3QOWA

Dot1l structure in complex with sam
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
327
structure length
322
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKWTGKPVSYYLHTIDRTILENYFSSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 322
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qowA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qowA02
1AQIA 3FTDA 2GAFA 5IH3A 4AZWA 5K0BA 5FA5A 1XDZA 3EGVA 2OXTA 4LG1A 3BWMA 4FZVA 1XCJA 2IDJA 2NXEA 3ELYA 3G5LA 3KQSA 4GC9A 4CXMA 2PX5A 1XCLA 5FWDA 4MTLA 5E9JA 3P2IA 4YMGA 3B7PA 2HNKA 3CJQA 4RX1A 3T7TA 4CWAA 4RTOA 4QQNA 1P39A 5CD1A 3MAGA 3DXYA 2ZIGA 2C7PA 3UJAA 4RTRA 1BKYA 2HMYB 3G89A 3FZGA 3A26A 3DTNA 1SVUA 3KPVA 3G2MA 2CKDA 2FK8A 2YTZA 3I58A 2AOTB 4PYLA 3D2LA 5ICCA 5EMJA 3KR1A 2PX4A 1MHTA 3DXXA 2ORED 3EVZA 4HGZA 5EKXA 1G38A 3M6UA 5FWAA 1VP3A 3BGIA 5K09A 1YZHA 4XUDA 1JR4A 5EMKA 1I1NA 4FP9A 3TPZA 5KQRA 4ER6A 3CKKA 3LHDA 1UFKA 3VC2A 4RTMA 3ER9A 2ZZMA 5F2OA 4AZSA 1L1EA 1TW2A 3T7RA 3JWIA 2VDUE 4U7TB 5HIJA 2PWYA 3I53A 2I6GA 5U4XA 4A6EA 2IGTA 3E7PA 2OY0A 3DR5A 4FGZA 5EZSA 3PB3A 4QVGA 3HTXA 5DWQA 1NW5A 3PLAE 3A7DA 4PGGA 1SG9A 1D2HA 3UBTA 4PYNA 4XCXA 3TRKA 4Y2HA 1RJEA 3KQPA 4LWOA 5DX0A 4R8SA 3MQ2A 4E30A 2JH8A 3CVOA 3KQOA 5DTQA 3NWEA 4MHTA 1G55A 1YUBA 4FT2A 1WZNA 2BZGA 5DX8A 5K03A 4FS8A 4P7GA 4PIPA 3LBFA 3R9XB 5KVAA 4IV8A 4RTPA 4UOEA 3S68A 5DTRA 2NXCA 1BHJA 3FYCA 3GRZA 3OFKA 2AOXA 4PGHA 4BP1A 2PT6A 2ZVJA 2HWKA 4EVIA 5IKMA 4YUVA 1O9GA 3KQTA 4M36A 5EIWA 5P8WA 1DCTA 3P97A 3AJDA 4ATNA 2ZCJA 3NVKI 2WA1A 3FPHA 5K05A 1NV8A 3AXTA 1PRYA 4ER3A 1NW7A 3KR2A 2ZLBA 1QZZA 5LQRA 2ZZKA 3UZUA 4HH4A 3BWCA 4GOMD 3GNLA 4HRAA 2ZW9A 3O7WA 5EC8A 3JWHA 3LL7A 3NWBA 3P8ZA 3B3GA 1WS6A 1R74A 3FPGA 4XUCA 2NNWB 5GOZA 2EJTA 4IWNA 2YQZA 3ELWA 3DMHA 3HVKA 3MB5A 2AVDA 3ANXA 2WA2A 3MTIA 5DXJA 3LGAA 3MHTA 2PGXA 5HILA 2BR4A 3ID6C 2JHAA 5DXAA 5DM2A 5DRYA 2QE6A 3E05A 3K6RA 3HVIA 5C9ZA 3H2BA 3P2KA 2O57A 2K4MA 1R8XA 3G8AA 3IYLW 4LWPA 5GM2A 3WSTA 3GXOA 4GOOD 2C7RA 3HM2A 2CMHA 1KYWA 2E5WA 5DTMA 2NYUA 2BH2A 2I7CA 2P40A 3OZRA 3LSTA 1R8YA 4E2XA 3JWJA 4H0NA 4YUYA 4ER7A 1SQFA 1D2CA 1M6EX 1IXKA 4E33A 4RTNA 2O05A 2Q41A 4PYKA 3I9FA 5ICEA 3AXSA 2F8LA 3GRVA 4M37A 1YF3A 2GS9A 2IH5A 4KWCA 2BM9A 2GH1A 4O29A 4OA8A 5T67A 1UWVA 2CL5A 4CTJA 2Z6UA 3FUUA 3DULA 3GU3A 3OCJA 1YB2A 3MCZA 5CVJA 5EG5A 3Q87B 4GF5A 3SM3A 3T0IA 1EJ6A 1X1AA 1ZGAA 3G7UA 5LQNA 5K0JA 2PKWA 4ER0A 3B3JA 5GM1A 5M5BA 5CCBA 3SSNA 3UJDA 1KP9A 3DUWA 4X61A 3NDIA 3ELUA 4CTKA 3UWPA 2ZIFA 2OBFA 3HCFA 3EVDA 4CKBA 1DL5A 2IDKA 4BLWA 1N7IA 4P58A 4EKGA 2HTEA 3R3HA 4HTFB 4POOA 4AZVA 3M70A 3EEOA 5DSTA 3PS9A 5CUQA 3LKDA 5E1BA 2ZBQA 2ZIEA 4PCLA 2QY6A 3NJRA 3V97A 1H1DA 4IV0A 3KQYA 2AVNA 3KPYA 3MERA 4V0RA 3SGLA 4YV0A 1ZHFA 1RI2A 4A6DA 2CMGA 5LQCA 5BW5A 3VC1A 4DA4A 4B17A 4GQBA 4PCAA 4HGYA 2DULA 2UZ4A 2QRVA 5EHGA 5EOVA 4DZRA 1XXLA 2GPYA 1VBFA 3HVHA 1NBIA 3R0QA 5LR6A 4BY9E 4OX9Y 3L8DA 4QPNA 2P41A 3A7EA 1RJFA 3M6XA 4KVZA 5D1NA 5DSXA 1JTEA 2G70A 3R6TA 3P71T 1G8AA 3EVEA 4EMSA 3OU7A 1VLMA 3G8BA 3UJ6A 1ZQ9A 4C06A 3CCFA 2P3LA 5EEHA 2PXXA 3PT9A 3GRRA 1V39A 5FQNA 2HV9A 3QOXA 2IP2A 3BZBA 1Y8CA 3C3YA 3UA4A 5H02A 1DUSA 2OO3A 3CBGA 1F38A 1YFLA 2EG5A 4RTSA 2OKCA 1SUSA 3DMGA 7MHTA 3FRIA 5MHTA 2ONZA 5LQJA 3V8VA 4RVFA 2P7IA 3GWZA 4OBWA 3RW9A 5ICFA 4RVDA 1RI5A 3FTEA 4GEKA 5FUBA 1NBHA 3HP7A 4PYOA 4R6WA 1IM8A 5EHIA 2ZFUA 3Q7EA 1WXWA 2P1DA 4MQ4A 5E9WA 3EVFA 3GIWA 2IBTA 2AS0A 3MTEA 2XYRA 1SUIA 1XTPA 1NE2A 1BOOA 1I4WA 2ESRA 3DLIA 1KPHA 1RJGA 2ZTHA 3FTCA 3GRYA 3HNRA 4PWYA 2A14A 4X63A 3B3FA 2FYTA 2H11A 2AOTA 5EEGA 3GDHA 2PWPA 4OQDA 3SXJA 5BP7A 3E23A 3KHKA 4P7JA 1QYRA 1KPGA 5ERGB 4X1OA 4C03A 5JR3A 2EFJA 1T43A 2JH9A 1FPQA 3SSOA 3R24A 3JWGA 4QDKA 5CVVA 3BUSA 4EKIA 2YXEA 2PBFA 3P9KA 4R8RA 2PXAA 2I9KA 4IKPA 2C7QA 3TM4A 2AOUA 5E1MA 1N7JA 1M0EA 5HIIA 3DH0A 2OB1A 3OU6A 1XJ5A 4E31A 1FBNA 3C6KA 5C0OE 1AQJA 4F86A 4KW7A 2PY6A 4E32A 3OE5A 4YV2A 3E8SA 3M33A 3GRUA 3CC8A 5BXYA 4GOLD 5LSAA 4KRGA 3SR4A 3ELDA 3LDFA 5FCDA 1WXXA 4RTKA 5CIYA 5GP1A 2JG3A 1VP9A 5CM2Z 3PX2A 2ZBPA 3FUWA 3CJRA 3DMFA 2EJUA 5HOQA 5ICGA 4QQKA 3PTAA 2I62A 3OFJA 1ORIA 2PJDA 5EMMA 5D1HA 1L9KA 3LX6A 4HG2A 1JTFA 3FPEA 2HR1A 4KIGA 2P3OA 2N47A 4Z2YA 3C6MA 3RIEA 1XDUA 2VP3A 2ONYA 3G5TA 3QV2A 3LDGA 3M4XA 4U7PB 4X41A 3ER8A 3AWIA 2IBSA 2PT9A 4KDRA 4RSRA 5G02A 1ZKDA 2O0LA 3SSMA 4RWZA 1B42A 2GA9A 4PONA 3LKZA 1BC5A 1HMYA 2G71A 2BR5A 4PIMA 4PYMA 4YMHA 3TLJA 3DLCA 3EGEA 3GCZA 3EVGA 3NMUF 2B3TA 4BLUA 4RTQA 3G2OA 4KIFA 3GJYA 1UIRA 2ERCA 4WXHA 1VPTA 2VDVE 5E2AA 2JHCA 3LBYA 4RYLA 2XBMA 3FRHA 4AX8A 2IIPA 4P7FA 1R00A 2UYOA 2FPOA 4C05A 3KPUA 4QTUB 1L3IA 5K0EA 4YV1A 2PV0A 5K8VA 5KYGA 5FTWA 3EPPA 3SX0A 1HNNA 1U2ZA 4M38A 1OR8A 1NV9A 3UJCA 2V7EA 5E1OA 2R3SA 5LQKA 4C04A 3KR9A 2B9EA 1VE3A 4PINA 3SMQA 5JUWA 3M6WA 1JG3A 4AZTA 1INLA 3C3PA 4YUZA 2VDWA 1SQGA 3B5IA 1VQ1A 1XVAA 3THRA 1KR5A 3A25A 3B89A 1AV6A 5FQOA 2KW5A 1JG4A 3BKWA 3GO4A 5EGSA 2PVCA 4E70A 3P2EA 1WY7A 2XVMA 4FR0A 4F85A 2XYVA 2G72A 1RJDA 1G60A 3C0KA 3HEMA 10MHA 1RI1A 4ISCA 3KQVA 2NP7A 5DX1A 2YUIA 3P9IA 4RTJA 