3QOWA

Dot1l structure in complex with sam
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
327
structure length
322
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKWTGKPVSYYLHTIDRTILENYFSSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase
total genus 102
structure length 322
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qowA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qowA02
1AF7A 1U2ZA 2C7QA 2AR0A 5CVJA 4YV2A 3K6RA 5E2BA 1PRYA 3PB3A 3FYDA 4OBXA 1NW6A 2G8NA 3ME5A 3EEOA 3FPHA 1QAOA 3BZBA 3LHDA 5GM1A 4F86A 5FA8A 5DX8A 4AZVA 1SQGA 3OPNA 3FYCA 1JSXA 2P7IA 3FPJA 4K6MA 4OA5A 3R9XB 5EPEA 4F85A 3DXXA 2HWKA 4GUAA 5H02A 4V0RA 4DMGA 1IY9A 1SVUA 3LBFA 4YUWA 4C05A 4UOEA 4BLUA 2C7PA 5DTRA 5DWQA 2QM3A 5LQJA 2Y1XA 4PYNA 1X19A 4FT4A 4EQZA 1JG2A 4V0QA 4C06A 3A27A 5CM2Z 1EQAA 3NJRA 2IDKA 3DP7A 2YXLA 3DXYA 4FSXA 2QRVA 3CJQA 1JG1A 1BC5A 5EEGA 3PTAA 3UWPA 1B42A 4C03A 1EG2A 1L3IA 3CCFA 1ORHA 3FPEA 3FRIA 2BR5A 3UFBA 4EKGA 5K05A 2Z6UA 3LGAA 3T7SA 5LQAA 1FJXA 3HTXA 2K4MA 2O06A 3AY0A 2B2CA 3A7DA 1VP3A 3NDIA 3GIWA 2QRVB 2PBFA 3CJTA 1NW7A 3TM4A 2FCAA 3TQSA 2B25A 3AXSA 4RTOA 3KKZA 3KQOA 3E7PA 1VLMA 4IWNA 2BH2A 2O05A 3EVFA 2HV9A 3G5LA 2UYQA 4GOOD 2AZTA 4U7TB 3BWBA 3AJDA 2NXEA 3C3YA 1MHTA 2PKWA 3FPGA 2ZVJA 4QVGA 5HILA 3ERCA 4GEKA 1IM8A 2R3SA 1R8YA 3FTCA 5FTWA 3P8ZA 1NE2A 2DPMA 2AOVA 5BW4A 4C04A 2ZLBA 2NP6A 1L3BA 2NYUA 2PXCA 2ZIFA 2OY0A 3VC2A 1X1AA 4EVIA 5IKMA 4XCXA 5P8WA 3OFJA 1XVAA 1F38A 1SG9A 2C7OA 2ZCJA 1KPHA 1WY7A 2R6ZA 2VDVE 5LQCA 3G5TA 5K0CA 1RI3A 2AVDA 2PY6A 4HTFB 3NW9A 1XXLA 4AZWA 4DZRA 5CIYA 3PFGA 2PXAA 5DTQA 2CL5A 2ZBRA 4X61A 3GWZA 2OBFA 3FUWA 3T7RA 1G8SA 5DX1A 5GINE 3DMFA 1O9GA 3ELDA 4PYIA 3B3FA 5DTMA 1AQIA 3Q7EA 2VP3A 2YXDA 5FULA 1O9HA 2ZWVA 4JXJA 2JH9A 1UIRA 4DF3A 3BWMA 3I5UA 2NP7A 2PJDA 3M6WA 4QVKA 2FHPA 5E8RA 3I9FA 1RI5A 2P35A 1SUSA 4HSGA 1R00A 2VDWA 3OE4A 4DA4A 2QY6A 3JWIA 2FK7A 3TLJA 1NBHA 3CJRA 4HGZA 3DH0A 4QTUB 2ZZMA 1KYZA 3TKYA 1YFJA 2C7RA 4YUYA 5E1OA 1VL5A 2ERCA 3HCCA 3M6VA 2EX4A 4AZSA 3OCJA 2B78A 3G88A 4PYLA 1VIDA 4KIGA 3A7EA 3IHTA 4HG2A 4MTLA 2P3LA 5DM2A 2FK8A 1KXZA 3HCAA 3KQPA 2HMYB 1RJEA 1UFKA 3CBGA 4PYJA 3G2OA 5EHIA 4E30A 1YZHA 2AOWA 1RI1A 3HVHA 4RWZA 5EZQA 1ZHFA 4RTNA 10MHA 5EC8A 4LG1A 5LQUA 4RTQA 4YV0A 3KPWA 2UZ4A 4QPPA 5BP7A 2AOTA 1MJFA 2N47A 2ZULA 4GC9A 5FQNA 2QE6A 3P2EA 5DSXA 1JR4A 3A26A 4OX9Y 1KPIA 4IV8A 1P39A 3NDJA 4GOLD 5LR6A 2IH4A 4R8SA 3B7PA 1DL5A 1SQFA 3G2QA 2ESRA 5FWDA 3G89A 2DULA 4BLVA 2GA9A 1KP9A 3CVOA 4GC5A 4RTKA 3KPUA 5K0LA 3ID6C 3NTVA 4GF5A 3ELUA 2PT6A 3R0QA 3R24A 3MQ2A 1VQ1A 3TKAA 4EMSA 4DKJA 5K01A 2FPOA 1H1DA 4X41A 1ZGJA 1NV9A 2ZIEA 4Z2YA 5KS2A 1YB2A 3O7WA 1NV8A 4RVHA 1YZ3A 3LDUA 4PYOA 5DM0A 1JTFA 1V39A 3QOWA 3LPMA 3UJBA 4BP1A 3SVZA 2PLWA 2P3QA 4LWPA 2UYCA 3P97A 5D1HA 3BKXA 3AWIA 5K0NA 1P1BA 2IIPA 4DCMA 2YXEA 2JHCA 2NXNA 3C0KA 3LKDA 1VBFA 3GXOA 3T7TA 4PYQA 3NVMB 4O29A 3TMAA 4HH4A 2EFJA 5E9WA 3UJCA 1QYRA 2ZZNA 3LDFA 3PT9A 5K0FA 5ERGB 1KYWA 3DMHA 3ELWA 1TW2A 5E9JA 2OB1A 2XYQA 4OA8A 4RV9A 4AUKA 2BM8A 1ZQ9A 4HC4A 1D2GA 2AOUB 4YV1A 4X63A 3P2IA 3BGIA 5ICEA 3KQSA 1QZZA 2BR4A 3G2PA 1D2HA 3JWHA 2FYTA 3KPVA 4M7RA 4WXHA 5DM1A 1X1CA 3FUTA 2G71A 4E2ZA 3FUXA 1L1EA 2KW5A 3CC8A 3DR5A 3HCBA 4P7GA 4RX1A 2GPYA 2V7EA 4PCLA 1JQEA 5EIWA 1NT2A 2YTZA 3UA4A 2ZIGA 4PCAA 5K0EA 2AOTB 4AZTA 1KPGA 2IGTA 2H11A 4H0NA 5DLYA 1WXWA 3S68A 2Z6AA 3Q87B 1R18A 2ZW9A 3TRKA 4ER7A 2AN4A 5ICGA 3UJAA 1VE3A 4RTPA 4FP9A 5EMLA 5DRYA 1XJ5A 2EJUA 3LCVB 4L7VA 3EVAA 3BUSA 1N7IA 4P7JA 2O57A 3M4XA 5FHQA 2GS9A 2PX4A 4ZTBA 3SSNA 1AQJA 3FTEA 3THRA 3NMUF 2OYRA 5HEKA 3PX3A 1WXXA 5B1SA 1N2XA 2VS1A 2P7HA 4C08A 3HCDA 3PFHA 4RTSA 4Y2HA 1FPQA 4QQNA 3NWBA 3BGDA 3GJYA 4XUDA 2B9EA 3G2MA 2CWWA 5MHTA 3GDHA 3LSTA 3V97A 2IDJA 3REOA 3SX0A 4F84A 2BR3A 3ER9A 5F2OA 3B3GA 3FTDA 3O31A 3PVCA 3EGIA 2G70A 2O0LA 5K8VA 2P3OA 2I7CA 4E31A 5E2AA 4EK9A 1NBIA 2PV0A 3UZUA 2ZTHA 4YUZA 3MCZA 5BXYA 3C6MA 5KQSA 1EAMA 4P7FA 3MB5A 2NNWB 3I58A 3G8AA 5GM2A 3DLIA 4OBWA 4PNEA 1WZNA 3DXZA 1XDZA 5KYGA 4WVLA 2WA2A 2NXCA 4FZVA 4KW7A 1TW3A 1BKYA 2PXXA 3GRRA 3MTEA 3LL7A 4ER5A 3OZRA 3OZSA 5K03A 2JHAA 2I9KA 2GH1A 3EGVA 3LECA 4PWYA 5FHRA 5F2NA 1JSZA 3BGVA 3OU6A 2E5WA 4PINA 3EVZA 2OXTA 3E8SA 5U4XA 3MERA 4QDJA 3LDGA 3HCFA 3BWYA 3LX6A 3G8BA 4G56A 4ISCA 2QYOA 3FUUA 3GRVA 3SGLA 7MHTA 1G8AA 5GOZA 5M5BA 1DUSA 1JG3A 4E2XA 5EQJB 2VZ9A 5GIOE 5EMKA 4PIPA 3UJ7A 1I1NA 3MTIA 3LCCA 2IPXA 1ZGAA 4DCGA 4GOMD 4ER6A 1I9GA 1KR5A 4R8RA 4HGYA 3HA7A 5G02A 3KHKA 5FADA 3UA3A 4HRAA 4RTJA 1SKMA 5DT2A 2YR0A 2Q41A 1IXKA 1R8XA 4FGZA 1XCJA 1QANA 3KQMA 5DSTA 2HR1A 5C1IA 1NW5A 1EJ0A 5EZSA 3PLAE 2OZVA 2PX2A 2GAFA 3KQWA 3UJDA 4CTJA 1RJFA 1XDSA 1SUIA 3HA5A 4NECA 4YUXA 3KQQA 2I62A 2V74B 3NVKI 5KVAA 5EEHA 1YUBA 3JWGA 1RI2A 2EJTA 5DRTA 2OPBA 1RJDA 2P40A 4GBED 5EMMA 5E1MA 3P9KA 4B17A 2Z6QA 2ZZKA 2AS0A 3C3PA 4XUCA 4PGHA 4MHTA 4YMGA 3OU7A 5CVVA 1XCLA 5EMJA 4ATNA 1RI4A 1FP2A 4PGGA 3OU2A 4M36A 1EJ6A 2YVLA 3KPYA 3LCUA 4CKCA 1R6AA 3OFKA 3DOUA 1NW3A 4X60A 5CVDA 5ICFA 3TM5A 4E2WA 2JHPA 1I4WA 3UJ6A 5FA5A 3TR6A 3SM3A 