2AXZA

Crystal structure of prgx/ccf10 complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
306
structure length
306
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYVAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 110
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axzA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axzA02
2LYLA 1ADRA 3GN5A 1L1MA 2HINA 1LCDA 2AUWA 2PE5A 1JFTA 1ZZ9A 3VK0A 2O49A 3G7DA 4I6TA 3UFDA 2EBYA 1NERA 2IVGA 1WH6A 4X4EA 3TRBA 3KJXA 1RZSA 2XI8A 2IVBA 4Z5DA 3F52A 1WH8A 1UTXA 2LYKA 2MEZA 4MCTA 4O8BA 3F51A 1AU7A 1R69A 1O4XA 1JFSA 5A7LA 2JVLA 3LISA 4OB4A 1VPWA 4IA8A 1PRVA 3D1NI 2LCVA 4YG1A 2GZUA 3GBFA 2CROA 1PNRA 3OMTA 2PUFA 3OP9A 1R63A 1ZZ6A 2EWTA 4NDWA 2KEIA 1ZVVA 4FN3A 3QYXA 2R1JL 4GHJA 3SCGA 1ZZCA 1RZRA 3ZHIA 1PRUA 2AWIA 4IVZA 1Y9QA 2MQKA 3RZZA 1JWLA 1DW9A 2O38A 3SCHA 4Z5HA 2BNOA 3S8QA 1YSEA 3OQMA 3U3WA 4JCYA 4PU7A 2IVQA 1QQAA 4JCXA 3JXDL 3G5GA 1B0NA 2XSDC 4X4DA 2AXVA 3BDNA 1CQTA 2XCJA 3QWGA 3R1FA 4Z58A 1ZZBA 3BD1A 1RIOA 3IVPA 4GQMA 4YBAA 3OQNA 3H5TA 2CSFA 4MCXA 2PUGA 4PU8A 4Y42A 1IC8A 3HZIB 1ZUGA 2OFYA 1OCTC 3CLCA 1GT0C 1BDIA 1E3OC 1BDHA 3B7HA 2KPJA 1LMB3 2GRLA 1OSLA 4IWRA 3FYAA 4Z5CA 1UXDA 3SCFA 4X4HA 2PUBA 1Y7YA 2L8NA 2WIUB 2O4AA 2FJRA 3PXPA 1LQCA 3ZKCA 2PUDA 1ZZ8A 2XJ3A 4X4IA 1CJGA 4X4BA 2GRMA 2IUOA 2PUCA 1NEQA 1RPEL 1QP0A 3OQOA 2ICTA 2BNMA 2KZ8A 2PUAA 3O9XA 2PUEA 1QQBA 4X4CA 1WIZA 2AXZA 1RZRD 3KXAA 2KEKA 2BJCA 5K98B 1UXCA 1S7EA 4I6UA 2LYQA 3JXCL 4X4GA 1X57A 2HSGA 1SQ8A 4PU3C 2LYRA 1ZAYA 3F6WA 4Z59A 2LYPA 2L49A 2PIJA 3QF3A 1QP4A 1ZPQA 2AW6A 3LFPA 3GN5B 2IV1A 1DWKA 3L1PA 2OR1L 4YARA 3JXBC 3MLFA 1X2LA 1XWRA 2LYSA 1LCCA 2LYJA 3CECA 1LLIA 2WUSR 3FMYA 3KZ3A 4F8DA 1PRAA 2XIUA 2B5AA 2IU7A 3ZHMA 1JH9A 1QPZA 3CROL 4I8TA 2EF8A 1EFAA 2KEJA 1ZZ7A 1HF0A 3EUSA 4X4FA 1POUA 4FBIA 2BNNA 4J1XA 2ICPA 4PU4C 3DNVB 2R63A 1QP7A 4I6RA 3BS3A 1ZS4A 3QQ6A 4JQDA 2D5VA 2PPXA 3FYMA 1PERL 4YG4A 2H8RA 2AXUA 2A6CA 2JCGA 4YG7B 4J1WA 1WETA
chains in the Genus database with same CATH superfamily
3UM1A 2PE5A 1NW3A 1VDYA 4I6TA 3UFDA 2WXJA 4PUCA 3CHOA 4DX5D 1OWOA 4UI9K 3FTXA 4ATGA 4WWNA 4J7WA 1VPWA 1O1RA 1ZZ6A 1H2TC 2AVPA 5E76A 3Q49B 5B1AE 5ENTD 4LRZA 5CRVA 4U0SA 3KL4A 2F37A 3UT8A 3PE3A 4TXPA 3B95A 3OKZA 1N94A 4LG6A 5BV1A 3SD5A 3HZIB 4L2LA 3CLCA 3KSLA 2XXPA 2VYIA 4AM9A 4XE0A 2PXTA 4JVSA 5J90A 2PUBA 1Y7YA 3NDBB 4BESA 3FTUA 4UWGA 3LPZA 4EECA 3D9KA 2GRMA 2GRRB 2IF4A 5DTRA 1E96B 1WIZA 3UMVA 3GUUA 1S7EA 3DSXA 3U66A 1FT1A 1WY6A 4K5BA 1NFIE 3LXUX 4YDEA 4BETA 3VWSA 4XI9A 2QYJA 5AAOA 1LCCA 4FJZA 2WUSR 3CVLA 2XGOA 3CKBA 3FH5A 3PS6A 4ER5A 1U2VG 2DCPA 4Y6CA 3EUSA 3NBNB 3PE5A 5ANRA 3BS3A 2JABA 3FWVA 5KJLA 3KD7A 4YVQC 2FO1E 4YDOA 3ASGA 2NXPA 3C5RA 3R9AB 4GPKA 3ABLE 1WH8A 1Z6TA 2HCNA 3F51A 5A7LA 4BERA 3LISA 1PRVA 2GW1A 2CG2A 3CVUA 4L9PA 1UN8A 3GZDC 5FQ6A 5LCWJ 2R5SA 3FU0A 3UI2A 1Y9QA 2J4BA 3PNLB 2J08A 5G04C 2IVQA 4N39A 2DZOA 3T5VA 2AXVA 2YQ8A 5FZRA 4F7AA 4YDYA 4GZCA 4E6HA 3CK9A 3TXNA 2CSFA 4NURA 5B3SE 2ZXWE 3AJIA 3A9XA 2FULA 2ONDA 4Y6WA 3BUAA 3QOXA 2KZTA 1TNUA 2O4AA 4L23A 1S70B 1JCRA 5ENPD 3RK6A 4R7LA 3ASNE 2I9CA 5KWDA 4JHRA 3NXHA 5K98B 3TGOA 2P9PG 3MKRA 4J0UA 3LYAA 4CT0A 3DXMG 4N5CA 1QP4A 3NF1A 3LFPA 3S7BA 2VGYA 1AP7A 4GYYA 1X2LA 3LEWA 3AS8A 3CVPA 3UM2A 4BTAA 5JJ7A 3MZLB 1OCOE 2WB2A 1INZA 2L1PA 2LSUA 3C98A 1O5MA 3DNVB 2PXBA 3APFA 3FTZA 4UQZA 2C2LA 3TWQA 1PERL 3ZHEB 1ADRA 5CRUA 3ML9A 4ER6A 2M4HA 3R9MA 3NZUA 3G7DA 3CQCB 2GRQB 3RAUA 4GA1A 4H7YA 4DRXE 1R69A 3EIQC 4WAFA 2XGMA 2R59A 4N3CA 3JCKC 5BPPA 4AXHA 1TNOA 3LJNA 1MHQA 5LX8A 4L2YA 2BNOA 3JXJA 3U64A 2OEWA 3ABKE 4I17A 3H5TA 1S0PA 1IC8A 5BXUA 3DPDA 2Y4UA 4DLOA 3UM3A 3A9ZA 2C0MA 3FYAA 2Y4TA 5FQ4A 1K3ZD 2QC9A 2F0YA 3IHVA 3G2UA 1QP0A 2WXNA 5G05J 1HH8A 4HXIA 3SHFA 2ETAA 3LS8A 2FF4A 3GN5B 1O1SA 2L6JA 1DC2A 2J49A 2PXLA 3UT4A 4MBGA 2KC7A 4A3VA 1YMPA 1Z5SC 4KT6B 4XKCA 1TJFA 2KEJA 1X5BA 2Q7FA 4FBIA 2LAIA 1KZOA 4BT9A 1ZS4A 3QNKA 2B0OE 2VEOA 3WG7E 2Y1LE 2H6GA 3ZXPA 1ZBPA 4UWKA 2QZAA 2KM4A 2WQHA 4JC8A 1H6OA 5HS0A 2VGEA 2IVGA 4AOFA 4WWOA 3RRMB 4JL0A 2LUHA 1NA0A 1N4RA 1OWPA 1E7UA 3D9IA 3CVWA 3IHYA 1B89A 3RRUA 2WXQA 2LCVA 2GZUA 2PUFA 3OP9A 2KCLA 1D9SA 4EBAG 1SA5A 1ZZCA 2MQKA 5A23A 4BSXA 3LY8A 3UT7A 3V2OA 1CQTA 4BX9A 3R1FA 4CGVA 1A5EA 1E7VA 3OQNA 3DWLG 3OTNA 2DVWA 4EZLA 2ETBA 3DSSA 4B8AA 3MJWA 1E3OC 1QNFA 4OAUC 4WNFA 4WVLA 2XQ0A 4GTVA 4EKIA 3GYZA 4ANUA 2WXLA 2PUDA 4AY6A 4BSZB 2PUCA 2R17C 2XPZA 4GMRA 2PUEA 1S64A 5IY5E 2X6KA 5CCLA 2LYQA 5BV0A 1X57A 1ZAYA 3F6WA 4Z59A 1DCQA 2L49A 3ZIMA 1ZPQA 1HG5A 3CVQA 4UQYA 1N4SA 5AQ9A 4F8DA 2IFUA 4GYWA 2MXDA 1E8XA 2XEVA 3ZHMA 4I8TA 2XS1A 4JZYA 2UWJG 3UIOC 1QB2A 2BNNA 2WXRA 5BUZA 3FFLA 4EZKA 1E8WA 4HLLA 2KCVA 2PXEA 3UXGA 2XXAA 1Z3YA 3CHRA 3EIJA 1O1TA 1TJCA 1NERA 3TG4A 1WH6A 1WAO1 4G11A 3GZSA 5CMYA 3ZPXA 4AIFA 3E30A 2I1KA 4DI3A 1A17A 4YG1A 5JJ6A 2XPIA 2IOSA 2LXLA 5CECB 2R1JL 5KJMA 3ZVVA 3MYVA 3UKRG 4DE9A 1OWNA 1TN6A 5HKPA 1YCSB 3FY4A 1IXVA 4HOUA 2WXMA 1KPSB 4YBAA 2UY1A 3Q75A 4DE8A 3PZDA 2BKGA 1L5JA 3RKVA 2PXUA 2WXGA 4JA9A 5D66A 3FDHA 5BT1A 2P9NG 4OVVA 4X8QA 4URKA 2MYOA 4X4IA 3JYSA 4GTQA 3NOGD 3RJVA 4HBDA 1H0AA 2YINA 3SZ7A 1ZB1A 2WXIA 5GAHi 3ONLA 3FTYA 4I6EA 4EK9A 3FUHA 2XXQA 3E34A 1IHGA 3G0TA 3EJNA 3TG5A 4Z68A 5KNGA 3E37A 1WM5A 3F6QA 3ASDA 4GZ5A 1LF8A 1TR4A 3JQ0A 1QBQA 3SFXA 1E8ZA 4J1XA 2KATA 2R02A 5HQ8A 5EYLA 4FA6A 4B94A 4I2WA 2JCGA 5FQ7A 2P9KG 1IYGA 2V4HC 4PS3A 3TWRA 3ISMC 5GAGi 3L13A 3ASOE 2OVBA 1KT0A 4O60A 3ULEG 4KVOA 4Z5DA 4O8BA 2DWZA 2WM9A 1MX4A 2EIKE 3FH7A 2XRZA 4GTOA 1V54E 2KEIA 1OUVA 3CQGB 1TN8A 4TV3A 4J8YA 2WXPA 3ME5A 3SNXA 1SVXA 4JCXA 3D3MA 5C2YA 1B0NA 3MA5A 4X4DA 2FBNA 4E85A 1RIOA 4BFRA 2PUGA 4Y42A 2XCBA 2P9LG 4F53A 3I4GA 3T5XA 4IWRA 3D9NA 3R7RA 4UI9C 2Y0BG 2J7UA 1JWGA 2FJRA 3LQXA 1ZZ8A 1RPEL 3PE4A 3KXAA 2BKKB 4QFVA 4L1BA 3CV0A 4I6UA 3UTMA 5CEAA 3JXCL 2PZIA 2VSOE 3IEGA 1N52A 3TXMA 3QF3A 4TRQA 4YVOA 4H7XA 3DEOA 3HXBA 1P5QA 3S7JA 3EHNA 5JA4D 4CDMA 3L22A 1OCCE 2H6FA 5EX3A 5JJTA 1HFAA 2VTBA 2IU7A 1HXIA 1JH9A 3CROL 3Q15A 2YHEA 3TWUA 3ENEA 2X6FA 5KNHD 3I3NA 2J4DA 3TEPA 4KMOA 2H8RA 2WMNA 1ZU2A 2VSXE 4I6JA 3GZCA 2E0IA 3FULA 5FZQA 2QYUA 3HDXA 1JUQA 3CVVA 2JLBA 4W9RA 5G04J 2XI8A 2GGFA 1JPLA 3G2WA 5HI7A 2ODRD 2P58C 2PL2A 3DPYA 3B7TA 1PNRA 2CHXA 4J8FA 3P1UA 2R03A 2GRNB 2VGXB 5A6CA 3ZW3A 3B7BA 2FEZA 3CVYA 2BF0X 3TAXA 3CK7A 3DM5A 4HQDA 3UIPC 4Z58A 5JMND 2IY0C 4JD2G 