1ZG3A 2H1RA 3HA3A 3KPJA 4QDJA 4XUEA 5HFJA 2AN4A 2LD4A 5DPMA 4QPPA 2PSSA 3LCCA 5FULA 2AOVA 1JQDA 2AZTA 2FK7A 2YXDA 2YX1A 5F2NA 2VS1A 1PJZA 4EQZA 3MGGA 5GIPE 2Y1WA 3BXOA 5E8JA 2H00A 1JQ3A 3BWYA 4E2WA 2ZZNA 5HIMA 1YZ3A 3HVJA 5K0LA 3VSEA 3RODA 2FHPA 1Q0SA 3EGIA 1VIDA 4OQEA 4QTTB 4MIKA 1KIAA 4PYQA 1AF7A 1NW3A 2DPMA 4FSDA 1KYZA 4OA5A 3TMAA 3NTVA 2BM8A 3X0DA 2XVAA 5GINE 3KKZA 5CCXA 5FHQA 5FHRA 2P8JA 2FCAA 2PX2A 2NP6A 4JXJA 3EVAA 4CKCA 5KQSA 4BP3A 3F4KA 3NW9A 2GLUA 2XYQA 3CGGA 4FT4A 3TKAA 4DF3A 4RVHA 1EIZA 3PFHA 4PNEA 4LECA 4RTLA 3UA3A 2P7HA 4PYIA 5HZMA 4HTFA 4R05A 4KDCA 4HC4A 2QM3A 1FP2A 1QAOA 3FUTA 4DM3A 5HEKA 3TOSA 2P35A 3BWBA 4L7VA 4C08A 3HA5A 2AOWA 5CVEA 1NKVA 5B1SA 4PYJA 1IY9A 5EPEA 3A4TA 3IV6A 1XDSA 2G1PA 1R18A 3UJBA 2UYCA 5DRTA 1P1BA 3KQMA 3LCVB 5CVDA 4ER5A 4DCMA 1FP1D 2AOUB 2PX8A 3DOUA 3BGDA 1RI3A 3DXZA 1EJ0A 3UFBA 1P1CA 2PXCA 4DQ0A 1NW6A 4YUXA 3O31A 3UJ8A 2B78A 2V74B 2UYQA 3G88A 3PFGA 5C1IA 3IHTA 1X1CA 3LECA 3OU2A 3PX3A 4F84A 3BT7A 5FADA 4M7RA 4HSGA 3KQQA 5EKUA 5DM1A 1JQEA 3KR0A 3TFWA 9MHTA 4C4AA 3OE4A 1G8SA 4WVLA 5DLYA 4E2ZA 2IH2A 2YXLA 3EMDA 1RI4A 3IEIA 3KQWA 3I5UA 1P91A 3HCDA 3A27A 1F3LA 3G2QA 5EQJB 2OYRA 3MCTA 2OB2A 2P3QA 2ADMA 2YVLA 3HA7A 4GUAA 1EAMA 5F2KA 1YFJA 3ORHA 1EG2A 1JG1A 1NT2A 2O06A 2GB4A 3AY0A 5DM4A 5LQAA 1EQAA 4GC5A 2VZ9A 2R6ZA 3P9CA 4ZTBA 3FUXA 2OPBA 4BLVA 1FJXA 5KS2A 5GWXA 3T7SA 3NDJA 4X60A 1I9GA 1L3CA 2UYHA 4K6MA 4YUWA 5LQUA 5DM0A 1X19A 4OBXA 5E2BA 4E2YA 1JG2A 1NW8A 1R6AA 3O4FA 5K0CA 2FRXA 4FSXA 2CWWA 2EX4A 2C7OA 2YR0A 3FPFA 3TQSA 3VYWA 2JJQA 2QYOA 5GIOE 1TPYA 2ZBRA 2ZWAA 3FYDA 5K0FA 3FTFA 8MHTA 1SKMA 3DP7A 2B25A 3UJ9A 1G6Q1 1WG8A 3TR6A 1L3BA 3G2PA 1X1DA 2AN5A 5T64A 5K01A 3KU1A 2B2CA 4MWZA 2NXNA 3EVBA 3EVCA 5T6BA 5K0GA 4DCGA 4DMGA 3SVZA 1Z3CA 2O07A 1KHHA 5DT2A 4RV9A 5EMLA 4NECA 3ME5A 4G56A 4Y30A 3TM5A 1ORHA 5E9QA 4DKJA 1TW3A 3KPWA 1QAMA 2PLWA 1O9HA 4GOND 1JSZA 5E1DA 2IPXA 2ZULA 2Z6AA 5FA8A 3OZSA 3OZTA 2NXJA 1KXZA 1MJFA 2ZSUA 3P9NA 4RVGA 3HCAA 3TKYA 3HCEA 5EIFA 1VL5A 4C07A 2Z6QA 1M6YA 3CJTA 3HCCA 5CVUA 2AN3A 3OPNA 2G8NA 2JHPA 3FUVA 1O54A 1KPIA 2BR3A 3LDUA 4R6XA 2IH4A 3GGDA 2QRVB 3UJ7A 4EK9A 3I64A 2IFTA 2WK1A 1N2XA 3BGVA 3M6VA 1QAQA 5K0NA 3QOWA 5BW4A 1X1BA 3REOA 1Q0TA 4GBED 5HIKA 3EMBA 3PVCA 4V0QA 2AR0A 3LCUA 3THSA 4CKEA 4AUKA 5EVJA 3LPMA 2Y1XA 4P7KA 3ERCA 1ZGJA 2OZVA 3EEYA 3FPJA 3K0BA 3NVMB 4QVKA 1D2GA 3BKXA 1QANA 5E8RA 1JSXA 5EZQA 3HCBA 2ZWVA 3U81A
chains in the Genus database with same CATH superfamily
2DLDA 1NP3A 2ATVA 1U81A 3T7AA 4DBLC 3U5TA 3GLRA 1YJXA 2ON6A 1I2DA 2W4IA 1SXJE 4IVPA 5PNTA 3UAOA 3I09A 1KP2A 1VE1A 1WDTA 4UUNA 1SUEA 1W5BA 4OHZA 1SCUB 3N2EA 2XF2A 1XMVA 1VJTA 4LGMA 3FPCA 3EISA 1NVDA 1UBJS 2QTFA 2JCBA 4NNPA 3I6ZA 1W88B 4OQZA 3SVTA 2O8FA 3RT7A 4KQ9A 3ND8A 3MAGA 2VRCD 3N76A 4X6LA 1FDOA 3DXYA 1TI7A 3OKPA 4FJ2A 4IRMA 4KO4S 4RABA 3TTYA 4BATA 3UO8B 1P81A 3QEBZ 2CV2A 4E4YA 1GNSA 5MDHA 3EG9A 4GKVA 4KB5A 4MPRA 2Q8QA 1DADA 4G8JA 4BPBA 4I66A 4ZYUA 3UF0A 2PTGA 3O6VA 3ESAA 4RHXA 1TUBB 4HRYA 1YHNA 4XLZA 2LCVA 5CFZA 1JIIA 1XZCA 2IZ0A 3IXLA 4NMLA 1LPOA 1YS6A 5EMJA 4DDUA 2IS2A 1WB6A 3RK0A 4ECAA 4V1CI 3UW3A 4D8XA 1YBVA 4FYHA 2Y68A 3SYKA 1JZTA 2ZRJA 4K1XA 1GEGA 1TCVA 2FJRA 1A9QA 1A9RA 1I1HA 2VYVA 3UQZA 1KO5A 5B30A 2XDAA 1MT0A 1N8SA 3JZFA 3N59A 4LMAA 1QHHB 2RJ3A 4R84A 2YYYA 3LY7A 5F4BA 1NVAA 3WFJA 3WHKA 1R15A 3H8JA 3EZFA 5K99A 3QX9A 3RBVA 1RJWA 3QTLA 1T8SA 5BQ5A 1GPDG 5D3QA 1P73A 2FN7A 4AZSA 2HCJB 3H5IA 4WOCA 2G28A 3EVTA 3H1TA 2A1UA 1E63A 1C1YA 2YCLA 4QQRA 3KSBC 4DE8A 3FDZA 4E1BA 2YJ4A 3DVAB 1EVQA 2OV8A 4HUTA 2F17A 3D7NA 4BGUA 1MEOA 1SG9A 4B3DA 4KIWA 3JQAB 3STTA 4YASA 1EQUA 1IIRA 4BFLA 4CKXA 1YQ9A 2QUAA 1Z74A 4TLCA 5DNYB 4B3RB 3ZWCA 3CZRA 4Y8VA 1Y8QB 4FS8A 1WXHA 4MI1A 3TSYA 1WEHA 2VHJA 5KVAA 4RTPA 2W2KB 4NYMR 1JNYA 2DFLA 3H9JA 4BFCA 4WUVA 3TX2A 3OF3A 1DEXA 1T5IA 3D8RA 4LKOA 1O9GA 4YUVA 5I7WA 3OQIB 3I28A 3TCXB 5I4KA 4A5OA 5D6OA 4BNIA 4ZOQI 1VRCA 3RFCA 4U6QA 3GUUA 3UZUA 1K1EA 1E98A 3J7TA 2OHFA 1J20A 3GWGA 1E2HA 4ZVQA 1K92A 2QSZA 1JR3E 3F7NA 4OG2A 2NSYA 4INPA 2OFWA 3QVSA 5I8PA 3FHTA 1F6BA 2C5GA 2HA4A 3GRAA 1ULZA 3I9NA 1KO4A 2Q5CA 3AEXA 1U2DA 3NO4A 2WHPA 1TKBA 4B6RA 5KX5B 4DEXA 1ZM3A 4DSTA 1NRIA 3DWFA 2GX6A 4ZAVA 3FYUA 3SQLA 1XTQA 2COUA 1MZVA 2CFOA 1H23A 3G0OA 5ALIA 4B3IA 2WWFA 3IE0A 4RHEA 1MABA 2QVCA 4PC3A 4LOKA 2OLJA 5EHXA 2G7MC 4FR2A 4LXHA 4ZAXA 1N4AA 3S2GA 3UFDA 4AY3A 3AUXA 6GPBA 1L5QA 4BNFA 1QFXA 2W2NA 4C29A 1G63A 1IB0A 4RJTA 3GYGA 1YASA 2X0FA 1NX9A 1G20A 3U40A 1SOMA 3GEPA 5I3ZA 3OBBA 4XASA 2XGOA 2C3PA 2CK3D 5CNKA 2WYIA 2FXIA 4YXWA 4OI0A 4KQXA 2LP4Y 1TJ5A 2BM9A 4HWRA 4MW4A 4MGIR 2XWBF 5TR9A 3UXMA 2EGUA 3OLXA 3DBVO 4GM1A 3NH6A 4U02A 1LBHA 1Z36A 2QPOA 1QJ4A 1G8YA 1PJBA 3DLTA 3ST7A 2GM4A 3TW6A 4YP1A 1X1AA 3I2IA 4C7OA 3FTQA 1QOZA 1PHPA 2X0JA 2XRMA 5HBGA 2YDXA 4KN5A 5J5AA 1LDBA 3ZS8A 1KP9A 4J0QA 4DABA 1I3MA 2XSZA 3GD7A 1CE8A 1F7UA 5AW1A 2JIRA 2HEIA 3EXAA 2Q8NA 4P36A 4EG6A 4YJFA 3PICA 3BULA 3CT6A 1YE3A 4ZOLF 4K6FA 1JF8A 4PC7A 2UUAB 2D2IA 1P7PA 4X8MA 2GSDA 3DMTA 4PVDA 5JDIA 1N2JA 4AZVA 5BV7A 