4POOA 5HIKA 3U81A 5EKXA 3GNLA 1FBNA 5ICCA 4ER3A 3KQVA 3OZTA 4QPNA 5CCXA 2NXJA 2ADMA 3HVIA 2OKCA 2XVAA 4BLWA 3LBYA 2BM9A 2IP2A 2ZBPA 5LQNA 5CCBA 3I64A 5K0BA 4RTRA 2JG3A 2PGXA 4GOND 3HCEA 3EEYA 3L8DA 4CTKA 4ER0A 2VDUE 1AV6A 2P1DA 3K0BA 4P58A 3LKZA 1BHJA 2GLUA 2JJQA 2YUIA 5HIIA 1TPYA 2ONZA 3IEIA 2PWPA 3M6UA 5T64A 1ORIA 1T43A 9MHTA 2AOUA 1M0EA 5DM4A 3SSMA 4C07A 4KIFA 3DLCA 4A6DA 3EVGA 2EG5A 4YUVA 2UYOA 1KHHA 4CWAA 3FRHA 5CUQA 3A25A 4DQ0A 5LQRA 5JUWA 1BOOA 5LSAA 2GB4A 3T0IA 3MCTA 5EOVA 4E2YA 3HVKA 3WSTA 3GGDA 3M70A 5GIPE 1DCTA 3MAGA 4QTTB 1NKVA 3I53A 3EVDA 3ER8A 3VYWA 1Z3CA 1Y8CA 4DM3A 3IV6A 2CKDA 3UBTA 3E05A 2P8JA 1PJZA 3KR1A 4RYLA 2AN3A 3EGEA 5C9ZA 3KQYA 1G6Q1 3UJ9A 1HMYA 3BXOA 3EMBA 2HTEA 3FZGA 4M38A 5HIMA 3RODA 3VSEA 4FR0A 4FSDA 3SMQA 4CXMA 2WA1A 1L9KA 1M6YA 1P91A 3EVCA 2PX5A 3F4KA 1D2CA 3OE5A 4PONA 2PWYA 3TPZA 2IBSA 2IBTA 4QDKA 4KWCA 4RVDA 4GQBA 5IH3A 3PS9A 1NW8A 1VPTA 2HNKA 3EVBA 3DUWA 4FS8A 5EVJA 5CD1A 2PVCA 2WK1A 3KQTA 4IV0A 5HZMA 3ELYA 1G38A 1F3LA 2JH8A 2O07A 3BWCA 1JTEA 5F2KA 4BP3A 2Y1WA 1R74A 3R3HA 5E1DA 3TOSA 4PYMA 3MHTA 2OO3A 2ORED 5BW5A 2IH2A 4BY9E 3ANXA 3RW9A 5HFJA 1RJGA 3O4FA 2CMHA 5HOQA 5GWXA 4LWOA 3FTFA 4CKEA 4PYKA 1QAMA 4E70A 4RVFA 2LD4A 4MIKA 2F8LA 4X1OA 5DXJA 3UJ8A 3HEMA 3SR4A 1X1BA 2H1RA 4M37A 4XUEA 5K09A 3GU3A 4P7KA 4U7PB 5KQRA 3TFWA 1ZKDA 1INLA 1X1DA 2XYRA 2ZSUA 1VP9A 2XVMA 2IFTA 2ZWAA 2ZFUA 1KIAA 3HP7A 1WG8A 5DX0A 5FWAA 5C0OE 2I6GA 3ORHA 4YMHA 1UWVA 3MGGA 2PT9A 1N7JA 5T67A 1WS6A 3B89A 3CGGA 3KR9A 5EG5A 2G72A 3KPJA 1XTPA 3GRZA 3B5IA 1Q0TA 5T6BA 5LQKA 3HA3A 3NWEA 4E33A 2PX8A 2AOXA 3HVJA 1JQ3A 2ZBQA 3P9CA 1G55A 3IYLW 5E1BA 4OQDA 5K0GA 2YQZA 3DULA 5CVUA 3EVEA 3P9NA 3THSA 3P71T 3RIEA 3M6XA 3HM2A 2XYVA 5HIJA 3D2LA 3R6TA 5E9QA 2P41A 2AVNA 8MHTA 2XBMA 3G7UA 4QQKA 1M6EX 4PIMA 1JQDA 3KU1A 4CKBA 3X0DA 3QV2A 4LECA 3BT7A 3FUVA 4KDCA 1L3CA 4MWZA 5FUBA 4KDRA 5K0JA 4R6WA 5GP1A 3A4TA 3P9IA 4C4AA 1XDUA 5DPMA 3KR2A 2H00A 3BKWA 4Y30A 4RSRA 3EPPA 4AX8A 4RTMA 1OR8A 3GCZA 5D1NA 3M33A 1EIZA 3AXTA 4MQ4A 5E8JA 2G1PA 4KRGA 3V8VA 1G60A 2UYHA 3SXJA 2PSSA 4OQEA 4IKPA 2IH5A 3EMDA 2YX1A 3DTNA 5DXAA 5FQOA 3QOXA 2FRXA 2OB2A 5EHGA 4RTLA 2AN5A 2BZGA 3PX2A 3CKKA 4R6XA 5EIFA 4RVGA 1P1CA 3P2KA 1QAQA 1Q0SA 3H2BA 1YFLA 3DMGA 3GRYA 1YF3A 3B3JA 5EGSA 4EKIA 3VC1A 3KR0A 1FP1D 2A14A 1HNNA 3GO4A 1ZG3A 5EKUA 4FT2A 4R05A 4A6EA 1JG4A 3HNRA 3C6KA 5CVEA 3SSOA 4HTFA 2ONYA 4KVZA 4E32A 2B3TA 2CMGA 3FPFA 3GRUA 5FCDA 1O54A 3E23A 3JWJA 5JR3A
chains in the Genus database with same CATH superfamily
4UBOA 1AF7A 2VHWA 4W1QA 1N5RA 2O38A 4MRRA 4EO4A 1KC1A 1KEEA 2QTZA 5TF4A 3ME5A 1QX4A 3BZBA 3V2HA 1NX9A 4HLUC 5JTUA 3JASB 2GK6A 2WJYA 4FHDA 1T2CA 3RVPA 1UZUA 4QBHA 5IFLA 3FSJX 3QNUA 1LU9A 1Z08A 2HWKA 4RQBA 4IIEA 5JNLA 4IJUA 4V0RA 1Q83A 1UBOS 5H02A 4YUWA 1E9BA 1UQUA 1LW6E 2DVMA 1YUNA 2X9LA 1BS2A 3Q2IA 3GBSA 1XA3A 1SD1A 1K27A 4A8JC 2WKRA 2E37A 1FYEA 4DLWA 1OZ0A 2HQBA 3Q85A 4PYNA 1Z25A 2FSUA 1W25A 5KAMA 3RVMA 3RWBA 3TECE 2KM1A 1JQAA 3W2HA 5KCZA 3QQPA 5IYZB 2UZIR 3KOXA 3PRJA 5IYZA 3KSUA 4PE5B 1GCAA 4XE5A 1IZYA 3ZTWA 3UK2A 1MAVA 1I94B 1MB9A 3D7SA 4LTMA 821PA 1NVFA 1Y9EA 4GGMX 4F9EA 3NAGA 1OHHD 3LWBA 1AUQA 4I50A 3DB1A 3QTBA 3UUFA 3ZJ4A 3ZU3A 5JBNA 3HHPA 5AJVB 3L6EA 5EP2A 1FFBA 2CJPA 1JAHA 3AY0A 2B2CA 3IPXA 3C1OA 3LV8A 5CIQA 4HB0A 1NN1A 1JXMA 2IRWA 1OMOA 4ZOLF 4N0DA 1NUQA 3AXSA 1IBMB 2H52A 1ODKA 2NSJA 3E7PA 3RI3A 1UJ4A 1LJ8A 3GT0A 4E22A 2R751 1G9SA 2HCTA 1Z7GA 2HIAA 1J07A 3OM0A 4HVLA 2DOKA 1C30B 1P2SA 2XHZA 4OQLA 1X3SA 1SAYA 4JOSA 3N8IA 3VDXA 1NXVA 1W34A 5EAIA 5ALTA 3N2YA 3K8QA 2EJWA 3B1WA 2GPSA 2A4MA 2ETXA 2PXCA 2ZRPA 4OU5A 4H1HA 4V2IA 3BCUA 2BBTA 4V39A 3WI7A 2WB2A 4BFXA 3U4AA 4B75A 5K3BA 3HZHA 3MYYA 1Q2XA 1TM5E 3LT4A 4MEAA 4NZOA 3VGPA 5K8UA 4TSRA 2R6DA 3EIEA 2DTXA 4M1KA 2IWRA 1CUVA 5IEJA 5FL7A 2ZIUB 2QSJA 1QDEA 5H8WA 2VDVE 3KU4A 4CDNA 1IBSA 2VEDA 4REOA 2PMWB 2AC7A 2ENUA 1QRSA 1UKYA 2NO0A 4MGYR 4B1FA 3OO0A 2NUTB 3JZDA 3E3NA 2Q2OA 5FL7D 4Q12A 3KOWA 2GXQA 3JRXA 3M83A 3ZY3A 4CIVA 1G8SA 4BRZA 5BN5B 1EP2B 1LBIA 2Q5LA 1KJYA 2DWCA 2A6PA 5H4HA 2W8BB 1Z22A 1O9HA 2QGNA 4MEBA 4K40A 1N32B 3JQDA 4PRZA 1ZAYA 2BOVA 5DULA 4ZO4A 4HTAA 2GEVA 4Q3AA 4BFUA 3K73O 3UEOA 1E94E 2C7BA 4KXQA 2FE4A 3ZHSA 1X7WB 1RI5A 1S9DA 4D2IA 2P35A 1SD5A 2JFZA 1PHRA 4Y1RA 4I1IA 2GCOA 1HL3A 1NATA 1U1FA 1P5HA 4NZ9A 3UT5A 1QORA 1ZH0A 4HGQA 1USWA 2QTNA 3T7IA 3VR6H 2J7UA 1E6WA 3R0IA 4QTXA 1TI7A 1ZXXA 3EOZA 3ITEA 2N42A 1VL5A 3HCCA 3HN7A 3EFBA 3EIWA 3IT2A 4NE7A 2C95A 3ZIUA 1LZKA 3DFUA 8ADHA 1XCMA 3T9CA 4K3VA 3QG1A 4WXEA 1E1QA 5CDSA 3UFDA 1EQ2A 4IZHA 3KETA 2IXAA 3PF9A 4HG2A 1T1GA 4IDGA 4OGLA 1RFGE 3ZIAA 1ECBA 5HHTA 1TRKA 1QC5B 1M54A 1LLIA 3IMEA 4YI5A 2VKQA 1ZCZA 4CR7A 1W5BA 2VNSA 2ZSJA 3LBHA 3PGMA 2UUAB 3AJ9A 2W00A 2CVZA 2PKYX 2WWWA 2V55B 4I55A 5F1KA 1FTSA 5TQ2B 3IVPA 1U3CA 1EK0A 5D01A 1M2VB 2ZBUA 5BP7A 1PVVA 4ENUA 2ZULA 3X2FA 5IC5A 3CPJB 1W0KA 1SN7A 2TSYB 1TQHA 3FNHA 5FOXA 1NVBA 3RREA 2ID8A 1JN0A 1XTKA 2FTKE 1HNXB 2Y6UA 3AUXA 5FP0A 1QVVA 5IP5A 4B6PA 1Z2EA 3QPVA 3MLFA 3LDHA 1EXDA 1W0KD 1ONSA 1IEQA 1K97A 2DHEA 3NTVA 