2AXZA

Crystal structure of prgx/ccf10 complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
306
structure length
306
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 110
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axzA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axzA02
1CQTA 1L1MA 1POUA 2IVGA 4JCXA 2AXZA 2BNNA 3ZKCA 2D5VA 2JVLA 1ZZ8A 2ICPA 3OQNA 4IVZA 3F51A 2LYSA 4MCTA 1PRVA 1R63A 1DW9A 1ZZBA 1DWKA 2ICTA 3FYAA 2IUOA 2BJCA 2IU7A 2PIJA 4X4BA 1CJGA 2PPXA 4NDWA 2CROA 3OQOA 4YG1A 1SQ8A 4F8DA 2LYLA 2EF8A 4X4GA 3L1PA 1E3OC 3F52A 3D1NI 4X4HA 4IA8A 3JXDL 1QPZA 4YG7B 1ZZ9A 2AWIA 3VK0A 1RZRA 2PUDA 3BS3A 1ZZCA 2EBYA 2BNOA 2JCGA 4PU8A 4FN3A 3LISA 3SCGA 4X4IA 4YBAA 1LCCA 2B5AA 3G7DA 3GN5A 3KZ3A 3SCHA 4PU4C 1RIOA 1OCTC 3CECA 2HINA 2R63A 2BNMA 3BD1A 3G5GA 1QP4A 1ADRA 1XWRA 1JFTA 2PUAA 3RZZA 4X4CA 4I6TA 1WIZA 4Z5CA 3SCFA 2AXUA 4OB4A 4X4FA 1UXCA 3EUSA 3QQ6A 1HF0A 2XIUA 4I6RA 2GZUA 4GHJA 1LCDA 1ZAYA 1BDHA 2WIUB 1UXDA 2HSGA 3LFPA 1ZPQA 3ZHMA 3U3WA 2O38A 4O8BA 1PRAA 4Z5DA 1O4XA 4PU7A 2KEIA 3CROL 2GRMA 3FYMA 3PXPA 3IVPA 2O4AA 1WH6A 1QP7A 3BDNA 1Y7YA 3QWGA 2KZ8A 1OSLA 2KEJA 2L49A 3MLFA 1VPWA 1ZVVA 1LQCA 1X2LA 1PRUA 1ZUGA 3KXAA 1LLIA 4Y42A 5K98B 4Z5HA 1PERL 1NERA 1BDIA 1RZRD 2FJRA 1R69A 2KEKA 2XJ3A 3TRBA 4X4EA 4PU3C 1JFSA 2R1JL 1NEQA 1JH9A 2EWTA 2IV1A 4IWRA 3GN5B 4I8TA 2LYJA 3JXCL 1ZS4A 2LYPA 2LCVA 4YARA 3GBFA 3HZIB 3CLCA 3UFDA 2WUSR 2LYQA 2PUFA 1B0NA 3OQMA 2AXVA 2XSDC 2LYKA 2MQKA 1JWLA 4I6UA 1LMB3 1RZSA 2MEZA 4GQMA 3JXBC 1RPEL 2PUBA 1YSEA 3B7HA 3KJXA 2AW6A 4Z59A 1WETA 1Y9QA 1X57A 4YG4A 2PE5A 1QQBA 2PUCA 5A7LA 3ZHIA 4J1XA 4MCXA 3FMYA 3R1FA 2L8NA 4JCYA 1WH8A 2CSFA 1AU7A 4FBIA 2OFYA 2PUGA 2KPJA 3OP9A 3OMTA 1IC8A 1EFAA 1ZZ7A 2OR1L 4X4DA 2GRLA 3QF3A 1QQAA 2AUWA 3S8QA 1QP0A 2XCJA 2XI8A 3DNVB 2PUEA 1S7EA 3O9XA 1PNRA 2H8RA 2IVQA 4JQDA 4J1WA 3H5TA 1UTXA 2IVBA 3F6WA 2A6CA 1ZZ6A 4Z58A 2LYRA 3QYXA 2O49A 1GT0C
chains in the Genus database with same CATH superfamily
2RD0A 4A55A 2L0TB 3Q79A 4BEPA 4UQZA 3DSUA 3EU9A 4GTPA 2PIJA 4PUCA 2PPXA 4R7LA 5B3SE 3D3MA 1BPOA 1TEZA 2CHWA 5CERB 3GZCA 1E3OC 1OUVA 3NB2A 4G8LA 4AVXA 2E2EA 3F6QA 3WG7E 3TWUA 3TGOA 5DIZA 1ZZCA 3NBNB 3MV3B 1KLXA 1OCTC 3KSQA 4JHKA 2ETCA 4Y6WA 4HBDA 2MRIA 1OCRE 3FP3A 3QQ6A 5FJYA 1VDYA 5AYWD 3ZHMA 1PRAA 3G2VA 4JEHA 4GTTA 3IKOB 2XHEA 2RFMA 3ZVVA 5FWQA 2WVIA 2XGOA 3S2AA 4I17A 2VSOE 5T4YA 2M4HA 1BD8A 4BTAA 4XI9A 2FF4A 2R02A 3AG4E 3UFDA 4ATGA 2PUFA 2LXMA 2EIKE 3KS2A 2VTBB 2HM8A 2VSNA 5JHAA 4CGVA 1Y9QA 2HFZA 2PUCA 1YMPA 3G2SA 5BNWA 3B7BA 1JWGA 3LJ3A 3LYAA 4Q94A 2P2CP 1TR4A 5CBOA 5EKQD 2XI8A 3ASNE 5JMND 1PNRA 5G04C 5AAOA 5BUZA 2XEHA 2IVQA 2IVBA 3VLEA 1CQTA 1POUA 3PZDA 5ENSD 3TWRA 3AS5A 3FYAA 3U9WA 3FFLA 2EQXA 5HRYA 4U0UA 3SBTB 5G04J 2XRYA 1NW3A 1RZ4A 2XZTG 4RG9A 1KZPA 3KSLA 2MOWA 4FU3A 3URZA 1ZZ9A 4APOA 3ZYMA 2VEOA 1JUQA 2PUDA 2I1KA 1U3DA 3L6AA 4QQIA 4A1SA 1OCOE 4HQDA 3KEAA 2ZISA 2J8SD 2LAIA 3RRMB 5DRTA 3SF4A 4PS7A 4X4FA 5AJDA 5FQ7A 3VTXA 1TNYA 2Y0BG 2P9LG 4E6HA 1W3BA 3FH5A 1MJ0A 2WPVA 3SFZA 5B1AE 2FO7A 3NAWA 3QWGA 4M3OA 2KEJA 2L49A 2EINE 5KJKA 2XCCA 2KZTA 1HU3A 1OXJA 4HOQA 5G2NA 2XXQA 3MX3A 1UOHA 4AEZC 4WWOA 5KBAA 2KBXA 2X6JA 1LD7A 2VJ8A 2CG2A 5FT9A 3JCKC 1JWLA 2UY1A 3FWVA 2H6GA 3HHMA 3SHFA 3CVLA 3DSWA 3R7RA 2WXRA 2J09A 5BXUA 2CSFA 4J8SA 4EKIA 4I9EA 5KJMA 1QQAA 2AUWA 1MHQA 1U3CA 4N2QA 3FUFA 4HOTA 1UTXA 3F6WA 4PU7A 2A6CA 3PUJA 1E7UA 3ZYKA 4F3VA 2GRRB 3CVXA 2ICPA 4IVZA 1PRVA 3IHVA 2JABA 1D8EA 1D8DA 1S70B 4NDWA 4I1AA 3OQOA 3E4BA 4YG7B 2PM7A 5CCLA 4LERA 2JCGA 2NXPA 3APDA 4BY6A 3UM0A 3PEUB 1X81A 2WMOA 3L9TA 2WXFA 4L2YA 3J5QB 1N94A 1Y6IA 3VLDA 4RVBA 1H6PA 1JCSA 3L22A 2FI7A 1UXDA 5CEAA 3QKYA 4JA9A 3MEJA 3JXJA 4N3BA 1Y7YA 3FEXA 3KL4A 1H6KA 3CHRA 4LG6A 1KPSB 1QNFA 1UG3A 1OWMA 1Z5SC 3AU4A 3CSTA 3GZDC 4KBQA 4G8KA 4KZCA 2I9CA 5AJLA 3B7UX 3TEPA 3CVYA 4LNUD 2HCNA 3V79K 4B0ZA 2OV8A 4MCXA 2L8NA 5FQ4A 5LP0A 4HLEA 4WWPA 2CFZA 2XPZA 2XXPA 3TWXA 3GZ2A 1UJKA 4GTQA 2LYRA 1PERL 5LOZA 5A23A 3BQOA 3N71A 1IKND 2LYSA 1ZZBA 3T5VA 1DWKA 4P29A 2CROA 4U95D 3C3OA 1N54A 3HG0D 4F8DA 5EDSA 5CHEE 2LYLA 2EF8A 1EF1C 4OVVA 1ZU2A 1QYMA 2IO3C 1HE8A 4ILIA 3EU5A 4AV7A 3QWWA 4X4IA 3Q15A 1SZAA 3WXXA 5EX0A 1WG0A 4Z5CA 1ZBPA 1JCQA 3R9AB 4B89A 2J49A 1G3NB 2GZUA 3EJNA 1NA0A 3AS8A 2VGYA 5FQ8A 3CHMA 2OEVA 2LXLA 2GRMA 2BF0X 2ZXWE 3E33A 4A3VA 2R59A 2YQ8A 3BDNA 1DCQA 1ELWA 3RSEG 3FUIA 4GMLA 4C0MA 1N11A 2CG3A 2WXKA 4A3TA 4KXKB 3CSFA 3NZSA 4U8VD 3OKZA 1SVXA 4CZ2D 3RU0A 3HZIB 1TN6A 4YNDA 4BT8A 4JHJA 1RPEL 2LLVA 1N4RA 4Q2JA 4ER7A 3DPYA 3SBSA 4BX9A 2WQ6A 3DM5A 1B89A 3L82A 1N95A 3SNXA 1V54E 2F8XK 4WNFA 5BV1A 2P9NG 5BW8C 4DX6D 2WM9A 2LNMA 4AIFA 4HOUA 3S8QA 3LVQE 3SFXA 3TWTA 2A4ZA 4URKA 5KNGA 5ANLA 4L7TA 2EIJE 5FIOA 5LFAA 1N4QA 1H0AA 1MX6A 4HRNA 3T8MA 4FJZA 4X4HA 2ZIRA 2EIME 4JPSA 4FJYA 1BI7B 3UT7A 1U2VG 2J7WA 5T8IA 4K5BA 3D9OA 1OWOA 1HX8A 2WXPA 1LCCA 4YBAA 4N3CA 3G7DA 4JC8A 3EIQC 1KZOA 2ETAA 3Q7AA 3C3RA 4KVOA 2QZAA 3CK8A 2LNIA 2A5EA 1O1RA 1XGWA 1ZAYA 3ESKA 1ZPQA 2XEEA 4BERA 4Z5DA 3UUXA 2KEIA 3LPZA 3SI5A 1Z3XA 3PUKA 3D9IA 4HRMB 3E30A 4XI0A 3BG1B 4DJAA 4GTVA 4E85A 1ZVVA 1X2LA 2YHCA 2FEZA 2BKGA 3EUVA 3APCA 3ZUVB 1OCCE 1NA3A 2CHXA 4GCNA 4W9RA 2FFHA 2R2LA 5G05C 2FO1E 2ODRD 5CEDB 3RJVA 3ABKE 3ASFA 3E32A 4WAFA 2QY7A 4BSZB 2FULA 3ASDA 3UIOC 3AJIA 2I6HA 2MHKA 1MX4A 5ANRA 3FMYA 4GU5A 2X6HA 4PS3A 2PUGA 1IC8A 1ZZ7A 3PS6A 3MV2B 2GRLA 3DEOA 3GW4A 5D2MC 3SZ7A 2XRZA 4G23A 5DTQA 4BWRA 3UMVA 3ASHA 4HLLA 5LCWJ 2JVLA 4MCTA 4ILHB 3HYMB 4N5QA 5JJ7A 2KZTB 5J08A 4C0EA 2EILE 3PNLB 3DXKG 3JXDL 3PRZA 3L17A 4RG6A 4B94A 4IRUA 2IQCA 1X5BA 5JHBA 3BU8A 2DVWA 2PXUA 2KATA 4PU4C 1ADRA 1JFTA 4L1BA 3FUMA 2WXGA 3G2UA 4OB4A 4OAUC 4GTRA 1UXCA 3EUSA 1HF0A 2PL2A 5C1DA 1QZ2A 1GW6A 3LFPA 3QOXA 4GAAA 1HXIA 1TNBA 4BSXA 3Q5MA 2BUGA 3DBSA 1TN7A 3U64A 4F7AA 3QB2A 3MJWA 1PRUA 2VSXE 4HB5A 4FHJA 3JUEA 4DI4A 3W9GA 2EWTA 3HXDA 5AQBA 2AJAA 2KCVA 2HO1A 1TNZA 2LYPA 2VSYA 3GBFA 2J4DA 3TL5A 2DZNA 2P9KG 2V3CC 4G1TA 4G26A 4ABNA 3GYZA 2LUHA 3FU0A 4EZJA 3ZHIA 2C0MA 4JCYA 1WH8A 2Y4TA 2KPJA 3PNTB 2J07A 2I2OA 3D9PA 4JQDA 2O49A 2BTDA 2XJ3A 4U0ZA 4DX2A 1GT0C 3U66A 1DCEA 2AXZA 5KWDA 3RK6A 3Q4AB 2ICTA 2HYZA 1N0QA 3AS4A 3ULQA 1NZNA 3SD5A 2VGEA 3PZ1A 2YHEA 1FVFA 2RG8A 3FEYA 4GA0A 4K0RA 4CDMA 4HOSA 3LY8A 4DE8A 2WXLA 3JYSA 2HR2A 4G2VA 2R63A 2BNMA 4U0SA 3UXGA 4I6TA 2NYJA 3LXUX 5JJ6A 3PE3A 2X3MA 2PXVA 3EDTB 