4RSHA 4YXWD 1B8VA 4CN9A 4CT4B 5EJIA 4DLKA 2O14A 5HM6A 2VNSA 1AO0A 5M04A 5JW6A 1AS3A 2WJWA 2Y77A 2J08A 5DI3B 4JVLA 5AK6A 1UXCA 3T7IA 1KBQA 1WQ3A 4WCFA 2OORC 1HQKA 2CNDA 4DLPA 4YT2A 4IZOA 4DCPA 1XRNA 3NT4A 1GRVA 2QX8A 3A7EA 2XSZD 4HQNA 3RJ9A 3TJMA 2NVOA 2Z5GA 4TV9F 2I8LA 4BBZA 1QVRA 3H9UA 3I04M 3M1IA 3KQHA 3SICE 2P3LA 3L77A 2GTHA 3FB4A 5EIBD 5K1ZA 3T12A 4X85A 5G0UA 5TNXA 4UNSA 3PL5A 3N7TA 3BDNA 5F1KA 3HXKA 3T3HA 1OW3B 4LWQA 2VRNA 1MEEA 4P33A 1C9JA 1C8KA 4HDMA 2ZG6A 3RBZA 5FL7A 1P7CA 1JFFB 1TADA 1FFSA 1LBQA 2JGJA 4ZVUA 4CLRA 2OEPA 4MVCA 4UREA 1NVTA 1FU4A 3GWZA 2BEWB 3PXPA 1FUYB 1RI5A 2UDPA 2WAOA 2G67A 2FPPB 3NRBA 3NM5A 5FNZA 4ZCPA 2C92A 4R6WA 4WOKA 4NX2A 2Z04A 2OL4A 1ZITA 3JASB 4JEUA 1NXPA 4PZYA 4B6SA 4KG7A 2DRIA 2X86A 5LNK1 5KYYB 3D2AA 4L5AA 1DWKA 1WMSA 1BOOA 1N2CE 2ESRA 2QP4A 1IY8A 4LGCA 4Q3BA 4RLHA 1CR1A 4PRYA 4B5KA 4CL2A 3S6JA 1R12A 3AU9A 4EDHA 1QP0A 1B6TA 1E3LA 2O23A 3KDAA 3L6DA 4IIVA 5DIZA 3UC9A 5BR7A 2B2NA 5LXTB 2OFFA 4PZAA 1Z26A 3E23A 1HL7A 4AJPA 1DUIA 2ZS8A 2D5CA 3LZDA 1K86A 1NUSA 5LLSA 4D4JA 3E1GA 1QYRA 5KNCH 1ZA2A 2V9ZA 5F3DA 1OH8A 2HPVA 1S02A 2XXQA 1YAHA 3O0DA 4L15A 1VTKA 4UZFA 2ZTMA 3VQTA 2YHBA 3LOPA 1ISHA 3SZ3A 2DBYA 2V1XA 5C81A 3MWYW 1Z0SA 2J0EA 3OO1A 3A6FA 2C4MA 4Q00A 3LO5A 5KJEA 2DT8A 1MMFB 2P9BA 4MJXA 3ZHIA 5EN4A 2BSAA 1Z6XA 2TECE 3HR7A 5CBPA 3ZJVA 1XIVA 4UAGA 5C1PA 2J9FA 4EGFA 3G59A 4DAEA 1YOVA 2HOQA 2J9XB 2RARA 2PR7A 2I4TA 3PDUA 4BNGA 4M86A 1WXXA 1ZD5A 2AYXA 3PQ4A 1RQRA 4H08A 4CNBA 2HDHA 2FZVA 2MSWA 3FUWA 5BQOA 1C41A 4UQPA 4I8DA 1JLHA 3OX2A 3RO7A 4ZVVA 2Z8YA 3MWJA 4Q3CA 1K8XB 2WG1A 3IQWA 4WECA 3S0JA 1QBGA 3O3MB 3VUFA 1ZN9A 2XOKD 1W4BA 3LDGA 3WA6A 5BN5A 2BFOA 2IXDA 4J0FA 3ZHRA 3V2GA 4PZUA 3WMRA 2J6BA 4X1IB 3A9WA 5G41A 1KI4A 1NXWA 3FSRA 4REQA 1OSLA 1IY2A 1HTTA 1M2VA 1J8VA 3C3KA 4C87A 5FV7A 3RSQA 5EWJB 3B6KA 4N6NA 1VA4A 1ONSA 3ZWKA 2R8OA 3MCAA 1C2YA 1AHPA 4OQMA 3HI4A 2I3GA 2Q2VA 3SHOA 2XCSB 2A94A 3RTBA 5BMOA 4RZSA 1FPMA 1H9BA 1NBWB 4F3TA 1I33A 3B3QA 1S96A 2G9RA 3I9LA 3BVPA 1EGMB 4X8LA 4WLUA 1R9MA 1HNNA 3DV0B 4M38A 5EE0A 1NV9A 1NM5C 4GGMX 4KLRA 3K71B 4P82A 4S0XA 3M6WA 1AMUA 2H7YA 3PI6A 4ND4A 1L2TA 1Q7BA 3F5DA 4Q4AA 3IUNA 1TZMA 2VQEB 4JXZA 1DJNA 2EWVA 1G3QA 1E7YA 1KR5A 1LCCA 4GS5A 5F3RA 5TS3A 5KB3A 4QM6A 2CHQA 2JGKA 2KW5A 3C48A 3IAM6 1NJSA 2HV8A 3P2EA 3ML1A 5JEEA 1KZ9A 2R7MA 4IIYA 4G5XA 4S1PA 2HTFA 1ZN8A 3HYRA 1XP5A 2FTKE 4NICA 1YS9A 1SU6A 2SCUA 3CUYA 2HCNA 1G60A 1Q1EA 2P79A 4MNTA 1DJQA 2W8BB 3ODGA 4L85A 1R6BX 3OI7A 2HQSA 1H2ZA 3IPAA 1LSUA 1T91A 1C9EA 4GEGA 1L8AA 5GTDA 1T9GS 2LD4A 1FNNA 5LJIA 4RAOA 4WKCA 3THOA 4CL8A 4AJ1A 3C3MA 3F3MA 2C82A 3YASA 1Q15A 2ETXA 4V0MA 5EE3A 3WSWA 4B8YA 1F8UA 1GCGA 2NO4A 5MGBA 3SEAA 1JQ3A 4CFZA 5FNVB 5EP3A 1YZ3A 3KUKA 4IQGA 4P5PA 2O8BA 3VAZA 1ADJA 3VPXA 4C6HA 2H08A 3FCSB 1Q0SA 2QTMA 2ZB4A 1NC3A 3OSZA 4O4JB 4QDUA 4QOEA 3KOMA 4D02A 4U7DA 1M0SA 2BUCA 3LWBA 1RQLA 3GVIA 1UWCA 3OWQA 2QJFA 2KYRA 4Z0HO 3TMAA 2DQSA 3Q7QA 5SZHB 1VGQA 1ZK1A 4O8BA 2FA9A 1JN0A 2PX2A 2ZU6A 3DTVB 1NVBA 3QLVC 4INZA 4P3KA 1NDUA 4UUAA 3T7EA 3OFVA 8GPBA 1PBNA 4MQ6A 2X58A 3TRJA 3W04A 4EVSA 1ZR2A 4TYWA 1FRVA 2GAAA 2V55B 5EUBA 1JNXX 4GMFA 1QO9A 1TO6A 2P7HA 3PLNA 4PYIA 5ARDA 2IE0A 2NV0A 4Q3LA 2WTEA 4KNWA 1EFAA 4JIGA 2IXBA 2OCYC 1MZPA 4DBVO 1M1XB 2PMFA 4LQ4A 4LF5B 5B1SA 3RIMA 4WCDA 4N1AA 4I6TA 4BNUA 1V11B 2YJZA 1MB0A 1XDSA 1XQXA 2NZXA 3GYBA 4MUIA 3RUCA 1LC0A 3MXTA 3VU0A 4AJIA 4QO8A 1BEZA 1XN4A 4GNRA 5CVDA 4FFBA 5ER9A 3MIIA 4JBWA 4JLSA 5C7YA 1RI3A 1LTQA 1RWOA 4PZDA 4X9XA 3UFBA 5JMPA 2V97A 3SZMA 4ED9A 1RYEA 3RYCB 1G4UR 1ZHOA 2ZU0C 1MX5A 6ABPA 2E18A 4KO3S 1UPXA 3O3CA 2A3NA 2NSDA 5L3QA 3B7HA 3AESA 2HADA 4M7RA 4CDMA 1WUTA 1BXGA 3TQCA 1IEVA 1D2MA 1UFVA 4IIUA 4BNJA 4WVLA 2OHXA 3R7SA 1WOYA 3USES 3V7YA 1DUVG 4E2ZA 3WKBA 4LF4B 3T3GA 1IY1A 2O7SA 3GLHB 1HEIA 1SG6A 3DYVA 4MKFA 3C4QA 5TMBA 4CMGA 1KJWA 1Z4MA 4IJ5A 2J5RA 3H18A 4MUMA 3WIBA 2V7PA 4OXXA 1EG2A 2O06A 1A95A 1OLSB 2Z9BA 4M0EA 4YVFA 1VKZA 1UP7A 2J4CA 2ORWA 2ZWMA 3GBPA 3H5LA 4CDGA 4F4IA 1XE3A 2JFBA 1KNXA 1QP8A 2PZEA 3E22A 3UB3A 2YN4A 1L4HA 2WI8A 4IV5A 4RM2A 1VLHA 4DV7B 3NDJA 5HR5A 1DIRA 4DLBA 3FWYA 1UZUA 3OFNA 4LNUB 4RIHA 5FPKA 1MO4A 4H9GA 4QAJA 1B3RA 1DJPA 1PT7A 3DZIA 3CCCA 3HVUA 4GXQA 4XXHA 1NW8A 1XB2A 2PH3A 3KE8A 3JVIA 4EJSC 4URWR 4YAOA 3HA2A 2NG1A 2Z83A 1XO1A 4OXRA 4UBLA 1K8YB 5JCXA 2YV2A 2XB2A 1PDWA 1MD9A 1V48A 3CZCA 3A3OA 1EFLA 2ZBRA 2ZJBA 3FYDA 3HY4A 3QF7A 1EP3B 3A2LA 1L3BA 2FR0A 3E58A 1RM3A 3WWOA 3G9XA 4OYHA 4BB5A 1Z2CA 4MUFA 1ZNYA 2NADA 2VNKA 3ZVRA 4BFSA 1KS9A 4X20B 5DBHX 4MCXA 1ADYA 1HG1A 1NWCA 3C1UA 3QKWA 4OH7A 3UVEA 5DISB 1IQ0A 2WWWA 2Z95A 1KI6A 1NE7A 4PR0A 3GBFA 2XUHA 1U8FO 5HK9A 1A96A 1FX0A 2PLWA 2NSLA 2Y0CA 4WFKA 2OG1A 2AT1A 3L6EA 1JFVA 3ZR4B 1U7PA 3A05A 1AKWA 4DTIA 1ZD2P 3U5ZB 4C0BA 1KXZA 2V6FA 1Q11A 4WZBA 2J5QA 3JXBC 2PBZA 1LJUA 2TYSB 2ZAYA 3HCNA 1NVMB 4QYSA 3CJTA 1QWOA 1SURA 3HCCA 4LRQA 2WF9A 1N2BA 1B73A 1PFKA 2C1EA 2BDTA 4TTVA 3U4AA 2G83A 1N2OA 4RH3A 4RK4A 1UXJA 1ZJ4A 2AEEA 2H18A 4HXGA 2AFIB 3N0TA 3AR5A 3C16C 3MJRA 3W8NA 1Z0ZA 1XLTC 1L5VA 2AJTA 