3QOWA

Dot1l structure in complex with sam
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
327
structure length
322
Chain Sequence
b'KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKWTGKPVSYYLHTIDRTILENYFSSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 322
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qowA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qowA02
1KIAA 1JQEA 1MJFA 4ER0A 1INLA 3NDIA 3P2KA 3BT7A 1EJ6A 3P97A 2C7RA 3Q7EA 3LL7A 3SMQA 4ATNA 2O0LA 4R05A 2HNKA 3NWEA 1R6AA 4AZSA 1ZHFA 1EIZA 2WK1A 4C08A 3TMAA 3E7PA 1VE3A 5FCDA 2PXXA 3OCJA 3JWHA 4WVLA 3IYLW 3LDGA 3FPHA 4FP9A 3O4FA 1BKYA 5BW5A 2ZW9A 4OBXA 2ERCA 5DM4A 5K0GA 2JHPA 2VS1A 3QV2A 2YTZA 2XVMA 3DULA 4RVGA 3DR5A 4PYKA 1BOOA 1KPIA 2HWKA 4CKEA 2OYRA 4BY9E 1JG2A 1ZQ9A 4GBED 5HILA 5HIMA 4RTSA 5ICCA 4XUDA 1O9GA 4PYMA 4PCAA 1IM8A 1P91A 3V8VA 1I1NA 4RVHA 1VPTA 3UJ8A 4NECA 3S68A 3A25A 4OBWA 1G38A 1R74A 4RTPA 3C6MA 4QDJA 3IEIA 2OKCA 3C0KA 2BR5A 3DMFA 1ZGJA 5GOZA 5GP1A 3P9IA 1X1AA 3OFKA 3TKAA 4YUWA 1RI3A 3QOXA 5DRTA 1JQ3A 2AN5A 2AVNA 1L3IA 2QRVA 2P7HA 2YQZA 4H0NA 5EPEA 1XXLA 4RWZA 2EG5A 5FUBA 3FRHA 4Y2HA 5FHQA 5K0EA 3O7WA 4WXHA 3T7RA 2Z6AA 3JWIA 4KVZA 4BLWA 5P8WA 1NBIA 2HTEA 5K0LA 3UJBA 5GM1A 2ZFUA 3MERA 4CWAA 2P35A 3LGAA 4HGZA 5LR6A 5KVAA 4RYLA 5F2OA 4GQBA 3EPPA 2PX2A 1JSZA 3HM2A 5EOVA 3ELUA 3H2BA 1I9GA 3ME5A 1WZNA 4E2ZA 3GO4A 5K0BA 4U7TB 2QRVB 4GOMD 1M0EA 2FK7A 3DTNA 3UJDA 4CTKA 3KQSA 4ER3A 5EKXA 3AY0A 3UJ7A 3KPJA 1UFKA 2OZVA 5ICEA 1SVUA 3GRYA 4R8SA 3SSNA 1QAQA 1P39A 4QDKA 5ERGB 3SVZA 3PX3A 1OR8A 3F4KA 1XCJA 2BR4A 3BWMA 1KXZA 2OY0A 4HSGA 4KIGA 2P3OA 4A6EA 5LQKA 5E2BA 1G55A 1DL5A 3PFGA 2YVLA 5C0OE 2NYUA 2CWWA 1SQFA 3DP7A 3A4TA 3MCZA 3KQTA 4P7KA 4C06A 4PYNA 4GOOD 5DXJA 2AOTB 2ZWAA 2N47A 2ZVJA 3UA4A 5KS2A 1AQJA 3HVJA 2XYQA 4RTKA 3MB5A 4C4AA 2XYVA 3HTXA 3DLIA 1P1BA 3CJRA 2UYOA 3C6KA 2NXJA 3PFHA 5E1MA 1RJEA 3SSMA 2PGXA 4YUXA 3OZSA 3RW9A 4FZVA 1ORIA 3GIWA 3JWJA 4FT4A 5E9JA 1O9HA 5F2NA 4PYQA 3ERCA 5EKUA 2ONZA 1NBHA 1R8XA 4RTMA 2AS0A 2G1PA 2XVAA 1Q0TA 2DULA 3GCZA 5EZQA 4RTOA 2ZBRA 1VL5A 4PNEA 5U4XA 2ZLBA 3FYCA 5ICFA 3GRUA 4M7RA 3DXYA 2PT9A 4OX9Y 2PXCA 5B1SA 5LQAA 3I53A 5IKMA 3LX6A 2ZULA 3NW9A 2VDVE 4X41A 5MHTA 1X1BA 2IBSA 4XUCA 1KYZA 5K8VA 1NW7A 4OA5A 3E8SA 2NXCA 2O57A 3GGDA 4M38A 3NDJA 4AZWA 5E9WA 3UJ9A 1ORHA 2PXAA 2P41A 3AXTA 5BP7A 3B7PA 3KU1A 3GRRA 4QPNA 5LQRA 1YUBA 2PX8A 3C3PA 3KQVA 5DX0A 2G8NA 5GM2A 3OZRA 3HCFA 4F85A 1T43A 3P9CA 1JTEA 4PIPA 4XUEA 3HA5A 3TRKA 3PB3A 3SXJA 1NV8A 4P7FA 3B3GA 1D2HA 2FPOA 4E2YA 1WXXA 5EIWA 3HP7A 4MQ4A 2R3SA 2PV0A 2B9EA 3SR4A 2B3TA 3UJCA 2HMYB 4YMHA 2PT6A 2IH2A 1G8SA 4KRGA 5FA8A 3FUXA 1L9KA 3M6VA 4BLUA 2CKDA 2FHPA 2ZTHA 4HTFA 5CVVA 1RJDA 2B78A 4KWCA 3GRVA 3LCUA 4GUAA 3G89A 2YXLA 5H02A 3UFBA 3EVEA 2B2CA 3OZTA 5HOQA 3ID6C 3T7TA 1KR5A 1AF7A 3IV6A 4FT2A 4LWPA 1G8AA 3P8ZA 2ZBPA 3E05A 2A14A 3ELWA 3EVBA 4ZTBA 3FYDA 2IFTA 5BW4A 2AR0A 2YR0A 2YXEA 3BWCA 3CJTA 4RSRA 3KQOA 4RV9A 5E1BA 3I58A 1FPQA 4RVFA 5E1OA 5K0CA 2GAFA 5E2AA 3QOWA 3HCBA 2OXTA 5JUWA 3T0IA 5DSXA 4HTFB 3A7DA 3CCFA 4IV8A 1L1EA 5HEKA 3ER8A 3I64A 5ICGA 3A7EA 1NKVA 2CMHA 2FRXA 3FUWA 3FUVA 4FR0A 5FQNA 4KW7A 3NWBA 2HV9A 4E32A 3G2PA 3LKDA 4RTJA 1VQ1A 3M6XA 5DWQA 5DTMA 4E31A 3K6RA 4E30A 2K4MA 3FRIA 5JR3A 3NVMB 5K0JA 3P2EA 5DTQA 4JXJA 9MHTA 2QE6A 3G8BA 4X60A 4RTNA 2LD4A 2V74B 2I6GA 4CXMA 1QYRA 5K01A 1JSXA 2H1RA 2P7IA 5EC8A 3FZGA 4LECA 3HCEA 1X1CA 4X63A 4F86A 3THRA 3UWPA 3TFWA 1WS6A 2FYTA 1QZZA 4HGYA 5CM2Z 3ER9A 1JG1A 1X1DA 3DH0A 2UYHA 5FA5A 2ZZKA 4BP1A 2ZCJA 3PVCA 1PRYA 1VBFA 2H00A 1QANA 3KR0A 4KIFA 1YB2A 5FWDA 5G02A 3V97A 7MHTA 3TLJA 2EJTA 1D2GA 5CUQA 5DM2A 3O31A 4AX8A 2AOTA 1M6EX 4AUKA 3R9XB 1KHHA 2PY6A 2JH8A 4YUVA 3LCCA 4MIKA 5FTWA 1R18A 5T6BA 2JG3A 3G88A 5LQJA 1RJGA 3EVDA 1SKMA 3PT9A 4C04A 2QY6A 2IH5A 2BR3A 4R8RA 1FP1D 4PWYA 3FUTA 2AVDA 3B89A 5CVJA 2C7PA 2PX4A 5K0NA 3DMHA 3T7SA 3D2LA 2IIPA 4GF5A 2P3LA 5EQJB 1AV6A 2C7QA 4GEKA 2EFJA 1RI1A 1G6Q1 2GH1A 4PYLA 2CL5A 3UBTA 1NW8A 4QQKA 3HCAA 3M70A 2IH4A 1L3BA 5E9QA 1NW5A 2P3QA 2OPBA 1JG3A 2PX5A 3FTEA 1DCTA 5HZMA 4DQ0A 5DX1A 2ZWVA 3UJ6A 2AOUB 1VLMA 4RVDA 1QAOA 1XTPA 4EQZA 3U81A 1H1DA 1TPYA 2AN4A 4K6MA 3SM3A 4XCXA 3EVZA 2KW5A 3MAGA 3OE4A 4GOND 4C07A 3PTAA 5HIJA 5FWAA 4YV2A 1XCLA 2PKWA 2Y1WA 1R00A 1WY7A 3DOUA 3VYWA 3EEOA 2P40A 1YF3A 3VSEA 3TQSA 3KR1A 4P7GA 4DZRA 4E33A 1NW6A 2PSSA 3BKWA 4MTLA 3EVAA 3UA3A 1ZGAA 2EX4A 4B17A 1ZG3A 3EMDA 2FK8A 5CVEA 1VIDA 4PGHA 3CJQA 4RTQA 1XDUA 4CKCA 4U7PB 2JHAA 5GINE 2PVCA 3BWYA 1KP9A 3EEYA 4LG1A 2NNWB 3FTCA 4FSXA 5EMJA 5T67A 3TM4A 1ZKDA 4C03A 1BHJA 3KPUA 5EHGA 1NT2A 3CC8A 4DCMA 3HA7A 1SUIA 1YZHA 1EAMA 4IV0A 3SSOA 3DXZA 2Z6UA 2YX1A 3DLCA 3I9FA 4EK9A 2FCAA 3LECA 4QTUB 4L7VA 3EMBA 5EEHA 3BWBA 3MTEA 4DM3A 5DX8A 5DXAA 3BZBA 3A26A 3FTDA 1EJ0A 2IBTA 3HA3A 1RI5A 3EGVA 4YUZA 3CVOA 4KDCA 2NXNA 2JH9A 3EGEA 3LKZA 2JJQA 3LDFA 1KYWA 4DF3A 3P71T 5C1IA 3GDHA 2I9KA 5EVJA 1B42A 3KPWA 3HNRA 4GC5A 5DSTA 3MGGA 2VDUE 2EJUA 3BXOA 3LCVB 2I7CA 3OE5A 4M37A 4DMGA 5HIIA 3E23A 5FQOA 2ESRA 3B3FA 4YUYA 2O07A 3MHTA 