4UWKA 2BKKB 2WIUB 1YA0A 2GRQB 4D10C 4O8BA 1O4XA 3HRAA 2GRPB 3OXFA 5FTPA 3CHOA 2H6FA 4M7CA 1V55E 2IJGX 3LS8A 3QWPA 3G2WA 4DLQA 4YDOA 3ABLE 3CKCA 3AU5A 3B7RL 3FDHA 3D9KA 2IV1A 3SY2A 4I2ZA 5EILA 2MXDA 3D9MA 5EIBE 4IYPA 4CT4A 2IY0C 2IEJA 4XIFA 2FBNA 3ZXPA 4BETA 3R1FA 4EBAG 2KXPC 2OR1L 2Y1LE 1MX2A 3O9XA 3I5PA 2LAHA 4OBMA 4JB8P 4C48B 2PXTA 4JCXA 4LRZA 4XX5A 4FC8A 4CDNA 1DW9A 3CK9A 4YDWA 3APFA 3PE5A 2IU7A 4X4BA 2UWJG 4GB9A 4JW1A 5DT2A 3ML8A 2M63A 3B7TA 2ILRA 5FQ6A 2DYRE 5BPPA 2LO6A 4HFGA 3BG0B 4KYOB 1QB2A 2EBYA 2P9IG 2OVFA 2B5AA 5KJLA 3CECA 4GPKA 2C0LA 3ZGQA 4Y6CA 3SQVA 3NOGD 3Q73A 4AJWA 4GHJA 4I2WA 2IOLA 4EECA 2X6FA 3IV0A 2O38A 5JA4D 2PZIA 1N4SA 4H7XA 1H6OA 1OSLA 3QDNA 5DTMA 2YBDA 3A9XA 1N4PA 3QNKA 3ZU7B 1UJJA 4Z68A 3ZNGA 3HVEB 4ANVA 3AG2E 4LUNU 4IWRA 2LYJA 4JD2G 3JXCL 3CLCA 3LCAA 1SZ9A 2QYUA 4FLBA 4I6UA 5EX3A 2MEZA 2WXQA 5CRVA 1UN8A 3JQ1A 4J1XA 4TUUA 1E8XA 3MEKA 1EPUA 5BV0A 4L2LA 4GMJA 4UI9J 1S7EA 3QYXA 5HQ8A 1FVHA 5ENRD 1OWLA 3TAXA 3ZKCA 2D5VA 2IO2C 1FCHA 3EHNA 3I3NA 4EZLA 5AIJA 1UN9A 1ZB1A 1OWPA 3FU6A 3NF1A 4DI3A 1SQ8A 3LY9A 3RRNB 3QWVA 5CMYA 4O1PA 2PNNA 4TUMA 5ENNA 2R03A 1IHGA 2DYSE 4A63B 4XKCA 3MA5A 5KJNA 3C72A 4U07A 1HF8A 4PU8A 4CRWA 4BESA 1KT0A 3SX0A 5ENQD 2LSVA 1QP4A 4DPRA 3CV0A 2VGXB 2L1PA 2IONA 3FUKA 4YVOA 3ZPJA 2L6JA 3FYMA 4J8EA 1EYHA 4J8YA 1UW4B 2ZGGA 3LKUA 4KVMA 1QP7A 1MYOA 2YNQA 3KXAA 2XCBA 2WXJA 3LEWA 4GMRA 5K98B 3HXEA 2ETBA 5D66A 3ESLA 1RZRD 4LNGA 1R69A 1HQ1A 3TXNA 2V4LA 3RAUA 2LCVA 1QBQA 3ZHEA 4ILGA 3BEEA 4FA6A 2AXVA 2LYKA 4F1SA 1HZ4A 3W9FA 3A9YA 5FZQA 3DSSA 3DWLG 4HNAD 3ZW3A 2XXAA 4CCAA 3VWSA 3MCXA 2P58C 4N2SA 2OFYA 2V4HC 2HCSA 4X4DA 2P9UG 1RW2A 3CIAA 3UM1A 2JEKA 1S64A 3C5RA 5CCMA 4J1WA 3VLFA 5DTRA 4I43A 2IVGA 2PXKA 3UWPA 3FH7A 3C3QA 1E7VA 1TNUA 3UT4A 1D9SA 2IOSA 3QFIA 3OAWA 3L08A 3D1NI 5BXOA 4ANUA 4HVBA 1Y8MA 2RFAA 1LTXA 4ANWA 3ZEFA 4J6IA 3MKQA 4FN3A 4TXQA 1K1AA 1PC2A 3PZ2A 3ZPXA 5CBNA 3RO3A 1L5JA 1YYHA 3B13A 1BI8B 2XIUA 5FINA 1LCDA 1BDHA 4I6GA 3U4TA 1WY6A 2V5QC 3D9NA 4HXIA 3ENEA 3U3WA 2J4BA 3TJPA 3IVPA 3QARA 3SO8A 3GZ1A 2L0IA 4OAVB 1VPWA 4CGWA 3A9ZA 1H2VC 4F1PA 4JXTA 3ZYQA 3O48A 3ML9A 4TXRA 5ENPD 4MBGA 2VYIA 3TWWA 1NEQA 3FUJA 4LEUA 5JUWA 2H6IA 4I6JA 3PDNA 3R7QA 2NC9A 3DPDA 4A1GA 2QC9A 2AW6A 3NXHA 1SA5A 5CRUA 5DBKA 4ER3A 3TG4A 4J8FA 3OMTA 2B6CA 3S7BA 3SFYA 5AQ9A 3ZN3A 5AENA 4AM9A 4ER5A 4AP2A 1B0NA 4APFA 3DSTA 3GZDA 5ARGA 1DNPA 4AXHA 3P1UA 3LJNA 4K03A 1AP7A 2IUOA 5AARA 2F37A 1QPZA 2XS1A 1S63A 1E8ZA 3ULYA 2E0IA 2OCCE 2XZDG 2Y4UA 2IFUA 3G2TA 4Q69A 2PXBA 3CHPA 2X6KA 2BNOA 3E34A 4Q96A 3CK7A 1E96B 1FPPA 3LISA 3SCGA 3UPVA 3PEVB 3V2XA 4ACKA 5AQAA 2B0OE 3IXEA 1OY3D 3DEPA 1Z3YA 4YVQC 4G11A 1QQEA 2Y69E 3ONKA 3FTUA 1KT1A 2GGFA 2WQ7A 4UWGA 5HI7A 1S0PA 1OCZE 1LF8A 3CVNA 3FUNA 2KC7A 3S7FA 2ZGDA 4I1MA 3Q78A 3ZFWA 4JVSA 4DX7D 1HG2A 3OXLA 4XE0A 5BT1A 1YCSB 4V3IA 3IEGA 3FUEA 2LSUA 2C2LA 4EHMA 5ENOD 4IN3B 4XEIG 1QQBA 1ELRA 1NL4A 1TNOA 3DRAA 3EHMA 3JUIA 4ANXA 2Q7FA 1AU7A 2V8SE 3UINC 2J08A 2PQRA 1QP0A 2Y3AA 5GAGi 4K5CA 1NI1A 3TWVA 3LQXA 4EPZA 4GZDA 2DBAA 4GYYA 1H19A 4UQXA 4WNDA 1CJGA 5E76A 2OVBA 3ZXSA 1BLXB 3E37A 4X4GA 3L1PA 3FTYA 3UI2A 2XS8A 3Q75A 4U63A 1LD8A 1FT2A 4EZIA 3FUDA 1ELKA 4B93B 2F0YA 4HS2A 5KNHD 4AOFA 3Q9UC 2PXDA 3OXGA 4GZ3A 4U04A 4HRAA 3CVQA 4J8DA 2VTBA 3CLJA 4U96D 2XQ0A 3BD1A 2PUAA 4JEUA 4WWNA 3SCFA 1N0RA 3C98A 4L9PA 4HI8A 1HH8A 2PXFA 3QAQA 3EHQA 4GZ5A 3CVVA 5CECB 4GYOA 2WMNA 3CROL 3CEQA 4IULA 1HFAA 2O4AA 2WQHA 3PH0C 4JZYA 4EZKA 1Z6TA 3NOCD 3D9LA 3ULEG 2P9SG 1H2TC 2JLBA 3FTSA 4PH4B 4L23A 1MFQC 3SGHA 4FP7A 4I9CA 4ATZD 3RKVA 3BUAA 4PU3C 4H7YA 3GN5B 3TXMA 4EKGA 1ZS4A 3MYVA 3AG1E 2KM4A 4KMOA 4DX5D 5EYLA 2WXMA 3HIZA 4GQMA 1WAO1 5FZSA 1YSEA 3B7HA 5A7DB 4NQ0A 2VGXA 3I4GA 4CT0A 3EIJA 3I4RB 2ONDA 3ABME 5ARFA 3B95A 3QF3A 2R05A 2CFUA 2XCJA 4MKTA 4O6FA 5LCWC 1E90A 2PE5A 3KD7A 4B8AA 4UQYA 1K8KG 2XEVA 4U7EB 1R63A 3LVRE 1P5QA 1IXVA 2BJCA 4ER6A 4GPMA 1AWCB 3NDBB 1FT1A 4JA7A 3F52A 3FULA 3JXIA 4JHRA 2AWIA 1DULA 3J5PA 1RZRA 1K3ZD 3CKBA 2WXOA 1O5MA 2XPYA 3T5XA 5DRYA 3G0TA 1RIOA 3KZ3A 1E8WA 4CDRA 4X4CA 4B8CB 1WIZA 3B7SA 3CVUA 2AXUA 5HS0A 2GRNB 3PVLA 4K5AB 3KAEA 2L9BA 3L54A 3V2OA 3PREA 3FU3A 4I6EA 2DZOA 3PXPA 4FLHA 4HI9A 3GZSA 4YDYA 4Y42A 4ER0A 3OWQA 4MRUA 4N39A 1BDIA 4JL0A 4MS6A 1JCRA 2XENA 2FJRA 3L13A 2YINA 1JFSA 5FZRA 3IBEA 3RO2A 1JH9A 2RKKA 1MQSA 3DXMG 3HXCA 3KEZA 2PXQA 4UWHA 1DC2A 1LMB3 5JJTA 4RQIA 4EQFA 3KJXA 2CHZA 2L6BA 4Z59A 1IYGA 4OVUA 4NRHB 4YG4A 3CVWA 1PY1A 5A7LA 3D9HA 1HS6A 4O1OA 4DK5A 5B1BE 1L1MA 2BNNA 2X6IA 1U2ZA 4BTBA 3SR4A 1K1BA 3MKQB 4UI9C 1ZZ8A 3DSVA 1NFIE 1TJCA 3PZ4A 4ACLA 2VQ2A 2WXHA 5GAHi 1TYQG 3Q9NC 4GZ6A 3FHEA 2DCPA 3S7DA 2WB2A 3AAAC 3Q49B 1SW6A 3UX4A 4EBAA 5G55A 3UQ3A 3ZRHA 3QC1A 4DLOA 4I1OB 3NZUA 3V30A 4ZHBA 1IHBA 4DRXE 5D0OD 4AY6A 3HVEA 2MYOA 3RRUA 3GN5A 4J0UA 3T8KA 3SCHA 3P2BA 1TN8A 3OTNA 3T9KA 3UM3A 1OWNA 4AY5A 4GA2A 3ZKJA 1HG5A 4O60A 3QOWA 3TELA 2ZU6B 3LDZA 4U8HA 4UI9K 2KCKA 3FTXA 3D9JA 2J9QA 4CEMA 2IU1A 3CQGB 4MLPA 1LLIA 2KCLA 1IQUA 2PXPA 3M9LA 2V5FA 3TWSA 3HXFA 2KEKA 3MZLB 4X4EA 3CR3A 4QFVA 4RSYA 2IF4A 3OQMA 2XSDC 3UM2A 2XGSA 3CHSA 3UKUG 4FHKA 5EN5D 4GZCA 5IY5E 1OT8A 1SA4A 1EFAA 4HRLA 4EK9A 3X2QE 4GTMA 3DNVB 3FTWA 2H8RA 2J7UA 3V31A 3FY4A 2XGMA 4GA1A 2UY1B 3NROA 1JPLA 3ISMC 3R9MA 5KCMA 4U8YD 1IQRA 1QZXA 1N52A 4DE9A 2QYJA 5ENTD 4OYSA 2DWZA 4GTSA 4F53A 1WM5A 3UT8A 4NACA 3VK0A 1O1TA 3BS3A 3MKRA 4GYWA 4J7WA 2GW1A 1INZA 2PM6A 2LLWA 4BT9A 5AN8A 5HKPA 3O4ZA 1H2UA 2HINA 3ZHEB 1BU9A 1XWRA 3RZZA 4GTOA 3ME5A 4RLYA 2A5UA 2PXLA 5CMWA 4TRQA 4BX8A 4I6RA 3TFLA 3FH8A 2OOEA 2JQEA 4FULA 3Q47B 2KZ8A 5ITZF 1HO8A 3MLFA 2P9PG 1LQCA 3QJZA 3CQCB 4EQZA 4XKBA 5T3RA 3FUHA 1NERA 4TXPA 5A6CA 3TRBA 4LSZE 5AQ7A 2R5SA 2GROB 1Q2ZA 1NP7A 4YARA 4UWLA 2WUSR 2LYQA 4G24A 4WUYA 5J90A 3JQ0A 1RZSA 3JXBC 3ASGA 3CVPA 3S7JA 2I1JA 4WNEA 2F8YA 4PDXA 5LX8A 4NURA 3RIBA 2QFCA 3FU5A 3OP9A 4WNGA 4NIKA 5EYPF 4F6RD 2PUEA 1N9AA 3H5TA 4X8QA 4Z58A 1ZZ6A 1E8YA 3FTZA 3HDXA 4DX1A 4UUCA 4DUIA 3NQPA 3OQNA 3F51A 3AG3E 1TJFA 3FTVA 3ASOE 4LNBA 4HORA 4YG1A 4IA8A 4CYMD 3K9IA 3TWQA 2R17C 1SQMA 2BEDA 3EHRA 3QK0A 3ZYLA 5C2YA 2X38A 4LCTA 2XPIA 3DSXA 3GUUA 5DSXA 5G05J 3G5GA 4C9BB 1JWFA 3VTYA 2PXEA 1WDYA 4N5CA 3LY7A 4FADA 4ME2A 2OEWA 3CGHA 5E75A 3PE4A 5H7PA 2HSGA 1MZCA 4GCOA 4XZ4A 3IHYA 1WH6A 3ZIMA 1A5EA 3NZLA 3MGBA 1ZUGA 2WXNA 4Z5HA 5EIDA 4BFRA 5D0QD 3Q7FA 3R09A 1PAQA 3UIPC 3UKRG 2R1JL 2AVPA 3UTMA 4I8TA 3HXBA 2NSZA 3PZ3A 3QOUA 1DVPA 4PS8A 5M72A 4WVLA 2WXIA 4ZFHA 4KT6B 2MQKA 1XNFA 2PUBA 3CHQA 3TG5A 2V0PA 3L16A 1WETA 1X57A 2PQNA 1A17A 4YDEA 4KZ0A 4G25A 4FBIA 4N3AA 2DIWA 4TV3A 1EDUA 3ONLA 1O1SA 2H6HA 4UWFA 2HE0A
