3QOWA

Dot1l structure in complex with sam
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
327
structure length
322
Chain Sequence
b'KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKWTGKPVSYYLHTIDRTILENYFSSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase
publication title Chemogenetic analysis of human protein methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 322
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3qowA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3qowA02
4FS8A 1MJFA 3BKWA 2I6GA 3LCUA 2EJTA 5FTWA 2B3TA 3NVMB 3P2KA 3CBGA 2H00A 4GQBA 4KW7A 1QAQA 3BGIA 3EEYA 4R6XA 2OYRA 4GBED 2ERCA 2P35A 3BZBA 3C0KA 2G71A 4CWAA 2I62A 5IKMA 3DLIA 5EIFA 1ORHA 3KPUA 1YFLA 3F4KA 3TPZA 3V8VA 5CCBA 1U2ZA 4XCXA 5FQNA 2CMHA 2PX8A 3R24A 5K0NA 4HGZA 2DPMA 5KQSA 2AOTB 4AX8A 2P3QA 3NTVA 2Y1XA 4GUAA 2PWYA 1V39A 3MERA 4KDRA 4GEKA 4R05A 4YUWA 5CD1A 2ZZMA 4E70A 4RTMA 2VS1A 2C7OA 1BKYA 1NW7A 1VQ1A 3CCFA 5DX1A 3UA3A 4QTUB 2IIPA 5DM1A 1IM8A 4V0RA 3VC1A 3DXXA 3NDIA 1KIAA 2BR4A 1FBNA 2P8JA 1YB2A 3DMHA 3IV6A 3O31A 4PYMA 5FHRA 2ADMA 5P8WA 3U81A 4YUXA 2IFTA 2Y1WA 5T64A 2AVNA 2YVLA 4DMGA 5LQUA 2HR1A 5HOQA 3C3YA 3GU3A 5E9JA 5FADA 3FPFA 4X41A 5HFJA 4B17A 2AN4A 3KQYA 1L9KA 2O05A 3LPMA 3PB3A 2XVAA 3D2LA 5E1DA 5BP7A 1VLMA 3HNRA 4M38A 5DSXA 4HTFB 4POOA 5F2NA 3MQ2A 2G72A 2EFJA 3K6RA 3KQWA 4U7PB 1SUSA 2O57A 3FUXA 3HVIA 3KPJA 4YUZA 4RTKA 3LBFA 1L3IA 1XCJA 2PSSA 4C06A 1UFKA 3OZTA 2P3LA 4GOND 4QTTB 5DWQA 5KYGA 3GRYA 4RTQA 1KP9A 5DM4A 3UJAA 3OFJA 4FT4A 5EMMA 3HM2A 3VSEA 3KPYA 1XTPA 4MWZA 5ICFA 4PNEA 2NP7A 3M6UA 1XVAA 2HTEA 5JR3A 3P2IA 4FSDA 1NBHA 3T7TA 1AQJA 3JWGA 4RTPA 2NYUA 3CJRA 4ER3A 1OR8A 3HCBA 1G60A 5FHQA 2H11A 1NE2A 4E2XA 3HA3A 3MCZA 2I9KA 3DP7A 3ME5A 5GOZA 5LQNA 4KRGA 5DXJA 2IPXA 4KIGA 4M36A 5CIYA 3LGAA 5E1OA 2Z6AA 3UJ6A 4HRAA 5DX8A 3P71T 4X60A 5HIJA 2YXLA 2ZIEA 5HZMA 4FSXA 1ORIA 1WZNA 1X1DA 3SXJA 4C05A 4DQ0A 2CL5A 2NXNA 4C03A 1NBIA 5GM1A 2GLUA 2WK1A 2NXCA 5EEGA 3CGGA 3HA5A 5EEHA 1H1DA 3QV2A 3P97A 3LKDA 2O06A 4WXHA 1BC5A 4P7GA 2ZIFA 3EVFA 5EVJA 5HIIA 4YUYA 5K01A 4CXMA 2CWWA 3EGIA 1B42A 4QVKA 4PYLA 5EPEA 4LWOA 4AZTA 3NWBA 4RV9A 3ID6C 3G2QA 5GP1A 3I53A 2R6ZA 3OU6A 3LDFA 1DCTA 4F85A 5HEKA 4EMSA 3PVCA 3G5TA 1O9HA 3E7PA 3DXZA 3MB5A 3O4FA 3G8BA 2P3OA 3M6XA 4R8SA 2ZW9A 4YV0A 1G38A 4EQZA 5FQOA 3EVAA 4E31A 4CTKA 1Z3CA 1PJZA 5DM2A 3TMAA 5DX0A 1JG4A 3A4TA 1R00A 1KYZA 2OKCA 5GM2A 3FPJA 4HGYA 5DPMA 2QY6A 4X63A 3B3GA 3KQOA 3FUVA 3CJTA 2AN5A 2JH9A 2V7EA 5DRTA 2PXCA 4IV8A 3I9FA 5CVVA 5EHIA 5JUWA 2YX1A 5ICCA 4X61A 3HCFA 3EVDA 4GC5A 3DLCA 2P41A 1SVUA 3M33A 3REOA 1EG2A 3QOWA 2OXTA 1SG9A 3AXSA 4PYNA 3OE4A 4MHTA 4UOEA 2AOTA 3FYCA 2IH2A 3MTIA 2EJUA 5T67A 5K0CA 1O54A 1BHJA 2AOXA 2JJQA 3G89A 4RVHA 3DUWA 3B7PA 2HNKA 4AZVA 3KR9A 4QDJA 2QE6A 3SM3A 3K0BA 2PLWA 3BWYA 1X1CA 1TPYA 3DTNA 4MQ4A 4OQEA 1INLA 1I9GA 2PWPA 4DF3A 4DM3A 1JTEA 2VDVE 2ZTHA 4U7TB 2IH4A 2OB1A 2B9EA 2NP6A 3BKXA 4IV0A 2PXAA 1XXLA 3M70A 4RSRA 1KPGA 4Y2HA 4ER7A 2F8LA 1NV8A 3HVJA 4RVDA 3UZUA 2GB4A 2PX4A 2G70A 3DH0A 5EZQA 1HMYA 5E1BA 5K03A 3PT9A 3P9CA 3SMQA 3UJDA 1XDZA 2BR5A 2EG5A 3GGDA 4GOLD 3E05A 4P7JA 1N7IA 4XUCA 1N2XA 5U4XA 3MHTA 1AF7A 3QOXA 3R0QA 1AV6A 1TW2A 2GPYA 2HWKA 3KHKA 1ZHFA 3THRA 4BLUA 3GXOA 2VDUE 3SSNA 1M6YA 2PGXA 4RVFA 1YZHA 2IBTA 3V97A 2NXEA 3Q87B 4CKEA 3GRRA 2ZCJA 5K0FA 5ICEA 4E2YA 2GA9A 3OFKA 2G1PA 4FGZA 5MHTA 1EQAA 2QM3A 2YR0A 5KQRA 1XDSA 2YXEA 1L3BA 8MHTA 2NXJA 3FPHA 5FA8A 3P9IA 2PJDA 5CUQA 2ONYA 5KVAA 2FYTA 2PT9A 3OZSA 1WY7A 3P2EA 4PYQA 5K0EA 3P9NA 4EKIA 3TR6A 2XBMA 1RJGA 2KW5A 2JH8A 3BWBA 3ELWA 5EMKA 3PLAE 1G55A 3FYDA 1JTFA 2EX4A 3BUSA 1RI2A 3EVZA 4M37A 4QDKA 2OO3A 3BWCA 3ELUA 1R8YA 4KWCA 5C0OE 3HP7A 3LL7A 5C9ZA 3CVOA 3KQTA 5LQCA 2B25A 2ZZKA 4YV2A 3EMBA 4RTNA 2NNWB 1EIZA 4CTJA 5F2KA 4GOMD 5EC8A 1RI5A 1F38A 1QAMA 2PXXA 3LBYA 4E30A 4GOOD 1RJFA 3TRKA 3EVCA 5K0BA 2FK7A 2ZVJA 3GRZA 3UJBA 4PCLA 3B89A 3KR2A 4ATNA 2ZZNA 3E23A 3NWEA 3TKAA 4L7VA 3G5LA 4PYIA 4A6DA 3IHTA 4ER5A 5E8RA 3DR5A 2H1RA 3M6VA 4MIKA 4OBWA 3GNLA 2FHPA 4Y30A 2IDKA 1R8XA 3OCJA 1IY9A 5DSTA 1Q0TA 4WVLA 3LDUA 3PTAA 3RIEA 1WS6A 3X0DA 3TQSA 5LQJA 2GS9A 4AZWA 3S68A 4RTJA 2QRVB 1HNNA 3JWHA 3KQSA 2OB2A 4AZSA 2HV9A 10MHA 2OPBA 1VP3A 4C04A 5DLYA 3EGEA 1NW5A 3PFGA 3R3HA 2P40A 3WSTA 2ZLBA 3SX0A 1PRYA 3EVGA 3KR1A 3VYWA 4GF5A 4O29A 3AWIA 5CVEA 3FTDA 3Q7EA 2UYQA 3NJRA 4OQDA 5F2OA 3BT7A 3BXOA 4XUEA 3I5UA 4E2ZA 4PINA 1SKMA 2IBSA 5B1SA 3UA4A 4ER6A 5LR6A 3H2BA 5G02A 4BLVA 3AY0A 4YUVA 3DXYA 5CVDA 2WA2A 5T6BA 2B78A 1JG3A 4EKGA 3E8SA 4M7RA 4MTLA 4F86A 4RTOA 1FJXA 3FTEA 3ERCA 1NW8A 2N47A 2JHCA 3OZRA 5FWDA 5EMLA 4EK9A 3FRHA 3A27A 2PX5A 5EKUA 1FP2A 3M6WA 2AOUB 5E2AA 3SVZA 4LG1A 1WG8A 1FP1D 4DA4A 1X1AA 5DTMA 2ONZA 2ZBQA 1X1BA 4LECA 4C08A 2C7QA 1JG1A 3MCTA 1EAMA 1FPQA 1RJDA 5E9QA 3TM4A 2GAFA 2Z6QA 3HCDA 3ER8A 2JHAA 1I1NA 5DRYA 2BM8A 4XUDA 1KYWA 2FPOA 3LKZA 4QVGA 3UWPA 9MHTA 3TLJA 3KPVA 2FRXA 2AVDA 4KDCA 2AOVA 4RTLA 4QQKA 5GIPE 1IXKA 3HCCA 2XYVA 1ZG3A 3IEIA 4HSGA 4V0QA 3ELDA 4G56A 2DULA 2C7RA 2XYRA 4R6WA 2JHPA 2ZWAA 1RI4A 2OY0A 