5E8RA 1N7IA 1XJ5A 1RI2A 3DMGA 3CBGA 2R6ZA 3G5TA 3HCCA 3OU6A 4R6XA 1I4WA 5D1NA 5IH3A 2WA2A 3R6TA 3RIEA 1JTFA 5CCBA 2IP2A 2AOXA 3GU3A 4UOEA 1SG9A 3UJAA 3B5IA 2G71A 5EZSA 4FGZA 5D1HA 4QVGA 5DT2A 3EVCA 5GIOE 3FPFA 4E70A 2PLWA 4O29A 2WA1A 2OB2A 2VDWA 2ZIFA 4HRAA 4AZVA 3HEMA 4QVKA 4P58A 2Z6QA 1FP2A 2PBFA 4E2WA 2H11A 4C05A 1AQIA 3BGIA 5GWXA 2F8LA 1D2CA 2ORED 4X1OA 5KQSA 3OU2A 3X0DA 3G7UA 2Q41A 4ER6A 5HFJA 1KPGA 3KR9A 5E1DA 2GB4A 3ANXA 1FJXA 5FULA 3KQWA 3TPZA 1MHTA 3SGLA 1IY9A 3GRZA 4PGGA 3GJYA 3ORHA 5EGSA 4YV1A 5BXYA 3LBYA 1YFLA 3TM5A 5LQUA 4ER5A 1JQDA 3IHTA 1RI4A 5DRYA 3ELYA 4ISCA 1N2XA 4MWZA 1M6YA 5CVUA 3TOSA 1G60A 4HG2A 4F84A 3LSTA 1XDZA 3OPNA 4PCLA 4HC4A 5DM0A 4OQEA 4ER7A 3NVKI 3NTVA 4PYOA 4CTJA 4DCGA 5DTRA 3KR2A 1L3CA 3R3HA 1QAMA 1EQAA 1VP9A 2BM8A 2JHCA 3M6WA 5DPMA 5EMLA 5K0FA 2IPXA 4YMGA 1N7JA 3FPEA 4Z2YA 1F3LA 2VZ9A 4LWOA 1Z3CA 3A27A 2GPYA 3ELDA 1NW3A 4R6WA 2UYQA 5EMMA 2ONYA 2QYOA 1JG4A 3G2QA 3K0BA 2YUIA 3G8AA 4PONA 2IDKA 4PYIA 1FBNA 2AN3A 4FS8A 3LHDA 2GLUA 2G72A 3HCDA 3R0QA 5FHRA 2AOUA 3RODA 1UWVA 3KHKA 4EMSA 5LSAA 3FTFA 4FSDA 5EEGA 3G5LA 3P9NA 2UYCA 1KPHA 4QTTB 4IKPA 10MHA 1Y8CA 2ZIGA 3VC2A 1HMYA 3BGVA 3LPMA 4M36A 1HNNA 1X19A 4QQNA 3PLAE 1P1CA 5F2KA 3THSA 3FUUA 2P8JA 1Q0SA 3AXSA 4EKIA 3HVKA 3HVIA 5CVDA 1IXKA 1WG8A 3EVGA 3HVHA 4V0RA 3LBFA 5FADA 4RTRA 4KDRA 4EVIA 2I62A 5CCXA 2PWYA 3L8DA 2GS9A 3TKYA 4V0QA 1R8YA 1NE2A 2AOVA 1UIRA 5M5BA 4GOLD 4PIMA 3M6UA 5EMKA 4E2XA 1BC5A 4IWNA 4QPPA 3SX0A 1U2ZA 3GNLA 1RJFA 5K03A 4DKJA 4OA8A 3BKXA 3MTIA 4P7JA 3PX2A 1XVAA 3KPVA 3KPYA 2C7OA 3KQYA 2ADMA 2E5WA 2GA9A 1TW3A 2V7EA 5DLYA 4A6DA 4POOA 3EGIA 3P2IA 3R24A 3REOA 3AWIA 2XBMA 5LQNA 3OU7A 3OFJA 1XDSA 1PJZA 3FPGA 3BUSA 4RX1A 2BM9A 2ZZNA 5K05A 5K09A 8MHTA 3BGDA 2BZGA 4RTLA 3Q87B 5EHIA 2ZSUA 3DXXA 3EVFA 2XYRA 3M4XA 4PINA 3GWZA 5E8JA 4PYJA 5KYGA 2PJDA 3CKKA 3VC1A 5T64A 5C9ZA 3NJRA 5GIPE 4MHTA 2IDJA 3GXOA 1SUSA 5EIFA 1EG2A 1SQGA 1TW2A 3AJDA 4GC9A 2OO3A 3JWGA 5KQRA 4DA4A 1YFJA 4YV0A 3P9KA 4BLVA 2CMGA 2NP6A 2OB1A 2QM3A 2G70A 5CD1A 1JR4A 3PS9A 2HR1A 2ZZMA 1DUSA 1VP3A 2O06A 2YXDA 2BH2A 2ZBQA 5CIYA 2NP7A 2Y1XA 4X61A 1O54A 2AZTA 2O05A 4BP3A 2UZ4A 1NV9A 3KQPA 1V39A 5LQCA 3KQMA 5HIKA 3CGGA 4AZTA 5DM1A 3TR6A 2ZIEA 2NXEA 3MQ2A 2PWPA 3I5UA 2DPMA 3G2OA 3FPJA 4HH4A 3NMUF 4Y30A 3UZUA 3MCTA 3DUWA 4CKBA 3B3JA 2VP3A 1F38A 3G2MA 3KQQA 2P1DA 4EKGA 1WXWA 2IGTA 2AOWA 1YZ3A 3C3YA 3M33A 4OQDA 3WSTA 3KKZA 2OBFA 3LDUA 4G56A 2B25A 5EG5A
chains in the Genus database with same CATH superfamily
3P4UA 4K8RB 4LYJA 1SBZA 4ER0A 3QXHA 1CQJA 2ZJ6A 2FW7A 3IOCA 1CIVA 1QVRA 1WW8A 4V1CI 3HU2A 3A4LA 3A6PC 4WFQA 2Y3IA 3PUYA 4RQUA 3Q7EA 3VDRA 1U2DA 3RRFA 4IGFA 1FA9A 2O0LA 1U9CA 3L5OA 1AGNA 1U2GC 2QPAA 4R05A 4BVJA 2GCGA 2VP0A 2WI8A 3CM0A 3NUGA 5TRTA 5KOIA 5HKLA 1V1RB 4AXXA 1WMFA 3PRHA 4PM4A 5SZHB 4F2DA 5KSOA 2O0KA 5FOSA 2Y27A 5A3RA 3QMPA 5JMPA 4E3WA 4CVNA 1AG9A 1QHGA 5G3ZA 3LBHA 1BIFA 2EGHA 1DRVA 5E6RA 5HS6A 1F5NA 2OV2A 5FOWA 4Z8YA 5K3FB 2DKOA 3RBXA 3UHFA 4AECA 4B6FA 3H6GA 2JCVA 1IEWA 1WQ3A 4JR2A 1DTWA 5CEJA 4HATA 2ZPUA 1D2RA 2X4DA 4RA9B 1YBHA 2CLEB 1A76A 2AYZA 5JNRA 1XNQB 3VU1A 2D5AA 2RGGA 1RAFA 2GILA 1N0VC 1TQDA 4CKYA 4DNFA 2QTFA 1UM9B 3RYFA 4LSMA 5C80A 2ZB8A 1P5JA 3GWGA 4FN5A 2R47A 3VNAA 3DMTC 2EDAA 4DMMA 4ZVVA 1HZZC 4LV5B 1G8FA 1GPUA 4NOLA 2AJLI 3K0FA 4PANA 3T7DA 4RULA 3S99A 3DHVA 4WTOA 1L7EA 1TYEB 3PI7A 4KXXA 5FHQA 2E6UX 2BAGA 3DPIA 3ES9A 4PX5A 3WZ2A 4QVIA 1QGUB 1ML3A 2CUTA 3F1KA 3FNGA 2X0DA 2OFFA 5JBQA 1U1FA 5LR6A 1GCIA 2ERYA 4Q16A 4J7XA 3GD7A 1QZ3A 3EZYA 2AG5A 1SXJA 3L0SA 3K0SA 1DO2A 1JHYA 3DAGA 1DWQA 2KLBA 4Z5DA 1C9JA 1JAHA 3BK7A 2AMVA 3C98A 3IQHX 5FOTA 1KU6A 5LBUA 3GJ7A 1TOAA 4BKMA 5E0OA 4BZWA 3ZXXA 4B34A 1JEYA 4YASA 4N0DA 4MVCA 4OB7A 4YJDA 1Z0KA 3JQQA 5G1OA 1CR4A 4MR9A 4YCNA 1JLMA 2GWRA 3S2IA 1VPDA 3OHSX 4JXKA 3B1KA 1ORTA 2OY0A 2NVUB 1DS6A 2O23A 4B3BA 3KJXA 4EPTA 1FDRA 1LW6E 4A0FA 3MW8A 4IRXA 1O8BA 2RCYA 3PC6A 4EGQA 1USKA 2OE2A 4QGHA 5AJUA 3GNQA 3S70A 5AXCA 4CG2A 4UEWA 1VRCA 2F43A 3K53A 3TUJC 4R0MA 1P1KA 4D92A 1MIOB 2IHYA 1U63A 2OAGA 1NMYA 4ML3A 1L4KA 1P6QA 2I8CA 2P75A 5DCLA 4BO6A 3OMXA 5FBVB 5F77A 3S2FA 5DHPA 1K2VN 1WDKA 3RW9A 2CN1A 4CQMD 4ZMRA 1I4LD 3HI4A 2A5FA 2ADFA 1SK9A 4GI7A 1EUZA 1V8DA 2AQKA 4DLVA 1U11A 2QSUA 3F3YA 4EB6A 1YV9A 1XDDA 2BISA 2PZEA 4FHEA 2FMUA 3VVCA 2A9OA 3SD7A 4BGEA 1H3NA 1AZWA 1EZZA 5L3SA 1JSRA 3CX8A 1DUVG 1QLJA 2AFVA 2JIOA 3ILHA 3QVVA 4RD2A 1Q1BA 3GN2A 1TU3A 4M7RA 1FS6A 2HU2A 4KH0A 3P27A 4WOCA 3ZIDA 2ZSEA 2V7VA 1WPXA 1UXGA 3ICEA 3TNLA 3N0WA 3FSEA 3BAZA 2IHNA 3ESZA 4G36A 3I5MA 1G8MA 1P3JA 2QMZA 3KDAA 4XFJA 3UYLA 1CR0A 3KYDA 2AN9A 4ARZB 4BLSA 4OG2A 3KB2A 2G88A 3G9XA 1DKPA 4B3MB 4M38A 3JQAB 2CUKA 5C7OO 1ORHA 1ZW6A 4LE1A 4RF4A 2Y77A 4QPNA 5LYJF 2WFMA 4IIJA 1CCWA 1EJ2A 1Y6QA 5DTEA 4BTVA 4INAA 1ZNYA 4O2LA 3TQRA 3ZX5A 2E4YA 4QDTA 4EW6A 1DQPA 1ZHHA 4FZJA 4EARA 4EH1A 1T43A 4G5HA 5LMNB 5T8KA 4PIPA 4XUEA 4Z99A 2GZ1A 4Y2XA 3S1AB 4I3HA 1C1HA 3UJNA 3VNSA 2XI8A 1NUAA 2IYXA 2XECA 1IJBA 2ZU6A 3A10A 4C6TB 3IP9A 3TCKA 3VOAA 4B5LA 3RLFA 2VPPA 1EGVB 4G81A 4HYYA 