chains in the Genus database with same CATH topology
2RD0A 3KD7A 4A55A 2L0TB 2A4ZA 4B8AA 4URKA 1OWLA 3TAXA 3ZKCA 2D5VA 4UQYA 2XEVA 4UQZA 5ANLA 1FCHA 3EHNA 1R63A 3I3NA 3LVRE 1P5QA 4L7TA 4EZLA 2BJCA 2PIJA 4PUCA 5AIJA 2PPXA 1UN9A 4R7LA 3D3MA 1OWPA 3FU6A 3NF1A 4DI3A 1SQ8A 1BPOA 1H0AA 1TEZA 4JA7A 2CHWA 3T8MA 1E3OC 3F52A 3FULA 4X4HA 4FJZA 4JHRA 3LY9A 1OUVA 3RRNB 4AVXA 2E2EA 4JPSA 2AWIA 3QWVA 4FJYA 5CMYA 3TGOA 5DIZA 5ENNA 3UT7A 4AP2A 1RZRA 1IHGA 3CKBA 1ZZCA 4XKCA 5T8IA 2WXOA 3MA5A 5KJNA 3D9OA 4U07A 2XPYA 1OWOA 1HF8A 4PU8A 4CRWA 3T5XA 1HX8A 2WXPA 4YBAA 1KLXA 1LCCA 3G7DA 3KZ3A 1RIOA 1KT0A 1OCTC 3MV3B 4N3CA 2LSVA 1E8WA 1QP4A 4JHKA 4CDRA 4DPRA 4JC8A 3CV0A 3EIQC 2VGXB 4X4CA 4Y6WA 4B8CB 1WIZA 3B7SA 2IONA 3CVUA 2AXUA 2MRIA 3FP3A 4KVOA 3CK8A 3QQ6A 2LNIA 3PVLA 3KAEA 1XGWA 2L9BA 3L54A 3PREA 1ZAYA 5FJYA 1VDYA 3FUKA 4YVOA 5AYWD 3ZPJA 3FU3A 3ESKA 1ZPQA 3ZHMA 1PRAA 4Z5DA 4I6EA 2KEIA 3UUXA 3LPZA 2L6JA 1Z3XA 3SI5A 3FYMA 3PXPA 3G2VA 1EYHA 3D9IA 3PUKA 4J8EA 1UW4B 4FLHA 3LKUA 4JEHA 4KVMA 1QP7A 3GZSA 3IKOB 4XI0A 3BG1B 4DJAA 2XHEA 2YNQA 4E85A 1ZVVA 1X2LA 2YHCA 3KXAA 3ZVVA 2XCBA 2WXJA 2WVIA 4Y42A 3LEWA 5FWQA 5K98B 2XGOA 3S2AA 2FEZA 2VSOE 4I17A 5T4YA 4MRUA 4N39A 1BDIA 4JL0A 3ESLA 1RZRD 4MS6A 2FJRA 1R69A 3APCA 3L13A 2YINA 1NA3A 2CHXA 1JFSA 5FZRA 3IBEA 2V4LA 1JH9A 4XI9A 4GCNA 3RO2A 3TXNA 4BTAA 2FF4A 4W9RA 1MQSA 2LCVA 5G05C 3ZHEA 4ILGA 3KEZA 3UFDA 4ATGA 3BEEA 2PUFA 4FA6A 2AXVA 3KS2A 3RJVA 3ASFA 4UWHA 2LYKA 4F1SA 1LMB3 5JJTA 1HZ4A 2QY7A 4WAFA 2FULA 2VTBB 3ASDA 4EQFA 5FZQA 2HM8A 2VSNA 3KJXA 2CHZA 3ZW3A 4Z59A 5JHAA 1IYGA 4OVUA 4CGVA 1Y9QA 4NRHB 4CCAA 4YG4A 2PUCA 3CVWA 1PY1A 2I6HA 5A7LA 2MHKA 3G2SA 3MCXA 5BNWA 2P58C 1JWGA 5ANRA 3FMYA 3LJ3A 4GU5A 2X6HA 1HS6A 4PS3A 3LYAA 4N2SA 4Q94A 2PUGA 2OFYA 1IC8A 1ZZ7A 4X4DA 3MV2B 3PS6A 2GRLA 3CIAA 3GW4A 5EKQD 2JEKA 2XI8A 1PNRA 5G04C 3SZ7A 5BUZA 2XRZA 2IVQA 4G23A 5CCMA 4J1WA 3VLFA 4DK5A 4I43A 2IVBA 3VLEA 4BWRA 1CQTA 1L1MA 1POUA 2IVGA 3PZDA 3UMVA 2BNNA 2X6IA 3ASHA 4BTBA 5LCWJ 3MKQB 2JVLA 4UI9C 1ZZ8A 4MCTA 3AS5A 3FH7A 1E7VA 4ILHB 3UT4A 3HYMB 1TJCA 3FYAA 3U9WA 5JJ7A 3FFLA 2EQXA 2KZTB 2VQ2A 2IOSA 2WXHA 4ACLA 3OAWA 4U0UA 5J08A 3L08A 5G04J 3SBTB 4C0EA 2XRYA 3PNLB 4GZ6A 3D1NI 2DCPA 3JXDL 3FHEA 4RG9A 3S7DA 3PRZA 4ANUA 3L17A 2WB2A 2MOWA 3Q49B 4FU3A 3URZA 1ZZ9A 4HVBA 4RG6A 4B94A 3UX4A 4EBAA 5G55A 4IRUA 3UQ3A 3QC1A 3ZRHA 3ZYMA 1Y8MA 4APOA 4DLOA 4I1OB 1JUQA 2PUDA 3NZUA 2I1KA 2IQCA 1U3DA 1X5BA 4ANWA 3ZEFA 4J6IA 5JHBA 5D0OD 4AY6A 3HVEA 3MKQA 3L6AA 4A1SA 4FN3A 3RRUA 2KATA 3GN5A 4J0UA 3SCHA 4PU4C 1PC2A 3P2BA 1ADRA 3RO3A 1JFTA 4L1BA 3FUMA 1L5JA 3B13A 2LAIA 3RRMB 3SF4A 2WXGA 3G2UA 4OB4A 4PS7A 4X4FA 3OTNA 1UXCA 3EUSA 1HF0A 2XIUA 2PL2A 5C1DA 1QZ2A 1LCDA 5AJDA 5FQ7A 3VTXA 1BDHA 4I6GA 3U4TA 1GW6A 1WY6A 4E6HA 1OWNA 1W3BA 3D9NA 3ENEA 3LFPA 2WPVA 3FH5A 4HXIA 4GAAA 3U3WA 4AY5A 1HXIA 4GA2A 3SFZA 4BSXA 1HG5A 2J4BA 2FO7A 2ZU6B 3IVPA 3LDZA 4U8HA 3QARA 4UI9K 3TJPA 2KCKA 3FTXA 2BUGA 3Q5MA 3D9JA 3DBSA 3QWGA 2J9QA 4M3OA 3GZ1A 2L0IA 4CEMA 2KEJA 2L49A 1VPWA 3U64A 2IU1A 4F7AA 3QB2A 4CGWA 3CQGB 1PRUA 3MJWA 4MLPA 1LLIA 1H2VC 4JXTA 3ZYQA 5KJKA 2KCLA 2VSXE 1IQUA 2V5FA 3O48A 2XCCA 3ML9A 4FHJA 2KZTA 2VYIA 2KEKA 3MZLB 1HU3A 4X4EA 4DI4A 1NEQA 3CR3A 2EWTA 3FUJA 4HOQA 4LEUA 5G2NA 2KCVA 2HO1A 4QFVA 3MX3A 4I6JA 2LYPA 2VSYA 4WWOA 3GBFA 4AEZC 2J4DA 4RSYA 2X6JA 2IF4A 2VJ8A 3PDNA 3OQMA 2CG2A 5FT9A 2XSDC 3TL5A 3JCKC 2XGSA 1JWLA 4G1TA 3R7QA 2UY1A 3FWVA 2NC9A 3DPDA 4G26A 3CHSA 4A1GA 2AW6A 3HHMA 4FHKA 3SHFA 4GZCA 4ABNA 3GYZA 3CVLA 3FU0A 3R7RA 4EZJA 5DBKA 3TG4A 3ZHIA 2WXRA 2J09A 2C0MA 4JCYA 4HOSA 1WH8A 2CSFA 4J8FA 2Y4TA 2KPJA 4J8SA 3OMTA 1EFAA 3PNTB 2J07A 4I9EA 2I2OA 5KJMA 1QQAA 2AUWA 1MHQA 1U3CA 3S7BA 3D9PA 3DNVB 3FTWA 4N2QA 3FUFA 4HOTA 2H8RA 3ZN3A 4JQDA 5AENA 4AM9A 1UTXA 3F6WA 4PU7A 1E7UA 1B0NA 2A6CA 2XJ3A 2O49A 2BTDA 2XGMA 1GT0C 3FY4A 3PUJA 4GA1A 4U0ZA 4APFA 3ZYKA 5ARGA 4F3VA 2UY1B 2AXZA 3RK6A 1JPLA 3CVXA 1DNPA 2ICPA 4AXHA 4IVZA 3P1UA 5KCMA 1PRVA 3Q4AB 3IHVA 1IQRA 2ICTA 4K03A 2HYZA 1N52A 2IUOA 3AS4A 3ULQA 4I1AA 4NDWA 3OQOA 1NZNA 3SD5A 1QPZA 3E4BA 4OYSA 4F53A 2YHEA 1WM5A 3UT8A 1E8ZA 4YG7B 4NACA 2E0IA 1FVFA 3VK0A 2PM7A 2RG8A 2Y4UA 5CCLA 2IFUA 3G2TA 3BS3A 3FEYA 3MKRA 4GA0A 4K0RA 3CHPA 4LERA 4CDMA 4GYWA 4Q69A 2GW1A 2X6KA 3LY8A 2JCGA 2BNOA 4Q96A 2NXPA 3APDA 2WXLA 2PM6A 3CK7A 3JYSA 1E96B 2HR2A 3LISA 3SCGA 4BY6A 3PEUB 3PEVB 3UPVA 4BT9A 4G2VA 4ACKA 1H2UA 2HINA 2R63A 2BNMA 2WMOA 2WXFA 3O4ZA 4L2YA 1XWRA 4U0SA 3ZHEB 3RZZA 4I6TA 3LXUX 2A5UA 1Y6IA 3VLDA 5CMWA 4TRQA 1Z3YA 4YVQC 5JJ6A 3PE3A 4I6RA 2X3MA 4BX8A 4RVBA 3EDTB 4G11A 1QQEA 3FH8A 4UWKA 2WIUB 1YA0A 3ONKA 2OOEA 2FI7A 1UXDA 3FTUA 1KT1A 3L22A 4D10C 2GGFA 2WQ7A 3QKYA 4O8BA 4JA9A 4UWGA 1O4XA 4FULA 5HI7A 3Q47B 1S0PA 3OXFA 1LF8A 3CVNA 5FTPA 1Y7YA 3CHOA 2KC7A 3FEXA 3FUNA 2KZ8A 1H6KA 4N3BA 3S7FA 1HO8A 3MLFA 3CHRA 4I1MA 1LQCA 3QJZA 3CQCB 2IJGX 3ZFWA 4JVSA 3LS8A 3QWPA 1HG2A 4XKBA 1QNFA 3FUHA 1NERA 3OXLA 4XE0A 3G2WA 5T3RA 4DLQA 5BT1A 1UG3A 1OWMA 4V3IA 3AU4A 5A6CA 3CKCA 3IEGA 3TRBA 3AU5A 5LFAA 2R5SA 2LSUA 3B7RL 2C2LA 3D9KA 3CSTA 2IV1A 3FDHA 3FUEA 4KBQA 4KZCA 2I9CA 1NP7A 4I2ZA 4YARA 4UWLA 5AJLA 3B7UX 2WUSR 2LYQA 4G24A 4WUYA 5J90A 3JQ0A 4IN3B 3D9MA 1RZSA 4IYPA 3JXBC 3ASGA 4CT4A 3CVYA 3CVPA 3S7JA 2I1JA 4WNEA 1QQBA 1ELRA 4PDXA 4B0ZA 4XIFA 3EHMA 3JUIA 2FBNA 5LX8A 2OV8A 4NURA 4MCXA 3RIBA 4ANXA 3R1FA 2Q7FA 2L8NA 2QFCA 5FQ4A 5LP0A 4EBAG 1AU7A 2V8SE 3FU5A 4HLEA 3OP9A 2OR1L 4WNGA 2J08A 4WWPA 2PQRA 2CFZA 2XPZA 2PUEA 1QP0A 2Y3AA 3GZ2A 3O9XA 3I5PA 2LAHA 3H5TA 1UJKA 4Z58A 1E8YA 1ZZ6A 2LYRA 3FTZA 3HDXA 1PERL 5LOZA 5A23A 4JCXA 3N71A 4LRZA 4XX5A 4EPZA 4GZDA 3NQPA 3OQNA 2DBAA 4FC8A 1H19A 4GYYA 3F51A 2LYSA 4UQXA 4WNDA 4CDNA 1DW9A 1ZZBA 3CK9A 1DWKA 1TJFA 3APFA 3T5VA 3FTVA 2IU7A 4X4BA 1CJGA 4P29A 5E76A 2OVBA 2CROA 2UWJG 4YG1A 4GB9A 3ZXSA 4HORA 4JW1A 1N54A 3ML8A 4F8DA 5EDSA 5CHEE 2LYLA 2EF8A 4X4GA 3L1PA 3FTYA 4IA8A 1EF1C 4U63A 3K9IA 4OVVA 1ZU2A 2R17C 2M63A 1ELKA 3FUDA 3U66A 1SQMA 3B7TA 2ILRA 1HE8A 3QK0A 4HS2A 5FQ6A 4AOFA 2LO6A 5BPPA 4ILIA 4HFGA 3BG0B 5C2YA 3ZYLA 2X38A 4KYOB 4LCTA 2XPIA 2EBYA 3OXGA 4GZ3A 4U04A 4AV7A 3QWWA 