4U96D 4XZ4A 2J8SD 1KT1A 2CHWA 2EIME 3CSFA 4GMJA 3NQPA 4ILIA 4NIKA 4PDXA 4AY5A 3JUEA 2X6HA 1NP7A 4C9BB 3SX0A 3APDA 1D8DA 4A55A 1H6PA 2PQNA 4MLPA 5LOZA 1DCEA 1V55E 4NRHB 5EYPF 3VTYA 3PZ3A 1RZRD 3D9HA 3OXFA 5KCMA 2V8SE 4PU3C 4Q96A 2NSZA 3GW4A 2RFAA 4I9CA 3FU6A 3EHQA 4A63B 3FUMA 4YARA 4TXRA 1N54A 3V79K 5HRYA 5ARFA 1MX2A 5DTMA 3HXEA 4JHJA 4PH4B 2A5UA 3NZSA 1OCRE 2WPVA 4FP7A 5CHEE 4ABNA 1EF1C 4IULA 3BG0B 2PPXA 3FUKA 3SBSA 2XHEA 1ELKA 5ENNA 3Q5MA 3VTXA 1ZZ9A 2NC9A 2H6IA 3VK0A 4GYOA 4I43A 2EBYA 5AARA 1TN7A 3SQVA 3TRBA 3W9FA 1UOHA 3KJXA 1RZSA 1QQEA 4GCNA 4CDNA 1AU7A 1HG2A 1MZCA 4ANVA 3DSWA 4OB4A 4TUUA 3RO3A 3TWSA 3O48A 3NOCD 3MEKA 2CROA 1R63A 2ZISA 2J7WA 4GHJA 3DXKG 3ZHIA 3LVQE 4ILHB 2PM6A 5AENA 3HXDA 3RIBA 3S8QA 4RG9A 3U3WA 3ZN3A 1K1BA 5T8IA 1UW4B 4GMLA 1N0RA 2H6HA 3CKCA 2XCJA 3QWGA 3NAWA 3L54A 4GCOA 3IVPA 4GQMA 3D9OA 3U4TA 3FEXA 1BDIA 2X38A 5D0QD 3ZKJA 1BDHA 1LMB3 2BEDA 3C3QA 1Z3XA 2EILE 3ULYA 3PXPA 3B7SA 5BXOA 5B1BE 3TWTA 1DNPA 4X4BA 4G2VA 3B7RL 3CIAA 4J8EA 4C0MA 3EDTB 2R05A 4CT4A 4X4CA 4F1SA 2IOLA 4G26A 3QOWA 5CCMA 3PVLA 4GU5A 2PIJA 1JCQA 1FVFA 2XEHA 1BU9A 3L1PA 4U8VD 3NROA 1XNFA 4G1TA 2E2EA 2P9SG 3HIZA 4I2ZA 2LYSA 2ZGGA 3ASFA 4XI0A 1LLIA 4N2QA 5FINA 2OEVA 1MYOA 4JHKA 4DX7D 4G8LA 1PY1A 3QKYA 2NYJA 4LSZE 3V2XA 4X4FA 5JHBA 2ICPA 4HI8A 4BTBA 4FLBA 3FUDA 3PEVB 5DRYA 1JFSA 3JQ1A 4YG7B 4WWPA 3CK8A 3AG3E 4YNDA 4B89A 4X4EA 1FVHA 4UUCA 3QB2A 2P9UG 3IV0A 1N4PA 2LLVA 3LCAA 3HXFA 3AG2E 3PEUB 1SA4A 1O4XA 2OCCE 4BX8A 4KVMA 4ANXA 1MX6A 4DX2A 4GPMA 1QZXA 1FPPA 2HM8A 3KEAA 2KXPC 3BDNA 4GB9A 3EHMA 3S7DA 4BWRA 1ZUGA 3A9YA 2X3MA 3HRAA 1RW2A 4HLEA 4O1OA 4CYMD 4JB8P 2QFCA 3UPVA 4U0UA 3PUKA 1CJGA 1Y6IA 2IEJA 2ICTA 5JHAA 4ZFHA 2CHZA 3QWPA 5T3RA 3QDNA 4WUYA 4Q2JA 1NL4A 3PZ1A 4X4GA 4DJAA 4WNGA 5C1DA 2Y69E 3MV2B 4Q69A 4RSYA 3J5PA 1DWKA 4J8DA 2IONA 1AWCB 3CECA 3QJZA 3P2BA 5EX0A 1QPZA 2VSNA 2HE0A 1ZZ7A 2PNNA 1EPUA 2VQ2A 4PS7A 5CBOA 3J5QB 4TXQA 3SR4A 3SGHA 1Y8MA 5FWQA 3ZYKA 3G2SA 4LNGA 2IVBA 2A4ZA 4U04A 2V4LA 5CMWA 4MCTA 5H7PA 3C72A 3S7FA 2JVLA 3JXIA 4KBQA 1QZ2A 5AQAA 3FUFA 3V30A 4UWHA 4CRWA 4QQIA 5ENSD 1PRUA 4IVZA 1JWLA 1HX8A 4JCYA 4JW1A 3L82A 1QQAA 2JEKA 4G8KA 2FFHA 1HF8A 3AU5A 2P2CP 4IN3B 3C3RA 3U9WA 1OY3D 3AU4A 4HORA 4MCXA 3QWVA 3L16A 2OFYA 2LSVA 3RU0A 3R09A 3Q47B 5FTPA 4CDRA 1K8KG 2IU1A 3UKUG 1LD7A 3MEJA 3Q9UC 3I5PA 3SF4A 3AG1E 3FUJA 2IUOA 2DYSE 3OQOA 2WQ7A 2RD0A 3Q4AB 4AEZC 4RQIA 4MS6A 1RZ4A 3DSUA 3GZ2A 4A1SA 2HSGA 4GTTA 2IV1A 3CR3A 2DYRE 3KSQA 3NB2A 4YDWA 3KZ3A 4FC8A 3ZUVB 2L0TB 4I1MA 4GZ6A 4FLHA 5AQ7A 2FO7A 5KBAA 5CBNA 4EHMA 3G2TA 4A1GA 2A6CA 2WVIA 3ZEFA 4C48B 3GN5A 2C0LA 5AJDA 1K1AA 1HQ1A 3ZXSA 2CFUA 5ARGA 3T8KA 3TWWA 5E75A 4GTPA 2XRYA 2I2OA 3D9MA 4K5AB 4OBMA 4M3OA 3F52A 2XZTG 3UWPA 3QWWA 2HO1A 2OOEA 5DIZA 2ETCA 3UQ3A 2KZTB 3FTVA 4LCTA 4UI9J 3E32A 3QAQA 3JXDL 1SW6A 1NZNA 1SZ9A 2RKKA 3MGBA 1H19A 3EHRA 4O1PA 3UX4A 3PNTB 4DPRA 2ZU6B 3EUVA 5T4YA 2GRLA 3E4BA 1UJKA 2L8NA 3PH0C 1NEQA 1HU3A 2KCKA 2L9BA 3SI5A 4HI9A 3URZA 4B8CB 2PUAA 1H2UA 3PUJA 4XX5A 2KEKA 4LEUA 3CEQA 1S63A 4XIFA 3FH8A 3HVEA 3FTSA 1MQSA 1TYQG 3JXBC 3X2QE 2R2LA 3FMYA 4UQXA 2HCSA 4I1OB 3KS2A 5G2NA 3I4RB 1WDYA 5EKQD 4PU4C 4K5CA 2R63A 2IJGX 3QQ6A 4ER3A 3OXLA 2MRIA 3FYMA 3T8MA 5AYWD 4FHKA 3BG1B 4N3BA 4J1WA 4AJWA 5M72A 4JEHA 4HRMB 3CHPA 4U8YD 4DK5A 4RVBA 4AVXA 3AS5A 1UTXA 3FU5A 4JA7A 3S2AA 4HOTA 2GROB 2J09A 4FJYA 2HR2A 1QYMA 4ACKA 2OV8A 3D1NI 4MRUA 4OYSA 3FUNA 1N11A 3MKQA 3IBEA 1BLXB 3TELA 5BNWA 3ABME 3SCGA 1RZRA 3RZZA 2A5EA 3CLJA 3TJPA 3ULQA 3FU3A 4Z5HA 2XS8A 1YSEA 4PU7A 4WNDA 2PXDA 3CGHA 3G5GA 2XSDC 1PC2A 4HOQA 3HHMA 5KJKA 4PU8A 3ZYMA 2JQEA 3DSTA 1UJJA 4PS8A 3BQOA 3RRNB 1FT2A 1OSLA 4APFA 4KYOB 2PXPA 4Z5CA 1OXJA 3TFLA 5ENQD 4LUNU 4LNUD 3ZKCA 2YNQA 4D10C 2F8YA 2Y3AA 3ZNGA 4JEUA 2FI7A 3Q79A 2AXZA 4ER0A 3ML8A 5BW8C 3TL5A 3VLFA 2IO2C 2AW6A 1TNZA 3VLDA 2DBAA 3KAEA 2XPYA 3Q9NC 3SFZA 2LYJA 5EIDA 5DBKA 4U0ZA 3PDNA 4XKBA 3ESLA 4B0ZA 4CCAA 1POUA 2XZDG 3FEYA 3G2VA 1OT8A 2D5VA 4J6IA 5FT9A 2L6BA 3D9JA 4FADA 3GZ1A 4BT8A 1JFTA 5DSXA 4KZCA 4F1PA 5LP0A 2I6HA 2MEZA 4DI4A 3FP3A 3KEZA 3L17A 3IKOB 1H6KA 4V3IA 1DULA 4FN3A 3R7QA 3HG0D 2DIWA 2AWIA 1DW9A 2X6IA 3OQMA 1BD8A 3W9GA 4CGWA 3IXEA 3UINC 3LVRE 3BD1A 1XGWA 3D9LA 4DUIA 4OVUA 2L0IA 1SQMA 2KPJA 4MKTA 5LCWC 1W3BA 4EKGA 5AIJA 3LY9A 4RLYA 5G55A 3WXXA 1Q2ZA 5AQBA 3O4ZA 2KZ8A 3TWXA 4OAVB 1SZAA 2BJCA 4FU3A 3V31A 3CSTA 2M63A 3AG4E 1HE8A 1SQ8A 4DX6D 3K9IA 2LYPA 5ANLA 1HZ4A 2X6JA 3VLEA 1KLXA 2VSYA 4M7CA 2HYZA 4APOA 4UWFA 3UM0A 3SBTB 1YA0A 2XIUA 2MOWA 2ZIRA 2XENA 4LERA 2DZNA 4HRLA 2V0PA 4K0RA 1QP7A 3CHSA 3T9KA 1IKND 3Q78A 1NA3A 2XEEA 4YG4A 1JCSA 4ATZD 3M9LA 5KJNA 2LYLA 4U95D 1L1MA 3ESKA 3EU9A 1YYHA 4K03A 4F6RD 3LKUA 2ILRA 1LD8A 3LJ3A 2WXKA 4RG6A 1HO8A 2MHKA 2PM7A 2UY1B 3OWQA 3RSEG 4O6FA 4EQZA 2XGSA 4CEMA 4N2SA 3ZU7B 3ZRHA 1OWLA 4IA8A 4GTSA 1TEZA 1U3CA 2EWTA 4NDWA 1E8YA 3QYXA 1KZPA 3E33A 3ONKA 2O38A 3SCHA 4I9EA 3NZLA 1X81A 4ACLA 3HYMB 4TUMA 2EINE 1G3NB 4I6GA 3ZYQA 4ZHBA 1GT0C 2CG3A 4HS2A 5ENRD 4G24A 3PZ4A 4X4HA 2VGXA 3CHQA 2WIUB 1LQCA 2GRPB 3C3OA 5DTQA 2I1JA 5EILA 3CVNA 1N9AA 2BNMA 5D0OD 5ITZF 4N5QA 1UXCA 4BEPA 2LYRA 4P29A 3ZPJA 1ELWA 4HRAA 3UUXA 3Q7FA 3B13A 3L6AA 1XWRA 5FZSA 2V5QC 3OAWA 1H2VC 5G05C 3RO2A 1OWMA 3DSVA 4U8HA 5FIOA 1GW6A 5FQ8A 2F8XK 1OCZE 4GTRA 1HF0A 4L7TA 5AN8A 1TNBA 1E90A 2PXVA 2WMOA 3OXGA 3N71A 2J9QA 1UN9A 2HINA 2AUWA 3ASHA 4EQFA 2O49A 4HOSA 3SO8A 4JPSA 4GTMA 2ZGDA 3BU8A 4U63A 1UG3A 2LYKA 3MV3B 1EYHA 5DRTA 3DRAA 3HVEB 4C0EA 2HFZA 3OMTA 4XEIG 2IO3C 4ANWA 3PZ2A 3ZFWA 5EIBE 3BEEA 2RFMA 5LFAA 4J8SA 2VJ8A 3HXCA 3AAAC 1ZZBA 1ELRA 4AP2A 2PQRA 1OCTC 1U2ZA 2LNIA 2EIJE 3B7HA 5AJLA 5D2MC 4A3TA 1D8EA 4LNBA 2LNMA 4ILGA 4UWLA 3ZHEA 1EDUA 5J08A 4NACA 4NQ0A 4F3VA 2IQCA 2XJ3A 1BI8B 2VTBB 1N0QA 3O9XA 1QQBA 4G25A 5EDSA 4ME2A 3DBSA 4FULA 1U3DA 2LLWA 5DT2A 3MKQB 4I1AA 1MFQC 2YHCA 4HNAD 4HRNA 3FUEA 5FJYA 1WG0A 4HB5A 4HVBA 3MX3A 3AS4A 1PRAA 4WNEA 4BY6A 2KBXA 2EF8A 4KZ0A 1EFAA 3QC1A 3PRZA 2PXFA 2RG8A 1MJ0A 2WXOA 4EZJA 4GA0A 1TNYA 4JQDA 4EBAA 2LAHA 2AXUA 1WETA 3EU5A 4GZDA 5CERB 1LCDA 2LO6A 2P9IG 3QFIA 3APCA 3FHEA 4N3AA 4EPZA 3JUIA 2PXKA 5ENOD 3Q73A 4ER7A 4EZIA 2OVFA 3D9PA 3GBFA 2BUGA 4FHJA 4AV7A 1ZVVA 4GA2A 4GAAA 1DVPA 3FUIA 1NI1A 1BI7B 4GZ3A 1IQUA 2J07A 5JUWA 3DEPA 3Q7AA 4Q94A 3SY2A 3L9TA 3TWVA 2V5FA 4U7EB 4U07A 3QK0A 2BTDA 2XCCA 2LXMA 2QY7A 1IHBA 3QARA 4CZ2D 3B7UX 1UXDA 3SCFA 3SFYA 4B93B 3L08A 4HFGA 4DX1A 2YBDA 1N4QA 4KXKB 3GZDA 2AJAA 4JXTA 3LDZA 3MCXA 4IRUA 1IQRA 3CVXA 4DLQA 2OR1L 3FTWA 3MLFA 3PREA 1FCHA 3ZYLA 5A7DB 2B5AA 2B6CA 2PXQA 4IYPA 2CFZA 2EQXA 2WXHA 5CEDB 1LTXA 5EN5D 1PAQA 2V3CC 3ZGQA 1JWFA 3QOUA 4I6RA 2WQ6A 2WXFA 1HS6A 4G23A 3LY7A 1N95A 3CHMA 1BPOA