1N7JA 1P91A 4BP1A 1ZKDA 3ORHA 4RTRA 2UZ4A 3TKYA 5ICGA 3M4XA 3B3FA 3CC8A 4QPNA 4YV1A 3GJYA 2AZTA 5K09A 3SGLA 4OA8A 4K6MA 3TM5A 1KXZA 4PGHA 5EQJB 2WA1A 4FR0A 2VDWA 3FPEA 3OPNA 4BY9E 3DULA 4P7KA 1G6Q1 3MTEA 5E9WA 1EJ6A 4PYOA 2IH5A 3PX3A 3PX2A 1AQIA 3LHDA 4OA5A 3GRUA 4HTFA 4P7FA 3TFWA 2AS0A 3T7RA 4PYKA 4JXJA 3G88A 4C4AA 4NECA 2FK8A 1ZGJA 1P39A 2IGTA 4ER0A 4FP9A 5FA5A 5K0LA 3ELYA 5EMJA 3UJ8A 4CKBA 5LSAA 4Z2YA 3C6KA 5GIOE 1XJ5A 4H0NA 5BW5A 3FUTA 3G7UA 4HH4A 1JG2A 2PBFA 1T43A 1YUBA 2G8NA 3HCAA 4IKPA 4QQNA 5KS2A 1X19A 3AJDA 2XVMA 3OE5A 3THSA 1JQEA 3DMFA 5EKXA 1UIRA 1L3CA 5EZSA 4AUKA 1Q0SA 3JWIA 1R74A 3NMUF 3RODA 4BP3A 7MHTA 5FCDA 3SSMA 4P58A 1F3LA 1QANA 3GCZA 3L8DA 1Y8CA 5CVJA 3HA7A 3FUWA 3PFHA 1R18A 5E1MA 2E5WA 3UJ7A 5DTRA 1G8SA 5H02A 5DXAA 3KQVA 4FT2A 4RYLA 5LQKA 3OU2A 2GH1A 4IWNA 3KPWA 3CKKA 1RJEA 2HMYB 1RI3A 3MAGA 2VZ9A 2VP3A 2UYHA 1DUSA 2O07A 2QRVA 4RWZA 1G8AA 3KR0A 5E2BA 1VBFA 1SUIA 3JWJA 4FZVA 2ZIGA 1TW3A 4YMGA 3ANXA 4PWYA 2JG3A 2ZSUA 2PKWA 4PCAA 4RTSA 1VL5A 2ZBPA 5C1IA 2CKDA 2PY6A 3KQMA 2FCAA 4PGGA 3C6MA 3GO4A 3DMGA 1NV9A 3HCEA 1KHHA 3B5IA 2I7CA 3T0IA 1XCLA 1P1CA 2AN3A 4DZRA 3R9XB 5DTQA 5HIMA 5IH3A 3LDGA 1VPTA 1R6AA 1ZQ9A 2QYOA 1QAOA 2ZBRA 3G2OA 3A25A 4QPPA 2PT6A 2YUIA 1BOOA 3FRIA 1YF3A 1VE3A 3MGGA 2A14A 3HVKA 2IDJA 3BGDA 5D1HA 5K05A 1MHTA 3UJ9A 3UBTA 3G2PA 1VIDA 3IYLW 4EVIA 1SQFA 5GWXA 2Z6UA 5ERGB 4PYJA 4ZTBA 2IP2A 3I58A 5K0GA 2BZGA 2OZVA 4RVGA 3GRVA 2ESRA 3EVEA 2UYCA 2AOUA 3EPPA 3LECA 4HC4A 5CVUA 3DOUA 4OBXA 4R8RA 3NVKI 1QZZA 3KQPA 5CCXA 3UJCA 3FTFA 3A26A 1NW6A 3R6TA 5EOVA 3RW9A 3SR4A 3EMDA 1WXWA 2P7IA 3A7DA 1KPHA 1QYRA 1RI1A 3SSOA 3FTCA 3GDHA 3LCCA 4X1OA 2K4MA 5EIWA 5LQRA 4KVZA 2O0LA 2YQZA 5M5BA 5CM2Z 1NT2A 3LSTA 3FZGA 1JQDA 4C07A 3TOSA 3VC2A 4DCMA 5BXYA 5HIKA 1M0EA 1KR5A 1JQ3A 1ZGAA 3NDJA 2PV0A 3PS9A 3KU1A 5K8VA 1YFJA 3KKZA 1EJ0A 3O7WA 3OU7A 5D1NA 3HEMA 4BLWA 2LD4A 2Q41A 1JSZA 3NW9A 2XYQA 4LWPA 1O9GA 3HVHA 5K0JA 4PONA 1D2CA 1JSXA 3T7SA 2BM9A 2V74B 3GWZA 2YXDA 5E8JA 1DL5A 5DM0A 1L1EA 4A6EA 1D2GA 3A7EA 1D2HA 3FPGA 3G2MA 2ZWVA 4E2WA 4ISCA 5FWAA 4CKCA 2R3SA 4YMHA 1WXXA 5DT2A 2PVCA 1KPIA 3HTXA 1NKVA 4F84A 5FUBA 1UWVA 2AOWA 3EGVA 1VP9A 1XDUA 1NW3A 1I4WA 1JR4A 2PX2A 4GC9A 3UFBA 3BWMA 2P7HA 3G8AA 2B2CA 2AR0A 2P1DA 3CJQA 1P1BA 3LCVB 4E32A 4E33A 1YZ3A 5EGSA 5LQAA 3P8ZA 4PIPA 2BR3A 2ZULA 2UYOA 1M6EX 2C7PA 5FULA 5EHGA 4PIMA 4DKJA 5BW4A 3BGVA 3EVBA 3P9KA 3KQQA 2BH2A 3C3PA 4OX9Y 3GIWA 5GINE 4KIFA 2ZFUA 3ER9A 1SQGA 2CMGA 2YTZA 2ORED 3B3JA 4DCGA 3EEOA 3FUUA 4RX1A 5HILA 3I64A 2OBFA 4HG2A 3AXTA 3LX6A 5EG5A
chains in the Genus database with same CATH superfamily
3KUKA 3MLAA 3RH0A 1S9HA 2HAEA 4B3FX 3CWQA 2XHZA 3P2KA 4KW7A 3AHIA 5AVJA 3U13A 3G9ZA 3NG1A 5DGXA 1PW7A 5EJ7A 2IUYA 3HWRA 3B78A 4AKSA 3F98A 4K0KB 2OL4A 4BYGA 1BDMA 3KPUA 2HMVA 1LW6E 3V8VA 2FN3A 3GFOA 5GVSA 4XCXA 3ROFA 4YCLA 1QP8A 2FQ1A 4BNMA 1JR3D 4E15A 2Y1XA 621PA 2OV6A 1KYIA 1XNHA 2C7OA 3LG2A 3RZZA 1WQ1R 1X7GA 2VYVA 5AO9A 1JIJA 4UKDA 1Z88A 3I5XA 1N36B 1CQIB 3ZU4A 1NVXQ 5DM1A 4NY1A 3B1YA 3WMGA 5HS4A 3BTOA 4QUDA 3NUQA 5EAIA 3IKJA 4MKXA 5FHRA 3PUYA 5LYJB 3FSRA 1IHPA 1NXVA 2HY7A 1W88B 2HF8A 2OBBA 2UUCB 5T64A 1UZLA 1UPBA 2HR1A 4QODA 3T5AA 4ALNA 1P7PA 2BDUA 3L46A 3W1VA 3A36A 3SQNA 3NU1A 3L06A 4YXWD 2FKAA 3CX6A 3JARB 4R54A 1QGYA 2PXDA 1HDIA 1QQTA 1XR3A 2I03A 2JGDA 3BE6A 3D6VA 3K05A 4HTFB 4L7QA 1U9IA 2R6HA 4K9OA 1T1EA 4P3PA 1OPRA 4R2HA 4UXIA 3SBDA 4LHSA 1OX4A 2JAHA 2OCYC 2IYSA 3PUKA 4RFLA 2IYFA 4N41A 4UNRA 1JDUA 4JWTA 4DMUB 1PRAA 4MW0A 5LLTA 1J2RA 5FEMA 4J0GA 1UFKA 4ZT4A 4DMKA 1GL3A 4EARA 1PL6A 1KP9A 4XVQA 3MC1A 1TIKA 3UNXA 2NP7A 1PZHA 4A10A 3T1YB 3QEAZ 2J9FB 4YMWA 1QRDA 4FSDA 2VP6A 5JR3A 3GJZA 1PFVA 5ALPA 5DOZA 1AQJA 1G8HA 4CEHB 2WPDD 1LVHA 1T8SA 3FLMA 1OLXA 2Q1WA 4AM8A 2WFMA 3UYLA 1S2LA 1SKBA 4ZI7A 5GOZA 1BVUA 5LZ4A 2OZPA 4M36A 2VDJA 5K6TA 5E1OA 4F3RA 5CIYA 1H6DA 3AMVA 1SK8A 3OFND 1UM8A 1CY4A 2FG7C 3CHYA 1N2JA 3F3MA 4LZZA 3L8ZA 4HWRA 3WSWA 3ROGA 1M8KA 2Z83A 1QIJA 3D7RA 3SXJA 3K1YA 1PG5A 2CL5A 1WV1A 2DB3A 3GGGA 3KJIA 1WUIS 3T7AA 1CETA 1YRHA 3V8QA 1YR3A 3CRVA 3HA5A 2CEAA 1UXCA 2XE6A 3RJMA 1AH2A 5C1DA 1GGKA 1ECBA 1SIBE 3B20A 2WUWE 3M6FA 4J2HA 3OPYA 4MI1A 2H18A 3H5TA 4CM3A 2ETXA 3AZPA 5IKXA 1WA5A 2BRUA 4PYLA 1T8PA 4QWWA 4O4IF 4Q9DA 2OG1A 3SXUA 4YVFA 4JI0B 2DPHA 3HU2A 4MVJI 1EK6A 1BXGB 3SQLA 1OYOA 3EA4A 1DKPA 2C5AA 1LJUA 3O38A 4M9UA 2WZBA 4UOQA 1CBUA 1PW5A 2FRVA 5A9SB 2PWBA 4UUPA 2QQFA 3QV1A 3DBLA 3TZHA 3Q7QA 4RV5A 3GJSA 5LFAA 1BGVA 4D9CA 1G6KA 1EK0A 3L1JA 4M55A 1U1FA 1B2RA 1DBRA 1NW4A 3QYAA 5KYKA 3BTVA 4F9GA 4O4HA 1S9DA 3CQ9A 2C5BA 3HNOA 1Z0JA 1UMCB 3W5IA 2AWNA 1LBQA 2PCJA 1UMKA 2ATVA 5BV2P 4BO7A 1Z08A 2KX7A 4X61A 3ZPXA 2A9PA 2ZJ6A 1O4VA 3M33A 1TKAA 2GESA 4ODIA 4TV9B 4WCFC 2FGJA 5CM8B 5EZ6B 3JSXA 1KY5A 3KOMA 2Q2NA 3R8CA 3S7TA 4NJMB 3QP9A 4ZU3A 1Y8ZA 1QJ4A 3K0FA 2Y67A 4JA2A 4R9SA 2FOXA 2IITA 4QYMA 4RTMA 3I42A 2HNKA 4HKTA 3CF6R 2O7QA 4J3FA 4RF4A 3TQRA 3K0BA 4UDYX 2BM1A 2WVGA 4CG2A 1MIOA 3V7UA 1WSBA 3ZWCA 1XT6A 4TXMA 1XMSA 3M3DA 2FPPA 3IA7A 3NT2A 4ZMBA 5IYZF 1WCWA 2EFHB 3HP1A 4WECA 4YAJA 1FX1A 