4ND4A 3B52X 4P93A 3OETA 4P53A 3O3CA 5G4KB 3T5PA 1JALA 3DOCA 4C2TA 1GIAA 1YL6A 1E8MA 4Y2YA 3BXXA 1RZVA 2C2YA 1WUJS 3BS4A 1WCV1 4UNIA 3G89A 4UE2A 5EE0A 6GPBA 3OZTA 4HGRA 3LSYA 4E1BA 1H1LA 2V6IA 4NG4A 5IX8A 2H31A 1MV5A 1RRMA 3RRNA 3VBEA 1AUQA 2ONKA 4B7AA 4BWFB 6ADHA 1N6IA 1DEAA 1YA4A 1MABA 3HCOA 4L4ZA 2R7NA 4JUIA 3FI0A 3IHWA 4DREA 3E9NA 1CR2A 2DBRA 3UC5A 3I8OA 1I6MA 5CA1A 2BY4A 2Q4OA 1F6WA 4X3PA 2WTMA 5GGXA 4AJPA 1OJ7A 2XUGA 2WKPA 4W7SA 2DTXA 2MT9A 5IM4F 3DL7A 2JGNA 3G0IA 4OUDA 1PWHA 1Z8HA 2ZIUB 5LCXA 3FYTA 2X0FA 1P7ZA 4IMPA 2CMHA 3VR5A 2WKQA 3T7EA 1LGYA 5KJEA 4OH7A 4Q34A 1E6LA 3D6NB 3K31A 4XYGA 3TIVA 1QJ4A 1SFRA 2DFDA 2C0PA 1M1YB 2C4KA 1CNEA 3OBBA 1E2UA 4XH9B 3WY9A 4RXTA 1DT5A 9MHTA 4JLPA 1NHGA 1BH6A 2ZYRA 1AS3A 1NOJA 4YRBA 1U3DA 4U3JA 2XUPA 3VH1A 2HOQA 3M9WA 1E94E 4JODA 2IPOA 3U5ZB 1Y4DE 3I32A 4TM7A 4D0GA 1W44A 4H0FA 2WWWA 1YB6A 3ANTA 3F90A 4P2BA 3FPAA 4OBBA 1T24A 1Y48E 3IODA 5KVCA 3KJQA 3HKEA 4J0QA 3ACCA 3HP1A 2OYCA 1J97A 3V97A 5AVTA 2M1ZA 1DQNA 2OL4A 4BQIA 1FYVA 4Y2VA 5UKDA 3OTOB 3F3MA 4C7OA 4ZJYA 3O31A 5DBEX 4B3HA 2R96A 1PEAA 2WFLB 3ZVLA 1ZNQO 2WSMA 4M1MA 4YG1A 3B6KA 4NE2A 3LX4A 3W6ZA 4II3A 2X7JA 2QR5A 5I9LA 1PYGA 5FWYA 1JT2A 1QO9A 2O8FA 1PZMA 3RYCA 1M2JA 4MEJA 1MAUA 2IU3A 1U8ZA 3E9EA 1AV6A 3IS3A 5HCNA 4H3SA 1OI2A 1GN8A 3CISA 5AOAA 3H2ZA 5JVDB 3PNMA 1NVFA 1QV9A 3CG0A 3M70A 2MYUA 4Y6GB 5AIBA 1FMFA 4IOLA 1N5RA 3TAHA 1FDWA 4HLUC 1ZU4A 1U6JA 3TZKA 3UXMA 4TS3A 5CK5A 2XMSA 3CKYA 1LDNA 2HKIA 4X4EA 4CMEC 5EJ4A 4RENA 4L0QA 2B4QA 1CX9B 4TQGA 3W90A 2VK2A 4AULA 3LCJA 4YXWA 2X5JO 1ZINA 1U4SA 5HF9A 3WNVA 1E9DA 2L17A 2XIJA 1QRDA 3DBOB 1H1DA 1XX6A 2QX7A 4HNHA 4II7A 4LQ4A 1UKBA 4N5LA 2CD7A 4PG6A 3AQ4A 3L4SO 2WB2A 5F5XA 3VYRB 4R1QA 4YRTA 3EXIA 2H4ZA 1XA0A 2BHNA 2K7ZA 3PTAA 2TMKA 4KXUA 2ECOA 1XCLA 4EF5A 4JCXA 3L0CA 1EUQA 4RLFA 4UDOA 3TJRA 4M1ZA 4QRIA 2QA5A 4L22A 4B17A 1TM2A 3EQ7A 5A4IS 1DHRA 4B6QA 2LYQA 4M8KA 4G37A 4DVJA 2GCOB 4AICA 4GDFA 4D26A 4HEA6 1UMDA 2XD4A 3BAFA 5ALGA 3U5TA 1OXUA 3ILVA 1NGSA 1YJAA 4MRMA 2VRCD 3IXQA 1Z8DA 2DECA 1PD0A 1IRIA 1DKRA 1ZK0A 4H7KA 5A4MS 2FPWA 1N32B 2ATIA 3PNOA 4PGFA 4BJ5A 5KNBA 1V26A 2CXPA 3K1AA 3KX2A 1NW9B 3LS2A 3TLGB 3RHFA 3U0VA 2HSDA 1P2UA 2HJGA 2A3RA 3BE5A 5KYUA 4TXJA 4QTUB 5D86A 3ZJ4A 1YC5A 4F4IA 3QWIA 4EZBA 2AG0A 4GLLA 2IBTA 1V11B 3F6PA 3R5FA 2WU4A 1GITA 4E5MA 1F6BA 1UQTA 2EXXA 5JHGB 4Q4CA 2YY5A 3TRJA 2ZJZA 4PZUA 1BN7A 5AK3A 2R2AA 3EFBA 3SQMA 3RFXA 2ZU0C 4LE2A 1PFYA 1NYLA 1IL0A 1CULC 1XN4A 2RSLA 3JXEA 1U1IA 4OAQA 4P7BA 2B6NA 2OBXA 5JSZB 2HL6A 2QOEA 2VXOA 3BMCB 3K7EA 4EOGA 2Z6QA 2Q5LA 3E23A 1Y5RA 3LV8A 1Z47A 1QNLA 1PEDA 1ZK3A 3PZBA 5I7OA 1KMIY 1WLYA 4OSOA 3RNOA 1FJ2A 1WTAA 4FCWA 2V54A 4C22A 5GZ1A 3QJGA 4XKJA 4R6XA 4YP5A 1PD1A 1EXNA 3BGSA 2ZETA 1E1NA 4H4EA 3OEHA 4HWKA 1LVHA 3S29A 3V9AA 5T4BA 1XXHA 3MGBA 1NM5A 1NURA 3MAJA 4LOJA 2Y68A 2WU1A 5AVYA 2VA9A 4TUYA 2XNKA 3Q2KA 3WOVA 1UBJS 2W8BB 4P98A 4DFDA 1CZRA 3WMEA 1HNZB 5AW0A 3C6QA 1U9IC 4HPXB 1XPJA 5K3AA 3RGWS 2LWIA 1U8UA 3TJMA 1G7CA 4W5HA 2H11A 3CLSC 2GZUA 1XA3A 5AKGA 4IQ0A 1DFIA 1KH2A 2F8LA 2VDQB 5FWXA 2XCRB 2ZJYA 3EULA 2GHRA 5TMBA 3PEYA 3KZVA 4EO7A 3QNMA 3RYIB 1RXYA 1T6XA 2LLWA 2F9LA 3A28A 4HADA 1T6ZA 4RXUA 2CVHA 5AJXA 3ICWA 5LYYA 1E5TA 1JG6A 1GSIA 1YFLA 1F51E 2G77B 4RVUA 3WIDA 4P2GA 1AA6A 5I7WA 5CXXA 1ZSVA 3LX8A 3T35A 4C78A 3CZCA 5BMVF 1RE1A 1RAIA 1G60A 1A9RA 1PJBA 2DWUA 3PQCA 2IP4A 4HG2A 3UK2A 1JHXA 1YDEA 5LWHA 3WGYA 5CLJA 1BXKA 4ER7A 2Q8NA 5KZMB 3SR3A 4L16A 2SCUB 5DTRA 4GGOA 2GAAA 1KEWA 1BQ3A 2MJLA 4TTJA 1NASA 2CDBA 3SIPA 2GZAA 2IPXA 5C46F 2EZ4A 4B4WA 5KWSA 3A0RB 1A71A 4XXHA 4OB4A 3P9RA 3RABA 1YNSA 3A27A 2C4HA 3OTWA 2YYAA 3HJFA 1EP3B 4MH0R 5FBQB 4LMPA 4Z9XA 2NUPA 4DM7A 4XX0B 1TJ5A 2O2JA 3JQ8A 4G5YA 3VUFA 821PA 1UQRA 2DM6A 1N1MA 3GRKA 3NEAA 3OQJA 2LPMA 2V6FA 2ZIGA 4G4SP 3BGVA 5HMLA 1E18A 1HNNA 3OMLA 4RV4A 4FS3A 4P4NA 3RJTA 2R4QA 3GUUA 2PIJA 1N2SA 4H2DA 4AUEA 2GM4A 3K8OE 3DGFC 1QB8A 3OMWA 5TVKA 4DPMA 3IL2A 3HVHA 3LPDA 1P2VA 6PFKA 3PQ2A 3SHOA 1OW3B 2CNLA 3K3PA 3L8DA 3EIQA 1D07A 2XZDA 2E89A 4KE9A 5LOVA 2NW6A 3R40A 3WICA 4DAEA 1LH0A 2WWFA 1M7HA 3W3AA 4P8RA 3NORA 4NU8X 1U2ZA 4AKTA 2ARKA 2E5FA 3WLAA 1KHTA 3DO6A 4CM7A 1MO5A 1WNTA 2OC4A 4RNCA 3G0OA 5TGZA 2J9ZB 3M83A 2IVZA 4S12A 3VTAA 4AIRA 4ME6A 1XZGA 2MSKA 4B3CA 1RPTA 4DR2B 2IS6A 2JCBA 5IM5A 3AWIA 3V8BA 1FSGA 5H0IA 1P6XA 1TD1A 1A8PA 3DM5A 1HDZA 4WLVA 5DYWA 1SBCA 1XMSA 4UTVA 2PFSA 2RHOA 3C1OA 3IPCA 4H7EA 4YJ3A 3AVVA 1F2VA 5GONF 2NO9A 3VNRA 1WDLA 1ZD2P 5DBHX 5HFNA 4W8HA 2HLPA 2X7HA 4NBSA 3RSQA 2E9SA 2NZXA 1XZJA 4DCUA 1G42A 3FPLA 4OUKX 2YZ7A 1W59A 3HJGA 1Z38A 3QFCA 2VRWA 4MCHA 2BELA 3T7KA 5LYJB 3RVDA 2Y67A 4H1WA 4AWAA 1O57A 2EDCA 4KDFA 1IN6A 2KQUA 3VSDA 3WLKX 1NPYA 1U3TA 3CXRA 3DM9B 1USWA 2G70A 4EUFA 5ALVA 2RBGA 4QXRA 5DKFA 1ELOA 4I1IA 4BLOA 4BO2A 1QVZA 2J1LA 1H0SA 5AYVA 1RJ9A 5TC4A 3TNJA 4Y1RB 1E1RD 1PZXA 1YVEI 3F96A 4Q5IA 4X85A 4LOLA 1DQZA 3VTZA 1W35A 3ZKCA 1KRWA 3AF4A 4M0LA 4NPAA 1OXMA 4R1LA 2PWPA 4Q3KA 1RMYA 2HA3A 2IKSA 2BEVB 3BSSA 4XIJA 1LSJA 1M33A 3TVTA 1C8VB 1Y9DA 1CWUA 2JFPA 4R1PA 4TRJA 3RTBA 