chains in the Genus database with same CATH topology
4WWPA 4BT8A 1JFTA 2PE5A 4KZCA 1Z3YA 3CK8A 3CHRA 3EIJA 1VDYA 1TJCA 4I6TA 3UFDA 5LP0A 2WXJA 4PUCA 1NERA 4YNDA 3TG4A 1WH6A 4X4EA 3CHOA 4B89A 1WAO1 1FVHA 3QB2A 1OWOA 2I6HA 3IV0A 4G11A 4UI9K 2MEZA 3GZSA 5CMYA 3FTXA 3LCAA 4AIFA 4ATGA 4DI4A 3PEUB 3FP3A 4WWNA 1O4XA 2I1KA 4DI3A 1VPWA 4BX8A 1A17A 3KEZA 3L17A 4YG1A 3IKOB 4KVMA 4ANXA 5JJ6A 2XPIA 1ZZ6A 1H2TC 1H6KA 2AVPA 4V3IA 4FN3A 5E76A 2IOSA 2R1JL 3R7QA 2DIWA 3Q49B 5KJMA 2AWIA 3ZVVA 4LRZA 1DW9A 2X6IA 3MYVA 4U0SA 3OQMA 4CGWA 2HM8A 1OWNA 3UT8A 3PE3A 3BDNA 4B8CB 3FY4A 4GB9A 4HOUA 2WXMA 3LVRE 3BD1A 3EHMA 4YBAA 2UY1A 3S7DA 1XGWA 3D9LA 3PZDA 5BV1A 3CHMA 4BWRA 3SD5A 1L5JA 3HZIB 1ZUGA 3CLCA 2WXGA 4L2LA 3RKVA 4OVUA 2L0IA 2VYIA 2X3MA 4AM9A 1SQMA 4HLEA 2KPJA 4MKTA 4XE0A 4JA9A 5LCWC 4JVSA 5J90A 1W3BA 3FDHA 5AIJA 2PUBA 3LY9A 1Y7YA 5BT1A 3FTUA 2QFCA 4OVVA 4UWGA 5G55A 3WXXA 3LPZA 4URKA 4U0UA 4EECA 3D9KA 3UPVA 4X4IA 3PUKA 1CJGA 3JYSA 2GRMA 1Y6IA 3RJVA 2ICTA 3O4ZA 2KZ8A 1H0AA 5JHAA 2YINA 3SZ7A 2IF4A 2CHZA 3QWPA 5T3RA 3T8MA 3QDNA 1E96B 1WIZA 1SZAA 2WXIA 4WUYA 3UMVA 2BJCA 4FU3A 3CSTA 2M63A 1S7EA 4DJAA 4X4GA 3U66A 1HE8A 1SQ8A 4WNGA 3ONLA 5C1DA 3FTYA 3K9IA 3MV2B 2LYPA 1WY6A 4I6EA 5ANLA 3LXUX 4Q69A 5G2NA 3FUHA 4RSYA 1HZ4A 2X6JA 1DWKA 1IHGA 4J8DA 3VLEA 4XI9A 1KLXA 2IONA 2VSYA 2HYZA 4APOA 4UWFA 1LCCA 3CECA 3EJNA 4FJZA 3TG5A 3SBTB 3QJZA 2WUSR 3CVLA 3P2BA 5EX0A 1WM5A 1YA0A 2XIUA 2MOWA 2XGOA 3CKBA 3ASDA 3FH5A 3PS6A 1QPZA 4GZ5A 4LERA 1LF8A 2VSNA 3JQ0A 2DCPA 1ZZ7A 4Y6CA 3EUSA 1EPUA 1E8ZA 4J1XA 2V0PA 4K0RA 2KATA 5HQ8A 5ANRA 1QP7A 2VQ2A 3BS3A 3CHSA 1NA3A 4PS7A 3FWVA 5KJLA 4FA6A 4YG4A 3KD7A 4YVQC 4B94A 4I2WA 2JCGA 5FQ7A 5KJNA 1IYGA 2LYLA 3ASGA 1L1MA 2NXPA 3ESKA 4PS3A 4K03A 3L13A 3SGHA 3LKUA 2ILRA 2OVBA 3R9AB 1KT0A 1Y8MA 3LJ3A 5FWQA 4GPKA 2WXKA 4RG6A 4KVOA 3G2SA 3ZYKA 1HO8A 2IVBA 2A4ZA 4Z5DA 1WH8A 1Z6TA 2MHKA 4U04A 2PM7A 2V4LA 5CMWA 4MCTA 4O8BA 3F51A 2UY1B 4O6FA 3S7FA 5A7LA 2WM9A 2XGSA 2JVLA 3LISA 4KBQA 3ZRHA 4CEMA 4N2SA 1OWLA 4IA8A 1TEZA 1QZ2A 1PRVA 2GW1A 3FH7A 3FUFA 2CG2A 4UWHA 2XRZA 3CVUA 1U3CA 2EWTA 4CRWA 4NDWA 2KEIA 1UN8A 1E8YA 5FQ6A 3QYXA 1OUVA 5LCWJ 3CQGB 2R5SA 1PRUA 4IVZA 3FU0A 1Y9QA 1JWLA 3ONKA 4TV3A 2O38A 1HX8A 3SCHA 2J4BA 2WXPA 3PNLB 4JCYA 2J08A 5G04C 3SNXA 2IVQA 4I9EA 4JW1A 4N39A 1QQAA 4JCXA 3D3MA 5C2YA 2JEKA 1B0NA 3T5VA 3MA5A 1HF8A 4X4DA 2AXVA 2YQ8A 2FBNA 3AU5A 5FZRA 4ACLA 4IN3B 4F7AA 3HYMB 4E85A 3U9WA 4GZCA 4E6HA 3CK9A 3AU4A 1RIOA 4BFRA 3TXNA 4HORA 2PUGA 2CSFA 4MCXA 4NURA 4I6GA 4Y42A 3QWVA 2XCBA 3ZYQA 3L16A 2OFYA 2LSVA 1GT0C 2CG3A 3RU0A 2FULA 3Q47B 4HS2A 2ONDA 4Y6WA 4F53A 5FTPA 3I4GA 4G24A 4XKCA 3T5XA 4CDRA 4IWRA 3D9NA 3R7RA 4X4HA 2VGXA 4UI9C 2KZTA 2IU1A 3CHQA 1JWGA 2WIUB 2O4AA 2FJRA 4L23A 3I5PA 1LQCA 3SF4A 1ZZ8A 3FUJA 2I1JA 2IUOA 1RPEL 3RK6A 3OQOA 3CVNA 4R7LA 2WQ7A 2BNMA 2RD0A 3PE4A 3Q4AB 5D0OD 4MS6A 4AEZC 2I9CA 4JHRA 3KXAA 4QFVA 5K98B 4L1BA 3TGOA 1UXCA 3CV0A 4I6UA 3GZ2A 3JXCL 3MKRA 4J0UA 4A1SA 2HSGA 2PZIA 3JQ1A 2VSOE 2LYRA 3LYAA 4P29A 3ZPJA 1ELWA 3IEGA 4CT0A 1N52A 3TXMA 3QF3A 4TRQA 4N5CA 1QP4A 3UUXA 3NF1A 4YVOA 3LFPA 4H7XA 2IV1A 2VGYA 3S7BA 3B13A 3CR3A 3L6AA 1P5QA 3S7JA 4GYYA 3EHNA 1X2LA 1XWRA 3LEWA 3AS8A 5FZSA 5JJ7A 3CVPA 4CDMA 3OAWA 3L22A 1H2VC 3KZ3A 5G05C 5EX3A 4FC8A 3RO2A 1HFAA 1OWMA 5JJTA 2L0TB 4U8HA 4BTAA 2IU7A 1HXIA 1GW6A 4I1MA 1JH9A 3CROL 3MZLB 3Q15A 2YHEA 4GZ6A 5FQ8A 3ENEA 2WB2A 4FLHA 2FO7A 2X6FA 1INZA 1HF0A 4L7TA 2LSUA 3C98A 3DNVB 3APFA 3FTZA 3I3NA 4UQZA 2J4DA 2C2LA 3G2TA 4KMOA 4A1GA 1PERL 1E90A 2H8RA 2A6CA 2WMNA 2WMOA 3OXGA 3N71A 2WVIA 2J9QA 1ZU2A 3ZEFA 3ZHEB 1ADRA 1UN9A 2VSXE 3GN5A 2C0LA 3ML9A 2HINA 2E0IA 3FULA 4I6JA 5AJDA 3ZXSA 2AUWA 3ASHA 5FZQA 3HDXA 4EQFA 2CFUA 2O49A 3NZUA 3G7DA 1JUQA 5ARGA 3CVVA 3CQCB 4HOSA 2JLBA 4JPSA 4W9RA 5E75A 2XRYA 4U63A 2I2OA 3D9MA 4GA1A 5G04J 1UG3A 2XI8A 4M3OA 3F52A 4H7YA 2GGFA 2LYKA 1JPLA 3G2WA 3MV3B 5HI7A 1EYHA 2P58C 1R69A 2PL2A 3EIQC 2XGMA 3QWWA 4WAFA 2HO1A 2R59A 3B7TA 3HVEB 3JCKC 4N3CA 4C0EA 2OOEA 5DIZA 5BPPA 4AXHA 1PNRA 3OMTA 4ANWA 2CHXA 4J8FA 3P1UA 3ZFWA 2VGXB 5A6CA 3UQ3A 2KZTB 1MHQA 3BEEA 3FTVA 4LCTA 5LX8A 3ZW3A 4L2YA 2FEZA 5LFAA 4UI9J 2BNOA 2BF0X 4J8SA 3TAXA 3CVYA 3QAQA 2VJ8A 3CK7A 3U64A 3JXDL 1SZ9A 1NZNA 3MGBA 1H19A 4I17A 4Z58A 1ZZBA 3UX4A 1ELRA 3PNTB 4DPRA 2ZU6B 3H5TA 4XZ4A 1S0PA 4AP2A 1KT1A 2CHWA 2PQRA 1IC8A 3CSFA 1OCTC 4GMJA 2LNIA 3NQPA 5T4YA 3DPDA 2Y4UA 3B7HA 4ILIA 4PDXA 5AJLA 4AY5A 2GRLA 4A3TA 4DLOA 3E4BA 2X6HA 2C0MA 3FYAA 2Y4TA 4ILGA 4UWLA 5FQ4A 3ZHEA 1EDUA 1UJKA 1NP7A 2L8NA 4NACA 4NQ0A 4C9BB 5J08A 4F3VA 3PH0C 2IQCA 2XJ3A 3APDA 4A55A 3IHVA 2PQNA 1NEQA 1HU3A 2KCKA 1QP0A 2L9BA 3G2UA 2WXNA 4MLPA 4NRHB 5LOZA 5G05J 2PUAA 1H2UA 3SI5A 3PUJA 3O9XA 3URZA 3VTYA 1QQBA 4XX5A 4G25A 5EDSA 4ME2A 1RZRD 1HH8A 2KEKA 3DBSA 4HXIA 4LEUA 3CEQA 3OXFA 5KCMA 4FULA 4XIFA 2V8SE 4PU3C 4Q96A 3FH8A 2NSZA 1U3DA 3GW4A 3FTSA 3HVEA 3MKQB 3SHFA 4I1AA 1MQSA 3LS8A 2YHCA 4I9CA 3FU6A 2FF4A 3GN5B 3FUEA 5FJYA 3FUMA 4YARA 3JXBC 2L6JA 1N54A 2J49A 3UT4A 5ARFA 4FADA 4HVBA 3MX3A 2KC7A 3FMYA 4A3VA 3AS4A 1PRAA 4UQXA 4JHJA 4I1OB 4WNEA 3KS2A 4KT6B 4BY6A 4PH4B 2EF8A 4KZ0A 1EFAA 2VTBB 2A5UA 3NZSA 2WPVA 1TJFA 2KEJA 3QC1A 1X5BA 2Q7FA 3I4RB 3PRZA 4FBIA 2LAIA 4FP7A 2RG8A 2WXOA 5EKQD 4PU4C 4ABNA 2VTBA 4EZJA 2R63A 4GA0A 2IJGX 4BT9A 1ZS4A 3QQ6A 1EF1C 3QNKA 4JQDA 4IULA 3OXLA 4EBAA 3BG0B 2PPXA 2MRIA 3FYMA 3FUKA 2LAHA 3SBSA 5AYWD 2XHEA 1ELKA 2AXUA 4FHKA 3BG1B 4N3BA 4J1WA 4AJWA 1WETA 4GZDA 5ENNA 1ZBPA 3Q5MA 5M72A 4UWKA 1LCDA 4JEHA 3VTXA 1ZZ9A 2NC9A 2KM4A 3VK0A 4GYOA 4I43A 2WQHA 4JC8A 3CHPA 2LO6A 2EBYA 3APCA 3FHEA 2IVGA 4N3AA 4EPZA 4AOFA 3JUIA 3TRBA 4WWOA 3RRMB 3KJXA 1RZSA 4JL0A 4DK5A 1NA0A 4RVBA 4AVXA 3AS5A 1QQEA 4GCNA 1UTXA 1OWPA 4CDNA 3FU5A 1E7UA 3D9IA 4JA7A 1AU7A 1HG2A 3S2AA 2OVFA 3IHYA 3CVWA 2J09A 1B89A 2HR2A 4FJYA 4HOTA 4ANVA 4OB4A 4TUUA 3RO3A 3RRUA 3O48A 4ACKA 2OV8A 3D1NI 2LCVA 2WXQA 3D9PA 4MRUA 4OYSA 2GZUA 3GBFA 2CROA 2PUFA 2BUGA 3FUNA 3MEKA 3OP9A 1R63A 2KCLA 4FHJA 3MKQA 3IBEA 4AV7A 4EBAG 1ZVVA 5BNWA 4GA2A 4GHJA 3SCGA 1ZZCA 4GAAA 1RZRA 3ZHIA 3LVQE 3RZZA 1DVPA 3CLJA 