2XSDC

Crystal structure of the dimeric oct-6 (pou3f1) pou domain bound to palindromic more dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
128
Chain Sequence
b'APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*AP)-3'
publication title Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 43
structure length 128
sequence length 151
ec nomenclature
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xsdC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2xsdC01
2CU7A 1WH7A 2LKXA 1DW9A 4X4BA 3MN2A 2AWIA 3CMYA 3HOZJ 3G1OA 2JA8J 3H3VK 1PNRA 2VI6A 1POGA 5BNGA 4A3KJ 3S2HJ 2Y0SN 1MBHA 2NVYJ 4OB4A 2LVSA 2O49A 4G12A 2LLKA 1ETXA 4XRMA 4X6AJ 4UUTA 3QPLA 4DYRA 2AW6A 4A3FJ 5IPAA 2WB1N 3HGGA 5E3MA 2JCGA 1ZKGA 1JKOC 1X57A 4D5CA 1H8AC 2LYQA 2M9HA 3O8HA 1TWCJ 1ETVA 2K9QA 3Q0UA 4C2MJ 2DN0A 1QPZA 3BR2A 2CJJA 2Y9YA 2XB0X 4GHJA 2IVGA 4B1RA 4L5EA 5E3OA 4FE4A 2XGEA 4JX4A 2AXUA 2PPXA 2E2HJ 1T33A 1IRZA 4XICA 2MGQA 2LYSA 4JQDA 2ECCA 5JLWA 3KJXA 2O38A 1BL0A 1GVDA 2TRTA 1W0UA 1RR7A 1HLVA 1ZZCA 4V2GA 3HZIB 1QVUA 1UHSA 3F0CA 3SDGA 4CYCA 5F1JA 5K7ZA 3ZQIA 1O4XA 3ZOBA 1RPWA 5K7FA 2X6OA 4J19A 1R69A 5EG0B 3IH3A 3OQNA 4A3JJ 1AKHA 2XRLA 1U9OA 1ZTRA 2E2IJ 1JKPC 2HINA 4B3AA 1OCPA 2NOGA 4YG7B 2M2EA 1BDHA 2DMUA 3LOCA 1SQ8A 2JJ7A 1IC8A 3I4MJ 1JT0A 4X4IA 4IHWA 1ZAYA 1ZZ6A 2DA7A 2KT0A 9ANTA 1X58A 1B8IB 3M4OJ 2FQ4A 3C2BA 1TWAJ 1RPEL 5M3FJ 3ZQFA 1IJWC 3K7AJ 5M5YJ 2XSDC 1GV2A 2IVQA 1JUPA 1AU7A 1FJLA 4YG1A 5FLVA 1DU6A 3JRFA 1MBFA 2ECBA 1UG2A 4PU3C 1ORKA 2EBYA 4AUXA 3CLCA 1WH8A 2L0KA 2LYKA 2LYLA 3H5TA 4GFBA 3ZQGA 4J1WA 2LY9A 3BQZA 1JJ8C 3BR5A 1ENHA 1BDIA 1A6IA 3HB9A 1WIZA 2AXVA 1QQBA 5EGOA 1JH9A 3BTJA 4YG4A 2GZUA 5GPAA 1TWGJ 2L49A 3A02A 4JP0A 5GPCA 2VPRA 2WIUB 4X4HA 1LLIA 1LCDA 1ETWA 3BTLA 2GRLA 4Z5CA 2ME0A 4M3FA 4RBOA 2MW8A 1X2LA 1Y7YA 1LQCA 3SFIA 4UUSB 1NEQA 3F51A 1VF9A 3FISA 1MSEC 5K98B 4FBIA 3MKLA 2DA1A 2LYJA 1VI0A 2L7MP 3HKZN 2HSGA 3PO2J 2EH3A 5F27A 3MVPA 4FN3A 3DEWA 4A3MJ 2IAIA 1QP7A 3LSGA 3RZZA 2CUFA 1ADRA 3QWGA 3BTCA 3BG5A 3TP0A 1Z0XA 5C4JJ 3JRBA 3TP3A 4FCYA 3GTMJ 4I6RA 1X2NA 3O8GA 1MBKA 1U9NA 4X4FA 1JFTA 3RKQA 4XK4A 2PUAA 2GBYA 3PM1A 4ABZA 2DTZA 3IH2A 4MO7A 1EFAA 4IVZA 2L7ZA 2MG4A 3TEDA 3JREA 3RZDJ 1ZPQA 1FEXA 3ZHMA 3HOUJ 3M3YJ 2JA7J 4M3EA 3RQIA 5EEAA 5F04A 3TRBA 1JUMA 2ME6A 3UFDA 4X4GA 1YSEA 2O8KA 3GN5B 3CROL 1WH5A 1QP0A 4NDLA 2DJNA 2PUCA 3JRAA 2CSFA 3QPSA 3HGYA 2RAEA 2DA2A 1XG1A 2DMQA 3OOUA 2PUDA 4M3BA 1H88C 1FIPA 2LP0A 3JRDA 3R1FA 5EG0A 2BNOA 1ZZ7A 2EZLA 3BG3A 2DMTA 2R93J 2LYRA 1ETOA 1PUFB 2NVQJ 4LOCA 5IP7J 4BKXA 5EDNA 3QQ6A 3HOXJ 1DU0A 3BG9A 1W0TA 2Y9ZA 2FX0A 3S8QA 1VFCA 2EZIA 4X4EA 1PRVA 1ZZBA 2XPVA 3K2AA 3OMTA 3FIWA 1ETYA 2DA4A 5EF6A 1B8IA 2EBIA 3KZ3A 4Z5HA 4I8TA 1FIAA 1ZK8A 4M6VA 5JLXA 4BXXJ 4MCXA 1H89C 2HOSA 1WETA 4O8BA 3QQAA 1JJ6C 5M5WJ 3GTQJ 2BNNA 1IGNA 2O7OA 5C3EJ 1ZR2A 4A93J 4J1XA 2L8NA 3DNVB 4W97A 2OR1L 5C4XJ 2COBA 5FKKA 2VKVA 1IDZA 2D5VA 4JCXA 1ETQA 1JT6A 3KXAA 3A01B 2ID6A 3VPRA 4B4CA 5FJ8J 1YRNB 2FJRA 1U8BA 1RKTA 3B6AA 1EF4A 3GBFA 2JN6A 3JRGA 2JVLA 3IH4A 3QYXA 1ZVVA 2EZHA 3ZHIA 2ELKA 3BTIA 2IU7A 1OSLA 3OIOA 4QIWN 2HYJA 5C44J 2IUOA 3DCFA 3LISA 4YBAA 2R63A 2AUWA 2PIJA 2QF7A 4UUSA 4DW6A 1P7IA 3CECA 3EUSA 5IYCJ 2B63J 5FKOA 3L1PA 4X4CA 1RZRD 2ICPA 4QTRA 3BS3A 4Y52J 4A3IJ 4I6UA 1Y1VJ 2OPTA 2CROA 3GTOJ 1FTZA 4A3GJ 1LE8B 1Y1WJ 2XB5A 1U78A 1Z77A 5EZGA 5J1RA 2R5ZB 3GTJJ 4IHYA 2MEZA 2O4AA 4XIDA 2EWTA 2Y2ZA 1B72B 2X48A 3FYMA 5J3LA 3Q0WA 3H0GJ 2WUSR 3OQOA 4FTHA 1TWFJ 4Z5DA 1ZR4A 2DMPA 1MNMC 1DWKA 1D5YA 2GRMA 1RZRA 4DYCA 1WI3A 4EEFG 1UXCA 2AXZA 3NAUA 1MSFC 3S1RJ 3VK0A 1IUFA 2DA3A 2X9DA 5E3NA 4IWRA 3G1MA 4MIMA 4Z58A 3OSFA 4A3DJ 3ZKCA 3LNQA 1I50J 3G5GA 3GN5A 2KEJA 1B0NA 1UTXA 5M3MJ 1NTCA 3Q3SA 1UXDA 1ZGWA 2PUGA 1G2HA 1TWHJ 3HM5A 2B5AA 3JXDL 1L1MA 1BJZA 1GDTA 2PMZN 3JRHA 1QPIA 5F0CA 3JXCL 5GP9A 2XJ3A 1VPWA 3JRCA 1IG7A 3IV5A 4GQMA 2R0QC 2IVBA 5FKLA 2G0EA 4X4DA 3OSGA 1JTXA 1PUFA 1I6HJ 3BR3A 3LSJA 2BJCA 1ZZ9A 3BQYA 2EF8A 2IV1A 1QVTA 3QF3A 4M3DA 2XCJA 2JMWA 5F0HA 1OJLA 5IP9J 4MFDA 4PU8A 3SCHA 1F36A 4X1EA 3A03A 1OFCX 5F0FA 3G1LA 2KPJA 2CUEA 2HOTA 4NDWA 2JWTA 2L7FP 1MBJA 1POUA 3JR9A 2PUEA 2P81A 4JX6A 2AHQA 1CQTA 2GM4A 3HOYJ 4FE7A 1PERL 1GUUA 2K9NA 3PO3J 2GLOA 4Y7NJ 2LD5A 1MH3A 1IV6A 3GTPJ 3CCYA 3PXPA 2LFBA 1QRYA 3B6CA 3A01A 2WAQN 4D5FA 2KEIA 5FLMJ 2OFYA 1YRNA 3SCGA 3OP9A 1HCRA 3HOWJ 2LTPA 1LFBA 3S15J 3SCFA 1S7EA 5IOYA 4A3BJ 3TW7A 1JKQC 1UMQA 2DA6A 5FKNA 2JA6J 4MFEA 2CRGA 2CQXA 1XS9A 2R5YB 1E3OC 2O9LA 3S1NJ 4A3CJ 3B7HA 3WHBA 1XWRA 2M0CA 2Y30A 1R63A 3BR6A 1FTTA 2EZKA 4Y42A 3JRIA 1RESA 3I4NJ 3GTGJ 2PUBA 2KDZA 2XIUA 3BDNA 2OF7A 3S16J 3FK7A 1MBEA 5HODA 2JA5J 2XPWA 1HDPA 3HDDA 5F08A 1XC5A 3FK6A 5FKMA 4DZJA 4A3LJ 3MLFA 4IHXA 5A7LA 5DTDA 2XI8A 3W6VA 2VKEA 2W48A 2R7ZJ 1LE8A 1ITYA 1Y9QA 2R5ZA 4JCYA 1QQAA 1IDYA 5K7HA 1LFUP 1BW6A 5IYBJ 2E19A 3GTKJ 1P7JA 2PUFA 4D7NA 1ZQ3P 3Q0VA 1B72A 2E2JJ 3G7DA 2HOAA 4BBRJ 3FYAA 2I10A 1HF0A 4I6TA 4JYKA 3F52A 2NS7A 1JWLA 3S1QJ 3SJMA 5EZHA 3GTLJ 1PRAA 1PRUA 1ETKA 2HDDA 4XRSA 2HQ5A 1CJGA 2HXIA 3S1MJ 3RZOJ 1APLC 2VUMJ 2LR8A 4FISA 2HXOA 4BY7J 4BBSJ 2ICTA 3BR1A 2XPUA 3BD1A 2PE5A 1I3QJ 1WGXA 1F43A 1NERA 1MBGA 4DYQA 2YUSA 4C3HJ 5IP6A 3LSRA 3NARA 3S17J 4IHVA 3O9XA 4RDUA 3WHCA 1JTYA 1MH4A 1LMB3 4PU7A 4AYBN 3E7LA 4M3GA 1GT0C 1JKRC 1LCCA 4JX5A 2LK2A 2ZB9A 1R9TJ 4MCTA 4F8DA 1QP4A 5DS9A 1SANA 3GBGA 5IYDJ 1SFOJ 4CYCB 2YS9A 2LCVA 1GV5A 4IA8A 2HI3A 2M34A 3S14J 1RETA 3LSPA 1TC3C 2H8RA 4W1UA 1ZS4A 1VNDA 2KEKA 1AKHB 1OCTC 1RZSA 3CDLA 2CQQA 4I76A 1JFSA 1BW5A 3BT9A 1Q1VA 1ZUGA 4QSHA 1A5JA 5J1UA 1X2MA 2MQKA 4D7MA 1HDDC 4BY1J 2L9RA 2WV1A 1JUSA 2M8GX 1WCMJ 2DA5A 3D1NI 1K83J 3U3WA 2DMNA 2JK3A 3LFPA 2A6CA 2IBDA 2MSYA 1RIOA 5EYRA 3FMYA 3JXBC 2K40A 5M5XJ 2R92J 3HEFA 2IEKA 3IVPA 2LYPA 1WPKA 4DZPA 1NK3P 4V2FA 2FD5A 2K9SA 3FKIJ 3HOVJ 5J1YA 3CQZJ 1RKWA 4C3IJ 3ZQCA 2AO9A 1JGGA 5IOZA 2BNMA 2KZ8A 4C3JJ 4I6ZA 3F6WA 4HNVA 2R1JL 2FJ1A 4A3EJ 2ID3A 5E3LA 2TCTA 2XGDA 4AC0A 4IEJA 4Z59A 2EQRA 5EGOB 3TW6A 3S2DJ 2R5YA 1ZZ8A 3OQMA 3UKGA 4A69C 2N8GA 4YARA 4PU4C 2H1KA 3BR0A 2NVXJ 1BA5A 1AHDP 2NS8A 1NK2P 4MLOA 1K61A 4XRSG 2YU9J 2NVTJ 3HBLA 3ZQHA 2QCOA 1HOMA 1WH6A 2Y31A 2E1OA 2XGCA 1T56A 4S0HB 3ZQLA
chains in the Genus database with same CATH superfamily
3Q9SA 3R09A 1X1BA 2CU7A 3GO5A 3OYEA 2LKXA 4QLCU 3MN2A 4IOAF 4G9YA 3CMYA 2AQEA 2ELHA 2X6YA 2V1UA 1PNRA 5BNGA 3QOPA 1O3QA 3QP6A 1ZN2A 1HSTA 3GMEA 4G12A 3JAMZ 5JVGF 4XRMA 1PJRA 1WKMA 2RKHA 4UUTA 5GTIC 4GRIA 5D8KB 4G7ZF 1TL8A 2AW6A 3TEPA 2DT6A 5E3MA 1X57A 2CO5A 4D5CA 1H8AC 2M9HA 3GLXA 4OIOF 3O8HA 3E0JB 1LJ9A 3QYBA 2CJJA 3ABLH 2IVGA 2IS4A 4B1RA 5E3OA 4FE4A 1HXDA 3KYDB 4LITA 4EKGA 1T33A 4A0YA 1EV7A 1LEAA 3BJ6A 3L7WA 3S3OA 2VN2A 3KLOA 2R7RA 3T8TA 1W0UA 1TLHB 1HLVA 1ZZCA 2FNAA 2OAZA 5J4YA 2VT3A 2W4SA 3F0CA 5DUKA 3SDGA 5ED4A 1K6YA 1O57A 1OISA 5K5OA 2X6OA 3D5SC 3LQXA 2FBHA 3TL4X 5HDNA 4EQQA 1ZREA 2XRLA 4XN0A 3ZMUA 2DCEA 1VQ7I 2CW8A 5E20A 2BY0A 4BHPA 5CVVA 2HINA 3F3XA 5DSXA 1OCPA 2LY2A 4ZZDA 1YFHA 4NHJA 2UV1A 1SQ8A 5D5WB 2BBYA 1IXCA 4M6XA 4RAFA 1ZRFA 1ZAOA 1UHWA 2VJ4A 2E7XA 1FYKA 2W57A 3M4OJ 2WC2A 3IUOA 1RPEL 2ZJRF 5M3FJ 3CP2A 3ZQFA 1XGMA 3KIOA 2XSDC 5LGNA 2IVQA 2E5ZA 1AU7A 1FJLA 3S3NA 3JRFA 1MBFA 3NRVA 2F5EA 2W85A 2LYKA 5ILUA 4GFBA 3P9KA 1IUYA 4LJZF 3BR5A 4H0EA 1R5ID 1BDIA 4RB1A 3HB9A 3DEUA 1YLFA 2ICWG 4F3QA 2GIZA 1TWGJ 4DIQA 2CH0A 2JQEA 1SC7A 3VODA 3I9V2 3K1PA 1KU9A 3N4MA 1LCDA 1ETWA 3BTLA 3OYJA 4ENMA 2DXIA 2GRLA 4XSXF 2ME0A 1S6LA 5L3EA 1FMVA 4G7HF 1U5TA 1ZLKA 4UNOA 1LQCA 2KISA 2JPBA 2IRFG 2HR3A 3GZ6A 1MIJA 3TO9A 1IRGA 2GXGA 1VI0A 3MQ0A 4UV8A 3B02A 1WI9A 4A3MJ 2Y0MA 5B1BH 2QVOA 3LSIA 3HKZA 5TRDA 3FM5A 4N4NB 2DPUA 2CUFA 2CV2A 2EB7A 2JQ7A 4FCYA 1N77A 3WGIA 4I7HA 3ECOA 4X4FA 1JFTA 3GFJA 2CG4A 2XAJA 3OYMA 2PUAA 2OD5A 3T5XA 4ABZA 4BQNA 2DTZA 3IH2A 5AIPA 3K4LA 3TEDA 4XMYA 3DU5A 3A4CA 1FEXA 4KFCA 2QEXI 2JA7J 3HRMA 4FQGA 3SDBA 5L3CA 5EEAA 5LGUA 3TRBA 3L9FA 2DTRA 2O8KA 3BDDA 3KE2A 4NDLA 4ZJZA 2VKDA 3HGYA 4RS8A 2DA2A 2PUDA 1K4SA 1QB2A 