1MRNA 4KXVA 2VP3A 3W4KA 4LF4B 4PFKA 3GN1A 2IHJA 4JBGA 2FJRA 1SC1A 3C3YA 3LDUA 4TSFD 2AEJA 2P0EA 3AL0C 1GGFA 2C92A 4JJZA 2XMDA 3J7AC 2FSGA 5DF1A 1INLA 1J70A 1Y4UA 2YL2A 2EW2A 4Q18A 3EODA 5BSMA 5J4LA 3BT7A 2X13A 2VJPA 2VRBA 1BDJA 1EFPA 1MH9A 2VTBA 1MOSA 1J9ZA 1G291 1XRRA 2I4IA 5JS6A 3U4QB 2FPGA 5TQ0A 4Z4FA 2VH5R 1IQRA 2VPIA 4EL5A 2FQWA 3O1JC 2XOKA 3D5EA 3PI6A 3P9QA 2J8ZA 4AJ9A 4LKOA 3OCJA 1O5TA 3QKSB 4ZU6X 1IB6A 1Z35A 3L0IB 4U2CA 1ZJWA 3ER6A 1ECLA 4UQOA 1Z7WA 2AA3A 3IIMA 1GYRA 5SYMA 1NLZA 4M0DA 4ZXFA 4Z5HA 2X0KA 4N0QA 4YQEA 2JGEA 5H5JA 1X14A 2OYRA 1QV7A 2C98A 4WY8A 1TU4A 3KT0A 3GJZA 1MFPA 3AUXA 1UANA 4EKDA 2OFOA 4IUYA 1HNXB 2JS7A 2FCRA 2XRYA 4MUXA 2JIBA 2NXWA 1GCAA 2D3WA 1G8YA 1RD4A 4DRZA 3N6XA 4RO0A 1UP6A 3IEIA 2OKCA 3CIOA 4RZ3A 4DV0B 3LVFO 3E82A 3O0TA 2WW8A 4N8DA 3UGJA 1V5FA 2QGZA 2X0JA 1UBGA 4QODA 4Q05A 4KBYA 4ZEOA 2H4WA 1Z8NA 2B82A 3C3WA 4Y2HA 1DELA 1QORA 2EJBA 5K0EA 1KETA 3I9JA 4DIDA 3TLZA 4QBIA 3C7CB 1JI3A 1KZ9A 2AFHA 4HZUA 4MYUA 4YJGB 4F71A 3X2SA 1HYGA 4IJKA 4AO6A 2PMCA 1TMYA 2ZDHA 5A3QA 4YCJA 5HCIA 2JVKA 3BMNB 1EX9A 3DL4A 1I14A 1PGOA 4EA8A 1I9GA 5CB4B 4BTEA 1B6GA 2COKA 2GXQA 2OUKA 3GLFE 1RQGA 1XEXB 1GPMA 1MGPA 1M0EA 1Y80A 1NJ2A 1KJIA 4ER3A 2RARA 3NDPA 1T8RA 3HUEA 4Z9BA 4US2R 3KPJA 1KZHA 3RG2A 2OV3A 2FSSA 1XJCA 1Y4ZA 4QDKA 4QECA 5D3MB 2E4UA 4ZV7A 5B1YA 2C58A 3O92A 4NHOA 1H0KA 1XCJA 2BP7A 3BWMA 5CX1A 3QEAZ 1FW6A 4MV6A 4D3FA 2VH1A 5BSUA 3OPYA 5I9MA 4XEUA 4U1RA 5FBRB 4HQRA 1NP7A 4WK0B 5C0OE 1Z06A 3HHEA 3ABRB 4N3BA 4LY0A 2HHHB 5FX2A 4JJIA 1X13A 1RRGA 1GU0A 1GD1O 4S1NA 2ZUEA 4REQA 2WM8A 2XYQA 1SQSA 2YYSA 4WZAE 3U7RA 3ZZUA 4AKSA 4B44A 2EVWX 4AZ3A 1WE2A 4EZEA 2JAUA 3PFHA 3THXB 1RWWA 1Z6QA 2GBCA 4GT1A 2Z0MA 3A32A 1LFDB 5KPDA 4E0BA 1T5TA 2HXGA 1JLLA 4FZVA 5CT6A 1M7GA 3VISA 4ZVUA 3ANLA 5AK5A 3T1HB 3BL5A 2J0UA 2OORC 4QBKA 1VJ5A 2JD0A 3IV7A 3U4DA 3NALA 4PW0A 3E9ZA 5LMCA 1B0UA 1YRWA 3OJEA 3UA4A 2PUDA 2ICAA 1Y82A 3HKDB 1Z0IA 3DZIA 3VPAA 4CM5A 2C2WA 3K73O 2X5XA 3LRXA 4QREA 4WXPA 2YWRA 3QGMA 4IDDA 4K6KA 3OQBA 3EIUA 1SHTX 2R2GA 4PFQA 1OFUA 1ZW1A 2ZAIA 4J0JA 3NG1A 3MD0A 4F4FA 1KJWA 2FPRA 1JA1A 2IEYA 1KVSA 2WJ3A 4M22A 1O9BA 5CH8A 3N8GA 3E8SA 2CV1A 4LDAA 1YIDA 3NDJA 4A5OA 2ZYWX 4DV7B 2FUG6 1KVTA 1VRVA 2FUCA 1OYWA 3B7PA 3ZE9A 3I42A 1PZEA 4MV7A 4PQRA 4H15A 1Q2XA 1WBJB 1VGQA 3Q5EA 1E77A 5B1DA 5BUSA 3HCFA 4AJ4A 4RXMA 1VZ2A 1QBKC 1GUDA 1ZH8A 3I72A 3ITKA 3LY8A 3TRKA 2AXEA 2VAVA 4FLMA 4YHHB 2EFYA 1K6JA 1O4XA 3K0AB 1MR3F 2OCGA 4TMFA 3KC2A 1WXXA 4BMDA 3T52A 1KTIA 3B7HA 5I3ZA 3HJCA 1QTQA 4XLLA 2O1XA 1QCZA 1XZ8A 2FMKA 1YB5A 3KSRA 5EJ2A 1EFKA 4YMHA 2D8AA 3OJWA 2IH2A 4KRGA 4UNNA 2HA7A 4GR9A 5JNLA 2CFIA 3VR4D 2BZ1A 2SKEA 4F3CA 3PICA 1E9BA 1O2DA 2FR0A 5EESA 2D2EA 2IDZA 2ZXFA 4IIDA 2JK0A 5H83A 3GJ5A 5KOYA 1G8AA 2BJCA 4PRYA 4KG7A 1H0RA 1U0JA 3TEPA 3WDMA 1DXQA 2DR0A 1WWKA 2G40A 3JZFA 2ECFA 3O2QB 2IXGA 1YRAA 4KE7A 1JFVA 4IG9A 1MUUA 3C5HA 2D0IA 4WIAA 4A23A 1TAHA 2ECQA 5DSXA 3JXCL 2XZTA 4HTFB 4P92A 4KSCA 1UBLS 2MU1A 1ICIA 2CHGA 1YDHA 2Q3JA 1TK9A 2WAYA 3HKBA 3O9XA 5BYBA 16PKA 1NKVA 4OFXA 3KQUA 4HN2A 5FUQA 2MQKA 4LNUB 1R4NB 2VWQA 3V6MA 2QY9A 2NPIA 4YP7A 2F55A 1TAGA 2PR7A 4AP9A 3VR6A 1WDMA 5CDYA 4DT1B 2Q9CA 3A04A 3X1DA 1QQ6A 1MB9A 1YR8A 3S8QA 1Y8RA 3G8BA 5JXJA 1WU8A 4X4FA 4HDOB 2QTBA 5H3LA 3ORQA 4L6AA 1YMVA 1G16A 2V74B 1P2TA 4X5OA 4BGVA 1Y89A 3IO3A 4UNPA 3X2EA 1NJ5A 4WCVA 4QGBA 3HCEA 4YS6A 4D74A 4G8DA 3RC9A 3U3RA 3A58B 1PTKA 1W2WB 2V6JA 3AG5A 3GEGA 1CUHA 1X1DA 2IYYA 3JVEA 5EGNA 2WT9A 3H18A 2UYHA 3OSZA 4TXNA 1MW9X 3I8SA 2H00A 3ABOB 4QUHA 3KR0A 1QHIA 2L8NA 2HRBA 5D5HA 4Y1FA 3W1VA 3OPVA 3BH7A 1K3FA 2BFPA 4TVBA 2OQVA 4P9NA 2VHEA 2B61A 4FX5A 2BFDB 4WASA 3R9XB 1MBZA 4RVNA 3IUSA 1XPOA 4MIKA 4EG5A 3RJZA 1YAHA 5CDUA 5J58A 1B8UA 1KYVA 1JDBB 3EVDA 1VCHA 2XCSB 3O4IA 2REQA 3R7WA 1DC4A 3G17A 4MPJA 4FI3F 3SICE 1FP1D 3M82A 1COWA 2PZBA 3WGZA 3L7JA 2IRWA 1E6UA 2O59A 3PRJA 2QHXA 5L3VA 2JNWA 5HJ5A 5L4SA 4RPHA 1N5OX 1QZUA 3ACDA 3DWFA 4UEQA 2K5UA 3RS9A 1FMLA 4G1CA 1C7JA 2H2WA 4FLFA 5IJAA 2EYUA 3WK7A 1V9LA 4DRXA 3DAOA 2HMWA 2BM1A 4R1SA 4F9TA 1L4YA 1NXTA 2QVXX 3RNLA 4DZZA 3WOHA 4GX0A 3FTEA 3BICA 3MFQA 3DDCA 2ZRIA 1W5EA 1DC7A 2J6HA 2XEXA 2CVOA 2VBIA 5GONB 2B5AA 2A5LA 3JQ7A 5DBIA 1YE3A 2OZPA 3CUSA 3OZIA 3ZGNA 2XQFA 3FKSA 4JP8A 1W4BA 3FOCA 4YY3B 5GZ3A 2RHRA 3GPCA 1P9LA 2GCEA 2HPZA 5AUOB 1F0KA 3K1ZA 1OFHA 3LWZA 3IIIA 5F4BA 5MGBA 1OSNA 3MT9A 3KYBA 2OT3B 3RRYA 4KK4A 1KFEB 3H04A 4A8JB 1F48A 3A9UA 1TTPB 1WMAA 3EVAA 2HJVA 2W6QA 1AQYA 2A1TR 2CLDX 2WIBA 3UOWA 2PD3A 3K16A 1I7SB 3ISTA 2JKYA 1R0LA 3I3SR 2IPNA 1LPAB 4LI3X 4DQDA 1KP9A 2XE4A 5CEFA 2BBWA 1K4KA 1VPWA 3EIHA 3COJA 3JAKA 1KEPA 3PZRA 2BCGY 4FN4A 1SBQA 4D2IA 1A9TA 1U5BB 1ORRA 1VFNA 1CFZA 2DYKA 3GT0A 3QM1A 2EFCB 3K0CC 3RUHA 4HDNA 5DOZA 4BGIA 3Q7IA 4DA8A 4DXHA 3SEQA 4PZCA 4WZAB 1IUKA 2NQ2C 3R0JA 1WXIA 2YMQA 3RIGA 1MKYA 3NEJA 2EBWA 3NETA 4I5FA 3TLBA 1Z4KA 2F17A 1X2BA 1SUAA 3OOJA 3FMIA 4MVJM 4CUJA 3IHLA 3G2NA 1JWAB 1E32A 1KYXA 4QU5A 4EB8A 4N5IX 2P0AA 4BQQA 4QYIB 1YL5A 3JD0A 3LTEA 1K75A 1AKRA 5JJ5A 3FMYA 3DVSX 4EKYA 1L9XA 4XYMA 