  4JXT A;  4NIK A;  4JB8 P;  1YCS B;  3AAA C;  2XQ0 A;  3KSQ A;  3JXB C;  1PY1 A;  3NOG D;  1N0Q A;  1MZC A;  3W9F A;  3QWV A;  2L6J A;  2FEZ A;  2RG8 A;  3ZPJ A;  3Q73 A;  2ICP A;  3GZS A;  4GB9 A;  3SHF A;  2FFH A;  2ZIR A;  3MZL B;  4HOT A;  3FY4 A;  3FU5 A;  2B6C A;  2IOL A;  1H2T C;  1N4S A;  2NXP A;  2PIJ A;  3ASH A;  5EX3 A;  3GYZ A;  1SQ8 A;  3EIJ A;  3S7B A;  1JWF A;  2PQN A;  4I1O B;  5C1D A;  1DCE A;  4XIF A;  1TN7 A;  2PXU A;  3HXC A;  4G8K A;  5AEN A;  5JUW A;  4CYM D;  4GMR A;  1OY3 D;  1JWL A;  3TWU A;  5LOZ A;  3SFZ A;  3D3M A;  4FUL A;  3UT4 A;  1N94 A;  2GRN B;  2WVI A;  4UI9 C;  4JPS A;  3FH8 A;  4GYW A;  4GZD A;  3CHR A;  3LIS A;  4EZL A;  2HM8 A;  1JWG A;  3PDN A;  4BTA A;  3DST A;  2O4A A;  2LYS A;  4XZ4 A;  5EX0 A;  1EF1 C;  3U3W A;  2I2O A;  1MHQ A;  3DPY A;  3ZHE B;  3EHQ A;  3PE4 A;  1XNF A;  3AS4 A;  4GTV A;  4XX5 A;  5JMN D;  1DWK A;  3UXG A;  4GTO A;  1JH9 A;  4YAR A;  2PXB A;  3NBN B;  3SNX A;  3JQ0 A;  4ANV A;  1IYG A;  3FMY A;  2WXM A;  3RSE G;  2I1J A;  4LNB A;  2O38 A;  1ZZ6 A;  1QP0 A;  3ISM C;  5CCM A;  4U8H A;  1QBQ A;  3JUE A;  5FQ7 A;  3KSL A;  3NQP A;  3SGH A;  4PUC A;  4F3V A;  4IYP A;  4GZ6 A;  3SBT B;  4WAF A;  3LYA A;  1H0A A;  1DCQ A;  1INZ A;  3CVU A;  5CMW A;  3R9M A;  3OMT A;  4B94 A;  4HLE A;  4E85 A;  4QQI A;  4EZI A;  2HCN A;  4FHK A;  1S64 A;  3DEO A;  1S7E A;  3FTV A;  2AXZ A;  4DX7 D;  3L22 A;  2LYL A;  3AG3 E;  3APD A;  3G2S A;  3QNK A;  3QWP A;  4OAU C;  3TWX A;  3T8K A;  3OQN A;  4HVB A;  4LNG A;  4WND A;  4UI9 J;  4U95 D;  5G55 A;  4C48 B;  1ZPQ A;  1QB2 A;  4DI4 A;  3QAQ A;  3CK8 A;  4BWR A;  3N71 A;  3V30 A;  5GAH i;  4OVU A;  3FTW A;  1JUQ A;  4LUN U;  3KS2 A;  4DX2 A;  2Y3A A;  4B89 A;  2CFU A;  3SCH A;  2KM4 A;  3MEJ A;  3G0T A;  4LER A;  4N2S A;  3BUA A;  1Z3X A;  4E6H A;  3CVY A;  2VSY A;  2Y4T A;  3PZ2 A;  2OVF A;  2EQX A;  2AUW A;  2CHZ A;  4O1O A;  3FTX A;  1MX6 A;  4ER0 A;  3CK9 A;  4HRN A;  3L82 A;  1DUL A;  2FBN A;  4GA2 A;  1ELW A;  2WXJ A;  3MCX A;  3NOC D;  4UWF A;  1EFA A;  5C2Y A;  2XI8 A;  1HE8 A;  4MKT A;  1R69 A;  1HH8 A;  4JC8 A;  3U66 A;  2ETC A;  4BSZ B;  2H8R A;  1IKN D;  1B89 A;  2WB2 A;  5CRU A;  5JJ7 A;  3Q7F A;  5CBN A;  2L8N A;  3TWQ A;  4Q96 A;  5CBO A;  5FT9 A;  2P9S G;  2AXU A;  4KMO A;  1KLX A;  1N9A A;  4CCA A;  3MKR A;  2F8Y A;  1PER L;  3LPZ A;  3I4G A;  5HS0 A;  3CHQ A;  5FWQ A;  4KZ0 A;  4I6U A;  4GTM A;  1UTX A;  2KC7 A;  1TJF A;  3RAU A;  3ASO E;  4BT9 A;  2FJR A;  4ZFH A;  2PXV A;  2WXF A;  2V4L A;  2IO3 C;  5A6C A;  4FJY A;  3D9N A;  4DX5 D;  2C0L A;  1K3Z D;  3B13 A;  4CGV A;  3C3R A;  2GW1 A;  3CLJ A;  2XCC A;  4MRU A;  3FU3 A;  2HIN A;  5G04 C;  1OWM A;  2I1K A;  4WUY A;  1HO8 A;  3ZHI A;  4HOS A;  2MQK A;  1E8Y A;  2WXG A;  4X4D A;  3CVQ A;  4PH4 B;  4HXI A;  2ETB A;  5DT2 A;  2BED A;  3TWR A;  4NDW A;  5G05 C;  5ENT D;  3MV2 B;  4YDO A;  1TR4 A;  1SZA A;  2X6I A;  2XGO A;  1FVH A;  1ADR A;  4YDE A;  1DNP A;  1SA5 A;  1MQS A;  1BI7 B;  3QWG A;  2PUB A;  2LNM A;  4BET A;  2MYO A;  3EHN A;  2HFZ A;  3E30 A;  3PXP A;  1LLI A;  4DE9 A;  1IC8 A;  5CEC B;  4AXH A;  3T8M A;  3UTM A;  5FZS A;  4B8A A;  2YBD A;  4NUR A;  2KZT B;  1U3C A;  3ML8 A;  2VYI A;  1ZZC A;  1IHB A;  3HIZ A;  3LJ3 A;  3FTS A;  3HYM B;  4Z5D A;  4I6T A;  4DI3 A;  3AG4 E;  3PRZ A;  4DLO A;  2QFC