1VE9A 2Q5OA 1PO7A 2BI4A 2RAUA 3JQGB 4C7JA 4MDYA 4D02A 2XX3A 3V8EA 1X2BA 1YZUA 3MQFA 4NE2A 1ML3A 4CGYA 5DNCA 5IEJA 5K03A 3MPOA 1I7SB 3E05A 3FNIA 1X38A 1AF7A 4IICA 4N1AA 5KOHA 3PJRA 1N7HA 1I10A 1A9QA 1GGEA 1V71A 2LGJA 3FDFA 4ISBA 3FSGD 3LSYA 4DDKA 2JGAA 1RXEA 4U2FA 2LNMA 1SEPA 2AZDA 5JCPA 5AQ1A 3NDRA 3PRHA 3OFKA 1MORA 2VWQA 5HJEA 4KOAA 2XMGA 2DCUA 3FCCA 4MP6A 4LW8A 1ZCFA 3OIVA 3IESA 2WYOA 4XX0A 1T9KA 2WV7A 2JK0A 1ICEA 4FHDA 2VDOB 1ZOOA 2M32A 2QS9A 3FTNA 4Q4LA 3LHKA 3S55A 5GADl 3B8HA 4KE6A 4N0QA 4JI7B 3LKBA 1U3WA 1ZYUA 3GCGA 4E5YA 3CKMA 3FCUB 2OXRA 4KAAA 3ZI0A 5AH0A 1KO8A 1T2AA 4X8MA 4RTNA 2MMCA 3W79A 1A50B 5HRAA 4BE4A 4TTRA 5EC8A 2OAQ1 1UK9A 2G7MC 3UAWA 1Z8FA 2WQ6A 5DLPA 5EIBD 4EB6B 1O95D 2EHDA 4M9ZA 4YRDA 2HRCA 3K92A 3K0SA 3QVGB 3GRAA 4IKEA 4NZ9A 4YRCA 1TEVA 4P84A 3JPYA 4MIYA 4YONB 1PJLA 5KHOC 1WR8A 1A5BB 4BNHA 3DVLA 1K27A 3L8MA 4FPXA 4RKYA 2VHWA 2Y05A 4GD3Q 1R4AA 1S89A 1ACMA 2QNRA 2ZRBA 3M6VA 2H48A 3AI1A 4U2DA 2VSNA 3DZDA 2CDRA 4UM9D 4CF3A 3D59A 1BEUB 1X1TA 2NU6B 3KVNA 5KDDA 1UM9A 3RU9A 1I3OA 3DE6X 4N76A 1WETA 1T4MA 1ZD9A 2YVAA 5EIEA 2BZSA 4A4DA 3ZD6A 3O8NA 1M2OB 1N2OA 4ZOCA 5HQ3A 1VJ0A 1BJRE 2VBFA 4CDNA 4HDRB 4GICA 5CH5A 4Q01A 1XRMA 1UXKA 1C1DA 3HZRA 4Y2JA 4TKVA 2P40A 3GHHA 4MV6A 5KTKA 3IQGX 5DLEA 2AW5A 5C34B 1L4GA 4J0JA 1EQ2A 1RACA 4I4LA 4EECA 3Q7EA 3FNGA 4UVDA 3ZBPA 3THWA 3PJEA 1YHYA 1V47A 3H6GA 4F71A 2OKGA 2GEKA 4IQ0A 1VJ1A 4CM9D 5JBIA 1L5VA 4LOAA 1E8NA 3SQWA 2A1UA 4TTAA 2ZTUA 2VR1A 2VQFB 1G8KA 1X7XA 2F1HA 3AF1A 3QE0A 3QEKA 5F64A 1RRCA 2AXQA 3PJGA 5ALDA 3K70D 1QFJA 1D09A 4R5MA 4E03A 5INTA 4AWXA 5CA1F 3UPTA 4XWKA 4G0VA 3PZRA 4Z1MD 1XKXA 3I2JA 5BRJA 4TV9F 5KYYA 3PUXA 3D31A 4KQCA 3DFUA 1NURA 4R1OA 4BFLA 2GJSA 4ZVVA 3CLUC 5BWCA 5IASA 2CXPA 1FSZA 1IY8A 1TJ3A 2RI0A 2P6UA 3NHPA 3TNDA 4BASA 3EGWA 1GTZA 1ZOSA 3AHDA 3KQNA 4JH0A 1XX6A 2Z2IA 4G8JA 1E89A 4CUZA 3RTEA 4NESA 5CW2A 5AM2A 2Q0SA 3GLHB 3HFGA 3MPUA 3OVMA 2C7QA 5TQ2B 2M1ZA 3ZDYB 4CMAA 3IR6A 3H86A 5I4IA 2P6NA 4UBJA 5BQXA 3AU8A 1QPBA 1PJQA 3B5EA 3EXAA 1NUPA 3OECA 3ER8A 2QPTA 5DRYA 2WWHA 3OKAA 3CLTD 1Y5LA 3IAHA 4ENPA 5JZSA 1HNXB 2GERA 4XR4A 5IUKC 4A23A 2OUKA 1IJEA 2YWJA 5H9VA 3H4IA 4DNOA 5JO0A 3KJXA 5BT9A 3ZWKA 2NYAA 1K3FA 5MF6A 4KV9A 2F2TA 1Z7EA 1COWD 3D0RA 4LXXA 4AXBA 4CR7A 2CC2A 5CG2A 2IQ5A 3ESZA 1ZU4A 4QIHA 1II0A 1OVGA 3DVAA 4GL2A 4CKXA 1OIWA 2IHUA 4IRXA 3TIFA 2WPNA 2G9RA 3CZCA 4FEEA 1YE8A 2VDWA 1M2NA 2FX2A 1JIXA 1QK5A 2ZSHA 5I8PA 1N8SA 4WY5A 1CY1A 2PMCA 5DWDA 2MWMA 4G63A 4LF7B 1RZSA 1OXMA 4H1VA 4BQPA 2XRZA 3F9CA 4G9EA 2DY0A 7GPBA 1O58A 4M0CA 5JDCC 5JTTA 2AJBA 1N2ZA 2AK3A 2AW3A 3BIJA 2LLVA 1ULSA 1JEAA 4LCJA 3VPBA 1QHNA 2EKBA 4KQWA 4L4SA 3ZHVA 1SIWA 2A8YA 5JZ9A 1KJQA 3WYCA 4MR7A 3SIRA 2RFLA 5BQ5A 1BWRA 1CJCA 2JL1A 3F3KA 5B53A 1KYVA 2ISCA 3LBHA 3I04A 3I9OA 4HH4A 4UMEA 4BQNA 2QROA 1T43A 3BULA 1AU7A 3VPDA 4TTSA 1P1IA 1X19A 2ST1A 1ZZ9A 2VWGA 1UOEA 4S24A 4RABA 3V1YA 4MV1A 5I9LA 1NPYA 2TS1A 5F5XA 3HCRA 1Y1SA 3LGXA 2WHPB 4MKHA 4JR1A 3TZBA 3DKKA 3U40A 3C3EA 4ZCLA 4LXIA 4OU5A 1LPAB 4DXHA 4R5HA 1B8OA 5A06A 3IQEA 4WJLA 4PO1A 2CUKA 3KLBA 4HDMA 3WGQA 4IKOA 3PFIA 5HJ5A 1L8QA 3GMIA 1ZVQA 3IVMA 5G2OA 2XMQA 5I5EA 3AF4A 2C92A 4IXWA 1VBFA 1NOJA 3I4CA 1NC3A 4ZRNA 1TE2A 1VRCA 1ZVJA 2EWWA 4TTVA 4B81A 4KK3A 5NLLA 5KYXA 4G4IA 3AVXA 2O8FB 5EERA 2RSLA 4F2GA 1HT0A 5FL7D 1C1XA 1Z7WA 5T3YA 4CMIA 3IL2A 4WXRA 3SKYA 1NV9A 1VG0B 5FAKA 1QGUA 4JZKA 1XCLA 3LQQA 5AUPB 1VIAA 4MPRA 4X44A 5BNTA 1RSZA 3W1EA 4V0KA 1NY6A 4BWYA 4LDNA 1VPTA 4JB3A 2ZBRA 4B35A 1H93A 4OREX 4D3FA 1L7XA 2QMZA 1VCIA 4OLHA 4TZ0A 3TQCA 4AW9A 4K9DA 1VLJA 4JP3A 3PF9A 4N3NA 3WDSA 1XV5A 2HCBA 2JNWA 2ES4A 2O2JA 1BE6A 3P0HA 3K35A 1NQXA 4FMDF 5GWXA 2JIDA 4OQYA 4I9NA 4MVJF 3R23A 1NXQA 1H9AA 4QG7A 1T3TA 3NBYC 4CKWB 5EWLB 3CVWA 3MYRA 5A5DA 2H51A 2G1UA 2ZRDA 2J3LA 5F7OA 1Z18A 3TL2A 4FFPA 4KI0A 1XLTA 1YCGA 3S2FA 4I6TA 1Z5PA 2KB0A 3L8YA 2XXQA 5EVCA 3HH8A 3N8DA 1NP6A 2XWQA 2C3YA 2SBTA 1N2IA 4LQCA 4LUCA 2PCLA 1YGYA 5K8IA 4CHGA 5T8KC 1OGYA 3KX2A 2ZJ3A 4YYEA 1RWVA 3CKYA 2FLVA 2Q6LA 3EIWA 3FLAA 3Q9NA 2PZGA 2VLBA 2WWXA 2P7IA 4L5IA 4RXUA 1NZFA 2C99A 3TRHA 3GDHA 5EHNA 4PFKA 2FLWA 2QXUA 3VO8A 1LVUA 2YN0A 2DJ5A 2HA6A 5LL6P 1I14A 3CE6A 4TS3A 4BGIA 1DUIA 1ECCA 3EJ6A 2HJWA 1SBTA 4MS1A 4NULA 4N47A 4OB8A 1E3IA 4JUFA 3WLKX 4YBRA 2RARA 1NYQA 3D5EA 4HNSA 4HN4B 5CXXA 3W8EA 1WWKA 2VJNA 4W82A 1F1BA 3EISA 5K0JA 4Q3DA 2XDQB 1EYZA 1HYGA 3T7SA 1BN7A 5CLLA 2RD2A 4QJ5A 2HI0A 3UXHA 3FIUA 1B26A 1ZUGA 4HL6A 4ZAXA 4CV2A 4FIZA 4DR2B 1FMTA 1NIJA 1OT3A 1U0GA 2VPYA 3E1GA 3NHWA 1Z28A 4HQLA 1UBOS 1UH5A 4PAOA 3JQCA 1T1JA 4YIHA 2X3YA 3A1TA 4YRMA 4WOBA 4F84A 1QV7A 5CJ2A 1TJ5A 3B12A 4FTWA 4WZ6A 3EGVA 4ZVQA 4O59O 1E2QA 4DG8A 1JR4A 2PX2A 3LF1A 4EPRA 1PFUA 3NFRA 5AW6A 5BVHA 1X14A 2RC6A 1JEJA 1LDMA 1YR9A 2BHNA 2E3JA 4J0EA 2HDOA 3IKLA 2Q9BA 4S1WA 2V58A 4NR0A 1T35A 3DEZA 3M34A 2UZIR 1O8BA 1QX4A 2RGNA 1S3SA 8ATCA 4FIDA 2V3CC 3UK7A 1UBFA 2XNSA 3D54D 4UZEA 1QYDA 1P80A 4WK2B 2OBYA 3GIWA 4OMFG 3VZDA 2VJAA 5H3LA 1KU0A 2ORED 1IEVA 3JQAB 1UFVA 3FUUA 3P9YA 3C5VA 1F20A 2ASEA 1TU3A 1BKSB 4QOHA 5CP8A 3BSSA 3C98A 