1FRNA 1U02A 4WLFA 1LTHR 2YCLA 2H17A 1Q1GA 4UM9B 3VJMA 1W46A 4L4UA 3PJDA 5I7SA 3ADOA 1QONA 3GZ4A 1OX4B 3C1UA 3O0DA 3VPCA 3V1TC 4ZOQI 3JTMA 5J4HA 1I3NA 2FPPB 2QM0A 1KQNA 3YASA 1I3KA 1HGXA 3DMDA 4R68A 3O47A 4EENA 4WPGA 3L7KA 2IA5A 2W6IA 2FU5C 4JCOA 2VJDA 1S5PA 3U7QA 3EZ6A 1EFVA 1KVUA 1UDCA 2X77A 2A6PA 4Q0MA 4US1R 4ZCSA 5HFAA 4WK6A 4IIJF 3L5KA 1UBRS 1M0WA 1W93A 2R8PA 3U49A 4TT3A 3D0RA 4Q3EA 5FPKA 2O8DA 3OOEA 1PX0A 5F7JA 4FOTA 5FXMA 1I13A 4E2WA 1GYPA 1BFDA 2RJOA 2Y0DA 1EFTA 1AQIA 4L5JA 4OHPA 4QM7A 3CBQA 3GK3A 3FB4A 1G7RA 5KQSA 1O94C 2X42A 1WH8A 3M81A 1RXUA 2DP4E 1CUDA 1LBQA 1BS2A 3BDIA 1U65A 3G7UA 2IIVA 3M0EA 4WGFA 5CXSA 4BO0A 3K9QO 4NYMR 4X00A 5IVDA 1TVKB 1JVNA 1RVDA 4XQGA 1E2NA 3DBLB 5FV7A 1XEWX 4ZV9A 4M98A 3KEMA 4UVIA 5LJLA 2BRUA 2H1IA 4PGGA 1ATIA 1K88A 2PX0A 1APBA 1G0OA 1PHPA 3DBHB 3VQTA 3HXOA 2HA5A 3AF2A 2QNRA 3D6AA 4I5DA 3PNVA 1U0BB 1OYOA 1OV4A 4H6WA 2Q4RA 5HTKA 1YS1X 3CTPA 1MG5A 3IT3A 3S3TA 3EGDB 5T41A 1GKYA 3EJWA 4GIBA 3GV0A 3VGPA 1Y1KE 5IDWA 4TV8F 1SCNE 4KL8S 1DBQA 4G07A 4MR8A 5GMOA 4DLKA 5BN1A 1XROA 1GGJA 1QRSA 3SE0A 1A8SA 1HOTA 1M8KA 2BD0A 4MVJE 3RQSA 3SC2A 1QYCA 1YVDA 2FW6A 3HBJA 3L1UA 1Z2CA 2VQ6A 2ZSKA 3V34A 3WP1B 2RGAA 4YMUA 4LWOA 5EHZA 4GKAA 1V5EA 1FDOA 1KK3A 4R6WA 1QR6A 1N6PA 1NPTO 3A9XA 5JAZA 3ICVA 3J7TA 2NT4A 3T3EA 3IURA 2NN3C 4PONA 2ZOSA 3RUPA 2V65A 2WDPA 3TYXA 4K6OA 3WJ2A 4CM3A 3RB8A 1MNQA 4KPUB 2XRMA 2GFIA 2J0QA 2FGKA 4OOFA 5ERXA 4JOCA 2QUJA 4ND7A 1KE1A 4QLAA 3TBKA 4IKPA 1ZZ8A 1IBKB 3LD9A 1G2OA 3PWKA 3ROXA 3PLAE 2P30A 2EYQA 5F2KA 3NHRA 3FUUA 5L3ZA 3GCDA 1Y9JA 3RV4A 1EXWA 2V4MA 4LK2A 4BZXA 2ZYTX 5CVDA 1N2HA 2IITA 3DFUA 4HB2A 4EABA 1QU2A 1Y9ZA 1IPEA 4G9EA 3OEWA 4EBFA 4H7DA 3KJZA 4GOLD 5BQXA 2QR3A 3DDHA 2EBFX 3PHIA 3MWKA 4RD6A 4R3UC 4HTAA 1L5YA 1NG9A 4HGOA 4IWNA 1QO7A 3SM9A 5DNVA 4PZZA 5J3JA 1GZ6A 2GA9A 2VHTA 3N2KB 3F2IA 2Q6LA 4OM8A 3L6CA 2HB6A 4A5SA 1NLFA 3L8YA 3N3BC 4L9SA 4PO8A 3RIMA 3T5BA 4DANA 4H60A 1X7YA 1QQ5A 2CK3A 3DBVO 3V2UA 5FEUA 4BFWA 5JZMA 3E0XA 5MHTA 2FSHA 1NC1A 1WVMA 2BM9A 1GTZA 3O83A 2B37A 3M5CA 4MW5A 4Q01A 4EEXA 5K09A 2RK6A 3K09C 4GPTA 1M2NA 1BQ4A 2XQGA 1MEOA 3N8DA 3E1GA 3GWZA 4LGMA 4Y2SA 5E8JA 1ZUNA 1KJ9A 3VO9A 2R44A 3NJRA 5T3YA 3HU3A 2FG7C 3ZDEA 3WXBA 3QF3A 4MI9A 5KIAA 3AJDA 1YVUA 5B12A 1WZEA 5KQRA 1VJDA 3JR7A 1JHRA 1XQYA 3BXGA 4OKIA 2XE8A 2H7VA 2BI8A 3F6YA 4ZO7A 5H82A 1VP3A 4V0OA 4J0FA 2HC9A 3WGTA 1MRSA 1KAMA 1DKMA 1QGZA 5I5EA 5IFKA 5JALA 1HXHA 5BMOA 1PKEA 1C4WA 3WHPA 1XEWY 2PLFA 1JQ5A 1UJ4A 1C9KA 2GYVA 2RC6A 5AMXA 4ZARA 3ZWKA 4BMZA 3BEOA 3UUFA 3ZTYA 2VWGA 3MQ2A 3NBFA 4O0MA 3NONA 4LZZA 1R4ZA 2PGNA 4TXMA 2G04A 1V5WA 3FPJA 4C88A 4EGAA 2WJHA 1JZSA 3ICPA 2LKDA 5GTDA 1FDSA 3CINA 4MQ5A 3OLYA 5GQSA 5J2UA 1J8VA 3PQEA 4UVDA 3RS0A 5LUBA 4O2AF 3B7GA 3CX3A 3G2KA 1YZ3A 2GK6A 4OL0A 2H4YA 1DTSA 2PLRA 2VYVA 2YASA 2DQZA 2E21A 4CCWA 4GE0A 5JC8A 3DPSA 4W1RA 3MSCA 4A3SA 1ND5A 2NADA 4LYAA 1IULA 4TXHA 3P2KA 1X2LA 1X3SA 3INTA 5IKPA 3ZJ5A 4XSVA 3A6DA 2CDAA 4X6YA 1A5BB 1JT9A 5TVGA 3WS7A 4ZI7F 3B7WA 3DEJA 1OXSC 1CUSA 2UZ1B 4GKBA 4MCIA 4NBNA 1CHNA 1R15A 1R6AA 4FJ0A 4X7PA 1VE3A 1MOZA 1FU4A 1KFCB 2EF8A 1XD9A 2AQIA 2J6BA 1TO6A 2OZLB 4P35A 2A86A 3JQDA 3WX0A 2YY6A 3GZCA 3IYLW 1SXJD 2IEGA 3FPHA 4NENA 2RAPA 4HT3B 2I4OA 3ETHA 1FUIA 4F8EA 2G17A 2HT6A 2VS1A 3OPXA 3IV9A 1U0NA 1A2OA 2YTZA 2C61A 3QV2A 3MSXA 4L50A 4QUJA 3HZZA 5K3CA 3GEPA 1WLSA 3AUAA 3EE6A 1Z45A 4KE6A 3FHLA 4HUTA 3L1HA 2Y1GA 4CKWB 2QTMA 3I76A 4JYMA 1G59A 5TS2A 1CU1A 2MINA 4MWSA 4X0EA 1M0TA 4RVHA 2QAGB 2WTEA 3GLUA 3ONNA 2LGJA 1A2KC 4ZC1A 1VLZA 4M1OA 1G38A 3WTCA 4JP2A 3GAMA 4CIAA 2EWTA 2OCDA 4X71A 5AKEA 2V4UA 2I3AA 2WQZA 3ZW9A 2M6RA 1JNXX 1QH8A 2GFQA 4B6SA 3IQIX 3VZSA 5GVSA 3G68A 4QYTA 2GASA 3ABZA 3BQNB 1CP2A 4I9HA 1L3IA 3LVQE 2ROQA 3HN7A 1FLNA 3GR6A 1Z34A 4BLTA 3MJTA 4BASA 1EGMB 3FG9A 3WGHA 4YCCA 1Y6JA 4BOYA 5GM1A 5CLGA 4ALKA 1HKHA 1W8IA 2F1RA 1KEEA 2P9BA 3KUUA 3ROKA 1SD5A 4MKGA 2QORA 2J9FA 5M29A 4UBOA 1M73E 4AS1A 1U9JA 3ELUA 1EM8A 2YYYA 4WSOA 2C8KA 1N0UA 3GLFA 2DERA 1J5XA 3N2ZB 4ZQHA 4A26A 4D0SA 1M6HA 5JSHA 2DC1A 1EFRA 1GEGA 1WMBA 2RG1A 2KHZA 2DCUA 4PNPA 1PZHA 3AUKA 3X2FA 1LDEA 1M2WA 2NNLD 3NBQA 4HQKA 4GX2A 3U48A 2IEAA 2C99A 2LUOA 2WC1A 4Q9HA 4WW0A 5THQA 1YDFA 4HSGA 1N25A 5ITWA 5JD4A 4TQUS 2W6JA 3P1JA 3UV3A 1OYYA 4KGVA 1U8XX 1VCNA 2H92A 2LVBA 4NZZA 5H9WA 4BEJA 3ORSA 1UF9A 3KQTA 4PYNA 4PY2A 4O2RA 1ULZA 2CD9A 2QZ4A 3ZHQA 2NO4A 3IPRA 3FBWA 4TZTA 2ZI4A 1P1BA 3CJRA 3V00A 3QVGB 4F8JA 4X9XA 1ENOA 2QLMA 1VBNA 3C6KA 1YJBA 3DMTA 3O8RA 4RKYA 1HZZA 5HW0A 5LP6F 2J9XB 4GDMA 1QPGA 5AVRA 3G0BA 3PFIA 1P5ZB 3L43A 4MROA 4CL3A 1Z0AA 1ZJ5A 2CJYA 3JWJA 1A9ZA 3A37A 3COZA 2YRXA 4BIIA 1UADA 1DBPA 2QUAA 1NXSA 1SU8A 4IHJA 5SZIA 3DAHA 1R8XA 4NP6A 3ZJVA 3Q3CA 1DE0A 1L7RA 3KG2A 5K8LA 5L4NA 4ZT5A 3IPXA 2HPVA 3NXHA 3SFZA 3LO5A 3EFEA 5D6OA 1DCFA 1XHFA 2JZNA 1EFLA 1W8DA 3DR3A 4R01A 5GJWC 1ND6A 3KELA 3TZBA 4LDJA 3IP7A 3A06A 3K71B 1BXGA 4FGWA 4HQOA 4I4TF 4BX2A 2UKDA 4A1OA 3N2NA 2F62A 2DTEA 3MRTA 1OLXA 3MWEA 4Q37A 4HDSB 1Q7RA 1W19A 3PP8A 3I52A 1BHQ1 1YCDA 4JJ8A 1R4MA 4NJOA 3SJZA 4OA5A 