2Z9OA 2GQQA 4LK1F 2WY7Q 1H88C 3CMEI 2LP0A 2ZMEA 2BNOA 1AA7A 4CICA 1UCRA 1B59A 2DMTA 4XONA 5FROA 2R93J 3DLAA 3AL0C 1Z7UA 3I55I 5IP7J 3QQ6A 1XGSA 4EV0A 1A36A 1DU0A 1Y39A 2BY3A 5JR3A 2PJRB 2R7FA 3DF8A 3N97A 3DXJF 1VFCA 2ZXJA 3WU2C 1DP7P 3COAC 4ZC3A 5E17F 3FIWA 4I8TA 4HYEA 4CO8A 2EFQA 2EBIA 3HRUA 3KZ3A 1ZLJA 2DO7A 3F8FA 1ZK8A 2BE5F 1K4TA 3PIPF 4MCXA 2HPMA 2HOSA 2CYYA 2O6GE 2O7OA 1ZR2A 4Q4ZF 4A93J 2V7FA 2XXQA 2OR1L 2RVCA 4PJJA 3CUQB 2COBA 3E5UA 5FKKA 4HBLA 2D5VA 1TQIA 2VEOA 1P4WA 2ID6A 3VSLA 4B4CA 3F22A 2DK5A 4RMNA 2FJRA 2P6SA 2EFNA 3ZMDA 1RKTA 3GWZA 1LB2A 1U8RA 2JZYA 2JVLA 5GAHi 3QYXA 3OYDA 2ZNZA 3ELKA 2ELKA 2K4BA 2KFDA 4PFOA 3RKYA 2VBYA 2AUWA 2PIJA 3SZTA 3IP4B 1R1VA 4HRIA 4KUMA 1ZHFA 3CECA 4OU0A 4FT8A 2Z1DA 5IYCJ 2V1XA 1ZGAA 2B63J 3ZN1A 2L9NA 2ICPA 3DPLC 3ZP5A 4A3IJ 1Y1VJ 4A3GJ 4HZFA 4L5IA 3A0BC 4XLAA 3MEXA 1Y1WJ 2J5PA 1Z77A 5F1RA 5J1RA 4IHYA 2RREA 2VASA 1WWXA 2HVQA 2F4IA 1H9GA 4XIDA 2Y2ZA 3OS1A 2LNBA 5J3LA 4I2OA 4E7JA 3HSFA 3RYRA 3NROA 3TOAA 3T8RA 1VQNI 2DMPA 3FXJA 1RZRA 1WI3A 2I8DA 3WTTC 1YJ9I 1MSFC 3VEPA 1K6OA 1TW2A 4IWRA 4XR6A 4U0YA 1HKSA 2KIQA 4Z58A 3ZKCA 3OR1C 3R60A 1IN5A 3VSKA 2K3PA 1HSJA 1H9TA 2EIJH 3JW4A 1MGTA 3KCCA 4KICA 3OYIA 3CCRI 4RM3A 2B5AA 5H6RA 2XV4S 4BYYA 2V79A 1T6SA 2PMZN 2W84A 2HFZA 3P7NA 2XJ3A 2OA4A 1IG7A 3IV5A 1S8NA 1D0YA 3QOEA 5FKLA 3M1CA 3C3WA 3OSGA 2A07F 3FM3A 1I6HJ 2X0LA 3QF3A 2EF8A 4XLHA 4MFDA 1DUXC 2PJRA 1F36A 4X1EA 3CCEI 3ZPXA 1PP8F 5F0FA 2KPJA 4BXUA 2JUCA 3M8JA 3OS0A 3MD2A 1I6XA 2DOFA 2P81A 2AHQA 3F6OA 5KNLA 3OYFA 1UAAA 2BGCA 4ETSA 2P7CB 1AOYA 3AAFA 1PERL 2LKSA 2M4KA 2CW7A 2K4JA 4JK1X 4HG2A 1IV6A 4ZYHA 4E7LA 2BHZA 3CJQB 2G7HA 4U7BA 3CCYA 2LFBA 2ESHA 4O3MA 4RB2C 4EJWA 3LMMA 4HQMA 4R1HA 4D5FA 1YIOA 3X2QH 2MBFA 4E70A 3SCGA 4M73A 3RPUD 3B73A 1Z7LA 3SCFA 1S7EA 3KZYA 4A3BJ 2WADA 3GLLA 4KIFA 1VQMI 4ENJA 2CQXA 3CC2I 1T95A 2LG4A 2VJIA 2RNGA 4AIKA 2DBBA 2O9LA 2Q0OA 4G6TB 4PFPA 2BHYA 4Y3OA 5B1AH 3FX3A 3B7HA 1Y56A 2EZKA 4UVAA 3JRIA 3GTGJ 2LY1A 2LBFB 1HA8A 4YEJA 3S16J 3H92A 1XGNA 3QPTA 2XPWA 1ULYA 2YU3A 3FK6A 5FKMA 4DZJA 4A3LJ 2V9KA 2P4WA 2Z3YA 5A7LA 2LF8A 2VKEA 4BE0A 3LFUA 2OTJI 4JCYA 1QQAA 4WXHA 5IYBJ 3L2VA 3GTKJ 3REOA 4KNYA 3LWFA 4D7NA 1JXSA 4ZTFA 3R0JA 1MNDA 4YFXF 3E97A 2ZNYA 1XSDA 2I10A 1ACIA 1HF0A 4PSXA 1AWCA 1YS6A 3F52A 1XN7A 2NS7A 1JWLA 3S1QJ 3SJMA 5EZHA 4B44A 5B3SH 3GTLJ 5E79C 1PRUA 3W6KB 1PRAA 3QU3A 4XRSA 1CJGA 4DE8A 1T2KA 2VUMJ 1YYVA 4FISA 2HXOA 2VB6A 2FOWA 3G73A 2XPUA 3GFLA 1NERA 3S2WA 3JTGA 4DYQA 2A68F 2L54A 2X6XA 5D6EA 2H27A 2ISZA 3R0AA 1LMB3 2PXDA 1EH8A 3ZN0A 3CCQI 1SFKA 1SVOA 2ZB9A 4MCTA 2M4GA 4F8DA 5JFRA 3GBGA 4BU2A 1J59A 2M7AA 4E7KA 3V8LA 2BV6A 4BQAA 2ODRD 3EYIA 4W1UA 4CSWA 1AKHB 4OMZA 4I02A 4I76A 3VB2A 2LLVA 1S5LC 1ZUGA 1XCBA 3GYHX 4V19K 3HRTA 2XAFA 3E6CC 3PJRA 4IO9F 2L9RA 3BCBA 5E18F 3R61A 2DA5A 5DT2A 3U3WA 2F4MB 1D1AA 1G6NA 4UHTA 4D0PA 2A05A 2A6CA 2IBDA 1RIOA 3HZJA 2YBDA 1KA8A 5CYVA 1XB4A 3DU6A 3EUKL 3GZCA 3G2BA 5L3GA 2DU9A 3HOTA 3NZLA 2QGUA 3DEEA 4V2FA 4CDGA 3KETA 2JT1A 3CQZJ 2F5CA 2K7LA 5IOZA 4IX7A 2KZ8A 1A35A 3DKXA 1ZYRF 2COMA 1MMAA 1SVLA 3F8BA 2VKHA 2R1JL 2FJ1A 4BL0B 1OCRH 4AC0A 2M3AA 2EQRA 3GFMA 1KGSA 1SVMA 2ZXIA 2VE9A 4II2A 4RA2A 5KVRA 1ZZ8A 2ZJ2A 2D45A 3FXLA 4IQ4A 3V8KA 2IGKA 2BXZA 1LUJB 4YARA 2IXSA 3KFWX 1BA5A 2NS8A 2ZJPF 2BYVE 2STWA 3K1NA 3V4GA 2LBFA 3DPUA 2ZFUA 4JBAA 2PLYA 2VQCA 2QCOA 1ZG5A 1WH6A 3RIRA 1X1PA 4I0BA 1EKEA 3ZQLA 2E1MC 4I98B 1DW9A 2WBMA 4A2UA 2VE8A 1LPQA 3VWSA 2R4GA 2VBXA 2YSRA 5LRRA 5K5RA 2R7DA 2QENA 1KQ0A 2RGVA 5FRNA 3K10A 2L02A 4PJMA 5LLQA 2VONA 1J0RA 3HOZJ 3H3VK 1P6RA 1POGA 5HOOA 3S2HJ 5DM7F 3HRSA 4A5NA 2M5WA 4IVNA 4OB4A 4ZH4F 3OMYA 2XF7A 4KMFA 3G4SI 2F5DA 2WB1N 3HGGA 1KQ8A 4ESBA 5GAGi 3R6SA 4FETA 5FFZA 4H4KC 2K9QA 4HAMA 2DN0A 1YS7A 2L4MA 3BR2A 2Y9YA 2XB0X 4GHJA 4JX4A 2PPXA 2HYGD 4OWRB 2XKPA 5J6XA 3LFKA 2MGQA 2LYSA 4JQDA 4P9UA 4JOMA 1MDMB 5HLTA 3KP6A 5JLWA 3KJXA 3KP7A 2IPQX 2TRTA 1W36C 4QWQA 3RCOA 2F6CA 4YIRX 2PXUA 2GOXB 4V2GA 2E35A 2JSCA 5K7ZA 3ZQIA 4E6KG 2A3SA 3ZOBA 3H5NA 1NG7A 3OQNA 3RI4A 3FDYA 1AKHA 2AXLA 3ISPA 4MGRA 1XSVA 4B3AA 3RJPA 4EM0B 4YG7B 2DQLA 5DM6F 4G6QA 2DMUA 3I4MJ 1K78B 1R00A 4IHWA 1S72I 3K0LA 5J40A 2KT0A 1TQMA 2B9SA 1W7PB 3R4KA 3KP3A 4LLLA 2W82A 5KK1A 1J09A 2EV5A 1T98A 2L4AA 2JUGA 4EMSA 1O3TA 2ZJQF 1GV2A 1O3RA 1JUPA 4BXFA 2EFWA 5HLIA 4L0YB 4J01A 1UG2A 3A0HC 4AUXA 3FXQA 5CLSA 3OYCA 2LC2A 2PFBA 1FYMA 1OMIA 2X4HA 2FSWA 2MFZA 3HXLA 3BZCA 2KRCA 3ZQGA 4J1WA 3BQZA 5KAIC 2J7WA 3WTSC 3NEUA 4HEA2 2ZFWA 5ICEA 3J7AY 4YIFA 4ER0A 3CCSI 1YITI 5FLXZ 4BJTA 1WJBA 2R7QA 2HKOA 4YG4A 5GPAA 4ZZLA 1Z6TA 2VPRA 1XTAA 1LLIA 2VJJA 2EFOA 4HX8A 4M3FA 1OLTA 2MW8A 1Y7YA 2LNMA 5FO5A 4RGUA 1NEQA 3LAJA 4XKBA 5EEHA 1RR8C 3F51A 3KEQA 1W36D 1DGRM 3MKLA 2DA1A 2YX7A 2H1LA 3A2KA 2LYJA 3V7RA 2PXLA 1UB9A 1FP1D 3HKZN 3MVPA 1R4NB 5E1XA 4ENKA 1Z9CA 3DEWA 4PJ0C 2IAIA 1QP7A 3ERMA 4BE2A 2BZTA 1ADRA 1LFPA 1ZG1A 2YR2A 3QWGA 1Z0XA 5C4JJ 3TP3A 4PGHA 4I6RA 1X2NA 4NB5A 1MBKA 3VDXA 4LB5A 1P4XA 2HVRA 2X6WA 2PXBA 4XK4A 1ERDA 5ICGA 2ZC2A 5HS9A 2FUG2 3KZZA 3A9ZA 2LF7A 3AG3H 1BR4A 3JREA 4CHUA 2XIGA 4UXNA 1W1WE 3E6MA 3ZHMA 1B9NA 2VL8A 5DTRA 4M3EA 5F04A 2K9LA 3I3LA 2DOEA 1YI2I 1JUMA 4U87A 1MDMA 2X85A 2IW5A 4XORA 2V1DA 1R36A 2DJNA 3CJTB 4BEHB 3GZDA 3QPSA 3FMRA 4LLNA 2FQ3A 3K4CA 3TMOA 3UWPA 4GYGA 3OOUA 2D2WA 3AG1H 4M3BA 3HTSB 1FIPA 3WTWC 3OYLA 2WB1A 5HS7A 3I58A 1W5SA 3ZMSA 2ZCWA 1SAXA 1PDNC 4RM2A 1VQLI 2HZDA 3M1EA 5EDNA 1MKMA 1Y6IA 2A6EF 1YW8A 2Y69H 2K85A 4WVLA 2Z16A 1IF1A 5HVQC 2STTA 3GUUA 1K78A 2FX0A 3I53A 3S8QA 3KP2A 3QAHA 2F2EA 1G59A 1QNTA 1ODDA 1ON2A 3K2AA 1W7PA 1XMAA 4ER7A 4B47A 4Z5HA 2A5WA 4XLPF 2XXPA 1IN6A 2KZVA 3ABTA 4S04A 4BXXJ 3FXMA 3A9XA 1BI1A 3M7GA 1WETA 4O8BA 3QQAA 4AU7A 3P5JA 1N75A 1L0OC 3DP7A 4IHSA 1IGNA 2GXAA 2PQ8A 2K27A 2K9MA 3DNVB 5EJCA 4CCKA 2HQAA 4NBQA 4JCXA 1ETQA 1JT6A 2R7XA 4OINF 4QPOA 4BNCA 3BWGA 2DT7B 3V7SA 3V42A 1U8BA 3DKWA 2J7UA 2JA2A 2XUBA 5LBQA 3IH4A 2FBIA 3H3UA 1ZVVA 4Y17A 1J5YA 3WTVC 2XRNA 2IVMA 3BTIA 4KIGA 3CUQC 2HYJA 3LSHA 3DCFA 3LISA 2DOAA 4ZTJA 2VQGA 1MJAA 2QF7A 2FMYA 3NQOA 1V5GA 4KDPA 1KZHA 5CVIA 3SR4A 1DULA 3L1PA 1RZRD 4QTRA 3BS3A 2OPTA 3GTOJ 3QU6A 3MZYA 4I09A 1X3WB 3DTKA 3I59B 2XHKA 1RRJA 1U78A 2R5ZB 4Y13A 1I3AA 1SD7A 2AQFA 2QSHX 1Z1DA 1KQ9A 2EWTA 4XKCA 1P4AA 1B9MA 3FYMA 2QQ8A 3MEJA 3Q0WA 4FTHA 3H1CA 4LMYA 3G0TA 4FX4A 2OQRA 4AIJA 2CUJA 1T39A 1B6AA 1DWKA 3W2VA 1D5YA 2GRMA 5GAEJ 4BQOA 4EEFG 5FB2A 2CQNA 1VTNC 3S1RJ 3PFIA 2CWEA 1IUFA 2DA3A 4B48A 2P7VB 4M74A 1V5FA 2OV7A 3H9GA 5FD6A 1QU3A 4K2EA 4KJZA 3EUHA 2DFEA 1TNTA 1I50J 3LNQA 3HTUA 3S32A 4PUSA 1SFXA 5DD4A 1MMNA 1TBXA 1LDKB 3H9JA 4BEHA 5M3MJ 4A6EA 4OIQF 1NTCA 1ZGWA 3IL2A 2LOOA 1TWHJ 4Y4RA 1ON1A 3JXDL 3IRQA 5KCMA 2E5NA 3SX0A 3JRHA 1QPIA 5F0CA 2R7OA 3OYAA 4ENNA 2VXDA 5GP9A 3JXCL 1VPWA 3JRCA 2A6TA 4GQMA 4A0XA 2E7WA 2IVBA 2NNYA 1Z3YA 3OWQA 3HHGA 4X4DA 3KX2A 2MC4A 1QZXA 3LSJA 2ISYA 2PMUA 3ZQ7A 4A6DA 2BJCA 2IA0A 2IV1A 2VXZA 3K4JA 1OJLA 5F0HA 2ZO4A 3A03A 2KDOA 4CUGA 3G1LA 2CUEA 2WA0A 5J8CA 1YOVB 2F5FA 4C9YA 3OKZA 1KU3A 4JX6A 3SEQA 2GM4A 2HOEA 1HQCA 1R7JA 1GUUA 3VOEA 5ILSA 2DJIA 3PO3J 5J4VA 3OR2C 3Q9VA 1MZBA 3FBNB 2LLWA 1MH3A 2B0LA 2NOJB 3AG4H 5DTMA 2R7SA 3GTPJ 3K9TA 4KT5C 4L0ZB 1QRYA 1T8IA 2PX9A 1T0FA 2MLKA 2LDUA 1ZG3A 2HGCA 3V8JA 2OFYA 2WAQA 3OP9A 4EM2A 4TV7A 3HOWJ 1JHFA 1MMSA 2LTPA 1LFBA 2IP2A 2Q8KA 3S15J 4HDUA 1UMQA 1Z91A 1NG6A 2CRGA 2QKMB 4MFEA 2R7VA 2GWRA 4ESFA 3TO6A 2R5YB 1E3OC 3ONQA 1I1GA 4UB6C 2M0CA 2CQKA 2Y30A 4Y42A 1J2XA 4LB6B 1RESA 5D5XB 4B3XA 2PUBA 2XIUA 1BC8C 3BDNA 3FK7A 1MBEA 4QPQA 5HODA 1MW7A 4DOZA 1OPCA 2HQRA 4EZIA 3O6BB 1XC5A 4XKVA 4IHXA 4M9XA 4UY8I 4NQWB 2L2OA 3I59A 3PQKA 1Z05A 2R5ZA 1LFUP 4B09A 2E19A 2QUFA 5DCFA 1ZQ3P 1QHHD 4U0VA 2W7NA 1LVAA 3QOWA 2NYXA 1RC9A 2FBKA 2HOAA 3L09A 1QQIA 3LSTA 3FYAA 1O7FA 1G3SA 2IS2A 3CESA 2MA3A 4ZYGA 4EJTA 2XSJC 3AKZA 3A1YA 1Z67A 1ETKA 3BZ6A 3KP5A 2HXIA 1APLC 3RKWA 1SD4A 4BY7J 1VQ4I 4E7ZA 2ICTA 2BOLA 4HPQA 3VWBA 2KQRA 4RAZA 1UG0A 3LSRA 5IP6A 3NARA 4ITVA 5CVRA 3S17J 3IHUA 