A;  2OV8 A;  1EDU A;  5JJT A;  2KXP C;  3F6W A;  4MBG A;  3ZRH A;  4NQ0 A;  2CG3 A;  3ENE A;  4B8C B;  5T8I A;  3BG0 B;  4Q94 A;  4G11 A;  4UWK A;  1TN6 A;  2WUS R;  3UWP A;  1HF0 A;  2OFY A;  2IV1 A;  2WXO A;  3DRA A;  4GYY A;  3SX0 A;  3SFX A;  4J8D A;  2FO7 A;  1BDH A;  2XCJ A;  1D9S A;  4PU4 C;  1N95 A;  4AIF A;  5G05 J;  4FC8 A;  1QQE A;  2PL2 A;  3A9Y A;  4KYO B;  3FP3 A;  1OCO E;  4DK5 A;  3NZL A;  1IQR A;  3T9K A;  4HNA D;  3R7R A;  2WXP A;  3LFP A;  3ZEF A;  4HBD A;  1H6P A;  4TV3 A;  2H6I A;  3G2T A;  2GGF A;  3D9L A;  5ENO D;  3SR4 A;  3L1P A;  4I9E A;  4HOU A;  5AAO A;  2P2C P;  3OXF A;  4EZJ A;  4BX9 A;  1B0N A;  2PXE A;  3AJI A;  4YG1 A;  3T5X A;  4FJZ A;  4L23 A;  2H6F A;  2Y4U A;  2IFU A;  3C3Q A;  5DRY A;  2MEZ A;  3I5P A;  4TUU A;  3CHM A;  4GTP A;  2LYR A;  4PS7 A;  1KPS B;  3ZIM A;  3GBF A;  4F8D A;  3PS6 A;  3GZ2 A;  4F1P A;  1FPP A;  4CRW A;  5J08 A;  2PZI A;  4L7T A;  2LXM A;  2PUD A;  4JZY A;  1NI1 A;  3APC A;  5DTR A;  3CLC A;  1KT1 A;  5EN5 D;  1MX2 A;  3Q78 A;  1BLX B;  3KZ3 A;  4OAV B;  4LSZ E;  1ELK A;  3UT8 A;  2FO1 E;  5AIJ A;  3PNL B;  3I3N A;  2IOS A;  3C98 A;  3J5P A;  4CGW A;  3I4R B;  3JXJ A;  4U8V D;  3V31 A;  3L9T A;  1ZU2 A;  3TXM A;  2QZA A;  5A23 A;  3ZGQ A;  2X6H A;  3ZN3 A;  3FYA A;  3FUD A;  5KJN A;  1Z5S C;  2LCV A;  2ODR D;  2PXP A;  5EDS A;  4AM9 A;  3OP9 A;  3Q47 B;  2Y1L E;  4JL0 A;  4HRL A;  2DVW A;  4JD2 G;  4L2Y A;  3BS3 A;  2A4Z A;  2A6C A;  2MXD A;  3OAW A;  4JA9 A;  4A55 A;  5ENR D;  3LY7 A;  2XGS A;  3E4B A;  2JCG A;  1EPU A;  2WXN A;  1OWP A;  3RIB A;  4P29 A;  1SZ9 A;  2J07 A;  5FQ8 A;  3OWQ A;  2KCL A;  2J4B A;  3DBS A;  3CVV A;  3NZS A;  2DCP A;  1Y8M A;  2XSD C;  5LFA A;  2EIM E;  4UQZ A;  4WWP A;  5FIN A;  2DYR E;  3O4Z A;  1HX8 A;  4N3C A;  1NER A;  2X6F A;  2LSV A;  4YVQ C;  3FU6 A;  3ASG A;  5AJD A;  2DIW A;  4FU3 A;  2ZGD A;  2GRQ B;  1HQ1 A;  3CVP A;  1X81 A;  3UMV A;  1W3B A;  1POU A;  3WG7 E;  4GU5 A;  2GRR B;  4U0S A;  3PZ4 A;  3OTN A;  3KXA A;  5BNW A;  4YG7 B;  3NAW A;  2JQE A;  2J7W A;  4KZC A;  2R05 A;  2WIU B;  3CEC A;  3GZ1 A;  1YA0 A;  3ABK E;  4J8S A;  2BJC A;  4L9P A;  2XZT G;  2RKK A;  3VLD A;  3B7S A;  1IXV A;  3S8Q A;  4IWR A;  1V55 E;  2E0I A;  4G26 A;  5A7L A;  4GZ5 A;  4TXP A;  2JLB A;  3FUL A;  3FUM A;  3ASN E;  1R63 A;  3TWT A;  3E37 A;  1O1R A;  2V5Q C;  3DSV A;  1Y7Y A;  3PH0 C;  1TNB A;  3FFL A;  1K1A A;  3C5R A;  4AP2 A;  1S0P A;  1HZ4 A;  1H6K A;  4N3B A;  3IBE A;  3EHR A;  3UI2 A;  3J5Q B;  4HLL A;  2UWJ G;  3Q5M A;  4X4G A;  1OCR E;  2IU7 A;  3JCK C;  4BER A;  3ZNG A;  4GMJ A;  2XZD G;  4ANW A;  1UJJ A;  3L17 A;  4XE0 A;  5BXU A;  5LCW C;  3G2W A;  3B7B A;  4BT8 A;  2R59 A;  4K5C A;  5BV1 A;  5BW8 C;  4FLH A;  2P9L G;  3DWL G;  2J8S D;  5B1B E;  1UN8 A;  1N54 A;  1DVP A;  3MX3 A;  1ZVV A;  3S7J A;  2OR1 L;  3CQG B;  1Z6T A;  3ZVV A;  4YDY A;  4EHM A;  2A5U A;  2WXK A;  1S63 A;  1NA0 A;  4OB4 A;  1D8E A;  2OEV A;  2WXL A;  4LEU A;  3L16 A;  3LY8 A;  3MLF A;  1N4Q A;  1GW6 A;  3QFI A;  4JW1 A;  3UPV A;  3ULE G;  3UIO C;  2I9C A;  4CT0 A;  1JFS A;  4Q2J A;  3ZHM A;  3P2B A;  1PAQ A;  1PRV A;  5KJK A;  4XKB A;  3UX4 A;  3K9I A;  3VWS A;  2C0M A;  2VSN A;  3ONK A;  3KL4 A;  1OSL A;  3X2Q E;  2PUE A;  1H2U A;  2PUA A;  3JUI A;  4O6F A;  4KBQ A;  1X2L A;  4YBA A;  5BUZ A;  