4X4IA 3CVQA 4J8DA 2VTBA 2OVFA 2B5AA 5G05J 5KJLA 3CLJA 3CECA 4GPKA 2XQ0A 3G5GA 3BD1A 4C9BB 2C0LA 3Q15A 3ZGQA 1JWFA 2PUAA 1SZAA 3VTYA 4Y6CA 4JEUA 5EX0A 4Z5CA 1ZBPA 4N5CA 4WWNA 3R9AB 3WXXA 3SCFA 3LY7A 4FADA 3C98A 4B89A 2J49A 4ME2A 4AJWA 1HH8A 2GZUA 3EJNA 4GHJA 3CGHA 4I2WA 1NA0A 3QAQA 3AS8A 5E75A 3CVVA 2VGYA 3PE4A 4GZ5A 5FQ8A 2HSGA 2IOLA 3CHMA 2X6FA 4EECA 3IV0A 2O38A 4GCOA 4GYOA 4XZ4A 2WMNA 3CROL 2PZIA 2GRMA 2BF0X 4A3VA 3CEQA 4IULA 2R59A 3IHYA 1HFAA 2O4AA 1WH6A 2YQ8A 2WQHA 3ZIMA 3PH0C 3BDNA 4JZYA 1ELWA 3MGBA 4H7XA 1Z6TA 4EZKA 1OSLA 3D9LA 3QDNA 1ZUGA 2WXNA 3FUIA 1H2TC 2JLBA 3FTSA 4GMLA 4L23A 4PH4B 4Z5HA 3SGHA 4C0MA 4FP7A 4BFRA 3QNKA 5D0QD 4I9CA 1UJJA 2CG3A 3RKVA 2WXKA 3HVEB 1PAQA 4PU3C 4A3TA 2R1JL 4KXKB 4ANVA 2AVPA 3CSFA 4LUNU 3NZSA 4H7YA 4IWRA 3GN5B 4I8TA 3TXMA 1INZA 2NSZA 2LYJA 3JXCL 3RU0A 1ZS4A 3MYVA 3HZIB 1DVPA 3CLCA 2KM4A 3QOUA 4PS8A 4KMOA 5M72A 2WXIA 3LCAA 4YNDA 1SZ9A 2WXMA 3HIZA 2MQKA 4FLBA 4I6UA 1XNFA 4GQMA 2MEZA 4KT6B 1WAO1 4JHJA 2WXQA 5EX3A 4BT8A 1RPEL 2PUBA 1YSEA 3CHQA 3B7HA 2V0PA 5FZSA 3L16A 5A7DB 3TG5A 1WETA 4NQ0A 1UN8A 1X57A 2PQNA 2VGXA 3I4GA 3JQ1A 3SBSA 1A17A 4BX9A 4CT0A 1B89A 3EIJA 2WQ6A 3I4RB 3SNXA 2ONDA 4J1XA 4KZ0A 4TUUA 1E8XA 4G25A 5ARFA 3MEKA 1EPUA 4FBIA 4WNFA 5BV1A 4N3AA 5BW8C 2DIWA 2WM9A 3QF3A 1EDUA 4TV3A 4AIFA 3ONLA 4L2LA 5BV0A 4HOUA 4GMJA 3S8QA 2CFUA 2XCJA 4UI9J 1S7EA 3LVQE 4UWFA 4MKTA 4O6FA 5LCWC 3QYXA 5HQ8A 1E90A 1FVHA 2PE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQT A;  1L1M A;  1POU A;  2IVG A;  4JCX A;  2AXZ A;  2BNN A;  3ZKC A;  2D5V A;  2JVL A;  1ZZ8 A;  2ICP A;  3OQN A;  4IVZ A;  3F51 A;  2LYS A;  4MCT A;  1PRV A;  1R63 A;  1DW9 A;  1ZZB A;  1DWK A;  2ICT A;  3FYA A;  2IUO A;  2BJC A;  2IU7 A;  2PIJ A;  4X4B A;  1CJG A;  2PPX A;  4NDW A;  2CRO A;  3OQO A;  4YG1 A;  1SQ8 A;  4F8D A;  2LYL A;  2EF8 A;  4X4G A;  3L1P A;  1E3O C;  3F52 A;  3D1N I;  4X4H A;  4IA8 A;  3JXD L;  1QPZ A;  4YG7 B;  1ZZ9 A;  2AWI A;  3VK0 A;  1RZR A;  2PUD A;  3BS3 A;  1ZZC A;  2EBY A;  2BNO A;  2JCG A;  4PU8 A;  4FN3 A;  3LIS A;  3SCG A;  4X4I A;  4YBA A;  1LCC A;  2B5A A;  3G7D A;  3GN5 A;  3KZ3 A;  3SCH A;  4PU4 C;  1RIO A;  1OCT C;  3CEC A;  2HIN A;  2R63 A;  2BNM A;  3BD1 A;  3G5G A;  1QP4 A;  1ADR A;  1XWR A;  1JFT A;  2PUA A;  3RZZ A;  4X4C A;  4I6T A;  1WIZ A;  4Z5C A;  3SCF A;  2AXU A;  4OB4 A;  4X4F A;  1UXC A;  3EUS A;  3QQ6 A;  1HF0 A;  2XIU A;  4I6R A;  2GZU A;  4GHJ A;  1LCD A;  1ZAY A;  1BDH A;  2WIU B;  1UXD A;  2HSG A;  3LFP A;  1ZPQ A;  3ZHM A;  3U3W A;  2O38 A;  4O8B A;  1PRA A;  4Z5D A;  1O4X A;  4PU7 A;  2KEI A;  3CRO L;  2GRM A;  3FYM A;  3PXP A;  3IVP A;  2O4A A;  1WH6 A;  1QP7 A;  3BDN A;  1Y7Y A;  3QWG A;  2KZ8 A;  1OSL A;  2KEJ A;  2L49 A;  3MLF A;  1VPW A;  1ZVV A;  1LQC A;  1X2L A;  1PRU A;  1ZUG A;  3KXA A;  1LLI A;  4Y42 A;  5K98 B;  4Z5H A;  1PER L;  1NER A;  1BDI A;  1RZR D;  2FJR A;  1R69 A;  2KEK A;  2XJ3 A;  3TRB A;  4X4E A;  4PU3 C;  1JFS A;  2R1J L;  1NEQ A;  1JH9 A;  2EWT A;  2IV1 A;  4IWR A;  3GN5 B;  4I8T A;  2LYJ A;  3JXC L;  1ZS4 A;  2LYP A;  2LCV A;  4YAR A;  3GBF A;  3HZI B;  3CLC A;  3UFD A;  2WUS R;  2LYQ A;  2PUF A;  1B0N A;  3OQM A;  2AXV A;  2XSD C;  2LYK A;  2MQK A;  1JWL A;  4I6U A;  1LMB 3;  1RZS A;  2MEZ A;  4GQM A;  3JXB C;  1RPE L;  2PUB A;  1YSE A;  3B7H A;  3KJX A;  2AW6 A;  4Z59 A;  1WET A;  1Y9Q A;  1X57 A;  4YG4 A;  2PE5 A;  1QQB A;  2PUC A;  5A7L A;  3ZHI A;  4J1X A;  4MCX A;  3FMY A;  3R1F A;  2L8N A;  4JCY A;  1WH8 A;  2CSF A;  1AU7 A;  4FBI A;  2OFY A;  2PUG A;  2KPJ A;  3OP9 A;  3OMT A;  1IC8 A;  1EFA A;  1ZZ7 A;  2OR1 L;  4X4D A;  2GRL A;  3QF3 A;  1QQA A;  2AUW A;  3S8Q A;  1QP0 A;  2XCJ A;  2XI8 A;  3DNV B;  2PUE A;  1S7E A;  3O9X A;  1PNR A;  2H8R A;  2IVQ A;  4JQD A;  4J1W A;  3H5T A;  1UTX A;  2IVB A;  3F6W A;  2A6C A;  1ZZ6 A;  4Z58 A;  2LYR A;  3QYX A;  2O49 A;  1GT0 C; 
#chains in the Genus database with same CATH topology
 2RD0 A;  4A55 A;  2L0T B;  3Q79 A;  4BEP A;  4UQZ A;  3DSU A;  3EU9 A;  4GTP A;  2PIJ A;  4PUC A;  2PPX A;  4R7L A;  5B3S E;  3D3M A;  1BPO A;  1TEZ A;  2CHW A;  5CER B;  3GZC A;  1E3O C;  1OUV A;  3NB2 A;  4G8L A;  4AVX A;  2E2E A;  3F6Q A;  3WG7 E;  3TWU A;  3TGO A;  5DIZ A;  1ZZC A;  3NBN B;  3MV3 B;  1KLX A;  1OCT C;  3KSQ A;  4JHK A;  2ETC A;  4Y6W A;  4HBD A;  2MRI A;  1OCR E;  3FP3 A;  3QQ6 A;  5FJY A;  1VDY A;  5AYW D;  3ZHM A;  1PRA A;  3G2V A;  4JEH A;  4GTT A;  3IKO B;  2XHE A;  2RFM A;  3ZVV A;  5FWQ A;  2WVI A;  2XGO A;  3S2A A;  4I17 A;  2VSO E;  5T4Y A;  2M4H A;  1BD8 A;  4BTA A;  4XI9 A;  2FF4 A;  2R02 A;  3AG4 E;  3UFD A;  4ATG A;  2PUF A;  2LXM A;  2EIK E;  3KS2 A;  2VTB B;  2HM8 A;  2VSN A;  5JHA A;  4CGV A;  1Y9Q A;  2HFZ A;  2PUC A;  1YMP A;  3G2S A;  5BNW A;  3B7B A;  1JWG A;  3LJ3 A;  3LYA A;  4Q94 A;  2P2C P;  1TR4 A;  5CBO A;  5EKQ D;  2XI8 A;  3ASN E;  5JMN D;  1PNR A;  5G04 C;  5AAO A;  5BUZ A;  2XEH A;  2IVQ A;  2IVB A;  3VLE A;  1CQT A;  1POU A;  3PZD A;  5ENS D;  3TWR A;  3AS5 A;  3FYA A;  3U9W A;  3FFL A;  2EQX A;  5HRY A;  4U0U A;  3SBT B;  5G04 J;  2XRY A;  1NW3 A;  1RZ4 A;  2XZT G;  4RG9 A;  1KZP A;  3KSL A;  2MOW A;  4FU3 A;  3URZ A;  1ZZ9 A;  4APO A;  3ZYM A;  2VEO A;  1JUQ A;  2PUD A;  2I1K A;  1U3D A;  3L6A A;  4QQI A;  4A1S A;  1OCO E;  4HQD A;  3KEA A;  2ZIS A;  2J8S D;  2LAI A;  3RRM B;  5DRT A;  3SF4 A;  4PS7 A;  4X4F A;  5AJD A;  5FQ7 A;  3VTX A;  1TNY A;  2Y0B G;  2P9L G;  4E6H A;  1W3B A;  3FH5 A;  1MJ0 A;  2WPV A;  3SFZ A;  5B1A E;  2FO7 A;  3NAW A;  3QWG A;  4M3O A;  2KEJ A;  2L49 A;  2EIN E;  5KJK A;  2XCC A;  2KZT A;  1HU3 A;  1OXJ A;  4HOQ A;  5G2N A;  2XXQ A;  3MX3 A;  1UOH A;  4AEZ C;  4WWO A;  5KBA A;  2KBX A;  2X6J A;  1LD7 A;  2VJ8 A;  2CG2 A;  5FT9 A;  3JCK C;  1JWL A;  2UY1 A;  3FWV A;  2H6G A;  3HHM A;  3SHF A;  3CVL A;  3DSW A;  3R7R A;  2WXR A;  2J09 A;  5BXU A;  2CSF A;  4J8S A;  4EKI A;  4I9E A;  5KJM A;  1QQA A;  2AUW A;  1MHQ A;  1U3C A;  4N2Q A;  3FUF A;  4HOT A;  1UTX A;  3F6W A;  4PU7 A;  2A6C A;  3PUJ A;  1E7U A;  3ZYK A;  4F3V A;  2GRR B;  3CVX A;  2ICP A;  4IVZ A;  1PRV A;  3IHV A;  2JAB A;  1D8E A;  1D8D A;  1S70 B;  4NDW A;  4I1A A;  3OQO A;  3E4B A;  4YG7 B;  2PM7 A;  5CCL A;  4LER A;  2JCG A;  2NXP A;  3APD A;  4BY6 A;  3UM0 A;  3PEU B;  1X81 