2XAHA 3WHCA 1IN4A 1XDSA 2HTJA 3QWLA 2EA4A 3C7JA 4M3GA 3ECHA 2JTVA 5FD5A 1JKRC 2LK2A 3FXKA 1R9TJ 1NH3A 4HSRA 4AYBA 3BC8A 4BHCA 4CYCB 1FX7A 5JI6A 4HDVA 2Z5UA 1RZ4A 2OCEA 1ZS4A 4M72A 2JSPA 3L2CA 4HX7A 2JVHA 1VNDA 2KEKA 1FC3A 1OCTC 1VQOI 3CDLA 3BLYA 4Q48A 5HNHA 4PCQA 5K1YA 1BJAA 2X51A 2JPCA 1Q1VA 2DODA 2XAGA 1WJCA 1X2MA 4L18B 4BUPA 4MNUA 2WV1A 1D8KA 1JUSA 2OZ6A 3W3CA 2M8GX 5LGTA 3D1NI 4OAYA 3ZXSA 1FOXA 2KJBA 1K83J 2CS3A 4RAGA 3L2UA 3LFPA 4HX4A 3EPZA 5EYRA 2ZXWH 4EKIA 5M5XJ 3IVPA 3SFZA 4KMUX 2LYPA 3I54A 2EWNA 4DZPA 1E2XA 4XM3A 2FD5A 2K9SA 5B5EC 2O8XA 2IGMA 5LEKA 3HOVJ 1RKWA 2H6BA 3ZQCA 1JGGA 3ZMVA 3CLQA 2HCNA 3HOSA 3RTRA 4HNVA 5DRYA 5BS6A 1JI8A 1FBSA 3DFGA 5E3LA 1UTXA 2HKXA 3IKTA 4Z59A 2O5RA 2RQQA 4DE9A 1FPQA 3M07A 5EGOB 1U3EM 3S2DJ 3PNTA 2R5YA 2V6EA 1K79A 3UKGA 4A69C 1DDNA 2PXFA 1LDJA 4IRHA 5D8LB 2H1KA 1AHDP 1NK2P 1SMTA 4NC8A 3DWLE 3V7CA 5A2QK 2UXNA 1HOMA 2Y31A 2E1OA 3OOPA 2EILH 2XGCA 2K5CA 1T56A 3LA2A 4JQFA 3FMYA 3CUQA 2PXQA 4EM1A 3QYFA 2CV1A 4NQWA 2AWIA 3FZVA 2XASA 2LRDA 3BG7A 4F55A 5E1WA 1RNLA 4YFNF 3QPHA 1KYWA 3K6GA 4A3KJ 4U7DA 2JVGA 2G9WA 1MBHA 2NVYJ 2LVSA 2O49A 2KHMA 2Y0SA 3ZR8X 4DYRA 4KITB 3IRRA 2PMHA 4GCVA 4A3FJ 1HW2A 2PI0A 2JCGA 1ZKGA 3F8NA 1K7AA 2OZUA 3VYSB 2BW3B 1X19A 4B43A 2LYQA 1FBQA 2CGPA 3WG9A 2L5QA 1ONVA 4C2MJ 1CGPA 4Z2YA 2RV8A 4DGWB 2AXUA 4HNUA 1TT0A 2HCSA 4YFKF 2QSGX 1G8XA 4WK8F 3MZHA 1IRZA 1OCCH 1YW7A 4N9IA 1FOWA 5GAHJ 1GVDA 3H5RA 1DGWY 1LNWA 2MH9A 1A31A 2QKLB 2CV0A 5FRMA 1QVUA 3IAS2 2A5YB 2H8WA 4CYCA 1KU2A 3GXOA 1RPWA 2WY8Q 1R69A 5DUIA 4A3JJ 4CCJA 1WSUA 3TFLA 4ER3A 2HYFA 1YJWI 2UXXA 3WU1B 2X1CA 2OC6A 1JKPC 3GZDC 3RSNA 5JHFA 2TDXA 3GX4X 4G7OF 1BDHA 3LOCA 1LDDA 1JT0A 1RUNA 3CO6C 1X1CA 1Y0NA 3BOQA 3M8FA 4IF4A 1W5TA 1OYWA 3GUDA 1ZZ6A 4HW0A 2DA7A 2M7BA 1X58A 1QZZA 2GIVA 3PSIA 4YRVA 1B8IB 3WODF 2VQHA 3ASNH 4BJ5C 2P5VA 1YO5C 1U2WA 1IJWC 3K7AJ 1UELB 3DBRB 2ZSHB 2E71A 5FLVA 1DU6A 3I4PA 5CVJA 4PU3C 1ORKA 2EBYA 2BXYA 2MABA 3IWZA 1WH8A 2L0KA 2LYLA 2LY9A 4XSZF 3AFHA 1ENHA 4ASNA 1A6IA 3E6BA 2XXAA 1WJFA 1Y8RB 4PDKA 2R7WA 5EGOA 1JH9A 4YELA 3JSPA 2GZUA 4XLNF 2HNHA 3H9QA 5TISC 3PUFA 3A02A 2NVUB 2L49A 4XKWA 2B7EA 5GPCA 2WIUB 4X4HA 3C18A 2V9PA 3HUGB 3L00A 1EA3A 1D8JA 2I5UA 1X2LA 1DQUA 3QRFF 4HNTA 1SAUA 5DD8A 2EIMH 4PSWA 1VF9A 3CP8A 1MSEC 5K98B 3GF2A 1BIBA 3HJEA 1YJNI 4FBIA 2MC3A 3TOBA 1F1ZA 2L7MP 4EK9A 5DEQA 4D9JA 3M9LA 2EH3A 2RC4A 2O0YA 4FN3A 2L7KA 4I01A 3D5LA 3I5UA 4L9JA 1V4RA 1OR7A 1WHUA 4N0BA 3BTCA 3TP0A 3JRBA 1F4KA 3GTMJ 2V3CC 2HQNA 3WG7H 5CKTA 3O8GA 5D4RA 1U9NA 3FMSA 1VQKI 4R79A 5LHIA 3BY6A 3EUAA 5D6FA 1EFAA 4YIIA 1D3YA 3GEZA 3I0TA 1ZPQA 2VJ5A 4BS9A 5GTHC 3HOUJ 3MMYB 1SFUA 5F6FA 5BPDA 3K4KA 3OY9A 5BPIA 2ME6A 3UFDA 3DTIA 4X4GA 1PP7U 1HKQA 1YSEA 4Q5SF 4LK0F 2DPDA 1USSA 3GN5B 1QP0A 3CCUI 2VC1A 3DBLB 3JRAA 1S7OA 3MCZA 4F93B 1HW1A 5DRTA 2YPRA 2P5LC 2KIUA 2ELJA 5L3BA 2OJED 5HNFA 1W7PD 4PK4A 2XF5A 3JRDA 1FWZA 4KYWA 3L2WA 2EJRA 1ZZ7A 2Q2EB 3EUHC 2KL4A 1ETOA 1TTYA 1PUFB 4OOIA 4ZDLA 2NVQJ 3ABKH 2IJLA 5GADJ 5FFXA 1I27A 4BKXA 5D5VB 1V3FA 5JHUA 4IZZA 3F8CA 1W0TA 3J7YJ 2XC7A 3PSFA 2GA2A 4P1WA 1SEUA 2EZIA 4BJ6C 4CXFA 1ZZBA 2XPVA 3CCLI 1EH7A 3OMTA 4AM3A 1B8IA 3KP4A 4L5JA 4ZYDA 3CDHA 3G3ZA 1FIAA 2PEXA 2VT2A 1QO0D 1H89C 1IZ1A 3M8EA 4M9ZA 3WU0A 3GTQJ 2BNNA 2VQLA 3H36A 5C3EJ 2FRHA 2L8NA 1I39A 1REPC 2VKVA 1S9HA 2W24A 1F5TA 3A01B 1U0JA 3WTZA 1GVJA 1WVRA 3DKYA 5FJ8J 4EJOA 5LRSA 1PYVA 2HVSA 3ZRGA 1YRNB 3B6AA 3J7ZI 2XF6A 1EF4A 3VYTB 4RLQA 3JTHA 3CD6I 3JRGA 3GBFA 2VODA 2EZHA 3ZHIA 3ZQQA 3HUGA 3OIOA 4QIWN 4F91B 3TELA 4MEYF 2L3DA 1BOAA 4RGXA 1Q1HA 2D1HA 2R63A 3MZ8A 2QLZA 3PIOF 1T0FC 2DFIA 1MD0A 2LH9A 4HLXA 1P7IA 3GZ5A 1VQ9I 1USTA 4NUBA 4WX9A 1QHGA 2LYCA 1IRFA 1D1CA 4Y52J 2CROA 1FTZA 4AD9A 2OBPA 4GGGA 1LE8B 4WXCA 5EZGA 1ZH5A 2KRHA 4XOPA 1XD7A 3FHNA 4EGYA 2MLGA 5H20A 2M87A 5D5UB 2X48A 3KPHA 2WUSR 3CZ6A 3H0GJ 2DFFA 1TWFJ 4Z5DA 2MD0A 2DW4A 1OYYA 1WRJA 2XAUA 1MNMC 4HF2A 4DYCA 3OIQA 2HDWA 1G3WA 2FA5A 2XROA 1UXCA 3NAUA 1LQ1A 1IAWA 3FHZA 2AXZA 1JHHA 2GXBA 3F21A 1WZ2A 1OCOH 3G1MA 2DDAA 4MIMA 3DQVC 5DCMB 1J75A 4Y33A 3OSFA 4A3DJ 1E3PA 4HOBA 3SHFA 3GN5A 1W4MA 2FOKA 2QA4I 1B0NA 2KEJA 1T38A 4MEXF 3Q3SA 2M0MA 2XVCA 3W2WA 4EGZA 4F92B 4PJLA 2XGXA 2O3FA 2UUZA 1YIJI 4LIUA 1FY7A 1R6RA 1BJZA 1FOYA 1L1MA 1XCVA 5IY5H 3ESWB 5IT9K 2PBIA 3OYBA 2R0QC 4L9VA 1L3LA 2XAQA 2OCCH 2Q2EA 3DPTA 3BPVA 1JTXA 3I71A 1PUFA 1EJ9A 4XL9A 2IS1A 2CQ7A 1ZZ9A 1B1BA 1A6QA 1QVTA 2XCJA 1GLNA 2P6TA 3GVAA 4IHTA 3L2RA 5DDGA 1BR1A 5IP9J 4PU8A 5IT9Z 4ZDOA 1OFCX 1A04A 2L9VA 4ANJA 3CUOA 1D5VA 1BOBA 2HOTA 1R1TA 2JWTA 2L7FP 3GCMA 2VOPA 4E4HA 1CQTA 1YW9A 5TJJA 1QZEA 4FE7A 5GAGJ 3HOYJ 2EIKH 5ERIA 4B8XA 4EJUA 2QQ9A 4Y7NJ 2PXVA 1PVEA 4II3A 3OYHA 1ZGJA 5BOXA 2ESNA 3B6CA 3A01A 2WAQN 1E3HA 3VYUB 4G6DA 5FLMJ 1YRNA 1HCRA 3ML6A 4OIPF 4A0ZA 5IOYA 3BJOA 3TW7A 3G6EI 2DA6A 2V1NA 5FKNA 2JA6J 1ZRDA 2O61A 2AXTC 3KL4A 2OTLI 3LQQA 4A3CJ 3WHBA 1XWRA 2Y75A 4L9NA 3BR6A 1FTTA 5B66C 3FXOA 2OUMA 3I4NJ 3HIFA 2KDZA 1CF7B 1VQ6I 4CCOA 2OF7A 3DTEA 2HS5A 3E1SA 3RKXA 1HDPA 1TNSA 5F08A 4OIRF 4KA4A 5DTDA 2XI8A 3W6VA 1SD5A 1LE8A 2JRMA 2E60A 2R7ZJ 3U1DA 1VQ5I 1ITYA 1E17A 1IDYA 5K7HA 5LD2C 1IV8A 3UR3C 3CJNA 2ACJA 3DV8A 5CQGA 1RIOH 2DFHA 3Q0VA 3IWFA 2E2JJ 2E1CA 3F9KA 3CDIA 3HPGA 4C2TA 1R5HA 2WAFA 2ZMEB 5AONA 5KHDA 2CW0F 4FX0A 1U2ZA 4BAYA 2HDDA 3RZOJ 2LR8A 3WGGA 1D0ZA 5DCMA 4BBSJ 2HU9A 4DBRA 4ON0A 3BD1A 1I3QJ 1S29A 3FXUA 3I64A 2YUSA 3BG6A 4C3HJ 2IT0A 4U88A 4IHVA 3OV8A 1YX5A 1BR2A 1JTYA 4EQZA 2PXPA 2ZSIB 4AYBN 2K86A 3E7LA 3FBIB 1NHAA 1FT9A 4PGGA 1GT0C 4PU7A 3PNYA 1WJDA 1LCCA 3EDPA 3LQRA 1QP4A 3OL3A 5DS9A 3WTYC 5IYDJ 4NNJA 5LHGA 2YS9A 2LCVA 3GZNB 2V26A 2HI3A 3K1MA 3LSPA 2G7UA 1TC3C 5HS8A 2H8RA 1HW5A 3PL8A 5L3FA 2FXAA 3JSOA 1STZA 1RZSA 1JGSA 3G71I 3GW2A 3VFZA 1JFSA 4CYDA 2E36A 3BT9A 3K4NA 5EEGA 1BW5A 5DTQA 1XPXA 4D7MA 1J9IA 1WQ2A 4I99C 1HDDC 5TGTA 3ME5A 1BI2A 3MKWB 1TQPA 1WCMJ 3LA7A 1GHCA 2PXEA 2DMNA 4M9SA 2QYOA 3SZGA 3HYIA 4Z6YA 2OQGA 3N05A 2IGNA 1JE8A 1EH6A 2KZGA 1O7LA 3HEFA 2F48A 3HSEA 3I56I 1WPKA 3MKYB 1S7AA 2FEZA 3F23A 2BNMA 4C3IJ 2AO9A 4IOCF 4C3JJ 3F8MA 1PUEE 4HLYA 2FFHA 3KEYA 5F64A 2TCTA 3MFKA 4IEJA 1BBYA 1BM9A 3TBIA 3TW6A 1TP4A 2HPIA 1YX3A 4PU4C 3BR0A 4PZJA 1K61A 1IO2A 2R7UA 1X3ZB 1CF7A 1XX5A 3LAPA 3HBLA 1HQ1A 2VC0A 1UZCA 5E8GA 1YTYA 4YG2F 2M1BA 2DYSH 3T0YA 4S0HB 4A12A 5ICCA 1WH7A 4X4BA 2V4JC 1Z21A 4ESJA 1FZPB 4BHBA 3BZKA 2EFPA 1H0MA 3WTXC 3CF2A 3G1OA 2JA8J 1N25A 4HF1A 1VQ8I 4F52A 4UUVA 2VI6A 4WF2A 4U0WA 3ULQB 4BDYA 2V9VA 2Y0SN 4IXAA 4XNFA 2EV0A 2LLKA 1ETXA 3EYYA 4X6AJ 5LHHA 4O6JA 3QPLA 3ZGKA 1V5EA 4KN4X 6PAXA 2YX4A 5IPAA 2VPLA 4I0AA 1J7KA 1DPRA 1E0EA 2CMPA 3W2AA 1JKOC 4P96A 1TWCJ 4RGRA 5H6QA 1ETVA 2D1VA 3Q0UA 3CO7C 1QPZA 2WTEA 1OR7C 2GAUA 4L5EA 4KN7X 4BQQA 2XGEA 5LEJA 2E2HJ 4XICA 1VZ0A 2ECCA 3U2RA 2O38A 5AIQA 1BL0A 3SEZA 2F5VA 1IXSB 1RR7A 2FE3A 1QBJA 3HZIB 4EVIA 1UHSA 3TKYA 2M30A 5E1ZB 3S8PA 5F1JA 1O4XA 3DM5A 5K7FA 2DDBA 4J19A 3DBHB 5EG0B 3IH3A 2M4HA 1LVKA 1U9OA 4AIHA 1ZTRA 3ABMH 4IQJA 2E2IJ 4CZZA 1BI3A 4R8HA 2NOGA 2M2EA 2VIXA 2JJ7A 5HLGA 1IC8A 3NXHA 2KMUA 4X4IA 1UHMA 3QP5A 4AVPA 3BP8A 1Y8QB 4HV6A 4HRAA 3CMMA 1ZAYA 9ANTA 1OCZH 1IN7A 2RN7A 2FQ4A 1DPUA 3OL4A 1MMDA 1TWAJ 2VBZA 3C2BA 3E5QA 3K69A 4F7ZA 4Y15A 5M5YJ 1G4DA 2DQRA 3K2ZA 1T08B 4YG1A 3U21A 2KRFA 4NC7A 2ECBA 3CLCA 5JUWA 3H5TA 2FU4A 4P55A 1MNEA 1UJ8A 1JJ8C 2NS0A 3ASOH 2J5OA 1XGOA 1WIZA 2AXVA 1QQBA 1R23A 4ZYAA 1P9QC 3BTJA 4WWCA 3QFIA 1W5CC 1KONA 4JP0A 2BY1A 2WWYA 3CCJI 3OYNA 4LIVA 4LFUA 4HQEA 1XDUA 2MXDA 2P0WA 4Z5CA 4AIDA 2FNPA 4RBOA 5FGMA 2W00A 3SFIA 2EA2A 4UUSB 3CF5F 3FISA 1QPMA 3PNVA 4ZDPA 2HSGA 3PO2J 5F27A 1Z6RA 3IKVA 4XLCA 4XOTA 1P92A 3KZIC 2A61A 3LSGA 3RZZA 2H09A 3BG5A 3SXYA 3FF5A 2ZXHA 1IXRC 5CQEA 3SQNA 3CTAA 3RKQA 2BEOA 2LREA 3CLOA 2GBYA 2EINH 3PM1A 4AWXB 4MO7A 1FSHA 4LLGF 4IVZA 2L7ZA 3F72A 2MG4A 2IA1A 3RZDJ 1BIAA 3NWTA 3CC7I 3D0SA 2ETHA 3M3YJ 3CMAI 5HLHA 2E1NA 3RQIA 1R58A 4HV5A 1FLIA 3KYLA 3FMQA 3PE5A 3HHHA 3CCVI 3AL0B 3CROL 4N9HA 1WH5A 5A2QZ 2PUCA 1F9NA 1TW3A 4HSTA 