2H3EA 1RZVA 3EZLA 1DWQA 1ULUA 4WI1A 5B2FA 4JITA 1IN7A 2ZVDA 2JAPA 7AT1A 4O59O 3BICA 1Y7YA 2QMQA 1SUCA 5EVJA 5CB6A 3QA9A 2Y1XA 2X9VA 3PQ8A 4P7KA 3G0TA 4YAFA 5KYTA 2QJRA 2QORA 4RKEA 2YIDA 3CUSA 3OM1A 5HCUA 4CEHB 2Z4SA 4HEHA 4JA0A 3DPIA 4AZWA 3H11B 1V4NA 5K0BA 1TEZA 4FZVA 3BDAA 3TW8A 3ELYA 3EGWA 3G5LA 3VR3A 4L7QA 4HLUA 1GTMA 3FHLA 3HBMA 3SF0A 1VG8A 2GN2A 3AR3A 2C29D 4RX1A 1UZAA 2VR1A 1E1DA 3PCTA 1I6MA 5CPFA 2C4NA 5M2QA 4HNQA 1YE8A 5THQA 2KEIA 4HY3A 4F9EA 2C54A 2VCEA 3LNTA 3TVDA 2C7PA 3UJAA 3MT7A 4MUHA 2QL5A 1WP9A 2V6MA 5JAZA 1IUPA 5AIBA 1K6EA 2J31A 3JSAA 4BO7A 4D8VA 3B6IA 1AK9A 2CKDA 4RQTA 4Z8YA 3W2FA 1PIWA 2G5PA 2AMJA 3D7MA 1WP4A 2BGJA 2IZ5A 2YC4C 4PYLA 4Q16A 5JNVA 3KB1A 1XAJA 3MPOA 3VISA 3PZRA 1V37A 5DNWA 2ATIA 3AH8A 1ICEA 4Y1FA 4LXIA 2Q9BA 2R4TA 2QPTA 3GZNA 2J59A 3QVTA 3FLAA 3EVZA 3VR3D 1CY7A 1Y5MA 4HP8A 3P27A 1ZY2A 4FFNA 4L3VA 2HBYA 4G4IA 4NZZA 4D7AA 2AWIA 3BGIA 2IEGA 4E5DA 4BFTA 1FSZA 3LYAA 2ORIA 1I1NA 4NS1A 1POXA 4U63A 3VZPA 3V55A 1VCNA 3DVLA 4ZIRA 1YFKA 1V6SA 5KNLA 4TN1A 2PSFA 3I1YA 3TE7A 3H9EO 4PF1A 1A8UA 2Z3VA 4I14A 4LV6A 4Q5IA 4XTCS 3ED5A 3S1LA 2HK9A 4A6EA 1GUFA 2WU8A 2AX3A 3NTRA 3HKEB 1ULSA 3C5EA 5JJBA 1C8BA 1V8PA 4PO9A 2RBKA 3K1ZA 2G6BA 1CVLA 5FF9A 4KLCA 3G0BA 4LWOA 3BORA 1XYGA 1EX9A 3GIDA 3NWEA 5DTQA 1A88A 1T0JB 2BFPA 1M72A 1GYRA 1PNRA 3NEAA 4QJ4A 2WYUA 3ABSB 3FYCA 4QOSA 3L7JA 3S44A 2QYHA 4Y0AA 3HGMA 3OTHA 5P8WA 2E9SA 4RJLA 3AJDA 2MQKA 2WA1A 1YTLA 1UXIA 1YR2A 4OCZA 3AXTA 3HI6A 3UY4A 4L4UA 5J2TB 2Q3HA 3C8UA 3ACDA 2JBAB 4YRGA 4DMCA 3DBIA 3IBFA 3W8FA 2ZJ3A 3CLRD 4RD3A 4D79A 4DJFC 1U9IA 3N7UA 3REQA 2FG5A 3WADA 3BERA 2BFEA 2D4AA 2JI8A 2I2DA 3SNHA 3ZHSA 2BKVA 5GGXA 2YMLA 3AONB 5C8VA 1KSHA 3HSSA 1ODKA 1QRRA 3QBDA 3RZZA 4XUCA 4JUCA 1HNXB 1KEUA 1X1RA 3G2HA 2HJHA 1ZN7A 3B5JA 1HE2A 4RY2A 2CHEA 2AVDA 1A0OA 4JB8A 3ZVKA 6Q21A 3J81k 3R3WA 2X9QA 4IHJB 4FYVA 2J7PA 2AX4A 1X6VA 2XE7A 4MGEA 4X97A 3QHAA 1A4IA 4JB0A 1U0HC 4FHZA 4ALJA 4TS9A 4YHHB 5DTMA 3A6PC 3IUBA 3I4LA 1CULC 2ADFA 5JCJD 2J4DA 1M6EX 2HGZA 4BS9A 3OLZA 2C5LA 2Q41A 4IHAA 3N07A 4OM8A 4EYGA 1RS0A 4CW7A 4QM7A 2PZGA 3JZMA 3PEFA 3QLUC 4JASB 3OPMA 2GH1A 5ENDA 3ZIAD 2KE5A 4E15A 1E89A 3DB2A 1F4PA 1SCQA 3U4QB 3AHDA 1JHQA 1O6ZA 3FMGA 4P8RA 3UNXA 3VHQA 3FYMA 4L8LA 5A3SA 4HN2A 2KBEA 1JQJC 1S5PA 2JGLA 2NO6A 2VUHB 2OCPA 4I8TA 2YVKA 1R4MB 1ZAKA 3FAKA 3IJ5A 3WRYA 4BNNA 5FR2A 5JJCA 2ZT7A 1MO5A 1TKAA 5TV2A 5AVYA 3DUWA 1WUJS 3ZEAA 1HZJA 4C4RA 1O3YA 3L0SA 4DQXA 1P44A 3K9BA 3P5BA 3HCFA 4F93B 5LLDA 3T4UA 1JBEA 3WLAA 4I0WB 2O4UX 1EK0A 3OCZA 1V1RB 1VBKA 2VYQA 4P58A 3ZWPA 2ATXA 1K7CA 2XGGA 1B00A 3E6AA 1DT5A 4JZKA 1VYVA 2QQ0A 2FX5A 3QPUA 1DRUA 3NBAA 3PS9A 5DO9A 3V8QA 4BNXA 3OEYA 1P74A 1QOQB 4DG8A 1PQWA 4KTVE 4YT4A 2VSNA 3SGLA 2GZUA 9ABPA 3LQ4A 3L4BA 3QYXA 4L08A 3M5WA 4TL6A 3ZQJA 2HJVA 3AKEA 4UPVA 1ZXXA 3A0UA 3RSHA 2P4UA 2Y67A 1XMQB 3HVHA 3NRJA 3GGJA 4CUKA 5TLSA 1G0NA 1DWPA 2XIUA 5HIAA 2B30A 2JARA 4L5BA 1ZN2A 3R6TA 4FFVA 4TL9A 1CIPA 2Y1KA 1VLMA 3T52A 4ZT6A 1ZR4A 2C5HA 2VOEA 3A6ZA 3ASVA 2XA2A 4D9BA 2J3IA 5KKCA 1MAAA 1BKDR 3SKYA 3MGBA 5FUWA 5DYGA 1XKXA 4J8PA 4H7PA 3CLHA 2IX3A 5ELMA 3H7IA 4JYZA 4HWSA 4YJKA 3L7BA 4L8GA 2ISCA 1NATA 2MINA 2LIVA 2WU3A 3A6KA 3FW1A 3K9WA 2OTCA 2CUKA 3LT2A 3K5PA 3HMQA 3L7CA 3PUYA 4K2HA 3U3DA 1Z5VA 4RVFA 1C30B 1L4KA 1OXKB 3RYIB 1Z4NA 1XELA 2V4MA 1NPYA 2DPLA 5HX7A 5JC8A 4Y6LA 3HP7A 4Z0TA 3FI9A 4UMDA 1XPJA 1RWWA 4EHDA 5EQDA 2D74A 1QP4A 2RAUA 3PEEA 5A06A 1QZUA 2D1QA 3ON5A 1WM1A 2COKA 3LT5A 4LNHA 5JTTA 1PR0A 1DXQA 3ZY6A 1KPHA 1RJGA 1D2AA 1XEAA 3KB6A 1D07A 4RD2A 4DCSA 4XGNA 1OI4A 4IQFA 2F7SA 4EJMA 3D6TB 1OVGA 4YPOA 2EWTA 1GCUA 1DNPA 1K6IA 1PJAA 2FZKA 4PU4C 1WPXA 4Y2QA 5BP7A 4PSAA 5DI9A 3MJDA 5TMEA 4MH0R 1GNRA 4FNMA 4JOSA 2VFAA 5HF9A 3T4XA 2ZJAA 4P7JA 3MSCA 4M22A 2WPNA 4QYIB 2R8XA 4KFRA 3N74A 2EC5A 3BEDA 5DW3A 4FGLA 2I9KA 1XMOB 4URUR 2HJ9A 2XCIA 3DCYA 3SJAA 3TM4A 1YU6A 2G4CA 3CTPA 5BSHA 2J46A 4OK5A 4ZI7B 4E31A 3KETA 1V7ZA 4EO9A 1NQVA 1GQQA 3GJ8A 3GT0A 3IEMA 3DWGA 3IEPA 4TM7A 3C8HA 1L1FA 1CJGA 1ZZ7A 1MX9A 4TSRA 4U2EA 2LRHA 5AKIA 3OZ7A 1H6BA 3AIKA 5HCNA 4MCTA 1GNLA 4FYXA 4W7SA 2Q7DA 2AHRA 4G65A 3ZE1B 3OCCA 1V96A 4EG1A 5FCDA 4WK0B 5C34B 1JX6A 4X66B 5IJWA 5KOJA 2AFIE 2ZWPA 2ZYUX 3C8DA 1PK7A 1BWSA 2HIMA 5EJMA 1S2IA 3N2IA 1ORIA 4V0OA 2C99A 5IJAA 7MDHA 4DB4A 3KEOA 1G8KA 4PHCA 3D5QA 2P3OA 2N47A 1M1ZA 2A84A 5IYZB 2WUDA 2C3OA 4MITA 2ONYA 1ZQ1A 1ORTA 4PZZA 3M4XA 4PXSA 3OSUA 5FKJA 4EI9A 1SZJG 2DH6A 3T1HB 3UAGA 5FAXA 4QEZA 1RPEL 3ED1A 2QD2A 3LKZA 1NMEA 2G71A 4U00A 1U0EA 2G82A 3FSGA 1US8B 4ERNA 3AC0A 4N7BA 1AS2A 3BE8A 3CRNA 4F6CA 3EVGA 4U7HA 3BGOS 4KIFA 1EWVA 1WXIA 4NMWA 2GYWA 2APJA 3X43A 3FGPA 2QD5A 3I9MA 1VMDA 1Z4LA 1HYGA 1BX0A 3IIKA 4QO7A 4XDYA 1M6VA 3HU1A 1VIAA 3JPWA 5AKJA 1T13A 3KPUA 4AO7A 3MJSA 1GDDA 3CVXA 3RVMA 5KYGA 2C9MA 5LOVB 3W0LB 3W6NA 3TFOA 2XGJA 3KR9A 1BROA 2B9EA 2ZYGA 4PINA 1HDOA 1NT4A 3DFMA 1F12A 3UHJA 4Y1RA 2A58A 4M1TA 5BSRA 3OM8A 3O4HA 3Q41A 1YK1A 1MVLA 4FHFA 1NPDA 3V48A 4GDMA 5IC6A 5ED0A 5FBVB 3FSGD 4MCJA 2HRDA 1S2OA 1Y1QA 1NKSA 2O8VA 3BC1A 4HJRA 4LHVA 4JB3A 