3PUJ A;  4J6I A;  4C9B B;  2R1J L;  3L54 A;  3FH7 A;  2XIU A;  3CEQ A;  5DTQ A;  4PDX A;  1N11 A;  4I43 A;  3KD7 A;  2R03 A;  3S7D A;  1H2V C;  3QJZ A;  3BQO A;  1OCT C;  5EYL A;  4B93 B;  1OXJ A;  4AEZ C;  1FCH A;  2WXR A;  2KEK A;  4N39 A;  2WXI A;  2KEJ A;  3D9O A;  4I6J A;  3BEE A;  5JA4 D;  5AQB A;  2L49 A;  2JVL A;  3CHO A;  5JJ6 A;  2PXD A;  2R17 C;  4GPM A;  3ONL A;  3E33 A;  2XEH A;  5LCW J;  2WXQ A;  4GTQ A;  3V79 K;  5E76 A;  1KZP A;  4OYS A;  5CEA A;  2LYK A;  2OOE A;  2A5E A;  4FLB A;  2EIJ E;  4OVV A;  3IHV A;  3UKR G;  3ML9 A;  4L1B A;  3GN5 B;  1TNY A;  3ZYM A;  1OCZ E;  2MRI A;  1IHG A;  3RU0 A;  4EQF A;  2DWZ A;  2JAB A;  3D9H A;  2IEJ A;  3Q49 B;  3ZUV B;  3FTZ A;  3ABL E;  2VQ2 A;  1PRA A;  4Q69 A;  4RG6 A;  4D10 C;  4EBA G;  1Y9Q A;  5T4Y A;  3ZFW A;  2F0Y A;  4QFV A;  3H5T A;  3MKQ A;  5K98 B;  4ANU A;  2ICT A;  1QP7 A;  4W9R A;  4DJA A;  1L1M A;  3LJN A;  2LNI A;  4G8L A;  2VSO E;  5M72 A;  3D9J A;  3CIA A;  4JVS A;  4UWH A;  2HR2 A;  3HRA A;  2VTB B;  1BD8 A;  4ZHB A;  1D8D A;  1XWR A;  2XPY A;  3DSS A;  3TJP A;  2PPX A;  2LSU A;  3DSW A;  1LCD A;  2CSF A;  4WWN A;  3B7H A;  1FT1 A;  5BXO A;  3LQX A;  2KZT A;  3D1N I;  3TWW A;  3D9I A;  3HVE A;  1ZZ8 A;  3DM5 A;  1QNF A;  2YHE A;  3SFY A;  3DPD A;  3F52 A;  3IXE A;  2X38 A;  1TNU A;  3CVW A;  4UWG A;  3AS5 A;  3FUJ A;  4N3A A;  1YMP A;  1P5Q A;  4FBI A;  1U3D A;  2V3C C;  2XXA A;  4LG6 A;  1ELR A;  2XS8 A;  3TEP A;  2YHC A;  2KPJ A;  3RRM B;  2Q7F A;  5ITZ F;  2H6H A;  3GZC A;  4IA8 A;  4JEU A;  1N0R A;  1JCQ A;  3B95 A;  4EK9 A;  1E7V A;  2H6G A;  2EIK E;  2EBY A;  4BES A;  4ILH B;  2VGX B;  2M4H A;  4FN3 A;  2IY0 C;  2HE0 A;  3Q7A A;  2B5A A;  1LQC A;  3UM0 A;  1PRU A;  4K5A B;  3CKB A;  4DE8 A;  2XPI A;  3ZU7 B;  3EDT B;  2KCV A;  4J1W A;  3TWS A;  1X57 A;  4PS8 A;  2KEI A;  3ESK A;  5FZQ A;  5J90 A;  3SD5 A;  3QDN A;  1OWL A;  2BNO A;  2ZIS A;  2WXH A;  1RZS A;  4NRH B;  2LUH A;  3FUK A;  2IUO A;  3FDH A;  3VLF A;  4AJW A;  2QYU A;  3CHP A;  3ZXS A;  3SO8 A;  1UG3 A;  2KZ8 A;  3LKU A;  4UWL A;  5ARF A;  3V2O A;  2Y69 E;  2XEV A;  1HS6 A;  4MCT A;  1YSE A;  2ILR A;  2PXT A;  4IVZ A;  3L13 A;  5AN8 A;  3ASF A;  3PRE A;  5ENP D;  1GT0 C;  1QZ2 A;  1KZO A;  5AQ9 A;  4N2Q A;  2XEN A;  3UM3 A;  3SCG A;  4CDR A;  2P9U G;  3FYM A;  5G04 J;  3B7U X;  4HI8 A;  3CHS A;  4ER6 A;  4GAA A;  3DNV B;  3URZ A;  1HFA A;  2V8S E;  5EIB E;  3TL5 A;  2UY1 B;  3G2V A;  2WMN A;  1WH8 A;  1HU3 A;  3TFL A;  3FUI A;  4F53 A;  3RRN B;  3CGH A;  2YQ8 A;  4BY6 A;  4JCX A;  4HS2 A;  1BDI A;  4XI0 A;  4CEM A;  1BPO A;  2VEO A;  4AY6 A;  4X4C A;  3SI5 A;  3DSX A;  2L1P A;  1CJG A;  5JHA A;  3VLE A;  1RPE L;  4XI9 A;  2OVB A;  3FUF A;  2P9N G;  1ZZ7 A;  3NB2 A;  2BNN A;  5D0O D;  1NL4 A;  4N5C A;  3ABM E;  2LXL A;  1NP7 A;  4GYO A;  3ESL A;  3F51 A;  3QF3 A;  5DIZ A;  2XXP A;  2AW6 A;  2JEK A;  3C72 A;  2V0P A;  4I9C A;  4YG4 A;  1HF8 A;  5DTM A;  1QYM A;  3QOW A;  1AU7 A;  4BX8 A;  4MLP A;  4I1M A;  2LLV A;  2VSX E;  5B3S E;  1IQU A;  3DXK G;  3MV3 B;  1HG5 A;  3F6Q A;  4LCT A;  5ENS D;  1WDY A;  2KCK A;  3L6A A;  5DBK A;  1QP4 A;  3U64 A;  2LAH A;  4BFR A;  2CHW A;  5BT1 A;  3NXH A;  4UQY A;  1E8W A;  1WAO 1;  5ANR A;  4GTT A;  1VDY A;  1ZB1 A;  4EKG A;  3OXL A;  3JXI A;  4GCO A;  3ZW3 A;  4H7X A;  4J8E A;  2RFM