4EB6B 3G23A 4JB0A 3OO1A 3TG8A 3ZE7A 3KQHA 1B1AA 1BW9B 5KDLA 3VAYA 1PFKA 2Z2YA 2GZ2A 3FZQA 4HKTA 5DO9A 3WHIA 3WKDA 5C8XA 5K3OA 3DMPA 4ZHQF 2FA9A 4W5RA 4G0VA 1XDBA 1Z62A 2NSYA 4A2PA 1CF2O 2ET6A 3VR5D 2VBGA 2RI1A 5A02A 2IXFA 1JHUA 4OU4A 3WRWA 4E3ZA 5FH9A 1DBSA 4YJ3F 3ZBQA 2P2CA 4D4JA 1F7UA 2XR1A 1SOWA 1IN5A 2R84A 1DG3A 3NQ41 2QRHA 4MQ4A 3GLHB 5A5GA 1HDYA 3CKLA 1M34B 1HYEA 3DP9A 4EMTA 5L8VA 4K9NA 4KXNA 1AXRA 4JOSA 4WA8A 4YACA 4DIEA 2VF2A 2FSFA 2IODA 4XQ9A 2UU9B 4FFMA 3FE2A 4PBRA 2R25B 2ZTHA 4PTZA 2PR2A 1KEUA 3R3YA 2Z2XA 2B2XA 3OKPA 3TIIA 2VEDA 1RT9A 3VKHA 1JUDA 1NF2A 3KXLA 3L05A 3IKTA 3H4VA 3E05A 1CUEA 4AO7A 3LC1O 1KSJA 2P69A 3ECCA 4YCLA 3I6IA 2IFTA 2PX3A 1UBMS 4RSRA 3CJTA 5EQTA 4CKZA 3EZLA 3ZDAA 3I58A 5G4LA 1Y7IA 1LI4A 2QTVA 4DC9A 5BUZA 3LIIA 4XWWA 2Q9BA 3LYLA 4UFOA 4KZPA 5JTUA 3BMOB 4NCKA 2YNMC 2X15A 3F8SA 3I64A 3VPHA 2Q0QA 3IP1A 2FPXA 3L7IA 3VKUA 4S2EA 4GPBA 4JV5B 2WF5A 4BUCA 1D6MA 5ED0A 3U7FB 1QHNA 4TV8B 3V2GA 3UKJA 4KIJA 3FJ1A 2KZ8A 5ECWA 2BJWA 1ADFA 3FRIA 2XJ9A 3L0DA 3NEYA 4XM2A 4JXJA 3I01M 3UV7A 4DSAA 1WPGA 2FUEA 3LBNA 1KI7A 4MJXA 3O90A 1DAKA 1CZHA 3OUZA 1DOAA 5EC8A 4DMCA 4L7QA 1NMQA 1TCUA 2ZT5A 1Z28A 1X1CA 3L0BA 4OXYA 4REOA 3IP3A 4WY5A 5B4TA 2P9JA 4GOKA 1P17A 3CXUA 4G9BA 5DBOA 4HGYA 4YXWD 1K06A 3C7TA 1ZNZA 4DLXA 1EDDA 1I94B 4J1QA 1ST3A 3WYAA 4F5WA 1DV2A 5IAGA 4M99A 5IU6A 3FH0A 3KYJB 4MYSA 4NS1A 4OLHA 4DV4B 3V1LA 3R3JA 2AOTA 4Y6QA 5GAHi 5K6AC 3TI9A 3GFGA 3EPHA 1MT3A 1PUIA 3DOIA 1Y4AE 3M1LA 1NQTA 4RACA 4AK9A 3OIVA 4U02A 3HL4A 4J7AA 4ZOBA 4NFLA 2QY6A 1PQ4A 3LOUA 4LW8A 5JFGA 4IQ4A 5BYKA 3Q9SA 3LK7A 1KEVA 3LUFA 4GF5A 2QBYB 1DO8A 5EQJB 1MOPA 2PMEA 1E2JA 4J91A 4J1WA 3CZPA 3VZRA 1ZI8A 1S6YA 3DQQA 3JAWB 2GZMA 4L08A 1L3BA 4F12A 5KNBD 5A4FS 1XU9A 3AY7A 3QRWA 3G9TA 3OC6A 4IOMA 2YBDA 3W1WA 3GLIB 3VH2A 1WKVA 8ATCA 4NJEA 3S8YA 3SNHA 4JVSB 2O8FB 3ANMA 3KEGA 4LVCA 3G5MA 3BZWA 4J0GA 3UJ6A 1AZTA 4P1ZA 2YIJA 1GADO 1OJLA 1QAOA 4DJJA 4UEJA 4JEUA 4L28A 2X3FA 4MJLA 5TJHA 4EGSA 2L2QA 5FNVA 4YQFA 3AOGA 4D9KA 4W1SA 1U31A 3E9MA 1JL3A 2WZQA 3M2PA 3MUOA 4IDHA 4EYEA 1UXDA 2HNBA 1WCWA 4YV2A 2DWPA 4S1WA 4O2BF 4TKVB 2EF0A 3DNMA 4GBMA 2QYTA 2B0CA 5JHHB 1GGNA 4CL8A 8GPBA 2XODA 3EZGA 2I9PA 3NIFB 1QH9A 1XF9A 1O5IA 3PXCX 3TFLA 5TPZA 3Q7SA 3OEHD 1VIDA 4L8YA 1EK0A 4YT8A 2C5AA 4YA6A 1PL7A 2LYJA 4IKEA 1QS0B 4GZ3A 2ZWMA 1W1IA 4LG1A 4DNOA 2ZJ0A 4KOAA 4NU0A 4DW8A 1WKCA 3FOAA 5ENDA 2VDMB 4C03A 3U9SA 5IDXA 1JJAA 4FWTA 2NTVA 1Q3HA 3T3MB 3WLNA 2FFRA 4AG5A 2XADA 3RAFC 3LYHA 4O2AB 1MZPA 5BT9A 2I7TA 1UXKA 2P91A 3WQQA 3GZDC 1RJWA 4BFLA 2CCKA 2XXBA 5DX8A 3KEFA 2AHRA 3WWYA 4PG7A 2QTGA 2WAAA 2JBAA 2H8GA 3U39A 1Q14A 1E1CA 4HLUA 1FLDA 2G5CA 2D5LA 4B43A 2O1EA 2V6MA 4ZI7B 2CFCA 2DHQA 4TM8A 1P72A 4CMEA 5G53C 1SQ0A 2I76A 1A4RA 1N3YA 2QJTA 3QKIA 2G0NA 3AFNA 1GKUB 1XLTC 1K7XB 2OR3A 2QPLA 2VRNA 3FVRA 3L1JA 4IH4A 3N39C 4UD2A 3C2QA 2ESRA 4M89A 2AR7A 3VR0A 3ZK9A 1VE5A 3H0EA 1RXVA 4DWOA 2BFEB 3V8PA 4TLBA 1RKVA 4INPA 2OQ2A 4PAGA 5IH3A 1IOLA 1O96B 1U3WA 2ISQA 4QBHA 4RFLA 1ECGA 2ID8A 4XGNA 4UOEA 3QQPA 1JHQA 2HN9A 2P6MA 2X2OA 4Y9SA 3ZDZB 3T7IA 3EVNA 5FT9A 1UC9A 3EAGA 5KJCA 4DUPA 1PNVA 4HQNA 1L1MA 3TQQA 3BM5A 4X91A 1ZVQA 2QLNA 3C97A 3G7SA 3NCTA 1OT5A 2IUOA 4G5FA 4RZUA 1Z2DA 2ZIAA 3H5NA 4Z5CA 2ODBA 2L42A 2OAEA 3PITA 4BNFA 3FNRA 2C96A 3MIIA 4CIYA 3OQIA 1XZEA 5HCUA 3PQ3A 3OU2A 1A1SA 3KHTA 4AURA 5FOQA 3NP9A 4RPJA 2HQBA 2P1RA 4MUYA 1DT3A 1G4HA 1A04A 4IWRA 5FULA 4EG7A 4X62B 1VL6A 4RA6A 1T2CA 3D81A 5J47A 1T2UA 4TN1A 2AXZA 3MXTA 1OKKA 3TM5A 1AKWA 2VPYA 3LQYA 4AG3A 4DV5B 1YS9A 2CDNA 2WWXA 1OLUA 3C43A 2WAXA 3CZRA 4MMZB 5EE9A 1L7DA 4N8SA 5D3QA 2BFCA 4M8LA 1T6BY 2BEWA 2C9OA 4BFXA 1Q50A 3ZUGA 4PO1A 3GJSA 4QXOA 3W3AD 4OP2A 4MWGA 4CN9A 1P4JA 4QT4A 3MK31 4QA9A 1X1EA 3DXFA 2VQSA 1PHRA 2VHUA 3GW8A 4U0JA 5IXYA 3I0ZA 3VVMA 2VZ9A 1ZGHA 4LC0A 5K1ZA 4DDKA 2PRKA 7AT1A 1ZUHA 2I22A 5AW3A 4C5BA 1HOXA 1UPUA 2JAXA 2VI5A 2WVJA 3DAYA 5T5QA 4F21A 3G8AA 1XPRA 2IDKA 4B83A 5IJ9A 1QTIA 4TTVA 4RSGA 2OCYC 2CGEA 1G1AA 3NUZA 1YCFA 2QLBA 4XM1A 5A3VA 2PRYA 3A9CA 3GDOA 1AKQA 5F23A 1UDWA 3VA7A 3G5LA 1U9IA 5EA2A 2KJQA 1OD6A 1C3OB 4HYEA 4BB9A 5K8IA 1Z75A 4EDHA 1TECE 1N92A 1QFSA 4PLHA 4ZPXA 4J90A 2ZB7A 1EU1A 1TKRA 1J7KA 2B4TO 3D1JA 4IUDS 1PDOA 1JPJA 1E4EA 3ETDA 4ARBA 5KJFA 1ZMBA 2WTUA 4PU7A 1UAAA 1LKZA 1W76A 4V0RA 3FOFC 2W6OA 2XWPA 3IUMA 3K4QA 2PJRA 5LP6B 2PE5A 3M4JA 2AWIA 4V0QA 3H4TA 2NUPB 3PWSA 3R41A 1FNBA 1IMOA 2B8WA 2J07A 1N8NA 3EUFA 2HFKA 4BBZA 4JT8A 1Z7GA 3JQ8B 3UHJA 4ZVMA 1CEYA 3NZLA 1BC5A 2JBHA 5KYNA 1RJFA 3GOQA 1P1FA 3MTIA 1BMFA 1OZ0A 4MR7A 1LBSA 1YQDA 2ZITA 5DGXA 4HH3C 2C7OA 1SM4A 4PZDA 4QQRA 1GZDA 1N3IA 2FSUA 4L6IA 4YRLA 5IF3A 4JX9A 1JDTA 5U4QA 3KWLA 3OCWA 5LQNA 2A2ZA 4BQPA 1G18A 3T3HA 3S2EA 1JEAA 4TWBA 1WABA 3ZZTA 4I4TB 2X4IA 4ZYXA 1NR7A 3D6JA 4RHXA 4KRXA 3ZY3A 4GVPA 3RQIA 1W94A 4OKSA 2GPNA 5C9ZA 4KQXA 4QYWA 3OIFA 1K63A 2DPHA 3W3ZB 1MZVA 1HQ1A 3PWZA 4BX0A 3HR7A 4C7XA 3OJFA 4ZAXA 3INRA 3MC1A 3VPSA 5JCOC 4ZHQB 4B6PA 1G8KA 1Z4NA 3T1QA 1X94A 1S9DA 1NRIA 3BXHA 2XOKD 3PS9A 4OLBA 2ZZMA 4MTCA 1IOVA 1KGSA 4NULA 3NH6A 5B30A 