2MQKA 2PM6A 4ILHB 3TJPA 3FUIA 3ULQA 5AENA 3FU3A 4Z5HA 3RIBA 3S8QA 1YSEA 3U3WA 4RG9A 3ZN3A 4PU7A 5A23A 4WNDA 1UW4B 4GZ3A 5T8IA 1IQUA 4GMLA 3LY8A 3CGHA 3UT7A 3G5GA 4BSXA 2XSDC 1CQTA 2J07A 2XCJA 3QWGA 1PC2A 3CKCA 4Q94A 4BX9A 3R1FA 4CGVA 3L54A 4GCOA 1E7VA 3IVPA 4GQMA 3OQNA 4HOQA 3D9OA 3HHMA 2V5FA 4PU8A 3OTNA 3ZYMA 5KJKA 4U07A 4EZLA 3QK0A 3U4TA 1UJJA 3FEXA 4PS8A 1BDIA 3MJWA 2X38A 5D0QD 4B8AA 1E3OC 1BDHA 2BTDA 1QNFA 1LMB3 2XCCA 4WNFA 3RRNB 2QY7A 2XQ0A 1OSLA 4APFA 4KYOB 3QARA 1Z3XA 3B7UX 4Z5CA 1UXDA 3SCFA 3GYZA 4LUNU 3L08A 4HFGA 4ANUA 3PXPA 3B7SA 2WXLA 3ZKCA 2PUDA 2YNQA 4D10C 1DNPA 4X4BA 4AY6A 4G2VA 2PUCA 2Y3AA 3B7RL 3CIAA 4KXKB 4J8EA 2R17C 2XPZA 4C0MA 3EDTB 2PUEA 4JXTA 4CT4A 4X4CA 4JEUA 2FI7A 4F1SA 2AXZA 5CHEE 3LDZA 2X6KA 2IOLA 4G26A 2LYQA 3ML8A 5CCLA 5BV0A 1X57A 5CCMA 3PVLA 5BW8C 3TL5A 1ZAYA 3F6WA 4Z59A 4GU5A 2L49A 2PIJA 3VLFA 3MCXA 3ZIMA 1FVFA 1ZPQA 2AW6A 4IRUA 1IQRA 3VLDA 3CVXA 4DLQA 3L1PA 2OR1L 1HG5A 2DBAA 1XNFA 2E2EA 2XPYA 3CVQA 3FTWA 3KAEA 3MLFA 3HIZA 3PREA 4G1TA 4I2ZA 4UQYA 2LYSA 1FCHA 3SFZA 2LYJA 3ASFA 4XI0A 3ZYLA 1LLIA 4N2QA 4F8DA 5DBKA 2IFUA 4GYWA 4U0ZA 1E8XA 3PDNA 4XKBA 2B5AA 5A7DB 2XEVA 3ZHMA 4JHKA 4I8TA 3ESLA 2UWJG 4IYPA 2CFZA 4JZYA 2EQXA 2WXHA 4B0ZA 1PY1A 3QKYA 1PAQA 4X4FA 1POUA 1JWFA 2WXRA 2BNNA 3FEYA 3ZGQA 2ICPA 4CCAA 5BUZA 3FFLA 5JHBA 3QOUA 4I6RA 4BTBA 1E8WA 2WXFA 4FLBA 4EZKA 2WQ6A 3G2VA 1HS6A 4G23A 3LY7A 2D5VA 4J6IA 3FUDA 5FT9A 3PEVB 3D9JA 1JFSA 2KCVA 4YG7B 1BPOA 3GZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYL A;  1ADR A;  3GN5 A;  1L1M A;  2HIN A;  1LCD A;  2AUW A;  2PE5 A;  1JFT A;  1ZZ9 A;  3VK0 A;  2O49 A;  3G7D A;  4I6T A;  3UFD A;  2EBY A;  1NER A;  2IVG A;  1WH6 A;  4X4E A;  3TRB A;  3KJX A;  1RZS A;  2XI8 A;  2IVB A;  4Z5D A;  3F52 A;  1WH8 A;  1UTX A;  2LYK A;  2MEZ A;  4MCT A;  4O8B A;  3F51 A;  1AU7 A;  1R69 A;  1O4X A;  1JFS A;  5A7L A;  2JVL A;  3LIS A;  4OB4 A;  1VPW A;  4IA8 A;  1PRV A;  3D1N I;  2LCV A;  4YG1 A;  2GZU A;  3GBF A;  2CRO A;  1PNR A;  3OMT A;  2PUF A;  3OP9 A;  1R63 A;  1ZZ6 A;  2EWT A;  4NDW A;  2KEI A;  1ZVV A;  4FN3 A;  3QYX A;  2R1J L;  4GHJ A;  3SCG A;  1ZZC A;  1RZR A;  3ZHI A;  1PRU A;  2AWI A;  4IVZ A;  1Y9Q A;  2MQK A;  3RZZ A;  1JWL A;  1DW9 A;  2O38 A;  3SCH A;  4Z5H A;  2BNO A;  3S8Q A;  1YSE A;  3OQM A;  3U3W A;  4JCY A;  4PU7 A;  2IVQ A;  1QQA A;  4JCX A;  3JXD L;  3G5G A;  1B0N A;  2XSD C;  4X4D A;  2AXV A;  3BDN A;  1CQT A;  2XCJ A;  3QWG A;  3R1F A;  4Z58 A;  1ZZB A;  3BD1 A;  1RIO A;  3IVP A;  4GQM A;  4YBA A;  3OQN A;  3H5T A;  2CSF A;  4MCX A;  2PUG A;  4PU8 A;  4Y42 A;  1IC8 A;  3HZI B;  1ZUG A;  2OFY A;  1OCT C;  3CLC A;  1GT0 C;  1BDI A;  1E3O C;  1BDH A;  3B7H A;  2KPJ A;  1LMB 3;  2GRL A;  1OSL A;  4IWR A;  3FYA A;  4Z5C A;  1UXD A;  3SCF A;  4X4H A;  2PUB A;  1Y7Y A;  2L8N A;  2WIU B;  2O4A A;  2FJR A;  3PXP A;  1LQC A;  3ZKC A;  2PUD A;  1ZZ8 A;  2XJ3 A;  4X4I A;  1CJG A;  4X4B A;  2GRM A;  2IUO A;  2PUC A;  1NEQ A;  1RPE L;  1QP0 A;  3OQO A;  2ICT A;  2BNM A;  2KZ8 A;  2PUA A;  3O9X A;  2PUE A;  1QQB A;  4X4C A;  1WIZ A;  2AXZ A;  1RZR D;  3KXA A;  2KEK A;  2BJC A;  5K98 B;  1UXC A;  1S7E A;  4I6U A;  2LYQ A;  3JXC L;  4X4G A;  1X57 A;  2HSG A;  1SQ8 A;  4PU3 C;  2LYR A;  1ZAY A;  3F6W A;  4Z59 A;  2LYP A;  2L49 A;  2PIJ A;  3QF3 A;  1QP4 A;  1ZPQ A;  2AW6 A;  3LFP A;  3GN5 B;  2IV1 A;  1DWK A;  3L1P A;  2OR1 L;  4YAR A;  3JXB C;  3MLF A;  1X2L A;  1XWR A;  2LYS A;  1LCC A;  2LYJ A;  3CEC A;  1LLI A;  2WUS R;  3FMY A;  3KZ3 A;  4F8D A;  1PRA A;  2XIU A;  2B5A A;  2IU7 A;  3ZHM A;  1JH9 A;  1QPZ A;  3CRO L;  4I8T A;  2EF8 A;  1EFA A;  2KEJ A;  1ZZ7 A;  1HF0 A;  3EUS A;  4X4F A;  1POU A;  4FBI A;  2BNN A;  4J1X A;  2ICP A;  4PU4 C;  3DNV B;  2R63 A;  1QP7 A;  4I6R A;  3BS3 A;  1ZS4 A;  3QQ6 A;  4JQD A;  2D5V A;  2PPX A;  3FYM A;  1PER L;  4YG4 A;  2H8R A;  2AXU A;  2A6C A;  2JCG A;  4YG7 B;  4J1W A;  1WET A; 
#chains in the Genus database with same CATH topology
 3UM1 A;  2PE5 A;  1NW3 A;  1VDY A;  4I6T A;  3UFD A;  2WXJ A;  4PUC A;  3CHO A;  4DX5 D;  1OWO A;  4UI9 K;  3FTX A;  4ATG A;  4WWN A;  4J7W A;  1VPW A;  1O1R A;  1ZZ6 A;  1H2T C;  2AVP A;  5E76 A;  3Q49 B;  5B1A E;  5ENT D;  4LRZ A;  5CRV A;  4U0S A;  3KL4 A;  2F37 A;  3UT8 A;  3PE3 A;  4TXP A;  3B95 A;  3OKZ A;  1N94 A;  4LG6 A;  5BV1 A;  3SD5 A;  3HZI B;  4L2L A;  3CLC A;  3KSL A;  2XXP A;  2VYI A;  4AM9 A;  4XE0 A;  2PXT A;  4JVS A;  5J90 A;  2PUB A;  1Y7Y A;  3NDB B;  4BES A;  3FTU A;  4UWG A;  3LPZ A;  4EEC A;  3D9K A;  2GRM A;  2GRR B;  2IF4 A;  5DTR A;  1E96 B;  1WIZ A;  3UMV A;  3GUU A;  1S7E A;  3DSX A;  3U66 A;  1FT1 A;  1WY6 A;  4K5B A;  1NFI E;  3LXU X;  4YDE A;  4BET A;  3VWS A;  4XI9 A;  2QYJ A;  5AAO A;  1LCC A;  4FJZ A;  2WUS R;  3CVL A;  2XGO A;  3CKB A;  3FH5 A;  3PS6 A;  4ER5 A;  1U2V G;  2DCP A;  4Y6C A;  3EUS A;  3NBN B;  3PE5 A;  5ANR A;  3BS3 A;  2JAB A;  3FWV A;  5KJL A;  3KD7 A;  4YVQ C;  2FO1 E;  4YDO A;  3ASG A;  2NXP A;  3C5R A;  3R9A B;  4GPK A;  3ABL E;  1WH8 A;  1Z6T A;  2HCN A;  3F51 A;  5A7L A;  4BER A;  3LIS A;  1PRV A;  2GW1 A;  2CG2 A;  3CVU A;  4L9P A;  1UN8 A;  3GZD C;  5FQ6 A;  5LCW J;  2R5S A;  3FU0 A;  3UI2 A;  1Y9Q A;  2J4B A;  3PNL B;  2J08 A;  5G04 C;  2IVQ A;  4N39 A;  2DZO A;  3T5V A;  2AXV A;  2YQ8 A;  5FZR A;  4F7A A;  4YDY A;  4GZC A;  4E6H A;  3CK9 A;  3TXN A;  2CSF A;  4NUR A;  5B3S E;  2ZXW E;  3AJI A;  3A9X A;  2FUL A;  2OND A;  4Y6W A;  3BUA A;  3QOX A;  2KZT A;  1TNU A;  2O4A A;  4L23 A;  1S70 B;  1JCR A;  5ENP D;  3RK6 A;  4R7L A;  3ASN E;  2I9C A;  5KWD A;  4JHR A;  3NXH A;  5K98 B;  3TGO A;  2P9P G;  3MKR A;  4J0U A;  3LYA A;  4CT0 A;  3DXM G;  4N5C A;  1QP4 A;  3NF1 A;  3LFP A;  3S7B A;  2VGY A;  1AP7 A;  4GYY A;  1X2L A;  3LEW A;  3AS8 A;  3CVP A;  3UM2 A;  4BTA A;  5JJ7 A;  3MZL B;  1OCO E;  2WB2 A;  1INZ A;  2L1P A;  2LSU A;  3C98 A;  1O5M A;  3DNV B;  2PXB A;  3APF A;  3FTZ A;  4UQZ A;  2C2L A;  3TWQ A;  1PER L;  3ZHE B;  1ADR A;  5CRU A;  3ML9 A;  4ER6 A;  2M4H A;  3R9M A;  3NZU A;  3G7D A;  3CQC B;  2GRQ B;  3RAU A;  4GA1 A;  4H7Y A;  4DRX E;  1R69 A;  3EIQ C;  4WAF A;  2XGM A;  2R59 A;  4N3C A;  3JCK C;  5BPP A;  4AXH A;  1TNO A;  3LJN A;  1MHQ A;  5LX8 A;  4L2Y A;  2BNO A;  3JXJ A;  3U64 A;  2OEW A;  3ABK E;  4I17 A;  3H5T