A;  2WMO A;  3L9T A;  2WXF A;  4L2Y A;  3J5Q B;  1N94 A;  1Y6I A;  3VLD A;  4RVB A;  1H6P A;  1JCS A;  3L22 A;  2FI7 A;  1UXD A;  5CEA A;  3QKY A;  4JA9 A;  3MEJ A;  3JXJ A;  4N3B A;  1Y7Y A;  3FEX A;  3KL4 A;  1H6K A;  3CHR A;  4LG6 A;  1KPS B;  1QNF A;  1UG3 A;  1OWM A;  1Z5S C;  3AU4 A;  3CST A;  3GZD C;  4KBQ A;  4G8K A;  4KZC A;  2I9C A;  5AJL A;  3B7U X;  3TEP A;  3CVY A;  4LNU D;  2HCN A;  3V79 K;  4B0Z A;  2OV8 A;  4MCX A;  2L8N A;  5FQ4 A;  5LP0 A;  4HLE A;  4WWP A;  2CFZ A;  2XPZ A;  2XXP A;  3TWX A;  3GZ2 A;  1UJK A;  4GTQ A;  2LYR A;  1PER L;  5LOZ A;  5A23 A;  3BQO A;  3N71 A;  1IKN D;  2LYS A;  1ZZB A;  3T5V A;  1DWK A;  4P29 A;  2CRO A;  4U95 D;  3C3O A;  1N54 A;  3HG0 D;  4F8D A;  5EDS A;  5CHE E;  2LYL A;  2EF8 A;  1EF1 C;  4OVV A;  1ZU2 A;  1QYM A;  2IO3 C;  1HE8 A;  4ILI A;  3EU5 A;  4AV7 A;  3QWW A;  4X4I A;  3Q15 A;  1SZA A;  3WXX A;  5EX0 A;  1WG0 A;  4Z5C A;  1ZBP A;  1JCQ A;  3R9A B;  4B89 A;  2J49 A;  1G3N B;  2GZU A;  3EJN A;  1NA0 A;  3AS8 A;  2VGY A;  5FQ8 A;  3CHM A;  2OEV A;  2LXL A;  2GRM A;  2BF0 X;  2ZXW E;  3E33 A;  4A3V A;  2R59 A;  2YQ8 A;  3BDN A;  1DCQ A;  1ELW A;  3RSE G;  3FUI A;  4GML A;  4C0M A;  1N11 A;  2CG3 A;  2WXK A;  4A3T A;  4KXK B;  3CSF A;  3NZS A;  4U8V D;  3OKZ A;  1SVX A;  4CZ2 D;  3RU0 A;  3HZI B;  1TN6 A;  4YND A;  4BT8 A;  4JHJ A;  1RPE L;  2LLV A;  1N4R A;  4Q2J A;  4ER7 A;  3DPY A;  3SBS A;  4BX9 A;  2WQ6 A;  3DM5 A;  1B89 A;  3L82 A;  1N95 A;  3SNX A;  1V54 E;  2F8X K;  4WNF A;  5BV1 A;  2P9N G;  5BW8 C;  4DX6 D;  2WM9 A;  2LNM A;  4AIF A;  4HOU A;  3S8Q A;  3LVQ E;  3SFX A;  3TWT A;  2A4Z A;  4URK A;  5KNG A;  5ANL A;  4L7T A;  2EIJ E;  5FIO A;  5LFA A;  1N4Q A;  1H0A A;  1MX6 A;  4HRN A;  3T8M A;  4FJZ A;  4X4H A;  2ZIR A;  2EIM E;  4JPS A;  4FJY A;  1BI7 B;  3UT7 A;  1U2V G;  2J7W A;  5T8I A;  4K5B A;  3D9O A;  1OWO A;  1HX8 A;  2WXP A;  1LCC A;  4YBA A;  4N3C A;  3G7D A;  4JC8 A;  3EIQ C;  1KZO A;  2ETA A;  3Q7A A;  3C3R A;  4KVO A;  2QZA A;  3CK8 A;  2LNI A;  2A5E A;  1O1R A;  1XGW A;  1ZAY A;  3ESK A;  1ZPQ A;  2XEE A;  4BER A;  4Z5D A;  3UUX A;  2KEI A;  3LPZ A;  3SI5 A;  1Z3X A;  3PUK A;  3D9I A;  4HRM B;  3E30 A;  4XI0 A;  3BG1 B;  4DJA A;  4GTV A;  4E85 A;  1ZVV A;  1X2L A;  2YHC A;  2FEZ A;  2BKG A;  3EUV A;  3APC A;  3ZUV B;  1OCC E;  1NA3 A;  2CHX A;  4GCN A;  4W9R A;  2FFH A;  2R2L A;  5G05 C;  2FO1 E;  2ODR D;  5CED B;  3RJV A;  3ABK E;  3ASF A;  3E32 A;  4WAF A;  2QY7 A;  4BSZ B;  2FUL A;  3ASD A;  3UIO C;  3AJI A;  2I6H A;  2MHK A;  1MX4 A;  5ANR A;  3FMY A;  4GU5 A;  2X6H A;  4PS3 A;  2PUG A;  1IC8 A;  1ZZ7 A;  3PS6 A;  3MV2 B;  2GRL A;  3DEO A;  3GW4 A;  5D2M C;  3SZ7 A;  2XRZ A;  4G23 A;  5DTQ A;  4BWR A;  3UMV A;  3ASH A;  4HLL A;  5LCW J;  2JVL A;  4MCT A;  4ILH B;  3HYM B;  4N5Q A;  5JJ7 A;  2KZT B;  5J08 A;  4C0E A;  2EIL E;  3PNL B;  3DXK G;  3JXD L;  3PRZ A;  3L17 A;  4RG6 A;  4B94 A;  4IRU A;  2IQC A;  1X5B A;  5JHB A;  3BU8 A;  2DVW A;  2PXU A;  2KAT A;  4PU4 C;  1ADR A;  1JFT A;  4L1B A;  3FUM A;  2WXG A;  3G2U A;  4OB4 A;  4OAU C;  4GTR A;  1UXC A;  3EUS A;  1HF0 A;  2PL2 A;  5C1D A;  1QZ2 A;  1GW6 A;  3LFP A;  3QOX A;  4GAA A;  1HXI A;  1TNB A;  4BSX A;  3Q5M A;  2BUG A;  3DBS A;  1TN7 A;  3U64 A;  4F7A A;  3QB2 A;  3MJW A;  1PRU A;  2VSX E;  4HB5 A;  4FHJ A;  3JUE A;  4DI4 A;  3W9G A;  2EWT A;  3HXD A;  5AQB A;  2AJA A;  2KCV A;  2HO1 A;  1TNZ A;  2LYP A;  2VSY A;  3GBF A;  2J4D A;  3TL5 A;  2DZN A;  2P9K G;  2V3C C;  4G1T A;  4G26 A;  4ABN A;  3GYZ A;  2LUH A;  3FU0 A;  4EZJ A;  3ZHI A;  2C0M A;  4JCY A;  1WH8 A;  2Y4T A;  2KPJ A;  3PNT B;  2J07 A;  2I2O A;  3D9P A;  4JQD A;  2O49 A;  2BTD A;  2XJ3 A;  4U0Z A;  4DX2 A;  1GT0 C;  3U66 A;  1DCE A;  2AXZ A;  5KWD A;  3RK6 A;  3Q4A B;  2ICT A;  2HYZ A;  1N0Q A;  3AS4 A;  3ULQ A;  1NZN A;  3SD5 A;  2VGE A;  3PZ1 A;  2YHE A;  1FVF A;  2RG8 A;  3FEY A;  4GA0 A;  4K0R A;  4CDM A;  4HOS A;  3LY8 A;  4DE8 A;  2WXL A;  3JYS A;  2HR2 A;  4G2V A;  2R63 A;  2BNM A;  4U0S A;  3UXG A;  4I6T A;  2NYJ A;  3LXU X;  5JJ6 A;  3PE3 A;  2X3M A;  2PXV A;  3EDT B;  4UWK A;  2BKK B;  2WIU B;  1YA0 A;  2GRQ B;  4D10 C;  4O8B A;  1O4X A;  3HRA A;  2GRP B;  3OXF A;  5FTP A;  3CHO A;  2H6F A;  4M7C A;  1V55 E;  2IJG X;  3LS8 A;  3QWP A;  3G2W A;  4DLQ A;  4YDO A;  3ABL E;  3CKC A;  3AU5 A;  3B7R L;  3FDH A;  3D9K A;  2IV1 A;  3SY2 A;  4I2Z A;  5EIL A;  2MXD A;  3D9M A;  5EIB E;  4IYP A;  4CT4 A;  2IY0 C;  2IEJ A;  4XIF A;  2FBN A;  3ZXP A;  4BET A;  3R1F A;  4EBA G;  2KXP C;  2OR1 L;  2Y1L E;  1MX2 A;  3O9X A;  3I5P A;  2LAH A;  4OBM A;  4JB8 P;  4C48 B;  2PXT A;  4JCX A;  4LRZ A;  4XX5 A;  4FC8 A;  4CDN A;  1DW9 A;  3CK9 A;  4YDW A;  3APF A;  3PE5 A;  2IU7 A;  4X4B A;  2UWJ G;  4GB9 A;  4JW1 A;  5DT2 A;  3ML8 A;  2M63 A;  3B7T A;  2ILR A;  5FQ6 A;  2DYR E;  5BPP A;  2LO6 A;  4HFG A;  3BG0 B;  4KYO B;  1QB2 A;  2EBY A;  2P9I G;  2OVF A;  2B5A A;  5KJL A;  3CEC A;  4GPK A;  2C0L A;  3ZGQ A;  4Y6C A;  3SQV A;  3NOG D;  3Q73 A;  4AJW A;  4GHJ A;  4I2W A;  2IOL A;  4EEC A;  2X6F A;  3IV0 A;  2O38 A;  5JA4 D;  2PZI A;  1N4S A;  4H7X A;  1H6O A;  1OSL A;  3QDN A;  5DTM A;  2YBD A;  3A9X A;  1N4P A;  3QNK A;  3ZU7 B;  1UJJ A;  4Z68 A;  3ZNG A;  3HVE B;  4ANV A;  3AG2 E;  4LUN U;  4IWR A;  2LYJ A;  4JD2 G;  3JXC L;  3CLC A;  3LCA A;  1SZ9 A;  2QYU A;  4FLB A;  4I6U A;  5EX3 A;  2MEZ A;  2WXQ A;  5CRV A;  1UN8 A;  3JQ1 A;  4J1X A;  4TUU A;  1E8X A;  3MEK A;  1EPU A;  5BV0 A;  4L2L A;  4GMJ A;  4UI9 J;  1S7E A;  3QYX A;  5HQ8 A;  1FVH A;  5ENR D;  1OWL A;  3TAX A;  3ZKC A;  2D5V A;  2IO2 C;  1FCH A;  3EHN A;  3I3N A;  4EZL A;  5AIJ A;  1UN9 A;  1ZB1 A;  1OWP A;  3FU6 A;  3NF1 A;  4DI3 A;  1SQ8 A;  3LY9 A;  3RRN B;  3QWV A;  5CMY A;  4O1P A;  2PNN A;  4TUM A;  5ENN A;  2R03 A;  1IHG A;  2DYS E;  4A63 B;  4XKC A;  3MA5 A;  5KJN A;  3C72 A;  4U07 A;  1HF8 A;  4PU8 A;  4CRW A;  4BES A;  1KT0 A;  3SX0 A;  5ENQ D;  2LSV A;  1QP4 A;  4DPR A;  3CV0 A;  2VGX B;  2L1P A;  2ION A;  3FUK A;  4YVO A;  3ZPJ A;  2L6J A;  3FYM A;  4J8E A;  1EYH A;  4J8Y A;  1UW4 B;  2ZGG A;  3LKU A;  4KVM A;  1QP7 A;  1MYO A;  2YNQ A;  3KXA A;  2XCB A;  2WXJ A;  3LEW A;  4GMR A;  5K98 B;  3HXE A;  2ETB A;  5D66 A;  3ESL A;  1RZR D;  4LNG A;  1R69 