A;  1NW3 A;  3TG4 A;  1RZR D;  4C0E A;  2CRO A;  3EHM A;  1A17 A;  1FVF A;  5FZR A;  2D5V A;  3G2U A;  2O49 A;  3ZXP A;  1NFI E;  5AYW D;  1O5M A;  2VGY A;  3BG1 B;  5HQ8 A;  2E2E A;  2WPV A;  1RZR A;  3FEX A;  3CVL A;  3MYV A;  4M7C A;  2OND A;  4X4I A;  3ZKC A;  4TXR A;  1UOH A;  4Z58 A;  1XGW A;  2WMO A;  3CSF A;  4WWO A;  4Z5H A;  1MYO A;  3QQ6 A;  5ARG A;  1NEQ A;  4KT6 B;  2J08 A;  2AWI A;  4JA7 A;  2R2L A;  1WM5 A;  1NZN A;  4N5Q A;  3ZYK A;  3FUE A;  1E7U A;  4A3V A;  4FP7 A;  2R5S A;  2BKG A;  5D0Q D;  3FEY A;  4L2L A;  5AQA A;  4XKC A;  2XHE A;  3IV0 A;  2NC9 A;  2HO1 A;  2XEE A;  4U07 A;  4JQD A;  2HYZ A;  1ZBP A;  1SQM A;  2EIN E;  2ZXW E;  4EPZ A;  3ZHE A;  1UN9 A;  4I17 A;  1WG0 A;  4X4F A;  4K5B A;  3VK0 A;  3JQ1 A;  3IVP A;  5EID A;  3V2X A;  1DW9 A;  3SCF A;  3AU5 A;  1O4X A;  3FUH A;  3JXC L;  4HOR A;  4ATZ D;  3OQO A;  4UUC A;  4I8T A;  4RQI A;  1V54 E;  4R7L A;  2AJA A;  2WQ7 A;  4GCN A;  1ZZB A;  2CFZ A;  1TN8 A;  4WNF A;  4CZ2 D;  1U2Z A;  2XCB A;  4G1T A;  2IO2 C;  2FF4 A;  4J0U A;  4ILG A;  3QK0 A;  4ER7 A;  2QC9 A;  5EIL A;  3NDB B;  4MS6 A;  3Q9N C;  3CQC B;  2DZN A;  4GQM A;  4YDW A;  2J09 A;  1H19 A;  3PZ3 A;  4IUL A;  3T5V A;  3RK6 A;  2X3M A;  3UUX A;  2WQH A;  3SF4 A;  2IVQ A;  4ATG A;  1H6O A;  1SVX A;  3UM2 A;  4U0Z A;  1LF8 A;  1SA4 A;  4ANX A;  1FT2 A;  4CDN A;  1MFQ C;  2V4H C;  2QY7 A;  3MGB A;  3EU9 A;  1TEZ A;  3RKV A;  4TUM A;  3DXM G;  3HXE A;  2M63 A;  4IN3 B;  4HRA A;  3M9L A;  2LO6 A;  3P1U A;  2IVG A;  3ZKJ A;  3SBS A;  1JCR A;  3ZYL A;  1E8Z A;  3RZZ A;  3G5G A;  3PUK A;  4JCY A;  3U4T A;  3EUS A;  1K8K G;  3KJX A;  4AY5 A;  3LDZ A;  2LLW A;  1E90 A;  3U9W A;  4XEI G;  1DC2 A;  2FI7 A;  2AXV A;  2XRY A;  3ASD A;  2ETA A;  2PXL A;  3S7F A;  5EKQ D;  4LNU D;  1TNZ A;  3FHE A;  3QYX A;  4M3O A;  3EIQ C;  3UT7 A;  2L9B A;  3WXX A;  5AJL A;  2HSG A;  1Y6I A;  4U0U A;  2IVB A;  4ER5 A;  4DPR A;  2GZU A;  4AV7 A;  3UIP C;  2AVP A;  4U8Y D;  2IQC A;  3NZU A;  4APO A;  1K1B A;  2XRZ A;  5DRT A;  4K03 A;  3AU4 A;  3EUV A;  4A63 B;  5BPP A;  1PC2 A;  3RO3 A;  4GZ3 A;  2LYP A;  3GN5 A;  3ULY A;  3VTY A;  5IY5 E;  4AOF A;  1ZZ9 A;  4F7A A;  2ZGG A;  5CMY A;  3GZD A;  1LMB 3;  2J9Q A;  2PE5 A;  4I2Z A;  2HCS A;  1QQB A;  3KAE A;  2LYQ A;  2EWT A;  4EQZ A;  2RFA A;  3D9K A;  1WH6 A;  1N4R A;  2XJ3 A;  3CRO L;  3UIN C;  1X5B A;  4DUI A;  4Z59 A;  3QOU A;  5HKP A;  4GHJ A;  4ACK A;  2XGM A;  1NA3 A;  1UXD A;  3CK7 A;  4GA0 A;  3LVR E;  2BTD A;  3CV0 A;  3QKY A;  4GTR A;  1O1S A;  5G2N A;  4Z68 A;  2CG2 A;  2VTB A;  2DZO A;  1CQT A;  2L0T B;  2KAT A;  4WNE A;  1O1T A;  3JYS A;  3GUU A;  4FAD A;  4UI9 K;  1PNR A;  3NRO A;  3PNT B;  1OWO A;  3PEU B;  4LRZ A;  3BD1 A;  4ER3 A;  5ANL A;  2P9P G;  1ZS4 A;  3A9Z A;  3TEL A;  2X6K A;  2PNN A;  3MA5 A;  1MX4 A;  1WET A;  4OBM A;  4I2W A;  1MJ0 A;  5HRY A;  1JFT A;  2VGE A;  5FIO A;  3RRU A;  3ZPX A;  5CHE E;  2R63 A;  5AQ7 A;  4HFG A;  4BEP A;  2IU1 A;  5ENQ D;  4DLQ A;  4G24 A;  5KJM A;  2Y0B G;  4ACL A;  1LD7 A;  2BNM A;  1E8X A;  2IJG X;  3CVN A;  3FTY A;  1QQA A;  2NYJ A;  3TRB A;  2VGX A;  5AAR A;  3DEP A;  1N52 A;  1U2V G;  4O8B A;  4J8F A;  3SY2 A;  3QAR A;  3IEG A;  4ME2 A;  4GA1 A;  3TWV A;  2PUF A;  4DX6 D;  1YYH A;  3HDX A;  4PU8 A;  4RG9 A;  4U96 D;  1RW2 A;  4KVM A;  4PU7 A;  