A;  1S0P A;  1IC8 A;  5BXU A;  3DPD A;  2Y4U A;  4DLO A;  3UM3 A;  3A9Z A;  2C0M A;  3FYA A;  2Y4T A;  5FQ4 A;  1K3Z D;  2QC9 A;  2F0Y A;  3IHV A;  3G2U A;  1QP0 A;  2WXN A;  5G05 J;  1HH8 A;  4HXI A;  3SHF A;  2ETA A;  3LS8 A;  2FF4 A;  3GN5 B;  1O1S A;  2L6J A;  1DC2 A;  2J49 A;  2PXL A;  3UT4 A;  4MBG A;  2KC7 A;  4A3V A;  1YMP A;  1Z5S C;  4KT6 B;  4XKC A;  1TJF A;  2KEJ A;  1X5B A;  2Q7F A;  4FBI A;  2LAI A;  1KZO A;  4BT9 A;  1ZS4 A;  3QNK A;  2B0O E;  2VEO A;  3WG7 E;  2Y1L E;  2H6G A;  3ZXP A;  1ZBP A;  4UWK A;  2QZA A;  2KM4 A;  2WQH A;  4JC8 A;  1H6O A;  5HS0 A;  2VGE A;  2IVG A;  4AOF A;  4WWO A;  3RRM B;  4JL0 A;  2LUH A;  1NA0 A;  1N4R A;  1OWP A;  1E7U A;  3D9I A;  3CVW A;  3IHY A;  1B89 A;  3RRU A;  2WXQ A;  2LCV A;  2GZU A;  2PUF A;  3OP9 A;  2KCL A;  1D9S A;  4EBA G;  1SA5 A;  1ZZC A;  2MQK A;  5A23 A;  4BSX A;  3LY8 A;  3UT7 A;  3V2O A;  1CQT A;  4BX9 A;  3R1F A;  4CGV A;  1A5E A;  1E7V A;  3OQN A;  3DWL G;  3OTN A;  2DVW A;  4EZL A;  2ETB A;  3DSS A;  4B8A A;  3MJW A;  1E3O C;  1QNF A;  4OAU C;  4WNF A;  4WVL A;  2XQ0 A;  4GTV A;  4EKI A;  3GYZ A;  4ANU A;  2WXL A;  2PUD A;  4AY6 A;  4BSZ B;  2PUC A;  2R17 C;  2XPZ A;  4GMR A;  2PUE A;  1S64 A;  5IY5 E;  2X6K A;  5CCL A;  2LYQ A;  5BV0 A;  1X57 A;  1ZAY A;  3F6W A;  4Z59 A;  1DCQ A;  2L49 A;  3ZIM A;  1ZPQ A;  1HG5 A;  3CVQ A;  4UQY A;  1N4S A;  5AQ9 A;  4F8D A;  2IFU A;  4GYW A;  2MXD A;  1E8X A;  2XEV A;  3ZHM A;  4I8T A;  2XS1 A;  4JZY A;  2UWJ G;  3UIO C;  1QB2 A;  2BNN A;  2WXR A;  5BUZ A;  3FFL A;  4EZK A;  1E8W A;  4HLL A;  2KCV A;  2PXE A;  3UXG A;  2XXA A;  1Z3Y A;  3CHR A;  3EIJ A;  1O1T A;  1TJC A;  1NER A;  3TG4 A;  1WH6 A;  1WAO 1;  4G11 A;  3GZS A;  5CMY A;  3ZPX A;  4AIF A;  3E30 A;  2I1K A;  4DI3 A;  1A17 A;  4YG1 A;  5JJ6 A;  2XPI A;  2IOS A;  2LXL A;  5CEC B;  2R1J L;  5KJM A;  3ZVV A;  3MYV A;  3UKR G;  4DE9 A;  1OWN A;  1TN6 A;  5HKP A;  1YCS B;  3FY4 A;  1IXV A;  4HOU A;  2WXM A;  1KPS B;  4YBA A;  2UY1 A;  3Q75 A;  4DE8 A;  3PZD A;  2BKG A;  1L5J A;  3RKV A;  2PXU A;  2WXG A;  4JA9 A;  5D66 A;  3FDH A;  5BT1 A;  2P9N G;  4OVV A;  4X8Q A;  4URK A;  2MYO A;  4X4I A;  3JYS A;  4GTQ A;  3NOG D;  3RJV A;  4HBD A;  1H0A A;  2YIN A;  3SZ7 A;  1ZB1 A;  2WXI A;  5GAH i;  3ONL A;  3FTY A;  4I6E A;  4EK9 A;  3FUH A;  2XXQ A;  3E34 A;  1IHG A;  3G0T A;  3EJN A;  3TG5 A;  4Z68 A;  5KNG A;  3E37 A;  1WM5 A;  3F6Q A;  3ASD A;  4GZ5 A;  1LF8 A;  1TR4 A;  3JQ0 A;  1QBQ A;  3SFX A;  1E8Z A;  4J1X A;  2KAT A;  2R02 A;  5HQ8 A;  5EYL A;  4FA6 A;  4B94 A;  4I2W A;  2JCG A;  5FQ7 A;  2P9K G;  1IYG A;  2V4H C;  4PS3 A;  3TWR A;  3ISM C;  5GAG i;  3L13 A;  3ASO E;  2OVB A;  1KT0 A;  4O60 A;  3ULE G;  4KVO A;  4Z5D A;  4O8B A;  2DWZ A;  2WM9 A;  1MX4 A;  2EIK E;  3FH7 A;  2XRZ A;  4GTO A;  1V54 E;  2KEI A;  1OUV A;  3CQG B;  1TN8 A;  4TV3 A;  4J8Y A;  2WXP A;  3ME5 A;  3SNX A;  1SVX A;  4JCX A;  3D3M A;  5C2Y A;  1B0N A;  3MA5 A;  4X4D A;  2FBN A;  4E85 A;  1RIO A;  4BFR A;  2PUG A;  4Y42 A;  2XCB A;  2P9L G;  4F53 A;  3I4G A;  3T5X A;  4IWR A;  3D9N A;  3R7R A;  4UI9 C;  2Y0B G;  2J7U A;  1JWG A;  2FJR A;  3LQX A;  1ZZ8 A;  1RPE L;  3PE4 A;  3KXA A;  2BKK B;  4QFV A;  4L1B A;  3CV0 A;  4I6U A;  3UTM A;  5CEA A;  3JXC L;  2PZI A;  2VSO E;  3IEG A;  1N52 A;  3TXM A;  3QF3 A;  4TRQ A;  4YVO A;  4H7X A;  3DEO A;  3HXB A;  1P5Q A;  3S7J A;  3EHN A;  5JA4 D;  4CDM A;  3L22 A;  1OCC E;  2H6F A;  5EX3 A;  5JJT A;  1HFA A;  2VTB A;  2IU7 A;  1HXI A;  1JH9 A;  3CRO L;  3Q15 A;  2YHE A;  3TWU A;  3ENE A;  2X6F A;  5KNH D;  3I3N A;  2J4D A;  3TEP A;  4KMO A;  2H8R A;  2WMN A;  1ZU2 A;  2VSX E;  4I6J A;  3GZC A;  2E0I A;  3FUL A;  5FZQ A;  2QYU A;  3HDX A;  1JUQ A;  3CVV A;  2JLB A;  4W9R A;  5G04 J;  2XI8 A;  2GGF A;  1JPL A;  3G2W A;  5HI7 A;  2ODR D;  2P58 C;  2PL2 A;  3DPY A;  3B7T A;  1PNR A;  2CHX A;  4J8F A;  3P1U A;  2R03 A;  2GRN B;  2VGX B;  5A6C A;  3ZW3 A;  3B7B A;  2FEZ A;  3CVY A;  2BF0 X;  3TAX A;  3CK7 A;  3DM5 A;  4HQD A;  3UIP C;  4Z58 A;  5JMN D;  2IY0 C;  4JD2 G;  4U96 D;  4XZ4 A;  2J8S D;  1KT1 A;  2CHW A;  2EIM E;  3CSF A;  4GMJ A;  3NQP A;  4ILI A;  4NIK A;  4PDX A;  4AY5 A;  3JUE A;  2X6H A;  1NP7 A;  4C9B B;  3SX0 A;  3APD A;  1D8D A;  4A55 A;  1H6P A;  2PQN A;  4MLP A;  5LOZ A;  1DCE A;  1V55 E;  4NRH B;  5EYP F;  3VTY A;  3PZ3 A;  1RZR D;  3D9H A;  3OXF A;  5KCM A;  2V8S E;  4PU3 C;  4Q96 A;  2NSZ A;  3GW4 A;  2RFA A;  4I9C A;  3FU6 A;  3EHQ A;  4A63 B;  3FUM A;  4YAR A;  4TXR A;  1N54 A;  3V79 K;  5HRY A;  5ARF A;  1MX2 A;  5DTM A;  3HXE A;  4JHJ A;  4PH4 B;  2A5U A;  3NZS A;  1OCR E;  2WPV A;  4FP7 A;  5CHE E;  4ABN A;  1EF1 C;  4IUL A;  3BG0 B;  2PPX A;  3FUK A;  3SBS A;  2XHE A;  1ELK A;  5ENN A;  3Q5M A;  3VTX A;  1ZZ9 A;  2NC9 A;  2H6I A;  3VK0 A;  4GYO A;  4I43 A;  2EBY A;  5AAR A;  1TN7 A;  3SQV A;  3TRB A;  3W9F A;  1UOH A;  3KJX A;  1RZS A;  1QQE A;  4GCN A;  4CDN A;  1AU7 A;  1HG2 A;  1MZC A;  4ANV A;  3DSW A;  4OB4 A;  4TUU A;  3RO3 A;  3TWS A;  3O48 A;  3NOC D;  3MEK A;  2CRO A;  1R63 A;  2ZIS A;  2J7W A;  4GHJ A;  3DXK G;  3ZHI A;  3LVQ E;  4ILH B;  2PM6 A;  5AEN A;  3HXD A;  3RIB A;  3S8Q A;  4RG9 A;  3U3W A;  3ZN3 A;  1K1B A;  5T8I A;  1UW4 B;  4GML A;  1N0R A;  2H6H A;  3CKC A;  2XCJ A;  3QWG A;  3NAW A;  3L54 A;  4GCO A;  3IVP A;  4GQM A;  3D9O A;  3U4T A;  3FEX A;  1BDI A;  2X38 A;  5D0Q D;  3ZKJ A;  1BDH A;  1LMB 3;  2BED A;  3C3Q A;  1Z3X A;  2EIL E;  3ULY A;  3PXP A;  3B7S A;  5BXO A;  5B1B E;  3TWT A;  1DNP A;  4X4B A;  4G2V A;  3B7R L;  3CIA A;  4J8E A;  4C0M A;  3EDT B;  2R05 A;  4CT4 A;  4X4C A;  4F1S A;  2IOL A;  4G26 A;  3QOW A;  5CCM A;  3PVL A;  4GU5 A;  2PIJ A;  1JCQ A;  1FVF A;  2XEH A;  1BU9 A;  3L1P A;  4U8V D;  3NRO A;  1XNF A;  4G1T A;  2E2E A;  2P9S G;  3HIZ A;  4I2Z A;  2LYS A;  2ZGG A;  3ASF A;  4XI0 A;  1LLI A;  4N2Q A;  5FIN A;  2OEV A;  1MYO A;  4JHK A;  4DX7 D;  4G8L A;  1PY1 A;  3QKY A;  2NYJ A;  4LSZ E;  3V2X A;  4X4F A;  5JHB A;  2ICP A;  4HI8 A;  4BTB A;  4FLB A;  3FUD A;  3PEV B;  5DRY A;  1JFS A;  3JQ1 A;  4YG7 B;  4WWP A;  3CK8 A;  3AG3 E;  4YND A;  4B89 A;  4X4E A;  1FVH A;  4UUC A;  3QB2 A;  2P9U G;  3IV0 A;  1N4P A;  2LLV A;  3LCA A;  3HXF A;  3AG2 E;  3PEU B;  1SA4 A;  1O4X A;  2OCC E;  