3AJAA 4X1YB 1XELA 5DZSA 3SY8A 4RGQA 4NMHA 4XWKA 3ZHVA 4YCDA 1MEEA 2GD6A 5G1NA 1CUGA 1V8BA 1DJMA 1D1TA 2IVGA 2VP5A 3TRHA 7REQA 5AI5A 3H0EA 4Z2YA 5KS2A 4IKOA 4O2AB 1P4JA 2OGWA 3UJBA 5LQNA 2YS7A 1J22A 1QH1B 4A2WA 3L8HA 4C0XA 3GG9A 2O8BB 2PUJA 3G2KA 4HDNA 1VI2A 5A3SA 5HZKA 4LYFA 3BRSA 3D7MA 2M1XA 2QORA 2C92A 3IJ5A 1G7CA 3UJ3X 2VHZA 1R6VA 4TLEA 3X43A 3MS4A 1X2LA 2YOFA 2I1LA 1XZCA 2KZ8A 2QV0A 4D0RA 3A3YA 1X42A 2F43A 3NASA 4ZCPA 1SWVA 5H5JA 3A70A 3ACDA 2V6FA 1KO4A 1N5IA 1ONBA 1WXIA 4HFMA 4UMDA 3RHZA 1ZZGA 3WIDA 5A03A 3AVOA 4IMPA 2DPHA 2ZS9A 5HM6A 2IYTA 3SNHA 4N65A 2VCHA 3P0EA 1YZQA 2Z4TA 3QITA 3KYCB 3UWSA 2XBLA 2LYJA 3UAOA 1O77A 4F1KA 4WXHA 3RROA 4ZV9A 3VR1A 2HH9A 2WJVA 3K05A 2XDQB 1XRNA 4Z58A 3DEJA 3LFHA 4TVBA 3VU0A 3I2JA 2O19A 4GL4A 3ZZTA 1GTL1 2HHLA 4J90A 4UFOA 5EIWA 1OZHA 4N8DA 5J63A 3GARA 2WWIA 4PCAA 3R74A 4MMYB 1LDBA 1NFRA 2AOTB 1FTYA 3ZG6A 3QYAA 3QLTA 1G6HA 3AHHA 1KNXA 2QXTA 1XCGB 3WY9A 2AV6A 1Z5PA 5FBWB 1QH8B 3SYKA 1R9GA 4EABA 4TSFA 3IUBA 5J43A 2IYWA 4IMIB 1J8QA 4Q03A 2XQFA 1G8MA 3ESCA 4RO0A 4S12A 4M83A 3PFBA 4DL9A 5GIPE 3EVAA 2PJRA 1JR6A 2Q1TA 2F7SA 1W9HA 3FROA 4D0NA 4YBRA 3ZGOA 4AQ7A 4AP5A 2MYPA 5HFAA 1NQXA 5L3ZA 3ZVLA 3T54A 1DC3A 2XUAA 3AU9A 4E3ZA 5KNBD 1KTIA 4QLOA 3VPDA 3HCDA 1SH7A 3EQZA 3SC2A 2XRZA 1JIJA 3CPEA 2NM0A 2LZ0A 1L4MA 5KVSA 4E13A 1I5OA 1OAAA 2BE9A 2RCNA 3VOAA 1DAFA 121PA 1PR3A 4PG5A 4XJVA 3SX0A 2X58A 5LVAA 3D6AA 4Q93A 4WOPA 2G80A 5DCUA 4C7XA 3W5BA 4L08A 3K5PA 2P3OA 2WU4A 3JZAA 1F1BA 3LIPA 4CCSA 5C5DA 4J49A 4EKDA 4A91A 5TEVA 3DTTA 3PQ8A 3QPUA 4RQUA 1RKUA 3R09A 4O4IF 4TLLB 2RGNC 3LG2A 3MB5A 4ZDIA 3OA2A 5T3UA 4QRDA 3MYRA 1XDZA 4G5SA 5JG7A 4EHBA 3IQHX 5E0OA 4QXPA 4RHXA 2I4LA 4ER5A 1K4KA 1Y6QA 1ZK4A 1F2VA 2OWDA 3CGWA 1I32A 1A5SB 1U2GC 3NM6B 2GRLA 2C29D 3PR1A 3PSAA 3U16A 2CNLA 3BGVA 2XCQA 1VKNA 2HT6A 4EY6A 3B5EA 3E8SA 2YL2A 5KWJA 3MLBA 2C04A 1Y98A 3LRTA 1KAEA 2PWZA 2PX6A 7MHTA 2OOSA 5CEEA 4E5DA 2B8JA 1JHMA 3ZXSA 4G0MA 1HYBA 1JG3A 2Q4RA 5CU7A 4YAKA 1MC5A 3NTXA 3REGA 3VR5D 2JLRA 2VZ9A 5AJHA 1Z5VA 2VYNA 5AM5A 2O59A 5CDUA 4ZHQB 4HDKA 2ECQA 4QRIA 3NYIA 1SZDA 3U5TA 5E38A 4R8RA 3CT6A 4QTZA 1ZH2A 3KHKA 1XZBA 2PA3A 2QIOA 2FMFA 2Q99A 4E5SA 3CONA 3OBIA 4EJSA 3W4IA 2YV4A 2UUPA 3D02A 4ADSG 3NPMA 1A9XB 3SQNA 3GMTA 4TGLA 5J4VA 3C3MA 4MV6A 4NR0A 1RJFA 4YMTA 2ZB2A 3BIFA 3SHQA 1Z74A 2ZJOA 3QUTA 3RC2A 2WW8A 3PUXA 5AICA 5EEHA 3JWGA 4Q9LA 2Q27A 3DKRA 3VR3D 4B8WA 2NQ2C 3RUDA 1QNLA 1QZ3A 2C3UA 3HXQA 5EZ6B 3RH0A 1IK4A 2YRFA 1N5JA 4EPTA 1NPTO 2Y9PB 2P6RA 4ATNA 1XCLA 5JXJA 2P9BA 3KUCA 1T1SA 1NI5A 3GGSA 4M36A 2NU8A 3LCUA 1NBMD 4LQCA 5SY4A 2OP0A 4O6VA 1VXRA 5ICFA 1GZHB 2BKVA 1L5VA 4OFXA 4TV8A 4M6WB 1I4WA 4P4LA 1SZCA 4US0R 5IJAA 3SM3A 3JYQA 2Y2UA 3RU2A 4TX1A 1HFJA 3FCSB 3DLAA 3TRFA 1DARA 1LA2A 1P9NA 1R9NA 1THZA 1YASA 2B7LA 1WY5A 2YV3A 3A3NA 3AUTA 4KL8S 1R0BA 4TTRA 1EUCB 3NVAA 1GITA 2B9VA 3BWDD 3EXEA 1VE6A 3OZUA 3VYRB 1NXSA 2UVPA 3G5AA 3ZWBA 1YBMA 2FPUA 4RTRA 1JJFA 2AN9A 3MJEA 4NU0A 3VXKA 3U09A 3IUMA 2H65A 4YV7A 2AH5A 1Z4PX 1C7JA 1W36B 5EKSA 4JYAB 2DKFA 1MOZA 5FD8A 3VO2A 2M1ZA 1Z39A 1I1OA 2R44A 3NDPA 4BJ5A 4BMCA 1FNDA 3GDOA 2V54A 4KK4A 2GUWA 4ML3A 1CQPA 2CL7X 2DSTA 1Y5LA 2VTEA 2D5BA 2DKNA 2WF9A 3LH5A 4TL9A 5IUKC 5DO9A 4ZEVA 5I9TA 4XPZA 5LMUB 4QPZA 4BCBA 4HWPA 4TPKA 2O48X 1Y7TA 3OTGA 1FLNA 3ZHIA 3WJ2A 4Y0VA 1KQGA 2RH9B 3O8OA 3QBVA 4KH0A 3WLHA 2W11A 2LCIA 4DM3A 1LK7A 4QSHA 1YC2A 2BFCA 2EAUA 2P8JA 1MOSA 3KK0A 1UMKA 4FZJA 1CIPA 1EFDN 1EVIA 3JQGB 4HBGA 1ISSA 1K8XB 5TVKA 3JQQA 1NUAA 3VVCA 4B9AA 1VG9B 2ZYWX 3GUZA 1CNMA 3EVCA 4EF6A 1U3FA 3KXAA 2I1VB 4OQNA 1U0NA 3RPEA 3CVUA 1P9OA 4PXAA 3UXYA 1CB0A 1NJGA 3KOMA 1PZNA 2J7WA 4LV8B 4BIIA 3QXSA 1WJGA 4BJ6A 3BEDA 4PZ9A 3VX4A 3GJZA 3WQQA 4KXVA 1R69A 1F3LA 3BWCA 3NV9A 4NZZA 1YQDA 2OG1A 3TOSA 3R3HA 2BGRA 4MYSA 3I4CA 1OH8A 3N9IA 4J1TC 4JUFA 1VRWA 2R25B 2Z98A 3HEBA 4UJ5A 3W5CA 1UZAA 1THTA 2WYOA 4HYTA 1QGUB 2F8LA 4W5QA 5IVKA 1O6GA 2EFYA 2JBAB 1IWPB 4ZI7F 1QR2A 1X1DA 1CQWA 1DEAA 3S2UA 1RE1A 2HJWA 5EIXA 2VHEA 5KYNA 3MLEA 1QFJA 3PLAE 1UWVA 1SBYA 2MMGA 1N7JA 2R8BA 3Q10A 1EUZA 3B89A 3GFBA 3UHOA 1AO3A 4Q4CA 3AR6A 4RE5A 1W0JA 3RU7A 4EFMA 2EYQA 1L5HB 2JLYA 1K0UA 5EA2A 1E1YA 1Z0SA 3H2SA 1DRWA 3LFTA 5DWVA 4IGFA 3GLTA 5I7EA 5JIBA 3MRTA 2K7FA 1MZVA 3TH5A 1U8AA 4TM8A 1A0OA 2OCYC 3M0EA 1JZQA 2F64A 1BE8A 1AM4D 1OTXA 1S4MA 3NGXA 4F4IA 4KE9A 1GIAA 4HAZA 1RWQA 5CHEA 3SYRA 3BRWD 4UUOA 1K9VF 3SCGA 3RIEA 3Q3IA 3V8BA 1N5MA 4F3RA 4G81A 4EG3A 5IHPA 2C0CA 2E55A 4K5QA 8MHTA 3YASA 3NHMA 3IP3A 4TTPA 5EWJB 3JD1A 2BFDB 2OBBA 1MQSA 2Q8QA 1G4HA 3ESQA 3KZMA 2OCGA 3OZXA 4OYLA 5E8JA 5E3HA 3JAMA 2E5LB 2HSZA 1W47A 4KQMA 4BLSA 1L3CA 5ITZB 4FMCF 5GP1A 3A1SA 2QI9C 2XT6A 1GZ7A 1JV2B 1M72A 4TLAA 2XGJA 4BJ1A 2GEJA 1PQPA 2BEWB 3P5BA 4PHGA 3KLOA 1Q0HA 4AKEA 4B48A 5AUOB 2QJTA 3OTWA 2GHQA 1OWOA 4HVCA 3VISA 1BRTA 1PQWA 1VFPA 2VYFA 4LSWA 4IHJB 4F45A 2W2KB 5JQGA 3HR8A 1XNJA 3S2SA 2OD7A 2ZWMA 3P2MA 3UPUA 4XIJA 5EHGA 1MT0A 2VAWA 4R6XA 1VGVA 3WJ7A 4BJHB 1ZC3A 3GLGE 3D54D 2G09A 3H2BA 4KBFA 2J33A 3FYUA 2YWRA 2IDMA 3F97A 3REQB 5DH9A 4G5OA 1MHPA 4IO1A 4XI9A 