1A5E A;  4G25 A;  1UXC A;  4ABN A;  3HHM A;  3CKC A;  3B7R L;  1Z3Y A;  3QWW A;  3PE5 A;  5CRV A;  2P9I G;  2IF4 A;  4HOQ A;  3EJN A;  4X4E A;  3FH5 A;  5KCM A;  3PVL A;  3O9X A;  2CHX A;  2DYS E;  3PZ1 A;  4A1G A;  3G7D A;  3HXB A;  2GRO B;  3DSU A;  2OCC E;  3JXD L;  3Q4A B;  3AG2 E;  4U63 A;  1QZX A;  4EZK A;  1JPL A;  2PXQ A;  4H7Y A;  4Y6W A;  5T3R A;  2XS1 A;  3UKU G;  4UQX A;  3MKQ B;  3TXN A;  1TNO A;  2BUG A;  4K0R A;  2XPZ A;  3W9G A;  3TAX A;  3R1F A;  1LCC A;  2UY1 A;  2PUG A;  3LCA A;  5H7P A;  4ILI A;  1TYQ G;  4DRX E;  3FWV A;  4U7E B;  5LP0 A;  3C3O A;  2PQR A;  5D66 A;  4Y6C A;  4BSX A;  4RSY A;  4J1X A;  3IHY A;  4TRQ A;  4APF A;  4A1S A;  2BKK B;  1ZUG A;  4V3I A;  2R02 A;  3FU0 A;  3A9X A;  3PZD A;  4TXQ A;  4A3T A;  4GTS A;  4KXK B;  3HVE B;  3GW4 A;  5KNG A;  1UJK A;  2MHK A;  2PM7 A;  5KWD A;  2J4D A;  5CER B;  1Q2Z A;  2NSZ A;  1S70 B;  3CVX A;  5FQ6 A;  2DBA A;  1WY6 A;  3Q75 A;  5KBA A;  3GZD C;  2PXK A;  4PS3 A;  5DSX A;  4X4H A;  2C2L A;  2YIN A;  4J7W A;  2GRM A;  3LEW A;  4O60 A;  4URK A;  3Q79 A;  1OT8 A;  2B0O E;  2L6B A;  4I1A A;  1AWC B;  3UM1 A;  5JHB A;  3R9A B;  3OXG A;  3QB2 A;  3HXD A;  5BV0 A;  3E34 A;  4X4B A;  3OKZ A;  4CDM A;  1OCC E;  4X8Q A;  2GRL A;  3QOX A;  1VPW A;  1RZ4 A;  3E32 A;  1G3N B;  4WNG A;  4GML A;  1OWN A;  4HI9 A;  2FUL A;  1E3O C;  3LY9 A;  2LAI A;  4I6E A;  4FA6 A;  5D2M C;  2J49 A;  2X6J A;  1KT0 A;  3SQV A;  5EYP F;  4MCX A;  4YVO A;  3AG1 E;  4U04 A;  2WM9 A;  4I6G A;  3RJV A;  1AP7 A;  1EYH A;  2I6H A;  2PXF A;  2XXQ A;  3R7Q A;  4B0Z A;  3CR3 A;  3TG5 A;  3B7T A;  4BTB A;  4C0M A;  4RVB A;  4J8Y A;  2PUC A;  3R09 A;  4DX1 A;  4IRU A;  1SW6 A;  3KEZ A;  4JHR A;  4Y42 A;  3CST A;  4G2V A;  1HXI A;  3FTU A;  5CED B;  3NF1 A;  3SZ7 A;  4NAC A;  1N4P A;  2P58 C;  4F1S A;  3LVQ E;  1BI8 B;  3EU5 A;  4KVO A;  3UFD A;  2L0I A;  2YNQ A;  4EKI A;  2ZU6 B;  3IKO B;  1BU9 A;  2LYJ A;  3Q15 A;  1E96 B;  3VTX A;  4HRM B;  3D9M A;  5A7D B;  5FTP A;  3FUN A;  4GPK A;  1ZAY A;  3OQM A;  3LS8 A;  4EBA A;  3ULQ A;  3AS8 A;  2EIL E;  4AVX A;  4HB5 A;  4Z5C A;  2MOW A;  5CCL A;  1JCS A;  1LTX A;  4FHJ A;  4CT4 A;  1L5J A;  2V5F A;  1RIO A; 
#chains in the Genus database with same CATH homology
 1LLI A;  5FJY A;  3ONL A;  3RK6 A;  5KJL A;  2X3M A;  1IC8 A;  3UUX A;  3PEV B;  2WQH A;  3T8M A;  3SF4 A;  4AXH A;  2WXQ A;  4G23 A;  2IVQ A;  5LCW J;  5FZS A;  4ATG A;  5KCM A;  5E76 A;  4B8A A;  4OYS A;  4NUR A;  2LYK A;  2KZT B;  1U3C A;  4I6R A;  2OOE A;  4FLB A;  4JHK A;  4U0Z A;  1LF8 A;  4ANX A;  4OVV A;  3IHV A;  3S2A A;  4CDN A;  1UW4 B;  2VYI A;  3ML8 A;  2ION A;  1ZZC A;  3QC1 A;  2BF0 X;  3LXU X;  3ML9 A;  4L1B A;  2QY7 A;  3MGB A;  3HIZ A;  3GN5 B;  3LJ3 A;  3D9P A;  3FTS A;  3ZYM A;  3HYM B;  2MRI A;  5E75 A;  1TEZ A;  4Z5D A;  3RKV A;  4I6T A;  1IHG A;  4DI3 A;  3RU0 A;  3O48 A;  2M63 A;  4IN3 B;  3PRZ A;  4EQF A;  3P1U A;  2LO6 A;  4DLO A;  3HZI B;  3Q49 B;  2IVG A;  2QFC A;  3FTZ A;  4YND A;  2OV8 A;  2VQ2 A;  3SBS A;  3ZYQ A;  1EDU A;  1PRA A;  4Q69 A;  5JJT A;  4RG6 A;  3ZYL A;  1TJC A;  1E8Z A;  3RZZ A;  3G5G A;  3F6W A;  4D10 C;  1QPZ A;  5ENN A;  4EBA G;  3ZRH A;  1Y9Q A;  2EF8 A;  4NQ0 A;  2CG3 A;  5T4Y A;  3ZFW A;  3PUK A;  4QFV A;  5FQ4 A;  3H5T A;  3ENE A;  4JCY A;  3RO2 A;  3EUS A;  3U4T A;  4B8C