2JLQA 2FZ5A 1G291 2J7KA 2XJ9A 2PS1A 4L1KA 4YG4A 2CDRA 5B5SA 3HWRA 3G5GA 1RLOA 4FCCA 4YR9A 2P78A 3ROKA 2O2EA 4P5EA 5KMGA 3EAQA 3FFXA 4F4UA 1G8HA 5HFJA 1WZ2A 1ZZ9A 4RCVA 3TOZA 2GD0A 3OD1A 2BJWA 3C5CA 2YX1A 4ZAWA 1ZM9A 3CONA 3U39A 2VS1A 4PGFA 4QELA 3VYTB 3PJEA 1V1MA 4A3SA 3LT1A 1EGHA 1YZQA 3HVJA 5K0LA 2J3QA 4K9NA 2F90A 3Q5DA 4PG4A 1W5SA 5HTOA 3GMIA 4ZVMA 4EKNB 1O0BA 3O8OB 3IJPA 4ZDWA 3SC4A 3VU8A 1RKVA 3NEYA 2PKRA 5IFLA 2Y4OA 1AF7A 3U13A 4OJYA 1EXMA 2PZAA 4ZODA 2QR2A 2XVAA 2VF7A 3WL5A 4BLRA 4WERA 3F3SA 3M5PA 3ZHTA 4JXJA 5L4LA 4F4CA 3HB0A 3GA7A 1LDNA 3RARA 1GKYA 4PNEA 1RCFA 3IQGX 4OHUA 2B5OA 4AJJA 1WDMA 2UZIR 4LYAA 3CNHA 4TROA 4DCJA 1A76A 1G2OA 2R65A 3F3KA 4IIXA 4X94A 5EXXA 1JR6A 4BASA 5TRTA 1VHQA 4IMJB 3T9FA 2DSTA 1C7QA 3LMKA 1XI2A 2BBWA 2Q27A 5BQFA 2GFIA 3C87A 5HFNA 2H8RA 4MKZA 4EVRA 1SHUX 5JADA 1CZLA 1R1DA 4U3JB 5J4YA 3A9CA 4KO2S 5EUQB 2IKQA 2WZQA 4C0HA 4BUCA 1TEXA 1KE2A 4F5EA 2YMPA 1PYOA 2A4KA 3OA0A 3O31A 1FE8A 2ID4A 3PHJA 4G37A 4YJHA 4D2IA 2YVAA 3LECA 2VNHA 1P8AA 1F17A 4DS3A 1CRPA 1GHTA 5AOBA 3KKLA 4G41A 2GRMA 4BBAA 5IRCD 5EKUA 3RS4A 3DMDA 4H1TA 1GNPA 2R25B 2NNLD 3LUKA 3SBXA 2E4VA 1NDQA 1T5TA 3LF1A 1ISSA 2DHQA 4ZEXA 3K2BA 1ISRA 1B0NA 1YDWA 2ENUA 3DVRX 3P9PA 4PLYA 4BJHB 4ZHQB 2CF5A 2Q4BA 3NALA 1DSSG 2KJQA 2CEAA 5IEJA 1YFJA 1L8QA 3KVOA 1FP4B 3PE4A 2V03A 3AY0A 2FW0A 1Q14A 3PPIA 2A1TR 3SFVA 3GFVA 2DQYA 4OHRA 3SKVA 4J7CA 5CFRA 1KF0A 2GJAA 2A67A 1CKEA 1LQUA 2D00A 1FJXA 4GWKA 4K9KA 4FE3A 4GGOA 4KMSA 5BYKA 4UDXX 1JAHA 4JHXA 1C8VB 3TAHA 2VHYA 1KKLA 2OG2A 3B13B 3VYVA 2E5LB 2BP7A 1ZK2A 2FRXA 2Y6VA 2YJ5A 2XHZA 3PA6A 2COEA 3B5EA 2IOHA 3OE7A 1MB4A 2GWHA 4WEQA 2EP7A 3QUAA 3KB2A 1X87A 2PGOA 4A0RA 3REFA 2OQRA 2XVZA 3GF4A 3RVRA 1KJJA 2OWDA 1G19A 4LX8A 3K9HA 1T36B 4L6IA 4W9RA 3SYTA 1H2XA 2AN5A 2VPWA 5T64A 4AWAA 4X00A 3B1VA 1QHNA 2FMUA 1TRHA 4IMPA 4QOGA 2EAUA 3N6RA 3PTZA 1P45A 2EATA 2O07A 5DT2A 4I5FA 4M1KA 4TMYA 3TAXA 4PPNA 4EX7A 2PVSA 1YZKA 1W9MA 3BL8A 1K97A 2WLSA 1X2LA 3NATA 1V3VA 1HRKA 4WZAE 2YWHA 2PANA 2X8WA 5AM4A 2X0DA 1T6XA 3JQ9A 3LL4A 3SHWA 1T9DA 5JSZA 5DXFA 1F51E 4D4HA 5E1DA 3T54A 2PKQP 2PR2A 1DBIA 2GARA 3B51X 1TC1A 3P9NA 5EYPA 1HK7A 3ZTTA 3MUFA 3HB5X 2D1YA 1TMOA 4YWJA 1B1CA 1XGKA 3AF3A 4UZSA 4L6CA 4LZJA 2G8NA 1I3NA 2XXAB 1VZ3A 3EARA 3MLFA 5BRAA 1OLOA 5F9HA 2IV1A 5GY7A 5TQ2B 2YN0A 5TIIA 1ENPA 1N8TA 5CIWA 5GOZA 4LYHA 3W78A 3H83A 4B7ZA 1FX1A 1MV5A 2EZUA 3ZXYA 2AK2A 1UZLA 2NWQA 4G5YA 3TLCA 4D0LB 4EZBA 2QN3A 4KKXB 3WGYA 3W5AA 4GKKB 2I3BA 1TJNA 1WZCA 3PVCA 4L02A 3LCUA 4YYEA 4QGBA 4P9NA 4AUKA 4CJXA 3ZGOA 1OD6A 1O08A 1ODTC 1NVFA 3FVRA 1MEJA 2BCJQ 3DL2A 4LBVA 3RFTA 1G17A 1MNQA 1TM5E 4NWIA 3K6KA 1PS0A 4GPBA 3L5OA 3QEOA 4O2BA 4C0QC 4F71A 3S81A 3PGKA 1TK2A 3FTDA 4BYGA 1XKTA 2Q6VA 4LYGA 1W49A 1Z5OA 1U2RA 3SS7X 2HK8A 4A2QA 5AW2A 4NPAA 4X1KA 2WWIA 3K6SA 2H0RA 2R48A 4MTCA 1LLFA 2JEZA 2XAUA 2LCIA 3LQKA 3PP8A 2CHUA 3L6UA 2BDUA 1XCLA 3GLQA 1FQKA 5FWDA 1D0IA 2HFJA 4CWAA 2FR8A 2DWCA 1R3DA 1FYEA 2H59A 4MEAA 4YECA 3SX2A 1PSWA 4UUPA 3M89A 1PD0A 1GU7A 1L7XA 2QG9A 2X4GA 3LUBA 4Z9XA 1N36B 1NVXQ 1P4JA 4J9VA 1H22A 4EW2A 5JSUA 4JI4B 1E2NA 2HXYA 3R1IA 4DNPA 2WSLA 4MUEA 2IW3A 1QORA 3WAKA 3I58A 3UMCA 3AF2A 1Z2PX 4UDYX 1QU3A 2LBPA 3PT5A 1EDDA 3LRXA 4IHQA 2PKQO 8ABPA 2WM3A 1OU0A 9ATCA 1OX5A 2B8EA 3RTDA 5CA1B 4DV4B 1KBOA 2NO7A 2HHJA 2QVGA 4EMBA 4UTZA 3GLFE 1CS0A 3HPQA 1DX6A 1Z5UA 2HQOA 3OWHA 3BYZA 3R5KA 4UD6A 2GN8A 4N40A 5FWAA 3WQRA 2DTDA 5CYOA 3HY3A 1PDOA 3NOOA 1H6AA 3QVJA 2WWXA 1OJLA 1Q21A 1HY3A 5G0VA 4MUNA 3IUMA 4DXAA 1Z9BA 4IEIA 2D7CA 2C00A 1QZ3A 1CUYA 4B33A 4CT0A 5B1EA 1OZHA 3MUNA 2CYAA 4RENA 1EM8B 2H4JA 2XY4A 5EZSA 3HTXA 4KXQA 1YS2X 1FBTA 4M7PA 1H0RA 1V8BA 2RDMA 3CKYA 3B6EA 3GNTA 2W2MA 3T9AA 4O6VA 1UBMS 2JLAA 3VOAA 2FMIA 5HG0A 4JGIA 4R8SA 3DMNA 5CDHA 2PX3A 1E4OA 3DCNA 3GH3A 2HA2A 4FT2A 3ISTA 2A0WA 4HX9A 5DX8A 5K03A 4IDCA 3OPYI 1OREA 3R09A 1RDFA 1UK8A 2AE2A 1IU9A 3LBFA 4D3DA 4M88A 4D92A 2Z8XA 1C9KA 3FHJA 2HWKA 1AM4D 1QKKA 2G3YA 4TKVA 5DEOA 4M36A 3PR3A 4E14A 4FEGA 1E7RA 1LNQA 1VKOA 1XJCA 4M83A 3EIEA 3SI7A 3CRZA 5HCIA 3ZCXA 3IULA 3GJ5A 3FJ1A 1G1AA 4NBKA 4XGKA 1AKTA 3Q3HA 4OQ4A 4DA9A 3FOZA 5BMVA 1LEHA 5CVTA 5A9SA 1S9DA 5GAHi 1X15A 2D5BA 4YRJA 4UTVA 2P8SA 5BSGA 4DLXA 2HBQA 4OPMA 2EVWX 2PXKA 4Z9YA 4JN6B 2CL7X 2XTAA 3H99A 3SXUB 4AN4A 1LVUA 5HPYB 1EFUA 5AW0A 1RKQA 1GL9B 1R74A 3W2GA 1YR9A 3U7RA 2AKEA 5JD5A 5JNSA 1ZUHA 2GILA 3TLAA 4AICA 4BQSA 4C21A 3UHOA 3H19A 5E6UA 1E3DA 2ZT6A 4HK4A 4RY9A 4EHKA 2WJAA 5DXAA 5FNVF 5BR4A 3HKCB 2R6GA 3V4FA 2WAXA 5DRYA 5LA6A 5KWIA 3ZG6A 2QRPA 2B92A 4O4JF 2O57A 2XMPA 3SKXA 2FUCA 1ZNZA 1DBVO 1FFXA 1QFYA 2PS0A 3KLNA 2ZI3A 3Q98A 4HYEA 4WASA 1HQCA 1VCMA 2P40A 2F55A 1AUOA 1U90A 3H8WA 3O1IC 5EKTA 2W2XA 1T15A 3UAYA 3ZX4A 1W76A 5DBGA 3AXSA 4MAAA 3IHLA 4XVHA 5FEUA 3D3WA 4Z9BA 2GS9A 1Z0AA 3DMYA 4IOKA 5EIXA 2GMWA 3F5QA 3FUUA 5D5QA 2VT2A 3HACA 5AI9A 5GJWC 1Z88A 4PSKA 1G8GA 3DEZA 1DDIA 1ODFA 3U3WA 1Z33A 4LJ6A 1XLUA 4F0JA 2EHJA 2RH9B 4KK3A 2GCOA 1IZYA 1JU3A 1XDWA 4ER0A 2G7ZA 2ZBFA 4P1ZA 4BV9A 4C6TB 2L18A 3JYPA 4LC9A 5LBTA 1YE5A 4X61A 5CBKA 1XRLA 