1JDSA 2OBXA 3W2IA 1Z37A 2RGYA 2FPIA 2YN4A 1GEGA 4XM2A 4KWIA 1SOAA 1U8UA 2WF8A 3Q5EA 2Z5LA 2O2XA 3RJ5A 4B3MB 4MI3A 2WF6A 3UJHA 2DM6A 1QFYA 2VKTA 3K6RA 3IR7A 4Y6SA 5EE5B 1SXPA 1MPXA 4KUHA 3OMWA 3EEOA 3RRFA 4C9BA 5HNKA 3JWPA 3Q8KA 2BELA 3F90A 3D6TB 4IZIA 1YB5A 1WUJS 4M4SA 3V1NA 1T4GA 2B7CA 2HDOA 3MJDA 1AB5A 3OPNA 3UOGA 3EUSA 1A8UA 4ZCIA 3OIVA 3AVYA 3KJFA 2OECA 1VJRA 4TKMA 2NAFA 4YIHA 3FYTA 5I7RA 4GM0A 2IGBA 3FPAA 1QTNA 1YACA 2FN7A 1NVVR 2VJNA 2PIJA 2YW9A 1M2GA 1N2CE 4RFVA 5E7MA 3V7FA 4JJ4A 1WX1A 2Q5JA 4ARVA 1N1DA 3DXYA 1PR1A 2VWHA 3PG5A 4IUCS 3A36A 3F1KA 1B42A 4JBIA 4C03A 1MC4A 1M5TA 3HYCA 4FI3F 3JTMA 2BR5A 2ZRMA 4EKGA 3NTRA 4IFBA 5CH3A 3LGAA 4TLCA 5AK0A 3ZKCA 4FU0A 4RTPA 1RACA 1NPDA 3N2IA 2V59A 1I13A 3PGXA 3T15A 3FSGD 3KXPA 4TT8A 1W4LA 5LOVA 2ZU6A 1JNXX 1SOUA 2C83A 3LQ4A 3BD9A 4XKJA 3C74A 3FGNA 1O94A 3TOCA 1C7RA 3TIIA 3WGYA 4COOA 4EYKA 3A6DA 1NGSA 2V0CA 4BPRA 3URKA 2PXKA 1K3TA 1N5DA 1VLHA 4HJXA 3TE7A 2F55A 4OJNA 2GF9A 2YH2A 4JK3A 4Z9AA 3QVVA 1JZSA 3V4LA 4ARIA 2MSNA 1GGFA 5REQB 1MA3A 1NE2A 2DPMA 4M2LA 1RPZA 1E9DA 5G0SA 2QYHA 4DQKA 1TEVA 4OQYA 1GKLA 5AQEA 3C7KA 4E5PA 4MQMA 4YK7A 3TR5A 3G5GA 1S9HA 4KXXA 3U7RA 2QRZA 3AF1A 3UATA 4J4BA 2OK7A 3RS5A 2R60A 1BNCA 4Q9IA 4EYQA 1GR1A 3G0HA 1XPRA 3RFXA 4GPTA 4KIUA 4DUGD 3TLAA 2EV9A 1U7WA 1CR4A 2Q21A 1XKTA 1RI3A 2ZBGA 3N39C 3N8DA 2IVBA 2EIHA 5B58T 3W34A 3T4EA 3U3RA 5C4MA 4CDMA 3D1JA 2WIFA 4YN3A 1S3GA 1QIGA 3PQ3A 4M1YA 3QHQA 1VDMA 4NOMA 4PIVA 4X94A 3EPLA 2G9ZA 3KE8A 2A2ZA 3T38A 3F51A 5DTMA 4IWYA 5HR5A 3QXCA 5GV7A 2JASA 2BAGA 2CJYA 2HINA 1UXOA 1MB0A 1SA0A 1R8SA 5A3VA 2BTQB 1OB2A 2Q49A 2XE7A 3RC3A 5DGHA 2ATXA 4DHEA 2FV8A 2BFFA 2H4FA 4W9NC 2A1IA 1QOQB 3HJRA 1I4OA 3QSYA 1DOAA 4E1BA 4JCCA 1R00A 4OGFA 2WP8J 1JHRA 4NDWA 2QY6A 3GMDA 1YSEA 4DA4A 4Z1MA 4E08A 1ABEA 3CJRA 1UJ2A 4PPQA 2ZXFA 3SC4A 4G1MB 1BX0A 1VG0B 1IHOA 4C78A 5LQMA 5TIIA 2XODA 3I2GA 4UULA 5FOUA 2Q7OE 4G5FA 5JT1A 4JB2A 3BTVA 3DV0B 1T15A 2GPBA 3F71A 1PNRA 3PE5A 3V4OA 1DUVG 1DHTA 2C4VA 3KT3A 1EVKA 2QTBA 4NABA 2DSNA 5HRAA 4A36A 5EHNA 4BLQA 4ENRA 2FFBA 3FFAA 2F43B 4H7KA 3IUYA 4P2GA 5EHIA 1XRQA 2WINI 3TPCA 2AOWA 2VJMA 3NHAA 1KDZA 3UWKA 3A6LA 4NYMQ 3H97A 3I9KA 3KB6A 1I4EB 4TN1A 3TVTA 3VDNB 3KOUA 3HLTA 4ENWA 5DU2A 1RAAA 5LLTA 4LFAB 5BWCA 3A26A 4FFBB 4QWWA 3ROXA 3RGGA 2GVDC 1GFWA 4K81B 4M1OA 1TM1E 3IAAA 1XLTC 3TSAA 5FAKA 3DHWC 3L0BA 3OT5A 4F6CA 2IPLA 2GX6A 4H7PA 3Q2KA 1RNLA 1VSBA 3TWOA 4EDHA 3WLNA 5K0LA 4MA5A 5ELXA 1K8ZB 3DEZA 3P7MA 3DVAA 1X8KA 3TZBA 3W8EA 1J6UA 2WT4A 1PFGA 2ZATA 3Q7RA 4WASA 3WGHA 2E4XA 2SKCA 1NV8A 1VKRA 2ZSFA 3QOWA 1JLRA 3KSZO 4GI7A 3QWIA 5KJEA 1DC8A 3CQ9A 1R4NA 5T5QA 1R15A 2OFOA 4W5WA 4XDHA 3ZIAD 5HGXA 2Q46A 3AP3A 4TMXA 1GT91 1W5TA 2FDXA 1NDHA 4TTJA 4YACA 5F7ZA 4ZVSA 3STHA 2NXNA 1MXFA 2PZLA 4AJIA 1ZMXA 3HKEA 3V4VB 3T7TA 1EZZA 1HLFA 4IUBS 3JARA 2YYSA 3EH1A 1XXHA 4B83A 1KP3A 4BVJA 1MVNA 4P36A 3BMXA 1T0HB 1V71A 1BEUB 1PWYE 3CRZA 1D4ZA 4FSHA 1XZFA 4XRGA 2B4AA 3ITNA 2E9SA 1IK6A 3DDOA 2BM8A 1CPYA 4G36A 5FBHA 1GR0A 5HVNA 4TT3D 3IFSA 4MJLA 3N28A 1O96B 2BR4A 3RAEC 2FYTA 3AUKA 3PBKA 3VFDA 3MMSA 1KMHB 2YIVX 1XWWA 4OUDA 2Z95A 4P92A 4LDAA 1WAMA 1JHAA 1UJ5A 1AN9A 4P7GA 4J9VA 1N2ZA 1NT2A 3PRYA 2XBUA 2ZIGA 3ITKA 1WB6A 3BYZA 1IPEA 4HN9A 4PLHA 4CM7A 4FGKA 1TU0A 4NENB 4LISA 1ESMA 4G5YA 1YQUA 1YJBA 3DVLA 4HHEA 3DCNA 3EK2A 4MWOA 4QYSA 3V1UA 5BWLA 4BCDA 1V37A 2I6QA 2MSCB 2PD4A 5IT0A 2FWMX 3HJFA 2BGGA 4EZIA 1BTOA 1GNVA 5J9FA 4GKBA 3OAAA 3KEFA 1ZK1A 3AONB 4D82A 4BB5A 1YQWA 1UMDA 3LWNA 3HGQA 3S5UA 3EZ9A 4F92B 2JI8A 3HDTA 1OROA 3QEMB 4US2R 3V9PA 4AG5A 2HPVA 5ELMA 3JAKB 5LYYA 4DWVA 1JU9A 1EWQA 3HYTA 3NWBA 4RVOA 2AA3A 2FE1A 1SCDA 1P7PA 3GJYA 4PNZA 2Y8EA 3GV0A 5FBZA 3WK9A 1IUOA 5AKZA 5I9LA 4KTTE 3F3MA 3TXXA 4EG0A 3KEQA 3I9V6 1VL2A 4GG1A 1SCBA 3I9V1 4DMUB 3OCWA 3FAZA 3JSXA 1U0OC 1YONA 2VDNB 4KLZA 3F5MA 2E4WA 1XI2A 5JU6A 1JHZA 2QRHA 2XD4A 2JFPA 4G6ZA 2A84A 1S0UA 1AY0A 1M33A 2FFAA 2JFGA 4MVCA 2HJSA 3WQBA 3UT0A 1GTSA 3OJEA 3W1VA 2QMEA 2YOGA 3HWX1 1Y6JA 4KW7A 4LF7B 2PXXA 4P31A 4PC2A 4MNTA 1JDBB 2ZEJA 4F1WA 1E1RD 3KB2A 3QFTA 5K03A 2BDUA 4LRSB 2YXBA 5FHRA 4YJFB 2DY0A 2X6RA 1B93A 3RT1A 1G16A 1GUAA 3BHNA 3EVZA 4QOHA 3CKMA 5KJ1A 4N0MA 4I0WB 4TN5A 3QFIA 1ESCA 3LDGA 5AKKA 1GUYA 2HPHA 3FUUA 3O38A 4KZPA 3ETNA 3KLMX 1MAAA 4X5OA 3UQYS 2VFAA 1WKVA 1UKCA 1WD5A 4OBMA 1F6WA 5EMKA 2OGUA 2W37A 1N0VC 5KNDD 4DWWA 5BWOA 1ORVA 1R1DA 4S0ZA 3GAAA 5FADA 5HKBA 2Y1LA 4HRAA 1QU3A 1V7QA 2QENA 2VDWB 3H17A 1DJNA 4BQOA 1EM8A 1TVCA 5GTDA 2WPDD 3WS7A 1NRWA 5KX5B 3OVMA 1UXJA 1XEWY 1R63A 1XCJA 1WWKA 3ES9A 1DP4A 3T7KA 3DKKA 1F0YA 2AWOA 2J5XA 1X7GA 5BR1A 1QPZA 4NS1A 3Q9LA 4P4TA 1GPLA 4O1MA 3KQQA 4AS2A 5C35A 1Z68A 2X2OA 3ZYZA 5TY0A 4TTVA 1OKKD 5B2ZA 2X2EA 1RKBA 1XMPA 3Q0TA 5DNEA 4DUZB 4I4TA 3JQ9C 1YQ9A 4MCAA 1QGZA 1TMGE 2QLBA 1K8RA 1DG9A 3RIMA 1Z82A 3A10A 3ZY4A 1QV6A 2HFZA 2PBRA 4ZZIA 3HS3A 1EZ4A 2ZR0A 5GV8A 3UBMA 3BDAA 1NF3A 3U1BA 2HMTA 4FVTA 4HGOA 4GP7A 5CJ2A 5C8XA 1RLTA 4A15A 3PGKA 1XZLA 2ZUWA 3FSGA 3OU2A 2RH4A 2YVLA 4YP5A 1LXCA 1MR3F 4D6XA 3BWXA 4RA6A 2AUWA 2DFPA 4EB8A 3K6KA 