2CSFA 2DLLA 2HTSA 2RAEA 1Z3XA 1XG1A 1MJ9A 2DMQA 4DNCA 3IC7A 2X1EA 4LG0B 3RDIA 3R1FA 2A6HF 5EG0A 3S3MA 1QGPA 2EZLA 3BG3A 2CFOA 3ROUA 1GXPA 2LYRA 2PG4A 4BH9A 4XRFA 4RLFA 3J81K 4LOCA 4G8XA 1N78A 2PXTA 3HOXJ 5IT3A 4UV9A 2MH2A 2WAEA 3BG9A 3O3KA 2Y9ZA 4RB0A 5CVUA 5KAFC 4FHTA 2QBYB 3WGHA 4X4EA 2BVLA 4Q47A 1PRVA 3FWEA 3IAM2 2FMLA 4BE1A 2DK8A 2GA1A 1NW3A 1ETYA 5EF6A 1I5ZA 1V55H 2DA4A 2HZTA 1R71A 1BN5A 5CJ9A 3J81Z 4M6VA 5JLXA 3SYTA 2X1DA 4C2UA 3ZMTA 1JJ6C 3MAJA 5M5WJ 2QM3A 2QSFX 4EJVA 3CJRB 1R1UA 1SD6A 2W1OA 4J1XA 4W97A 3PUBA 5C4XJ 1P2FA 3RPQA 1IDZA 1M1EB 1SMYF 4GXOA 4RAYA 2PJPA 5L3DA 1X1DA 3KXAA 2VLAA 3VPRA 2O03A 2RQPA 2ZKZA 3BPXA 5E8IA 5DYMA 2JN6A 3BJAA 3EQLF 2KP6A 3P9CA 4PJNA 5DV5A 3U9GA 3ERED 2P5KA 4RB3C 2IU7A 1OSLA 1HC8A 4E7HA 1YE9A 4YBAA 5C44J 2FF4A 2IUOA 1C0WA 2NRAC 4Q2JA 4LD5A 4UUSA 4DW6A 3EUSA 3ABUA 3F6VA 4E7SA 2P8TA 5FKOA 3J80K 4X4CA 2PN6A 1IW7F 1FOKA 4I6UA 4P9FA 3VYRB 2LKPA 1FP2A 4MHGA 3TDZC 1IRXA 5ILVA 4XLEA 2LSOA 2XB5A 2MD5A 3GTJJ 4O5VA 1X4OA 1XMXA 4P5OA 2MEZA 2O4AA 3TGNA 2KIMA 2JRTA 2R3SA 1B72B 2EPFA 2VBWA 3J80Z 3OQOA 2QQAA 1WJAA 3E6DA 3K4BA 3AG2H 2C6YA 3S93A 1ZR4A 1RUOA 4X0GA 3E5XA 1LEBA 2IGOA 2L9SA 5H2FC 2IA2A 1FMWA 1YHQI 3VK0A 1GXQA 2X9DA 4AVZA 1QZYA 5E3NA 3GFIA 4IRIA 1OQYA 4M6YA 2QZ8A 1D0XA 1IN8A 3QYEA 4IRGA 3G5GA 3PQJA 1TT5B 1MFQC 1ZRCA 1FNNA 3C2GA 1UXDA 3TDUC 2PUGA 1G2HA 2Z33A 1YQAA 2HDCA 1X1AA 3HM5A 4LGWA 3LSMA 5HDGA 3MKZA 3LA3A 1GDTA 1R22A 4LG0A 4BDZA 3EETA 2BW3A 2PMZA 2VOOA 1DP3A 2KLOA 2G0EA 3A9YA 2A69F 2V6CA 4J00A 3BR3A 2CUZA 2KIFA 3NWSA 3BQYA 3OYKA 4M3DA 3OS2A 2JMWA 4XQFA 2UZKA 3SCHA 3BCAA 4CH7A 4DBQA 3CC4I 3C2HA 2L01A 1X4PA 2NAZA 3RQ4A 2QBYA 4NDWA 5HDKA 1MBJA 5LFAA 1POUA 3O2PE 3TQNA 3JR9A 1R4MB 2ADUA 2PUEA 4KISA 3P9IA 3K70C 1WJEA 5BQTA 4G94A 5D4SA 2K9NA 4BACA 2DT5A 2GLOA 2RNJA 2DAOA 5CPRB 2LD5A 3NDBB 2OU2A 2LMDA 3OYGA 4GYIA 3PXPA 2M45A 4N4OB 3C1DA 4MTEA 4UVCA 3TO7A 5K5QA 2KEIA 1HKTA 4OBMA 1TZLA 2W25A 5BMZA 2Y48A 1B4AA 4ER6A 4D1QA 4IKFA 1MMGA 3W6JB 1G3YA 3LL7A 3D5RC 4A5MA 1JKQC 3MWMA 3T1BA 4WCGA 2PXKA 1U5TC 1XS9A 2XKOA 1KU7A 4LG3A 3S1NJ 1R63A 2BY2A 1D1BA 3FKJA 2KPMA 2Q1ZB 3HPHA 1I1SA 4C30A 2E34A 3PFYA 4L9TA 1FBUA 2JA5J 3BROA 3RPUA 3DLLF 1Y0UA 3HDDA 4DJAA 3QOXA 3MLFA 2HEOA 4MTDA 1X3UA 4MQVA 2W48A 2AS5F 3H3ZA 4NC6A 1Y9QA 3H35A 3OWTA 2DI3A 3H0DA 2K02A 1YG2A 1BW6A 2EK5A 5J47A 1P7JA 2PUFA 2QQBA 3LSKA 1B72A 4CGZA 3G7DA 4BBRJ 3K4MA 3J7AO 3KLNA 4I6TA 1U6GA 5JVTA 3L2QA 4JYKA 4CA0A 4E7IA 2NXNB 1BI0A 2K3FA 4HF0A 3HSRA 4MQ9F 2RDPA 4ZYEA 5J8FA 2HQ5A 3S1MJ 5ICFA 1LKXA 1G3TA 1UFMA 3WE2A 2QWWA 3K70D 4GDFA 3WTUC 1XMKA 4UB8C 3BR1A 2PE5A 1WGXA 1F43A 4HA8A 1MBGA 3HL2A 4XLFA 1XSXA 4OMYA 3O9XA 3SZPA 4RDUA 1MH4A 2EV6A 2ZMEC 1WFXA 1OKRA 1O3SA 4CCMA 1ZELA 3UNGC 4JX5A 2WV0A 1S3JA 3H5AA 1SANA 4XN3A 1SFOJ 4DQ2A 5FLXK 3CCMI 1QA6A 2L1PA 1GV5A 3RYPA 4IL6C 2M34A 4WXDA 3S14J 1RETA 4IA8A 1V54H 2CQQA 1OYIA 1HBXG 3Q5FA 4GO1A 2KKOA 3ZPLA 4CZCA 1SFEA 2Z99A 3KEOA 4IPAA 2HFHA 3HG9A 4QSHA 1A5JA 5J1UA 2IS6A 2MQKA 3OIPA 2KJCA 1FSEA 3QODA 2UWMA 3U1KA 2CSOA 4BY1J 3JCUC 4CCNA 4M71A 2H6CA 3ZCOA 4KT6A 3WE3A 3FXRA 4UVBA 2JK3A 2GZWA 3M9AA 1BC7C 2MSYA 1WJ5A 3JXBC 2K40A 2R92J 1R5GA 1MJBA 2H94A 2IEKA 2MYSA 1KYZA 2DYRH 4XBFA 1NK3P 3FKIJ 2NNNA 5J1YA 2GOMA 1VQPI 1ZARA 2F4OB 3HC7A 3F6WA 4CCLA 2Z2SB 2ZBKA 4I6ZA 3KYCB 3ZMZA 2BVMA 4BGDA 2E1MB 4A3EJ 2ID3A 2XGDA 4KIBA 1FYLA 2XDVA 3E3VA 4IJAA 4OAZA 4RGSA 3OQMA 4FASD 4S05A 2N8GA 1RI7A 4EATA 2NVXJ 1R49A 2R7TA 4MLOA 2M8EA 4XRSG 2YU9J 2NVTJ 3ZQHA 1U5TB 2HWVA 2CFXA 3JAMK 4ER5A
chains in the Genus database with same CATH topology
2CU7A 1WH7A 2LKXA 1DW9A 4X4BA 3MN2A 2AWIA 3CMYA 3HOZJ 3G1OA 2JA8J 3H3VK 1PNRA 2VI6A 1POGA 5BNGA 4A3KJ 3S2HJ 2Y0SN 1MBHA 2NVYJ 4OB4A 2LVSA 2O49A 4G12A 2LLKA 1ETXA 4XRMA 4X6AJ 4UUTA 3QPLA 4DYRA 2AW6A 4A3FJ 5IPAA 2WB1N 3HGGA 5E3MA 2JCGA 1ZKGA 1JKOC 1X57A 4D5CA 1H8AC 2LYQA 2M9HA 3O8HA 1TWCJ 1ETVA 2K9QA 3Q0UA 4C2MJ 2DN0A 1QPZA 3BR2A 2CJJA 2Y9YA 2XB0X 4GHJA 2IVGA 4B1RA 4L5EA 5E3OA 4FE4A 2XGEA 4JX4A 2AXUA 2PPXA 2E2HJ 1T33A 1IRZA 4XICA 2MGQA 2LYSA 4JQDA 2ECCA 5JLWA 3KJXA 2O38A 1BL0A 1GVDA 2TRTA 1W0UA 1RR7A 1HLVA 1ZZCA 4V2GA 3HZIB 1QVUA 1UHSA 3F0CA 3SDGA 4CYCA 5F1JA 5K7ZA 3ZQIA 1O4XA 3ZOBA 1RPWA 5K7FA 2X6OA 4J19A 1R69A 5EG0B 3IH3A 3OQNA 4A3JJ 1AKHA 2XRLA 1U9OA 1ZTRA 2E2IJ 1JKPC 2HINA 4B3AA 1OCPA 2NOGA 4YG7B 2M2EA 1BDHA 2DMUA 3LOCA 1SQ8A 2JJ7A 1IC8A 3I4MJ 1JT0A 4X4IA 4IHWA 1ZAYA 1ZZ6A 2DA7A 2KT0A 9ANTA 1X58A 1B8IB 3M4OJ 2FQ4A 3C2BA 1TWAJ 1RPEL 5M3FJ 3ZQFA 1IJWC 3K7AJ 5M5YJ 2XSDC 1GV2A 2IVQA 1JUPA 1AU7A 1FJLA 4YG1A 5FLVA 1DU6A 3JRFA 1MBFA 2ECBA 1UG2A 4PU3C 1ORKA 2EBYA 4AUXA 3CLCA 1WH8A 2L0KA 2LYKA 2LYLA 3H5TA 4GFBA 3ZQGA 4J1WA 2LY9A 3BQZA 1JJ8C 3BR5A 1ENHA 1BDIA 1A6IA 3HB9A 1WIZA 2AXVA 1QQBA 5EGOA 1JH9A 3BTJA 4YG4A 2GZUA 5GPAA 1TWGJ 2L49A 3A02A 4JP0A 5GPCA 2VPRA 2WIUB 4X4HA 1LLIA 1LCDA 1ETWA 3BTLA 2GRLA 4Z5CA 2ME0A 4M3FA 4RBOA 2MW8A 1X2LA 1Y7YA 1LQCA 3SFIA 4UUSB 1NEQA 3F51A 1VF9A 3FISA 1MSEC 5K98B 4FBIA 3MKLA 2DA1A 2LYJA 1VI0A 2L7MP 3HKZN 2HSGA 3PO2J 2EH3A 5F27A 3MVPA 4FN3A 3DEWA 4A3MJ 2IAIA 1QP7A 3LSGA 3RZZA 2CUFA 1ADRA 3QWGA 3BTCA 3BG5A 3TP0A 1Z0XA 5C4JJ 3JRBA 3TP3A 4FCYA 3GTMJ 4I6RA 1X2NA 3O8GA 1MBKA 1U9NA 4X4FA 1JFTA 3RKQA 4XK4A 2PUAA 2GBYA 3PM1A 4ABZA 2DTZA 3IH2A 4MO7A 1EFAA 4IVZA 2L7ZA 2MG4A 3TEDA 3JREA 3RZDJ 1ZPQA 1FEXA 3ZHMA 3HOUJ 3M3YJ 2JA7J 4M3EA 3RQIA 5EEAA 5F04A 3TRBA 1JUMA 2ME6A 3UFDA 4X4GA 1YSEA 2O8KA 3GN5B 3CROL 1WH5A 1QP0A 4NDLA 2DJNA 2PUCA 3JRAA 2CSFA 3QPSA 3HGYA 2RAEA 2DA2A 1XG1A 2DMQA 3OOUA 2PUDA 4M3BA 1H88C 1FIPA 2LP0A 3JRDA 3R1FA 5EG0A 2BNOA 1ZZ7A 2EZLA 3BG3A 2DMTA 2R93J 2LYRA 1ETOA 1PUFB 2NVQJ 4LOCA 5IP7J 4BKXA 5EDNA 3QQ6A 3HOXJ 1DU0A 3BG9A 1W0TA 2Y9ZA 2FX0A 3S8QA 1VFCA 2EZIA 4X4EA 1PRVA 1ZZBA 2XPVA 3K2AA 3OMTA 3FIWA 1ETYA 2DA4A 5EF6A 1B8IA 2EBIA 3KZ3A 4Z5HA 4I8TA 1FIAA 1ZK8A 4M6VA 5JLXA 4BXXJ 4MCXA 1H89C 2HOSA 1WETA 4O8BA 3QQAA 1JJ6C 5M5WJ 3GTQJ 2BNNA 1IGNA 2O7OA 5C3EJ 1ZR2A 4A93J 4J1XA 2L8NA 3DNVB 4W97A 2OR1L 5C4XJ 2COBA 5FKKA 2VKVA 1IDZA 2D5VA 4JCXA 1ETQA 1JT6A 3KXAA 3A01B 2ID6A 3VPRA 4B4CA 5FJ8J 1YRNB 2FJRA 1U8BA 1RKTA 3B6AA 1EF4A 3GBFA 2JN6A 3JRGA 2JVLA 3IH4A 3QYXA 1ZVVA 2EZHA 3ZHIA 2ELKA 3BTIA 2IU7A 1OSLA 3OIOA 4QIWN 2HYJA 5C44J 2IUOA 3DCFA 3LISA 4YBAA 2R63A 2AUWA 2PIJA 2QF7A 4UUSA 4DW6A 1P7IA 3CECA 3EUSA 5IYCJ 2B63J 5FKOA 3L1PA 4X4CA 1RZRD 2ICPA 4QTRA 3BS3A 4Y52J 4A3IJ 4I6UA 1Y1VJ 2OPTA 2CROA 3GTOJ 1FTZA 4A3GJ 1LE8B 1Y1WJ 2XB5A 1U78A 1Z77A 5EZGA 5J1RA 2R5ZB 3GTJJ 4IHYA 2MEZA 2O4AA 4XIDA 2EWTA 2Y2ZA 1B72B 2X48A 3FYMA 5J3LA 3Q0WA 3H0GJ 2WUSR 3OQOA 4FTHA 1TWFJ 4Z5DA 1ZR4A 2DMPA 1MNMC 1DWKA 1D5YA 2GRMA 1RZRA 4DYCA 1WI3A 4EEFG 1UXCA 2AXZA 3NAUA 1MSFC 3S1RJ 3VK0A 1IUFA 2DA3A 2X9DA 5E3NA 4IWRA 3G1MA 4MIMA 4Z58A 3OSFA 4A3DJ 3ZKCA 3LNQA 1I50J 3G5GA 3GN5A 2KEJA 1B0NA 1UTXA 5M3MJ 1NTCA 3Q3SA 1UXDA 1ZGWA 2PUGA 1G2HA 1TWHJ 3HM5A 2B5AA 3JXDL 1L1MA 1BJZA 1GDTA 2PMZN 3JRHA 1QPIA 5F0CA 3JXCL 5GP9A 2XJ3A 1VPWA 3JRCA 1IG7A 3IV5A 4GQMA 2R0QC 2IVBA 5FKLA 2G0EA 4X4DA 3OSGA 1JTXA 1PUFA 1I6HJ 3BR3A 3LSJA 2BJCA 1ZZ9A 3BQYA 2EF8A 2IV1A 1QVTA 3QF3A 4M3DA 2XCJA 2JMWA 5F0HA 1OJLA 5IP9J 4MFDA 4PU8A 3SCHA 1F36A 4X1EA 3A03A 1OFCX 5F0FA 3G1LA 2KPJA 2CUEA 2HOTA 4NDWA 2JWTA 2L7FP 1MBJA 1POUA 3JR9A 2PUEA 2P81A 4JX6A 2AHQA 1CQTA 2GM4A 3HOYJ 4FE7A 1PERL 1GUUA 2K9NA 3PO3J 2GLOA 4Y7NJ 2LD5A 1MH3A 1IV6A 3GTPJ 3CCYA 3PXPA 2LFBA 1QRYA 3B6CA 3A01A 2WAQN 4D5FA 2KEIA 5FLMJ 2OFYA 1YRNA 3SCGA 3OP9A 1HCRA 3HOWJ 2LTPA 1LFBA 3S15J 3SCFA 1S7EA 5IOYA 4A3BJ 3TW7A 1JKQC 1UMQA 2DA6A 5FKNA 2JA6J 4MFEA 2CRGA 2CQXA 1XS9A 2R5YB 1E3OC 2O9LA 3S1NJ 4A3CJ 3B7HA 3WHBA 1XWRA 2M0CA 2Y30A 1R63A 3BR6A 1FTTA 2EZKA 4Y42A 3JRIA 1RESA 3I4NJ 3GTGJ 2PUBA 2KDZA 2XIUA 3BDNA 2OF7A 3S16J 3FK7A 1MBEA 5HODA 2JA5J 2XPWA 1HDPA 3HDDA 5F08A 1XC5A 3FK6A 5FKMA 4DZJA 4A3LJ 3MLFA 4IHXA 5A7LA 5DTDA 2XI8A 3W6VA 2VKEA 2W48A 2R7ZJ 1LE8A 1ITYA 1Y9QA 2R5ZA 4JCYA 1QQAA 1IDYA 5K7HA 1LFUP 1BW6A 5IYBJ 2E19A 3GTKJ 1P7JA 2PUFA 4D7NA 1ZQ3P 3Q0VA 1B72A 2E2JJ 3G7DA 2HOAA 