5DJ5A 4KYVA 3PX7A 1WTAA 2MIIA 2YICA 3OUZA 4U2KA 2WP0A 2P4SA 3THWA 2IZ7A 1GKUB 3L6RA 5EJGA 3EVDA 4LS3A 3E8MA 3BAZA 1G8JA 1W9HA 1YQXA 2E5FA 1V7CA 2CLSA 2GTIA 2IDKA 5A0FA 4CV0A 1WV0A 2VSFA 2ZUWA 4DQLA 3T0FA 3WB2A 1PRAA 1E6LA 3JRNA 3KYCA 3R3HA 3OP1A 4MGYR 1DC3A 3EUFA 3WNZA 1QHGA 3ZQ4A 4DE5A 2VQDA 4DCCA 2V8BA 4WZZA 1USWA 3CSSA 3HDHA 1KI9A 3DEHA 5JJ5A 2Y93A 1HE1C 1TGVA 4Q19A 3F6WA 4L8VA 1V8ZA 1UFQA 4M55A 1J1ZA 1QQ7A 4Q4HA 2QRGA 3JYOA 3W1VA 1KSGA 3EVEA 5KNBD 1PZMA 2O6HA 4U6SA 1OFUA 4K9DA 1BXRA 3R3SA 3W90A 2XCTB 5AQEA 4LGYA 3EA0A 1EUDB 1I80A 3WLTA 2PXUA 1OUMA 2B7CA 4B46A 5T7BA 1GTVA 4LTMA 5G4KB 4QUIA 1Y8CA 2TMKA 5I7VA 1YI8A 2WMYA 1AG9A 2H9YA 1COZA 2QF7A 1Y42X 3L5KA 3RRZA 1I7NA 3K1YA 2OR1L 1BQ4A 3N05A 5MHTA 1KRWA 1JDBC 3DDSA 5A1TA 3NZLA 5CFQA 2BFCB 5ICFA 1AKRA 3I3SR 2HA7A 2HPAA 1KWKA 4J2HA 1TLLA 1IM8A 1PGPA 1Y6QA 2ZE6A 3O73A 1MF7A 5KAPA 1PD1A 1M75A 2P1DA 3DE5X 1JT9A 3A58B 3G2JA 5L3SA 3HB7A 2WE8A 3EQ2A 3MTEA 3NTUA 1NE2A 2AG8A 1P9OA 1ECBA 5BV8A 5BN4A 2XKBA 4DV5B 2VNIA 2DR2A 1ZJYA 3VPBA 4BIIA 1IM5A 3DQZA 4HNRA 2W00A 1JDBB 4IDGA 3W34A 1SPXA 4NKRA 3K9QO 1C1XB 3K2EA 4OQDA 5A71A 5FIUA 2JDIA 1B6SA 1QM5A 4C03A 3ZCRA 3THYA 1AKYA 4ERXA 1O97D 1TM7E 3RS7A 4IUYA 3S2FA 3EQ9A 2YW2A 2HHCA 1UWLA 2CNLA 1P9WA 1XTTA 2W4QA 1TQ2A 2LDXA 3E3AA 3JWGA 4HOYA 3ZCVA 1FSFA 1J0DA 1KEKA 3K4PA 2OORA 1VG0B 2RAFA 1QHSA 1WNFA 3EOBI 1RRKA 2FP4B 2C3UA 2ZUSA 1EK6A 5CH8A 2OB1A 1XJ5A 1EFVA 3ADBA 3JD4A 3PEVA 4U2GA 1KDYA 4D42A 1E9BA 2XUFA 3PUVA 2D4HA 4UTRA 1RZRA 4G9GA 3H42B 3VNQA 4DC1A 3RHSA 3OE5A 4FKMA 4KE7A 2HM7A 4Y9UA 2QQ5A 3UICA 4I4TA 3LIPA 1JEAA 3MINB 2P69A 3TECE 4DBZA 4X4HA 4Q66C 2J3JA 3RVPA 2MYNA 2QRLA 2VJMA 3JW8A 2OOSA 3RG2A 4JBIA 5C1OA 2JDID 2YV4A 1NSYA 1KZ7B 1I4DD 2NZ2A 5F5NA 2KSQA 3WYNA 3ZV3A 1PNTA 4P92A 1GP2A 1PW7A 3Q9UA 4NZOA 4YCDA 4A92A 2YBEA 5AXDA 5JAHA 4CR7A 1ONPA 4MEJA 5EJ2A 3OURA 3AJRA 4IEFB 3RV3A 5D51S 2H0AA 1L7DA 3BQMB 5KCMA 2FW6A 5CA0A 3WFZA 1KDVA 1NAIA 2M6LA 2WLTA 2QL7A 4JLVA 1KRHA 4KDRA 5G02A 1K3TA 4M60A 5CW2A 2GA9A 5KSOA 1XA3A 4G5RA 1HMYA 4RZ3A 5KNCA 3DOHA 1Q20A 3JAWA 3DLCA 1ZCAA 3QG1A 3PDJA 4KQEA 3ZD9A 5A4JA 2DHDA 1KGDA 2MSLA 2B3TA 3IEKA 1M7HA 1PFGA 1C3JA 1ZH2A 3SF8A 5HJ5A 1CC1S 1F06A 3NBFA 1NQ5A 4FZRA 1T9ZA 1H69A 3GR6A 5F64A 3S4YA 1Q0ZA 3DE3X 3HUEA 1MW9X 4QGSA 2QYTA 2YJNA 1Y63A 1O6CA 1X80B 2ZJ6A 5TS2A 3IEVA 4CHGA 4OUDA 4OMCA 3HU2A 2R3SA 2E6UX 2Q62A 4L9WA 1CHDA 4J03A 3KTAB 2C2HA 5BRJA 1AK1A 3VPDA 4RIIA 1OIWA 3FR7A 1RYHA 1J97A 3DDUA 2ET6A 1HSZA 3E0XA 3EXHC 5B53A 3W4JA 5DV9A 421PA 4DDHA 4DWVA 4U4AA 4CKWA 4JCYA 3INTA 3TFQA 3CMMA 4MW7A 3QWFA 1NVVR 5JJKA 3L6CA 5IT5A 4ALMA 3VTZA 1SOUA 2K2WA 3JD0A 3SLKA 1GRQA 4DY6A 2Z0MA 1RJDA 2PWBA 4XJTA 3H1FA 1A7JA 3KQVA 1JEEA 3UV7A 1KAQA 1NI4A 1VI5A 2UKDA 2YUIA 5DHFA 3ZLBA 1F6DA 3C39A 5LZ8A 5T4BA 3KQNA 2AN4A 4TV8F 1H8HA 3EZNA 3WXBA 1TECE 4G5FA 1Y6RA 1NRWA 1WCIA 4ZI5A 2C07A 3AF0A 3MGGA 2Y1WA 1YQGA 3PYMA 4KJXA 4V2IA 3TNFA 4QARA 1M5RA 3H1BA 3IELA 5F52A 3WLQA 3QHQA 4EHHA 5KNDH 4YRMA 5CB4B 3L40A 4YMLA 4PZCA 4C01A 1S2LA 3MOSA 5ALGA 2BN4A 4EKDA 2FEOA 5BWLA 3D0KA 2HY7A 1NURA 2YHIB 3X0DA 4MDFA 2Y27A 1M67A 3EC7A 1WIWA 5KAMA 4KN8A 3VZCA 5B7PA 1P7YA 4UCFA 5FHRA 2E3JA 3F8TA 1GKIA 2ZWIA 3WV4A 4O4HB 2ZI6A 2VZ0A 3HFJA 4JLAA 3TO5A 5J3JA 5T3UA 5C4MA 5IU6A 1U0FA 5J2TF 3VNRA 2XUGA 3O3OB 1C3EA 2O3UA 2QRKA 2Y9PB 5DLPA 3T1TA 4OQLA 4E07A 1ND5A 2W83A 2FWRA 1H8HD 2X0EA 1WAMA 1Z0FA 3PPXA 4QODA 1R6DA 4NOJA 3TZQA 1DKMA 2H4FA 2Q28A 3CS3A 1XRSB 4R83A 4L7VA 3ROPA 1E3WA 3HJTA 1J09A 3IB6A 1JAZA 3GZDA 3IFSA 5CGZA 1YHZA 5H7XA 3TR5A 4DRXB 4PYJA 1NDHA 1SRQA 5AI0A 4BMOB 4HRXA 1UQUA 5IWAB 1D2NA 4X71A 1W85A 1P1BA 4V3BA 4PQEA 1I0ZA 2I65A 2IYXA 2RK4A 3G9ZA 3IAUA 4L16A 3FTNA 4MQLA 1EJ0A 2Q5IA 3E27A 5DLEA 1BXKA 1SCBA 1HNWB 4YN3A 4IHJF 2AI1A 2BFMA 2REBA 1QF9A 3GEIA 1T3HA 3PFGA 4LV8B 4UUBA 4CMJA 4GRDA 3GP5A 2K7FA 4XWTA 5TF0A 3RM3A 4IIEA 4G97A 2YJ3A 1G3IA 2FSGA 9MHTA 1RWBA 2W42A 3Q2KA 2IQ5A 1CDEA 1RI4A 4G3XA 2OPHA 4OGKA 1WKCA 3OOYA 5G0TA 2NVWA 3H1AA 4AMVA 5BSWA 5JPCA 4MR7A 1L4NA 2VPIA 4DUYB 3BSWA 1QH1B 2PLAA 3QVGB 4B81A 5KYXB 4QECA 4K3VA 1JBKA 1KFBB 3ES9A 5AKLA 2Q46A 1OJ7A 3QFRA 3HU3A 4EX6A 1QDUA 1P6XA 4B74A 1K0FA 2FWMX 1Y1SA 1ULHA 4RQBA 1HLGA 3DEIA 3W6PA 5HJ7A 2BTEA 4V02A 3R40A 3NBZC 4HPXB 3P9CA 1DRKA 3PHCA 2NVUB 1SAYA 3DD1A 3RC1A 4BLVA 3BH7A 2QRUA 5AI5A 3OIDA 5I7EA 4EHFA 1Z6TA 2H54A 5E7QA 4K6GA 1ZD1A 5CK4A 2CCGA 2Q4DA 3IDQA 4XYGA 4CQLB 4JQZA 3AZPA 1C3OB 3RAJA 1ZSYA 1R6AA 3C97A 3O4FA 3T5BA 4EAQA 2IF2A 2YQ5A 5JFGA 1CVRA 5F23A 4YB8A 4NHEA 4ZJZA 4PSUA 3ODPA 4R3UC 2NZ8A 3QKRA 1OXVA 1N4DA 3NORA 1UMCB 1AKVA 3HR8A 1OB5A 4PXYA 2I7XA 3WA7A 3U2QA 5LU8A 2IU3A 3BS4A 1R0ZA 4JB2A 4BLSA 5C3MA 2VLBA 2MJLA 1STOA 2Q5HA 3Q5EA 2O3SA 3JAKB 1FLDA 3IAEA 5K4GA 5BW8A 2NXWA 2G0NA 3RSGA 2VJNA 5CAEB 5K8LA 5COQA 1E6WA 3HKDA 1U6KA 3PDWA 3TW4A 1R4NB 3I9OA 4KUHA 1Y48E 1KZ4A 2D8AA 1L7BA 5F3WB 1I4OA 2XQIA 4NQZA 3D8BA 5FI5A 1CYEA 1OWMA 1IWBB 3D1JA 2BKLA 1BN6A 2ZB7A 3WZ2A 1R9NA 1E9RA 1N5OX 1M6YA 4EYEA 3AKCA 4Q39A 2B36A 4EM6A 1E8DA 1NL3A 3A6LA 4RACA 1PR3A 3QELB 5BW5A 2VUUA 1Q1AA 2NZUG 