1D4FA 1E4VA 2BT4A 2VOEA 3C8DA 3MUEA 5HIKA 4FUTA 3ELBA 5EKXA 5JCPA 3HXKA 4JLKA 2EKZA 3HYSA 2IE0A 1EVYA 5B6JA 4XWYA 2RAFA 2QWXA 5LJLA 5LB4A 5B3JC 3WLRA 2AW3A 2I3ZA 1ECLA 2DWQA 3GC6A 4M9QA 1RIFA 1JB1A 3OLVA 4KLNA 1J8DA 3B82A 3LKZA 1BHJA 4GNKA 3VC3A 1ZBDA 5CNJA 1FBTA 2GCIA 1M0EA 3CH7A 1RM0A 3C97A 3G13A 4AMZA 3IIKA 5EINA 3Q2OA 4RJIA 4OO3A 3DLCA 4BVBA 1PFKA 1MO3A 1KHHA 3BXPA 2O4UX 5LOVB 4ZI5A 1G8JA 5LQRA 2YXNA 3OFVA 3P0IA 4OHOA 1YKFA 1ZUHA 4Q1EA 3T0IA 1IBLB 2WTMA 2RC5A 1TM3E 1CR0A 1RWBA 1SXJB 3F46A 4ZVLA 3LY5A 3V8QA 4B3SB 1AURA 1SB8A 3GUVA 3RU9A 4BO0A 4Y3UA 4C4YA 4MR7B 3W79A 1AU9A 5TGTA 4ZP1A 4TZTA 4MVJI 2BWJA 3BD6A 4OX9B 4UM7A 3T4UA 1J5XA 2H0AA 1KJ8A 1FNSA 2FJPA 1DO8A 4GDMA 5HP4A 1Y5MA 3N6XA 2IEAA 1V9CA 2WUGA 3E84A 3OE5A 3EVTA 4PFKA 4UQPA 1GGJA 3T0GA 2G83A 4BVKA 5I5EA 4E09A 3MC1A 2DFKB 2NO5A 2RK4A 3U39A 3SDBA 1R6DA 3VBEA 2AD1A 5CG1A 4LBWA 4MZDA 3VZDA 4TYYA 1P44A 5FI5A 1UMBA 5ADHA 2PVCA 2H85A 3SJ7A 5ED4A 2NZ2A 5HKLA 1WSAA 3FMOB 3RYTC 2XCIA 2Q9UA 1NSTA 2C4TA 2IPMA 4KQ6A 1G0NA 2Y4NA 2BPOA 4RZXA 3VNAA 4CZ2A 2WUVA 2OO3A 3MSXA 4G8DA 3DDZX 2AFHA 1UTXA 2MJLA 3PHCA 2WE7A 4ND8A 3O75A 4PZDA 1QAMA 2FGJA 4K9SA 4PYKA 4AJKA 3JARB 5BSKA 2SBTA 3VHXA 1XE3A 4FYMA 2XWSA 4YG7B 4N3GA 5LFAA 4MRNA 5EIHA 2D3TA 3G1WA 1P3Y1 2ORVA 5KQRA 2XTAA 3SSMA 2DBVO 4KX3A 3T3PB 3GNQA 5D84A 1U3VA 4XGNA 5K8JB 1WMDA 1MN6A 4M9RA 2IV3A 3WDLA 3ZCXA 1JHXA 4ARZB 4YMHA 1H2YA 2W98A 1DCKA 4NMWA 4QYXA 5HCIA 2HB6A 1YBAA 2CEAA 5FWYB 3ZGZA 5LQKA 1P5ZB 1O5IA 2QF7A 3D8UA 4H1TA 3WAGA 4EJ2A 2QK4A 3DLPX 4URWR 1YO6A 1TZBA 2OQ2A 3F6PA 5CM9C 2OYSA 5FL3A 4EVRA 1P1FA 4ZYUA 3I9NA 1N2BA 1T2UA 4LSGA 4PU0A 3FVVA 3BDIA 4MWSA 2GJAA 3GLFE 2R66A 3NBMA 1CE8A 1H9BA 2BCGY 3JQ6A 4H6PA 1FDUA 4BQQA 5CVUA 1C29B 2AXPA 3DAGA 2QVGA 3RVBA 5HQ3A 4C7VA 2HM7A 4K3UA 4AROA 2C9MA 4HATA 4RPKA 3M1IA 1H5NA 2O8VA 4B2LA 2XNDD 1XDWA 5ELLA 2HTFA 4D9KA 1CDDA 4KO2S 4IJWA 4CKBA 1U2TA 3X0DA 1AK2A 4NAHA 1EEXB 1XQVA 2J6HA 4IYRA 5DOVA 3UMGA 1AKUA 1XNHA 2VBGA 3FUVA 4HSEA 4GI2A 4J0GA 3LS2A 1USVA 4MWGA 3T9DA 3UK0A 4C7OB 1U5AA 2OPHA 1IXZA 3ZXXA 3JCZA 4XD2A 4YFVA 5EIBD 2G9NA 1RHJA 4BAUA 3BHIA 4MQ4A 3Q11A 4I5DA 1DVRA 2QW1A 4OQEA 3MTQA 1YFZA 1HXHA 4GSLA 2IH5A 1I0LA 1GGVA 1VG1A 3EARA 2YFYA 2YFKA 3DOEA 5LBIA 3QOXA 4H0FA 4EY3A 3I2YX 1N6RA 1XFDA 3IQFA 4CF4A 1FDVA 3RVJA 4DC9A 4A8TA 1RSZA 3R7NA 5JDCA 1HEUA 1FMLA 4WXPA 5F9HA 1ZY2A 1UK6A 4HQLA 1RZRA 1DCFA 1ICIA 5EJMA 5KQPA 5GVSA 4CEJB 3F98A 1CJTC 3ZR4B 4AG6A 3K9LA 4RQAA 2BZSA 5DEIA 4WZBE 2B3TA 5EQTA 4A1FA 1ZK0A 4CMEA 2M4HA 5LCXA 3FDFA 3IJEB 4B7AA 2REOA 1WUYA 1TQ8A 2F3TA 4YYZA 1IN1A 1VLZA 4HAYA 3PB3A 4J0HA 2OYCA 4WZBB 4CEIB 3BJEA 1T9HA 1Y5NA 1N0UA 1OILA 3L7IA 1YR1A 4QDUA 5CNKA 5CB8A 2WABA 4HP8A 1XMSA 4QFCA 4C6RA 2GCPA 3PFIA 1QU2A 1JSXA 2LTAA 1CR1A 3SICE 2XMDA 4BAZA 5CLLA 4YALA 4L8WB 5AJZA 4DMGA 4J1XA 1T3LA 2B99A 2E7ZA 1MENA 1PG5A 1PJSA 2J9FA 3GRPA 4KQHA 4O4LF 4OQXA 3CUEF 3SJUA 1U0JA 4CM8A 2I4NA 3TXYA 5LQJA 5JZOA 5EE9A 1HFEL 4EY5A 3D7NA 1GPMA 2R85A 1JDZA 4HRVA 3ZS8A 4YFYA 5TE9A 2FWBA 4HDCA 5B7PA 1H9CA 4BV9A 4YRKA 1BKSB 2FPGB 1N3BA 1U7UA 4MH0R 4DEVA 4I1SA 2H1OA 4ARCA 3OOEA 4HWTA 4IGEA 4DG5A 3B12A 3NEPX 4J8PA 1H2ZA 4OFZA 2IZ6A 1A9ZA 3FKQA 1FFYA 4PBSA 3O26A 3E1SA 3P5SA 4ZYYA 3FPKA 3I12A 2TMDA 1OI4A 5IVIA 4WOCA 1ZGHA 2J87A 1TCUA 2PSEA 1L1RA 3BRWA 4N1AA 2L19A 3TM4A 1GAEO 1F17A 4JJAA 2D2FA 1QM5A 2ST1A 3DUFA 1JGTA 1U9IC 3C1AA 5HJ7A 3BREA 3DA8A 3TGWA 1IY2A 1DQPA 1VCNA 1NM5C 4LZNA 2JFBA 4RAOA 1QHEA 2B94A 2ZRAA 1OGIA 2R3SA 4C0QC 4JGIA 1URPA 3MJSA 4AUNA 4PW0A 4UHCA 3UYKA 3FMFA 4U6SA 3QLUC 1W4CA 4AMYA 4LHWA 5IBRA 1Z4OA 4BU0A 4YMUA 4C0JA 1XSEA 2X0RA 4FK8A 3PNLA 5CA1A 4YCJA 3RSQA 2EATA 1GPBA 4X7RA 2D00A 2GRAA 3ODPA 4ETMA 5ALYA 3NWJA 3TL2A 2WYIA 2Y05A 3VZSA 4EW1A 5IZCC 1NWHA 1Z4JA 1H4QA 4JI4B 4JYBA 3SKVA 2O49A 3IEKA 2G4CA 4RM2A 4XQCA 1Q0RA 1XXLA 4KNVA 1JFLA 4G4IA 1PTJA 4H7EA 1XT6A 3V1KA 2ZBRA 3KWMA 5ES3A 5I3CA 1BFDA 4CN9A 3IUQA 4UEKA 2VJYA 4UTNA 1GZVA 1KAOA 3ELDA 5IK2A 5GINE 1TFRA 4FNGA 3D6HA 1JIQA 3S8MA 1G4AE 2FEWB 13PKA 1SC9A 2H4ZA 2RC6A 2JARA 3IE0A 4ZT5A 5KVQA 3SX2A 4DRYA 2JCXA 3HHEA 2ZJAA 5FLYA 4N41A 1NMXA 1QTIA 4J3FA 3COWA 2H06A 1I6KA 1IRXA 1Z18A 2PD6A 8ABPA 1V4VA 3ANLA 5ITWA 4RZHA 3E9EA 3ZVMA 1V6AA 1M6VB 3FOAA 1RKQA 4GPEA 4JLPA 1TAGA 2C9CA 3B36A 1D04A 3GEHA 4RFSB 5AKIA 2GK3A 2C5EA 3CN9A 3ZHOA 4TMVA 3WZLA 1STOA 5CITA 1GEEA 3VBCA 4J2OA 2AFIE 1YTLA 1YFJA 1VJCA 4GOJA 2J59A 2O52A 4RMNA 6REQA 3ILHA 2W7TA 4PZAA 4XVHA 4OKSA 1Z83A 2UYYA 1AO0A 3U48A 4ND6A 2IUTA 3DVRX 2RBEA 4G0QA 3NKLA 1ITZA 1MX5A 1R5BA 2BEVB 2HJRA 2W6ID 2YVQA 3EGOA 3IHTA 4KIGA 3TLYA 3PXGA 3W5IA 4D80A 4AKHA 6GPBA 1KYTA 3GIDA 2HMYB 1A8HA 4Y6PA 2UYGA 4UEOA 4FFLA 5LZ9A 2OZPA 2C8KA 2G1JA 1G291 5AK4A 2B5WA 1D03A 4P83A 3D8NA 1W48A 3H1FA 5JHGB 3TB4A 5CYGA 1CY8A 1I3NA 2WTAA 4NJEA 1UCFA 2FWJA 3KHSA 3R23A 2I3GA 2N47A 1CDOA 2V5UA 5KDLA 1AB6A 1WCWA 3MK31 4HFJA 4DMMA 1QJ4A 5KDDA 4DQUA 2IS4A 3D4LA 4W7SA 4MICA 3BRQA 4ZPJA 2H6EA 4IH1A 1OX4B 4Y6RA 3DZJA 4EYOA 5JQWA 3THWA 5AVWA 1T9AA 4ND3A 5JFGA 1UADA 1ZH4A 3G0OA 3O95A 2LIVA 3I30X 4UBLA 4NDNE 3ZW9A 1ADRA 