A;  1HQ1 A;  3TXN A;  2V4L A;  3RAU A;  2LCV A;  1QBQ A;  3ZHE A;  4ILG A;  3BEE A;  4FA6 A;  2AXV A;  2LYK A;  4F1S A;  1HZ4 A;  3W9F A;  3A9Y A;  5FZQ A;  3DSS A;  3DWL G;  4HNA D;  3ZW3 A;  2XXA A;  4CCA A;  3VWS A;  3MCX A;  2P58 C;  4N2S A;  2OFY A;  2V4H C;  2HCS A;  4X4D A;  2P9U G;  1RW2 A;  3CIA A;  3UM1 A;  2JEK A;  1S64 A;  3C5R A;  5CCM A;  4J1W A;  3VLF A;  5DTR A;  4I43 A;  2IVG A;  2PXK A;  3UWP A;  3FH7 A;  3C3Q A;  1E7V A;  1TNU A;  3UT4 A;  1D9S A;  2IOS A;  3QFI A;  3OAW A;  3L08 A;  3D1N I;  5BXO A;  4ANU A;  4HVB A;  1Y8M A;  2RFA A;  1LTX A;  4ANW A;  3ZEF A;  4J6I A;  3MKQ A;  4FN3 A;  4TXQ A;  1K1A A;  1PC2 A;  3PZ2 A;  3ZPX A;  5CBN A;  3RO3 A;  1L5J A;  1YYH A;  3B13 A;  1BI8 B;  2XIU A;  5FIN A;  1LCD A;  1BDH A;  4I6G A;  3U4T A;  1WY6 A;  2V5Q C;  3D9N A;  4HXI A;  3ENE A;  3U3W A;  2J4B A;  3TJP A;  3IVP A;  3QAR A;  3SO8 A;  3GZ1 A;  2L0I A;  4OAV B;  1VPW A;  4CGW A;  3A9Z A;  1H2V C;  4F1P A;  4JXT A;  3ZYQ A;  3O48 A;  3ML9 A;  4TXR A;  5ENP D;  4MBG A;  2VYI A;  3TWW A;  1NEQ A;  3FUJ A;  4LEU A;  5JUW A;  2H6I A;  4I6J A;  3PDN A;  3R7Q A;  2NC9 A;  3DPD A;  4A1G A;  2QC9 A;  2AW6 A;  3NXH A;  1SA5 A;  5CRU A;  5DBK A;  4ER3 A;  3TG4 A;  4J8F A;  3OMT A;  2B6C A;  3S7B A;  3SFY A;  5AQ9 A;  3ZN3 A;  5AEN A;  4AM9 A;  4ER5 A;  4AP2 A;  1B0N A;  4APF A;  3DST A;  3GZD A;  5ARG A;  1DNP A;  4AXH A;  3P1U A;  3LJN A;  4K03 A;  1AP7 A;  2IUO A;  5AAR A;  2F37 A;  1QPZ A;  2XS1 A;  1S63 A;  1E8Z A;  3ULY A;  2E0I A;  2OCC E;  2XZD G;  2Y4U A;  2IFU A;  3G2T A;  4Q69 A;  2PXB A;  3CHP A;  2X6K A;  2BNO A;  3E34 A;  4Q96 A;  3CK7 A;  1E96 B;  1FPP A;  3LIS A;  3SCG A;  3UPV A;  3PEV B;  3V2X A;  4ACK A;  5AQA A;  2B0O E;  3IXE A;  1OY3 D;  3DEP A;  1Z3Y A;  4YVQ C;  4G11 A;  1QQE A;  2Y69 E;  3ONK A;  3FTU A;  1KT1 A;  2GGF A;  2WQ7 A;  4UWG A;  5HI7 A;  1S0P A;  1OCZ E;  1LF8 A;  3CVN A;  3FUN A;  2KC7 A;  3S7F A;  2ZGD A;  4I1M A;  3Q78 A;  3ZFW A;  4JVS A;  4DX7 D;  1HG2 A;  3OXL A;  4XE0 A;  5BT1 A;  1YCS B;  4V3I A;  3IEG A;  3FUE A;  2LSU A;  2C2L A;  4EHM A;  5ENO D;  4IN3 B;  4XEI G;  1QQB A;  1ELR A;  1NL4 A;  1TNO A;  3DRA A;  3EHM A;  3JUI A;  4ANX A;  2Q7F A;  1AU7 A;  2V8S E;  3UIN C;  2J08 A;  2PQR A;  1QP0 A;  2Y3A A;  5GAG i;  4K5C A;  1NI1 A;  3TWV A;  3LQX A;  4EPZ A;  4GZD A;  2DBA A;  4GYY A;  1H19 A;  4UQX A;  4WND A;  1CJG A;  5E76 A;  2OVB A;  3ZXS A;  1BLX B;  3E37 A;  4X4G A;  3L1P A;  3FTY A;  3UI2 A;  2XS8 A;  3Q75 A;  4U63 A;  1LD8 A;  1FT2 A;  4EZI A;  3FUD A;  1ELK A;  4B93 B;  2F0Y A;  4HS2 A;  5KNH D;  4AOF A;  3Q9U C;  2PXD A;  3OXG A;  4GZ3 A;  4U04 A;  4HRA A;  3CVQ A;  4J8D A;  2VTB A;  3CLJ A;  4U96 D;  2XQ0 A;  3BD1 A;  2PUA A;  4JEU A;  4WWN A;  3SCF A;  1N0R A;  3C98 A;  4L9P A;  4HI8 A;  1HH8 A;  2PXF A;  3QAQ A;  3EHQ A;  4GZ5 A;  3CVV A;  5CEC B;  4GYO A;  2WMN A;  3CRO L;  3CEQ A;  4IUL A;  1HFA A;  2O4A A;  2WQH A;  3PH0 C;  4JZY A;  4EZK A;  1Z6T A;  3NOC D;  3D9L A;  3ULE G;  2P9S G;  1H2T C;  2JLB A;  3FTS A;  4PH4 B;  4L23 A;  1MFQ C;  3SGH A;  4FP7 A;  4I9C A;  4ATZ D;  3RKV A;  3BUA A;  4PU3 C;  4H7Y A;  3GN5 B;  3TXM A;  4EKG A;  1ZS4 A;  3MYV A;  3AG1 E;  2KM4 A;  4KMO A;  4DX5 D;  5EYL A;  2WXM A;  3HIZ A;  4GQM A;  1WAO 1;  5FZS A;  1YSE A;  3B7H A;  5A7D B;  4NQ0 A;  2VGX A;  3I4G A;  4CT0 A;  3EIJ A;  3I4R B;  2OND A;  3ABM E;  5ARF A;  3B95 A;  3QF3 A;  2R05 A;  2CFU A;  2XCJ A;  4MKT A;  4O6F A;  5LCW C;  1E90 A;  2PE5 A;  3KD7 A;  4B8A A;  4UQY A;  1K8K G;  2XEV A;  4U7E B;  1R63 A;  3LVR E;  1P5Q A;  1IXV A;  2BJC A;  4ER6 A;  4GPM A;  1AWC B;  3NDB B;  1FT1 A;  4JA7 A;  3F52 A;  3FUL A;  3JXI A;  4JHR A;  2AWI A;  1DUL A;  3J5P A;  1RZR A;  1K3Z D;  3CKB A;  2WXO A;  1O5M A;  2XPY A;  3T5X A;  5DRY A;  3G0T A;  1RIO A;  3KZ3 A;  1E8W A;  4CDR A;  4X4C A;  4B8C B;  1WIZ A;  3B7S A;  3CVU A;  2AXU A;  5HS0 A;  2GRN B;  3PVL A;  4K5A B;  3KAE A;  2L9B A;  3L54 A;  3V2O A;  3PRE A;  3FU3 A;  4I6E A;  2DZO A;  3PXP A;  4FLH A;  4HI9 A;  3GZS A;  4YDY A;  4Y42 A;  4ER0 A;  3OWQ A;  4MRU A;  4N39 A;  1BDI A;  4JL0 A;  4MS6 A;  1JCR A;  2XEN A;  2FJR A;  3L13 A;  2YIN A;  1JFS A;  5FZR A;  3IBE A;  3RO2 A;  1JH9 A;  2RKK A;  1MQS A;  3DXM G;  3HXC A;  3KEZ A;  2PXQ A;  4UWH A;  1DC2 A;  1LMB 3;  5JJT A;  4RQI A;  4EQF A;  3KJX A;  2CHZ A;  2L6B A;  4Z59 A;  1IYG A;  4OVU A;  4NRH B;  4YG4 A;  3CVW A;  1PY1 A;  5A7L A;  3D9H A;  1HS6 A;  4O1O A;  4DK5 A;  5B1B E;  1L1M A;  2BNN A;  2X6I A;  1U2Z A;  4BTB A;  3SR4 A;  1K1B A;  3MKQ B;  4UI9 C;  1ZZ8 A;  3DSV A;  1NFI E;  1TJC A;  3PZ4 A;  4ACL A;  2VQ2 A;  2WXH A;  5GAH i;  1TYQ G;  3Q9N C;  4GZ6 A;  3FHE A;  2DCP A;  3S7D A;  2WB2 A;  3AAA C;  3Q49 B;  1SW6 A;  3UX4 A;  4EBA A;  5G55 A;  3UQ3 A;  3ZRH A;  3QC1 A;  4DLO A;  4I1O B;  3NZU A;  3V30 A;  4ZHB A;  1IHB A;  4DRX E;  5D0O D;  4AY6 A;  3HVE A;  2MYO A;  3RRU A;  3GN5 A;  4J0U A;  3T8K A;  3SCH A;  3P2B A;  1TN8 A;  3OTN A;  3T9K A;  3UM3 A;  1OWN A;  4AY5 A;  4GA2 A;  3ZKJ A;  1HG5 A;  4O60 A;  3QOW A;  3TEL A;  2ZU6 B;  3LDZ A;  4U8H A;  4UI9 K;  2KCK A;  3FTX A;  3D9J A;  2J9Q A;  4CEM A;  2IU1 A;  3CQG B;  4MLP A;  1LLI A;  2KCL A;  1IQU A;  2PXP A;  3M9L A;  2V5F A;  3TWS A;  3HXF A;  2KEK A;  3MZL B;  4X4E A;  3CR3 A;  4QFV A;  4RSY A;  2IF4 A;  3OQM A;  2XSD C;  3UM2 A;  2XGS A;  3CHS A;  3UKU G;  4FHK A;  5EN5 D;  4GZC A;  5IY5 E;  1OT8 A;  1SA4 A;  1EFA A;  4HRL A;  4EK9 A;  3X2Q E;  4GTM A;  3DNV B;  3FTW A;  2H8R A;  2J7U A;  3V31 A;  3FY4 A;  2XGM A;  4GA1 A;  2UY1 B;  3NRO A;  1JPL A;  3ISM C;  3R9M A;  5KCM A;  4U8Y D;  1IQR A;  1QZX A;  1N52 A;  4DE9 A;  2QYJ A;  5ENT D;  4OYS A;  2DWZ A;  4GTS A;  4F53 A;  1WM5 A;  3UT8 A;  4NAC A;  3VK0 A;  1O1T A;  3BS3 A;  3MKR A;  4GYW A;  4J7W A;  2GW1 A;  1INZ A;  2PM6 A;  2LLW A;  4BT9 A;  5AN8 A;  5HKP A;  3O4Z A;  1H2U A;  2HIN A;  3ZHE B;  1BU9 A;  1XWR A;  3RZZ A;  4GTO A;  3ME5 A;  4RLY A;  2A5U A;  2PXL A;  5CMW A;  4TRQ A;  4BX8 A;  4I6R A;  3TFL A;  3FH8 A;  2OOE A;  2JQE A;  4FUL A;  3Q47 B;  2KZ8 A;  5ITZ F;  1HO8 A;  3MLF A;  2P9P G;  1LQC A;  3QJZ A;  3CQC B;  4EQZ A;  4XKB A;  5T3R A;  3FUH A;  1NER A;  4TXP A;  5A6C A;  3TRB A;  4LSZ E;  5AQ7 A;  2R5S A;  