3QOWA

Dot1l structure in complex with sam
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
327
structure length
322
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKWTGKPVSYYLHTIDRTILENYFSSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase
total genus 102
structure length 322
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qowA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qowA02
3VC2A 2IBTA 1JQEA 3MB5A 3PTAA 3P8ZA 4POOA 1JG4A 2A14A 2OBFA 2IIPA 4M7RA 3NTVA 4PGGA 1YZHA 4XUCA 1Y8CA 2WK1A 2AS0A 4XUEA 1G8AA 5DX8A 4FSXA 5HEKA 4YUYA 4CXMA 3IHTA 3SSNA 3T0IA 2BM8A 3HP7A 4ISCA 4YUZA 1I4WA 2FK7A 5E1MA 3FTEA 3KPUA 3OFJA 4RTPA 2EJTA 4DM3A 1UIRA 3BXOA 2AOWA 4WXHA 3UJCA 1PJZA 1QANA 3BKWA 3GGDA 3E23A 3M33A 3PX2A 3NWBA 3LECA 5HZMA 4RTRA 2P8JA 3ERCA 5FADA 5DRYA 1XDSA 2PV0A 3CJQA 1SUSA 5H02A 1SQFA 2Z6QA 1L1EA 5DPMA 4PYIA 3S68A 4V0QA 1G55A 2CMGA 3I9FA 5HIJA 2ERCA 5JR3A 1RI5A 1XTPA 2IDKA 5EMJA 3T7RA 5JUWA 2VP3A 1QAOA 4P7JA 4GUAA 3G5LA 5HILA 5G02A 3Q7EA 4PYNA 3KQPA 3VYWA 2YXEA 3LDUA 4MQ4A 2P7HA 3CBGA 3FPGA 5K0JA 4BLVA 5E2BA 1X1CA 2IDJA 2I62A 1V39A 3ME5A 5K03A 5CM2Z 2IH5A 2ZVJA 2AR0A 5DX1A 1XCLA 5GWXA 1VE3A 3M6XA 1EQAA 2PX5A 3TMAA 2ZFUA 4DZRA 4QQNA 1U2ZA 1SG9A 1AV6A 2VZ9A 1UWVA 1FP1D 5GP1A 1P91A 3BGVA 4WVLA 5EMLA 2R3SA 1N7JA 5CVEA 5FWDA 5DT2A 3C6MA 2Y1XA 3EMDA 3SSMA 1O9GA 2O05A 4PGHA 1YF3A 3GRRA 3BWMA 3RW9A 3GCZA 3KQTA 3WSTA 1YFJA 1FBNA 2ZSUA 2XYRA 3MTEA 4O29A 2BR3A 5EOVA 3TKYA 3TQSA 3PB3A 1AF7A 4ER0A 3EVZA 3FRIA 3GU3A 3LCVB 5EEGA 1SQGA 4EKGA 3GRVA 2V74B 2CWWA 4DF3A 2OY0A 3PX3A 5EEHA 4ER7A 2XVMA 1BKYA 2EX4A 5K09A 5D1NA 3HVIA 1QAQA 3FRHA 1R18A 3ELDA 4YV0A 5LQRA 3EEOA 3UBTA 3DP7A 5K05A 1BC5A 1X19A 1AQJA 4ZTBA 3GXOA 3KPJA 5LQJA 3T7TA 1IXKA 2IPXA 2VS1A 1P1BA 3LDGA 2PX4A 1JSXA 2PT9A 1I1NA 1KIAA 1ZHFA 2AVDA 4FGZA 4GBED 1EIZA 3M4XA 4ATNA 4PNEA 4OQDA 5EIWA 4R8SA 4EKIA 5DM4A 3QOXA 3Q87B 7MHTA 4AX8A 2Z6UA 2B3TA 3P2IA 2NP7A 1NW8A 1SUIA 2WA2A 3D2LA 3AY0A 3E05A 3PFGA 2QYOA 1WS6A 3FZGA 5DM1A 2IH2A 2QE6A 1WG8A 2I7CA 1L3CA 4KIGA 4FT4A 3ER8A 4F84A 4KDRA 1HNNA 4C4AA 3P9CA 1BHJA 5B1SA 5KVAA 2C7QA 3DULA 3G8BA 4X61A 3SR4A 2ZWVA 3C0KA 3HCFA 4OQEA 3M70A 4E2ZA 4PINA 1VQ1A 4HTFB 1XXLA 5FTWA 2OXTA 5CCXA 3HVKA 2ZIFA 5EKUA 1KR5A 3K6RA 4RTOA 5T64A 2JH9A 5LQUA 4C03A 5DTRA 3SGLA 1X1BA 3UA3A 4P7KA 3MHTA 5LQAA 1ZG3A 1D2GA 3GWZA 4QVGA 4DMGA 2C7PA 2VDUE 3P9IA 1B42A 2AN3A 3DR5A 1JSZA 2IFTA 4AZVA 3PLAE 2ZULA 5K0LA 1ORIA 3PT9A 4U7PB 5K0NA 2UYHA 2C7OA 5GIOE 2PXCA 4RWZA 1JQ3A 3OPNA 3VSEA 5ICEA 2UZ4A 1YB2A 3FUTA 2JHCA 3UZUA 1EJ6A 3LSTA 1KPGA 5EQJB 4HSGA 3TFWA 2QY6A 1NKVA 4CKBA 1ZKDA 5E1DA 2PX2A 1DCTA 3EGEA 5KYGA 2JHAA 4F85A 3TKAA 1H1DA 2QRVA 3EVAA 3FUVA 2AOTA 5E9QA 3H2BA 3KQMA 3UJDA 3LGAA 5GIPE 5IH3A 1WZNA 4X41A 2H00A 5GOZA 3TLJA 4RTMA 3LX6A 3MCZA 4RTQA 2G8NA 4HRAA 3LCCA 3F4KA 2K4MA 3HNRA 2GA9A 4CWAA 2GAFA 3HA7A 3O7WA 4Y30A 4HH4A 4DCGA 2FPOA 3G89A 1R8YA 3MQ2A 2O57A 2FK8A 2PLWA 3BWBA 5E1OA 4RTJA 4P58A 2AN5A 2YR0A 5C0OE 1L9KA 3SSOA 2I6GA 4RTNA 2ZBRA 3SX0A 4PYOA 1BOOA 1EG2A 4CTJA 2ESRA 3BWYA 5DM0A 5EMKA 3P9KA 2P40A 4E31A 4YUVA 2JHPA 2ZBPA 4QVKA 1WY7A 3IEIA 4PYLA 2LD4A 3A4TA 4G56A 5DXJA 3X0DA 4PONA 4E2XA 3DMGA 2YVLA 3ID6C 4PWYA 1R74A 4PIPA 3KPWA 3TR6A 3T7SA 4YMGA 1AQIA 3P71T 2PGXA 3KQQA 1TW2A 1P39A 2B2CA 4QPNA 1G60A 2NXEA 3DTNA 3GRYA 1QAMA 2AOXA 5DWQA 5HIMA 3DLIA 5DSTA 3SM3A 3SXJA 3I5UA 5EIFA 3B89A 5MHTA 4HGYA 4E32A 2PXXA 1NV8A 3R0QA 2I9KA 4EMSA 1SVUA 3FUXA 2AOUA 1RI3A 2FYTA 4KIFA 4GOOD 1JG3A 3B5IA 4AZTA 4KW7A 3AJDA 3OE4A 4R05A 3TRKA 4XUDA 4YV2A 2PVCA 2O06A 5M5BA 4C08A 4L7VA 1FPQA 1SKMA 2F8LA 1D2CA 3HA3A 1VBFA 3DMFA 3HVJA 2H11A 3P97A 3MERA 4MTLA 2AOTB 2YXLA 3UJ9A 1M6EX 4YUWA 1JQDA 5K0BA 2UYQA 4QTUB 1KYZA 3NVMB 5FCDA 4GEKA 5KQRA 4X63A 4BLUA 3IV6A 5EPEA 3FPJA 1JG1A 4OBWA 5ICFA 3LHDA 3G2OA 4LECA 3KR0A 3CCFA 3GIWA 4Z2YA 3RODA 3KPVA 3REOA 3C3YA 5BXYA 1N7IA 3DOUA 3GJYA 2IH4A 4C04A 2PWPA 3E7PA 3LBYA 1EAMA 4FR0A 3C6KA 4DCMA 2OPBA 5CCBA 3DMHA 3EVCA 5FQNA 1JTFA 3R9XB 3G8AA 3AXSA 3CJRA 4KVZA 5DTQA 3BUSA 3NWEA 4U7TB 1JG2A 1F3LA 5E8JA 5EGSA 1DUSA 4BLWA 1YFLA 2JG3A 2XYVA 1YUBA 4QTTB 4QDKA 3I64A 4C06A 1NW3A 2ZIEA 4GC9A 2BZGA 5K01A 2G1PA 2ZZMA 3CVOA 2ORED 2WA1A 1VPTA 3B3FA 3I58A 3E8SA 1FP2A 5HOQA 4K6MA 3A27A 3HTXA 5EHGA 5CVJA 2O07A 4OA5A 3FTFA 4P7GA 2HMYB 1RI4A 3ELYA 3G88A 2P41A 5E1BA 4C05A 3CGGA 3AWIA 2NP6A 2G71A 4EVIA 4AZSA 3A26A 4YMHA 2PKWA 1M6YA 1NW7A 3NVKI 3C3PA 1JTEA 3HCDA 3HA5A 5FHQA 4A6EA 1N2XA 5K0EA 3HCAA 1R6AA 5BW4A 4RTSA 5LR6A 3NW9A 4CKEA 4P7FA 1IY9A 3HEMA 2YTZA 1Q0SA 1JR4A 1VLMA 2O0LA 5CVUA 2NXJA 2VDVE 2ZW9A 2ZZKA 3EGVA 3THSA 1QZZA 1L3IA 2G72A 3L8DA 4F86A 5LQNA 2HR1A 2BM9A 2NNWB 1QYRA 2PXAA 5DM2A 8MHTA 2NXCA 3KHKA 2HNKA 3G5TA 4GC5A 3KQSA 3EVDA 4E2WA 5LQKA 3EPPA 2KW5A 4IKPA 5BW5A 3V8VA 3TPZA 5FUBA 5K8VA 5EVJA 5FA5A 3FTCA 3LDFA 3CC8A 2UYCA 4BY9E 2ZTHA 2ZLBA 5ERGB 2AVNA 3PS9A 3GO4A 3B3JA 3BGDA 4ER5A 3LKDA 1NT2A 4HG2A 3TOSA 3I53A 2JH8A 3HCEA 2XVAA 3MGGA 5CVDA 3BZBA 3THRA 1XDZA 1G6Q1 2AOVA 3FUWA 1MJFA 2P3OA 2B78A 3HCBA 3NJRA 4HC4A 4RTLA 4ER6A 4RVFA 3LCUA 