2VP9A 1Q0UA 4X61A 4YJ3B 2COUA 3KZKA 4L0CA 3U4MA 2WB4A 4MGZR 3PUHA 2HMTA 3E9YA 4FPXA 2CLIB 2Y2VA 1DEHA 2Q4EA 3JZDA 3AB7A 2CXTA 2IYWA 1BXRA 4MINA 5BWCA 3TNYA 2NXEA 2TSYB 3DKIA 1ADJA 1TC2A 4HH4A 1OF1A 4MPDA 7REQB 4IGEA 3U6KA 2Y1KA 5MFZA 3BG5A 3PCTA 3PXBA 4B75A 2PSFA 2LR0A 1K6MA 5ENZA 4YMWA 3P0FA 2XX3A 3L4KA 4MCJA 4L6CA 1RJ9B 4OQDA 4RGYA 3FB1A 1WHSA 4OREX 4M8IA 5JJLA 3E6AA 2EWVA 4KO2S 4E46A 1R3DA 3R3UA 1HT0A 4FHFA 3O3OB 1WIZA 4WECA 1NVXQ 4FFBB 2V5AA 1GXSB 3FSJX 1J09A 3IDAA 5BW6B 5LWQA 1ZHFA 3I28A 1HM5A 2PAFA 1R0YA 2XBUA 4NYIQ 4UJ5A 4UU1A 3TMAA 1R5JA 3AT1A 4MW9A 5LZ4A 1WCYA 1K7SN 1N7HA 1YACA 3OWXA 5JRDS 2WSSA 3H1AA 3IEXA 4AY5A 1TCCA 5FF9A 3GDGA 1YNOA 2DVMA 4DLUA 4K1XA 4WXYB 2EWMA 2BHSA 2XVMA 2CMDA 1FXWA 3M34A 4ILEA 2YWJA 1RPJA 5EWMB 2VTBB 1L1RA 1DOHA 5JBIA 3LHIA 5L45A 4H0CA 4HDRB 4B45A 4R9VA 3U1VA 2PKXA 5KYKA 2YDXA 2D62A 2HTFA 4Q4JB 3AGPA 3RDPA 4ICIA 4OBWA 1EGAA 5CD9A 4JSYA 4XB6B 3EOAI 3LA8A 3AZPA 1ZOSA 5BVGA 2NO1A 3WRXC 1J42A 2O8NA 4N5NA 5BNZA 5KWJA 1A4IA 4H0NA 1G2QA 2JFQA 2MSCB 2YQZA 4QDXA 3RSCA 4RWZA 3SJBA 1SB8A 4F2HA 1FW8A 2FFBA 1HFEL 2VIIA 2FR8C 3N0RA 2PO7A 2XKKA 2CUNA 1J2TA 1VBMA 4TL6A 2GN1A 4CWAA 1Q21A 5ED4A 1I2ZA 3CZ9A 1SCDA 1Q15A 4JOBA 4QWWA 3RBVA 1L5RA 1V7QA 2RB4A 3KVYA 3LXXA 3RT9A 4EELA 3H5VA 4L02A 3HM2A 2P2YA 3Q9LA 5K5EA 5DHAA 3NUQA 1ESMA 3ESYA 2P2NA 4L57A 1H85A 1XTIA 2FK7A 2F4VB 2GF2A 3D4LA 1JWLA 3CZQA 2G6TA 2M6KA 1YT5A 3R6LA 2BJVA 3RAPR 3LH5A 2AFHB 3DVRX 1ZONA 4JL6A 3GRYA 4I4CA 3V7NA 3UVEA 1U4OA 1TJ3A 2FE4A 1DFGA 1CZNA 4KFSA 3OX4A 2G63A 3CLTC 1Y5MA 2QL9A 3CF4G 4ZK2A 1ZMTA 4KYTA 1ZZ7A 1E9EA 2FXVA 2EZTA 3TTSA 4DMKA 3WZLA 1VKHA 4NZ9A 4G26A 2ORWA 3HYNA 5A2GA 4JKYA 2GEBA 4H18A 2QJOA 1B1CA 2A9QA 4GZLA 3S2GA 3ZGOA 1LWNA 2HHLA 4D0LB 3ZPXA 5ADVA 5G0WA 5TQVA 6LDHA 1NOKA 1RXEA 1ZH6A 4FKZA 4O2BB 3ZZMA 3P2YA 3AEUB 4BNGA 3HTXA 1AN9A 1OFIA 3ZU5A 4DYDA 4PX9A 3M49A 4PO3X 2GJKA 4BNUA 4JBWA 1A9OA 1QVVA 3JD2A 4R1NA 4UUAA 3RREA 3SHWA 3U37A 4GKKB 4D42A 3GA0A 3WLFA 4CQJA 1JA9A 2J5RA 3B9QA 3PUZA 2Q3HA 3HMKA 3BIWA 3P9XA 2ZYDA 3PBKA 3RO7A 2QP3A 1H6BA 1P6UA 4A36A 2FRVA 4F1JA 3K70D 2YC2C 1YH3A 4K9OA 4Y1GA 2QMHA 1T36A 1GRNA 1ECCA 1J8DA 1F5SA 3IJPA 4AZ3B 4HLCA 4KR7A 3S27A 4TSRA 1QFZA 1T1SA 1JYSA 3QWBA 2W71A 1ZS4A 1DUIA 4FNAA 4LRSB 5SV2A 1TIBA 1E5LA 3FYAA 2VYNA 5B4UA 1OVGA 5KSYA 5C3UA 3LX6A 2ZULA 1EWTA 4EATA 2A5YB 5AXBA 5C8YA 9ABPA 4BO5A 3N7AA 1UQUA 1X1BA 1X9GA 3P4YA 1U0FA 2J0UB 2KX7A 3WBFA 5GVRA 2ACEA 1XVIA 3E22A 3WGQA 5BP7A 3DL0A 1GQOA 2QN7A 4BCDA 4P82A 4JELA 3C4JA 3I04M 1A2QA 3MN1A 4K9SA 3V8MA 3IBFA 4OPMA 3O8CA 2ZB4A 4HX2A 3PB3A 1LVGA 4RV5A 4Y7CA 3SXJA 3ZHUA 4FVTA 5LC1A 2H2DA 1P4RA 3VR6D 4CEJB 4ZI2A 2GO1A 1WNFA 4IZ6A 4KXWA 5EIWA 3UIEA 4Y6SA 2R3SA 2CV0A 2XVYA 2ZKIA 3FDFA 2B9EA 3D3WA 3IXMA 2EFHB 2R9VA 3D7SA 4KP7A 4EYGA 3WWEA 2JCYA 1DLJA 1G98A 2ODPA 3VU3A 3HN2A 2C9CA 4LBVA 1YI1A 4JQZA 4U9HS 3FUXA 1HYQA 1IBSA 3KE8A 1RFGE 4BLUA 5AW2A 4B80A 3HVRA 2FHPA 4N76A 5J2TB 5CVVA 1RJDA 1VDZA 2AC7A 1SXIA 4EJSC 4JN6B 5EXTA 2VHCA 2VT2A 2OORA 3QMVA 4KQFA 1MP0A 4MI1A 3L93A 2D0OB 3T7TA 3ZLVA 4FGUA 1PGQA 1M6VA 2NUBA 3LUGA 2FP3A 4TRNA 3ELWA 1IZ8A 4Q12A 4PQEA 3EVTA 3FYDA 2OFWA 1VZ3A 2C88A 1E96A 1G5IA 1HLDA 2AR0A 2G4LA 2WZDA 4NS4A 5GADl 1E4OA 2I65A 1QVAA 4LXUA 2JKZA 2OXTA 5BMVA 3C3BA 3RRZA 1XGKA 5J2UF 2IEDA 2VSQA 4TS4A 3UXYA 1XTUA 3GD5A 4KTVE 3FDZA 2XKAA 1GV1A 2FN7A 2JI8A 3EUAA 1FCJA 1SEVA 2A92A 4GWGA 5HEKA 4QUDA 4BJ1A 5BUCA 1COWD 4NBUA 1JR6A 1IDOA 3TEFA 3VC7A 1PNTA 3ZIUA 3DS8A 3FY4A 3WGIA 4RGBA 3LVRE 1P80A 3MTGA 5DWQA 5DTMA 3B36A 3E8XA 4ZGGA 3ACBA 5I7UA 1I4TD 2QM8A 2VATA 1J24A 3K9BA 3FBTA 2F8TA 2B99A 3O03A 4RTNA 2LD4A 1JEOA 1UK6A 2JEZA 1AKYA 3N2GB 4IFBA 4HXGA 3LP8A 4B3RB 2ZYVX 3CW2A 3PGLA 3EGCA 4GG1A 1R0SA 2YJGA 1LPMA 3HKBB 4XIYA 5I7HA 5FI1B 3TZLA 3UWKA 5K3EA 1WW2A 1YZNA 3HM9A 5M3BA 3I37X 1PRVA 3TFWA 1XKLA 2WVHA 3VU0A 3L7NA 3AETB 1PNOA 2C2KA 4OHXA 5TPWA 1Z2EA 3FKSD 4HAWA 4L2IA 1ZSYA 4HLDA 4EQ6B 2AWOA 3FYUC 4GU5A 3VTKA 2SNIE 4PTLA 1I30A 4CEIB 1IY0A 4RH3A 1JKXA 2VDRB 1KHHA 2JH8A 1U7OA 2PUTA 1IZZA 5JS2A 4BQEA 4YQYA 3DT8A 3NI2A 3R75A 4GVLA 4Y1EA 4OCZA 1HE1C 3RT7A 4JP5A 2BR3A 3RUAA 3WGMA 3EXFA 4PYRA 5JMWA 4TMXA 3AK4A 3WFIA 4FW9A 1LEHA 3BK2A 4UUNA 3EG9A 2C4VA 4LZPA 3WDKA 2YY7A 3IUPA 3G6WA 4HGNA 5HHTA 4I50F 1E5XA 1GUYA 2D1SA 2GSWA 1L5MA 4LMRA 2P1ZA 3WJ7A 1Y7HA 5C5DA 4OXIA 5KOHA 1WY5A 2UVPB 1CQIA 3AESB 3D3JA 1J22A 1HC7A 1XWFA 3KB6A 1Z5OA 1Z6PA 3RSSA 4EAAA 4O08A 1R12A 4V0ME 3NGLA 1AY0A 3QP9A 3C5VA 4YDRA 4BUJA 3GI1A 4MI3A 5AUPB 3ZD8A 4YVFA 2JFWA 5DNEA 1TUBA 1W34A 4NBVA 4H3VA 4X95A 1QPZA 3QU4A 5TE9A 5AM5A 4M6WA 4JI6B 4GH5A 3TJZA 2BI7A 2H1WA 1T8TA 4NI5A 4BS9A 1IBMB 3JYHA 4IKOA 1ZIOA 4ZZ2A 3PEWA 1I7DA 4EHDA 5JQGA 3N8IA 1EVJA 3DOUA 1X6VA 3G8YA 4R16A 4HS4A 5AVKA 1QHEA 4DCVA 4U5XA 2W6PA 2DQSA 4J9UE 1OOEA 2XGSA 3GQBA 3UK6A 4DZRA 2AUTA 3JQBC 1JE1A 2BGLA 1PUXA 2CNWD 3VNUA 1GNLA 2XMRA 5JXHA 4C6HA 1YMUA 1M2OB 1VBKA 1D5WA 2W6ID 2Z8ZA 4A03A 5FKJA 4RE6A 3RUFA 5L6LB 3T3DA 3PXDA 1X77A 4DEXA 4FSXA 2B7CA 5JAQA 1O4WA 4C2AA 1X8JA 4G6ZA 4BL5A 3HA7A 5CMLA 1W36D 4TT3D 3O2SB 1E3MA 