1U5CA 1L5SA 2I71A 3D2BA 4L4UA 4HVAA 3RSHA 4QGFA 3JXCL 4C7OB 1FDWA 2QUHA 2M9MA 3EEYA 3O92A 3RVMA 3ETEA 3LHIA 2ID4A 2UVDA 1P7WA 1U0NA 3G1WA 3KEOA 4WFKA 3ZOZA 3P2MA 2NTEA 1NXTA 1Y3FE 2QTLA 1HYQA 3DEHA 3K94A 3OP1A 2FW0A 2QGFA 2LP4Y 4CL2A 2ZE6A 5KQSA 3R3VA 3VC7A 5KBYA 1QHFA 1NVBA 2W2XA 1GHTA 3BS3A 4MUEA 3DFKA 1Q0UA 4O1IA 4UUOA 1IOLA 1YBHA 4W5JA 4EFDA 1A76A 4E70A 4ABTA 1C7JA 4UNQA 2ZSEA 1UQRA 1VE7A 3UXMA 3R1IA 2EFCB 1RABA 3SKVA 1TAQA 1RXWA 2Z5VA 5KWJA 3TZEA 2VLIA 2ZRJA 4LGCA 3MG9A 4KDFA 3WNZA 1S1CA 2VXBA 1J0BA 3T15A 5M04A 4PYMA 1Z6TA 3VVMA 5AKJA 4JP2A 2IXGA 1V6AA 2Y1WA 1YB5A 3GNQA 3RGGA 5I45A 4W63A 1TYEB 5HOQA 3SICE 1G5IA 5AXCA 3CVVA 1O94A 4OHVA 3OQ1A 1MQAA 1NJ8A 1U2GA 5EXXA 4HRXA 1FUUA 4MGKR 2O05A 1ESNA 1ZNWA 3EQ2A 1T8UA 3AESB 4HFRA 4IJWA 5LVAA 4OBBA 3IPLA 3ND8A 1R6DA 5ALIA 3VOAA 1OH7A 5EE3A 3RARA 4YRTA 2KEKA 2B1IA 2JFBA 4GRIA 4NCHA 1MO2A 5J2UB 2C94A 1SUSA 4I4NA 5JD3A 2DLCX 4CLRB 2O2SA 2G3YA 3OZGA 1VRVA 3GY0A 4X71A 4DJDC 4RTKA 3LS2A 6CHYA 1J9EA 5IJXA 3TD9A 3EZNA 4PSCA 3V4RA 3CZQA 2UUBB 5FBQB 3ZHBA 2X15A 1GT6A 1CW2B 1LK0A 3CEJA 4NDAA 1QH8A 2WT4A 3Q3GE 1O6FA 2DFKB 2HO4A 1POXA 3EPRA 3AJ9A 3MS2A 3PDUA 4S2EA 1P3DA 4JU9A 4JBLA 1YUNA 1N3IA 1QRRA 4W9RA 2QTBA 1BQ4A 1MX3A 2FETA 4GH5A 2O2GA 3ZDCA 2B6NA 4TKMA 5FOSA 5EJ5A 1G60A 4F9TA 2H11A 1AA9A 2HWXA 1NVFA 3CSDA 5L4NA 3WDLA 5JNSA 1G20B 4EI8A 1N33B 3BH7A 3G1UA 3PPIA 3V1MA 4J1TA 3LGAA 1L1RA 3DMTA 3I39X 1UBHS 3RUPA 2GRLA 3VOTA 4KRXA 3UJ6A 5F51A 1A5ZA 2DM6A 1EP2B 1PGQA 4XAQA 1M2KA 3JTEA 4XIIA 4CFSA 4FSXA 1WZNA 4EA7A 1X1DA 5CFPA 5EHXA 1KI2A 2GR9A 3OEHA 3VSCA 4OJKA 2WJIA 3U7GA 1EHYA 4ZVNA 3L7LA 4JGIA 1RE1A 4C4RA 5JD6A 1U4NA 1FVFA 5EPUA 1FP7A 2YJNA 1MH9A 1ZH6A 2ZYDA 3C97A 3CGGA 5DZSA 4F04A 4Q4HB 2Y93A 1TO2E 3E58A 1BC5A 1E1KA 2H65A 2MMGA 3PNKA 1KEPA 1WQ3A 1G18A 5IEBA 3O3MB 4C76A 4YUYA 5IWAB 2D5AA 1EVIA 1UPFA 3NIDB 3L1PA 3PRJA 1T91A 4N5DA 3KTDA 3NWBA 4US0R 3ID6C 5AXAA 1O9BA 1QB2A 2R6ZA 3B70A 4E11A 3RYHA 2EP7A 2I33A 3KSRA 5AVZA 1DXHA 4FSHA 2BP7B 3I2GA 4X62B 1T36A 2J5QA 2Q7XA 3CRRA 4GBJA 4HXGA 3RS7A 3LQXA 2ZQZA 3QZUA 2P3OA 4TWZA 4UE3S 3T3IA 4YV0A 5HUHA 4QM6A 2FKNA 4RD4A 2RGEA 3WB1A 1X74A 2C9MA 1D6MA 1CZLA 1JHYA 3TOVA 5GM2A 1TEXA 4HGYA 3H9QA 3LQRA 4RMJA 4ZOLF 5F77A 4LFCB 3E2IA 4XB2A 1EI9A 5A4JA 1N2EA 1RAGA 1FYEA 2JFXA 1HT2E 1H6AA 2LDXA 4BTEA 2AN5A 2CT8A 2JFFA 3VM6A 3QM1A 1JHDA 4FOTA 2AZXA 1Q1BA 3HUFA 4M1EA 3P26A 3V4ZA 2NWQA 4XGRA 1EUZA 4QVIA 1MZVA 3DCYA 3OHPA 4QJBA 5KJ6A 1TJ4A 4JR0A 1YS2X 2C59A 5DNEA 1U7TA 5KREA 3S1SA 4Q9KA 5KTPA 5H3HA 3V9AA 1OIVA 1U6JA 2VCEA 3KEQA 1DCKA 1G63A 1W4ZA 5K0CA 1BHJA 1ZI8A 2EW1A 5AM5A 1NC1A 5GONB 3M4NA 1G8JA 1AKNA 1SH7A 1QQ5A 2CW5A 2JFPA 4Y7DA 2OK7A 2TYSB 3PC2A 1W1IA 1RTTA 1JTEA 2AG5A 1L6RA 4IL5A 4KJZA 1FNSA 2Q5HA 3RFCA 3WJ2A 2O0KA 1LV8A 3DS8A 4G5OA 4AJPA 1GG5A 3ZHIA 4XTRA 1LFDB 2ZTVA 2OFYA 2PUEA 2OZEA 3PGLA 3ROKA 1EVQA 3A06A 4M9XA 4C3UA 1HI9A 5A04A 4M0LA 4OHXA 1XZAA 2GZHA 2YCLA 1XZJA 1WW8A 2B61A 5EJ6A 1YZTA 1WSAA 1UJMA 1Z2AA 1UT8A 3DFZA 3I9LA 4HQRA 4PPGA 3WMXA 2FY8A 4TRNA 3ZU6A 3DFMA 3JQ8B 1QGZA 2XSZA 2YDXA 4UCXA 2HFKA 3OOEA 4V0LA 3KHKA 4DR5B 2O8DB 1NRIA 3ABQB 5C8YF 2RG1A 3D8RA 4KRYA 1RRKA 2VP2A 4RETA 2IYPA 3QVVA 2HF7A 3O1HB 3HLYA 3OUTA 5JYEA 1LS6A 5B1YA 4ZDWA 4PO9A 2I4TA 2ZIXA 3GT7A 2FMHA 3EDQA 4V0ME 1VGQA 1V5IA 2EP8A 1IONA 4KUHA 5F7JA 3RU7A 3WHIA 3AH8A 5K0EA 1RJGA 1E2DA 3FD8A 2WKSA 3PLAE 4NX2A 4PLTA 3TUZC 4C4SA 3BUSA 4REQB 4HD8A 4QDKA 1JHXA 3AL3A 2GRJA 1P2VA 2B36A 2YRWA 3BWCA 5JXJA 3J7AC 3QLVA 1MOPA 2P8SA 1R4NB 1ST3A 2ZXEA 3EARA 1YIOA 2HCFA 1IK4A 2SKEA 4II2A 4NNOA 4UW9A 2RIRA 1KIMA 3B6IA 5T57A 4MGEA 5JQWA 3ZE2B 5LQCA 3EMBA 4I6RA 4MIOA 2ZDHA 4PO8A 4Y2UA 3T3EA 4EQ6A 2ZWOA 4A1FA 2HRBA 1CRLA 3WLEA 5A5EA 4G84A 4XGIA 4YAWA 4OK3A 1MVNA 1CUEA 1RYEA 4FQ5A 4O1HA 2O59A 2O8BA 3L1HA 3Q0TA 4YQFA 5IKEA 4GWKA 3EULA 1DE0A 4UMVA 4KMMA 5FWNA 1PV1A 1P4AA 3TKAA 5KVSA 1BH2A 5TS2A 1BOFA 2Q8QA 4HAOA 3GJ7A 3G0CA 5BYJA 4ZD6A 2YCBA 3DR5A 5EMHA 4D9FA 2H1RA 4H27A 4OBWA 2BSXA 3KT3A 1NLMA 2H1SA 3CF4G 2IDKA 2XMPA 3P0IA 4BKPA 2IZOA 1GPAA 2IPOA 3UMRA 3NOXA 4DGQA 3UV6A 3JR3A 4AZWA 1CSEE 3SHVA 1HDCA 2QRVB 4YQYA 3M1LA 1KJWA 4ZI2A 2BEWA 2XIJA 3LV8A 3VR0A 4F2DA 1NATA 2HM7A 3PIRA 1VI6A 4MWSA 3SX0A 1E2BA 4QXQA 4W6QA 3KZ3A 1IAQA 1Z0ZA 5AHRA 2QRLA 1QWSA 2B21A 3P9XA 2AG0A 5HUQA 1OX4B 4MUFA 2HFZA 3LPAA 1YQDA 3B3QA 5FNVF 4BJ5A 1KI9A 1DG1G 2EF0A 1XRRA 2DHCA 3KK0A 3OBIA 3V1NA 3NNSA 3QWAA 4PRKA 4CLXA 3INNA 2J7UA 2IA5A 1W8IA 3FTEA 3PV0A 4Z9XA 4BNNA 5TLSA 2PXPA 2F9MA 2BFEB 1PR6A 2XHEA 4EMBA 3O90A 2I4RA 4LIPD 5AKYA 4NG5A 3EGDA 4BKMA 2G4VA 2W58A 3ZV5A 5A4FS 1QHGA 3ICPA 4R0NA 1DG9A 3N59A 3VGPA 2PKQO 2XDYA 4KN5A 4D74A 1YGPA 3A6LA 4NBTA 4ZI7B 4OI0A 1BSVA 4JHLA 2XAAA 1THZA 2WHEA 2ZBQA 4LDPA 1QP4A 2VDNB 3FI0A 4F5WA 1DI0A 2V3VA 3AY3A 2YJGA 1RPNA 4RD3A 3TM4A 3U62A 1Q77A 1CS4C 2VG8A 1V5EA 5LYYA 1GQSA 2FPOA 2AVDA 4ON9A 2C9OA 4MTCA 4PCUA 1VECA 4QQKA 3GZTB 4YP1A 1K75A 3D8UA 2PZ8A 3ENVA 3ZKAA 4G56A 1PX2A 1QHYA 2CXOA 2FOIA 2VPPA 4O02B 4BUZA 3RF7A 5MGBA 3IO5A 3OPYB 1RDFA 4L4RA 5DHPA 1H2ZA 2PU7A 3TSCA 3EDRA 2UZ4A 2B1JA 5NULA 4FQ8A 3SXUB 