1NBHA 2N47A 5HFJA 3OZRA 3JWGA 3ANXA 3GRUA 3P2KA 1F38A 1NE2A 5U4XA 3FTDA 4M38A 4V0RA 2YUIA 3UJBA 4RVGA 2JJQA 3LPMA 3G2PA 3CJTA 3KR9A 4GQBA 4GOND 4IWNA 4RYLA 3KR2A 4DA4A 4OX9Y 3ER9A 4B17A 2AN4A 1EJ0A 3OFKA 2CL5A 3JWJA 4GF5A 2CMHA 3M6VA 2XYQA 4E70A 5GM1A 1YZ3A 2B9EA 3PFHA 4LWPA 1RJGA 3MCTA 1KPIA 3FPFA 3KPYA 3O31A 5KS2A 3JWIA 2ADMA 2IGTA 5F2NA 4FT2A 5DSXA 3BKXA 3TM5A 3UJAA 1X1AA 3ORHA 4PCLA 4R8RA 1R8XA 1D2HA 3OE5A 2P1DA 2HWKA 1INLA 2OB1A 2AZTA 2QM3A 4QQKA 5EHIA 2OZVA 4FSDA 4MHTA 5D1HA 2VDWA 5EMMA 2CKDA 1DL5A 2DPMA 1RI1A 3DXZA 3FPHA 1T43A 4RSRA 5E9WA 4A6DA 3DLCA 3B7PA 5FA8A 1P1CA 1KPHA 3EGIA 4UOEA 5EZQA 2IBSA 3LL7A 3R6TA 4AUKA 4HTFA 3EEYA 2H1RA 5EKXA 4QPPA 3FUUA 4FZVA 2P7IA 3A7EA 3EVFA 5DTMA 4PYKA 3NDJA 3OCJA 4RVDA 5GM2A 3SMQA 3QOWA 5BP7A 1G38A 2E5WA 4YUXA 1KP9A 1VIDA 2PBFA 3R3HA 2PT6A 2ZCJA 1RJFA 3GNLA 3P9NA 2Z6AA 3FYDA 3EVBA 4PIMA 3FPEA 4X60A 2GB4A 2ONZA 4OA8A 1XDUA 3DUWA 2XBMA 2BR5A 4M37A 2HTEA 3SVZA 2GS9A 4GOLD 5ICGA 4LWOA 4CTKA 1VP9A 1IM8A 5HIIA 2ZBQA 3PVCA 5K0GA 2B25A 3UWPA 4JXJA 3CKKA 3KQWA 4EQZA 3EVGA 3UA4A 3IYLW 3OU7A 3V97A 2ZWAA 4DQ0A 4MWZA 4M36A 2QRVB 2GPYA 3OZSA 3P2EA 1L3BA 2YQZA 3DXXA 3A7DA 1VL5A 5ICCA 2EJUA 5FULA 4PCAA 1Z3CA 2UYOA 3ELWA 5DRTA 1WXXA 3K0BA 3KQVA 2YX1A 3HCCA 1G8SA 2IP2A 2Y1WA 4GOMD 1R00A 3ELUA 5CUQA 5FHRA 4E30A 1PRYA 3LKZA 3BT7A 1TW3A 2PJDA 4DKJA 3G2MA 2EG5A 2PSSA 1XCJA 4H0NA 4E33A 2FHPA 4PYJA 3FYCA 2R6ZA 4XCXA 1XVAA 5E9JA 2FRXA 5E8RA 3KKZA 3LBFA 2PX8A 3OU2A 4OBXA 2BR4A 5P8WA 3MTIA 3M6UA 2PY6A 5T67A 1NW5A 3OZTA 4X1OA 4R6XA 2OO3A 4QDJA 3UFBA 1VP3A 1Q0TA 1M0EA 3B3GA 4KRGA 1OR8A 5F2KA 1FJXA 3NMUF 1TPYA 4PYMA 2ZZNA 3A25A 3HVHA 5CIYA 2C7RA 1ORHA 2OKCA 2EFJA 1UFKA 3KU1A 2BH2A 1NW6A 1NBIA 3MAGA 5HIKA 3G2QA 4NECA 3RIEA 5EZSA 3GDHA 5CVVA 10MHA 4ER3A 1WXWA 3QV2A 3R24A 3TM4A 1RI2A 3KQYA 3O4FA 5DXAA 4IV8A 1KYWA 1O54A 2YXDA 3G7UA 3AXTA 5LQCA 5EC8A 3EMBA 5DLYA 5EG5A 3M6WA 3DH0A 1ZGAA 5C1IA 4AZWA 4C07A 4HGZA 5F2OA 9MHTA 4FP9A 3BGIA 4LG1A 4PYQA 5FQOA 3NDIA 4BP3A 4E2YA 1RJEA 3OU6A 1I9GA 4R6WA 5IKMA 2AOUB 2GLUA 2ZIGA 4KWCA 2P3QA 3BWCA 3VC1A 3UJ6A 4YV1A 1X1DA 1RJDA 2NYUA 2V7EA 5K0CA 5GINE 3UJ8A 1KXZA 4FS8A 3EVEA 4KDCA 4EK9A 2NXNA 2FCAA 4MIKA 4CKCA 2OYRA 2DULA 5KQSA 3HM2A 4RV9A 5K0FA 4IV0A 1XJ5A 3JWHA 4Y2HA 1O9HA 5DX0A 1KHHA 4RX1A 1HMYA 3GRZA 4RTKA 3U81A 4RVHA 5LSAA 2GH1A 4BP1A 2ONYA 3DXYA 2P3LA 5C9ZA 1ZQ9A 2G70A 1NV9A 2HV9A 2P35A 2PWYA 2Q41A 3KQOA 3KR1A 5CD1A 1MHTA 5FWAA 2OB2A 5T6BA 3UJ7A 5E2AA 1ZGJA
chains in the Genus database with same CATH superfamily
5LL6P 1VL8A 3WNDA 1KGDA 2XCIA 1S7CA 2L18A 4LOKA 3T5MA 5JXIA 3OLZA 4DE8A 1PG0A 3ZZNA 3KVRA 2ODEA 4FZ5A 1C7RA 2DUNA 4RY2A 3HACA 4W6QA 1TCUA 1OVGA 1U8YA 1Q5PA 1Y9EA 3I39X 1G3RA 4I50B 1V6AA 1Y0BA 3CF4G 1OD6A 1HFKA 4KJZA 4KNYA 1HLPA 4M7WA 1RU3A 4YBAA 5JS2A 3W2GA 1C1YA 1ZGZA 2Q3MA 2WSMA 2G36A 4IW3B 4W5JA 3DUFA 3B5JA 2C03A 4BMVA 2AHRA 2HMUA 3QFCA 4PYIA 1KEVA 3HKCA 3IQHX 2YQ4A 3V8QA 1LLFA 4YDQA 4MV0A 3DGEC 3I9FA 3ZCQA 1UC9A 3DEKA 5BN3A 1WXQA 4NX2A 1UDAA 4B44A 3T7RA 1OQAA 1E7QA 1IBSA 2Q5FA 3HNOA 4GU5A 1RABA 3OETA 3TLMA 1WPXA 4DG5A 5KQRA 3O8QA 4UUAA 1YS9A 2CSUA 1DEKA 1T9DA 1P4HA 3B52X 5CX4A 4DIKA 4FZ3A 3TNYA 4AJ1A 4EA8A 5JANA 2DETA 4OHRA 2XIUA 3ME5A 3NDBB 2VOEA 1V39A 5DHPA 5LVAA 3KYCB 5DX1A 4BMZA 1DEXA 1Z2CA 3HMQA 3O7MA 5FL3A 1QVWA 1ZD3A 4TMTA 3PC7A 4X94A 3TRBA 2ZGVA 3LQ1A 2WYIA 5DN6A 3RYHA 3STYA 2Y1XA 4WNYA 4DKXA 2W2VA 1Q7EA 3NBUA 4HI0E 2V6IA 4CM1A 3H87A 1DARA 3GH1A 1GDDA 2VXBA 1NQ5A 4TL7A 3I1IA 3SR3A 2OGWA 5E95A 3MOIA 4EA7A 4OBBA 3GRVA 1Y7LA 3ZLVA 1TYBE 1JHZA 3U5TA 3PUXA 3MHPA 3VTKA 3W8DA 1EQ2A 1ONOA 1QPGA 2HLDA 4MJ7A 4HYYA 3TJRA 4F4UA 4Z3KA 4NWIA 3UF0A 4PZZA 1GPYA 3REFA 1FL9A 1A1SA 2NQ2C 1QQ5A 3QVVA 5I7FA 1H4VB 4ZTBA 2F9MA 3L4KA 1GTL1 2JK0A 1K97A 2AKEA 2H51A 3E35A 2DCUA 1U2PA 3G68A 1ESZA 2LYKA 1G5TA 2Q2VA 2YASA 1CP2A 1ZR2A 2DPLA 3TECE 3D8UA 3LX4A 3ZNNA 5LKRA 3GLKA 3PWKA 1VRVA 1I13A 4NZOA 1BE6A 3CROL 3FMIA 4P8RA 2NTYC 2HGSA 3ZHMA 1KI9A 2VA9A 2JGDB 3AGPA 4C0LA 4M8SA 4QDUA 1NW8A 3AUSA 5KYYA 3SPXA 4Q7EA 4MYUA 4B7UA 3N70A 4GWLA 1Y3HA 2W0MA 1TD1A 2PBRA 3AB7A 3HJTA 3RJ9A 3SQLA 4C0BA 2Y6UA 2BFBA 2XYGA 3QVGB 4IXDA 4W7SA 2R00A 2HYIC 3QXXA 2O8DB 1TMOA 1OZAA 1NATA 2IYPA 5DSZA 3S8YA 3SR4A 2ZWVA 3HCFA 3WK7A 4E2ZA 1QRTA 2Y3IA 2PZAA 3AJRA 4M1EA 1Z6ZA 2O7RA 5C8YF 2ONKA 4YQEA 2H2WA 1QR6A 1HYGA 4TROA 4CKCB 2OBYA 2BNOA 1C7QA 1NXVA 1O0SA 3ZNQA 4D9CA 5HUQA 2VPTA 3KKQA 3WR5A 3GRPA 3H9BA 4EUNA 1W0JA 3NG1A 4JCOA 4KN5A 4WNCA 5KCMA 1CR6A 3PLAE 1T2CA 3PXXA 2ZROA 3PT9A 4QDTA 1THTA 1YSEA 3OOHA 5LXTF 4NYJQ 4WBXC 4A5OA 5IAOA 4AJ4A 4P3PA 1Y48E 2UZ4A 4EI2A 4FYKA 2P2GA 4O2AA 5FPSA 3MD9A 3N8DA 2QP9X 1SXJD 3C74A 1N0HA 2ZYAA 4HBGA 4NLLA 3U0VA 1HM5A 3ANNA 2YOHA 4CLRA 5KYGA 3DTTA 4K86A 3H2BA 3ZJVA 4AX4A 4A36A 1QGYA 4L51A 1S8AA 1NXPA 1M5TA 4Q7KA 5J9FA 4I6TA 3IEUA 2J9FA 1SBTA 2VJQA 3ND7A 4GT1A 1DV2A 3UUEA 3WWCA 2PTHA 1DIHA 3BSSA 5L53A 1CUGA 2YWJA 1YA6A 4R68A 4X97A 1R8YA 2PU5A 3LHIA 5CCEA 4TT3D 3JAKB 2QXTA 3P7MA 4I1UA 1S0UA 5ALKA 4UQOA 4L95C 3AVPA 3KBOA 1THZA 4J3NA 4QUHA 2Y1OA 1NY5A 2QAGC 2YVAA 1FTYA 3GJ5A 