B;  5T8I A;  3KJX A;  3BG0 B;  4PU3 C;  5K98 B;  3MKQ A;  3PE3 A;  4Q94 A;  4AY5 A;  4ANU A;  3LDZ A;  2VJ8 A;  2ICT A;  3L08 A;  1QP7 A;  1E90 A;  4W9R A;  2PM6 A;  4G11 A;  3U9W A;  4DJA A;  4UWK A;  2FI7 A;  2WUS R;  2AXV A;  3UQ3 A;  2XRY A;  3ASD A;  1L1M A;  1HF0 A;  3S7F A;  5EKQ D;  2LNI A;  2OFY A;  2IV1 A;  2WXO A;  4M3O A;  3FHE A;  3QYX A;  4JEH A;  3APF A;  3EIQ C;  3UT7 A;  2VSO E;  2L9B A;  5M72 A;  1HG2 A;  4GZC A;  3D9J A;  1OUV A;  3WXX A;  3CIA A;  4GYY A;  1WIZ A;  2HSG A;  1Y6I A;  4JVS A;  4U0U A;  4UWH A;  3MJW A;  2HR2 A;  2WQ6 A;  2VTB B;  2IVB A;  4JHJ A;  2RD0 A;  1XWR A;  3BDN A;  2XPY A;  4J8D A;  2FO7 A;  1BDH A;  3TJP A;  2XCJ A;  3MEK A;  4DPR A;  2PPX A;  2GZU A;  5HI7 A;  4AV7 A;  5LX8 A;  4PU4 C;  4EEC A;  4JXT A;  2LSU A;  2AVP A;  1LCD A;  4AIF A;  2CSF A;  2IQC A;  3NZU A;  4WWN A;  3B7H A;  4FC8 A;  5G05 J;  2KZT A;  1QQE A;  2PL2 A;  3D1N I;  4APO A;  4KYO B;  2XQ0 A;  3D9I A;  3FP3 A;  2XRZ A;  3HVE A;  1ZZ8 A;  4K03 A;  1QNF A;  3JXB C;  1PY1 A;  2YHE A;  3AU4 A;  3DPD A;  3F52 A;  2X38 A;  3CVW A;  5BPP A;  4UWG A;  1PC2 A;  4DK5 A;  3RO3 A;  4GZ3 A;  1IQR A;  2LYP A;  3GN5 A;  3VTY A;  3R7R A;  2WXP A;  2L6J A;  3QWV A;  3AS5 A;  4AOF A;  3FUJ A;  1ZZ9 A;  3LFP A;  4N3A A;  3ZEF A;  1P5Q A;  2FEZ A;  2RG8 A;  3ZPJ A;  4F7A A;  2ICP A;  3GZS A;  4GB9 A;  5CMY A;  4FBI A;  1LMB 3;  3SHF A;  1U3D A;  2J9Q A;  3MZL B;  4HOT A;  3FY4 A;  3FU5 A;  2PE5 A;  4TV3 A;  1ELR A;  4I2Z A;  1QQB A;  2IOL A;  1H2T C;  3G2T A;  3KAE A;  2LYQ A;  2EWT A;  2YHC A;  2GGF A;  3D9L A;  3D9K A;  3L1P A;  1WH6 A;  2NXP A;  4HOU A;  2PIJ A;  3ASH A;  4I9E A;  2KPJ A;  2XJ3 A;  5EX3 A;  3RRM B;  3CRO L;  3OXF A;  4EZJ A;  1X5B A;  4BX9 A;  1B0N A;  3GYZ A;  2Q7F A;  1SQ8 A;  4Z59 A;  4YG1 A;  3EIJ A;  4IA8 A;  4JEU A;  3T5X A;  3QOU A;  4FJZ A;  1JWF A;  2PQN A;  4I1O B;  3S7B A;  5C1D A;  4GHJ A;  4L23 A;  4ACK A;  2XGM A;  2Y4U A;  2IFU A;  1NA3 A;  4XIF A;  1UXD A;  3CK7 A;  4GA0 A;  2MEZ A;  3I5P A;  3LVR E;  1E7V A;  2BTD A;  4TUU A;  3CHM A;  3CV0 A;  5AEN A;  3QKY A;  2EBY A;  2LYR A;  4PS7 A;  4ILH B;  5G2N A;  2VGX B;  2CG2 A;  4FN3 A;  3ZIM A;  2VTB A;  3GBF A;  1JWL A;  4F8D A;  1CQT A;  5LOZ A;  2B5A A;  2L0T B;  3GZ2 A;  3PS6 A;  3SFZ A;  2KAT A;  3D3M A;  4WNE A;  4FUL A;  4CRW A;  3JYS A;  5J08 A;  2PZI A;  1LQC A;  4L7T A;  1PRU A;  3UT4 A;  4FAD A;  2J09 A;  2PUD A;  4UI9 K;  4JZY A;  1PNR A;  3CKB A;  2WVI A;  2XPI A;  4UI9 C;  3EDT B;  2KCV A;  3PNT B;  4J1W A;  3APC A;  4JPS A;  3FH8 A;  3T5V A;  1OWO A;  4GYW A;  1X57 A;  3CLC A;  1KT1 A;  3PEU B;  4PS8 A;  4GZD A;  2KEI A;  3ESK A;  5FZQ A;  3CHR A;  5J90 A;  3SD5 A;  3LIS A;  4LRZ A;  3BD1 A;  3QDN A;  5ANL A;  1OWL A;  4EZL A;  2BNO A;  1ZS4 A;  2HM8 A;  1JWG A;  2WXH A;  3PDN A;  1RZS A;  2X6K A;  4NRH B;  4BTA A;  3KZ3 A;  3FUK A;  1ELK A;  3UT8 A;  3MA5 A;  2O4A A;  2IUO A;  2LYS A;  3FDH A;  4XZ4 A;  3VLF A;  4AJW A;  5AIJ A;  3PNL B;  3I3N A;  2IOS A;  3C98 A;  5EX0 A;  4CGW A;  1WET A;  4I2W A;  3CHP A;  3I4R B;  3ZXS A;  1EF1 C;  1UG3 A;  2KZ8 A;  3LKU A;  4UWL A;  3U3W A;  5ARF A;  2I2O A;  1MHQ A;  1JFT A;  2XEV A;  1HS6 A;  1ZU2 A;  3TGO A;  3TXM A;  5A23 A;  3ZHE B;  5AJL A;  3RRU A;  3ZGQ A;  4MCT A;  2X6H A;  1YSE A;  3PE4 A;  2ILR A;  3ZN3 A;  5CHE E;  3FYA