1S7GA 4BV9A 4AYTA 1QK3A 1FLDA 2AZTA 2NZ2A 1SCUA 1ZM7A 2LKCA 4ARZA 1W59A 2I6FA 2N42A 2IEAA 3ZVRA 1D1TA 2IYAA 2LBPA 3IVXA 4P54A 1MJ5A 3FYUA 521PA 1OFUX 2CNOA 2AFIB 3GYBA 4J0FA 3FZQA 2V7QA 1Z7GA 1X7YA 1FLVA 3I4FA 4K2HA 2WKPA 3COJA 3U49A 1GCGA 2JFHA 2QNIA 2O4CA 4O4HB 4QUBA 2YZKA 2I99A 3QI2A 2Q28A 5HFAA 3X3HA 3H99A 1QE0A 1DAKA 2WUSR 4OGKA 3T7RA 1Y4SA 2CLDX 2IC5A 4JXJA 2DFDA 1Y89A 4YI5A 1GQ2A 1ZGJA 2FRDC 3C3CA 3L5KA 4CKBA 1ONOA 3VJKA 2Q3BA 3WJAA 2DSTA 3SVTA 5GIOE 3NXHA 5H80A 5JNLA 2D1RA 5AR1A 1JKJA 3NWJA 1AUVA 1KI3A 1CUJA 4WKBA 2DG2A 3HCAA 4J91A 4N12A 4QQNA 1CY2A 1A04A 2X19A 2PNJA 3RFXA 4BB5A 3H05A 4CG0A 1IC8A 1N8NA 1AMUA 1DZ3A 1TT7A 3K0FB 4R16A 4D3YA 1MB0A 5F1OA 3ZR4B 5C1PA 1ZD5A 2WNHA 3FGPA 9ATCA 1L5RA 5JEEA 5DHRA 1ZJ5A 4MW4A 3PD1A 4BP3A 4AP6A 4Y2RA 4DJAA 1KI6A 4BL5A 3OMWA 1XZ8A 4ND1A 1BZYA 1MIOB 1HBJA 4S3MA 5A0VA 2E5FA 2ZUFA 4N7BA 1DAFA 2FPPB 1NERA 3CUWA 1FNNA 4HGOA 4N5HX 4PTYA 3HADA 1Z73A 3EK2A 1UXGA 3OIFA 4XW2A 3RS4A 3FGZA 4LNHA 5PGMA 1UDXA 2MINA 3QVLA 1D04A 3ESYA 4BOYA 3I2KA 3GDFA 3H97A 3NCHA 2LCFA 4OFZA 1Q7BA 1JILA 1MFZA 4XRRA 1LX7A 5ELLA 3TE7A 4RTSA 2HRQA 4XWGA 4Y9DA 1L5ZA 2H7YA 4ZT5A 3OPMA 5IC4A 5KOHB 3D6AA 4WXYB 1E77A 4FCVA 4BX3A 3K72B 5IN4A 1SO8A 4PANA 4TWBA 5ALEA 1NMSA 4U2BA 4A0RA 2O5EA 2EJCA 5DTQA 1NUUA 2CN1A 2X9VA 5E3HA 4D81A 1EUQA 1OE0A 2GYVA 2QYOA 2IYYA 2IV3A 3SCHA 4KIJA 1Z0SA 1YT5A 1LBSA 1CZRA 2X7HA 4JODA 4L0MA 4N3GA 3K1JA 3QTTA 1XTIA 4WLEA 5D51S 2UXDB 3BG5A 2A14A 5CPBA 4EO7A 3C3BA 2FQQA 1BH6A 2DWOA 3ADKA 4M0EA 1KVTA 5D1HA 3O47A 2XTJA 2HL6A 3U7JA 1XROA 4PZPA 1KA9H 2QG9A 1JJ7A 4DE5A 4BO8A 3QI7A 4BGDA 3O9MA 3BAZA 2ESRA 3QEOA 4R1PA 2QL9A 3DJYA 3WXMA 5BMVA 2XZLA 1W36C 4K8OA 3OUUA 2IVGA 4CMHA 4EPYA 1X8XA 1UC8A 2CVOA 1P4GA 1P2BA 2WSBA 4KO4S 4F4DA 1IXSB 2IS6A 4FGUA 2IPAB 4IO1A 4IPTA 4ZODA 4UU8A 4B47A 4EPXA 4F6RA 4B3TB 3A3KA 1IZZA 3DCJA 4YP6A 1H5UA 1BN6A 2C0PA 2C82A 1GG8A 2PX3A 3L1VA 3N75A 5ALFA 1YQ9A 3IEUA 4KVZA 5LMCA 4RGVA 1ZMBA 1XRQA 3I92A 4PLGA 3VC2A 1V9SA 1DJOA 4I50B 3PDWA 4U5QA 1JQ3A 1NJ5A 1GVNB 3IAM1 2XUKA 2YS7A 4MGIR 4RMIA 2D7JA 3PS9A 1IVSA 4A0GA 1O89A 4KNVA 5FTKA 2XZOA 3ZCUA 1RYBA 3AF6A 5EA2A 3VHLB 4MWDA 1Z8DA 1KZ9A 3JAKA 4AKTA 2QBYA 1NUQA 2OHHA 2BW0A 1P4JA 1AHNA 3GEDA 3TSAA 2X23A 1QC5A 4HDOB 3R0VA 1GRVA 4GMHA 1KQPA 3H2KA 4LY0A 4UHHA 1XLVA 4KACA 3OQBA 3IVPA 5EJFA 3VR5H 4LJ5A 2R3SA 1DWKA 4YAIA 5DT2A 1F6WA 3ZQ6A 3CPHA 3PD7A 3SQXA 1HRKA 1M1YE 2RMKA 4GG1A 1CEYA 4FGKA 2NIPA 2YWHA 4GC9A 4XE5A 1OWLA 1DRKA 3FYHA 2QUIA 2REBA 4H16A 3G8AA 2YDYA 2I55A 3ACDA 1SR8A 2FSVA 1R0YA 4WGFA 3UENA 3KYIB 4BNZA 3ISVA 4DLLA 5JYCA 3FHOA 3HJGA 1DSSG 3SLKA 1H8HA 1AC5A 1RCUA 1WMFA 5LZ5A 4NMXB 4X3PA 3GUUA 4TZKA 3I6IA 4DEVA 4JJZA 1E2NA 3T12A 1E99A 1KKLA 1QKJA 2H57A 5AVUA 3KYCA 2PKXA 2J07A 1ZW6A 4NJEB 2VRCA 4PZLA 1GTG1 4Y67A 2A4KA 1D0VA 2WMOB 3DOOA 4I8XA 4OYHA 4GEGA 3RVBA 1NXXA 4DXAA 2IOHA 4Y2TA 1S2MA 3IKMB 2KQUA 1FUEA 3MCUA 1T29A 2E4YA 1GLVA 4YACA 4BO0A 3BWDD 5DVZA 3T7KA 2OCIA 3TZCA 3GCWA 4URWR 4GBED 3NI2A 1JZQA 2F6RA 2P35A 2G71A 4JCOA 4YAUA 3ZWMA 1W5BA 1U7HA 5F1YA 2B8TA 2CF6A 1C7ZA 3QNWA 2PX8A 3AJEA 2J3EA 3JCZA 3J7TA 3PIIA 3UPDA 2JCYA 3ZE6A 2EKPA 1JDZA 1GJRA 3MWKA 2IUEA 3FPLA 1BA3A 3NOOA 4LDRA 5DO9A 2D3TA 1E96A 4IH1A 1TCAA 3UA3A 5HCNA 3IRUA 1OYYA 3PPXA 5TE9A 7AT1A 5LQMA 4JS0A 2WAYA 2HW8A 2P5UA 721PA 2Q4BA 1ADYA 4PC6A 5LKAA 1W75A 2H5LA 3PNBA 3DMHA 1U94A 2GK3A 4GM4A 4ZC1A 4FYYA 3UQZA 4C7MA 1F7UA 1OBOA 3E7DA 2QUBA 2NUAB 3IC5A 2VDWB 4RK1A 3EODA 1E0KA 1GILA 1FF9A 1LK5A 2DFVA 1MT0A 3C3YA 4KXLA 3AC0A 4AL4A 2R8EA 3F2VA 4OI1A 1OGIA 1A82A 5HYVA 3IEPA 4LYJA 2CLFB 4M3NA 3LPMA 3P94A 3KD2A 3OIWA 4HH3C 4R40A 4ARAA 5JJBA 2P68A 3SYRA 5IFKA 1XQVA 3FROA 2FDRA 4X8HA 4X1IA 1X39A 2R87A 3U2QA 5AVRA 1E3SA 1Y5MA 4MR7B 4CF6A 2XUQA 3AUXA 1UBLS 5IZCC 4DCUA 3GMTA 1OJ7A 2NPIA 4HNTA 1SRQA 1H3EA 1AXEA 2CL0X 4G81A 4IDCA 4MO9A 3DDUA 3V8BA 4I6JA 3ZQUA 1XWFA 2OD2A 3LLVA 4BU1A 3IV9A 1Y6GA 2F17A 2IW1A 1AY0A 1OMOA 4QTTB 1A71A 3GRYA 1M2JA 3KT6A 3NX4A 3PUVA 3QWIA 2Y92A 1PP4A 3M9XA 4TQAA 5BVGA 1GU0A 1T9BA 3AVTA 3UT5A 4H7IA 1RD4A 3KPYA 4AKEA 2LE0A 4DT1B 4L5JA 3MEJA 3UF0A 5AJUA 1MMFB 3CR3C 3TD6A 3ZKWB 2SCUA 4MV3A 3Q8XB 5IT4A 4F3NA 4C7VA 4YYZA 3HYTA 3A1VA 1ILEA 1Q17A 1WBBA 3X1DA 2ZYVX 2YXLA 2B34A 3F5MA 3WHLA 4QRDA 4LJ8A 4DCPA 1YS9A 1G2QA 2NXNA 3RS9A 3AM5A 3R7BA 4BQSA 3R7AA 5KYXB 3UOWA 1U98A 2VDPB 2YVQA 5BORA 4M0MA 4NRDA 1ULZA 1F8FA 3AB8A 2QNBA 2B8WA 1NQAO 3C1OA 4J6FA 3HL0A 4MWOA 3U4DA 4C7BA 2XB6A 3F5SA 3VH4A 4C0SA 5FH9A 3BWXA 4R01A 1QGUB 2AUNA 1AK2A 5B5SA 1WQ4A 2OHIA 2X6QA 3HKBA 2H0RA 3NLLA 1U63A 1JIKA 4WNIA 2V7UA 2O8CA 5CPFA 2GXSA 2WSYB 5IXSA 4PSAA 4BQQA 1I1QB 3ILSA 1I2MA 5K1ZA 3QLEA 3TIVA 4CI9A 1W4RA 3E7PA 5FBVB 3W9UA 5CLHA 2GPJA 2K2QB 3T8YA 4GE3A 3W8DA 3NTXA 1BD4A 1BRTA 1YS7A 4X4DA 1AQ6A 4QDOA 1A5AB 1PJZA 4ZVKA 2ICPA 5DX0A 2LYLA 2D0PB 4B7CA 2A5DA 3PRKE 2CK3A 1GKIA 1F8XA 1KYZA 1GZ7A 1POWA 1SXHA 2JFVA 3ESAA 3R09A 1U7PA 2HJVA 3KVYA 2GUGA 3NJ8A 1BEEA 4TWAA 1RWQA 3LZCA 4WI1A 1KK2A 3QBEA 2UXCB 2JZNA 4ZRMA 1M34A 3B1ZA 4OQ4A 2B4TO 4YS6A 2XF2A 1YZQA 3GEBA 4IV8A 4DV2B 1F4LA 4JWKA 5K0TA 3BCRA 