2FLKA 4RELA 1KYVA 2OVBA 1YQXA 4G4GA 1FTWA 4HNGA 3S5JA 1OXSC 1YR6A 2I76A 3RVMA 4INOA 3TL3A 3LA6A 3U7IA 4CV0A 2FN7A 3I09A 5FBVB 3GLGA 1R3DA 1ATIA 2C96A 4GPIB 4QXQA 4W5NA 2XCUA 4X20B 1E6LA 3BWXA 3O21A 5TMBA 5KYNA 4E31A 2JHPA 1DC8A 5KMGB 3V1LA 5DXJA 3HLYA 3L6OO 2VXCA 4RA9B 3WLHA 1DDIA 1BVHA 3OZIA 1TYEB 1T3ZA 4PWYA 1ORRA 2XH8A 1VJGA 4XIFA 3ZVKA 4HVAA 3DZKA 5HTOA 4NOJA 2WWYA 2JANA 4TTJA 2B2CA 4WT7A 2E87A 3NBYC 4U8GA 4JVOA 2VHUA 3RSZA 3IP5A 4C4ZA 4GR9A 3GJ8A 4BNKA 3T94A 4OATA 2O49A 1NJ1A 4I1PA 3MAAC 4LNAA 4MX8A 2CNBA 4LW8A 1AA9A 3KHTA 5JH7B 4WESB 2P9QA 3R0QA 4YT8A 5EN4A 3SBXA 2I9KA 2IYQA 3OEHD 2FW0A 1DRVA 2R6CA 3KSUA 3OLCX 3T15A 2ZE5A 4EFDA 1GFZA 3TFLA 1GPWB 4KW7A 1VKZA 4PNZA 2YRXA 3T3GA 3V1UA 5I48A 2E37A 2E55A 1GUBA 1FXWF 2QE7A 3GFBA 1QBKC 5DOZA 4ITUA 5E4JA 4AY2A 2PBLA 2ZRIA 2FW9A 2X22A 2H11A 2I2WA 4RZSA 3RFUA 2Q29A 1S2GA 4PZ9A 3UJ9A 3ZUPA 3C4VA 3QLVA 3ESCA 3TSWA 4HDNA 1G3IA 4OHMA 1NR5A 4WKNA 2OXEA 3VR6D 4BMXA 4OBWA 1E4EB 1RHKA 3L7BA 1QDLB 1CEYA 2FSFA 1EESA 2M1XA 3D59A 2CLEB 4BS9A 2PZEA 4LECA 3OPVA 4FYPA 3X1KA 2QPTA 5C1DA 1RCUA 4QGGA 1OH6A 1DRUA 1UMCA 4BO3A 3C3YA 5ECGC 4B3BA 2PCLA 3A9RA 2GZ2A 1C4OA 3NP9A 2J45A 2BMEA 4UHFA 1A98A 3AOEC 1VLQA 5LXTB 3A36A 3BJEA 4G8BA 4OFWA 3QJYA 2OHFA 1C7ZA 3DL0A 4NDZA 3PGA1 5E8JA 4DEVA 2OCKA 2CVFA 1SR8A 3A3PA 4Q3BA 4BQPA 3GI1A 2VJYA 2DLNA 3E4DA 4B09A 1JSLA 4CDRA 5IANA 3EXIB 5KYXA 5K01A 4RWEA 5DHFA 4UNQA 4TVSA 3Q1KA 3CYFA 4MEJA 3G2LA 4NP6A 1TK9A 2ABWA 4WUVA 1RYMA 4ZARA 2QRPA 1NF9A 4DBLC 1U2DC 4ROTA 3AYXB 2MINA 3GPCA 1TEHA 1Z0KA 2G71A 4MS3B 4G2TA 2Q6OA 1FNDA 1MO4A 3CW8X 4RW0A 4GDMA 2A1UB 2WUFA 2IVGA 5F9MA 4WESA 4EH1A 2X77A 3BM5A 1PSDA 1THMA 3DHWC 3PUWA 5NULA 3RFVA 1CUEA 4PLZA 4BJ5A 2SHKA 1E1LA 3LCRA 4UXIA 4ZQEA 3IR6A 3KB1A 4DCTA 3PU6A 4MW6A 3Q3GE 1GZUA 2XDWA 4IUDS 1H2YA 1VGVA 2MEZA 2R1ZA 2WPDA 2N0SA 3SEQA 5TSDA 2FPIB 2IU4A 3K30A 4MA0A 4XAQA 5AJWA 3ZDEA 2H5LA 2V45A 2G72A 3V2HA 2PKCA 4K6GA 2ZRDA 3BH0A 4IIHA 3TNFA 4H4CA 2FP4B 1PFWA 1AUPA 4LYYA 3WRYA 3A2LA 4LJ8A 4DIDA 1IHPA 2WTNA 3F73A 2YYZA 3RRZA 4NYIR 2HBRA 3RBAA 1D9XA 3DEFA 4OYHA 4RF3A 3VRHA 5FOSA 3SBOA 3UHPA 4QZVA 3U7FB 3O73A 3T6KA 2WOJA 4E3WA 1G18A 2Y8EA 3BB1A 1KXJA 3KXPA 3WB0A 5KNCD 5EIEA 4O4LF 3O8CA 5JAOA 1QBGA 4B2LA 1Y5IA 4E5UA 2VTKA 3FFBA 5LXTA 1KJWA 1RYBA 3I53A 1C2TA 1KQGA 3JXDL 4RZ2A 3QKRA 4BYMA 4NU5A 2Z4TA 4R54A 4X6YA 3DDOA 3LP6A 3LV8A 1I6MA 3DMNA 3P4YA 4RVFA 1NBHA 1XDWA 1R50A 1ODSA 1NXSA 4Q1FA 4JEHA 5U4XA 1G4HA 3TG2A 1NG1A 4WI1A 2PPXA 1MNAA 1XZKA 1R4NA 3V4VB 1Z5VA 3BRQA 5EE0A 6NULA 3GPLA 4IZHA 3SN6A 3OZUA 5HK9A 4OK5A 2VA8A 5G4LA 4GGPA 4FWTA 2AR7A 3PRKE 1IUNA 4DZZA 1VG0B 2W2LA 3HJUA 3I8SA 3BXFA 4JUIA 1UJ4A 3W2HA 4MULA 1R4MB 2UYGA 4E70A 3DWIA 1W7AA 3Q0EA 1ISMA 4PRYA 5K20A 1I7QB 3W8FA 4W1PA 3KVVA 3MCTA 3PXAA 4JCYA 1VB5A 3JWIA 4Q19A 2QP3A 2FFBA 5DBEX 2BSXA 1JYEA 3DMDA 3GYGA 4P1ZA 4AUEA 3TJMA 1PJAA 1D2HA 4V2IA 4MI6A 3I5YA 4OLHA 2BPOA 2OB1A 3PR1A 1EPUA 1OI3A 2D1SA 5DYTA 1LZLA 1NVEA 3W2EA 4RSRA 1SUBA 1P3JA 4LPSA 1YS1X 4JK3A 2ZWPA 1JAZA 3E7WA 2UUAB 2PMFA 1HNXB 1H94A 1OFUX 1L5VA 5TT0A 3W6PA 1NQVA 2I3ZA 4TT8A 1V3UA 5ITSA 1NOIA 2ZYTX 4JLDA 3RSCA 4AN1A 3G5GA 7REQB 4R5HA 4EENA 3HDGA 5IXYA 4YRDA 4K9PA 2YZ7A 4DJDC 1EGVB 2V97A 3ROZA 2E5WA 2VCHA 4BGVA 4MQFA 4ED9A 2G9RA 3P9ZA 1SD2A 1H6AA 1PGOA 1NP6A 1SHKA 3O2JA 1QHFA 2XTNA 2XBUA 3RS4A 4BEVA 1KEZA 2VDKB 3ADBA 1Y6FA 2CNOA 3FYTA 2H3HA 5AI5A 4ZCTA 3L93A 4OHVA 5JECA 2PYZA 3JZFA 2BR5A 1JHAA 4HH1A 1IVYA 1NYRA 1GTMA 1W5SA 4GOLD 3PE4A 4LWOA 4UNNA 2XUZA 3N2GB 3UWPA 1Q6ZA 1H8HD 2XQFA 1ATZA 3LT1A 4IZIA 5ELLA 5BYBA 4OFXA 5IASA 2C4TA 1E58A 2FPGA 1ZYUA 3SK0A 2QT1A 5B53A 3UA4A 1GEEA 3W4JA 4BFSA 3LVRE 1A82A 2QAIA 3C98A 4BECA 2YQZA 3HU5A 4YRIA 3DLTA 2G8LA 3HLKA 4R8VA 1VL5A 2HIGA 3E81A 5J63A 1Q7RA 4C4TA 4EFLA 3TLEA 4BVGA 1RLUA 2EFYA 2I4NA 3BICA 2IOFK 4YDRA 3ELUA 5TDHA 4D02A 4QUEA 4GYWA 1I3NA 1J8MF 2QD3A 2Z4SA 3IV9A 5DWVA 4R2WA 2VYCA 4OI1A 3FNBA 5BVGB 1EK1A 2H0QA 4FHGA 3CUTA 4XWWA 2QMOA 3NCHA 1V8PA 4EDHA 3GNQA 2WZBA 4LZWA 5JNLA 2L69A 1G3MA 3TCXB 2BR4A 3MBIA 2J33A 3M6UA 2P9BA 5LP6C 5CA0A 3OHMA 3CVXA 3VAAA 1II0A 5GJVC 1TT5A 1VP3A 1Q0TA 4O0MA 1EFLA 2DBVO 2W4QA 3B3GA 5AJHA 3RK1A 1KFKB 3SJUA 1DIGA 4EUHA 5B64A 2FA9A 4GZ5A 2NUTB 3MNFA 1POWA 1N5LA 4Y1RB 2ZATA 4BX2A 4HB4A 5CEFA 5CIYA 1ITZA 1DG1G 2INGX 5DLQC 1EX9A 1OFVA 1HURA 2P6NA 2F1IA 3FX2A 1I6KA 3LZCA 4NMHA 5A3QA 4P0TA 1P60A 1OB5A 3O26A 1TVKA 2QLNA 3AUKA 2WUGA 1KYTA 3EQZA 1T1IA 2IEYA 2JGDA 3I9JA 4IEIA 2Y9PB 4M9UA 2HEIA 3IUYA 3H11B 2FU5C 3DDWA 5FOVA 1NQUA 1VG1A 4TTPA 1IM5A 1JAXA 2IYNA 1CC1S 1KKUA 3QU2A 2DU8A 1GT6A 1E7RA 5DWDA 1B7GO 1KHTA 1N57A 1JIXA 1EFRD 2Q8PA 5FLEX 2IS1A 5CK4A 5D3MB 4YV1A 2ENWA 1HPLA 4PTYA 3N8HA 5K0CA 3B60A 2YHSA 2EYQA 3FNFA 3MZ0A 1Z4QA 1I94B 2WHPA 3V34A 3LUKA 1CQZA 1VL0A 3FCEA 3EVEA 3BD6A 3MGKA 3OA2A 3R6LA 4K3VA 4ENPA 3NTUA 4FONA 3ZQJA 1ULTA 1F1BA 4Y2VA 1M5RA 3RNLA 4HDKB 1BO6A 4LSZA 1NUAA 2HPAA 4O2AB 4XFJA 2F3TA 4XX0B 1NI4B 1XTTA 5DX0A 4F38A 5B3JC 1HMYA 5BV2P 4L2IA 3CX6A 2DR3A 5AVYA 2MU1A 1XK7A 3PYXA 1U6JA 4Q3AA 4CR7A 4BP1A 8OHMA 4LJ6A 1DJNA 1QJCA 3SICE 