A;  3FUD A;  2R63 A;  5KJN A;  2LCV A;  1XNF A;  3AS4 A;  4IVZ A;  3L13 A;  2IU1 A;  4HFG A;  4DLQ A;  4XX5 A;  4G24 A;  5KJM A;  3ASF A;  4ACL A;  5EDS A;  3PRE A;  4AM9 A;  3OP9 A;  1GT0 C;  1QZ2 A;  1DWK A;  4BY6 A;  4N2Q A;  2BNM A;  1E8X A;  1JH9 A;  4YAR A;  2IJG X;  3Q47 B;  3SCG A;  3CVN A;  3SNX A;  3FTY A;  4CDR A;  3JQ0 A;  4ANV A;  3FYM A;  1QQA A;  4JL0 A;  1IYG A;  5G04 J;  3TRB A;  3B7U X;  2VGX A;  3CHS A;  3FMY A;  4L2Y A;  1N52 A;  2WXM A;  4GAA A;  4O8B A;  3DNV B;  3BS3 A;  4J8F A;  2I1J A;  3QAR A;  2O38 A;  1ZZ6 A;  3URZ A;  3IEG A;  1HFA A;  2A4Z A;  1QP0 A;  2V8S E;  4ME2 A;  2A6C A;  3OAW A;  4JA9 A;  3TL5 A;  5CCM A;  4A55 A;  2UY1 B;  3G2V A;  4U8H A;  4GA1 A;  2WMN A;  5FQ7 A;  1WH8 A;  2PUF A;  1HU3 A;  3LY7 A;  3NQP A;  4F3V A;  2XGS A;  3E4B A;  2JCG A;  1EPU A;  3HDX A;  4PU8 A;  2WXN A;  3FUI A;  1OWP A;  4RG9 A;  4KVM A;  4PUC A;  3CGH A;  3RIB A;  3RRN B;  4PU7 A;  3SGH A;  2YQ8 A;  4P29 A;  4JCX A;  1SZ9 A;  2J07 A;  1BDI A;  4HS2 A;  4XI0 A;  4IYP A;  4GZ6 A;  5FQ8 A;  4CEM A;  1BPO A;  3SBT B;  4G25 A;  1UXC A;  3LYA A;  4X4C A;  1H0A A;  4WAF A;  3HHM A;  3SI5 A;  4ABN A;  4AY6 A;  1INZ A;  2KCL A;  2J4B A;  5CMW A;  3DBS A;  3CVU A;  3CKC A;  3CVV A;  3NZS A;  3OMT A;  2DCP A;  1Y8M A;  3B7R L;  4B94 A;  2XSD C;  1Z3Y A;  3QWW A;  4HLE A;  5LFA A;  4E85 A;  1CJG A;  5JHA A;  4UQZ A;  2IF4 A;  4FHK A;  1RPE L;  4WWP A;  4HOQ A;  3EJN A;  4XI9 A;  3VLE A;  4X4E A;  2OVB A;  1S7E A;  3FUF A;  1ZZ7 A;  3O4Z A;  2BNN A;  1HX8 A;  5D0O D;  4N3C A;  3FTV A;  2AXZ A;  3FH5 A;  1NER A;  4N5C A;  3L22 A;  2LYL A;  2X6F A;  2LSV A;  3PVL A;  3O9X A;  2CHX A;  3ASG A;  3FU6 A;  5AJD A;  4YVQ C;  2DIW A;  1NP7 A;  3APD A;  3G2S A;  4GYO A;  3QNK A;  3QWP A;  4FU3 A;  3ESL A;  3CVP A;  3UMV A;  4A1G A;  1W3B A;  3F51 A;  3QF3 A;  3OQN A;  3G7D A;  1POU A;  4HVB A;  4GU5 A;  4WND A;  5DIZ A;  4U0S A;  2AW6 A;  2JEK A;  3JXD L;  3Q4A B;  2V0P A;  4UI9 J;  4U63 A;  5G55 A;  4I9C A;  1ZPQ A;  4YG4 A;  4EZK A;  1HF8 A;  1JPL A;  4DI4 A;  3OTN A;  3KXA A;  3CK8 A;  3QAQ A;  4YG7 B;  5BNW A;  4BWR A;  3N71 A;  4H7Y A;  4Y6W A;  4OVU A;  5T3R A;  1AU7 A;  3FTW A;  4KZC A;  4BX8 A;  4MLP A;  3CVY A;  2WIU B;  4UQX A;  3MKQ B;  1JUQ A;  4LUN U;  3CEC A;  3KS2 A;  3TXN A;  4I1M A;  3GZ1 A;  2Y3A A;  2BUG A;  2VSX E;  4K0R A;  4B89 A;  1IQU A;  1YA0 A;  3SCH A;  2CFU A;  2XPZ A;  3MV3 B;  4J8S A;  3R1F A;  1LCC A;  1HG5 A;  2KM4 A;  2BJC A;  3TAX A;  2UY1 A;  4LER A;  4LCT A;  2PUG A;  3LCA A;  4N2S A;  4ILI A;  3VLD A;  2KCK A;  3L6A A;  3B7S A;  3S8Q A;  4IWR A;  2E0I A;  5DBK A;  3FWV A;  4G26 A;  1QP4 A;  1Z3X A;  5LP0 A;  3U64 A;  2PQR A;  4E6H A;  5A7L A;  4F53 A;  2LAH A;  2VSY A;  4GZ5 A;  2Y4T A;  2CHW A;  4BFR A;  5BT1 A;  4Y6C A;  4UQY A;  2JLB A;  2OVF A;  3FUL A;  3FUM A;  2EQX A;  1R63 A;  1E8W A;  4BSX A;  4RSY A;  2AUW A;  4J1X A;  3IHY A;  4TRQ A;  1WAO 1;  2CHZ A;  3FTX A;  5ANR A;  4APF A;  4A1S A;  1ZUG A;  3CK9 A;  1Y7Y A;  1VDY A;  3PH0 C;  4V3I A;  3FU0 A;  2FBN A;  3FFL A;  1ELW A;  2WXJ A;  3PZD A;  3OXL A;  4GA2 A;  4A3T A;  3MCX A;  4KXK B;  4GCO A;  4UWF A;  3HVE B;  4AP2 A;  1S0P A;  1EFA A;  1HZ4 A;  4H7X A;  5C2Y A;  3ZW3 A;  4J8E A;  1H6K A;  2XI8 A;  1HE8 A;  4N3B A;  3IBE A;  3GW4 A;  1R69 A;  4MKT A;  1HH8 A;  