4BBRJ 3FYAA 2I10A 1HF0A 4I6TA 4JYKA 3F52A 2NS7A 1JWLA 3S1QJ 3SJMA 5EZHA 3GTLJ 1PRAA 1PRUA 1ETKA 2HDDA 4XRSA 2HQ5A 1CJGA 2HXIA 3S1MJ 3RZOJ 1APLC 2VUMJ 2LR8A 4FISA 2HXOA 4BY7J 4BBSJ 2ICTA 3BR1A 2XPUA 3BD1A 2PE5A 1I3QJ 1WGXA 1F43A 1NERA 1MBGA 4DYQA 2YUSA 4C3HJ 5IP6A 3LSRA 3NARA 3S17J 4IHVA 3O9XA 4RDUA 3WHCA 1JTYA 1MH4A 1LMB3 4PU7A 4AYBN 3E7LA 4M3GA 1GT0C 1JKRC 1LCCA 4JX5A 2LK2A 2ZB9A 1R9TJ 4MCTA 4F8DA 1QP4A 5DS9A 1SANA 3GBGA 5IYDJ 1SFOJ 4CYCB 2YS9A 2LCVA 1GV5A 4IA8A 2HI3A 2M34A 3S14J 1RETA 3LSPA 1TC3C 2H8RA 4W1UA 1ZS4A 1VNDA 2KEKA 1AKHB 1OCTC 1RZSA 3CDLA 2CQQA 4I76A 1JFSA 1BW5A 3BT9A 1Q1VA 1ZUGA 4QSHA 1A5JA 5J1UA 1X2MA 2MQKA 4D7MA 1HDDC 4BY1J 2L9RA 2WV1A 1JUSA 2M8GX 1WCMJ 2DA5A 3D1NI 1K83J 3U3WA 2DMNA 2JK3A 3LFPA 2A6CA 2IBDA 2MSYA 1RIOA 5EYRA 3FMYA 3JXBC 2K40A 5M5XJ 2R92J 3HEFA 2IEKA 3IVPA 2LYPA 1WPKA 4DZPA 1NK3P 4V2FA 2FD5A 2K9SA 3FKIJ 3HOVJ 5J1YA 3CQZJ 1RKWA 4C3IJ 3ZQCA 2AO9A 1JGGA 5IOZA 2BNMA 2KZ8A 4C3JJ 4I6ZA 3F6WA 4HNVA 2R1JL 2FJ1A 4A3EJ 2ID3A 5E3LA 2TCTA 2XGDA 4AC0A 4IEJA 4Z59A 2EQRA 5EGOB 3TW6A 3S2DJ 2R5YA 1ZZ8A 3OQMA 3UKGA 4A69C 2N8GA 4YARA 4PU4C 2H1KA 3BR0A 2NVXJ 1BA5A 1AHDP 2NS8A 1NK2P 4MLOA 1K61A 4XRSG 2YU9J 2NVTJ 3HBLA 3ZQHA 2QCOA 1HOMA 1WH6A 2Y31A 2E1OA 2XGCA 1T56A 4S0HB 3ZQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU7 A;  1WH7 A;  2LKX A;  1DW9 A;  4X4B A;  3MN2 A;  2AWI A;  3CMY A;  3HOZ J;  3G1O A;  2JA8 J;  3H3V K;  1PNR A;  2VI6 A;  1POG A;  5BNG A;  4A3K J;  3S2H J;  2Y0S N;  1MBH A;  2NVY J;  4OB4 A;  2LVS A;  2O49 A;  4G12 A;  2LLK A;  1ETX A;  4XRM A;  4X6A J;  4UUT A;  3QPL A;  4DYR A;  2AW6 A;  4A3F J;  5IPA A;  2WB1 N;  3HGG A;  5E3M A;  2JCG A;  1ZKG A;  1JKO C;  1X57 A;  4D5C A;  1H8A C;  2LYQ A;  2M9H A;  3O8H A;  1TWC J;  1ETV A;  2K9Q A;  3Q0U A;  4C2M J;  2DN0 A;  1QPZ A;  3BR2 A;  2CJJ A;  2Y9Y A;  2XB0 X;  4GHJ A;  2IVG A;  4B1R A;  4L5E A;  5E3O A;  4FE4 A;  2XGE A;  4JX4 A;  2AXU A;  2PPX A;  2E2H J;  1T33 A;  1IRZ A;  4XIC A;  2MGQ A;  2LYS A;  4JQD A;  2ECC A;  5JLW A;  3KJX A;  2O38 A;  1BL0 A;  1GVD A;  2TRT A;  1W0U A;  1RR7 A;  1HLV A;  1ZZC A;  4V2G A;  3HZI B;  1QVU A;  1UHS A;  3F0C A;  3SDG A;  4CYC A;  5F1J A;  5K7Z A;  3ZQI A;  1O4X A;  3ZOB A;  1RPW A;  5K7F A;  2X6O A;  4J19 A;  1R69 A;  5EG0 B;  3IH3 A;  3OQN A;  4A3J J;  1AKH A;  2XRL A;  1U9O A;  1ZTR A;  2E2I J;  1JKP C;  2HIN A;  4B3A A;  1OCP A;  2NOG A;  4YG7 B;  2M2E A;  1BDH A;  2DMU A;  3LOC A;  1SQ8 A;  2JJ7 A;  1IC8 A;  3I4M J;  1JT0 A;  4X4I A;  4IHW A;  1ZAY A;  1ZZ6 A;  2DA7 A;  2KT0 A;  9ANT A;  1X58 A;  1B8I B;  3M4O J;  2FQ4 A;  3C2B A;  1TWA J;  1RPE L;  5M3F J;  3ZQF A;  1IJW C;  3K7A J;  5M5Y J;  2XSD C;  1GV2 A;  2IVQ A;  1JUP A;  1AU7 A;  1FJL A;  4YG1 A;  5FLV A;  1DU6 A;  3JRF A;  1MBF A;  2ECB A;  1UG2 A;  4PU3 C;  1ORK A;  2EBY A;  4AUX A;  3CLC A;  1WH8 A;  2L0K A;  2LYK A;  2LYL A;  3H5T A;  4GFB A;  3ZQG A;  4J1W A;  2LY9 A;  3BQZ A;  1JJ8 C;  3BR5 A;  1ENH A;  1BDI A;  1A6I A;  3HB9 A;  1WIZ A;  2AXV A;  1QQB A;  5EGO A;  1JH9 A;  3BTJ A;  4YG4 A;  2GZU A;  5GPA A;  1TWG J;  2L49 A;  3A02 A;  4JP0 A;  5GPC A;  2VPR A;  2WIU B;  4X4H A;  1LLI A;  1LCD A;  1ETW A;  3BTL A;  2GRL A;  4Z5C A;  2ME0 A;  4M3F A;  4RBO A;  2MW8 A;  1X2L A;  1Y7Y A;  1LQC A;  3SFI A;  4UUS B;  1NEQ A;  3F51 A;  1VF9 A;  3FIS A;  1MSE C;  5K98 B;  4FBI A;  3MKL A;  2DA1 A;  2LYJ A;  1VI0 A;  2L7M P;  3HKZ N;  2HSG A;  3PO2 J;  2EH3 A;  5F27 A;  3MVP A;  4FN3 A;  3DEW A;  4A3M J;  2IAI A;  1QP7 A;  3LSG A;  3RZZ A;  2CUF A;  1ADR A;  3QWG A;  3BTC A;  3BG5 A;  3TP0 A;  1Z0X A;  5C4J J;  3JRB A;  3TP3 A;  4FCY A;  3GTM J;  4I6R A;  1X2N A;  3O8G A;  1MBK A;  1U9N A;  4X4F A;  1JFT A;  3RKQ A;  4XK4 A;  2PUA A;  2GBY A;  3PM1 A;  4ABZ A;  2DTZ A;  3IH2 A;  4MO7 A;  1EFA A;  4IVZ A;  2L7Z A;  2MG4 A;  3TED A;  3JRE A;  3RZD J;  1ZPQ A;  1FEX A;  3ZHM A;  3HOU J;  3M3Y J;  2JA7 J;  4M3E A;  3RQI A;  5EEA A;  5F04 A;  3TRB A;  1JUM A;  2ME6 A;  3UFD A;  4X4G A;  1YSE A;  2O8K A;  3GN5 B;  3CRO L;  1WH5 A;  1QP0 A;  4NDL A;  2DJN A;  2PUC A;  3JRA A;  2CSF A;  3QPS A;  3HGY A;  2RAE A;  2DA2 A;  1XG1 A;  2DMQ A;  3OOU A;  2PUD A;  4M3B A;  1H88 C;  1FIP A;  2LP0 A;  3JRD A;  3R1F A;  5EG0 A;  2BNO A;  1ZZ7 A;  2EZL A;  3BG3 A;  2DMT A;  2R93 J;  2LYR A;  1ETO A;  1PUF B;  2NVQ J;  4LOC A;  5IP7 J;  4BKX A;  5EDN A;  3QQ6 A;  3HOX J;  1DU0 A;  3BG9 A;  1W0T A;  2Y9Z A;  2FX0 A;  3S8Q A;  1VFC A;  2EZI A;  4X4E A;  1PRV A;  1ZZB A;  2XPV A;  3K2A A;  3OMT A;  3FIW A;  1ETY A;  2DA4 A;  5EF6 A;  1B8I A;  2EBI A;  3KZ3 A;  4Z5H A;  4I8T A;  1FIA A;  1ZK8 A;  4M6V A;  5JLX A;  4BXX J;  4MCX A;  1H89 C;  2HOS A;  1WET A;  4O8B A;  3QQA A;  1JJ6 C;  5M5W J;  3GTQ J;  2BNN A;  1IGN A;  2O7O A;  5C3E J;  1ZR2 A;  4A93 J;  4J1X A;  2L8N A;  3DNV B;  4W97 A;  2OR1 L;  5C4X J;  2COB A;  5FKK A;  2VKV A;  1IDZ A;  2D5V A;  4JCX A;  1ETQ A;  1JT6 A;  3KXA A;  3A01 B;  2ID6 A;  3VPR A;  4B4C A;  5FJ8 J;  1YRN B;  2FJR A;  1U8B A;  1RKT A;  3B6A A;  1EF4 A;  3GBF A;  2JN6 A;  3JRG A;  2JVL A;  3IH4 A;  3QYX A;  1ZVV A;  2EZH A;  3ZHI A;  2ELK A;  3BTI A;  2IU7 A;  1OSL A;  3OIO A;  4QIW N;  2HYJ A;  5C44 J;  2IUO A;  3DCF A;  3LIS A;  4YBA A;  2R63 A;  2AUW A;  2PIJ A;  2QF7 A;  4UUS A;  4DW6 A;  1P7I A;  3CEC A;  3EUS A;  5IYC J;  2B63 J;  5FKO A;  3L1P A;  4X4C A;  1RZR D;  2ICP A;  4QTR A;  3BS3 A;  4Y52 J;  4A3I J;  4I6U A;  1Y1V J;  2OPT A;  2CRO A;  3GTO J;  1FTZ A;  4A3G J;  1LE8 B;  1Y1W J;  2XB5 A;  1U78 A;  1Z77 A;  5EZG A;  5J1R A;  2R5Z B;  3GTJ J;  4IHY A;  2MEZ A;  2O4A A;  4XID A;  2EWT A;  2Y2Z A;  1B72 B;  2X48 A;  3FYM A;  5J3L A;  3Q0W A;  3H0G J;  2WUS R;  3OQO A;  4FTH A;  1TWF J;  4Z5D A;  1ZR4 A;  2DMP A;  1MNM C;  1DWK A;  1D5Y A;  2GRM A;  1RZR A;  4DYC A;  1WI3 A;  4EEF G;  1UXC A;  2AXZ A;  3NAU A;  1MSF C;  3S1R J;  3VK0 A;  1IUF A;  2DA3 A;  2X9D A;  5E3N A;  4IWR A;  3G1M A;  4MIM A;  4Z58 A;  3OSF A;  4A3D J;  3ZKC A;  3LNQ A;  1I50 J;  3G5G A;  3GN5 A;  2KEJ A;  1B0N A;  1UTX A;  5M3M J;  1NTC A;  3Q3S A;  1UXD A;  1ZGW A;  2PUG A;  1G2H A;  1TWH J;  3HM5 A;  2B5A A;  3JXD L;  1L1M A;  1BJZ A;  1GDT A;  2PMZ N;  3JRH A;  1QPI A;  5F0C A;  3JXC L;  5GP9 A;  2XJ3 A;  1VPW A;  3JRC A;  1IG7 A;  3IV5 A;  4GQM A;  2R0Q C;  2IVB A;  5FKL A;  2G0E A;  4X4D A;  3OSG A;  1JTX A;  1PUF A;  1I6H J;  3BR3 A;  3LSJ A;  2BJC A;  1ZZ9 A;  3BQY A;  2EF8 A;  2IV1 A;  1QVT A;  3QF3 A;  4M3D A;  2XCJ A;  2JMW A;  5F0H A;  1OJL A;  5IP9 J;  4MFD A;  4PU8 A;  3SCH A;  1F36 A;  4X1E A;  3A03 A;  1OFC X;  5F0F A;  3G1L A;  2KPJ A;  2CUE A;  2HOT A;  4NDW A;  2JWT A;  2L7F P;  1MBJ A;  1POU A;  3JR9 A;  2PUE A;  2P81 A;  4JX6 A;  2AHQ A;  1CQT A;  2GM4 A;  3HOY J;  4FE7 A;  1PER L;  1GUU A;  2K9N A;  3PO3 J;  2GLO A;  4Y7N J;  2LD5 A;  1MH3 A;  1IV6 A;  3GTP J;  3CCY A;  3PXP A;  2LFB A;  1QRY A;  3B6C A;  3A01 A;  2WAQ N;  4D5F A;  2KEI A;  5FLM J;  2OFY A;  1YRN A;  3SCG A;  3OP9 A;  1HCR A;  3HOW J;  2LTP A;  1LFB A;  3S15 J;  3SCF A;  1S7E A;  5IOY A;  4A3B J;  3TW7 A;  1JKQ C;  1UMQ A;  2DA6 A;  5FKN A;  2JA6 J;  4MFE A;  2CRG A;  2CQX A;  1XS9 A;  2R5Y B;  1E3O C;  2O9L A;  3S1N J;  4A3C J;  3B7H A;  3WHB A;  1XWR A;  2M0C A;  2Y30 A;  1R63 A;  3BR6 A;  1FTT A;  2EZK A;  4Y42 A;  3JRI A;  1RES A;  3I4N J;  3GTG J;  2PUB A;  2KDZ A;  2XIU A;  3BDN A;  2OF7 A;  3S16 J;  3FK7 A;  1MBE A;  5HOD A;  2JA5 J;  2XPW A;  1HDP A;  3HDD A;  5F08 A;  1XC5 A;  3FK6 A;  5FKM A;  4DZJ A;  4A3L J;  3MLF A;  4IHX A;  5A7L A;  5DTD A;  2XI8 A;  3W6V A;  2VKE A;  2W48 A;  2R7Z J;  1LE8 A;  1ITY A;  1Y9Q A;  2R5Z A;  4JCY A;  1QQA A;  1IDY A;  5K7H A;  1LFU P;  1BW6 A;  5IYB J;  2E19 A;  3GTK J;  1P7J A;  2PUF A;  4D7N A;  1ZQ3 P;  3Q0V A;  1B72 A;  2E2J J;  3G7D A;  2HOA A;  4BBR J;  3FYA A;  2I10 A;  1HF0 A;  4I6T A;  4JYK A;  