4TM7A 2VPWA 1ZQ9A 2G88A 3ACBA 2Q41A 3KR1A 2O19A 1ZVMA 2CYBA 1ODJA 4JU9A 3LUJA 1P0QA 1VSQA 4NIMA 1E1YA 1RD4A 3EDQA 4EW3A 4E13A 2HC9A 2NO0A 2XXBA 4LYAA 4KE9A 3WHIA 4O1IA 1G66A 2P27A 2QSJA 1A8HA 2R47A 3QZUA 4UCWA 2PXHA 2ERYA 2ATEA 5EJ2A 3ONWA 2IIPA 1RAAA 3FJOA 4F5EA 3WLQA 1KMCA 1JX6A 3VJLA 2B7CA 1KWGA 2ZM6B 4ZEMA 3CA8A 1MQ8B 5KDLA 2RAUA 2F90A 3UPTA 3CONA 2BM8A 4UJ3A 4KE6A 5SICE 3RRXA 1N3IA 5DHQA 1BX1A 4DM3A 1GSAA 3LO8A 4DT1A 3W1VA 2YWHA 3AW9A 4XA8A 2F8SA 2PS9A 3E23A 4EZIA 2F43B 1VA4A 2JGAA 2O3TA 2P4HX 3M33A 3NWBA 3BA1A 4I55A 5HZMA 3U56A 5G4KA 2FW1A 1NTOA 1UQTA 5H59A 2Z6QA 1UBGA 2UVPA 1GT91 1L1EA 2AI1A 3L5OA 3NUZA 2G5TA 3S68A 2A2ZA 2WBLC 4K9QA 5JFOA 2FN9A 4PRKA 2I4RA 4EHKA 1ZD1A 7MDHA 5AVZA 2FSVA 3FFWA 1FFDA 5B1HA 4TSFA 3EA4A 5IN5A 1SIUA 4AYWA 3A9ZA 3RWOA 1P9RA 5HZKA 1I2DA 4GSYA 1JQLB 3KOZA 2NZ8A 3LQKA 2RI0A 1K68A 1SKYB 4JMLA 4PSVA 2JL1A 1QFZA 2XX3A 3PRYA 4RGVA 2D4HA 5AW5A 1V16A 1D2RA 4FCCA 4MPDA 4NZZA 5LBTA 1P18A 3QTTA 2A5GA 1AM4D 3WQRA 4D0GA 1Z88A 3EXFA 4LE0A 3NT2A 3H13A 2H7CA 3BOSA 4JL6A 1V4VA 1KZ6A 3BHJA 5EIHA 4DCVA 1G8GA 4BVFA 5A0VA 1E6CA 4LZOA 2BFDB 4Z9BA 2ZYWX 1RZSA 4YQYA 3ZLTA 4KWHA 2HF2A 1P91A 4E15A 2AFHE 1NVWQ 1CQPA 4QRDA 2WT9A 3RF7A 3U3ZA 4BU0A 4LKRA 1ML3A 1BXGA 1Q44A 2YZNA 3FROA 4GM1A 2L1PA 4MQEB 1OA1A 3N2EA 5BSGA 1QCZA 3SFTA 1VCOA 1PEKE 3M0EA 4MYCA 1IEWA 2YY6A 2CWDA 1T0IA 3I12A 4UFOA 3GU3A 3LCVB 3ZQ6A 4B3HA 3T5GA 1XV5A 3ANLA 5CP8A 1KH1A 5FL7A 3ZCRA 2BLLA 1N9KA 3KOOA 4J07A 4CKYA 4JYBA 4JI8B 5BR4A 2CLIB 4ZGGA 3TXYA 4DMHA 5EQTA 4IRUB 2HK9A 2NPOA 1PKEA 4YV0A 1MB0A 1T3LA 1P80A 2ZITA 1FTSA 3O1JC 3R9XA 1E9AA 3L02A 1RWXA 2NWQA 4H3KB 1P45A 3C70A 4ENUA 3ZWNA 4U7WA 5BSEA 1N2JA 1MHTA 1ZHFA 5K3BA 2VJAA 1JFTA 1JTVA 1QZUA 4TLBA 5BW8A 2EW1A 3G2KA 3DBIA 5E6SB 5FNVF 1SU8A 2WP0A 2B3TA 2D2XA 3S3TA 1N8NA 1XGKA 2GKOA 1RQRA 2CD9A 1FSPA 4ZVNA 3D0QA 2PX6A 4KAXA 3F97A 1MHPA 2C77A 4Q48A 3TR0A 2D1FA 3Q7RA 1WG8A 2PXBA 4N3AA 5K1ZA 4MWOA 4ZGWA 5C8YB 1RRMA 1T10A 5B1IA 2DLDA 5EWLB 4PU7A 3WGZA 1TVKB 1GCGA 4BNNA 1GLVA 3GA5A 1J33A 3I8XA 4OLJA 3NHRA 1SU7A 3T3OA 1S7GA 3LD9A 1M2FA 4Z6KA 2VCEA 3SC2A 2C2OA 1M2KA 3IDAA 4ZZ2A 5EKUA 4RSMA 1RAHA 1F12A 2DFNA 1NLYA 2A59A 2V7PA 2ZJYA 1CQJA 4IXNA 1TFRA 3MHTA 2A0YA 1IATA 1QHHA 2G9QA 5LZ8A 4JBNA 1QHGA 1AIPA 3DEHA 2XIQA 1DJQA 1UIMA 1WSWA 1XD8A 2O1WA 3CR8A 1JSZA 3ICPA 1HDIA 1NN5A 1NBOA 2I54A 3OLWA 4TMXA 3KEOA 1MNQA 2GXSA 5FUMA 1GPJA 1A9TA 2GLTA 3R0JA 4KBFA 4X00A 4JITA 1WMFA 1ZXXA 4IVQA 3CEPB 4L0CA 1Y6JA 2Z8ZA 3HB5X 3DHYA 3OEED 1MBZA 1V3QE 3QPCA 2LDXA 1NIPA 4GX2A 4RV5A 4B47A 4HAWA 2DF8A 2PYDA 1G59A 3FUVA 4Q37A 4ZIRA 5IDQA 2BHLA 1KKMA 1W30A 1B4DA 1Z0UA 2J07A 3LGAA 4TX1A 4V03A 1RWWA 4X41A 4B46A 2OP0A 3LCCA 3KDPA 3B7HA 4ASUA 5BSUA 3MB8A 4BCDA 1I80A 3LU1A 2RGWA 1UK7A 4Y6SA 1V3TA 1NRJB 4H31A 1UMCB 2Q2OA 3GFGA 4Z0NA 5EJ4A 2CHFA 1ZO8A 2PRKA 2PMEA 2AN5A 1X80B 2CDRA 3PNKA 4JQZA 3SSOA 4CEIB 4FCTA 3TBKA 3BGSA 5FF9A 2JIPA 2IOYA 1XA4A 2A94A 2RJNA 1WDTA 4W6ZA 1CT9A 1VDMA 3CWZA 5LZ5A 1KZ1A 1MN6A 3T7TA 4B4UA 4BASA 5KPJA 5C52B 3BWYA 1OWNA 2G5PA 3BJIC 1EXDA 1G1MA 3R7FA 4LK2A 2ILVA 1NIJA 3OWOA 5D3QA 3LUHA 5JNUA 4V0SA 4G56A 2GTHA 3LLSA 4MVYA 1E66A 2Q4EA 2HQ1A 3M4ZA 2TSYB 2Q6VA 4NV3A 3RRNA 2AQ8A 3BCRA 3G5UA 4BTEA 5JYBA 5LUBA 1UP4A 2R8PA 3T9FA 1ACLA 2PGXA 1P6UA 4NZYA 3SOPA 1J99A 2QQ5A 3GT7A 4LQ4A 1E2KA 1IB0A 3DT6A 3PL1A 5HTKA 3ZDYB 4DIBA 3SM3A 1U1CA 3PHJA 3WLPA 4E32A 2FWBA 1JKMA 1N92A 3HN2A 3UVEA 3FUXA 4N5IX 5JCOC 2O6LA 1MB4A 3AF0A 4QUKA 5IUKC 5SZHB 4XUDA 1TU3A 3SY8A 4F45A 4RAQA 4F2WA 3K1YA 2QTTA 3MJCA 1OWLA 1SVLA 4J9VA 4FWIB 4G41A 1E94E 1PJSA 3ZLBA 2ZUDA 1YBVA 1ZHHA 4G5GA 5T5QA 2CFRA 1WM1A 4NCXA 3FSGA 3TAHA 5JHHB 1R5OA 3OD1A 1E0JA 5DK4A 2BJHA 2WEKA 3D64A 4F06A 4BZWA 5LYYA 1YQEA 5HQ3A 4HHEA 1D1PA 1RQPA 4YALA 3VR3A 4D0LB 4UDNA 1WB6A 4JUCA 3L01A 4QJIA 5EGSA 3C7AA 1KJIA 1T9GS 3BRSA 4D9GA 2BZGA 2WB2A 3JVIA 4JWKA 5DB4A 4ETNA 4KR3A 1AN9A 1BWPA 3WGGA 3LBNA 1JBKA 2J31A 1DG9A 1PTJC 4NEQA 2JD1A 1W19A 3TBHA 4FZJA 2W8BB 4BQFA 4A8JC 4ETMA 1SXIA 4K6MA 1WKBA 1BAPA 5JCXA 1L7MA 3INRA 1YIDA 3ET5A 4P7GA 3L0OA 4A9AA 2V7BA 4CETA 1GAWA 1E3QA 3LL4A 1M1YE 4TMFA 2NP6A 4ZDWA 2CFCA 4J1XA 2XKJE 1EJ2A 2ZAGA 5C8YA 4CMKA 1P44A 1ZVJA 1WP9A 2RK3A 3KE9A 1VCIA 1JNXX 1VPDA 1XXHB 2NZVG 2QS9A 2VCYA 3GFPA 5DKFA 3TZQA 4LNUB 3BTSA 1H2BA 3F98A 2D1RA 4JLSA 4F8EA 1FOEB 2NNLD 2BE7A 1F2TB 3NOQA 4GLBA 4NBVA 2K7FA 5ITVA 1P81A 4J29A 4MV1A 1DJPA 2VK8A 4WKGA 4BKOA 4KI0A 2GHQA 1AD2A 3MK31 3DAYA 3HYCA 4YCSA 4HNAA 1PGQA 3ZE0B 3X43A 2RH5A 4EDFA 1ELOA 1W4CA 3F4BA 1K6XA 1E3MA 2J8ZA 4CLXA 3E9RA 3EXHC 4CKBB 4N8DA 5E0KB 4KLZA 2XE7A 3GOQA 4PPFA 1AQLA 4DCOA 4OX9B 5IULC 4G1VA 5FEUA 4I9GA 1WVMA 1MB2A 1GY8A 2Z8YM 1HNZB 4HNRA 5CH5A 4EF6A 1YC2A 4XYLA 4ZDIA 4WDQA 4YO8A 4KSCA 2PMBA 4ZV7A 4AMVA 2JBHA 3PVZA 5BY2A 4RKYA 1F1JA 1BJKA 5F64A 4HUQA 2WKRA 4OQYA 4AF7A 3SX4A 4AXXA 3GLVA 3LKDA 2G63A 3U4MA 1VLVA 2PG3A 1P6QA 2D2FA 3LJKA 2H29A 5IBCA 5C51B 2I3DA 2JH8A 4GMGA 4JOQA 3V8MA 1DKRA 5M29A 1YZNA 3TRFA 1XDZA 2A9VA 1X80A 2VWGA 2P3OA 3G1TA 3IDSA 1DBVO 3K05A 3LKBA 4N4AA 4X7BA 5JPCA 2N47A 3P9RA 1PE0A 