2W6PA 2Y0DA 3O8CA 1NV9A 2LNMA 3AI3A 4W9RA 5T4HA 1YZ3A 3LDUA 3NFYA 1V39A 4JBNA 3TLCA 1VB3A 3R3SA 3EQ6A 4LWPA 4PWZA 2HAEA 3CF4G 2XY4A 3T1QA 4KN6A 2ZM5A 4LFBB 4Q4HB 2XUKA 3KKKA 4IIFA 1OV4A 4XWAA 2PRJA 5IBQA 3FCEA 5KQMA 3PUZA 4Q34A 3V2GA 1EX7A 1PD0A 1J0DA 3MOIA 1M1NB 4QX6A 4EF5A 1TVMA 2I2FA 4WERA 2J85A 1DXQA 2FQXA 1NNI1 3QVOA 3FNIA 2C82A 4RJJA 2PWAA 5JH7B 1U1EA 3OECA 2JGRA 1WMAA 5HTOA 1LI7A 1RYBA 3A3PA 5T7BA 1FU8A 1FLDA 1XZIA 3JQCA 1A9SA 4FDTA 3HUEA 1EVJA 1FSGA 4HC4A 4CMHA 3M3DA 4F3CA 3H13A 1E3DA 3EB9A 1QV9A 1SVNA 2ZCUA 3E2PA 1T13A 3CR7A 3HFSA 4Y2TA 4AG3A 3EBLA 1JJIA 1RBYA 3LPLA 4K87A 4CNQA 1LY1A 2F3PA 4YO7A 3M9WA 3PDIA 3RAPR 2XCSB 1QO0D 2C61A 3AOEC 4UHJA 1O94C 1M2WA 4QDTA 2QQEA 4G9GA 1ARZA 2N1BA 3E4CA 2YVUA 5AVJA 3S68A 3VDQA 1PWZA 3VU1A 3WYNA 2CT8A 1WZ2A 1UZMA 3B1XA 3THXA 5AXCA 1G2PA 3URMA 4ER7A 1N5OX 1Z0UA 1FX0A 3A6ZA 1OJ7A 3D81A 3K15A 4JJ8A 2W6MA 2PXDA 1N7IA 1Q19A 5FWXB 5IULC 1H6CA 4K28A 3GLGB 2OV3A 3Q4GA 4GYKA 1J5EB 5IDVA 1DPFA 1Q77A 1TZ2A 5FLEX 3AFIA 5E6RB 4CM9A 3AOGA 3R7WA 1Q91A 1P31A 1WXXA 1N2XA 2R1TB 3C4QA 3CLTD 1QH1A 4XR4A 5ALEA 3X1XA 1GFZA 4KLAA 5THKA 1KETA 4NBSA 2B1IA 4A27A 4QJIA 3BX1A 2D62A 2J5KA 1A7JA 4P3KA 2C3YA 1VBKA 2OA0A 4Z54A 3B3GA 4OXYA 1TO2E 2O2YA 4YWHA 3PSHA 4RDCA 3S1LA 1YJAA 1ZN7A 1YXMA 3HNPA 4IXWA 4G25A 4Y9DA 2Q5FA 2BFNA 4Z9FA 3EZ2A 3UAZA 1M5RA 3DW1X 3MCZA 4NH4A 2F90A 3C6MA 3AHIA 3D1LA 3WL3A 4K0RA 5IW8A 1YZUA 3PGVA 2XWBF 1IVNA 3DLIA 3FB1A 4WLVA 1BWQA 3G85A 3M8KA 4TKZA 3R4CA 5FOSA 4XVRA 5F4BA 1Q44A 4J0QA 2ZRCA 2VEOA 3MA0A 1BKYA 4QC2A 5KOIA 1F8FA 3FDJA 4HKTA 5EUQB 1LLUA 1PNVA 1Z0ZA 3MPUA 2R4TA 2WAAA 4RXMA 3OMLA 2NU7B 5JHHB 2FW6A 2VQ3A 1VG8A 2ZRHA 1Q0ZA 2FP4A 5BYBA 5KYUA 4QNRA 1C8LA 3HCFA 2NLOA 3G8BA 4HQKA 2QPLA 1Z4NA 1G8AA 5GOZA 4BUCA 4OSOA 1RYHA 5M5BA 3QXGA 4JOCA 1VSVA 2ZRQA 4JB3A 1LBEA 3QF7A 3UAWA 1KMNA 2IXFA 3IKMB 2IPXA 1S3IA 4YDSA 5J1SB 4DWJA 4ID3A 1BWSA 1UBHS 1TD9A 1E2DA 3PRKE 3PXDA 4FCCA 4BNGA 2I6XA 3EMKA 2DCMA 4KFUA 5FOTA 2XITA 1Z56C 1WQ4A 1IONA 6ADHA 1PS9A 4TXJA 4CM4A 1LX6A 1UFQA 3BIJA 3ORFA 4IAOA 5LZ4A 2R5NA 2A1UA 4D4IA 3AHGA 2G5CA 3KV3O 3TTWA 2P2LA 4WESA 1VKHA 4FYYA 3QVGA 1M34B 1T5DX 1L5KA 1RQRA 2Y66A 1TF5A 3F5QA 3GPCA 4E15A 4KSBA 4QBGB 3EBPA 3KQNA 3GN2A 3OQIA 4OHYA 3NIDB 4TS4A 4WD3A 3OJ0A 5IF9A 1MH9A 3B38A 4Q4JB 1W5EA 5D86A 2IVZA 1H9AA 4PGFA 1T6BY 3M5CA 3UG7A 4JASB 2I4IA 3JY6A 3R5HA 3W2EA 3VDMA 1UBSB 4MDHA 1FLVA 4BB6A 2XHEA 4BX3A 621PA 3EY4A 1YVDA 3C6BA 5KTPA 2ISCA 1MJ5A 2YY5A 3G8DA 1QGDA 1B8OA 2AQ8A 1JTVA 2Q3JA 1U3WA 3SBXA 3WK4A 1C0KA 4A6XA 4C4OA 4DCCA 3GNLA 4DRZA 4BATA 1BQEA 1YIOA 3AI7A 4L16A 4F46A 3V4ZA 4WESB 1NQTA 5AVRA 1QF7A 2OKCA 4UHDA 3DF9A 2Q9CA 1Y3IA 1ZNYA 2QN1A 2Z04A 5H68A 1G1MA 1M1YB 3CNHA 5DYWA 3UPDA 3GVHA 4JL8A 4LIPD 3WZMA 5LZ2A 1EXWA 2QVCA 2AK3A 3HB0A 3OX2A 4FBMA 3JYLA 2GEFA 4XUGB 5FR1A 3UV3A 4E5UA 2A7XA 1W0JD 3PUKA 4X8HA 3TTXA 2KQUA 2XMSA 5HIIA 3QLVC 4GPZA 4DBVO 5IHXA 1DBVO 2NGRA 5FTKA 4U2BA 1V0JA 1U28C 3SFTA 5IDQA 2GXUA 4I14A 4C07A 3SYTA 1MJNA 2J67A 4QXRA 1ZJWA 5ITSA 1Z4QA 2B1JA 1SC6A 3OAAD 2M6SA 2PEZA 1FTGA 4B46A 3HUTA 4MIOA 2AKYA 4IQFA 4L75A 4HK4A 4W5HA 5LSAA 4Q9HA 3DDCA 1JPJA 1LMB3 3HVKA 3WSTA 3M70A 3H5WA 1VKZA 3NKVA 4AZ3B 5ARDA 3M4JA 1T1JA 5DMHA 2EZTA 3ER8A 3NFRA 2XSDC 2X77A 3KX2A 1DQRA 1H2WA 2I3DA 3S3TA 4COKA 4DJAA 5KTTA 4RMJA 3JQBC 5H82A 4KOEC 1V5IA 2K6GA 1LGYA 1Y7YA 1A8SA 1P4HA 2PMDA 3DDNA 4Q05A 4M99A 4QPJC 2F17A 2X1MA 4F71A 1HYEA 5AKHA 2OV1A 2XIJA 3BK7A 3SOPA 2OHGA 3PXPA 1Q6ZA 5I4IA 2XYHA 3AESB 3OZ7A 4FR0A 3OJOA 4JXKA 2WJIA 3HL0A 4G8JA 3SMQA 4JCXA 1B1AA 2EJBA 2ZBVA 2D0OB 4G85A 2QIPA 4K9QA 4LGCA 4YJHA 5A4DA 2GN0A 4CF3A 3PS9A 2R97A 2VDKB 1BKDR 4HRXA 2DMRA 2ODAA 2ZYVX 4PPYA 1GWNA 2O1XA 2IVQA 3IULA 3NB0A 2WYVA 1VSTA 2JI4A 3PXCX 4H08A 1N6HA 5DYNA 2Y1WA 1R74A 4K1LA 1EK1A 1U3DA 2ORED 3JX9A 4PPGA 1M2NA 3VKHA 1OXBB 5HFJA 3VZRA 1UMCA 3C45A 1UIMA 1JI0A 1GY8A 2OFYA 1BVYF 2OBNA 4EW3A 4F4UA 5EGNA 4EO9A 1E98A 2BD0A 1ZXBA 4MIKA 4EELA 1F2TB 5HUHA 1Y89A 3PQ6A 2P2ZA 3TNJA 1QG4A 3MJFA 2CVFA 4MYDA 5CB4B 2ZUVA 4O02B 1HF0A 1LCDA 2OVFA 1DRVA 4RDIA 2EFEB 3QHPA 5E2IA 1Z15A 3MTDA 3LUHA 3ZHMA 1A9YA 1G5RA 3FXAA 3RS7A 3ZU2A 3DV0A 1NQWA 1MJHA 2KBFA 1LI4A 4IGAA 4Q7KA 5DBOA 3BA6A 1DG3A 2I8CA 2HNBA 2V8BA 4D57A 4D56A 1MV5A 3D1VA 5L53A 1WVGA 1WMBA 1YOVA 1XP5A 3KOYA 4S1OA 2BKEA 4TLBA 3HNOA 1Q0TA 3AL3A 4X4HA 3GLIB 1ZRNA 3A1DA 2IOFK 3Q0EA 2QU8A 2AR7A 4UBKA 1AZSC 1UXHA 1TF7A 2QUHA 4BFCA 3F73A 1QKIA 1NNEA 4D6PA 4XYBA 4R4JA 1YH3A 4ID9A 4LC9A 2H31A 3CSDA 2YQZA 2CCGA 2RB4A 4UNSA 4X1IA 4BFYA 1T5LA 4R3WA 1M2VA 3WV5A 4MLZA 1JKIA 3TMYA 2JG3A 2C59A 5A7FA 4RVCA 5DHFA 1AHNA 3BTUA 3FF1A 1CF4A 2QLJA 2BFPA 3JRWA 1AA9A 1R5NA 3CZCA 4DSOA 3RF6A 3ZDAA 3K9NA 4WADA 5CLJA 1PEAA 1ZBQA 3EAFA 2D4AA 2JFNA 4WINA 5BNFA 1VPWA 1HTBA 1XDUA 3P9IA 3G1TA 2O7SA 1FQJA 2CDNA 1XHLA 2NO6A 2V9CA 1YL5A 3KR2A 2HHJA 4Q2JA 3OESA 4LRQA 1NLUA 4IWRA 5A4FS 4ZU6X 5GONA 4DRXB 2KPJA 1VMKA 2Q0HA 1ZLXA 3KXKA 2XOKD 3NEYA 4KOAA 4WY2A 2VRBA 3FG9A 2B4QA 3CEJA 4KWTA 1CIJA 3PX2A 4REMA 4X93A 1TIBA 4CV3A 1Y82A 4V03A 5L3QB 2BFAA 1YB7A 3DMGA 3G23A 3ZTTA 1SHJA 