5I4KA 4L57A 1IB6A 1VKOA 4KK4A 2YINC 4QRIA 2JEYA 3WKAA 4EJSC 4GW3A 3SQMA 3C8HA 3ZVMA 2JJ8A 2QAJA 4HEQA 4P0QB 4PYNA 3DFFA 1E5LA 1DDIA 2AOTA 2Z9CA 2AF4C 1ZM9A 2FPGB 2OILA 2NW6A 3NM6B 5KYVA 2GILA 2JCVA 4N03A 5LZ8A 3PUWA 4NU0A 2Q4DA 4RE5A 3W7AA 3A4LA 4QDJA 3WYEA 4JASB 4MS1B 2JJMA 3GV0A 5CX4A 3W2IA 1RP7A 2RBKA 3RVSA 5IHPA 3GH3A 5JCZA 2FEOA 1J09A 2QAGC 4AC9A 1J24A 1U1GA 3IAUA 1EVZA 3U48A 2KLHA 1YNSA 1Z62A 2LXNA 3RO7A 4KNYA 4RVDA 3D7SA 4ZKEA 3L7KA 4UEKA 2BGUA 4IG9A 3U44A 1UDWA 3H3FA 1U9ZA 3H5IA 1OQAA 4JBHA 4IRMA 4M49A 4QELA 2WB2A 3DVQX 3L6OO 1XPOA 2VNKA 4P7JA 1PT8A 5CDSA 1HLFA 4QQFA 1OBFO 1J97A 4KLCA 3VKUA 2WTUA 4QU5A 3MHTA 1GPYA 1FTNA 1P1RA 3OIUA 3D1NI 4EKEA 2EDAA 1TW2A 2Y2VA 3OTHA 3PQ8A 3NNNA 2WE8A 3GT3A 1QG4A 3LW7A 2VP4A 1VSQA 1IH8A 3CCCA 1ZD3A 5KTNA 4YRPA 5LNK6 4E2YA 3LISA 3EZ7A 1KBOA 2FZ5A 2QM3A 3Q0EA 5BW6B 4W5OA 2NO1A 2P2DA 1OBCA 5AVXA 2GF0A 3ZJYA 2Z0MA 1FJ2A 3KV1A 3OCCA 3IAM6 4LC0A 4UQOA 1NR1A 4FR2A 4LRUA 1ACJA 3DAOA 6GPBA 2Z8YM 1JIVA 1BHQ1 1U28A 1RXYA 3GJQA 3MRTA 1NG9A 4NV1A 3G0BA 3VXKA 4EGCB 3WGYA 1FLAA 1AUQA 4LF5B 4IFBA 1H2WA 1ZESA 2DMRA 1PZMA 4MMXB 4NVRA 4U3JA 4X93A 1F06A 3SOZA 3PL1A 4HYYA 5B3JA 1P5HA 5E6UB 5LP6A 5CYPA 1XRJA 3OO0A 3OTIA 4P7BA 5F2KA 2PGJA 3EW9A 2FMIA 1RQLA 2F8MA 1U0RA 3COSA 3EVCA 1JRLA 4GYWA 1QH0A 3NP9A 4RS3A 3UJBA 4PG8A 3E4CA 2LYSA 2XADA 3LFTA 2GRAA 3M6MD 3NHRA 2ZZNA 1P5RA 2VJQA 4KQ9A 4EABA 1ZD4A 3B7HA 1WB4A 3N2ZB 3A37A 1DAMA 4LHWA 1JVBA 4LF4B 2BV3A 1M9NA 4A8JA 3L18A 2H3EA 2WF8A 3CUYA 4LAFA 4MIKA 3WRYC 1Y82A 4XM2A 3HYLA 1PHRA 2JA1A 2VYFA 4EG0A 1RVDA 2AR7A 4G9BA 3CX3A 4B45A 1GL9B 4IX9A 1POUA 3SCGA 4UTNA 4C3ZA 3IMEA 4JCXA 2Q2VA 3MJTA 3KJGA 5EKTA 4PFQA 1ZXBA 2RHLA 3EBPA 1T1SA 2K6GA 5IDVA 2O6LA 2R7MA 2FEMA 3T9AA 2C3MA 3HCPA 2RHMA 1M34E 3F71A 1KJJA 4GLJA 2NAPA 4UPEA 3MD9A 4MKZA 4B3MB 1BKDR 1RM4A 4R3NA 3ST7A 4LY9A 4QFDA 1QB7A 3IOBA 1R0KA 4FR5A 2XXPA 1ESZA 1SGWA 3P5SA 4MW5A 4QTZA 3NJRA 1GPKA 1IJFA 2A3RA 2C4UA 3BXOA 4RK4A 2E9SA 5DHTA 2GN0A 2I4LA 1YJCA 3MSXA 3ZJVA 5AW0A 4G1BA 3OM0A 2BFFB 5FP0A 1K5GA 5G02A 4UQLA 2VEDA 1GUFA 2A0KA 1J39A 3DMPA 5JXWA 3NATA 2AMJA 1UMDA 1QH8B 2B78A 4RPHA 1R64A 4M7RA 2A4MA 3SG0A 4F86A 4RJKA 4JV5B 2E1PA 4OHFA 1YU9A 4F4JA 5BV1A 1RVV1 1NVVQ 3EVNA 3QNMA 4XJVA 4EX6A 1MDFA 1R6TA 4MV0A 5A6SA 2GKOA 4M99A 3T3MB 5ALXA 2WVHA 1UEIA 1ZFNA 1EU1A 1A5TA 3FWKA 1LZLA 1XZQA 3HXOA 1UXIA 3ACBA 3IX7A 4DWWA 3F52A 1P4SA 1EDEA 2LYJA 1WW3A 3HJCA 1F0NA 4YRQA 5ALMA 1NLYA 4DCSA 3KZOA 4OMDA 3HA2A 3MCTA 2C03A 3EDOA 4ZAZA 1ZOIA 3B8EA 5ALQA 4F8EA 5BY2A 1XPRA 3WV4A 1RLOA 5JS8A 1MUUA 1W2WB 1E63A 1OSLA 1I1NA 1NMQA 2BM8A 2CHFA 2H4YA 2NU7B 2W6JD 4KHZA 3ASYA 4KO8A 4LVOA 2I5PO 2W22A 3QJYA 4X92A 2FRXA 3IE0A 3R3WA 3HB9A 1J99A 1IXKA 4WFJA 3ZLTA 2ZJAA 4ARSA 4M9CA 4QYXA 3VTKA 1UPXA 2MIIA 5IW8A 1NYTA 4DV1B 5K99A 2OY0A 4L85A 1PVDA 4TVSA 1MC8A 2H2HA 2J85A 2QTAA 3EUWA 5KAPA 2QIPA 3F5QA 2EOAA 1HTBA 1L8AA 1Y4ZA 3B3FA 1TDJA 1X70A 2CGEA 3DZKA 3GFRA 3GJYA 4QPNA 1PJ3A 1QFSA 1UOOA 2CXTA 5G0VA 3ZCVA 5K8JB 2VTVA 4Q3BA 4Y1EA 5EQJB 1QRAA 2IXEA 4DBVO 5I7RA 4F2WA 3QF3A 1SELA 3DULA 1ST2A 5EJMA 2P62A 3IPCA 4Z4CA 4NMLA 5B6PA 5B7PA 2V9ZA 5H81A 1G64A 1LSSA 4HJXA 4K26A 4FUQA 3QYXA 2XUPA 3PX2A 4HNVA 4GNRA 2G04A 4M8SA 1ZMOA 3WIEA 1Z4LA 2ATEA 2HEGA 1MX9A 1VLZA 3S2SA 5J58A 1TCVA 3I9MA 1Z12A 4WINA 2PX0A 3W3AA 4JBNA 2GLXA 1NASA 5FF9A 1FXWA 5JMPA 3O9ZA 4IMRA 4IGKA 2PRJA 4PQEA 5DN6A 5F2EA 5HKAA 3TECE 3WTBA 4R3WA 5KNCH 5AI6A 4FHCA 1B93A 2PQ6A 2Z5GA 1HE3A 3OLCX 4HLCA 4B8WA 3DNVB 4LYAA 5D3ZA 5BSRA 2MJLA 1JQEA 1S1MA 3BIOA 1OREA 3ECSA 1FVHA 1UKAA 2P4SA 1WCIA 2X0FA 3QEMA 3RHZA 3S7ZA 2QMQA 1Q7GA 1JJIA 2IEDA 2PFSA 4HK4A 3N8IA 4EY8A 1NI4B 3X1XA 4JUDX 4LC1A 3OLYA 4MA5A 4QX6A 1UF9A 1MD9A 3NZEA 4KGVA 1AGXA 5DTRA 1KP2A 3NTQA 4QO8A 3TNYA 5KQLA 1LH0A 1OBHA 2B3DA 1ZOPA 2CHQA 4OQNA 3KPWA 2FXVA 2W8ZA 1ZMXA 3FPSA 5FB3A 3SDZA 2VZ9A 2EIXA 2ZBEA 3OC6A 4RVNA 3ZGYA 1PT6A 1PR0A 2J59A 3TNFA 4ERXA 3CNQS 1VL8A 3IQXA 4LV6A 2H9AA 2PBZA 4KWIA 2YWFA 2R9VA 3HSKA 5FA6A 2FCAA 3RM3A 1KIFA 3ZD9A 3EASA 4A91A 1GZ5A 1UXOA 3W5UA 1Y9EA 1LB1B 2QZSA 2P77A 5TF0A 1GQOA 4TXHA 4AJEA 3MJSA 2O8NA 4RHUA 1E66A 1OAAA 3ZUGA 5HUJA 1DNPA 3GUYA 3N53A 2E1RA 4YQZA 4DNPA 2QG6A 3KCNA 5E7MA 1JF8A 3HB1A 3CZ9A 1KSFX 2G6TA 3O73A 1TM2A 1UMBA 4BZXA 1P6XA 2GWRA 2FVYA 3C45A 2ZREA 3T5TA 1DEHA 1W30A 3FFXA 1Z13A 1IPFA 2ZIXB 1P0CA 1JXQA 4G07A 4XB6B 3GLIA 3FGNA 4OHYA 5A71A 5M7EA 2G83A 1A8SA 2G06A 5K20A 2QA5A 4LOLA 3R40A 3A14A 5A4MS 3Q6MA 5DV9A 4KXNA 2OZVA 1O6CA 1RHKA 5BQOA 4AMYA 5L6LB 5AJXA 3DOUA 1IL0A 1K8YB 1NJ1A 2QX4A 4MR8B 2JZOA 4MICA 5CYFA 2Q7DA 1P0QA 4GLOA 3DOFA 3T5DA 3ROMA 2JI8A 2H2GA 4EQ6B 5K9ZA 3NKFA 3U9LA 3M89A 1GFIA 4YAGA 2WD8A 4QLBA 1QYRA 3D81A 2VBIA 4AAYA 4GRDA 4DABA 5AD1A 1PLLA 2WF5A 1TZKA 5HIKA 1JQDA 1DHRA 2AX4A 2B94A 3GDWA 3A1WA 5MN6A 1M0EA 4ZZ3A 2FR8A 1K4YA 2V6IA 3UUEA 1GNTA 3OLXA 2E6UX 1ZGAA 2CJYA 4YP7A 4R9RA 3CO5A 1RCTE 1L8XA 1WXQA 3NQ41 4ZOBA 5EP4A 2G36A 4A0SA 2ZXUA 4WA8A 4BX9A 1JR3A 1UJ2A 3DJFA 4LE2A 4LJ9A 4PZCA 2GKGA 2IPMA 5JNVA 4F3TA 1PTKA 2EZTA 2AJLI 2DQ4A 3FW1A 2DQYA 3EUFA 1U02A 3QWHA 4G2NA 3WISA 4WL0A 4MA4A 