2GRO B;  1Q2Z A;  1NP7 A;  4YAR A;  4UWL A;  2WUS R;  2LYQ A;  4G24 A;  4WUY A;  5J90 A;  3JQ0 A;  1RZS A;  3JXB C;  3ASG A;  3CVP A;  3S7J A;  2I1J A;  4WNE A;  2F8Y A;  4PDX A;  5LX8 A;  4NUR A;  3RIB A;  2QFC A;  3FU5 A;  3OP9 A;  4WNG A;  4NIK A;  5EYP F;  4F6R D;  2PUE A;  1N9A A;  3H5T A;  4X8Q A;  4Z58 A;  1ZZ6 A;  1E8Y A;  3FTZ A;  3HDX A;  4DX1 A;  4UUC A;  4DUI A;  3NQP A;  3OQN A;  3F51 A;  3AG3 E;  1TJF A;  3FTV A;  3ASO E;  4LNB A;  4HOR A;  4YG1 A;  4IA8 A;  4CYM D;  3K9I A;  3TWQ A;  2R17 C;  1SQM A;  2BED A;  3EHR A;  3QK0 A;  3ZYL A;  5C2Y A;  2X38 A;  4LCT A;  2XPI A;  3DSX A;  3GUU A;  5DSX A;  5G05 J;  3G5G A;  4C9B B;  1JWF A;  3VTY A;  2PXE A;  1WDY A;  4N5C A;  3LY7 A;  4FAD A;  4ME2 A;  2OEW A;  3CGH A;  5E75 A;  3PE4 A;  5H7P A;  2HSG A;  1MZC A;  4GCO A;  4XZ4 A;  3IHY A;  1WH6 A;  3ZIM A;  1A5E A;  3NZL A;  3MGB A;  1ZUG A;  2WXN A;  4Z5H A;  5EID A;  4BFR A;  5D0Q D;  3Q7F A;  3R09 A;  1PAQ A;  3UIP C;  3UKR G;  2R1J L;  2AVP A;  3UTM A;  4I8T A;  3HXB A;  2NSZ A;  3PZ3 A;  3QOU A;  1DVP A;  4PS8 A;  5M72 A;  4WVL A;  2WXI A;  4ZFH A;  4KT6 B;  2MQK A;  1XNF A;  2PUB A;  3CHQ A;  3TG5 A;  2V0P A;  3L16 A;  1WET A;  1X57 A;  2PQN A;  1A17 A;  4YDE A;  4KZ0 A;  4G25 A;  4FBI A;  4N3A A;  2DIW A;  4TV3 A;  1EDU A;  3ONL A;  1O1S A;  2H6H A;  4UWF A;  2HE0 A; 
#chains in the Genus database with same CATH homology
 2RD0 A;  3KD7 A;  4A55 A;  2L0T B;  2A4Z A;  4B8A A;  4URK A;  1OWL A;  3TAX A;  3ZKC A;  2D5V A;  4UQY A;  2XEV A;  4UQZ A;  5ANL A;  1FCH A;  3EHN A;  1R63 A;  3I3N A;  3LVR E;  1P5Q A;  4L7T A;  4EZL A;  2BJC A;  2PIJ A;  4PUC A;  5AIJ A;  2PPX A;  1UN9 A;  4R7L A;  3D3M A;  1OWP A;  3FU6 A;  3NF1 A;  4DI3 A;  1SQ8 A;  1BPO A;  1H0A A;  1TEZ A;  4JA7 A;  2CHW A;  3T8M A;  1E3O C;  3F52 A;  3FUL A;  4X4H A;  4FJZ A;  4JHR A;  3LY9 A;  1OUV A;  3RRN B;  4AVX A;  2E2E A;  4JPS A;  2AWI A;  3QWV A;  4FJY A;  5CMY A;  3TGO A;  5DIZ A;  5ENN A;  3UT7 A;  4AP2 A;  1RZR A;  1IHG A;  3CKB A;  1ZZC A;  4XKC A;  5T8I A;  2WXO A;  3MA5 A;  5KJN A;  3D9O A;  4U07 A;  2XPY A;  1OWO A;  1HF8 A;  4PU8 A;  4CRW A;  3T5X A;  1HX8 A;  2WXP A;  4YBA A;  1KLX A;  1LCC A;  3G7D A;  3KZ3 A;  1RIO A;  1KT0 A;  1OCT C;  3MV3 B;  4N3C A;  2LSV A;  1E8W A;  1QP4 A;  4JHK A;  4CDR A;  4DPR A;  4JC8 A;  3CV0 A;  3EIQ C;  2VGX B;  4X4C A;  4Y6W A;  4B8C B;  1WIZ A;  3B7S A;  2ION A;  3CVU A;  2AXU A;  2MRI A;  3FP3 A;  4KVO A;  3CK8 A;  3QQ6 A;  2LNI A;  3PVL A;  3KAE A;  1XGW A;  2L9B A;  3L54 A;  3PRE A;  1ZAY A;  5FJY A;  1VDY A;  3FUK A;  4YVO A;  5AYW D;  3ZPJ A;  3FU3 A;  3ESK A;  1ZPQ A;  3ZHM A;  1PRA A;  4Z5D A;  4I6E A;  2KEI A;  3UUX A;  3LPZ A;  2L6J A;  1Z3X A;  3SI5 A;  3FYM A;  3PXP A;  3G2V A;  1EYH A;  3D9I A;  3PUK A;  4J8E A;  1UW4 B;  4FLH A;  3LKU A;  4JEH A;  4KVM A;  1QP7 A;  3GZS A;  3IKO B;  4XI0 A;  3BG1 B;  4DJA A;  2XHE A;  2YNQ A;  4E85 A;  1ZVV A;  1X2L A;  2YHC A;  3KXA A;  3ZVV A;  2XCB A;  2WXJ A;  2WVI A;  4Y42 A;  3LEW A;  5FWQ A;  5K98 B;  2XGO A;  3S2A A;  2FEZ A;  2VSO E;  4I17 A;  5T4Y A;  4MRU A;  4N39 A;  1BDI A;  4JL0 A;  3ESL A;  1RZR D;  4MS6 A;  2FJR A;  1R69 A;  3APC A;  3L13 A;  2YIN A;  1NA3 A;  2CHX A;  1JFS A;  5FZR A;  3IBE A;  2V4L A;  1JH9 A;  4XI9 A;  4GCN A;  3RO2 A;  3TXN A;  4BTA A;  2FF4 A;  4W9R A;  1MQS A;  2LCV A;  5G05 C;  3ZHE A;  4ILG A;  3KEZ A;  3UFD A;  4ATG A;  3BEE A;  2PUF A;  4FA6 A;  2AXV A;  3KS2 A;  3RJV A;  3ASF A;  4UWH A;  2LYK A;  4F1S A;  1LMB 3;  5JJT A;  1HZ4 A;  2QY7 A;  4WAF A;  2FUL A;  2VTB B;  3ASD A;  4EQF A;  5FZQ A;  2HM8 A;  2VSN A;  3KJX A;  2CHZ A;  3ZW3 A;  4Z59 A;  5JHA A;  1IYG A;  4OVU A;  4CGV A;  1Y9Q A;  4NRH B;  4CCA A;  4YG4 A;  2PUC A;  3CVW A;  1PY1 A;  2I6H A;  5A7L A;  2MHK A;  3G2S A;  3MCX A;  5BNW A;  2P58 C;  1JWG A;  5ANR A;  3FMY A;  3LJ3 A;  4GU5 A;  2X6H A;  1HS6 A;  4PS3 A;  3LYA A;  4N2S A;  4Q94 A;  2PUG A;  2OFY A;  1IC8 A;  1ZZ7 A;  4X4D A;  3MV2 B;  3PS6 A;  2GRL A;  3CIA A;  3GW4 A;  5EKQ D;  2JEK A;  2XI8 A;  1PNR A;  5G04 C;  3SZ7 A;  5BUZ A;  2XRZ A;  2IVQ A;  4G23 A;  5CCM A;  4J1W A;  3VLF A;  4DK5 A;  4I43 A;  2IVB A;  3VLE A;  4BWR A;  1CQT A;  1L1M A;  1POU A;  2IVG A;  3PZD A;  3UMV A;  2BNN A;  2X6I A;  3ASH A;  4BTB A;  5LCW J;  3MKQ B;  2JVL A;  4UI9 C;  1ZZ8 A;  4MCT A;  3AS5 A;  3FH7 A;  1E7V A;  4ILH B;  3UT4 A;  3HYM B;  1TJC A;  3FYA A;  3U9W A;  5JJ7 A;  3FFL A;  2EQX A;  2KZT B;  2VQ2 A;  2IOS A;  2WXH A;  4ACL A;  3OAW A;  4U0U A;  5J08 A;  3L08 A;  5G04 J;  3SBT B;  4C0E A;  2XRY A;  3PNL B;  4GZ6 A;  3D1N I;  2DCP A;  3JXD L;  3FHE A;  4RG9 A;  3S7D A;  3PRZ A;  4ANU A;  3L17 A;  2WB2 A;  2MOW A;  3Q49 B;  4FU3 A;  3URZ A;  1ZZ9 A;  4HVB A;  4RG6 A;  4B94 A;  3UX4 A;  4EBA A;  5G55 A;  4IRU A;  3UQ3 A;  3QC1 A;  3ZRH A;  3ZYM A;  1Y8M A;  4APO A;  4DLO A;  4I1O B;  1JUQ A;  2PUD A;  3NZU A;  2I1K A;  2IQC A;  1U3D A;  1X5B A;  4ANW A;  3ZEF A;  4J6I A;  5JHB A;  5D0O D;  4AY6 A;  3HVE A;  3MKQ A;  3L6A A;  4A1S A;  4FN3 A;  3RRU A;  2KAT A;  3GN5 A;  4J0U A;  3SCH A;  4PU4 C;  1PC2 A;  3P2B A;  1ADR A;  3RO3 A;  1JFT A;  4L1B A;  3FUM A;  1L5J A;  3B13 A;  2LAI A;  3RRM B;  3SF4 A;  2WXG A;  3G2U A;  4OB4 A;  4PS7 A;  4X4F A;  3OTN A;  1UXC A;  3EUS A;  1HF0 A;  2XIU A;  2PL2 A;  5C1D A;  1QZ2 A;  1LCD A;  5AJD A;  5FQ7 A;  3VTX A;  1BDH A;  4I6G A;  3U4T A;  1GW6 A;  1WY6 A;  4E6H A;  1OWN A;  1W3B A;  3D9N A;  3ENE A;  3LFP A;  2WPV A;  3FH5 A;  4HXI A;  4GAA A;  3U3W A;  4AY5 A;  1HXI A;  4GA2 A;  3SFZ A;  4BSX A;  1HG5 A;  2J4B A;  2FO7 A;  2ZU6 B;  3IVP A;  3LDZ A;  4U8H A;  3QAR A;  4UI9 K;  3TJP A;  2KCK A;  3FTX A;  2BUG A;  3Q5M A;  3D9J A;  3DBS A;  3QWG A;  2J9Q A;  4M3O A;  3GZ1 A;  2L0I A;  4CEM A;  2KEJ A;  2L49 A;  1VPW A;  3U64 A;  2IU1 A;  4F7A A;  3QB2 A;  4CGW A;  3CQG B;  1PRU A;  3MJW A;  4MLP A;  1LLI A;  1H2V C;  4JXT A;  3ZYQ A;  5KJK A;  2KCL A;  2VSX E;  1IQU A;  2V5F A;  3O48 A;  2XCC A;  3ML9 A;  4FHJ A;  2KZT A;  2VYI A;  2KEK A;  3MZL B;  1HU3 A;  4X4E A;  4DI4 A;  1NEQ A;  3CR3 A;  2EWT A;  3FUJ A;  4HOQ A;  4LEU A;  5G2N A;  2KCV A;  2HO1 A;  4QFV A;  3MX3 A;  4I6J A;  2LYP A;  2VSY A;  4WWO A;  3GBF A;  4AEZ C;  2J4D A;  4RSY A;  2X6J