3IRUA 4MW2A 2V0NA 4FOLA 5KWEA 5FPPA 5EKUA 3L1HA 3NTOA 4DUGA 4RSGA 1NQVA 4WI1A 1YS4A 3FPLA 3NHUA 1JXOA 3LZDA 1GFIA 3W8FA 3H1EA 5DW3A 5BR8B 5BQOA 1A82A 5C5EA 4JJZA 4MS4B 1QAOA 1K7FB 1KL7A 2H9IA 2O50A 4QATA 2QAGB 2YY6A 4GQAA 4QGGA 4UU1A 4F5YA 4A73A 3DVSX 3MPOA 1JVSA 2AXNA 3WJ1A 3KSMA 3QVGB 1ZO8A 1H2EA 1MMFB 3R6DA 4LQ4A 1RRVA 4OK5A 3OE7A 2A1UB 3K2IA 4CR6A 1ZJZA 1ONOA 4MR8B 4B6OA 2BZ0A 5DWQA 4B40A 1IZ9A 2G0NA 1U6IA 2Q4BA 1Q0UA 3C8MA 4IDHA 3RF7A 4EIWA 1N36B 3ZXUB 1X19A 3PDCA 1T3ZA 3IA7A 1OBHA 2QMQA 5AJXA 1K08A 1XMQB 1PFVA 4DMFA 1QVWA 2DJIA 4KRXA 3AF6A 3EZXA 1BJTA 1JLHA 1X1TA 3K1JA 2EARA 1VL0A 1U3GA 1T9CA 4W82A 1J2YA 1XEAA 2JW5A 4JZYA 1OCTC 4NDZA 3LL4A 4HNQA 4RH0A 2B7BA 1N5KA 5E7IA 4DR6B 3RVKA 5AQ1A 3HTXA 2O06A 2PFGA 2PRZA 4KXLA 4AQDA 3C5CA 4R7TA 3IXMA 1E32A 2NVOA 1DKUA 2QRVB 3KVVA 3AZOA 4RY8A 4F7DA 5IX8A 3HV0A 2V5AA 3OJWA 1BH6A 2FCAA 2XA2A 2DUMA 1DFIA 4POAA 4QHSA 3T3MB 1GPUA 2WJ6A 1JH8A 4OK6A 2AZTA 4U7TB 1GNRA 2O3JA 2OD2A 3D3JA 4GZ5A 1XEFA 2V97A 3PXBA 2OUIA 5AI4A 1HOXA 5TV2A 2JB9A 2GJ9A 1ZMOA 3E3MA 3N5KA 4RD1A 4BMOB 4Y42A 1AKRA 4NCNA 2Q6LA 1HDOA 5ENVA 4Q0MA 4B6RA 2A0XA 4ZAVA 1NVUQ 4KXNA 5IKEA 3K53A 5L7TA 2PN1A 2Q1SA 1IPHA 3SVLA 3KV1A 1W19A 4GL2A 3WK8A 2XIUA 1EINA 2OVBA 3BGWA 2K2QB 3R3JA 1XO1A 1BHQ1 3W5HA 3N2GA 4LX8A 4TMTA 1OLOA 4O4HF 5P8WA 2WSYB 1IBRA 1XVAA 4IJQA 1TA9A 2D2IA 4L74A 1F2UB 1OPRA 1BE1A 4OEHA 4H1UA 2CMKA 5LQCA 2EGGA 1NMSA 3NW9A 3E48A 3FCOA 3NXKA 5JI2E 2QW0X 4CV0A 4H77A 4Z4QA 2JFFA 1DWQA 1H2HA 4X61A 1QIHA 3OQPA 4ZO6A 4D4MA 4O08A 3L1VA 1Y7PA 1Y8QB 3ZWDA 3NCHA 3QEAZ 2PD3A 1IIBA 3B3FA 5EXPA 1ZUNA 5FULA 3VJMA 4G0ZA 3IPYA 2ZWVA 5JXHA 2QYTA 1OTHA 4DYHA 2GLXA 2PJDA 4AVYA 3VPSA 3LNTA 3OLZA 1XNGA 4DC0A 4YRMA 1K7XB 3AY7A 1LDYA 1SUSA 1G8YA 4UXIA 3UN1A 2D1QA 3V3KA 4JR0A 4F4JA 3OUUA 2XMQA 2GRUA 1SBTA 1MNAA 1UXIA 2OGSA 4PANA 3CWZA 3FZEA 4JODA 4L4XA 3DYVA 2R1VA 1D2MA 1WPGA 3V42A 4J07A 2PXLA 4MGKR 2QUAA 2AXQA 3U3MA 2EX4A 1QB2A 2MR6A 2QMOA 4S2UA 4D42A 1G59A 3ESDA 5ES4B 4WZAB 4WCVA 3JD4A 3R0XA 5FYDA 3R3YA 3W7VA 3VYTB 5JSHA 3GBFA 4B31A 2C4HA 1M6HA 4J1QA 3MWDA 1N6IA 1GKYA 2NYVA 3I83A 5JCJA 5DN9A 3FDZB 2I3BA 3GYGA 2J7KA 2ZDGA 4MCIA 1QP4A 8GPBA 1AS2A 1EJBA 4UXJA 1EX9A 3ZZMA 2WP0A 4ALJA 1KO8A 4DILA 3NTQA 3DTVA 3L6CA 2WD8A 3T34A 1QHHA 1OW3B 1D4OA 4E11A 5JCOA 4DV7B 1N9ZA 2LPMA 3CWQA 3CLUC 4JVLA 3TZKA 2I67A 3COPA 4J0CA 5J2TF 1EESA 4YR9A 5B7NA 2VSOA 4ZT3A 1K86A 1DBRA 3TNLA 1D4AA 2I6TA 2ZJ5A 1DL5A 3G0BA 4JX9A 2RJ3A 1A71A 4BLVA 2OXRA 3CVOA 3H1GA 3DMNA 4IIJA 1MC1A 1IULA 4L6CA 4V24A 4BNTA 4DV5B 1H2AS 2DBYA 4X8MA 3WADA 3EZGA 1A8PA 3H8JA 3MS2A 4WL0A 5ILQA 5K01A 3OETA 1PCXA 2ZS7A 4YAEA 1W2GA 4Z0TA 4X84A 5EUBA 3WMFA 2B5AA 5IS2A 1ZNXA 1I9CA 5KB3A 1JUDA 3WMEA 4ZTZB 4KHZA 4XIFA 3ZGXA 1PF7E 4L8LA 4YIKA 4HEQA 3H7IA 4GX5A 4IS2A 3ZK7A 3TCNA 1VJDA 1HDYA 4YJ3A 1TEXA 5A1TA 2YXEA 1OX6A 3IQGX 4FZ5A 2XZLA 1HT1E 2C31A 2XUZA 3HRKA 1L8AA 2OLKA 1I6MA 4INPA 4V38A 1E1QD 3H65A 3PGLA 3QOYA 3FFTA 4HWSA 5CPBA 5BRJA 3GA7A 3HLKA 9LDTA 4X4BA 1UK9A 2PKRA 3HPRA 5IWAB 2N9UA 2XXPA 4WFJA 3E9DA 1WP9A 3DMTA 1YR8A 1R64A 2PIAA 1A5AB 4GX0A 5JS6A 4JLJA 3DMRA 1JECA 4UAUA 3QFCA 4X85A 2ODQA 2DXIA 1W30A 1QG6A 1DEKA 1Z0AA 2PZEA 2XXJA 4DIUA 4ALKA 4O2BF 3H99A 1QSGA 2LYSA 1BSVA 3WGUA 1QK5A 3AEUB 3TF5A 3FHTA 2GBPA 1OXUA 2IKSA 3QY0A 1VJGA 5ALLA 3ZD6A 4UM5A 5JWRA 1VYTA 1CW2B 2X76A 3GFVA 3RKSA 1Z8FA 4MKRA 2HMSA 1TECE 3QE0A 5BQ5A 4CMIB 4MDEA 4YJKA 5DLYA 4U2FA 3UW3A 3GDWA 3WGTA 3IV9A 3TRKA 4EMBA 5EHZA 5ICGA 4M22A 4OD0A 3CZ9A 3F7TA 3LCVB 1A8IA 4DPLA 3TBKA 3IT3A 4M86A 2PFKA 3PC6A 2QL9A 3ASZA 4JLSA 4S1PA 1OI7A 3DWIA 1VMIA 3TX6A 3UGQA 4BX0A 1O95C 4AAYA 4BNKA 4HUJA 4P4UA 1IMOA 3TPFA 4Z7QB 5IZ4A 1MORA 2VS1A 1B0NA 2WVJA 4TWBA 1FPQA 3AM5A 4G01B 5KHAA 3C48A 2NNLD 4OSPA 2YWEA 2XJ3A 1T4MA 4I1VA 2A3NA 3X1ZA 3LSTA 4EFKA 4MSUA 4F84A 3H3FA 3IIJA 4D3FA 2WB4A 3WLMA 2FFRA 2RGXA 1I2MA 3K16A 4IL5A 2ZB8A 4Z9BA 4E31A 1GZ6A 2BHTA 3EZ6A 1NJ8A 1KK1A 1K88A 1UPUA 3ED5A 4NEQA 1SCUA 4ZEWA 2C94A 4B45A 4Q4AB 2KHZA 1JVNA 5G53C 5JROA 3U4QA 2YYAA 3A3OA 4Z4EA 5MGBA 5ALQA 4OBWA 3BF7A 1WZNA 3TS1A 3UPTA 1WKCA 4OI4A 1H1TA 5U1PA 1H69A 3ND8A 1P4AA 3BXFA 3MTEA 2IHBA 4NK4A 1NNUA 5K3FB 2Q1WA 4NONA 1I7DA 2M9MA 3ORSA 3KT8A 4C5AA 1JEQA 3OJXA 5J2UB 4GHJA 2IX9A 2FPSA 1CQIB 5KSPA 1SXJC 4DIOA 1XAHA 1EGAA 2M32A 3HU2A 4EPXA 2O5RA 5JWOA 1YRAA 2CL6X 4ABTA 4H7JA 1Z8DA 2ZKLA 4X7PA 5TSDA 3I0MA 1JPNA 1G5PA 3R5KA 2MQKA 3FRJA 1LLQA 1QE3A 4I08A 3STXA 1M2KA 5TS2A 5ICMA 3SF8B 3IAM6 3CZPA 1M2OA 3OKPA 1JR3E 4WKBA 4X6LA 4ZDWA 4YCBA 5SY9A 4JV5B 3QX3A 5EUMA 3T5MA 2FPPA 4IJVA 4KODA 4OXQA 4QD3A 1L0BA 1MG0A 2GARA 4PN7A 2JGKA 3GFTA 5F3DA 1B6SA 3P0JA 1BRMA 4N5IX 1FFCA 3EZYA 4IHJF 2G17A 4MRAA 4IDCA 1NERA 5FEUA 2WY2D 3V8PA 1WDTA 3QBDA 4RKFA 1QP0A 3BMCB 2WBLC 4P4GA 2QX9A 1ETUA 2IY8A 4B6EA 4KPEC 3ISTA 2CFSA 3HJTA 1A9OA 1CR6A 3MBOA 1OCEA 2PH7A 4WZBA 5TMDA 1M2EA 3C1TA 4M49A 3CEHA 3DE3X 4XLTA 1I2DA 3C3PA 4MHTA 2IV1A 3AKZA 1R9JA 3H84A 3CY6A 4WXYB 4ALNA 4R8MA 5CYOA 3I5YA 2X5OA 5BSVA 3OE7D 3MJCA 5CVDA 4MRSA 2P68A 1W4AA 1U0GA 3JWEA 4TROA 2IHZA 3LLUA 4PLVA 5DTJA 4BO5A 1AXGA 