4BX8 A;  4KVM A;  4ANX A;  1MX6 A;  4DX2 A;  4GPM A;  1QZX A;  1FPP A;  2HM8 A;  3KEA A;  2KXP C;  3BDN A;  4GB9 A;  3EHM A;  3S7D A;  4BWR A;  1ZUG A;  3A9Y A;  2X3M A;  3HRA A;  1RW2 A;  4HLE A;  4O1O A;  4CYM D;  4JB8 P;  2QFC A;  3UPV A;  4U0U A;  3PUK A;  1CJG A;  1Y6I A;  2IEJ A;  2ICT A;  5JHA A;  4ZFH A;  2CHZ A;  3QWP A;  5T3R A;  3QDN A;  4WUY A;  4Q2J A;  1NL4 A;  3PZ1 A;  4X4G A;  4DJA A;  4WNG A;  5C1D A;  2Y69 E;  3MV2 B;  4Q69 A;  4RSY A;  3J5P A;  1DWK A;  4J8D A;  2ION A;  1AWC B;  3CEC A;  3QJZ A;  3P2B A;  5EX0 A;  1QPZ A;  2VSN A;  2HE0 A;  1ZZ7 A;  2PNN A;  1EPU A;  2VQ2 A;  4PS7 A;  5CBO A;  3J5Q B;  4TXQ A;  3SR4 A;  3SGH A;  1Y8M A;  5FWQ A;  3ZYK A;  3G2S A;  4LNG A;  2IVB A;  2A4Z A;  4U04 A;  2V4L A;  5CMW A;  4MCT A;  5H7P A;  3C72 A;  3S7F A;  2JVL A;  3JXI A;  4KBQ A;  1QZ2 A;  5AQA A;  3FUF A;  3V30 A;  4UWH A;  4CRW A;  4QQI A;  5ENS D;  1PRU A;  4IVZ A;  1JWL A;  1HX8 A;  4JCY A;  4JW1 A;  3L82 A;  1QQA A;  2JEK A;  4G8K A;  2FFH A;  1HF8 A;  3AU5 A;  2P2C P;  4IN3 B;  3C3R A;  3U9W A;  1OY3 D;  3AU4 A;  4HOR A;  4MCX A;  3QWV A;  3L16 A;  2OFY A;  2LSV A;  3RU0 A;  3R09 A;  3Q47 B;  5FTP A;  4CDR A;  1K8K G;  2IU1 A;  3UKU G;  1LD7 A;  3MEJ A;  3Q9U C;  3I5P A;  3SF4 A;  3AG1 E;  3FUJ A;  2IUO A;  2DYS E;  3OQO A;  2WQ7 A;  2RD0 A;  3Q4A B;  4AEZ C;  4RQI A;  4MS6 A;  1RZ4 A;  3DSU A;  3GZ2 A;  4A1S A;  2HSG A;  4GTT A;  2IV1 A;  3CR3 A;  2DYR E;  3KSQ A;  3NB2 A;  4YDW A;  3KZ3 A;  4FC8 A;  3ZUV B;  2L0T B;  4I1M A;  4GZ6 A;  4FLH A;  5AQ7 A;  2FO7 A;  5KBA A;  5CBN A;  4EHM A;  3G2T A;  4A1G A;  2A6C A;  2WVI A;  3ZEF A;  4C48 B;  3GN5 A;  2C0L A;  5AJD A;  1K1A A;  1HQ1 A;  3ZXS A;  2CFU A;  5ARG A;  3T8K A;  3TWW A;  5E75 A;  4GTP A;  2XRY A;  2I2O A;  3D9M A;  4K5A B;  4OBM A;  4M3O A;  3F52 A;  2XZT G;  3UWP A;  3QWW A;  2HO1 A;  2OOE A;  5DIZ A;  2ETC A;  3UQ3 A;  2KZT B;  3FTV A;  4LCT A;  4UI9 J;  3E32 A;  3QAQ A;  3JXD L;  1SW6 A;  1NZN A;  1SZ9 A;  2RKK A;  3MGB A;  1H19 A;  3EHR A;  4O1P A;  3UX4 A;  3PNT B;  4DPR A;  2ZU6 B;  3EUV A;  5T4Y A;  2GRL A;  3E4B A;  1UJK A;  2L8N A;  3PH0 C;  1NEQ A;  1HU3 A;  2KCK A;  2L9B A;  3SI5 A;  4HI9 A;  3URZ A;  4B8C B;  2PUA A;  1H2U A;  3PUJ A;  4XX5 A;  2KEK A;  4LEU A;  3CEQ A;  1S63 A;  4XIF A;  3FH8 A;  3HVE A;  3FTS A;  1MQS A;  1TYQ G;  3JXB C;  3X2Q E;  2R2L A;  3FMY A;  4UQX A;  2HCS A;  4I1O B;  3KS2 A;  5G2N A;  3I4R B;  1WDY A;  5EKQ D;  4PU4 C;  4K5C A;  2R63 A;  2IJG X;  3QQ6 A;  4ER3 A;  3OXL A;  2MRI A;  3FYM A;  3T8M A;  5AYW D;  4FHK A;  3BG1 B;  4N3B A;  4J1W A;  4AJW A;  5M72 A;  4JEH A;  4HRM B;  3CHP A;  4U8Y D;  4DK5 A;  4RVB A;  4AVX A;  3AS5 A;  1UTX A;  3FU5 A;  4JA7 A;  3S2A A;  4HOT A;  2GRO B;  2J09 A;  4FJY A;  2HR2 A;  1QYM A;  4ACK A;  2OV8 A;  3D1N I;  4MRU A;  4OYS A;  3FUN A;  1N11 A;  3MKQ A;  3IBE A;  1BLX B;  3TEL A;  5BNW A;  3ABM E;  3SCG A;  1RZR A;  3RZZ A;  2A5E A;  3CLJ A;  3TJP A;  3ULQ A;  3FU3 A;  4Z5H A;  2XS8 A;  1YSE A;  4PU7 A;  4WND A;  2PXD A;  3CGH A;  3G5G A;  2XSD C;  1PC2 A;  4HOQ A;  3HHM A;  5KJK A;  4PU8 A;  3ZYM A;  2JQE A;  3DST A;  1UJJ A;  4PS8 A;  3BQO A;  3RRN B;  1FT2 A;  1OSL A;  4APF A;  4KYO B;  2PXP A;  4Z5C A;  1OXJ A;  3TFL A;  5ENQ D;  4LUN U;  4LNU D;  3ZKC A;  2YNQ A;  4D10 C;  2F8Y A;  2Y3A A;  3ZNG A;  4JEU A;  2FI7 A;  3Q79 A;  2AXZ A;  4ER0 A;  3ML8 A;  5BW8 C;  3TL5 A;  3VLF A;  2IO2 C;  2AW6 A;  1TNZ A;  3VLD A;  2DBA A;  3KAE A;  2XPY A;  3Q9N C;  3SFZ A;  2LYJ A;  5EID A;  5DBK A;  4U0Z A;  3PDN A;  4XKB A;  3ESL A;  4B0Z A;  4CCA A;  1POU A;  2XZD G;  3FEY A;  3G2V A;  1OT8 A;  2D5V A;  4J6I A;  5FT9 A;  2L6B A;  3D9J A;  4FAD A;  3GZ1 A;  4BT8 A;  1JFT A;  5DSX A;  4KZC A;  4F1P A;  5LP0 A;  2I6H A;  2MEZ A;  4DI4 A;  3FP3 A;  3KEZ A;  3L17 A;  3IKO B;  1H6K A;  4V3I A;  1DUL A;  4FN3 A;  3R7Q A;  3HG0 D;  2DIW A;  2AWI A;  1DW9 A;  2X6I A;  3OQM A;  1BD8 A;  3W9G A;  4CGW A;  3IXE A;  3UIN C;  3LVR E;  3BD1 A;  1XGW A;  3D9L A;  4DUI A;  4OVU A;  2L0I A;  1SQM A;  2KPJ A;  4MKT A;  5LCW C;  1W3B A;  4EKG A;  5AIJ A;  3LY9 A;  4RLY A;  5G55 A;  3WXX A;  1Q2Z A;  5AQB A;  3O4Z A;  2KZ8 A;  3TWX A;  4OAV B;  1SZA A;  2BJC A;  4FU3 A;  3V31 A;  3CST A;  2M63 A;  3AG4 E;  1HE8 A;  1SQ8 A;  4DX6 D;  3K9I A;  2LYP A;  5ANL A;  1HZ4 A;  2X6J A;  3VLE A;  1KLX A;  2VSY A;  4M7C A;  2HYZ A;  4APO A;  4UWF A;  3UM0 A;  3SBT B;  1YA0 A;  2XIU A;  2MOW A;  2ZIR A;  2XEN A;  4LER A;  2DZN A;  4HRL A;  2V0P A;  4K0R A;  1QP7 A;  3CHS A;  3T9K A;  1IKN D;  3Q78 A;  1NA3 A;  2XEE A;  4YG4 A;  1JCS A;  4ATZ D;  3M9L A;  5KJN A;  2LYL A;  4U95 D;  1L1M A;  3ESK A;  3EU9 A;  1YYH A;  4K03 A;  4F6R D;  3LKU A;  2ILR A;  1LD8 A;  3LJ3 A;  2WXK A;  4RG6 A;  1HO8 A;  2MHK A;  2PM7 A;  2UY1 B;  3OWQ A;  3RSE G;  4O6F A;  4EQZ A;  2XGS A;  4CEM A;  4N2S A;  3ZU7 B;  3ZRH A;  1OWL A;  4IA8 A;  4GTS A;  1TEZ A;  1U3C A;  2EWT A;  4NDW A;  1E8Y A;  3QYX A;  1KZP A;  3E33 A;  3ONK A;  2O38 A;  3SCH A;  4I9E A;  3NZL A;  1X81 A;  4ACL A;  3HYM B;  4TUM A;  2EIN E;  1G3N B;  4I6G A;  3ZYQ A;  4ZHB A;  1GT0 C;  2CG3 A;  4HS2 A;  5ENR D;  4G24 A;  3PZ4 A;  4X4H A;  2VGX A;  3CHQ A;  2WIU B;  1LQC A;  2GRP B;  3C3O A;  5DTQ A;  2I1J A;  5EIL A;  3CVN A;  1N9A A;  2BNM A;  5D0O D;  5ITZ F;  4N5Q A;  1UXC A;  4BEP A;  2LYR A;  4P29 A;  3ZPJ A;  1ELW A;  4HRA A;  3UUX A;  3Q7F A;  3B13 A;  3L6A A;  1XWR A;  5FZS A;  2V5Q C;  3OAW A;  1H2V C;  5G05 C;  3RO2 A;  1OWM A;  3DSV A;  4U8H A;  5FIO A;  1GW6 A;  5FQ8 A;  2F8X K;  1OCZ E;  4GTR A;  1HF0 A;  4L7T A;  5AN8 A;  1TNB A;  1E90 A;  2PXV A;  2WMO A;  3OXG A;  3N71 A;  2J9Q A;  1UN9 A;  2HIN A;  2AUW A;  3ASH A;  4EQF A;  2O49 A;  4HOS A;  3SO8 A;  4JPS A;  4GTM A;  2ZGD A;  3BU8 A;  4U63 A;  1UG3 A;  2LYK A;  3MV3 B;  1EYH A;  5DRT A;  3DRA A;  3HVE B;  4C0E A;  2HFZ A;  3OMT A;  4XEI G;  2IO3 C;  4ANW A;  3PZ2 A;  3ZFW A;  5EIB E;  3BEE A;  2RFM A;  5LFA A;  4J8S A;  2VJ8 A;  3HXC A;  3AAA C;  1ZZB A;  1ELR A;  4AP2 A;  2PQR A;  1OCT C;  1U2Z A;  2LNI A;  2EIJ E;  3B7H A;  5AJL A;  5D2M C;  4A3T A;  1D8E A;  4LNB A;  2LNM A;  4ILG A;  4UWL A;  3ZHE A;  1EDU A;  5J08 A;  4NAC A;  4NQ0 A;  4F3V A;  2IQC A;  2XJ3 A;  1BI8 B;  2VTB B;  1N0Q