4KXNA 2IH4A 3DMPA 4OBEA 4ME6A 1U3WA 1QIIA 4MS1A 4XPIA 3M6VA 3D0OA 4QREA 2PT5A 3MTJA 3AOEC 3ND5A 4GL4A 3SJZA 1HE4A 3ZWQA 1X1BA 4BHTA 1T8PA 2POQX 3TXXA 5ECGC 5HDBB 2P9EA 3F78A 3KD3A 3TTTA 4BTVA 3RLFA 4LEIA 2OGSA 3RGWS 1T5LA 1A8SA 1U3VA 4CM6A 1U7WA 1E5DA 3FPJA 4QVKA 4JJFA 2GHTA 3EHDA 2H07A 4EJSA 3FM9A 1B0PA 2Q50A 3CLUC 4B7CA 4EYQA 4IS2A 1W36C 1XRRA 5H0IA 4ZQIA 3MS7A 3C14C 2VHUA 4XSHA 2GLXA 1G7CA 3UH0A 3WS7A 1P72A 1V45E 3P5SA 2EFGA 3THXB 2CCKA 4S0ZA 2IIBA 3LC7O 5CD1A 2HH9A 4URZR 2SBTA 1WSAA 3T35A 4RTRA 4KN6A 2UUPA 3MGCA 3DNMA 4UHBA 1NHWA 1NUHA 3A9UA 1K7SN 2HINA 1N6IA 1RJ9B 2R6R1 5B1DA 4ZI7F 3QG5A 2ZRHA 5GJCA 3IILA 1E2JA 2Z1NA 2H8GA 2NU7A 4YROA 4U1RA 3O47A 3PTLA 5J23A 621PA 3BGWA 4YJGB 3S8EA 3GT3A 4KFTA 4TLLB 4XX0A 2OO5A 5DULA 2IELA 1I0IA 1QIDA 3N28A 1G21A 3RFVA 1L5HB 1CK4A 2DPYA 1EUCA 5L7YA 1E1LA 2QTVB 1Z82A 3U1BA 5MN6A 4NBVA 2ZBVA 4FQ5A 4KPUA 2JGRA 1DOZA 1TJ4A 1USKA 2AI2A 1UFOA 2SKEA 2DEUA 4XD7D 5DZSA 3S2ZA 5TJHA 3TXAA 2EX0A 1GQYA 1TUGA 3K0FB 4BNDA 3EIUA 2JLRA 1BEUB 3AP2A 1WETA 5IYZF 4FD3A 4RTMA 4Y42A 3ER9A 1U4NA 3EIHA 1U3DA 1PP4A 1BQ3A 3SYRA 5EERA 4CM3A 1G9SA 3NB0A 4ZCMA 1CERA 1J42A 3DONA 4R1OA 4AN0A 1P6UA 1D6SA 1Z38A 2NU9A 3A8TA 3PLAE 5ISMA 2JFQA 1U31A 3GXBA 1D2HA 4V1CA 3AEUA 3AJ8A 5KPDA 4LYFA 1GWNA 1MC4A 1E61A 3R3UA 3ZXXA 2Q3JA 4WKGA 1GUAA 2FOXA 5ALOA 4BL5A 4A8PA 3LM8A 3OOHA 1OXSC 2WD7B 2JPDA 3E1SA 4R8VA 4Y9SA 5DB4A 5BW6B 2PGNA 3STVA 1RM0A 4TWAA 2GEDA 2VUIB 1QZTA 1H8EA 2EERA 3M1LA 4M1WA 4NBTA 2IZZA 4W5JA 5EKDA 5I7HA 4MDEA 1B6RA 1ZIOA 1RXCA 3UKOA 1M34E 1U2GC 1E1YA 1KS2A 3TLZA 1DINA 1L8LA 2IWRA 1W5FA 1GQSA 3VGPA 1C4KA 1UKYA 1EFPB 2QLFA 4YREA 1UIMA 4I1VA 3GLIA 3IBTA 4EWLA 4KBFA 1FDVA 1RAIA 3RU9A 4CEIA 1M2FA 2OD9A 4NFLA 1XAHA 3PDIB 5EC8A 3NWBA 2ZIUB 4TYMA 3GBSA 2Q99A 1WS6A 2YWEA 1M0TA 4C88A 1YULA 3L7DA 3QU9A 4FWBA 2LYRA 2QMUA 2R7KA 2PYDA 4LFCB 4E7PA 2GDJA 2RGDA 5AFSA 1N33B 3HB9A 4R9RA 1JFLA 1LVHA 3RKSA 3BK2A 2ZSBA 3MB5A 1H8ED 3CHYA 5DXJA 4OXIA 2FGKA 4MYDA 4MUBA 2FHSA 3ID6C 4TXNA 4NATA 3L7KA 5DHRA 1BJTA 5TVGA 3T38A 4AJLA 1Y3FE 2EQAA 1KVTA 5ESXA 3I1JA 3HVIA 5TQ0B 3E70C 3F47A 2I4RA 3H9CA 1HETA 1KTVA 4J0CA 4BN4A 4KHPB 3GXOA 2O5EA 4MMZB 5FAKA 3W9UA 1A9YA 2BHTA 2FWBA 4AROA 2Q5LA 2VPXA 4B4UA 2XGMA 4H0NA 2JFZA 1QE3A 4I3GA 3PQ5A 4DC9A 1JE1A 3I9FA 5CXUA 4RVUA 5AW4A 3DAGA 1SIWA 4OHVA 3F0TA 1TM1E 5AW6A 3CRVA 4DR6B 4KV7A 1GN8A 4BJ1A 3EWSA 2V58A 3OLQA 2IH5A 4KL8S 2FWJA 3MS2A 4UAJA 3P0IA 4WXMA 4BX9A 3G0GA 5IULC 1LTKA 4Y0NA 4G1UC 5BSEA 4DZTA 4ALIA 2I1QA 3NUQA 2PLFA 5LZ9A 1URPA 2R86A 1TYZA 3Q87B 3EZ9A 1XRQA 1D7OA 4MV5A 4TLBA 2G36A 2XZDA 1XA4A 3L7YA 3PITA 2Q3EA 2IP4A 3ZWBA 2VJDA 1CNMA 3OOSA 4FC7A 1U2TA 1N9GA 2EZ9A 1K27A 2X2FA 5JCOC 2XCRB 3UJDA 3EZ7A 1ZZEA 1PGQA 4CTKA 2C1XA 4MI3A 4PZPA 4HQKA 2XDQA 3JARB 2GDZA 3GEGA 4DA0A 2H06A 4HCJA 4GZ6A 4MVJP 2ZAOA 4IJWA 2FLKA 3T94A 2A4MA 3IP3A 4UBNA 4LC0A 1EDEA 4YXFA 3NAMA 5EWMB 2W58A 4KE9A 1UT6A 1KI1A 3BX1A 3L6OO 4IUDS 5DKFA 2ZI9A 5FWXB 5CUQA 3PC6A 4HAXA 4OXQA 5LIPA 1NUPA 2P0AA 2BPOA 2JI7A 4WNIA 1E4EA 5CDFE 1P9NA 4GOKA 1ENZA 1V3TA 3KPYA 1V7PC 2PRIA 5FOXA 4CFSA 5I7RA 1A7AA 2DT5A 2HO5A 4M7OA 4HDQB 3M82A 1FS4A 3OQVA 4HL6A 1AX9A 3ZD8A 2CCJA 3D8UA 4AS3A 2DULA 2J3KA 4XM2A 4OFXA 5EOVA 2GPYA 1DIAA 2RIPA 3EXIB 1NBIA 1TQ4A 3I6BA 1GAWA 3KFXA 4ZHQF 3LCMA 4UU7A 4B6EA 1A4UA 2R7AA 3QF4B 4ALLA 3VDNB 3DOCA 4PBSA 4UUOA 2QE7A 5BWOA 3OU7A 3ETLA 4W9NC 1ODSA 5ESDA 2PNJA 3ECAA 2LR0A 3PT9A 1KMCA 2LYQA 3ENWA 3ZJYA 1TCCA 5C52B 1PZEA 1OWOA 1IHDA 2AEFA 2A9OA 3FOFC 4FOPA 5I51A 2HREA 3OQOA 4ZVLA 4L3OA 4QU0A 4ZQHA 2RK3A 1A9OA 4LOAA 4YUAA 3X1ZA 4OKIA 3QXGA 4RPGA 1F0KA 3CPEA 4EZIA 4AX4A 3KSZO 4DYVA 2WNSA 1TK3A 5SZIA 1JJAA 4MCIA 1JEYB 4XWAA 5H59A 1E2GA 4N3BA 4F91B 3HP4A 3ZGVA 4FR5A 4X5OA 5AHRA 2MSEB 2YDYA 2BSXA 3KDPA 4PTZA 5G53C 4C5AA 4LC1A 3L1PA 1MU0A 1XTRA 1XTPA 3EZ2A 1XWIA 3LPCA 3VSDA 2QE7D 3WMEA 3HNRA 4BVKA 5AI8A 4DLSA 5I7UA 4XWWA 1UJ4A 1P60A 5IJ0B 3A6EA 2CLLB 3VNAA 1RXWA 2W2VA 5ICMA 5JLJA 3NJ8A 2HI0A 2W70A 1NVGA 1O96B 3VU9A 1IUKA 5AVJA 1ZRHA 1QR6A 1OFVA 1BGXT 4BE9A 2P1RA 1KGSA 2ISQA 4LJ8A 2VHXA 3GQBB 2IEDA 1B23P 1J07A 4GZLA 5E3JA 3CZQA 2YXEA 3F2IA 3DUFB 4KAJA 2GZHA 4MJ3A 3ZC3A 4HNAB 5CG2A 5IKPA 4AY6A 3F46A 3IRVA 1BOFA 4ZOLA 2WSMA 4MWTA 1YJ8A 3KSRA 1H2BA 1YHYA 4Z5XA 2JJ8A 4H0FA 4R2MA 3RK1A 1Y5NA 3MWFA 1UM9B 5IN4A 2ID8A 4AU1A 1ZXBA 1RYYA 4H3KB 2RHJA 2NO9A 3V8MA 2GK6A 2WF7A 3A6GA 3U1VA 5ECYA 2GZ2A 4MVYA 4CM1A 1BDHA 1QTQA 1FNDA 2NQ2C 3SCHA 2HJWA 3BMNA 4OSEA 4L76A 2CZQA 4WOPA 3ZEIA 2HCTA 4F8YA 3LDFA 4FZ3A 3NXKA 3ZTYA 1WW8A 2TMYA 1KNQA 3R0IA 4XB6B 3K8QA 2EGHA 4BFYA 2GK3A 2RHBA 3H4VA 3KT0A 3R2JA 4QQKA 4KSBA 2I62A 3TDMA 1HX7A 1Q0LA 2PJDA 2PXFA 3BTUA 5LUAA 2XZPA 4J0KA 3GY0A 4MCHA 2EGGA 3FPEA 4M89A 3V7UA 4TZTA 1CJVC 1OXMA 1ESZA 4TV9A 3FCUB 1Z4KA 1T24A 1EE2A 1TQDA 5IUNC 5E4YA 1TX4B 2XCOA 3MS4A 5BR1A 1RABA 4HN4B 1MXHA 1BC5A 2EQ5A 2O2CA 4CCAA 4PYMA 2P27A 1QH9A 1NTOA 3VZBA 3ZQKA 5LUBA 1N5MA 5JRJA 1CF2O 3DOFA 5KHLB 4KKVA 4Y7DA 5LQDA 4C0SA 3GBVA 4GBGA 2ODTX 2ZYWX 2BMJA 5BSMA 2R8BA 3EVNA 2JCVA 4ZP1A 3SK0A 3DL4A 3FNFA 5JH7B 1XZ8A 1PT9A 