5JEDA 3LHSA 1CJMA 1N0IA 4JN6B 5IN4A 1NUSA 3B1FA 2ZSHA 1EM8B 1WXHA 1KI6B 2PZ8A 4TUYF 4YG4A 1V95A 4PSUA 1T2EA 2OAP1 3EEYA 4NOLA 5HDBB 1Z0FA 5LD2B 4LV5B 3CNLA 4XGIA 4RGBA 1N6NA 1RIIA 3R7DA 3SIPA 1PVDA 4WA7A 1TMYA 5GZ3A 4RA9A 2OHVA 4MI1A 1Y80A 1KMMA 2OM2A 1QGAA 1YA4A 3WTCA 1IDOA 4QFDA 3EVGA 2EG5A 4JEUA 4QDXA 3P27A 2UUBB 2PK3A 5NULA 1ZM4A 2GILA 4BLPA 4F97A 2WZDA 4UCXA 1PFUA 3NXHA 3Q5GA 1OHHA 2FZWA 4L07A 3CECA 4EG1A 1LRJA 4YJFA 3KJIA 4EX6A 4CM1A 3QVSA 4YARA 1Y8CA 3WVNA 4NEHB 4F2GA 4DCNA 1PJZA 3D8HA 2QNIA 3PL5A 2HSEA 5JXGA 1QLWA 2BV3A 4CT5A 3DAYA 3I6YA 2HA5A 2WU3A 1CRPA 1VFNA 2WIDA 1BN6A 2WA1A 4PX2A 1ESZA 1T8YA 4EPVA 4K0KB 3M1YA 3NUZA 2YMQA 2IBTA 4QDKA 5TMEA 3BE8A 1LF5A 3WGGA 1KS9A 4P53A 4YJHB 1C2YA 1I01A 1EUDA 1T35A 3WIEA 5AM3A 1YHZA 2BGWA 3AR9A 4FS8A 3L7KA 5E3IA 421PA 2YXPX 1PT9A 1UJCA 1P18A 1XQXA 3FTQA 1P61B 4HMQA 2Q6OA 4LRTB 5F33A 2PHZA 3HV2A 1XRPA 5JSUA 1V16A 3LX8A 1B4DA 3C15C 4M21A 1U90A 3KVNA 4EEXA 1X57A 1QQAA 5BW5A 3NOVA 4QFMA 3W78A 1U0TA 3RW9A 3LUBA 1YJCA 3TMKA 4DUYB 2VJKA 4LJYA 2CJXA 4DA0A 1E5QA 5H0IA 3P52A 4ND8B 3HEMA 4JEIA 5K09A 4KPYA 4HEHA 3RS4A 5LMCA 1BCRA 1UM9B 2O8FB 3AV3A 4MB0A 3OKZA 1JQKA 1NIJA 4Y9RA 1WG8A 3OEHA 5C0OE 1QK4A 1G9XA 1XROA 4ZJUA 2I6GA 4NOKA 3SR3A 4QJBA 2FSVC 1NFFA 4LNAA 4EJMA 5J59A 4DCVA 2JIMA 2NIPA 1UMBB 3LUJA 5T67A 3VNBA 3CXUA 9GPBA 4BP9A 1PR5A 1FDWA 1G7TA 3H3XA 4FMCB 5DHPA 1O96A 2VSFA 5DI9A 1TJ3A 4JLBA 1TO1E 3QFSA 4IH9A 4D44A 3ZDXB 3MGAA 1F4LA 3HB5X 4GI1A 5B53A 4XWOA 3SC3A 1WIWA 3WRYA 1Q92A 2Q3HA 4R1LA 1PP4A 3ML1A 4OQDA 4R2MA 3TTTA 3OQVA 2C8JA 1PT5A 3P9NA 4NZPA 5MDHA 5ISMA 1V3VA 2D1FA 4MR7A 3CB4A 2PXEA 2BFBB 4RYDA 1H3EA 4WV3A 2JIOA 1SXJA 3VVBA 5A05A 2HK7A 4IDAA 4DREA 2I3AA 4X1IB 2IUSA 2XE6A 3NHYA 1NLZA 4Z5DA 2GZSA 1JIIA 3CLHA 4HAWA 1VPDA 3VO9A 2ZUTA 1GPAA 1THMA 4OXIA 4R6WA 2JGMA 3CR8A 1XRJA 3SLKA 2J46A 5DPMA 4DV2B 3OY7A 1TT5B 2DR0A 4B3FX 4WN3A 1ULUA 3V7WA 4YBZA 4B8YA 4CQMA 2H1IA 3M33A 3AXTA 4FHGA 5AK6A 5LYJA 1G7RA 1PI3A 4ZYWA 1E89A 3EUWA 4NCIA 1KTVA 3IP8A 3WWPA 3EUAA 2EZUA 3QU7A 4PS0A 5FTNA 3SK0A 4BKPA 3OX3A 3LOPA 2Q3MA 3QPWA 3BDNA 1IPFA 4L9SA 4WDRA 2MSLA 2ZRDA 4J3NA 4RXTA 2Q6VA 3B9QA 5K0SA 1M8PA 5BNWA 3QV1A 3TNYA 3IQEA 1Y1KE 5JYEA 2QTWB 3PXXA 2ZB4A 2Z5VA 4INAA 4C6SA 1YFLA 1S2NA 1E6UA 3PIIA 4KNWA 4LXYA 3TUIC 5K45A 5AIBA 2E48A 1BDIA 1JG4A 2HA6A 2ZSBA 1GQRA 1QJCA 1THGA 1JAXA 2XA1A 1P6XA 1OWMA 3BORA 2HQOA 2HWYA 4MV4A 4O5AA 4QXMA 2EZ9A 4ZPXA 1DBWA 5C18A 4BQNA 2C5HA 2P11A 3SPXA 1YVEI 3H75A 3TN7A 1KEUA 4MV7A 5DK6A 1PGJA 1LBSA 1W88A 1ZGBA 2I29A 3QA9A 4YRCA 5BMOA 1B8UA 1U1IA 4I36A 3TW6A 2XTZA 2PTGA 1PEYA 3DVQX 2AJBA 3BSYA 4AJEA 4XVUA 1W6RA 1JLSA 2Q4OA 3FYAA 3HYLA 4N48A 1X7YA 3GT4A 1U0SY 2IT1A 4Q6WA 1D8TA 3V8RA 1ULTA 2VDQB 2F1IA 3LBFA 2AR9A 2J45A 2J9ZB 3A0UA 3G9XA 1RJWA 3G7SA 5CXUA 5DGTA 1LH0A 2GETA 4P34A 2QM3A 4HNUA 4QASA 5J4YA 3GH1A 3NAZA 1DEOA 2QW8A 1NG1A 2ZSEA 2I2XB 3L7YA 3RS8A 4YCMA 2PH3A 4FKZA 2OBYA 1EXNA 2PSFA 3AVPA 5KOJB 4EM6A 3Q72A 3E9MA 4IY1A 3KVRA 4LVUA 5CLIA 3UWPA 1WU8A 1V3TA 2Z9DA 4GMDA 1ORWA 2V4UA 3CCFA 3QI2A 4AZ3A 2KYRA 2IC5A 1CUXA 1WQ3A 4I66A 4QNMA 3T7SA 2RH8A 3FWKA 4L28A 2VA9A 1Y7IA 3ASYA 3DBHA 4Q3BA 2ATEA 1DAMA 3NDIA 1P0QA 1NUUA 3JQ8A 1OI2A 1ZCAA 2WUSR 1JFVA 3NT2A 1E3JA 2WJZB 1CVIA 1P1RA 3DCYA 2QLNA 1XIVA 5EIOA 3KKZA 2VK8A 3TQSA 5CDTA 5AM4A 2FHSA 2PZJA 2H2GA 4MUIA 1NTRA 3ICOA 4FW9A 4JI7B 1HBJA 1DS6A 3LO8A 3C3YA 3EGDA 1OBCA 2CB0A 2HNAA 4D99A 2H5EA 1S6YA 5K20A 3FX2A 5IXJA 5AWFC 1IUKA 1ZCJA 1XTSA 2WSBA 2LUOA 1PZFA 1IBCA 4IR7A 1LLCA 4D0GA 4JIMA 2PUAA 1UBLS 2HYDA 2NZJA 2Y27A 4FHCA 5AP9A 3WLAA 1GUBA 1FB5A 2D5LA 2HRCA 4D79A 4BMXA 1TT5A 1P4RA 1VHJA 1YL7A 2CNOA 5AJWA 5FLKA 1JR3A 1V5FA 1GNLA 2GZDA 4CFYA 3OZGA 4K88A 1VKJA 1UAAA 1NP6A 4QG7A 3HKBB 1CRWG 1J0BA 3N75A 3O1HB 1WY7A 4LPKA 2XVXA 1VM6A 4IIUA 5JNWA 3KZ1E 1T8RA 4DNOA 4UOZA 1FP6A 5I7HA 3RIXA 4J1TA 2BFBA 2O2IA 3FAKA 4L72A 2D1SA 2ZYRA 3GWZA 4G0OA 4JP2A 1DC5A 3FUWA 4MLPA 3SJCA 4JJ7A 1I7QB 4RHFA 2Z3VA 2NACA 4PYIA 3E1GA 1KOLA 2WEKA 2IY9A 2YV5A 2WKQA 4FILA 4WW0A 3WGIA 3V7YA 2OXIA 4KLRA 2NP7A 1DBPA 2VZ8A 1ZHOA 1J24A 1QKJA 1HQ1A 1RPNA 1T36B 2ID7A 2OAEA 4U3JA 1U2SA 3UHAA 3UTDA 3ZEIA 3FFWA 1YT5A 1NBME 1MPTA 3QXXA 1LCIA 5KEIA 1U1GA 3I5AA 2RJNA 1ZOOA 2C00A 1UOQA 2PVSA 5A71A 3RAGA 3T61A 1KYZA 1N2OA 4OXRA 1IU9A 3WLQA 5C8ZA 2HD4A 2XIQA 3FNRA 3GD7A 1RVV1 2HXSA 4JGGA 2D3WA 4U0KA 1CERA 2B36A 2Z3WA 3AFOA 4H18A 1QOZA 5F76A 2YWJA 2IU3A 4DWOA 4P54A 4OH7A 3TLEA 1LSSA 4YJ3F 1QDUA 1X7XB 4XVQA 4ZC1A 1C3VA 1E79A 2I7DA 2BW0A 4RS3A 4TLDA 3V4PB 4B82A 2JS7A 5JAZA 4MUAA 3GRKA 1HDIA 4K9PA 4FDAA 1HZJA 2B4RO 2ZRIA 3IEVA 4ICIA 4UBJA 1QO7A 1LZLA 1PR9A 3R0VA 4YRQA 3L7JA 1N75A 2FMXA 5KQGA 3X2EA 3G2LA 1G7SA 3O4JA 1XK7A 1I2AA 2BEVA 1E8NA 5A06A 2R63A 1WH6A 1XHFA 4I9UA 5JSKA 3W5DA 1B7GO 3OM8A 1KNQA 1UK7A 2JJ1A 5K3AA 1QCCA 1RWXA 5A3JA 5LR6A 2IH4A 3KTFA 3GNTA 1OY1A 1W5AA 1KDTA 2P0YA 4LDJA 5FWDA 4BO2A 4X20B 5EJEA 1GN8A 2OSVA 5B5SA 1E7QA 4IX1A 4RFSA 5CJJA 4F38A 3JXCL 4PRKA 3NKFA 2QN7A 3GFRA 3OPVA 1P81A 3R24A 4DKJA 2EDCA 1GPH1 1DXHA 3FYSA 3ESXA 1KO5A 1N8KA 1X39A 1ZGJA 2H29A 3IQDB