3F52 A;  2NS7 A;  1JWL A;  3S1Q J;  3SJM A;  5EZH A;  3GTL J;  1PRA A;  1PRU A;  1ETK A;  2HDD A;  4XRS A;  2HQ5 A;  1CJG A;  2HXI A;  3S1M J;  3RZO J;  1APL C;  2VUM J;  2LR8 A;  4FIS A;  2HXO A;  4BY7 J;  4BBS J;  2ICT A;  3BR1 A;  2XPU A;  3BD1 A;  2PE5 A;  1I3Q J;  1WGX A;  1F43 A;  1NER A;  1MBG A;  4DYQ A;  2YUS A;  4C3H J;  5IP6 A;  3LSR A;  3NAR A;  3S17 J;  4IHV A;  3O9X A;  4RDU A;  3WHC A;  1JTY A;  1MH4 A;  1LMB 3;  4PU7 A;  4AYB N;  3E7L A;  4M3G A;  1GT0 C;  1JKR C;  1LCC A;  4JX5 A;  2LK2 A;  2ZB9 A;  1R9T J;  4MCT A;  4F8D A;  1QP4 A;  5DS9 A;  1SAN A;  3GBG A;  5IYD J;  1SFO J;  4CYC B;  2YS9 A;  2LCV A;  1GV5 A;  4IA8 A;  2HI3 A;  2M34 A;  3S14 J;  1RET A;  3LSP A;  1TC3 C;  2H8R A;  4W1U A;  1ZS4 A;  1VND A;  2KEK A;  1AKH B;  1OCT C;  1RZS A;  3CDL A;  2CQQ A;  4I76 A;  1JFS A;  1BW5 A;  3BT9 A;  1Q1V A;  1ZUG A;  4QSH A;  1A5J A;  5J1U A;  1X2M A;  2MQK A;  4D7M A;  1HDD C;  4BY1 J;  2L9R A;  2WV1 A;  1JUS A;  2M8G X;  1WCM J;  2DA5 A;  3D1N I;  1K83 J;  3U3W A;  2DMN A;  2JK3 A;  3LFP A;  2A6C A;  2IBD A;  2MSY A;  1RIO A;  5EYR A;  3FMY A;  3JXB C;  2K40 A;  5M5X J;  2R92 J;  3HEF A;  2IEK A;  3IVP A;  2LYP A;  1WPK A;  4DZP A;  1NK3 P;  4V2F A;  2FD5 A;  2K9S A;  3FKI J;  3HOV J;  5J1Y A;  3CQZ J;  1RKW A;  4C3I J;  3ZQC A;  2AO9 A;  1JGG A;  5IOZ A;  2BNM A;  2KZ8 A;  4C3J J;  4I6Z A;  3F6W A;  4HNV A;  2R1J L;  2FJ1 A;  4A3E J;  2ID3 A;  5E3L A;  2TCT A;  2XGD A;  4AC0 A;  4IEJ A;  4Z59 A;  2EQR A;  5EGO B;  3TW6 A;  3S2D J;  2R5Y A;  1ZZ8 A;  3OQM A;  3UKG A;  4A69 C;  2N8G A;  4YAR A;  4PU4 C;  2H1K A;  3BR0 A;  2NVX J;  1BA5 A;  1AHD P;  2NS8 A;  1NK2 P;  4MLO A;  1K61 A;  4XRS G;  2YU9 J;  2NVT J;  3HBL A;  3ZQH A;  2QCO A;  1HOM A;  1WH6 A;  2Y31 A;  2E1O A;  2XGC A;  1T56 A;  4S0H B;  3ZQL A; 
#chains in the Genus database with same CATH topology
 3Q9S A;  3R09 A;  1X1B A;  2CU7 A;  3GO5 A;  3OYE A;  2LKX A;  4QLC U;  3MN2 A;  4IOA F;  4G9Y A;  3CMY A;  2AQE A;  2ELH A;  2X6Y A;  2V1U A;  1PNR A;  5BNG A;  3QOP A;  1O3Q A;  3QP6 A;  1ZN2 A;  1HST A;  3GME A;  4G12 A;  3JAM Z;  5JVG F;  4XRM A;  1PJR A;  1WKM A;  2RKH A;  4UUT A;  5GTI C;  4GRI A;  5D8K B;  4G7Z F;  1TL8 A;  2AW6 A;  3TEP A;  2DT6 A;  5E3M A;  1X57 A;  2CO5 A;  4D5C A;  1H8A C;  2M9H A;  3GLX A;  4OIO F;  3O8H A;  3E0J B;  1LJ9 A;  3QYB A;  2CJJ A;  3ABL H;  2IVG A;  2IS4 A;  4B1R A;  5E3O A;  4FE4 A;  1HXD A;  3KYD B;  4LIT A;  4EKG A;  1T33 A;  4A0Y A;  1EV7 A;  1LEA A;  3BJ6 A;  3L7W A;  3S3O A;  2VN2 A;  3KLO A;  2R7R A;  3T8T A;  1W0U A;  1TLH B;  1HLV A;  1ZZC A;  2FNA A;  2OAZ A;  5J4Y A;  2VT3 A;  2W4S A;  3F0C A;  5DUK A;  3SDG A;  5ED4 A;  1K6Y A;  1O57 A;  1OIS A;  5K5O A;  2X6O A;  3D5S C;  3LQX A;  2FBH A;  3TL4 X;  5HDN A;  4EQQ A;  1ZRE A;  2XRL A;  4XN0 A;  3ZMU A;  2DCE A;  1VQ7 I;  2CW8 A;  5E20 A;  2BY0 A;  4BHP A;  5CVV A;  2HIN A;  3F3X A;  5DSX A;  1OCP A;  2LY2 A;  4ZZD A;  1YFH A;  4NHJ A;  2UV1 A;  1SQ8 A;  5D5W B;  2BBY A;  1IXC A;  4M6X A;  4RAF A;  1ZRF A;  1ZAO A;  1UHW A;  2VJ4 A;  2E7X A;  1FYK A;  2W57 A;  3M4O J;  2WC2 A;  3IUO A;  1RPE L;  2ZJR F;  5M3F J;  3CP2 A;  3ZQF A;  1XGM A;  3KIO A;  2XSD C;  5LGN A;  2IVQ A;  2E5Z A;  1AU7 A;  1FJL A;  3S3N A;  3JRF A;  1MBF A;  3NRV A;  2F5E A;  2W85 A;  2LYK A;  5ILU A;  4GFB A;  3P9K A;  1IUY A;  4LJZ F;  3BR5 A;  4H0E A;  1R5I D;  1BDI A;  4RB1 A;  3HB9 A;  3DEU A;  1YLF A;  2ICW G;  4F3Q A;  2GIZ A;  1TWG J;  4DIQ A;  2CH0 A;  2JQE A;  1SC7 A;  3VOD A;  3I9V 2;  3K1P A;  1KU9 A;  3N4M A;  1LCD A;  1ETW A;  3BTL A;  3OYJ A;  4ENM A;  2DXI A;  2GRL A;  4XSX F;  2ME0 A;  1S6L A;  5L3E A;  1FMV A;  4G7H F;  1U5T A;  1ZLK A;  4UNO A;  1LQC A;  2KIS A;  2JPB A;  2IRF G;  2HR3 A;  3GZ6 A;  1MIJ A;  3TO9 A;  1IRG A;  2GXG A;  1VI0 A;  3MQ0 A;  4UV8 A;  3B02 A;  1WI9 A;  4A3M J;  2Y0M A;  5B1B H;  2QVO A;  3LSI A;  3HKZ A;  5TRD A;  3FM5 A;  4N4N B;  2DPU A;  2CUF A;  2CV2 A;  2EB7 A;  2JQ7 A;  4FCY A;  1N77 A;  3WGI A;  4I7H A;  3ECO A;  4X4F A;  1JFT A;  3GFJ A;  2CG4 A;  2XAJ A;  3OYM A;  2PUA A;  2OD5 A;  3T5X A;  4ABZ A;  4BQN A;  2DTZ A;  3IH2 A;  5AIP A;  3K4L A;  3TED A;  4XMY A;  3DU5 A;  3A4C A;  1FEX A;  4KFC A;  2QEX I;  2JA7 J;  3HRM A;  4FQG A;  3SDB A;  5L3C A;  5EEA A;  5LGU A;  3TRB A;  3L9F A;  2DTR A;  2O8K A;  3BDD A;  3KE2 A;  4NDL A;  4ZJZ A;  2VKD A;  3HGY A;  4RS8 A;  2DA2 A;  2PUD A;  1K4S A;  1QB2 A;  2Z9O A;  2GQQ A;  4LK1 F;  2WY7 Q;  1H88 C;  3CME I;  2LP0 A;  2ZME A;  2BNO A;  1AA7 A;  4CIC A;  1UCR A;  1B59 A;  2DMT A;  4XON A;  5FRO A;  2R93 J;  3DLA A;  3AL0 C;  1Z7U A;  3I55 I;  5IP7 J;  3QQ6 A;  1XGS A;  4EV0 A;  1A36 A;  1DU0 A;  1Y39 A;  2BY3 A;  5JR3 A;  2PJR B;  2R7F A;  3DF8 A;  3N97 A;  3DXJ F;  1VFC A;  2ZXJ A;  3WU2 C;  1DP7 P;  3COA C;  4ZC3 A;  5E17 F;  3FIW A;  4I8T A;  4HYE A;  4CO8 A;  2EFQ A;  2EBI A;  3HRU A;  3KZ3 A;  1ZLJ A;  2DO7 A;  3F8F A;  1ZK8 A;  2BE5 F;  1K4T A;  3PIP F;  4MCX A;  2HPM A;  2HOS A;  2CYY A;  2O6G E;  2O7O A;  1ZR2 A;  4Q4Z F;  4A93 J;  2V7F A;  2XXQ A;  2OR1 L;  2RVC A;  4PJJ A;  3CUQ B;  2COB A;  3E5U A;  5FKK A;  4HBL A;  2D5V A;  1TQI A;  2VEO A;  1P4W A;  2ID6 A;  3VSL A;  4B4C A;  3F22 A;  2DK5 A;  4RMN A;  2FJR A;  2P6S A;  2EFN A;  3ZMD A;  1RKT A;  3GWZ A;  1LB2 A;  1U8R A;  2JZY A;  2JVL A;  5GAH i;  3QYX A;  3OYD A;  2ZNZ A;  3ELK A;  2ELK A;  2K4B A;  2KFD A;  4PFO A;  3RKY A;  2VBY A;  2AUW A;  2PIJ A;  3SZT A;  3IP4 B;  1R1V A;  4HRI A;  4KUM A;  1ZHF A;  3CEC A;  4OU0 A;  4FT8 A;  2Z1D A;  5IYC J;  2V1X A;  1ZGA A;  2B63 J;  3ZN1 A;  2L9N A;  2ICP A;  3DPL C;  3ZP5 A;  4A3I J;  1Y1V J;  4A3G J;  4HZF A;  4L5I A;  3A0B C;  4XLA A;  3MEX A;  1Y1W J;  2J5P A;  1Z77 A;  5F1R A;  5J1R A;  4IHY A;  2RRE A;  2VAS A;  1WWX A;  2HVQ A;  2F4I A;  1H9G A;  4XID A;  2Y2Z A;  3OS1 A;  2LNB A;  5J3L A;  4I2O A;  4E7J A;  3HSF A;  3RYR A;  3NRO A;  3TOA A;  3T8R A;  1VQN I;  2DMP A;  3FXJ A;  1RZR A;  1WI3 A;  2I8D A;  3WTT C;  1YJ9 I;  1MSF C;  3VEP A;  1K6O A;  1TW2 A;  4IWR A;  4XR6 A;  4U0Y A;  1HKS A;  2KIQ A;  4Z58 A;  3ZKC A;  3OR1 C;  3R60 A;  1IN5 A;  3VSK A;  2K3P A;  1HSJ A;  1H9T A;  2EIJ H;  3JW4 A;  1MGT A;  3KCC A;  4KIC A;  3OYI A;  3CCR I;  4RM3 A;  2B5A A;  5H6R A;  2XV4 S;  4BYY A;  2V79 A;  1T6S A;  2PMZ N;  2W84 A;  2HFZ A;  3P7N A;  2XJ3 A;  2OA4 A;  1IG7 A;  3IV5 A;  1S8N A;  1D0Y A;  3QOE A;  5FKL A;  3M1C A;  3C3W A;  3OSG A;  2A07 F;  3FM3 A;  1I6H J;  2X0L A;  3QF3 A;  2EF8 A;  4XLH A;  4MFD A;  1DUX C;  2PJR A;  1F36 A;  4X1E A;  3CCE I;  3ZPX A;  1PP8 F;  5F0F A;  2KPJ A;  4BXU A;  2JUC A;  3M8J A;  3OS0 A;  3MD2 A;  1I6X A;  2DOF A;  2P81 A;  2AHQ A;  3F6O A;  5KNL A;  3OYF A;  1UAA A;  2BGC A;  4ETS A;  2P7C B;  1AOY A;  3AAF A;  1PER L;  2LKS A;  2M4K A;  2CW7 A;  2K4J A;  4JK1 X;  4HG2 A;  1IV6 A;  4ZYH A;  4E7L A;  2BHZ A;  3CJQ B;  2G7H A;  4U7B A;  3CCY A;  2LFB A;  2ESH A;  4O3M A;  4RB2 C;  4EJW A;  3LMM A;  4HQM A;  4R1H A;  4D5F A;  1YIO A;  3X2Q H;  2MBF A;  4E70 A;  3SCG A;  4M73 A;  3RPU D;  3B73 A;  1Z7L A;  3SCF A;  1S7E A;  3KZY A;  4A3B J;  2WAD A;  3GLL A;  4KIF A;  1VQM I;  4ENJ A;  2CQX A;  3CC2 I;  1T95 A;  2LG4 A;  2VJI A;  2RNG A;  4AIK A;  2DBB A;  2O9L A;  2Q0O A;  4G6T B;  4PFP A;  2BHY A;  4Y3O A;  5B1A H;  3FX3 A;  3B7H A;  1Y56 A;  2EZK A;  4UVA A;  3JRI A;  3GTG J;  2LY1 A;  2LBF B;  1HA8 A;  4YEJ A;  3S16 J;  3H92 A;  1XGN A;  3QPT A;  2XPW A;  1ULY A;  2YU3 A;  3FK6 A;  5FKM A;  4DZJ A;  4A3L J;  2V9K A;  2P4W A;  2Z3Y A;  5A7L A;  2LF8 A;  2VKE A;  4BE0 A;  3LFU A;  2OTJ I;  4JCY A;  1QQA A;  4WXH A;  5IYB J;  3L2V A;  3GTK J;  3REO A;  4KNY A;  3LWF A;  4D7N A;  1JXS A;  4ZTF A;  3R0J A;  1MND A;  4YFX F;  3E97 A;  2ZNY A;  1XSD A;  2I10 A;  1ACI A;  1HF0 A;  4PSX A;  1AWC A;  1YS6 A;  3F52 A;  1XN7 A;  