4Q00A 4G37A 2PXUA 3VHQA 2ICPA 4CF4A 4MMYB 4GSKA 4KV7A 3UJBA 4MRAA 1KMMA 1QGOA 4LI0A 3WLNA 1MB3A 2ODWA 3CUKA 4I50F 4ODIA 5IUNC 1TXGA 2QG4A 2WHPB 2RGBA 3C87A 1FRZA 2V5AA 1E2HA 4UNRA 2QN6A 4YRLA 1F9EA 1LTHR 1QVVA 4EY3A 1CULC 1TM3E 1DP4A 4I8XA 4PZ0A 4XJXA 4JKYA 1Z2EA 3FMVA 4DA4A 2IYXA 3L43A 4D3YA 1QXSA 1NI4A 1E0AA 2PXTA 1XTQA 2J41A 2GK3A 4DY4A 3DOIA 4PSKA 2I65A 3U7HB 5JCPA 4KO8A 1CUFA 1E79D 2AK3A 4ZRMA 1GR0A 2OD2A 4UOQA 3D3KA 3IESA 2E48A 4RY9A 2LDBA 3LT4A 1UDBA 2Y93A 3CB2A 3DLAA 1T5HX 4GYJA 4NCHA 1I3MA 4FT2A 3SJCA 3JATA 1DBWA 1EZ1A 3A28A 3ORHA 2QN7A 4AYXA 2DHDA 1JXAA 3Q15C 1POUA 1PGPA 1FX0A 1A77A 3H6KA 3HDQA 2HWKA 4JBHA 2JAOA 4R3NA 2IYFA 2JASA 3WP0A 4MDEA 5AVSA 1G5HA 1GPAA 1OTXA 3ZWXA 1V41E 4G3XA 5KSOA 4OAPA 2W6PA 3EZ9A 2WDZA 1BEZA 4LWQA 5B6IA 4YP7A 4XDZA 3BJMA 5C34B 4LOJA 3BA6A 2Q5OA 2W2NA 2PFSA 3I0ZA 2LCFA 2ZREA 1DWQA 1E3JA 2ZYHA 1ADCA 3WNZA 1OAKA 4M89A 3EJWA 2X0DA 2IGBA 4DIOA 2YWXA 4BV9A 4M60A 4OKNA 1YJXA 2FEKA 1RTKA 1E9EA 3NDJA 3MLFA 2OGUA 5CRIA 2EWTA 2XW6A 3EEIA 3F90A 3KTDA 1G1AA 3MD0A 4UMFA 1PFUA 1VIDA 4PWZA 1OZGA 4MUEA 2DQKA 2M6KA 3NCTA 4WNAB 1HDYA 3EQ6A 2HK8A 5KNDD 4IJ5A 4FFPA 3KOYA 3SM9A 2WUVA 3VPCA 5B58C 1LX7A 1X0XA 3L1PA 4X84A 1BMTA 1XZQA 4DYVA 2O2YA 3DJYA 3H9JA 3DDHA 3EH2A 3GN2A 3TZCA 3IP1A 2B25A 3ZTTA 4LQLA 1DX4A 1MC8A 2DYKA 2FJUA 5ENVA 2GUWA 4C6RA 1U0HC 3WGNA 4IYJA 4ALMA 4LFAB 2GRUA 1QQBA 1OSLA 1AK1A 1LPPA 4URYR 3GP3A 1H0RA 3VO2A 1NJFA 1D2AA 1AZTA 3OSUA 5IUJC 5IKXA 5DRTA 3KQVA 4C4XA 4L08A 3BFPA 2R7KA 3LKZA 4QASA 3QWIA 4GOKA 4EYEA 4YCMA 3LQ2A 3TG8A 1FXWA 3GLIE 3D1VA 4G5FA 2I7DA 4TV9B 1S2LA 3NEJA 2XBLA 4RL6A 4ZOCA 1XEFA 2R62A 1KDOA 4YC7A 4IVRA 5CMLA 5DBFA 1IOVA 4QDJA 1R5NA 2JAUA 1M7HA 4OQQA 4RFSA 2QR5A 1ZVQA 4X85A 2FPLA 4UDOA 1U7TA 3IMKA 3V7FA 3GW8A 2NIPA 4AL4A 3HYSA 3SIXA 2JFUA 4RK6A 2JGFA 2ZTMA 2PUBA 3SLRA 4N0MA 3VH3A 2XF2A 3A6GA 4BZXA 2NZUG 3OBIA 1L1RA 3L1KA 4Q1DA 2ZI7A 5KYWB 3K72B 2D6FA 1ZRSA 4KACA 2VBCA 4DC1A 4DSTA 3VR6H 2X8JA 3O4FA 5BNTA 5GMOA 1XZAA 1HETA 5J59A 3M6MD 1C9DB 4K40A 5EC8A 4QVIA 5J2UA 4DXAA 3TQIA 2BCJQ 3PQ6A 3X2FA 3G0TA 1ZIDA 1K75A 1Y1PA 1UP7A 3CZAA 3H97A 5FQOA 1FDTA 4P33A 1U8ZA 2HA0A 4DUPA 2OORA 2V58A 1W88A 1ENOA 2P3QA 3THWA 2D5IA 4KRFA 3VR6A 4QFCA 3QU9A 1JDSA 1TF7A 4HQNA 4EGQA 5FORA 3SHOA 2EKQA 3NIGB 2Y66A 4MGHA 2RDMA 3MEJA 2FE4A 4B6GA 3HM2A 2NVUA 4WAUA 5EP2A 3V1KA 1E7SA 1Y8RA 2EV9A 2YJ4A 2YJNA 3DD1A 3CZQA 3V6MA 1GDTA 4DSUA 2D4AA 1Z4LA 2BUCA 2DFVA 1PBNA 4BP9A 4WKPA 3WS7A 4EO7A 3OF3A 3IHWA 4W82A 4B45A 1S3IA 2RGEA 3O1IC 2QTRA 1B0UA 4LMRA 1UEJA 2ZJAA 3VU3A 1ZGJA 1UADA 3VC2A 1C41A 3Q41A 2CD7A 1CR2A 2JEOA 2CNKA 4IINA 3CZ5A 3NC4A 4MV8A 5KJEA 3JXEA 4IQ8A 3TTWA 2A14A 2QSUA 2GZ3A 2ISCA 5G41A 4ENTA 3QBJA 4JUBA 3VTAA 4PGGA 4L3OA 1Y8CA 4YT4A 4ZHSA 2AYXA 3O8OA 3GDWA 4L9AA 5IZCC 3N59A 3VR1A 4X4BA 2CY0A 5EJGA 2HA7A 3Q72A 5F2EA 2J1LA 2D1YA 1U63A 1UIRA 4RLSA 3H7IA 1MEJA 1JL3A 2WZCA 3ZWCA 1LRKA 3V2IA 3FWKA 4B7XA 3LECA 4MVXA 3GH3A 5BYJA 2O1XA 3RFTA 5KDDA 1B26A 3AIMA 4RPHA 4CMHA 1J8FA 1X57A 4QUDA 5E1DA 2GYYA 4MW9A 1IN8A 2CMGA 2EKBA 2ERCA 1NVKA 4BO4A 4DW8A 1X8XA 1TI7A 2CBXA 1B2RA 5JR3A 3AUYA 4GP6A 3JPWA 2WIUB 3UWSA 1DTWB 1M2NA 5HXAA 5JUWA 3QITA 5ALIA 4LDRA 5B7PA 2ZAIA 4RXMA 5INTA 2C00A 4Z5HA 1Z13A 3H2IA 2O3QA 3HHEA 4FGLA 3NX4A 3QPDA 3HV0A 4BC1A 2W2TA 3RVBA 4P35A 4ES6A 2DP4E 1WHSB 1JYSA 1P33A 4MHOA 4ZV4A 2HMWA 1XCLA 3FCCA 4JA2A 2R11A 2BDTA 2XOKD 3VHXB 2ZFUA 1XU7A 3H86A 3KSZO 4OKSA 1E9DA 5ARBA 4BPBA 1CQIA 1GZ3A 4Y8VA 3SWWA 1MD9A 3QU5A 4YN3A 2PCJA 4X24A 1FZTA 3UK7A 3BS4A 1B3BA 4LY6A 2QJTA 5LQRA 3RTGA 5CA1F 1TLTA 1LSSA 3ETGA 2CXUA 3EWIA 3DFFA 3HPRA 3T5TA 1EKXA 3GRFA 5K6AA 3RYFA 1YFJA 4HGNA 4MKZA 5D00A 3VHLB 4NABA 4W9RA 2WICA 4Y2YA 4EKGA 3L40A 4JB8A 1XLTA 3PX3A 3PTZA 2DBZA 4LCBA 4A82A 4DUGD 5I7OA 5K3FB 4KOEC 3EODA 1KTIA 5K09A 4H1UA 3HZIB 1E3OC 2KQUA 3WYFA 4D3SA 4D6XA 2VSOA 2OG1A 3ZXSA 4UTOA 1YR9A 3N2NA 1IXKA 1CY6A 1P1BA 2YV4A 1YAHA 2GLXA 3L8FA 4CCAA 2JATA 4ATNA 2O3UA 3TDNA 3PUVA 1ZWKA 1Y7HA 4PZYA 1DZ3A 3QSGA 3HMKA 2FNAA 4Q1CA 4QICA 4WA7A 4BHTA 2ZI9A 1X7XA 4DM7A 1ODTC 3P2IA 4Z9XA 1C3VA 5IK2D 4XSVA 2O2XA 4JB3A 4IH9A 1E1RA 1MPXA 2A5LA 2TS1A 4H3HB 4XOIA 1WS6A 1GPKA 3TVTA 2IH2A 5LLSA 1X7WB 3KJHA 2DWPA 3D6JA 5J1SB 3R7SA 4C0XA 2PGAA 2JBAB 2VNJA 3KQKA 1XAHA 2QTNA 3VJKA 3D6UA 4IF6A 4Z7NB 4ZO6A 5D87A 2ISSD 3TRIA 2KPJA 1B43A 2C8LA 2GUGA 3GRKA 1E32A 3FLBA 3K1AA 1M72A 3FYHA 4FMPA 4K9DA 4ON9A 3RHTA 5FTWA 3D3WA 1M2VB 1ULSA 1CY0A 2R84A 1VCHA 3QMVA 5IAJA 5IJAA 1CX9B 3JD4A 1SBIA 1ZCBA 2BEUA 2FMFA 2J32A 3G02A 1K7FB 5CJJA 4P7KA 3AL2A 4XPZA 1ZG3A 3AP2A 2AMYA 4FNMA 1IBKB 2LR0A 1LCDA 2C7PA 3TSYA 2CV0A 3P0JA 4C3ZA 1PLKA 3RNOA 2G7ZA 1GQSA 4A0SA 2ETXA 1QGAA 2K6GA 2ZYSA 5IKEA 1ZZ6A 1Y3IA 4B6OA 4D46A 3GARA 1NPDA 2Y68A 4NCAA 3VSEA 1IC8A 4DV6B 3O9ZA 2A8YA 1GQFA 2CLDX 1CJUC 1KOJA 2XJ4A 3A3NA 3FUTA 3MOSA 4FFDA 4N54A 5DEIA 2AJLI 3UZUA 3BH7A 4C01A 4FBIA 3QOFA 1DAGA 2P1ZA 1T2FA 2LXNA 2F64A 4OXQA 2MSWA 5GZ6A 1E8MA 1W1WA 2HU2A 2GWHA 3OIYA 4NZMA 5B4VA 2QRVA 4ZT3A 2AOTA 3KJIA 1GVHA 3UJDA 4E94A 5IH3A 1K8YB 1JA0A 2ZTLA 4D41A 4E1VA 1FU7A 1DKLA 4MVJE 