2UWJ G;  1UJK A;  4JC8 A;  2MHK A;  3Q5M A;  3U66 A;  2PM7 A;  3TG4 A;  4X4G A;  2H8R A;  2J4D A;  1B89 A;  2IU7 A;  2WB2 A;  3JCK C;  1RZR D;  2NSZ A;  5JJ7 A;  4C0E A;  3CVX A;  2CRO A;  2L8N A;  5FQ6 A;  2DBA A;  4GMJ A;  3EHM A;  1A17 A;  1FVF A;  1WY6 A;  5FZR A;  4ANW A;  1UJJ A;  3L17 A;  4XE0 A;  2D5V A;  4Q96 A;  4PS3 A;  5LCW C;  3G2U A;  4X4H A;  2O49 A;  2C2L A;  2R59 A;  3G2W A;  5AYW D;  4BT8 A;  2YIN A;  5FT9 A;  2VGY A;  2GRM A;  5BV1 A;  3BG1 B;  5HQ8 A;  2E2E A;  2AXU A;  3LEW A;  5BW8 C;  4FLH A;  4URK A;  2WPV A;  1RZR A;  3FEX A;  3CVL A;  3MYV A;  4KMO A;  2OND A;  4X4I A;  1UN8 A;  3ZKC A;  1DVP A;  1N54 A;  3MX3 A;  1ZVV A;  1KLX A;  4I1A A;  3S7J A;  2OR1 L;  4CCA A;  4Z58 A;  5JHB A;  3R9A B;  3CQG B;  3MKR A;  1XGW A;  2WMO A;  1PER L;  1Z6T A;  3CSF A;  3LPZ A;  3ZVV A;  3OXG A;  3I4G A;  4Z5H A;  4WWO A;  3QQ6 A;  3CHQ A;  2A5U A;  1NEQ A;  2WXK A;  3QB2 A;  4KT6 B;  4KZ0 A;  5ARG A;  5FWQ A;  5BV0 A;  2J08 A;  4X4B A;  4I6U A;  4CDM A;  2AWI A;  4JA7 A;  1NA0 A;  4OB4 A;  1WM5 A;  2GRL A;  1UTX A;  1VPW A;  1NZN A;  3ZYK A;  3FUE A;  1E7U A;  2KC7 A;  4WNG A;  4FP7 A;  2WXL A;  4GML A;  1OWN A;  4A3V A;  1TJF A;  2R5S A;  4LEU A;  3L16 A;  2FUL A;  3LY8 A;  3MLF A;  4BT9 A;  1E3O C;  3LY9 A;  1GW6 A;  3FEY A;  2LAI A;  5D0Q D;  2FJR A;  4L2L A;  4JW1 A;  4I6E A;  4FA6 A;  3UPV A;  2J49 A;  2WXF A;  2I9C A;  1KT0 A;  2X6J A;  4XKC A;  2V4L A;  2XHE A;  3IV0 A;  5A6C A;  4CT0 A;  2NC9 A;  2HO1 A;  4MCX A;  1JFS A;  4FJY A;  4U07 A;  4YVO A;  3ZHM A;  3P2B A;  4U04 A;  1RIO A;  4JQD A;  2HYZ A;  2WM9 A;  3D9N A;  4I6G A;  3RJV A;  1EYH A;  1PAQ A;  1PRV A;  2C0L A;  2I6H A;  1ZBP A;  4XKB A;  5KJK A;  3UX4 A;  3K9I A;  1SQM A;  3B13 A;  3R7Q A;  4B0Z A;  4CGV A;  2C0M A;  3CR3 A;  2GW1 A;  3CLJ A;  2VSN A;  2XCC A;  3B7T A;  3ONK A;  4MRU A;  3FU3 A;  1OSL A;  3TG5 A;  4BTB A;  4C0M A;  4EPZ A;  3ZHE A;  1H2U A;  2HIN A;  2PUE A;  2PUC A;  2PUA A;  1UN9 A;  4I17 A;  4RVB A;  5G04 C;  1OWM A;  2I1K A;  3JUI A;  4IRU A;  4WUY A;  3KEZ A;  4X4F A;  1HO8 A;  1X2L A;  4YBA A;  3ZHI A;  4JHR A;  3VK0 A;  3JQ1 A;  4KBQ A;  4O6F A;  4Y42 A;  3IVP A;  3CST A;  3PUJ A;  1HXI A;  4G2V A;  5BUZ A;  3FTU A;  4J6I A;  2R1J L;  4C9B B;  3NF1 A;  2MQK A;  1DW9 A;  1E8Y A;  3L54 A;  3SZ7 A;  2WXG A;  4HOS A;  4X4D A;  3FH7 A;  2XIU A;  3CVQ A;  4NAC A;  3SCF A;  3AU5 A;  3CEQ A;  4PH4 B;  4HXI A;  4PDX A;  2P58 C;  4F1S A;  1O4X A;  4NDW A;  3FUH A;  3LVQ E;  5G05 C;  4I43 A;  3JXC L;  3KD7 A;  4HOR A;  3MV2 B;  4KVO A;  3OQO A;  4I8T A;  3S7D A;  1H2V C;  3UFD A;  4R7L A;  2L0I A;  2YNQ A;  2ZU6 B;  3QJZ A;  3IKO B;  2LYJ A;  3Q15 A;  1E96 B;  1OCT C;  1SZA A;  2WQ7 A;  3VTX A;  4GCN A;  2X6I A;  1ZZB A;  2CFZ A;  2XGO A;  4WNF A;  1FVH A;  2XCB A;  1ADR A;  3D9M A;  4G1T A;  5A7D B;  2FF4 A;  1DNP A;  4ILG A;  3QK0 A;  1MQS A;  4J0U A;  3FUN A;  5FTP A;  4AEZ C;  1FCH A;  1ZAY A;  4GPK A;  3OQM A;  3QWG A;  2PUB A;  3LS8 A;  2WXR A;  2KEK A;  4MS6 A;  4N39 A;  4EBA A;  3ULQ A;  3AS8 A;  4AVX A;  2WXI A;  3CQC B;  4Z5C A;  2KEJ A;  2MOW A;  3BEE A;  3D9O A;  4I6J A;  2L49 A;  2JVL A;  3CHO A;  4FHJ A;  5JJ6 A;  3EHN A;  4GQM A;  4CT4 A;  5CCL A;  1L5J A;  2V5F A;  3PXP A;  1H19 A;  2R17 C;  4IUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...