A;  2IF4 A;  2VJ8 A;  3PDN A;  3OQM A;  2CG2 A;  5FT9 A;  2XSD C;  3TL5 A;  3JCK C;  2XGS A;  1JWL A;  4G1T A;  3R7Q A;  2UY1 A;  3FWV A;  2NC9 A;  3DPD A;  4G26 A;  3CHS A;  4A1G A;  2AW6 A;  3HHM A;  4FHK A;  3SHF A;  4GZC A;  4ABN A;  3GYZ A;  3CVL A;  3FU0 A;  3R7R A;  4EZJ A;  5DBK A;  3TG4 A;  3ZHI A;  2WXR A;  2J09 A;  2C0M A;  4JCY A;  4HOS A;  1WH8 A;  2CSF A;  4J8F A;  2Y4T A;  2KPJ A;  4J8S A;  3OMT A;  1EFA A;  3PNT B;  2J07 A;  4I9E A;  2I2O A;  5KJM A;  1QQA A;  2AUW A;  1MHQ A;  1U3C A;  3S7B A;  3D9P A;  3DNV B;  3FTW A;  4N2Q A;  3FUF A;  4HOT A;  2H8R A;  3ZN3 A;  4JQD A;  5AEN A;  4AM9 A;  1UTX A;  3F6W A;  4PU7 A;  1E7U A;  1B0N A;  2A6C A;  2XJ3 A;  2O49 A;  2BTD A;  2XGM A;  1GT0 C;  3FY4 A;  3PUJ A;  4GA1 A;  4U0Z A;  4APF A;  3ZYK A;  5ARG A;  4F3V A;  2UY1 B;  2AXZ A;  3RK6 A;  1JPL A;  3CVX A;  1DNP A;  2ICP A;  4AXH A;  4IVZ A;  3P1U A;  5KCM A;  1PRV A;  3Q4A B;  3IHV A;  1IQR A;  2ICT A;  4K03 A;  2HYZ A;  1N52 A;  2IUO A;  3AS4 A;  3ULQ A;  4I1A A;  4NDW A;  3OQO A;  1NZN A;  3SD5 A;  1QPZ A;  3E4B A;  4OYS A;  4F53 A;  2YHE A;  1WM5 A;  3UT8 A;  1E8Z A;  4YG7 B;  4NAC A;  2E0I A;  1FVF A;  3VK0 A;  2PM7 A;  2RG8 A;  2Y4U A;  5CCL A;  2IFU A;  3G2T A;  3BS3 A;  3FEY A;  3MKR A;  4GA0 A;  4K0R A;  3CHP A;  4LER A;  4CDM A;  4GYW A;  4Q69 A;  2GW1 A;  2X6K A;  3LY8 A;  2JCG A;  2BNO A;  4Q96 A;  2NXP A;  3APD A;  2WXL A;  2PM6 A;  3CK7 A;  3JYS A;  1E96 B;  2HR2 A;  3LIS A;  3SCG A;  4BY6 A;  3PEU B;  3PEV B;  3UPV A;  4BT9 A;  4G2V A;  4ACK A;  1H2U A;  2HIN A;  2R63 A;  2BNM A;  2WMO A;  2WXF A;  3O4Z A;  4L2Y A;  1XWR A;  4U0S A;  3ZHE B;  3RZZ A;  4I6T A;  3LXU X;  2A5U A;  1Y6I A;  3VLD A;  5CMW A;  4TRQ A;  1Z3Y A;  4YVQ C;  5JJ6 A;  3PE3 A;  4I6R A;  2X3M A;  4BX8 A;  4RVB A;  3EDT B;  4G11 A;  1QQE A;  3FH8 A;  4UWK A;  2WIU B;  1YA0 A;  3ONK A;  2OOE A;  2FI7 A;  1UXD A;  3FTU A;  1KT1 A;  3L22 A;  4D10 C;  2GGF A;  2WQ7 A;  3QKY A;  4O8B A;  4JA9 A;  4UWG A;  1O4X A;  4FUL A;  5HI7 A;  3Q47 B;  1S0P A;  3OXF A;  1LF8 A;  3CVN A;  5FTP A;  1Y7Y A;  3CHO A;  2KC7 A;  3FEX A;  3FUN A;  2KZ8 A;  1H6K A;  4N3B A;  3S7F A;  1HO8 A;  3MLF A;  3CHR A;  4I1M A;  1LQC A;  3QJZ A;  3CQC B;  2IJG X;  3ZFW A;  4JVS A;  3LS8 A;  3QWP A;  1HG2 A;  4XKB A;  1QNF A;  3FUH A;  1NER A;  3OXL A;  4XE0 A;  3G2W A;  5T3R A;  4DLQ A;  5BT1 A;  1UG3 A;  1OWM A;  4V3I A;  3AU4 A;  5A6C A;  3CKC A;  3IEG A;  3TRB A;  3AU5 A;  5LFA A;  2R5S A;  2LSU A;  3B7R L;  2C2L A;  3D9K A;  3CST A;  2IV1 A;  3FDH A;  3FUE A;  4KBQ A;  4KZC A;  2I9C A;  1NP7 A;  4I2Z A;  4YAR A;  4UWL A;  5AJL A;  3B7U X;  2WUS R;  2LYQ A;  4G24 A;  4WUY A;  5J90 A;  3JQ0 A;  4IN3 B;  3D9M A;  1RZS A;  4IYP A;  3JXB C;  3ASG A;  4CT4 A;  3CVY A;  3CVP A;  3S7J A;  2I1J A;  4WNE A;  1QQB A;  1ELR A;  4PDX A;  4B0Z A;  4XIF A;  3EHM A;  3JUI A;  2FBN A;  5LX8 A;  2OV8 A;  4NUR A;  4MCX A;  3RIB A;  4ANX A;  3R1F A;  2Q7F A;  2L8N A;  2QFC A;  5FQ4 A;  5LP0 A;  4EBA G;  1AU7 A;  2V8S E;  3FU5 A;  4HLE A;  3OP9 A;  2OR1 L;  4WNG A;  2J08 A;  4WWP A;  2PQR A;  2CFZ A;  2XPZ A;  2PUE A;  1QP0 A;  2Y3A A;  3GZ2 A;  3O9X A;  3I5P A;  2LAH A;  3H5T A;  1UJK A;  4Z58 A;  1E8Y A;  1ZZ6 A;  2LYR A;  3FTZ A;  3HDX A;  1PER L;  5LOZ A;  5A23 A;  4JCX A;  3N71 A;  4LRZ A;  4XX5 A;  4EPZ A;  4GZD A;  3NQP A;  3OQN A;  2DBA A;  4FC8 A;  1H19 A;  4GYY A;  3F51 A;  2LYS A;  4UQX A;  4WND A;  4CDN A;  1DW9 A;  1ZZB A;  3CK9 A;  1DWK A;  1TJF A;  3APF A;  3T5V A;  3FTV A;  2IU7 A;  4X4B A;  1CJG A;  4P29 A;  5E76 A;  2OVB A;  2CRO A;  2UWJ G;  4YG1 A;  4GB9 A;  3ZXS A;  4HOR A;  4JW1 A;  1N54 A;  3ML8 A;  4F8D A;  5EDS A;  5CHE E;  2LYL A;  2EF8 A;  4X4G A;  3L1P A;  3FTY A;  4IA8 A;  1EF1 C;  4U63 A;  3K9I A;  4OVV A;  1ZU2 A;  2R17 C;  2M63 A;  1ELK A;  3FUD A;  3U66 A;  1SQM A;  3B7T A;  2ILR A;  1HE8 A;  3QK0 A;  4HS2 A;  5FQ6 A;  4AOF A;  2LO6 A;  5BPP A;  4ILI A;  4HFG A;  3BG0 B;  5C2Y A;  3ZYL A;  2X38 A;  4KYO B;  4LCT A;  2XPI A;  2EBY A;  3OXG A;  4GZ3 A;  4U04 A;  4AV7 A;  3QWW A;  4X4I A;  3CVQ A;  4J8D A;  2VTB A;  2OVF A;  2B5A A;  5G05 J;  5KJL A;  3CLJ A;  3CEC A;  4GPK A;  2XQ0 A;  3G5G A;  3BD1 A;  4C9B B;  2C0L A;  3Q15 A;  3ZGQ A;  1JWF A;  2PUA A;  1SZA A;  3VTY A;  4Y6C A;  4JEU A;  5EX0 A;  4Z5C A;  1ZBP A;  4N5C A;  4WWN A;  3R9A B;  3WXX A;  3SCF A;  3LY7 A;  4FAD A;  3C98 A;  4B89 A;  2J49 A;  4ME2 A;  4AJW A;  1HH8 A;  2GZU A;  3EJN A;  4GHJ A;  3CGH A;  4I2W A;  1NA0 A;  3QAQ A;  3AS8 A;  5E75 A;  3CVV A;  2VGY A;  3PE4 A;  4GZ5 A;  5FQ8 A;  2HSG A;  2IOL A;  3CHM A;  2X6F A;  4EEC A;  3IV0 A;  2O38 A;  4GCO A;  4GYO A;  4XZ4 A;  2WMN A;  3CRO L;  2PZI A;  2GRM A;  2BF0 X;  4A3V A;  3CEQ A;  4IUL A;  2R59 A;  3IHY A;  1HFA A;  2O4A A;  1WH6 A;  2YQ8 A;  2WQH A;  3ZIM A;  3PH0 C;  3BDN A;  4JZY A;  1ELW A;  3MGB A;  4H7X A;  1Z6T A;  4EZK A;  1OSL A;  3D9L A;  3QDN A;  1ZUG A;  2WXN A;  3FUI A;  1H2T C;  2JLB A;  3FTS A;  4GML A;  4L23 A;  4PH4 B;  4Z5H A;  3SGH A;  4C0M A;  4FP7 A;  4BFR A;  3QNK A;  5D0Q D;  4I9C A;  1UJJ A;  2CG3 A;  3RKV A;  2WXK A;  3HVE B;  1PAQ A;  4PU3 C;  4A3T A;  2R1J L;  4KXK B;  4ANV A;  2AVP A;  3CSF A;  4LUN U;  3NZS A;  4H7Y A;  4IWR A;  3GN5 B;  4I8T A;  3TXM A;  1INZ A;  2NSZ A;  2LYJ A;  3JXC L;  3RU0 A;  1ZS4 A;  3MYV A;  3HZI B;  1DVP A;  3CLC A;  2KM4 A;  3QOU A;  4PS8 A;  4KMO A;  5M72 A;  2WXI A;  3LCA A;  4YND A;  1SZ9 A;  2WXM A;  3HIZ A;  2MQK A;  4FLB A;  4I6U A;  1XNF A;  4GQM A;  2MEZ A;  4KT6 B;  1WAO 1;  4JHJ A;  2WXQ A;  5EX3 A;  4BT8 A;  1RPE L;  2PUB A;  1YSE A;  3CHQ A;  3B7H A;  2V0P A;  5FZS A;  3L16 A;  5A7D B;  3TG5 A;  1WET A;  4NQ0 A;  1UN8 A;  1X57 A;  2PQN A;  2VGX A;  3I4G A;  3JQ1 A;  3SBS A;  1A17 A;  4BX9 A;  4CT0 A;  1B89 A;  3EIJ A;  2WQ6 A;  3I4R B;  3SNX A;  2OND A;  4J1X A;  4KZ0 A;  4TUU A;  1E8X A;  4G25 A;  5ARF A;  3MEK A;  1EPU A;  4FBI A;  4WNF A;  5BV1 A;  4N3A A;  5BW8 C;  2DIW A;  2WM9 A;  3QF3 A;  1EDU A;  4TV3 A;  4AIF A;  3ONL A;  4L2L A;  5BV0 A;  4HOU A;  4GMJ A;  3S8Q A;  2CFU A;  2XCJ A;  4UI9 J;  1S7E A;  3LVQ E;  4UWF A;  4MKT A;  4O6F A;  5LCW C;  3QYX A;  5HQ8 A;  1E90 A;  1FVH A;  2PE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...