5A3JA 4M99A 1H4SA 3NEPX 1XZ8A 2AXZA 2EZTA 1BE1A 1Y98A 3IO5A 3GZJA 4NE2A 4BFWA 4PQRA 2FSVC 4IG9A 3NHSA 3K7EA 2CNWD 1GEGA 4J4BA 5JMTA 4ZN6A 3QLEA 1ZM9A 4UTRA 4G0XA 1DG3A 2HMTA 3IUJA 5FNVA 1W96A 3O91A 2Y0CA 2PKQO 2W4IA 5AM2A 1SZDA 2G77B 3EF1A 3PHCA 1JGTA 4K9LA 1IZYA 3DV2A 3B6MA 3FWNA 5CNJA 4DWOA 2WF8A 1QLJA 1T4GA 4II3A 1E5LA 1HEYA 4NI5A 3ZYCA 3USCS 4PONA 4HNHA 4OI0A 2QIPA 2BGLA 3H8SA 1T25A 3O8RA 4DV0B 2HIAA 5L3RA 1FY2A 3R44A 4E4YA 2V7UA 5CDGA 3ZXXA 4DR3B 3PCXA 3V7YA 3L06A 2XUDA 3MWYW 5DSTA 4M1YA 2Z04A 3T95A 1C0IA 2AZMA 2BTOA 3ISJA 4WK2B 3SQNA 3DTVB 1W36D 4QL3A 4K6HA 4HGYA 2IEDA 3WO1A 2GM4A 2PX3A 4EEZA 2Y1FA 3NBMA 4MKFA 4P83A 4V02A 1SVUA 1HDRA 3UT5B 1TQDA 4H35A 1WPGA 4PG6A 1U65A 3TMYA 4BAUA 3GF4A 4G8JA 2BGRA 4F85A 2HLNA 3L8EA 4NICA 4JYZA 1SKMA 4ILEA 2GPWA 4ZI3A 3AHGA 4MTLA 1E9VA 2RKOA 3G6KA 1T9HA 1QUFA 4UPVA 4D3FA 2AKAB 5GY7A 1SBQA 2AK2A 2PMWB 3IQZA 3E3NA 4R1NA 1YOVB 3PC8A 4IF4A 2XLCA 2BMJA 1X92A 5AVQA 4WCFB 4AJJA 2VC2B 2ZE8A 4ZVSA 1UQRA 4PHCA 2HWUA 3BF7A 1SPBS 4FZRA 5AK0A 3V3KA 4GNKA 4C78A 1GWNA 2BRUA 2D5CA 2H1SA 4MYHA 2J0UA 1MFZA 1YQUA 4RPLA 5F51A 3TVYA 4EYQA 3HEBA 1IQUA 2YMPA 4KNWA 5LN1A 3D5TA 3E7PA 1Y3FE 3PWTA 5COQA 5I4KA 2OPBA 5BOSB 4ID9A 1T0JB 4ZVVA 5EJ5A 3CIOA 4P4TA 4BVHA 2AUWA 2R1VB 5DW3A 3CPEA 1G9TA 1U1IA 1E1MA 1MIOA 3DHVA 1B1AA 4Y2PA 1I24A 2P6UA 1I6WA 3WDKA 4M9CA 4XWGA 2JG3A 4TMKA 1WXFA 1QYIA 4GC9A 4ARVA 2FPXA 4IDHA 3QK7A 3H2KA 1WQ1R 2V4MA 4MQBA 4H1WA 1G5QA 4CEJB 2QZPA 2GZAA 4EM6A 3MWJA 1ZICA 1M2OA 1J2JA 4TXJA 2YWBA 4JELA 3QYXA 2AV6A 2V7XA 4LBVA 2G1KA 1DAHA 1O58A 1CQXA 1PR9A 2D5VA 1J6UA 1YR1A 2O07A 2YJZA 5KKAA 5A03A 3G1UA 3G88A 4R0NA 4X6XA 4DLNA 1D0VA 2MSDB 3CGGA 4NJMA 4L74A 3OICA 4XQEA 4AZSA 1QX4A 3QVGA 4BUZA 1JFFA 3CKLA 4DMCA 2JQEA 4C7XA 3UV7A 4P0PB 3UATA 3H42B 3PJFA 5IX8A 5B2ZA 2P9EA 4OQ4A 3ESRA 1L5FA 3O2QB 5DYWA 3T35A 4CKEA 4L7QA 3QXGA 1XYYA 4DSAA 3QJGA 1H5QA 4RANA 4BB9A 3L0DA 1T35A 2BM9A 5CA0B 2Y67A 1P7CA 2AC2A 2OL4A 1DSSG 3D2AA 3L7YA 1ZIPA 4MROA 3QBEA 2HNKA 3A1TA 2C94A 3EZLA 3FMOB 1D2EA 3HCRA 3WZLA 2J6BA 1IYZA 2FPMA 2R85A 3C43A 4K9KA 4BGEA 1TO1E 2KW5A 3IOYA 5T6MA 4JBYA 3B78A 4LRWA 5M34A 1DLIA 1NW9B 2GN1A 1L5RA 1JVBA 4NPAA 3WIDA 3DL7A 1NVBA 4HX5A 4B81A 4DA0A 1ULBA 4URFA 4N82A 2V6FA 1G5IA 2XMDA 5D3ZA 3CQ9A 4RD6A 1G8JA 1EDZA 1JDVA 3N2KA 3EC2A 3SKVA 4D25A 4JB2A 2XDAA 1G4AE 2CDAA 5C3MA 1DWUA 4AZ3B 3AR4A 3QUAA 4BNHA 1NSFA 1IDN1 1OTHA 2VLBA 2PXEA 2P6MA 5EKXA 5G1OA 4DV1B 1OPXA 1CQTA 3NOXA 3W5CA 2I2XB 3UG6A 1VTKA 3VTFA 1JLLA 2YFHA 4GPAA 5G53C 3DMRA 3WGOA 5KJFA 2FEMA 1PERL 4GSLA 4G5QA 1XR3A 4DBVO 2JIMA 3H9GA 1A9PA 2HFKA 1Z63A 3W1EA 2DUJA 1CVRA 1ES9A 2FPSA 1T3GA 3CN7A 3KBBA 1C1DA 3LPMA 3UK6A 4NENB 5SYMA 2WTBA 1FUUA 4AULA 5IPFA 2JJ1D 3G8CA 3MQFA 4CQJA 3ICOA 4ZAFA 3L7OA 4Z5CA 2H4FA 1UODA 3E9ZA 3PQ8A 2R6FA 3BTUA 1UDRA 2AN4A 5DBIA 2FX3A 5JWHA 3OFKA 3DAGA 3IIMA 4Y0AA 1CLUA 2WJ6A 4MYSA 1UP6A 1PEYA 4IDBA 5EWMA 2X2EA 2C1XA 2B9EA 5FBHA 5JXJA 1GL9B 4RKRA 1O97D 5H3HA 2VEOA 1WW3A 4BZQA 2MTBA 4LF9B 4BMPB 1TCAA 1AKEA 2W6ZA 4PLYA 2OGSA 3UT6A 4LF5B 4DJEC 3Q12A 2OO7A 4PHGA 1G5PA 1R8XA 5EE5B 1BX3A 4FYYA 3COJA 4JYAB 3V00A 3PEEA 3SYKA 3OJXA 4EG5A 2C3MA 2N75A 2PVPA 3AF4A 3CTPA 3G5MA 3OCYA 1VRWA 5IMBA 1GUDA 1U2EA 3BWVA 2W8ZA 1XVUA 4H7EA 2FUKA 3TMKA 1Y9JA 1VRCA 2HL6A 4CG0A 4PN7A 5IT4A 1IHDA 1Z75A 3C7DB 4H1HA 4TZTA 4GZ6A 2HCBA 2PNJA 5CEEA 3RT7A 4TYWA 1P1IA 3O8QB 3K6SA 2GBGA 4S2EA 3C3KA 2C61A 4GR5A 5K3DA 1EFKA 2YOGA 4HTFA 4EMUA 1YCGA 2C2KA 2OG2A 4W1SA 1YVPA 2EP8A 5K99A 4MVCA 4FFSA 4RVDA 5DGTA 5JMOA 4K9NA 1N2CE 2AXNA 2QDXA 3M6AA 3K0CA 2O2ZA 3R3HA 4JGGA 4KO1S 4HYTA 1DC6A 3SYMA 4DQVA 4FUTA 3P9NA 1AXRA 2OFPA 2HRBA 3SR0A 3PQ3A 4LCJA 2CLHB 4GMKA 2GCPA 2NG1A 4G0NA 4PZEA 2FQQA 2ZIVB 3ZW9A 5JZVA 1U1DA 1FDIA 3IPYA 2TMKA 2EJBA 2VSYA 2YYSA 3OMTA 4KUEA 1XDBA 5K8CA 3FFTA 4I1OA 4ID3A 4B35A 1VP9A 4JLNA 3VOTA 5K0GA 5CT6A 1KE2A 1SNYA 5B7QA 5K7SA 4QHYA 3EVGA 3I1YA 5JJIA 1MJGM 1GKLA 2WD7A 3EXEA 3HXTA 1YAJA 3TIIA 4CLRB 4KXYA 2KEJA 3B51X 1QG0A 1L3BA 4ZQGA 3ZWPA 5FRDA 1PL0A 2LCIA 1XWFA 3RVRA 2IEBA 2FLVA 5ICCA 5JATA 1JDNA 2PYIA 2ZSJA 4D3ZA 1EDOA 4J2OA 1JPNA 3HCCA 2YFKA 2MYUA 1DT3A 2D5AA 4XB2A 4CQLA 2YV1A 4D4GA 2FMIA 2GZ1A 2AN1A 1L7PA 1R0KA 1QIFA 2FSGA 1WEKA 1CS0B 2FHPA 1NNUA 4ZAXA 4HYEA 2R6ZA 4G24A 2Y27A 3SYTA 1APBA 1XKLA 1PHRA 1K8XB 1T36A 3KAPA 4WW0A 5E8RA 3ZD6A 4IJWA 3WKDA 2DRIA 3QP9A 4YH1A 3ONVA 5BVHB 2JLSA 4FSHA 4YVFA 2AGVA 4EGCB 4PC6A 1U0OC 4ZZ3A 1BJRE 1P2UA 2GERA 3AB3A 2PKQP 1SKQA 5EIBD 3K96A 3FNHA 5AVOA 2FKNA 4ENSA 2P65A 4JR1A 2QYHA 1XB2A 2HJVA 2QL5A 2C7RA 1RBMA 4A7PA 1CRWG 3NM4A 3VGJA 1E20A 4J2TA 3ZY5A 1JZTA 4EG0A 1M1YB 4I1VA 2BH2A 1XF1A 4YDSA 3O9MA 3QV1A 3I28A 3M49A 4NDNE 6CHYA 2QZ4A 4MW4A 4BVEA 1ZOOA 3QV2A 3AHEA 3R41A 4TXHA 3GJSA 2QN9A 3K09C 1ZEJA 3OQBA 3ZE2B 2GXAA 1QH1A 4YJ2B 4CRWB 2AZXA 3S1AA 4L4RA 2QMZA 4HMQA 4TS4A 3LF1A 3ZCXA 1PT6A 3WJ1A 1M54A 4K87A 3IUMA 4DAEA 4QNNA 3IX7A 1Q74A 2IYTA 1U2RA 4D8YA 3E18A 4GMDA 3ILXA 1U6KA 1VE1A 1YUMA 2C4VA 2KLHA 4KXFB 3VC1A 5JLJA 1HO3A 1K8QA 2A9FA 2HGZA 3ELBA 2ZWIA 3ZWVA 4MKHA 2EZ9A 3ECSA 4RA6A 3T3EA 4FMDF 2NU8B 