2YX1A 2PMKA 5IARA 4MVJH 5B58T 1K7YA 3PLRA 4HFNA 3LECA 1VLJA 1NFRA 1OQAA 2BONA 3FWKA 3O9ZA 1Q3KA 3P7MA 4V3CA 2H0AA 3L8ZA 3V8QA 3SYMA 2PL3A 2ZTMA 3CVOA 3L6EA 4TYNA 3MWFA 4OGLA 3DEFA 4XB1A 2BSAA 3GRPA 4J4TA 3W5CA 4ROTA 1RWNA 2BEUA 4ZT6A 4CMIB 1MQAA 2EJUA 4HDNB 2HSZA 5EJIA 5J9FA 1R3UA 2RI0A 1IJEA 5FQOA 1XN1A 3GT7A 1CJMA 4HWTA 3MHTA 1C1XB 1JEQB 1UZUA 2OD7A 1XZLA 3JSAA 3TZQA 1WOYA 1K98A 4YAGA 5A5FA 5JOQA 4ZXPA 3RBAA 3L4JA 1S2MA 2W6CX 2G5PA 1E7RA 3UKOA 3IUYA 1CJKC 3QFTA 3O91A 3DEAA 4BFSA 4FGZA 1PSDA 3OOHA 2RGDA 2JFYA 4M0MA 3UK1A 4MV0A 4PPNA 1V5GA 4FFOA 5IT4A 5HF6A 2AKAB 1DNPA 1O08A 1J0DA 1GRCA 3BFPA 4FNOA 4P58A 3JD4A 3WKBA 1UDXA 4WNCA 1SBIA 1JAZA 2MIIA 5JYEA 1AGXA 3NWJA 4P3YA 1PERL 4BLQA 3IMEA 1E6EA 3NV7A 1XHEA 2ORED 5JAOA 2OSVA 1UBKS 1UOPA 3TTWA 4B4OA 4BVFA 1DADA 3BRCA 3RYHA 4BDSA 1ZY2A 4MOWA 5KQLA 2YIDA 5ALDA 3K0CA 4Y2UA 2W70A 3W4JA 4OAPA 3U7QB 1S2NA 1FJXA 2DH6A 3CEPB 4GKVA 2I6UA 1KJYA 1IY9A 1K2WA 1PR5A 3TPZA 4OM7A 4XZ3A 5ADUS 3W5AA 1LSUA 5BNWA 2FN4A 1K92A 1NVWQ 3BOSA 5BQ5A 5BN5B 1AS2A 1MIHA 1KOJA 5DRYA 3IHTA 4FHZA 5EYPA 1BCSA 2TECE 2W0SA 3EHDA 3TNFA 1GG2A 1YHZA 3DT9A 3BH0A 3QUBA 2I7XA 2ZJ2A 3X1JA 4IHAA 2NSHA 3NTVA 3MOIA 4V2UA 2ZUBA 4FCVA 2F1IA 1J8MF 2EW8A 3UT0A 1ITZA 5JAPA 1E60A 1P45A 4IW3B 4LHYA 2JGJA 2X6QA 4K0RA 4AN0A 5K98B 4K9MA 4ZI3A 2FVXA 2GCNA 4LZWA 4RK5A 5DP2A 3V32A 2B20A 3M9XA 4S1PA 4D41A 2ZREA 2R8XA 2WP0A 1JG4A 3L8MA 1WRBA 5CYOA 3UG7A 1E0DA 3LC2O 1ZK1A 4MAMA 3MD9A 4FS8A 3D8UA 4XRRA 3UGQA 3BDAA 4U39A 3L6DA 5ENVA 2EU8A 1EGQA 2PMDA 4MR8B 2EJWA 4EMSA 3UJPA 4DQUA 4KKXB 2PIDA 1KDTA 1LTQA 1ULUA 3R9WA 3OKCA 1YK0A 2QF7A 3U7IA 3EY4A 4MS3A 4I55A 2R86A 4D79A 5LU9A 2D4AA 1CE8A 4H16A 2YHIB 1E1QA 4HOYA 1GU1A 5E6UB 4IDEA 4J2TA 1O94A 3OAAA 3HQ4O 2MSEB 4WJKB 5IVKA 3HCNA 2ILVA 1SPXA 3ASZA 1X0XA 3O84A 4GP6A 4MVYA 4B3JA 5CCXA 3THWB 1TT5A 3AVXA 4MEBA 3AR5A 4BMSA 4WXEA 4V2IA 2GT1A 4PS0A 1QYVA 4ALNA 1RHMA 3IA2A 1N36B 1IATA 3EUWA 3TFQA 3VAZA 1W581 3B13B 1LLIA 2JLQA 4JDUA 1V71A 4ZCIA 3GRAA 3H2GA 4MPRA 1FTQA 3A4NA 3QLVC 4NCHA 3KPYA 5CHYA 4AYTA 3BIJA 3AUSA 4A6DA 2DRIA 4H6PA 3RVKA 2PVSA 2H1HA 3CF2A 1AUPA 1YASA 3PR2B 4NARA 3ZHVA 2XBMA 4FZ3A 5FUMA 3LPLA 4PBSA 1S3GA 4B2IA 4DIBA 1SG6A 2Q45A 2IS2A 1WDTA 2HMAA 2VYVD 3BGDA 3FX2A 5H4GA 1JKIA 1E9VA 3DXXA 3H3FA 5DK4A 4W4TA 2O8CB 5G3YA 2BFFA 3ENVA 4MW1A 5AHKA 4IOKA 4N5HX 5L7TA 5IP5A 4CQLB 3N05A 2OM6A 4JIMA 4HAVA 3ETCA 3PJFA 4FGLA 3P9KA 4JMLA 1OC2A 1VMIA 2JVLA 1SA0A 2FJPA 1FFEA 4WL0A 1CTQA 3LZCA 1EP9A 2IY8A 3K30A 1H66A 4H35A 1NVBA 4QUAA 7YASA 2A57A 1DC3A 2O4CA 1GAQA 2O05A 3D9QX 5CCDA 1NV9A 3GN5B 2HREA 3WK8A 5LQCA 5FTKA 1OB2A 4UNRA 2ZUFA 2ZI3A 4R8KA 3U7HB 2BC9A 3MWDB 4K26A 4OQPA 1YUNA 4G2NA 1L4UA 4WKGA 1ZD1A 3R5TA 3DUWA 2ZR8A 5IVIA 1ZM2A 2VNHA 1QRTA 4ZVOA 4YJHA 4TL7A 1FQWA 4ND6A 3G2MA 2HRCA 3EWAA 4R1UA 3SBXA 1ZVJA 2PQ6A 3VPDA 3KJIA 3SS8A 1Q19A 2OBFA 2J0EA 3QVXA 1BE1A 2J3LA 4X6UA 3RANA 4BFCA 3T9AA 4EA7A 5BR1A 4LGVA 2TMYA 3ILSA 4CT0A 2PXBA 1PG2A 2VZLA 3RASA 2QD1A 3KZ3A 1I0ZA 1OGYA 1AK9A 1KKLA 1MF7A 4RQAA 4G1MB 3N5KA 3SMQA 1A82A 1YKSA 4MUKA 3UWSA 5KNCH 2CKMA 3LQ2A 3AY3A 3K09A 4QX6A 3QITA 4XQCA 5JJCA 1WSWA 1YR7A 4LQDA 1VCIA 4RZQA 2FSPA 4F2PA 4UVEA 2FWIA 3WHKA 1R0KA 4HEHA 1O6BA 1E0JA 2PCJA 4YRGA 2YBEA 3ZE2B 3GUCA 5FTLA 3AINA 1KMQA 5A6SA 1GQSA 2B4KA 4DJAA 3FLBA 1LMB3 4I14A 4JYPA 4MKHA 4QWMA 1UP4A 1HDGO 1KYIA 1KY3A 4MO9A 1QLHA 4I8XA 4J75A 1TGYA 2XA9A 4PYKA 4BKOA 4BX8A 4BFUA 2WINI 4B3DA 1ZQ9A 3FMVA 1L5VA 4RTSA 1EFRD 2JAQA 1ZUD1 2ISCA 2O0MA 4XUDA 5DVZA 5COAA 1XVUA 2JB9A 2O38A 3H8JA 2ZQZA 3TQHA 3QHQA 2PUHA 4TTAA 3ORYA 3WVNA 4D4HA 2XHZA 4NBWA 1Q57A 2W6JD 1GR0A 2PZAA 1E6WA 2X1HA 1KDVA 3RTCA 1TQ6A 4ZAVA 3U19A 1U3FA 3JQFC 3P9IA 3H2IA 1E9AA 4QXQA 3MWLA 1JU3A 4K87A 1PT6A 3HU5A 5LD2B 1XXLA 1JMKC 2EG5A 1XMVA 3WADA 4YDQA 5KNDA 3RK4A 1EFDN 1PO7A 2D1TA 3PHJA 5AJVB 4ZMSA 1QOQB 3Q5GA 5H16A 3DC7A 4IYJA 1HQKA 3GVHA 1PYDA 3RK0A 5BSGA 4I1UA 3REQB 1MPTA 1XCBA 2BPOA 3EPPA 4UCXA 3IUQA 5EWLA 1T1EA 5T3UA 3ZQ4A 1PR1A 3HXQA 3CA8A 2CXSA 4YH1A 2CCJA 3IAAA 3UQYS 1E4YA 4IXDA 3PIIA 4U7TB 1L7MA 4Y98A 4G4SO 3BILA 4I50B 5JO0A 3ZHYA 4GFDA 2PUEA 3EYWA 5EKXA 2R68A 1L8OA 1N4DA 2R6HA 3EZ2A 4E03A 1Y3HA 1RKXA 3A4VA 2VNIA 5E0KB 3SSNA 2D59A 3FOEC 4RE5A 4Y6PA 4GSYA 1UMBB 3SVZA 4AF8A 1YTUA 3F4KA 2ZI5A 4Z59A 3LPNA 4WOJA 2VJMB 1RC0A 1IY8A 1JNYA 3HZIB 1Q0HA 3HBMA 1F4LA 4HNAB 4CMJA 2UXDB 3R0IA 1WMDA 4YJKA 3WL6A 3WAJA 1ENZA 1GKIA 2GBFA 2WE7A 3DP7A 3ZC3A 4DADA 2BI4A 3FCYA 3Q41A 4DUYB 3U26A 1AQJA 4MNTA 3UMYA 2FWRA 4WESB 4GR4A 1M5RA 1RQPA 1H05A 3LBIA 2FN9A 5EZ5A 1ZN7A 4GZ5A 1PGNA 3VHQA 2P9TA 2ODTX 1CKEA 1EBUA 3VDQA 4S1TA 2OC9A 2PGAA 2Z04A 3AFHA 3WNZA 3AKCA 3G82C 2GHQA 4X1KA 4CGZA 5D01A 4MKFA 1T5SA 1THTA 3U16A 3SR0A 1TEZA 1V2HE 1WUYA 4IGAA 2ZIXA 1Y7YA 1T6NA 3Q9UA 3W8NA 5BN4A 5BWMA 1HF0A 4CR7A 4DR4B 3DE5X 3NX4A 3P19A 4JOQA 4M9QA 1X70A 5JRZA 4Q47A 1IN8A 2XWJI 3LQKA 5ICFA 4LSWA 3VO1A 1N8SA 3KFVA 4G0OA 5KX5A 3C1TA 3G2JA 2HLNA 4JJ7A 3AVYA 4PLZA 1CDOA 5BWLA 4HWGA 2JLBA 3GJ4A 2GBPA 3M3HA 2AYYA 3OIDA 1EE9A 3WL3A 1H42A 5DCYA 3O21A 4GYJA 3ZCPA 5MN5A 1Z73A 2PS0A 4NXMB