2NS7 A;  1JWL A;  3S1Q J;  3SJM A;  5EZH A;  4B44 A;  5B3S H;  3GTL J;  5E79 C;  1PRU A;  3W6K B;  1PRA A;  3QU3 A;  4XRS A;  1CJG A;  4DE8 A;  1T2K A;  2VUM J;  1YYV A;  4FIS A;  2HXO A;  2VB6 A;  2FOW A;  3G73 A;  2XPU A;  3GFL A;  1NER A;  3S2W A;  3JTG A;  4DYQ A;  2A68 F;  2L54 A;  2X6X A;  5D6E A;  2H27 A;  2ISZ A;  3R0A A;  1LMB 3;  2PXD A;  1EH8 A;  3ZN0 A;  3CCQ I;  1SFK A;  1SVO A;  2ZB9 A;  4MCT A;  2M4G A;  4F8D A;  5JFR A;  3GBG A;  4BU2 A;  1J59 A;  2M7A A;  4E7K A;  3V8L A;  2BV6 A;  4BQA A;  2ODR D;  3EYI A;  4W1U A;  4CSW A;  1AKH B;  4OMZ A;  4I02 A;  4I76 A;  3VB2 A;  2LLV A;  1S5L C;  1ZUG A;  1XCB A;  3GYH X;  4V19 K;  3HRT A;  2XAF A;  3E6C C;  3PJR A;  4IO9 F;  2L9R A;  3BCB A;  5E18 F;  3R61 A;  2DA5 A;  5DT2 A;  3U3W A;  2F4M B;  1D1A A;  1G6N A;  4UHT A;  4D0P A;  2A05 A;  2A6C A;  2IBD A;  1RIO A;  3HZJ A;  2YBD A;  1KA8 A;  5CYV A;  1XB4 A;  3DU6 A;  3EUK L;  3GZC A;  3G2B A;  5L3G A;  2DU9 A;  3HOT A;  3NZL A;  2QGU A;  3DEE A;  4V2F A;  4CDG A;  3KET A;  2JT1 A;  3CQZ J;  2F5C A;  2K7L A;  5IOZ A;  4IX7 A;  2KZ8 A;  1A35 A;  3DKX A;  1ZYR F;  2COM A;  1MMA A;  1SVL A;  3F8B A;  2VKH A;  2R1J L;  2FJ1 A;  4BL0 B;  1OCR H;  4AC0 A;  2M3A A;  2EQR A;  3GFM A;  1KGS A;  1SVM A;  2ZXI A;  2VE9 A;  4II2 A;  4RA2 A;  5KVR A;  1ZZ8 A;  2ZJ2 A;  2D45 A;  3FXL A;  4IQ4 A;  3V8K A;  2IGK A;  2BXZ A;  1LUJ B;  4YAR A;  2IXS A;  3KFW X;  1BA5 A;  2NS8 A;  2ZJP F;  2BYV E;  2STW A;  3K1N A;  3V4G A;  2LBF A;  3DPU A;  2ZFU A;  4JBA A;  2PLY A;  2VQC A;  2QCO A;  1ZG5 A;  1WH6 A;  3RIR A;  1X1P A;  4I0B A;  1EKE A;  3ZQL A;  2E1M C;  4I98 B;  1DW9 A;  2WBM A;  4A2U A;  2VE8 A;  1LPQ A;  3VWS A;  2R4G A;  2VBX A;  2YSR A;  5LRR A;  5K5R A;  2R7D A;  2QEN A;  1KQ0 A;  2RGV A;  5FRN A;  3K10 A;  2L02 A;  4PJM A;  5LLQ A;  2VON A;  1J0R A;  3HOZ J;  3H3V K;  1P6R A;  1POG A;  5HOO A;  3S2H J;  5DM7 F;  3HRS A;  4A5N A;  2M5W A;  4IVN A;  4OB4 A;  4ZH4 F;  3OMY A;  2XF7 A;  4KMF A;  3G4S I;  2F5D A;  2WB1 N;  3HGG A;  1KQ8 A;  4ESB A;  5GAG i;  3R6S A;  4FET A;  5FFZ A;  4H4K C;  2K9Q A;  4HAM A;  2DN0 A;  1YS7 A;  2L4M A;  3BR2 A;  2Y9Y A;  2XB0 X;  4GHJ A;  4JX4 A;  2PPX A;  2HYG D;  4OWR B;  2XKP A;  5J6X A;  3LFK A;  2MGQ A;  2LYS A;  4JQD A;  4P9U A;  4JOM A;  1MDM B;  5HLT A;  3KP6 A;  5JLW A;  3KJX A;  3KP7 A;  2IPQ X;  2TRT A;  1W36 C;  4QWQ A;  3RCO A;  2F6C A;  4YIR X;  2PXU A;  2GOX B;  4V2G A;  2E35 A;  2JSC A;  5K7Z A;  3ZQI A;  4E6K G;  2A3S A;  3ZOB A;  3H5N A;  1NG7 A;  3OQN A;  3RI4 A;  3FDY A;  1AKH A;  2AXL A;  3ISP A;  4MGR A;  1XSV A;  4B3A A;  3RJP A;  4EM0 B;  4YG7 B;  2DQL A;  5DM6 F;  4G6Q A;  2DMU A;  3I4M J;  1K78 B;  1R00 A;  4IHW A;  1S72 I;  3K0L A;  5J40 A;  2KT0 A;  1TQM A;  2B9S A;  1W7P B;  3R4K A;  3KP3 A;  4LLL A;  2W82 A;  5KK1 A;  1J09 A;  2EV5 A;  1T98 A;  2L4A A;  2JUG A;  4EMS A;  1O3T A;  2ZJQ F;  1GV2 A;  1O3R A;  1JUP A;  4BXF A;  2EFW A;  5HLI A;  4L0Y B;  4J01 A;  1UG2 A;  3A0H C;  4AUX A;  3FXQ A;  5CLS A;  3OYC A;  2LC2 A;  2PFB A;  1FYM A;  1OMI A;  2X4H A;  2FSW A;  2MFZ A;  3HXL A;  3BZC A;  2KRC A;  3ZQG A;  4J1W A;  3BQZ A;  5KAI C;  2J7W A;  3WTS C;  3NEU A;  4HEA 2;  2ZFW A;  5ICE A;  3J7A Y;  4YIF A;  4ER0 A;  3CCS I;  1YIT I;  5FLX Z;  4BJT A;  1WJB A;  2R7Q A;  2HKO A;  4YG4 A;  5GPA A;  4ZZL A;  1Z6T A;  2VPR A;  1XTA A;  1LLI A;  2VJJ A;  2EFO A;  4HX8 A;  4M3F A;  1OLT A;  2MW8 A;  1Y7Y A;  2LNM A;  5FO5 A;  4RGU A;  1NEQ A;  3LAJ A;  4XKB A;  5EEH A;  1RR8 C;  3F51 A;  3KEQ A;  1W36 D;  1DGR M;  3MKL A;  2DA1 A;  2YX7 A;  2H1L A;  3A2K A;  2LYJ A;  3V7R A;  2PXL A;  1UB9 A;  1FP1 D;  3HKZ N;  3MVP A;  1R4N B;  5E1X A;  4ENK A;  1Z9C A;  3DEW A;  4PJ0 C;  2IAI A;  1QP7 A;  3ERM A;  4BE2 A;  2BZT A;  1ADR A;  1LFP A;  1ZG1 A;  2YR2 A;  3QWG A;  1Z0X A;  5C4J J;  3TP3 A;  4PGH A;  4I6R A;  1X2N A;  4NB5 A;  1MBK A;  3VDX A;  4LB5 A;  1P4X A;  2HVR A;  2X6W A;  2PXB A;  4XK4 A;  1ERD A;  5ICG A;  2ZC2 A;  5HS9 A;  2FUG 2;  3KZZ A;  3A9Z A;  2LF7 A;  3AG3 H;  1BR4 A;  3JRE A;  4CHU A;  2XIG A;  4UXN A;  1W1W E;  3E6M A;  3ZHM A;  1B9N A;  2VL8 A;  5DTR A;  4M3E A;  5F04 A;  2K9L A;  3I3L A;  2DOE A;  1YI2 I;  1JUM A;  4U87 A;  1MDM A;  2X85 A;  2IW5 A;  4XOR A;  2V1D A;  1R36 A;  2DJN A;  3CJT B;  4BEH B;  3GZD A;  3QPS A;  3FMR A;  4LLN A;  2FQ3 A;  3K4C A;  3TMO A;  3UWP A;  4GYG A;  3OOU A;  2D2W A;  3AG1 H;  4M3B A;  3HTS B;  1FIP A;  3WTW C;  3OYL A;  2WB1 A;  5HS7 A;  3I58 A;  1W5S A;  3ZMS A;  2ZCW A;  1SAX A;  1PDN C;  4RM2 A;  1VQL I;  2HZD A;  3M1E A;  5EDN A;  1MKM A;  1Y6I A;  2A6E F;  1YW8 A;  2Y69 H;  2K85 A;  4WVL A;  2Z16 A;  1IF1 A;  5HVQ C;  2STT A;  3GUU A;  1K78 A;  2FX0 A;  3I53 A;  3S8Q A;  3KP2 A;  3QAH A;  2F2E A;  1G59 A;  1QNT A;  1ODD A;  1ON2 A;  3K2A A;  1W7P A;  1XMA A;  4ER7 A;  4B47 A;  4Z5H A;  2A5W A;  4XLP F;  2XXP A;  1IN6 A;  2KZV A;  3ABT A;  4S04 A;  4BXX J;  3FXM A;  3A9X A;  1BI1 A;  3M7G A;  1WET A;  4O8B A;  3QQA A;  4AU7 A;  3P5J A;  1N75 A;  1L0O C;  3DP7 A;  4IHS A;  1IGN A;  2GXA A;  2PQ8 A;  2K27 A;  2K9M A;  3DNV B;  5EJC A;  4CCK A;  2HQA A;  4NBQ A;  4JCX A;  1ETQ A;  1JT6 A;  2R7X A;  4OIN F;  4QPO A;  4BNC A;  3BWG A;  2DT7 B;  3V7S A;  3V42 A;  1U8B A;  3DKW A;  2J7U A;  2JA2 A;  2XUB A;  5LBQ A;  3IH4 A;  2FBI A;  3H3U A;  1ZVV A;  4Y17 A;  1J5Y A;  3WTV C;  2XRN A;  2IVM A;  3BTI A;  4KIG A;  3CUQ C;  2HYJ A;  3LSH A;  3DCF A;  3LIS A;  2DOA A;  4ZTJ A;  2VQG A;  1MJA A;  2QF7 A;  2FMY A;  3NQO A;  1V5G A;  4KDP A;  1KZH A;  5CVI A;  3SR4 A;  1DUL A;  3L1P A;  1RZR D;  4QTR A;  3BS3 A;  2OPT A;  3GTO J;  3QU6 A;  3MZY A;  4I09 A;  1X3W B;  3DTK A;  3I59 B;  2XHK A;  1RRJ A;  1U78 A;  2R5Z B;  4Y13 A;  1I3A A;  1SD7 A;  2AQF A;  2QSH X;  1Z1D A;  1KQ9 A;  2EWT A;  4XKC A;  1P4A A;  1B9M A;  3FYM A;  2QQ8 A;  3MEJ A;  3Q0W A;  4FTH A;  3H1C A;  4LMY A;  3G0T A;  4FX4 A;  2OQR A;  4AIJ A;  2CUJ A;  1T39 A;  1B6A A;  1DWK A;  3W2V A;  1D5Y A;  2GRM A;  5GAE J;  4BQO A;  4EEF G;  5FB2 A;  2CQN A;  1VTN C;  3S1R J;  3PFI A;  2CWE A;  1IUF A;  2DA3 A;  4B48 A;  2P7V B;  4M74 A;  1V5F A;  2OV7 A;  3H9G A;  5FD6 A;  1QU3 A;  4K2E A;  4KJZ A;  3EUH A;  2DFE A;  1TNT A;  1I50 J;  3LNQ A;  3HTU A;  3S32 A;  4PUS A;  1SFX A;  5DD4 A;  1MMN A;  1TBX A;  1LDK B;  3H9J A;  4BEH A;  5M3M J;  4A6E A;  4OIQ F;  1NTC A;  1ZGW A;  3IL2 A;  2LOO A;  1TWH J;  4Y4R A;  1ON1 A;  3JXD L;  3IRQ A;  5KCM A;  2E5N A;  3SX0 A;  3JRH A;  1QPI A;  5F0C A;  2R7O A;  3OYA A;  4ENN A;  2VXD A;  5GP9 A;  3JXC L;  1VPW A;  3JRC A;  2A6T A;  4GQM A;  4A0X A;  2E7W A;  2IVB A;  2NNY A;  1Z3Y A;  3OWQ A;  3HHG A;  4X4D A;  3KX2 A;  2MC4 A;  1QZX A;  3LSJ A;  2ISY A;  2PMU A;  3ZQ7 A;  4A6D A;  2BJC A;  2IA0 A;  2IV1 A;  2VXZ A;  3K4J A;  1OJL A;  5F0H A;  2ZO4 A;  3A03 A;  2KDO A;  4CUG A;  3G1L A;  2CUE A;  2WA0 A;  5J8C A;  1YOV B;  2F5F A;  4C9Y A;  3OKZ A;  1KU3 A;  4JX6 A;  3SEQ A;  2GM4 A;  2HOE A;  1HQC A;  1R7J A;  1GUU A;  3VOE A;  5ILS A;  2DJI A;  3PO3 J;  5J4V A;  3OR2 C;  3Q9V A;  1MZB A;  3FBN B;  2LLW A;  1MH3 A;  2B0L A;  2NOJ B;  3AG4 H;  5DTM A;  2R7S A;  3GTP J;  3K9T A;  4KT5 C;  4L0Z B;  1QRY A;  1T8I A;  2PX9 A;  1T0F A;  2MLK A;  2LDU A;  1ZG3 A;  2HGC A;  3V8J A;  2OFY A;  2WAQ A;  3OP9 A;  4EM2 A;  4TV7 A;  3HOW J;  1JHF A;  1MMS A;  2LTP A;  1LFB A;  2IP2 A;  2Q8K A;  3S15 J;  4HDU A;  1UMQ A;  1Z91 A;  1NG6 A;  2CRG A;  2QKM B;  4MFE A;  2R7V A;  2GWR A;  4ESF A;  3TO6 A;  2R5Y B;  1E3O C;  3ONQ A;  1I1G A;  4UB6 C;  2M0C A;  2CQK A;  2Y30 A;  4Y42 A;  1J2X A;  4LB6 B;  1RES A;  5D5X B;  4B3X A;  2PUB A;  2XIU A;  1BC8 C;  3BDN A;  3FK7 A;  1MBE A;  4QPQ A;  5HOD A;  1MW7 A;  4DOZ A;  1OPC A;  2HQR A;  4EZI A;  3O6B B;  1XC5 A;  4XKV A;  4IHX A;  4M9X A;  4UY8 I;  4NQW B;  2L2O A;  3I59 A;  3PQK A;  