3V8PA 4EPWA 5DCLA 2AI3A 4OYRA 1XKXA 5ER6A 1MDBA 2I8AA 1JR3D 1T8WA 2RHHA 3G6WA 3KL4A 2OK8A 1IU9A 3BDVA 4QULA 3JWHA 4J1SA 4QTZA 2EFHB 2YN0A 4B34A 2C2YA 2WKWA 1W8DA 1XQVA 1LPOA 2NAFA 1PZEA 2PIAA 3IQXA 4XYGA 3X2EA 4DV5B 3WLEA 1MENA 2C9OA 2RHMA 3KVOA 3BD7A 4J1NA 4PLWA 5IVDA 3RC2A 4B4KA 1CR0A 1C80A 2OB2A 2HPHA 1WUJS 2C7BA 2J9FB 2LIVA 2Q1WA 1XJ0A 3QBDA 4RMHA 4LXTA 1XQ9A 5E2AA 5JMPA 2LYRA 4EGAA 2RGDA 1B16A 4M1KA 4BKMA 4ZMSA 1BVYF 1RWMA 4POOA 4HVTA 1UKAA 1PDVA 1R5BA 4DNFA 3KXDA 3HCPA 4F3RA 2KZ8A 1A9YA 2ZBUA 3Q3IA 4I4IA 5A05A 4IO1A 5U9CA 4IHJB 4MA5A 1GUAA 2E5LB 4X92A 3D9QX 5LP6F 1ILWA 1Z45A 1XA3A 2PLRA 1Y5LA 5FPYA 2NMVA 3CCBA 2BWJA 2F8MA 2WJ3A 4YJHB 1CNMA 5IBPA 3I5AA 1FLDA 3A1FA 1YI1A 3P20A 3Q7IA 3RRMA 3MTDA 2VKQA 5EJ8A 1WNTA 2NO5A 3B85A 4F9FA 3JRNA 4L27A 5IC5A 3H2ZA 2CEAA 2CL0X 3B1FA 3WB2A 3WY9A 4E5VA 2OFFA 1JLKA 2ID9A 2O2JA 4X91A 1T4DA 3MCVA 3WTBA 4ACBA 4RLFA 2QUHA 1FS5A 2I2FA 3CNOA 4S0ZA 1OLXB 4JLJA 2FSPA 1XTPA 2XRFA 3QHPA 1KVRA 3QYPA 1QG2A 3VVBA 4ACAA 1ECGA 1K6IA 4GUAA 4LNUA 2Z5FA 3R7BA 4PYNA 4F6CA 5KYKA 2IY7A 2C2XA 5BN1A 2O8BB 4JC0A 4UZSA 4XUGB 1JQBA 1SBNE 3CF0A 4E7OA 2R8XA 5A9SA 4EQ6A 2IH5A 2OMKA 1Q21A 1VJTA 2CVPA 4GPBA 2LNMA 3M6XA 4G07A 1EQAA 5DN6D 2BM1A 3O5AA 1L8QA 1QRSA 2OXCA 3GLFA 1PJ3A 1W85A 3TBFA 4NBRA 4F11A 4PQEA 3OEWA 1QE5A 4B32A 4KMSA 4IFBA 3OE7D 4P4SB 2OBBA 3D3QA 4ZC8A 1QP4A 4WLOA 2V54A 3NPMA 3N28A 3PKZA 4CEHA 1DWOA 2BR3A 4URZR 1GXSA 4A6PA 1E8NA 1U4OA 3FRIA 5KVQA 3OP1A 3TNJA 2GD0A 2BBTA 1DVRA 4WUTA 2GPJA 3KJXA 3A2MA 1OFUA 1ZUD1 1ADBA 3QKRB 4IPTA 3RVSA 2JIDA 2ZRGA 4YB8A 4TWJA 1FFBA 2WJJA 3HYTA 3OECA 3GELA 3OM0A 4BNLA 4L22A 1UFRA 2J5XA 1YQ9A 1F5SA 4QU5A 4F5YA 2R86A 1COWA 1WBJB 1VSUA 2EKLA 2EQ5A 5BW4A 3L0IB 3KEQA 4HNTA 2P9GA 2GVZC 4W5TA 3PFBA 5L7WA 4I9FA 5ERXA 1O7JA 1Y8ZA 3VTZA 4Y6OA 3D8HA 3UC9A 1EGQA 2NV0A 1S9DA 2SICE 1VLZA 1LEHA 1M7BA 1DAFA 2V6JA 1IOWA 4DHWA 2WTUA 4XQGA 6LDHA 2Q5CA 1NOKA 2R9VA 3LWBA 4OU4A 4YXWD 1J97A 4E5PA 1NHGA 3CSUA 2C83A 4W1RA 3K15A 3ZJUA 4OHOA 1XJQA 1MO5A 2G6TA 3VKHA 2XXAB 3ETHA 1HQ1A 4YJ3A 1DXYA 1T2AA 5IT0A 2RAPA 1R0YA 2EBUA 4CLHA 1LZKA 1VOTA 2VSFA 2ZRFA 3JQ9C 3CLKA 2CZQA 4LFCB 3ZJ5A 4BEJA 3AR5A 3EB9A 1N33B 3JXBC 1E9RA 1E3WB 1TF2A 2P5UA 5FOTA 1DINA 4HWSA 1U2GC 2EDCA 1L2TA 2APJA 2FPWA 4D9KA 2H57A 4F3NA 1FUKA 2BYTA 1G8HA 3FB4A 4PHHA 2RBKA 4BFYA 1OV6A 3I2HA 4MDHA 1QM5A 4TS9A 3T8YA 3VAZA 4KBYA 3PC2A 4WNAA 5E6RB 2AN3A 5HG0A 2XNSA 4AZVA 2ZB2A 1M0SA 2ZULA 1ORIA 1NSYA 3HBMA 4RHXA 3F6YA 2PXCA 3ML1A 3BFXA 2VL7A 3O8DA 2YBDA 4CM5A 5K8LA 4TTQA 5DLDA 1RQXA 2VT7A 1MTZA 1K4KA 3B6KA 3CUVA 1SIOA 2JJ8A 4Y67A 2O2DA 3B6IA 3OLVA 1DAIA 2JHAA 4DLYA 3Q6IA 1DCTA 3KZ3A 1H1DA 1U4NA 2G0TA 1BQ4A 3Q8LA 4FDMA 6Q21A 2IU3A 4PAOA 1UBNA 5JSUA 2B5OA 4PLFA 3LC1O 4F96A 4GL2A 3IBCA 1V6SA 2JGRA 2YMMA 3H4MA 4LJKA 2K4MA 4DREA 4YX9A 5KYUB 1IN1A 4HDRA 3K0CC 2G5CA 2P68A 1WDWB 2CMKA 3DBLA 4PY2A 4R3WA 5F35A 4IV5A 3MQ2A 3I9MA 1JKFA 2BEJA 3F0TA 5BUCA 3CR3C 4U39A 4YP6A 1LGYA 3KJZA 4M98A 1LMB3 1QWSA 2E4ZA 5B7NA 5LWQA 2AA3A 5CAEA 4LI3X 3KSDO 1NAIA 3EXHA 1TA0A 3KWFA 4CU2A 1BKSB 5EMKA 3ACDA 4PZPA 4ZQCB 2P40A 3C8DA 3QX7A 3WGMA 5EXSA 3HBJA 1A4UA 1QHEA 1YZFA 4PYLA 2LD4A 1WUKS 2ZT6A 2C9YA 3C2QA 4XVRA 1JVSA 2O50A 2GOYA 3KOXA 1GRCA 4ZYLA 3I01M 1K06A 4EJ6A 4B1FA 5JFGA 4X62B 2V59A 3GV0A 4IMPA 1U0JA 3NKFA 1XX6A 2JGJA 3IULA 4N6GA 1F20A 5FL7D 3RV3A 1N32B 1H9AA 4QPNA 5AKKA 1QAMA 2QX9A 4WOCA 1N3BA 2ZP1A 3AF5A 4RFSB 4C6HA 4JCCA 3HUFA 4YCAA 3EWNA 2JB9A 1I14A 2B1IA 4ZI7B 1IMOA 1P1JA 3HP1A 2GBPA 4ITRC 2ZVQX 3T41A 4EI9A 1QDEA 1XLTC 3RV4A 4JOSA 5SY6A 3TW6A 1X13A 2REQB 1P0CA 1XZMA 3EUSA 1QKJA 1K6EA 4C2TA 3SCZA 4EUFA 2C5EA 1V45E 3ZY4A 4PIVA 4Y9RA 4C08A 4HWRA 2V3VA 2HT1A 4B87A 3WRWA 4L0DA 4P81A 2BUAA 3X1WA 1W44A 4HDKA 5A3VA 2IVBA 4K6OA 4KMRA 3W7AA 2A1IA 2PEYA 3PC8C 4HYQA 2O3RA 1JHDA 3TXXA 1UBEA 3QI2A 1ZPQA 1D5CA 2IYYA 1HWYA 2AUNA 2IYVA 4FYWA 2OKGA 5ALWA 5IFLA 2ZAOA 1J23A 3P9PA 4KGDA 4YRAA 5KWVA 3RODA 3VZPA 2RHDA 2D7DA 2I29A 4TM8A 4XRGA 5TXGA 4ENWA 4EYOA 5KSYA 2YUTA 1U2TA 1BS2A 5U1PA 1YVRA 4BWVA 1E2LA 3F71A 3L8GA 3WYGA 4FR0A 2JDID 3TTVA 2J09A 3WWEA 4GP9A 4DLPA 5GZ1A 3FDZA 4KN8A 5BYAA 3BHIA 4RULA 1TM5E 1JG2A 2VPZA 1Y63A 2EU8A 1V8BA 3DOJA 2DZDA 2FDRA 2Q07A 2XYVA 3NKVA 3PZBA 4AS2A 1B3RA 1P75A 1NW3A 1FFWA 5EKSA 2ZIEA 3FTPA 1L4MA 4B8WA 1BJTA 1J25A 1L6IA 2C5FA 4RHUA 2E6UX 3CVOA 3IV7A 4AN4A 4DJFC 3AERA 3W2FA 3R4VA 3RQIA 1ONBA 1F6DA 1ZXLA 4I1RA 3B5EA 3D54D 2PBZA 3N8KA 5IWCA 3BJZA 3KQLA 1U1EA 3K1TA 1P2VA 4QXPA 4FEAA 3K20A 2Y76A 3L3BA 1PFYA 2E6KA 3VOAA 1MC1A 4EVIA 3HKDB 3OURA 2ZQYA 1M6YA 3C6QA 1NW7A 1XYVA 3DZIA 1PLJA 2HTFA 4XQ0A 5T4FA 3WL8A 4A6EA 1T5SA 1N2XA 1UBRS 3LYHA 1IVNA 2FX2A 5C4IA 3PJRA 4MGKR 1VLLA 2X7JA 3QIVA 3CPJB 5F78A 3QX8A 1D7OA 1YWGO 3HL0A 5FYDA 1G7TA 1X2LA 2NXJA 2VDVE 1OHHD 1GKYA 1OROA 2J5QA 2ZZKA 2ZUBA 3ZKCA 3H3FA 3SQDA 2VRBA 3HQ4O 2AMLA 1VSVA 3P4UA 2XGSA 4LRYA 1AX9A 3WK5A 3R5HA 5BVHA 1NR7A 4IXMA 4RPKA 2HHJA 3R6GA 4JIMA 1V43A 3U3KA 1P8AA 1CF4A 4IKPA 2UYCA 4GDFA 1MCZA 2R8EA 4BL5A 2NZJA 4MQEA 1XMSA 5KNCA 3MGAA 1SKAA 2CCKA 2J85A 1R6BX 2OZKA 1WEHA 1YVEI 5ERGB 