3STWA 3VU9B 1EWTA 2BEWB 2O6HA 3KZ1E 1T6BY 4BZWA 1JHQA 1YK0A 2CXUA 2PVCA 4Q4JB 5JTUA 3NWPA 2ZTLA 1EDDA 4KXYA 1GT91 2NACA 2RCYA 4UEQA 4RWEA 2P0YA 4ZO4A 3GGOA 4FFLA 4DCCA 1EM8A 3F8TA 5JAOA 2QVBA 4YXWA 3A28A 3CJQA 3TSOA 2FUEA 3F0TA 3P8ZA 4MVJH 2PX6A 2RHWA 3KTFA 3PXDA 4XI9A 3QF7A 3SNHA 1UUFA 3T7EA 3S2YA 2LYRA 4CCWA 3BGVA 2AN9A 3I28A 3K6JA 3ZDXB 4QUIA 1IATA 5HA5A 5TVKA 2YYSA 1F2UB 1DFHA 3FKJA 3P9PA 3TDMA 5I6DA 1OA0A 3BZWA 2AFRA 1XJQA 2REOA 2GPWA 4AYWA 3W5DA 3CINA 5ICMA 5CX1B 3CRQA 5JZMA 1QZUA 1J22A 4YJ3B 3AVVA 2Q0QA 1HDEA 2HPZA 3BFPA 1B2LA 3EAGA 4I2VA 2QWXA 5FTWA 2O9JA 1V7ZA 1M2VA 5TY0A 1PT7A 3A1EA 3E9NA 4PZ9A 2BYTA 4MDFA 4A16A 1E2PA 1UP7A 4CWAA 2I62A 2WPDA 1ZIYA 4EFMA 5IKMA 4NONA 1MTZA 3DLIA 3EXG1 2WHRA 1TZBA 4HX9A 1N5OX 1I7LA 3LA8A 4K5QA 2AK2A 1SUAA 3AINA 2BSQA 3UFXB 4BWGA 2R6FA 3BL8A 5K0NA 2LVBA 2DPMA 1E20A 3OFNA 4OXNA 3TLCA 4CEIA 1BTOA 4C0LA 4L16A 1KAGA 2C2GA 3C6BA 3IAAA 2Z4SA 2O38A 4BNJA 1FP6A 1CF2O 4H7PA 2XA1A 5IJ9A 5CD1A 3RSGA 3TOZA 1SXJB 4IQFA 1UDRA 1L4BA 1VQ1A 4LI0A 4CCYA 5KYWA 1E7WA 1T5HX 3VC1A 4X4BA 2DE0X 5FI1B 5J4LA 1N5RA 1Y5RA 5IVHA 4QU9A 4MCAA 2AW6A 2OV8A 4ZTUB 2AYZA 2QTRA 4R69A 2Z08A 5JCOC 3IV6A 1SCUB 1GRCA 1KDVA 5FO1A 1T25A 4WV3A 2GM9A 2RGUA 4P82A 2IFTA 4D4HA 1DEKA 1UJ6A 2VH5R 2Y9PB 8GPBA 1KJIA 1T9GR 1YR2A 3DNFA 3FYUB 1AHIA 3ONDA 5FADA 1MTOA 1TMYA 5ARCA 3KM0A 2BTEA 3DF9A 4X9XA 1X7YB 5LA6B 2B92A 2Q5QA 3AHEA 2Z3WA 4OXYA 5I9IA 1DRVA 3C8UA 3AHFA 2WAAA 3ELBA 1E2IA 1UWCA 5CNMA 4DV3B 5DSXA 2XMBA 4LJ4A 4NP6A 4R9NA 1QTNA 1O6ZA 1V96A 2R6GA 3AEXA 3L0YA 3KDPA 5HZGA 1F8UA 1RFLA 5FUXA 4YUZA 1XYYA 2O1XA 2WTNA 3LBFA 3QPCA 4CKBB 1WKCA 5LQDA 1N32B 3NPMA 4G24A 2PUGA 4QTXA 4C06A 1JKJB 2P3LA 4CV3A 1YAJA 2HIAA 5TMBA 5HTOA 3AEQA 3E1KA 3SCZA 1KK1A 3ZY5A 5A7GA 3F96A 2A57A 4G1CA 5AI0A 3P4YA 2GYUA 4KXQA 3U3WA 1VHWA 4M46A 3SEAA 2WP8J 5JHHB 4EY3A 2XWSA 1MO5A 5FHQA 4QARA 4TLLB 1JS1X 1RU3A 1NE2A 3SMVA 1W52X 2P9FA 3GW8A 4KRGA 1W85A 1E4EA 3ROXA 1W5FA 4EA9A 4Q4CA 4B82A 1TL7C 4NABA 5FFNA 1X94A 5GJCA 5FDFA 2MINB 3BMQB 1Q6ZA 2HK8A 3LX4A 2D5VA 2D2EA 1T4GA 1U0JA 2AG6A 2YNMC 3AOEC 3N8GA 4IEIA 4WCVA 3X2SA 4EHHA 4ZRDA 4IDHA 2W6QA 1E5DA 1O08A 3H17A 2EDCA 3H5NA 3QV2A 4YJ2A 1LNZA 4X7RA 5J2TA 1H2HA 5K01A 4PAGA 4X3OA 1M2GA 1MOQA 5JNTA 4LWOA 1IY0A 3CF2A 2L17A 2J0SA 5K3CA 2PH5A 4J07A 1TD9A 3B1JA 4FOOA 4JQSA 4QUGA 2VN8A 4RH0A 3W90A 1U5BA 3FWPA 4OQXA 4BRSA 1N9KA 3FSGA 3NONA 1R0SA 2XSDC 3IBYA 1LWNA 1YMQA 3GEEA 3IA2A 1GNQA 4R8SA 5BN4B 3LA6A 4WBNF 4KFCA 1KVQA 3JAWB 2G5GX 4XWTA 5E95A 1K06A 1R5NA 2BVNA 3B1XA 3P27A 3ZXUB 5JFTA 3ZDDA 3EFOA 2PBRA 4EUNA 1KVUA 5BMVB 2NU9A 3WAGA 1CYEA 1G3UA 1VI5A 2GD1O 2JVKA 3IBCA 4KH0A 5CURA 3RRZA 3SC2A 3EOAI 3I52A 1NWHA 2PH1A 4IIGA 4OJNA 4YJ3F 5F73A 3JQDA 5CJPA 2IYLD 2VZEA 4H2DA 4RLQA 3U1TA 1SVUA 1DW9A 2X5XA 3QJGA 3JALA 1ODTC 3GGJA 4B8ZA 3LOQA 4C0HA 1M2HA 2G76A 3K0CA 4M76B 1CJMA 3AW9A 1OX6A 3FB4A 5A5GA 5HWSA 1V95A 1MXHA 2XB8A 2ZSKA 2GPTA 2BKEA 4IR7A 1AZTA 4D9EA 2EGUA 2WM3A 4INAA 3ONNA 3SKXA 4TKLA 3PWZA 2I6QA 2IHTA 4HEHA 4LZLA 3DUWA 4LWZA 2QN2A 1XZLA 5A3SA 2P4HX 2O8VA 1O95A 2QE6A 2UYYA 3QF4A 5EE0A 2HT6A 3C85A 2VJMA 3MT7A 5E0KB 3DQPA 5KCMA 1X1CA 4E51A 4OQEA 3CTMA 4KYUA 4L73A 4MLCA 1SCIA 2FR1A 1OOEA 3JAKB 2R6R1 2V59A 2QBYB 1FSGA 3GLKA 3RAPR 2HU8A 2YIDA 5IABA 3SM9A 2C20A 4EPVA 1YDHA 2O4AA 1QC5B 2H63A 3M70A 2WJGA 3STHA 5E7QA 1EFVB 5ESWA 2CNNA 3T0FA 1P2FA 1QZXA 3F78A 3FLBA 3MUNA 5H5JA 1FNDA 5EZQA 4H1WA 2VT7A 4ETIA 5JWHA 2Z43A 4Z2AA 2CFCA 3TW4A 4QPDA 1F2DA 4JX9A 2OR3A 4HLNA 1O2DA 5CA0F 4C2AA 2FE1A 3OLVA 4EA8A 2ZUUA 3M8KA 1ZONA 2FI1A 2IEGA 3UHFA 3ZV3A 1TLTA 4ESOA 1W46A 1XWWA 1ZHFA 2PSEA 4MEJA 4EELA 3SSNA 5LA6F 3H04A 2YICA 3DE3X 3FF4A 3EQ6A 3UV7A 3LVBA 1QWOA 3LUBA 1P4HA 4GPEA 3RE1A 1BDBA 1IDOA 1EQAA 2D4AA 2YR0A 3JQAD 4MCXA 4DA9A 4WACA 4DIUA 4DN6A 2LPMA 3KYCB 4JB2A 4CM9A 1EUCB 4F4UA 3ZIDA 1WNTA 3MT0A 3S1AA 2WDPA 3WQHA 5BN3A 5JWOA 4AN1A 3HG7A 2WWYA 5EMKA 4EJMA 2MYUA 5G0TA 3ZTWA 1ZPQA 1PWZA 3LIPA 5C5IA 1DT5A 4R2KA 3CROL 4ARBA 3UUWA 2WM2A 3DTVA 4BLPA 2WJ4A 3QELA 4Z1MA 3K9NA 4LMPA 1FFWA 2NX2A 3LT0A 2Q1XA 2WNSA 1RZRA 4C6HA 1WX1A 3U17A 3AY6A 4D97A 3WO1A 3UG7A 1KMCA 1BFUA 3FJ1A 4E30A 3C87A 2E85A 1RJFA 3HLTA 1TJNA 2GN9A 4P32A 3QU9A 1R15A 3DQZA 5JWRA 1B7GO 4TT3D 3H4TA 3SJ7A 1CY6A 1HWYA 2VRBA 4TWRA 2VHZA 2VK4A 2YHUA 2GN8A 4OXKA 1E3WB 4PYIA 1DAIA 1SCAA 1KZGB 4RFSB 3UM9A 2HDNB 4F9FA 4HNUA 2J3JA 4DLXA 3HO1A 5L3ZA 3OCJA 4DIKA 3VTFA 4X7PA 2QMHA 3MWEA 5BQFA 2JAXA 3G8YA 4L6AA 1JU9A 1YXMA 1COWA 1OV4A 2DQKA 3ZJTA 3PQ7A 4DL9A 1JJAA 2WSIA 1L5FA 5B58C 4I4TB 3RG8A 4M86A 2HV9A 4FBMA 2OPBA 3TIIA 4YBZA 3S5JA 1X13A 3ZE8A 1H42A 4EVRA 3DAHA 1B43A 4RK5A 4A6PA 5J5VA 3V2UA 3ORYA 3ISTA 1EX6A 4J16C 1Y3BE 2PNFA 2J1LA 2X40A 4OQZA 2GQ0A 2IYOA 3AWIA 5CVEA 2NAFA 2PYDA 3CSSA 3LFPA 4J8PA 5F2OA 5HMMA 4PNHA 1LUAA 3VMMA 3BYZA 2UVPA 1SKMA 1MA0A 1T0UA 2IYNA 5IJWA 2DBZA 3K5WA 4ER6A 5IBPA 5CYGA 5K3BA 3HP4A 1KNQA 4G0PA 4XJSA 4LGVA 5F9MA 4A5SA 3C41J 4B7UA 1NNEA 4YUVA 1CIJA 5EL0A 5A3JA 3RS0A 1XD2A 5KSYA 4OB4A 4B80A 2C42A 3ZCPA 4YWHA 3L43A 3JD0A 3JXEA 3M9LA 3I6QA 1QG0A 1SXIA 4ZDIA 2IXFA 5CLJA 1ZRHA 