A;  3O9X A;  1QQB A;  4G25 A;  5EDS A;  4ME2 A;  3DBS A;  4FUL A;  1U3D A;  2LLW A;  5DT2 A;  3MKQ B;  4I1A A;  1MFQ C;  2YHC A;  4HNA D;  4HRN A;  3FUE A;  5FJY A;  1WG0 A;  4HB5 A;  4HVB A;  3MX3 A;  3AS4 A;  1PRA A;  4WNE A;  4BY6 A;  2KBX A;  2EF8 A;  4KZ0 A;  1EFA A;  3QC1 A;  3PRZ A;  2PXF A;  2RG8 A;  1MJ0 A;  2WXO A;  4EZJ A;  4GA0 A;  1TNY A;  4JQD A;  4EBA A;  2LAH A;  2AXU A;  1WET A;  3EU5 A;  4GZD A;  5CER B;  1LCD A;  2LO6 A;  2P9I G;  3QFI A;  3APC A;  3FHE A;  4N3A A;  4EPZ A;  3JUI A;  2PXK A;  5ENO D;  3Q73 A;  4ER7 A;  4EZI A;  2OVF A;  3D9P A;  3GBF A;  2BUG A;  4FHJ A;  4AV7 A;  1ZVV A;  4GA2 A;  4GAA A;  1DVP A;  3FUI A;  1NI1 A;  1BI7 B;  4GZ3 A;  1IQU A;  2J07 A;  5JUW A;  3DEP A;  3Q7A A;  4Q94 A;  3SY2 A;  3L9T A;  3TWV A;  2V5F A;  4U7E B;  4U07 A;  3QK0 A;  2BTD A;  2XCC A;  2LXM A;  2QY7 A;  1IHB A;  3QAR A;  4CZ2 D;  3B7U X;  1UXD A;  3SCF A;  3SFY A;  4B93 B;  3L08 A;  4HFG A;  4DX1 A;  2YBD A;  1N4Q A;  4KXK B;  3GZD A;  2AJA A;  4JXT A;  3LDZ A;  3MCX A;  4IRU A;  1IQR A;  3CVX A;  4DLQ A;  2OR1 L;  3FTW A;  3MLF A;  3PRE A;  1FCH A;  3ZYL A;  5A7D B;  2B5A A;  2B6C A;  2PXQ A;  4IYP A;  2CFZ A;  2EQX A;  2WXH A;  5CED B;  1LTX A;  5EN5 D;  1PAQ A;  2V3C C;  3ZGQ A;  1JWF A;  3QOU A;  4I6R A;  2WQ6 A;  2WXF A;  1HS6 A;  4G23 A;  3LY7 A;  1N95 A;  3CHM A;  1BPO A; 
#chains in the Genus database with same CATH homology
 4WWP A;  4BT8 A;  1JFT A;  2PE5 A;  4KZC A;  1Z3Y A;  3CK8 A;  3CHR A;  3EIJ A;  1VDY A;  1TJC A;  4I6T A;  3UFD A;  5LP0 A;  2WXJ A;  4PUC A;  1NER A;  4YND A;  3TG4 A;  1WH6 A;  4X4E A;  3CHO A;  4B89 A;  1WAO 1;  1FVH A;  3QB2 A;  1OWO A;  2I6H A;  3IV0 A;  4G11 A;  4UI9 K;  2MEZ A;  3GZS A;  5CMY A;  3FTX A;  3LCA A;  4AIF A;  4ATG A;  4DI4 A;  3PEU B;  3FP3 A;  4WWN A;  1O4X A;  2I1K A;  4DI3 A;  1VPW A;  4BX8 A;  1A17 A;  3KEZ A;  3L17 A;  4YG1 A;  3IKO B;  4KVM A;  4ANX A;  5JJ6 A;  2XPI A;  1ZZ6 A;  1H2T C;  1H6K A;  2AVP A;  4V3I A;  4FN3 A;  5E76 A;  2IOS A;  2R1J L;  3R7Q A;  2DIW A;  3Q49 B;  5KJM A;  2AWI A;  3ZVV A;  4LRZ A;  1DW9 A;  2X6I A;  3MYV A;  4U0S A;  3OQM A;  4CGW A;  2HM8 A;  1OWN A;  3UT8 A;  3PE3 A;  3BDN A;  4B8C B;  3FY4 A;  4GB9 A;  4HOU A;  2WXM A;  3LVR E;  3BD1 A;  3EHM A;  4YBA A;  2UY1 A;  3S7D A;  1XGW A;  3D9L A;  3PZD A;  5BV1 A;  3CHM A;  4BWR A;  3SD5 A;  1L5J A;  3HZI B;  1ZUG A;  3CLC A;  2WXG A;  4L2L A;  3RKV A;  4OVU A;  2L0I A;  2VYI A;  2X3M A;  4AM9 A;  1SQM A;  4HLE A;  2KPJ A;  4MKT A;  4XE0 A;  4JA9 A;  5LCW C;  4JVS A;  5J90 A;  1W3B A;  3FDH A;  5AIJ A;  2PUB A;  3LY9 A;  1Y7Y A;  5BT1 A;  3FTU A;  2QFC A;  4OVV A;  4UWG A;  5G55 A;  3WXX A;  3LPZ A;  4URK A;  4U0U A;  4EEC A;  3D9K A;  3UPV A;  4X4I A;  3PUK A;  1CJG A;  3JYS A;  2GRM A;  1Y6I A;  3RJV A;  2ICT A;  3O4Z A;  2KZ8 A;  1H0A A;  5JHA A;  2YIN A;  3SZ7 A;  2IF4 A;  2CHZ A;  3QWP A;  5T3R A;  3T8M A;  3QDN A;  1E96 B;  1WIZ A;  1SZA A;  2WXI A;  4WUY A;  3UMV A;  2BJC A;  4FU3 A;  3CST A;  2M63 A;  1S7E A;  4DJA A;  4X4G A;  3U66 A;  1HE8 A;  1SQ8 A;  4WNG A;  3ONL A;  5C1D A;  3FTY A;  3K9I A;  3MV2 B;  2LYP A;  1WY6 A;  4I6E A;  5ANL A;  3LXU X;  4Q69 A;  5G2N A;  3FUH A;  4RSY A;  1HZ4 A;  2X6J A;  1DWK A;  1IHG A;  4J8D A;  3VLE A;  4XI9 A;  1KLX A;  2ION A;  2VSY A;  2HYZ A;  4APO A;  4UWF A;  1LCC A;  3CEC A;  3EJN A;  4FJZ A;  3TG5 A;  3SBT B;  3QJZ A;  2WUS R;  3CVL A;  3P2B A;  5EX0 A;  1WM5 A;  1YA0 A;  2XIU A;  2MOW A;  2XGO A;  3CKB A;  3ASD A;  3FH5 A;  3PS6 A;  1QPZ A;  4GZ5 A;  4LER A;  1LF8 A;  2VSN A;  3JQ0 A;  2DCP A;  1ZZ7 A;  4Y6C A;  3EUS A;  1EPU A;  1E8Z A;  4J1X A;  2V0P A;  4K0R A;  2KAT A;  5HQ8 A;  5ANR A;  1QP7 A;  2VQ2 A;  3BS3 A;  3CHS A;  1NA3 A;  4PS7 A;  3FWV A;  5KJL A;  4FA6 A;  4YG4 A;  3KD7 A;  4YVQ C;  4B94 A;  4I2W A;  2JCG A;  5FQ7 A;  5KJN A;  1IYG A;  2LYL A;  3ASG A;  1L1M A;  2NXP A;  3ESK A;  4PS3 A;  4K03 A;  3L13 A;  3SGH A;  3LKU A;  2ILR A;  2OVB A;  3R9A B;  1KT0 A;  1Y8M A;  3LJ3 A;  5FWQ A;  4GPK A;  2WXK A;  4RG6 A;  4KVO A;  3G2S A;  3ZYK A;  1HO8 A;  2IVB A;  2A4Z A;  4Z5D A;  1WH8 A;  1Z6T A;  2MHK A;  4U04 A;  2PM7 A;  2V4L A;  5CMW A;  4MCT A;  4O8B A;  3F51 A;  2UY1 B;  4O6F A;  3S7F A;  5A7L A;  2WM9 A;  2XGS A;  2JVL A;  3LIS A;  4KBQ A;  3ZRH A;  4CEM A;  4N2S A;  1OWL A;  4IA8 A;  1TEZ A;  1QZ2 A;  1PRV A;  2GW1 A;  3FH7 A;  3FUF A;  2CG2 A;  4UWH A;  2XRZ A;  3CVU A;  1U3C A;  2EWT A;  4CRW A;  4NDW A;  2KEI A;  1UN8 A;  1E8Y A;  5FQ6 A;  3QYX A;  1OUV A;  5LCW J;  3CQG B;  2R5S A;  1PRU A;  4IVZ A;  3FU0 A;  1Y9Q A;  1JWL A;  3ONK A;  4TV3 A;  2O38 A;  1HX8 A;  3SCH A;  2J4B A;  2WXP A;  3PNL B;  4JCY A;  2J08 A;  5G04 C;  3SNX A;  2IVQ A;  4I9E A;  4JW1 A;  4N39 A;  1QQA A;  4JCX A;  3D3M A;  5C2Y A;  2JEK A;  1B0N A;  3T5V A;  3MA5 A;  1HF8 A;  4X4D A;  2AXV A;  2YQ8 A;  2FBN A;  3AU5 A;  5FZR A;  4ACL A;  4IN3 B;  4F7A A;  3HYM B;  4E85 A;  3U9W A;  4GZC A;  4E6H A;  3CK9 A;  3AU4 A;  1RIO A;  4BFR A;  3TXN A;  4HOR A;  2PUG A;  2CSF A;  4MCX A;  4NUR A;  4I6G A;  4Y42 A;  3QWV A;  2XCB A;  3ZYQ A;  3L16 A;  2OFY A;  2LSV A;  1GT0 C;  2CG3 A;  3RU0 A;  2FUL A;  3Q47 B;  4HS2 A;  2OND A;  4Y6W A;  4F53 A;  5FTP A;  3I4G A;  4G24 A;  4XKC A;  3T5X A;  4CDR A;  4IWR A;  3D9N A;  3R7R A;  4X4H A;  2VGX A;  4UI9 C;  2KZT A;  2IU1 A;  3CHQ A;  1JWG A;  2WIU B;  2O4A A;  2FJR A;  4L23 A;  3I5P A;  1LQC A;  3SF4 A;  1ZZ8 A;  3FUJ A;  2I1J A;  2IUO A;  1RPE L;  3RK6 A;  3OQO A;  3CVN A;  4R7L A;  2WQ7 A;  2BNM A;  2RD0 A;  3PE4 A;  3Q4A B;  5D0O D;  4MS6 A;  4AEZ C;  2I9C A;  4JHR A;  3KXA A;  4QFV A;  5K98 B;  4L1B A;  3TGO A;  1UXC A;  3CV0 A;  4I6U A;  3GZ2 A;  3JXC L;  3MKR A;  4J0U A;  4A1S A;  2HSG A;  2PZI A;  3JQ1 A;  2VSO E;  2LYR A;  3LYA A;  4P29 A;  3ZPJ A;  1ELW A;  3IEG A;  4CT0 A;  1N52 A;  3TXM A;  3QF3 A;  4TRQ A;  4N5C A;  1QP4 A;  3UUX A;  3NF1 A;  4YVO A;  3LFP A;  4H7X A;  2IV1 A;  2VGY A;  3S7B A;  3B13 A;  3CR3 A;  3L6A A;  1P5Q A;  3S7J A;  4GYY A;  3EHN A;  1X2L A;  1XWR A;  3LEW A;  3AS8 A;  5FZS A;  5JJ7 A;  3CVP A;  4CDM A;  3OAW A;  3L22 A;  1H2V C;  3KZ3 A;  5G05 C;  5EX3 A;  4FC8 A;  3RO2 A;  1HFA A;  1OWM A;  5JJT A;  2L0T B;  4U8H A;  4BTA A;  2IU7 A;  1HXI A;  1GW6 A;  