1SCQA 3PS9A 1A7AA 3IDQA 1J0EA 3VC7A 4EJ2A 1PF7E 2IWRA 2YVUA 4Y9TA 5KX5B 4J6EA 5JDIC 1P5RA 2WVJA 1M2HA 2VJMA 2XYHA 1BYIA 3JV7A 4L72A 4Z54A 3NJRA 4Y18A 2B78A 3O9VA 2B5WA 1JV2B 3MMNA 5ECYA 3S2EA 4RTLA 2AXVA 1W52X 3QUBA 5JD5A 3EXIA 4HEA1 5EIAA 1CJVC 1F38A 3P2KA 3USZA 3TUIC 3DEAA 3GNSA 4XB1A 4E0BA 3USES 5LIRA 2QG9A 4N5DA 3B1XA 3UCFA 1W0KD 1PGNA 1GLNA 2JFXA 2Y1CA 3G2PA 1V7QA 3JQAA 4GQBA 1NLFA 4ND5A 4A23A 4CM9A 2ENUA 4MXDA 1ZUHA 2Z9CA 3NAZA 4YJFA 1GL7A 2WFZA 3BWDD 4NS1A 3M8KA 4BX9A 1QTIA 3DMTA 2Z5LA 4NBKA 4MVJH 4P34A 4BPRA 1CNEA 1SVIA 4Q4CA 4ZD6A 5HF8A 2UXBB 1X7WA 3K8YA 2DQYA 4PW0A 2O5EA 5BPHA 1BSVA 2XXQA 5B3KA 1GG9A 2AQIA 1F9AA 4Z59A 3WA6A 4MYDA 2IGTA 3FVTA 2B1GA 4LYHA 1H1TA 2VHJA 3ACCA 3QU4A 1T6NA 4PCLA 5AOBA 5JD6A 1LDGA 1G20B 1TUGA 1YB1A 2GK7A 3KELA 1Z8FA 2CNLA 2WSBA 4CEJA 1IK6A 4QQKA 3RIGA 2RI6A 1FFHA 1XLWA 4OCZA 4ALKA 1LQ2A 2A9OA 3DFKA 3EG9B 1QNLA 3EOBI 4JDUA 4YCNA 5CIWA 5FA8A 1DX6A 2I6SA 2Y1DA 4N0DA 3W9BA 4XTRA 1BU8A 5BN4A 2IBSA 3MS4A 3M5DA 2J3HA 2PLNA 1YB6A 4I4TF 3F7OA 3NNDA 3CS3A 3HB0A 1Q17A 5LNK1 1HEUA 4QPPA 2CJFA 1T2VA 3SS8A 1FW8A 4KB5A 2HI0A 3V7WA 4AMUA 4LNHA 1X38A 3OFVA 1Q2UA 3GVIA 3ZZ1A 1QG6A 1V1JA 2YY5A 4HL6A 4V0LA 5FFNA 4WCFA 3RUHA 2R1UA 1JEQA 2FLWA 1H65A 3PLNA 3QEKA 2Y2VA 3FYMA 5LKAA 3FYDA 4KU4A 4IGIA 2R6HA 3Q40A 3MWDA 1WETA 1SQSA 4WK4B 3TI7A 4M37A 1JMKC 2QQFA 3NROA 5L51A 1Z0AA 5JE8A 1JIJA 2QTVB 1EDBA 1H8HA 2JAHA 3ZKWA 3JAKA 1S4MA 4JXJA 1Y1RA 3DE4X 1FYEA 4DUZB 2NGRA 2ZWAA 4BKUA 4M1TA 3ZVLA 3T3DA 1DCFA 1B8UA 5G1NA 4OH1A 4B3MB 3CRW1 5JYDA 1KMIY 2G4LA 1K6MA 1X1RA 3K0BA 2OD9A 4JENA 1X2EA 4OMFG 2H1IA 2R2AA 1V5WA 3ETJA 3RVDA 4MEAA 3LNTA 3CEHA 4KR7A 1UFVA 4RDHA 5IWAB 2EG5A 2RGGA 1II8B 3ZHXA 3AJ8A 2FWIA 1M5UA 1M34B 1SEPA 2L0XA 3BRWA 3MXOA 1YRBA 4C6TB 5ALJA 3KS9A 1KVSA 3KKZA 3L7NA 4KQKA 1CEEA 3ROTA 3IEKA 4MQLA 1FC0A 3A11A 3WKAA 2AFRA 3U44B 4TRNA 1FJXA 3AVTA 1QRDA 2NSHA 2RARA 1YI8A 2JFVA 2XTMA 4ND6A 5NLLA 1I2CA 4JUDX 4CT0A 2HSEA 1VJRA 2V6MA 3DONA 2PM8A 3E2IA 4BVLA 2YWDA 421PA 4NBLA 4KR6A 3LH5A 3MAGA 3EXG1 2NSLA 1XAIA 2FN3A 1R0XA 5ED0A 1MAHA 5YASA 3R24A 1UEIA 3TM4A 1BEUB 4AJIA 3QXJA 5DXAA 2GZMA 4M1ZA 3G7DA 2VRCA 2W37A 4MV5A 4UU8A 1XTSA 3BL5A 4EY5A 1AZLA 1MU0A 4AZWA 4D8TA 1X7YA 4PO8A 2AZDA 1YOVA 4MV9A 1CUUA 2DKNA 3GLHA 4RO0A 5AXDA 5TNXA 4Y6RA 4BLSA 1E4YA 4JLVA 4RORA 5H1YA 3U3DA 1UKCA 3R3ZA 3AZOA 3MJFA 2AOUB 2GLUA 4OQFA 2W70A 4CM4A 5LDHA 1CB0A 3BD8A 4W8OA 4Y2TA 5MFZA 1ECPA 1FU8A 4IDDA 3HFGA 4HPWA 5FT9A 4UFPA 1RC1A 2B61A 5AK5A 1ZZ9A 4RJJA 1QLWA 2GN0A 1U0BB 3MFYA 2B21A 1KP2A 1N9ZA 3C6YA 3UMJA 4F2GA 1OX6A 1Z4OA 4UNPA 5CXQA 2RCYA 3GWGA 1O2DA 3A4LA 1IZZA 2B20A 1ZRHA 2EERA 1CERA 3AFIA 1GL3A 3NJ4A 3OIGA 2G70A 3KO8A 2P35A 3HFRA 2QG6A 3OZAA 2WHEA 1PR1A 1PBTA 3HK2A 1TRKA 3ESDA 2C5BA 5I4IA 3PTLA 1QRRA 1Q6YA 1QZ3A 4IGAA 3G9TA 2PUDA 1ULUA 3ETCA 4W9NA 2OCAA 2OBFA 2J7PD 4W5RA 4JV5B 4GX0A 1KE1A 4RFLA 5FJJA 3DHNA 1W4AA 5DX8A 1P74A 4G4IA 2LYLA 1YNSA 2Q7OE 3QUSA 1N2BA 3GGJA 3HY6A 3SSNA 2GN9A 3T0IA 4F60A 1M8PA 3V8NA 5E1MA 3AEQB 2DUMA 3OFJA 3UXYA 5GQSA 4YRFA 3DW1X 2MYTA 4TKMA 2GEVA 2GHRA 1PX2A 3ZZTA 1O6FA 1FUIA 2QN1A 1WF3A 4XDGA 4BRZA 4DV3B 5B4UA 3ERCA 1Y33E 2EFGA 1WXDA 5LDDC 2CMFA 3S44A 1TC1A 3ZJ4A 5IM4A 3DL2A 1NJ5A 3VDXA 2HX1A 4V0QA 1N4AA 4EY8A 4G6ZA 4H1TA 1QK5A 1JJBA 1DEAA 4Q5IA 2HBYA 2F9FA 4IWRA 4QAQA 1JR3E 4N5NA 5FR1A 3EZGA 4ZI7F 3Q7EA 1CZKA 2WAOA 1WB9A 3VOSA 4EGJA 3LLCA 2JFWA 5K0JA 1ZN2A 2F62A 2Q9CA 3UK0A 2HA3A 3FPGA 4CL3A 1J2TA 5E2BA 2VDQB 3U5ZB 1IZ0A 4IIYA 4KZKA 3EFOA 3LK7A 1SOAA 2YXBA 4CZ2A 5EJEA 5K03A 1V11A 4U7HA 1H23A 4XM0A 2LVBA 3ETDA 1KEWA 3OOWA 4M0EA 3VNVA 3UJNA 3FDFA 2VZ9A 3ZS9A 1MB9A 3W3AH 9LDTA 1IZ8A 4TXLA 5CFLA 2CDCA 1EGAA 4JI6B 4RK1A 5CVEA 2CHGA 3EMDA 4CL2A 2ETVA 1P9NA 2BZ0A 3JD1A 4PGHA 3JYQA 3PEFA 2DFLA 4PLHA 5IDVA 4L02A 3LP8A 3WSTA 2R8RA 4BO5A 2EBHX 1L9XA 2QLMA 2X2OA 4H7JA 1AF7A 1IJFA 2MSKA 3BILA 3EVZA 4UU1A 1VG8A 3WADA 3IUNA 1UK9A 5EEGA 3UK1A 3VVLA 3DVSX 4ZYZA 1J00A 1Z2DA 4E5DA 4HNSA 4PSCA 1AKTA 5DP2A 3V4ZA 1B6SA 1TMYA 2B94A 4QG7A 1MJ5A 4OMDA 1AHHA 4KVGA 1KKLA 3QBTA 4GIBA 4WX2B 2LV8A 1KBQA 1N2CA 4M55A 1JS1X 3GD5A 3GXOA 2ZIWB 4EL5A 4JOCA 1BOFA 1YS7A 2LP4Y 2W22A 3AEZA 4Q9JA 2A78A 2OQRA 1FTQA 1HE4A 3BIOA 2XVYA 2BFEA 2PGNA 4OL9A 1DNPA 1YRLA 2WJIA 3Q11A 2PKEA 3A10A 3G5AA 5ICMA 1JPVA 1TUBB 2QEQA 4UD2A 5CHYA 2ZM5A 3ZHOA 2FTKE 3EXAA 1XZCA 4EKIA 3D8NA 3PQCA 4LXQA 2PJUA 3Q87B 1WH6A 5C3UA 4IMRA 5LQSA 1ISJA 3KCNA 4PPNA 5BN3B 1NBMD 1PWYE 1SUIA 2XKKA 4B83A 5BMVF 4PU3C 2FOIA 2OAQ1 4QHTA 3QHQA 3AR8A 4RTJA 3H5OA 3MLEA 2EAUA 2CXRA 3KX2A 1YTLA 3AERB 4CM6A 3CV3A 3PQDA 2BGMA 1OFHA 3TOZA 5AVVA 3V4PB 2IZ7A 2YWRA 5A2GA 2HSGA 1PNRA 1C81A 2F3SA 4WTOA 5KDOA 3U16A 3QPUA 3N05A 1MH9A 3CX7A 3DF9A 2E4VA 4CCSA 4MPRA 1L4GA 1LDBA 3NYIA 1MG5A 3OKAA 1QIHA 1UT8A 3O3CA 3SGLA 5I3ZA 1U2QA 3HC7A 4RBNA 2H2HA 1ZU4A 2VH5R 1VPLA 3FI0A 4NVRA 2JLRA 3EGOA 5CG2A 1RSZA 2VG8A 4LF8B 4DMGA 2QL6A 2B99A 1KO4A 4K28A 3PGVA 3GJ7A 1AB6A 1GIAA 2IBMA 5BN4B 5I5EA 3OQ6A 4LHEA 2BE9A 4YS6A 2NACA 1M7GA 1JHXA 1HKHA 1SHZA 3KWMA 1SXJC 1Y8QB 3L4BC 3N2GA 1G2PA 3LSTA 1EVZA 4IRMA 3DBRB