1R63A 1JMKC 1CP2A 2SCUB 3OEED 5CB4F 3V2HA 2R84A 3ZV4A 3QVKA 4C0AC 1JJVA 1TIPA 4IQGA 1ZD1A 2LCIA 3G1TA 5E0OA 3WLOA 1C4OA 1PK9A 2WYIA 4EF6A 1PS0A 2N1MA 3IAFA 4M87A 5SY9A 3CLRD 1EAMA 1VLHA 3N86A 3U4HA 1HM5A 1IG0A 2BEUB 2GAAA 4XA8A 1W5EA 1Z2PX 5TGTA 4LK3A 3VR6H 4B2PA 2OCPA 4FYKA 2Z6QA 1WBJB 4LJYA 4YECA 4JI5B 3VDXA 4Q2JA 2NSJA 2RONA 1ZK1A 4DUPA 3LI2A 1QHEA 2MYTA 1DKRA 3GJ6A 5CVCA 4P4GA 3BD1A 2AOVA 4KDCA 2HQ1A 2J0VA 3D8NA 3HCCA 1ZG3A 3IEIA 3PQDA 2R44A 1FTWA 2OQRA 4JGGA 1ULTA 2HQBA 2RKOA 3KOWA 2XYRA 1OTHA 3AKEA 4UHEA 2HLNA 2YIVX 1WMDA 1Q50A 2VP9A 3HKBB 3MIZA 5BWNA 5CB6A 3ZDAA 4KBFA 3TMKA 1ZSYA 5FL7A 3T1QA 3TKYA 1G7CA 1GPMA 4PWZA 2QE7A 1VYVA 4IAOA 1YRBA 3C3JA 3LH5A 5JI2E 1RPZA 4P4SA 5IMSA 4KO3S 2CV1A 2W6MA 4KITB 5CGZA 1P29A 3OPNA 1W19A 4NI5A 3RUEA 4YARA 1YQTA 3GA5A 3HB0A 4MP8A 3WXBA 1EJ6A 5BV0A 5B1IA 4G67A 4LVUA 1GNSA 3HABA 3QPBA 4TXJA 4W4TA 5ALUA 3ETCA 3L3BA 5FOQA 2H5IA 3ZG6A 5GV8A 2ANCA 2W71A 3IBSA 4EGFA 7REQA 4PYKA 3V00A 5JBNA 2HO5A 4JI8B 4NECA 4B33A 3F7NA 4DZZA 2P2ZA 3ELYA 3KJNA 4FDAA 4UHCA 4W6ZA 3SD7A 3ADCA 4MRMA 1FNCA 2Q8NA 3OE1A 2B8EA 3E9YA 4EW1A 3C3MA 5CEJA 4INOA 3O4JA 3T9BA 1B8UA 4K9LA 2DH5A 3VPCA 1HFKA 2QJRA 2HIGA 3AJDA 4YWJA 5JAIA 4XYBA 1TRHA 1P6UA 1U1EA 3B82A 4IUYA 5EZSA 6PFKA 3QVSA 2IHKA 1V1RA 2RH8A 1XVTA 4RLSA 1WZEA 2D0DA 2C7GA 3M49A 2R8YA 3IR5A 5EJ8A 2NT3A 1VMDA 1Z22A 2G63A 2E5WA 3UJ7A 5IS2A 1SK9A 3QWGA 4RYLA 4U7GA 4QUEA 2A1TR 3SQOA 1ODIA 2C5LA 1IMJA 2ZBDA 1FY2A 2Z57A 1WU7A 3NHZA 4KG7A 1AU9A 4C78A 2OZKA 1VHDA 3U44B 3UW1A 4BJ6A 4NCBA 1G8GA 2HXYA 4P5EA 4XR9A 3ANSA 2OAGA 2HK7A 2C07A 3QU4A 3GO4A 5C35A 1M1XB 2QOEA 4URHA 1M1UA 5HZKA 2O8EA 1ZAKA 2P2CA 1GA1A 1KJZA 4U7HA 1JAYA 2XT6A 3T0IA 2NTYC 4JYPA 4HWTA 2W00A 1HG0A 1RNLA 1NF9A 2HBZA 4GPZA 5IH3A 1N0UA 2GCPA 2ZVPX 2OBNA 2ACVA 2UVQA 3LDGA 1DB3A 2ECPA 2X3UA 3NV9A 2MSLA 4J4BA 3G2OA 1O5IA 5LOVB 2AC2A 4BNTA 5BPHA 4FW8A 1K3UB 5B58T 4DLRA 2X4DA 4D0LB 4BQEA 1UAAA 5LPNA 2X9NA 2BEKA 4UQPA 4UATA 3JWPA 1UKBA 1OWOA 1T2FA 4LBVA 1A77A 4IIUA 1CUIA 2RGWA 3UJ9A 4DR6B 3C8MA 5J5CA 4J0KA 4BQRA 4EY6A 3AFHA 1K6IA 2C9CA 4Z6KA 5C80A 5JJIA 2BFWA 3I58A 3BDVA 1Z8NA 4XIYA 4YN3A 4ADSG 3DE4X 3W4JA 4YAFA 4D0GA 4F91B 5HSGA 3VHQA 4B44A 1JN0A 3NHUA 3Q11A 4NFHA 4U3JB 4AS1A 2WD7A 2BEJA 1RXVA 1MGPA 3MTQA 4TS9A 1WXFA 2FW6A 1TEZA 5LP6B 1G17A 2IZ1A 2WQZA 4Y1RA 1RKVA 1ORTA 1RQXA 2Y1OA 4UFNA 4J3NA 4JXZA 3I9V1 3T94A 3VR2D 1O57A 1A9SA 3LCCA 1LLFA 2JIBA 3ZIAD 1EX7A 2O0LA 4AJ1A 4IOKA 3RAEC 5BXYA 1N77A 1VJ5A 3JD4A 3UB4A 1FXUA 1SUFA 2F1IA 2VPIA 3KKKA 4LC9A 4N6OA 4MRAA 2DUJA 3KL4A 1GG2A 3NDJA 1IQPA 3UJHA 1ZJZA 4Q3KA 2GK4A 3SCFA 1XLUA 4A8JB 4BNVA 2YYAA 3D7NA 1PJSA 4M88A 3DGFC 3VBEA 4TT8A 3GPIA 3VZQA 2XYQA 4UDOA 3O9VA 3AKYA 2AMLA 4IVZA 3DT6A 4PONA 3G13A 2ZB4A 3FKQA 2AC4A 1F60A 2YXDA 3JVEA 1REQA 1GSIA 4N3BA 4RAOA 5DM0A 4O5AA 3K15A 3LO8A 1ZCAA 4LXUA 4YMVA 1SCQA 4Q4DA 3IUYA 2H8RA 3NROA 3K09C 1KPIA 4DXDA 4EKNB 1C0LA 5HF8A 3GLGA 1L7MA 3VNVA 2V97A 2AOWA 1NRWA 2C00A 4L76A 3WB0A 3HJFA 4BO2A 1TGVA 3P19A 4RACA 4UDXX 4L9SA 2W2PA 4KN8A 2B2CA 1K4KA 1WUKS 2IHJA 3VYSB 3GNTA 2BFBA 2PJRA 3JZAA 3MJRA 1Y6RA 3QNUA 2AUMA 1W29A 4QDZA 1L5GB 2KJQA 2IF0A 4R1LA 4JUAA 4HAXA 1J7KA 1XVVA 2QLJA 3JQ9C 5M29A 1D0SA 3ZWAA 3MINB 5EUQB 1OD6A 3N87A 3VR4H 2D6FA 3KZNA 4OM7A 4PBTA 1IRXA 1C50A 1E3TA 2XDAA 3C3WA 3DB2A 5FYQA 3I64A 5AUNB 2DHQA 2O3SA 2OORC 1YJ5A 2GSDA 3SLGA 3EUAA 2OD7A 1Y6JA 3UXYA 2EJTA 5P21A 1O87A 3T9FA 1R6UA 1EP3B 2NSYA 4QGGA 1QRSA 3E0XA 1Z6GA 5ALYA 4DMHA 2I6TA 2QUKA 3A9CA 4LNUB 1Q2XA 1RWWA 4DLBA 2N46A 2A0FA 4HADA 4Q0MA 3VX4A 5L9AA 2WJ3A 1AX9A 4GRAA 5FQNA 4MYUA 1LLUA 4HGZA 3A2KA 2E21A 1XMXA 3G9TA 2D1QA 3RSQA 1QIFA 2VK8A 1ZGCA 2X58A 2FSGA 2XECA 3PQCA 3A9RA 4GEKA 4IDOA 2QR2A 4WXEA 3W2GA 3FWYA 1BKYA 3DDWA 3FMOB 2XQJA 3E18A 5HF9A 1KVRA 3RLIA 5FUVA 4HATA 2VCHA 1RAHA 2Z95A 1XPJA 3KIPA 3HWSA 1NSFA 3JD1A 1IM8A 1FFEA 4M21A 4MRPA 4WLOA 5DEIA 1ADCA 1M2FA 4RXTA 3HGQA 1FFCA 1IPHA 1DS6A 1SCJA 3IJEB 3QLUC 4R9UC 4Y8VA 4ZQCB 4JLKA 2IV7A 1JR2A 4K40A 4C6RA 1VBKA 3JQPA 5KNDH 3MJEA 4PZUA 1FUKA 4ZZ1A 2HLPA 3NRCA 1J9ZA 3IOCA 3JYLA 4QAQA 1RW4A 2J7KA 4MVJM 3AVPA 1E2GA 3IQDB 4JL6A 3UICA 1KEEB 2ORYA 3EUEA 2A67A 4P83A 4X97A 4BEBA 5LOVF 2YOHA 2FW8A 4LF9B 1UJNA 2HREA 2GEJA 3DLHA 5I7UA 3CZ4A 4Q03A 4DEYA 3CVUA 4DSUA 4C4TA 1H2BA 1X77A 4QJ3A 2HRDA 4N49A 1B00A 1QK4A 4C4XA 5GJWC 2ZANA 4WKNA 1E6CA 1KDYA 6YASA 1QLJA 4ZAGA 2C98A 4NK4A 5CU7A 4JKIA 1CJVC 4Q1FA 1XCJA 1RWBA 3JWEA 1QS0A 4WVFA 4AULA 3OZTA 4JYMA 4D9KA 4DDVA 3I3OA 1Y9DA 2HDHA 4MB2A 3LLMA 3ZQ4A 2BM0A 1UCFA 4GX2A 2WEKA 2Z8YA 4B0PA 4A26A 3RBAA 1ISHA 1W73A 3H5RA 2ZM6B 1OJLA 3N7UA 3T7TA 2XLCA 2VJKA 2BNNA 4WEQA 1F6DA 3CJRA 4M1WA 3HCBA 1GR0A 1EZ1A 3QFFA 3A4VA 4P2GA 4LHVA 1VKHA 3RIXA 5AVSA 3RCBA 1MG5A 4E6EA 4Z4QA 4BZQA 1YK1A 1UBMS 3MWYW 3UCEA 1TK9A 3P20A 5IRCD 4B74A 1ZNZA 1TT5A 2QYSA 5EJIA 1P8AA 2GJKA 3HZIB 4C05A 3LWNA 4J0QA 2EBHX 5IVPA 2GLUA 2ZXFA 3IBTA 4FC7A 4F38A 1IWOA 4YASA 5KUTA 1P0PA 5KTYA 3U7HB 2OT3B 2QTWB 3C4VA 3LY7A 4IH4A 3NV7A 1YI0A 2C77A 4N6NA 4M0DA 4CF7A 4HN9A 1Q14A 3MF4A 1J5PA 4MARA 2HSGA 2QW0X 2WHXA 3DG9A 3UB3A 3G2QA 3PX7A