4I1M A;  1JH9 A;  3CRO L;  3MZL B;  3Q15 A;  2YHE A;  4GZ6 A;  5FQ8 A;  3ENE A;  2WB2 A;  4FLH A;  2FO7 A;  2X6F A;  1INZ A;  1HF0 A;  4L7T A;  2LSU A;  3C98 A;  3DNV B;  3APF A;  3FTZ A;  3I3N A;  4UQZ A;  2J4D A;  2C2L A;  3G2T A;  4KMO A;  4A1G A;  1PER L;  1E90 A;  2H8R A;  2A6C A;  2WMN A;  2WMO A;  3OXG A;  3N71 A;  2WVI A;  2J9Q A;  1ZU2 A;  3ZEF A;  3ZHE B;  1ADR A;  1UN9 A;  2VSX E;  3GN5 A;  2C0L A;  3ML9 A;  2HIN A;  2E0I A;  3FUL A;  4I6J A;  5AJD A;  3ZXS A;  2AUW A;  3ASH A;  5FZQ A;  3HDX A;  4EQF A;  2CFU A;  2O49 A;  3NZU A;  3G7D A;  1JUQ A;  5ARG A;  3CVV A;  3CQC B;  4HOS A;  2JLB A;  4JPS A;  4W9R A;  5E75 A;  2XRY A;  4U63 A;  2I2O A;  3D9M A;  4GA1 A;  5G04 J;  1UG3 A;  2XI8 A;  4M3O A;  3F52 A;  4H7Y A;  2GGF A;  2LYK A;  1JPL A;  3G2W A;  3MV3 B;  5HI7 A;  1EYH A;  2P58 C;  1R69 A;  2PL2 A;  3EIQ C;  2XGM A;  3QWW A;  4WAF A;  2HO1 A;  2R59 A;  3B7T A;  3HVE B;  3JCK C;  4N3C A;  4C0E A;  2OOE A;  5DIZ A;  5BPP A;  4AXH A;  1PNR A;  3OMT A;  4ANW A;  2CHX A;  4J8F A;  3P1U A;  3ZFW A;  2VGX B;  5A6C A;  3UQ3 A;  2KZT B;  1MHQ A;  3BEE A;  3FTV A;  4LCT A;  5LX8 A;  3ZW3 A;  4L2Y A;  2FEZ A;  5LFA A;  4UI9 J;  2BNO A;  2BF0 X;  4J8S A;  3TAX A;  3CVY A;  3QAQ A;  2VJ8 A;  3CK7 A;  3U64 A;  3JXD L;  1SZ9 A;  1NZN A;  3MGB A;  1H19 A;  4I17 A;  4Z58 A;  1ZZB A;  3UX4 A;  1ELR A;  3PNT B;  4DPR A;  2ZU6 B;  3H5T A;  4XZ4 A;  1S0P A;  4AP2 A;  1KT1 A;  2CHW A;  2PQR A;  1IC8 A;  3CSF A;  1OCT C;  4GMJ A;  2LNI A;  3NQP A;  5T4Y A;  3DPD A;  2Y4U A;  3B7H A;  4ILI A;  4PDX A;  5AJL A;  4AY5 A;  2GRL A;  4A3T A;  4DLO A;  3E4B A;  2X6H A;  2C0M A;  3FYA A;  2Y4T A;  4ILG A;  4UWL A;  5FQ4 A;  3ZHE A;  1EDU A;  1UJK A;  1NP7 A;  2L8N A;  4NAC A;  4NQ0 A;  4C9B B;  5J08 A;  4F3V A;  3PH0 C;  2IQC A;  2XJ3 A;  3APD A;  4A55 A;  3IHV A;  2PQN A;  1NEQ A;  1HU3 A;  2KCK A;  1QP0 A;  2L9B A;  3G2U A;  2WXN A;  4MLP A;  4NRH B;  5LOZ A;  5G05 J;  2PUA A;  1H2U A;  3SI5 A;  3PUJ A;  3O9X A;  3URZ A;  3VTY A;  1QQB A;  4XX5 A;  4G25 A;  5EDS A;  4ME2 A;  1RZR D;  1HH8 A;  2KEK A;  3DBS A;  4HXI A;  4LEU A;  3CEQ A;  3OXF A;  5KCM A;  4FUL A;  4XIF A;  2V8S E;  4PU3 C;  4Q96 A;  3FH8 A;  2NSZ A;  1U3D A;  3GW4 A;  3FTS A;  3HVE A;  3MKQ B;  3SHF A;  4I1A A;  1MQS A;  3LS8 A;  2YHC A;  4I9C A;  3FU6 A;  2FF4 A;  3GN5 B;  3FUE A;  5FJY A;  3FUM A;  4YAR A;  3JXB C;  2L6J A;  1N54 A;  2J49 A;  3UT4 A;  5ARF A;  4FAD A;  4HVB A;  3MX3 A;  2KC7 A;  3FMY A;  4A3V A;  3AS4 A;  1PRA A;  4UQX A;  4JHJ A;  4I1O B;  4WNE A;  3KS2 A;  4KT6 B;  4BY6 A;  4PH4 B;  2EF8 A;  4KZ0 A;  1EFA A;  2VTB B;  2A5U A;  3NZS A;  2WPV A;  1TJF A;  2KEJ A;  3QC1 A;  1X5B A;  2Q7F A;  3I4R B;  3PRZ A;  4FBI A;  2LAI A;  4FP7 A;  2RG8 A;  2WXO A;  5EKQ D;  4PU4 C;  4ABN A;  2VTB A;  4EZJ A;  2R63 A;  4GA0 A;  2IJG X;  4BT9 A;  1ZS4 A;  3QQ6 A;  1EF1 C;  3QNK A;  4JQD A;  4IUL A;  3OXL A;  4EBA A;  3BG0 B;  2PPX A;  2MRI A;  3FYM A;  3FUK A;  2LAH A;  3SBS A;  5AYW D;  2XHE A;  1ELK A;  2AXU A;  4FHK A;  3BG1 B;  4N3B A;  4J1W A;  4AJW A;  1WET A;  4GZD A;  5ENN A;  1ZBP A;  3Q5M A;  5M72 A;  4UWK A;  1LCD A;  4JEH A;  3VTX A;  1ZZ9 A;  2NC9 A;  2KM4 A;  3VK0 A;  4GYO A;  4I43 A;  2WQH A;  4JC8 A;  3CHP A;  2LO6 A;  2EBY A;  3APC A;  3FHE A;  2IVG A;  4N3A A;  4EPZ A;  4AOF A;  3JUI A;  3TRB A;  4WWO A;  3RRM B;  3KJX A;  1RZS A;  4JL0 A;  4DK5 A;  1NA0 A;  4RVB A;  4AVX A;  3AS5 A;  1QQE A;  4GCN A;  1UTX A;  1OWP A;  4CDN A;  3FU5 A;  1E7U A;  3D9I A;  4JA7 A;  1AU7 A;  1HG2 A;  3S2A A;  2OVF A;  3IHY A;  3CVW A;  2J09 A;  1B89 A;  2HR2 A;  4FJY A;  4HOT A;  4ANV A;  4OB4 A;  4TUU A;  3RO3 A;  3RRU A;  3O48 A;  4ACK A;  2OV8 A;  3D1N I;  2LCV A;  2WXQ A;  3D9P A;  4MRU A;  4OYS A;  2GZU A;  3GBF A;  2CRO A;  2PUF A;  2BUG A;  3FUN A;  3MEK A;  3OP9 A;  1R63 A;  2KCL A;  4FHJ A;  3MKQ A;  3IBE A;  4AV7 A;  4EBA G;  1ZVV A;  5BNW A;  4GA2 A;  4GHJ A;  3SCG A;  1ZZC A;  4GAA A;  1RZR A;  3ZHI A;  3LVQ E;  3RZZ A;  1DVP A;  3CLJ A;  2MQK A;  2PM6 A;  4ILH B;  3TJP A;  3FUI A;  3ULQ A;  5AEN A;  3FU3 A;  4Z5H A;  3RIB A;  3S8Q A;  1YSE A;  3U3W A;  4RG9 A;  3ZN3 A;  4PU7 A;  5A23 A;  4WND A;  1UW4 B;  4GZ3 A;  5T8I A;  1IQU A;  4GML A;  3LY8 A;  3CGH A;  3UT7 A;  3G5G A;  4BSX A;  2XSD C;  1CQT A;  2J07 A;  2XCJ A;  3QWG A;  1PC2 A;  3CKC A;  4Q94 A;  4BX9 A;  3R1F A;  4CGV A;  3L54 A;  4GCO A;  1E7V A;  3IVP A;  4GQM A;  3OQN A;  4HOQ A;  3D9O A;  3HHM A;  2V5F A;  4PU8 A;  3OTN A;  3ZYM A;  5KJK A;  4U07 A;  4EZL A;  3QK0 A;  3U4T A;  1UJJ A;  3FEX A;  4PS8 A;  1BDI A;  3MJW A;  2X38 A;  5D0Q D;  4B8A A;  1E3O C;  1BDH A;  2BTD A;  1QNF A;  1LMB 3;  2XCC A;  4WNF A;  3RRN B;  2QY7 A;  2XQ0 A;  1OSL A;  4APF A;  4KYO B;  3QAR A;  1Z3X A;  3B7U X;  4Z5C A;  1UXD A;  3SCF A;  3GYZ A;  4LUN U;  3L08 A;  4HFG A;  4ANU A;  3PXP A;  3B7S A;  2WXL A;  3ZKC A;  2PUD A;  2YNQ A;  4D10 C;  1DNP A;  4X4B A;  4AY6 A;  4G2V A;  2PUC A;  2Y3A A;  3B7R L;  3CIA A;  4KXK B;  4J8E A;  2R17 C;  2XPZ A;  4C0M A;  3EDT B;  2PUE A;  4JXT A;  4CT4 A;  4X4C A;  4JEU A;  2FI7 A;  4F1S A;  2AXZ A;  5CHE E;  3LDZ A;  2X6K A;  2IOL A;  4G26 A;  2LYQ A;  3ML8 A;  5CCL A;  5BV0 A;  1X57 A;  5CCM A;  3PVL A;  5BW8 C;  3TL5 A;  1ZAY A;  3F6W A;  4Z59 A;  4GU5 A;  2L49 A;  2PIJ A;  3VLF A;  3MCX A;  3ZIM A;  1FVF A;  1ZPQ A;  2AW6 A;  4IRU A;  1IQR A;  3VLD A;  3CVX A;  4DLQ A;  3L1P A;  2OR1 L;  1HG5 A;  2DBA A;  1XNF A;  2E2E A;  2XPY A;  3CVQ A;  3FTW A;  3KAE A;  3MLF A;  3HIZ A;  3PRE A;  4G1T A;  4I2Z A;  4UQY A;  2LYS A;  1FCH A;  3SFZ A;  2LYJ A;  3ASF A;  4XI0 A;  3ZYL A;  1LLI A;  4N2Q A;  4F8D A;  5DBK A;  2IFU A;  4GYW A;  4U0Z A;  1E8X A;  3PDN A;  4XKB A;  2B5A A;  5A7D B;  2XEV A;  3ZHM A;  4JHK A;  4I8T A;  3ESL A;  2UWJ G;  4IYP A;  2CFZ A;  4JZY A;  2EQX A;  2WXH A;  4B0Z A;  1PY1 A;  3QKY A;  1PAQ A;  4X4F A;  1POU A;  1JWF A;  2WXR A;  2BNN A;  3FEY A;  3ZGQ A;  2ICP A;  4CCA A;  5BUZ A;  3FFL A;  5JHB A;  3QOU A;  4I6R A;  4BTB A;  1E8W A;  2WXF A;  4FLB A;  4EZK A;  2WQ6 A;  3G2V A;  1HS6 A;  4G23 A;  3LY7 A;  2D5V A;  4J6I A;  3FUD A;  5FT9 A;  3PEV B;  3D9J A;  1JFS A;  2KCV A;  4YG7 B;  1BPO A;  3GZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...