2CN1A 2VO1A 2R6AA 4DCTA 5KTOA 4OQYA 1TEHA 5FTWA 1U2ZA 2WTBA 3QXJA 3ZWMA 4AJ4A 2E82A 3I01A 2JC3A 3JVVA 3UMJA 4R1SA 3SIPA 3QXCA 1AC5A 3LP5A 4FDUA 4EVQA 3E9NA 3I5MA 3A14A 2AUMA 5CM9C 1WXEA 3VZDA 4IXWA 3KQKA 4KXMA 4H15A 2C1ZA 1MC5A 1JG4A 1NHGA 1Z47A 2QW8A 3BKWA 4HZGA 4QPZA 3TX6A 5GJBA 4JLWA 4CF3A 5ULLA 4CG2A 5KJ1A 2HLDA 3WRWA 1FDTA 2GBCA 4EEKA 3G02A 1J22A 1YKFA 4B87A 1U63A 4GMHA 4JI1B 4XFJA 4D9NA 1XROA 1CUCA 4ICIA 3SDSA 4RTJA 2ZT8A 3OF2A 4XUEA 2CL6X 3C74A 1F2UB 3I2JA 4B0PA 3CN7A 3GLSA 3T34A 5IF9A 4EKEA 4G86A 1AU9A 3IUPA 4DM4A 2H7VA 3URMA 2J09A 3OKCA 4PC6A 3CW8X 4I50B 4JT2A 4FYWA 2GRJA 3B8HA 1GPBA 1JXOA 4DREA 1S7CA 1Z56C 1G1MA 5B1YA 3VXKA 4OQEA 4YT5A 1ZNWA 3TYXA 3KSMA 1NW3A 2GERA 3I92A 3HDYA 4HFNA 1DE0A 5H1YA 3VH3A 3DDZX 4WESA 5HA5A 4C22A 3WLNA 4CIDA 3KKZA 4DQKA 2HLDD 1H4QA 1GA1A 6REQB 3I6IA 1XHEA 1GQ2A 3H97A 2O6LA 2XMCA 3TSOA 3C7KA 4K03A 4ARZB 3OKZA 1K2WA 2RH5A 2VP0A 4BDSA 1RLTA 3DMRA 3CU5A 4KDCA 4YEDA 3KZKA 5I5EA 3Q4GA 2M6KA 2ZE8A 3VZSA 4D43A 1BSVA 5CXXA 4YAGA 3DPSA 1Q74A 5FT9A 2KEJA 2P3SA 1JH8A 2B5VA 1E94E 4M8KA 5HF8A 3PD7A 4P7BA 4WNAB 1Y1KE 4KQHA 4GQIA 2WFLA 1XRPA 1D5CA 2DBZA 3GA5A 2F67A 1DBQA 2V7XA 2QT9A 4LWZA 4OFWA 4X44A 4B6JA 3VV3A 2PSDA 2FDRA 2JLYA 3UJBA 4RE5A 2G1PA 1Y6GA 2ZRKA 1BN7A 3HEAA 2ZGVA 1ML4A 1X2BA 4X7RA 4HWGA 1E5VA 4G63A 7ADHA 2OGWA 3D4LA 4MQFA 2GAIA 2CXTA 3FMPB 4GLJA 2BGLA 1E0JA 5EXPA 2D0IA 1FY2A 1EFTA 2ZS7A 1TEVA 2QZZA 3HSKA 3SE0A 1TA0A 2AQHA 3P2YA 1VFNA 1RM4A 2RI6A 2VJQA 3TLXA 4AURA 4Q1VA 1X42A 2WUGA 2YV3A 4LJSA 1HT1E 2QQFA 5IDQA 3VA7A 2OCAA 3TLEA 4KGDA 4C2BA 4G9BA 4KMOA 1VBNA 1PG0A 4MMXB 4S1VA 2GI4A 1VLQA 2ZRNA 3HPRA 4FGWA 4ND8B 2N42A 3E5NA 3IVGA 3MCTA 3I05A 3ZE6A 1AUPA 2F3QA 2IYEA 3G2NA 4W8HA 3C3JA 2B20A 5IVIA 1P29A 2QDXA 4A0HA 1VHJA 3PQCA 3VHRA 4FMDB 2FF5A 4G1CA 1Y8RA 4KODA 1FFAA 1M7GA 2WHEA 2VTBB 4Q03A 1UXKA 5L45A 2I3DA 4X60A 4PNHA 3T5TA 8ATCA 1RACA 2J9YB 3QFFA 5J40A 1JYEA 4JBNA 1NONA 1SEPA 3AF1A 4G67A 2JASA 4L73A 2QMZA 1VI6A 4E94A 1EHCA 4B34A 3GDGA 5JAQA 3ICQB 1F8GA 3E2MA 5ECDA 5T3YA 2C7OA 3GDWA 4EGJA 2AXNA 4IIJB 5FTKA 3HRKA 3TQSA 2X23A 4GZ5A 1G3MA 2IV7A 1GAXA 2P9HA 4OP2A 4J16A 2QT0A 1G6Q1 2V96A 3TR6A 4C0AC 2X6QA 5LIRA 1X1DA 2WZBA 3OJEA 2JRLA 1EDZA 1FA9A 2Y66A 2EL9A 4KXLA 4OGGA 4C3VA 1TZCA 2CLKB 2C78A 2WVHA 1Z28A 1H3NA 2H7XA 1ZZ8A 3HFGA 4E7OA 4ROTA 5AK5A 5K0GA 2OP1A 1GUYA 3VPFA 3H2SA 3GL9A 3ACBA 3RFUA 2XH8A 3V1UA 4J76A 2NV6A 2PN1A 1NXTA 2WUVA 1X94A 3BCUA 3Q72A 5ARCA 3X2FA 5LU9A 3LOUA 1YC5A 1W2HA 2BEVB 2QGNA 3OZSA 9LDTA 2FPGA 3HCEA 5CB8A 3CF2A 5EIFA 5GZ3A 2CHVA 4IG4A 4Y9RA 3SD7A 2Z6QA 2QMHA 1E6CA 4WJKB 4EL5A 5HM8A 5EWLB 1GV0A 1PJ8A 1QGED 2GBPA 5F77A 4CMIB 3ICPA 4MV8A 3AM5A 3AP1A 3AERB 2GXUA 2PM8A 4MV7A 1KY3A 1ZMOA 1KWGA 2PLRA 2VPYA 3CH6A 1I7LA 1QAQA 2HSDA 2UYYA 3KOXA 3R9KA 3ZHXA 1KJIA 3REOA 4GBED 4UE3S 1RFLA 3GMDA 2WABA 3NS7A 1T6YA 4L4XA 4KO1S 4FGSA 4TUYB 5G0SA 4UPEA 2B82A 3E7WA 3HFSA 4IW3B 4Q1BA 4RCYA 3TBKA 2MTBA 1HNZB 4BVBA 2IRWA 1EBUA 1TVKA 3QVKA 4XFKA 2ZWVA 5JAMA 2OECA 4I36A 4CKCB 2B7LA 5E6RB 4YQEA 2VC2B 4G0WA 1UC9A 1UJNA 4NDWA 1Q84A 1ZI8A 4CTMA 4JVOA 1XG5A 1JL3A 3P26A 2CFIA 1EK1A 4DPKA 4JROA 4BQQA 1DBSA 3FMFA 1XLWA 3T7TA 1KK2A 2R63A 1HKHA 2EBWA 1SVOA 2QLBA 2Z2XA 4OSOA 5IVPA 3AETA 5LYJF 1ZD8A 3A31A 4E1AA 1HUQA 1H9CA 4LJAA 5FJIA 2YV5A 3BBLA 3G2IA 3IOYA 3N2YA 3NT5A 3GEDA 4PAOA 1YB7A 3EGXA 4QUEA 4B3HA 4F21A 1XMXA 2DB3A 3RAEC 4Z4CA 2YTZA 3ILSA 4CUZA 2ZUDA 3DM9B 4DLVA 4F2HA 2VP6A 3U7IA 1V8DA 3CLVA 4AP6A 4YDQA 1I2AA 1LPSA 4XEUA 1E9AA 2PFSA 1CCWA 2MXDA 1AKUA 5MFPA 1UF9A 3A70A 2FOIA 3CR8A 1LGYA 2FV8A 2WWGA 4RL6A 4IH4A 5BPHA 2XNDA 1T5BA 1BW9B 4NZYA 3H6HA 3TOCA 1XPUA 4KGZA 3W7AA 4TMVA 3QFTA 4HDKB 4MWCA 4WY2A 4EJ2A 2J45A 5E4TA 3A28A 2CNWD 1DQYA 3AF5A 4WA7A 2EFEB 3G8YA 1BE6A 1NNI1 4RK0A 3R7NA 1IJKA 2H2AA 4J07A 4F8DA 3M49A 1ZS4A 2DE0X 1M73E 4M1QA 4CN8A 3FDJA 4JY7A 1U0OC 5H68A 4LV5B 2OV2A 2I29A 5IZ4A 4ZOBA 3AFGA 5U4XA 1QK5A 2Z2ZA 1FZTA 1EVEA 1U11A 1VL8A 2CNOA 3CMCO 3HCPA 3G5UA 3L1JA 4E5VA 2IHNA 4Z4EA 1J23A 4YGXB 4Y2TA 3MPUA 5JY1A 1MB2A 2J33A 2F2TA 3IDSA 3W5IA 1UDAA 4D4MA 4ANFA 4OJTA 1YSEA 3P0RA 4M1EA 1SVMA 1UMDB 2BJVA 3RUIA 1X74A 3TEPA 1XWWA 1JHMA 3AILA 5B57C 4BQIA 1U1EA 3CPSA 3K20A 5ALEA 5DW0A 1SXJA 3MT0A 3SZLA 3UUGA 2ACWA 1Z35A 3OAAA 5KQGA 1ND6A 4GWLA 1KQGA 1XXHA 2GEVA 1C9YA 5LP6B 2HXSA 1N77A 3KR2A 3IC5A 1GZ5A 2NAFA 2HX1A 4R1NA 2FWAA 2H0QA 1TIBA 1G6HA 1QRDA 3P9RA 4ETMA 5K6TA 4OKSA 4BFVA 1EFRA 3K31A 5KHOC 3K0SA 1PTJC 4ALNA 1XJWA 1Z2AA 3UH1A 1EQ2A 3VHXA 1RWXA 5A0TA 1R0XA 1BX3A 1C3LA 1ZFNA 2Q3DA 1Z5PA 4X8HA 3OIWA 1T34A 3LL7A 3TIFA 4MO2A 3AG5A 5CXSA 3R5SA 4G1BA 2CD9A 1A8QA 1AUVA 3DCJA 3OG9A 2Q9UA 1XPRA 1NW9B 4TXJA 4MDHA 1SIOA 2REQB 1R8QA 3DMHA 3HVKA 1XZGA 3MTIA 5FUXA 4GXNA 1SXJD 4FFDA 4E5PA 3ZZNA 4RXMA 1ZUD1 3OAAD 1FVXA 1NF8A 1W0KD 1NASA 3SEZA 2QTAA 1DIOB 3G8AA 5CB4F 1H3EA 3IIMA 2XUDA 3GG2A 3LG2A 4KPYA 4IGAA 1G2QA 2I03A 2I7CA 4ZWNA 1LS6A 3PC3A 1K89A 3KOWA 3PF9A 4FDLA 1EFRD 1DPFA 1FFDA 4G0NA 4TWBA 5D00A 1ZEMA 2W6OA 1PR6A 1T25A 5KOIA 1J24A 2R8RA 2AW3A 1FTWA 4O4HF 1A7UA 2SKCA 4HYYA 3H13A 3KLOA 2OKGA