1Z05 A;  2R5Z A;  1LFU P;  4B09 A;  2E19 A;  2QUF A;  5DCF A;  1ZQ3 P;  1QHH D;  4U0V A;  2W7N A;  1LVA A;  3QOW A;  2NYX A;  1RC9 A;  2FBK A;  2HOA A;  3L09 A;  1QQI A;  3LST A;  3FYA A;  1O7F A;  1G3S A;  2IS2 A;  3CES A;  2MA3 A;  4ZYG A;  4EJT A;  2XSJ C;  3AKZ A;  3A1Y A;  1Z67 A;  1ETK A;  3BZ6 A;  3KP5 A;  2HXI A;  1APL C;  3RKW A;  1SD4 A;  4BY7 J;  1VQ4 I;  4E7Z A;  2ICT A;  2BOL A;  4HPQ A;  3VWB A;  2KQR A;  4RAZ A;  1UG0 A;  3LSR A;  5IP6 A;  3NAR A;  4ITV A;  5CVR A;  3S17 J;  3IHU A;  2XAH A;  3WHC A;  1IN4 A;  1XDS A;  2HTJ A;  3QWL A;  2EA4 A;  3C7J A;  4M3G A;  3ECH A;  2JTV A;  5FD5 A;  1JKR C;  2LK2 A;  3FXK A;  1R9T J;  1NH3 A;  4HSR A;  4AYB A;  3BC8 A;  4BHC A;  4CYC B;  1FX7 A;  5JI6 A;  4HDV A;  2Z5U A;  1RZ4 A;  2OCE A;  1ZS4 A;  4M72 A;  2JSP A;  3L2C A;  4HX7 A;  2JVH A;  1VND A;  2KEK A;  1FC3 A;  1OCT C;  1VQO I;  3CDL A;  3BLY A;  4Q48 A;  5HNH A;  4PCQ A;  5K1Y A;  1BJA A;  2X51 A;  2JPC A;  1Q1V A;  2DOD A;  2XAG A;  1WJC A;  1X2M A;  4L18 B;  4BUP A;  4MNU A;  2WV1 A;  1D8K A;  1JUS A;  2OZ6 A;  3W3C A;  2M8G X;  5LGT A;  3D1N I;  4OAY A;  3ZXS A;  1FOX A;  2KJB A;  1K83 J;  2CS3 A;  4RAG A;  3L2U A;  3LFP A;  4HX4 A;  3EPZ A;  5EYR A;  2ZXW H;  4EKI A;  5M5X J;  3IVP A;  3SFZ A;  4KMU X;  2LYP A;  3I54 A;  2EWN A;  4DZP A;  1E2X A;  4XM3 A;  2FD5 A;  2K9S A;  5B5E C;  2O8X A;  2IGM A;  5LEK A;  3HOV J;  1RKW A;  2H6B A;  3ZQC A;  1JGG A;  3ZMV A;  3CLQ A;  2HCN A;  3HOS A;  3RTR A;  4HNV A;  5DRY A;  5BS6 A;  1JI8 A;  1FBS A;  3DFG A;  5E3L A;  1UTX A;  2HKX A;  3IKT A;  4Z59 A;  2O5R A;  2RQQ A;  4DE9 A;  1FPQ A;  3M07 A;  5EGO B;  1U3E M;  3S2D J;  3PNT A;  2R5Y A;  2V6E A;  1K79 A;  3UKG A;  4A69 C;  1DDN A;  2PXF A;  1LDJ A;  4IRH A;  5D8L B;  2H1K A;  1AHD P;  1NK2 P;  1SMT A;  4NC8 A;  3DWL E;  3V7C A;  5A2Q K;  2UXN A;  1HOM A;  2Y31 A;  2E1O A;  3OOP A;  2EIL H;  2XGC A;  2K5C A;  1T56 A;  3LA2 A;  4JQF A;  3FMY A;  3CUQ A;  2PXQ A;  4EM1 A;  3QYF A;  2CV1 A;  4NQW A;  2AWI A;  3FZV A;  2XAS A;  2LRD A;  3BG7 A;  4F55 A;  5E1W A;  1RNL A;  4YFN F;  3QPH A;  1KYW A;  3K6G A;  4A3K J;  4U7D A;  2JVG A;  2G9W A;  1MBH A;  2NVY J;  2LVS A;  2O49 A;  2KHM A;  2Y0S A;  3ZR8 X;  4DYR A;  4KIT B;  3IRR A;  2PMH A;  4GCV A;  4A3F J;  1HW2 A;  2PI0 A;  2JCG A;  1ZKG A;  3F8N A;  1K7A A;  2OZU A;  3VYS B;  2BW3 B;  1X19 A;  4B43 A;  2LYQ A;  1FBQ A;  2CGP A;  3WG9 A;  2L5Q A;  1ONV A;  4C2M J;  1CGP A;  4Z2Y A;  2RV8 A;  4DGW B;  2AXU A;  4HNU A;  1TT0 A;  2HCS A;  4YFK F;  2QSG X;  1G8X A;  4WK8 F;  3MZH A;  1IRZ A;  1OCC H;  1YW7 A;  4N9I A;  1FOW A;  5GAH J;  1GVD A;  3H5R A;  1DGW Y;  1LNW A;  2MH9 A;  1A31 A;  2QKL B;  2CV0 A;  5FRM A;  1QVU A;  3IAS 2;  2A5Y B;  2H8W A;  4CYC A;  1KU2 A;  3GXO A;  1RPW A;  2WY8 Q;  1R69 A;  5DUI A;  4A3J J;  4CCJ A;  1WSU A;  3TFL A;  4ER3 A;  2HYF A;  1YJW I;  2UXX A;  3WU1 B;  2X1C A;  2OC6 A;  1JKP C;  3GZD C;  3RSN A;  5JHF A;  2TDX A;  3GX4 X;  4G7O F;  1BDH A;  3LOC A;  1LDD A;  1JT0 A;  1RUN A;  3CO6 C;  1X1C A;  1Y0N A;  3BOQ A;  3M8F A;  4IF4 A;  1W5T A;  1OYW A;  3GUD A;  1ZZ6 A;  4HW0 A;  2DA7 A;  2M7B A;  1X58 A;  1QZZ A;  2GIV A;  3PSI A;  4YRV A;  1B8I B;  3WOD F;  2VQH A;  3ASN H;  4BJ5 C;  2P5V A;  1YO5 C;  1U2W A;  1IJW C;  3K7A J;  1UEL B;  3DBR B;  2ZSH B;  2E71 A;  5FLV A;  1DU6 A;  3I4P A;  5CVJ A;  4PU3 C;  1ORK A;  2EBY A;  2BXY A;  2MAB A;  3IWZ A;  1WH8 A;  2L0K A;  2LYL A;  2LY9 A;  4XSZ F;  3AFH A;  1ENH A;  4ASN A;  1A6I A;  3E6B A;  2XXA A;  1WJF A;  1Y8R B;  4PDK A;  2R7W A;  5EGO A;  1JH9 A;  4YEL A;  3JSP A;  2GZU A;  4XLN F;  2HNH A;  3H9Q A;  5TIS C;  3PUF A;  3A02 A;  2NVU B;  2L49 A;  4XKW A;  2B7E A;  5GPC A;  2WIU B;  4X4H A;  3C18 A;  2V9P A;  3HUG B;  3L00 A;  1EA3 A;  1D8J A;  2I5U A;  1X2L A;  1DQU A;  3QRF F;  4HNT A;  1SAU A;  5DD8 A;  2EIM H;  4PSW A;  1VF9 A;  3CP8 A;  1MSE C;  5K98 B;  3GF2 A;  1BIB A;  3HJE A;  1YJN I;  4FBI A;  2MC3 A;  3TOB A;  1F1Z A;  2L7M P;  4EK9 A;  5DEQ A;  4D9J A;  3M9L A;  2EH3 A;  2RC4 A;  2O0Y A;  4FN3 A;  2L7K A;  4I01 A;  3D5L A;  3I5U A;  4L9J A;  1V4R A;  1OR7 A;  1WHU A;  4N0B A;  3BTC A;  3TP0 A;  3JRB A;  1F4K A;  3GTM J;  2V3C C;  2HQN A;  3WG7 H;  5CKT A;  3O8G A;  5D4R A;  1U9N A;  3FMS A;  1VQK I;  4R79 A;  5LHI A;  3BY6 A;  3EUA A;  5D6F A;  1EFA A;  4YII A;  1D3Y A;  3GEZ A;  3I0T A;  1ZPQ A;  2VJ5 A;  4BS9 A;  5GTH C;  3HOU J;  3MMY B;  1SFU A;  5F6F A;  5BPD A;  3K4K A;  3OY9 A;  5BPI A;  2ME6 A;  3UFD A;  3DTI A;  4X4G A;  1PP7 U;  1HKQ A;  1YSE A;  4Q5S F;  4LK0 F;  2DPD A;  1USS A;  3GN5 B;  1QP0 A;  3CCU I;  2VC1 A;  3DBL B;  3JRA A;  1S7O A;  3MCZ A;  4F93 B;  1HW1 A;  5DRT A;  2YPR A;  2P5L C;  2KIU A;  2ELJ A;  5L3B A;  2OJE D;  5HNF A;  1W7P D;  4PK4 A;  2XF5 A;  3JRD A;  1FWZ A;  4KYW A;  3L2W A;  2EJR A;  1ZZ7 A;  2Q2E B;  3EUH C;  2KL4 A;  1ETO A;  1TTY A;  1PUF B;  4OOI A;  4ZDL A;  2NVQ J;  3ABK H;  2IJL A;  5GAD J;  5FFX A;  1I27 A;  4BKX A;  5D5V B;  1V3F A;  5JHU A;  4IZZ A;  3F8C A;  1W0T A;  3J7Y J;  2XC7 A;  3PSF A;  2GA2 A;  4P1W A;  1SEU A;  2EZI A;  4BJ6 C;  4CXF A;  1ZZB A;  2XPV A;  3CCL I;  1EH7 A;  3OMT A;  4AM3 A;  1B8I A;  3KP4 A;  4L5J A;  4ZYD A;  3CDH A;  3G3Z A;  1FIA A;  2PEX A;  2VT2 A;  1QO0 D;  1H89 C;  1IZ1 A;  3M8E A;  4M9Z A;  3WU0 A;  3GTQ J;  2BNN A;  2VQL A;  3H36 A;  5C3E J;  2FRH A;  2L8N A;  1I39 A;  1REP C;  2VKV A;  1S9H A;  2W24 A;  1F5T A;  3A01 B;  1U0J A;  3WTZ A;  1GVJ A;  1WVR A;  3DKY A;  5FJ8 J;  4EJO A;  5LRS A;  1PYV A;  2HVS A;  3ZRG A;  1YRN B;  3B6A A;  3J7Z I;  2XF6 A;  1EF4 A;  3VYT B;  4RLQ A;  3JTH A;  3CD6 I;  3JRG A;  3GBF A;  2VOD A;  2EZH A;  3ZHI A;  3ZQQ A;  3HUG A;  3OIO A;  4QIW N;  4F91 B;  3TEL A;  4MEY F;  2L3D A;  1BOA A;  4RGX A;  1Q1H A;  2D1H A;  2R63 A;  3MZ8 A;  2QLZ A;  3PIO F;  1T0F C;  2DFI A;  1MD0 A;  2LH9 A;  4HLX A;  1P7I A;  3GZ5 A;  1VQ9 I;  1UST A;  4NUB A;  4WX9 A;  1QHG A;  2LYC A;  1IRF A;  1D1C A;  4Y52 J;  2CRO A;  1FTZ A;  4AD9 A;  2OBP A;  4GGG A;  1LE8 B;  4WXC A;  5EZG A;  1ZH5 A;  2KRH A;  4XOP A;  1XD7 A;  3FHN A;  4EGY A;  2MLG A;  5H20 A;  2M87 A;  5D5U B;  2X48 A;  3KPH A;  2WUS R;  3CZ6 A;  3H0G J;  2DFF A;  1TWF J;  4Z5D A;  2MD0 A;  2DW4 A;  1OYY A;  1WRJ A;  2XAU A;  1MNM C;  4HF2 A;  4DYC A;  3OIQ A;  2HDW A;  1G3W A;  2FA5 A;  2XRO A;  1UXC A;  3NAU A;  1LQ1 A;  1IAW A;  3FHZ A;  2AXZ A;  1JHH A;  2GXB A;  3F21 A;  1WZ2 A;  1OCO H;  3G1M A;  2DDA A;  4MIM A;  3DQV C;  5DCM B;  1J75 A;  4Y33 A;  3OSF A;  4A3D J;  1E3P A;  4HOB A;  3SHF A;  3GN5 A;  1W4M A;  2FOK A;  2QA4 I;  1B0N A;  2KEJ A;  1T38 A;  4MEX F;  3Q3S A;  2M0M A;  2XVC A;  3W2W A;  4EGZ A;  4F92 B;  4PJL A;  2XGX A;  2O3F A;  2UUZ A;  1YIJ I;  4LIU A;  1FY7 A;  1R6R A;  1BJZ A;  1FOY A;  1L1M A;  1XCV A;  5IY5 H;  3ESW B;  5IT9 K;  2PBI A;  3OYB A;  2R0Q C;  4L9V A;  1L3L A;  2XAQ A;  2OCC H;  2Q2E A;  3DPT A;  3BPV A;  1JTX A;  3I71 A;  1PUF A;  1EJ9 A;  4XL9 A;  2IS1 A;  2CQ7 A;  1ZZ9 A;  1B1B A;  1A6Q A;  1QVT A;  2XCJ A;  1GLN A;  2P6T A;  3GVA A;  4IHT A;  3L2R A;  5DDG A;  1BR1 A;  5IP9 J;  4PU8 A;  5IT9 Z;  4ZDO A;  1OFC X;  1A04 A;  2L9V A;  4ANJ A;  3CUO A;  1D5V A;  1BOB A;  2HOT A;  1R1T A;  2JWT A;  2L7F P;  3GCM A;  2VOP A;  4E4H A;  1CQT A;  1YW9 A;  5TJJ A;  1QZE A;  4FE7 A;  5GAG J;  3HOY J;  2EIK H;  5ERI A;  4B8X A;  4EJU A;  2QQ9 A;  4Y7N J;  2PXV A;  1PVE A;  4II3 A;  3OYH A;  1ZGJ A;  5BOX A;  2ESN A;  3B6C A;  3A01 A;  2WAQ N;  1E3H A;  3VYU B;  4G6D A;  5FLM J;  1YRN A;  1HCR A;  3ML6 A;  4OIP F;  4A0Z A;  5IOY A;  3BJO A;  3TW7 A;  3G6E I;  2DA6 A;  2V1N A;  5FKN A;  2JA6 J;  1ZRD A;  2O61 A;  2AXT C;  3KL4 A;  2OTL I;  3LQQ A;  4A3C J;  3WHB A;  1XWR A;  2Y75 A;  4L9N A;  3BR6 A;  1FTT A;  5B66 C;  3FXO A;  2OUM A;  3I4N J;  3HIF A;  2KDZ A;  1CF7 B;  1VQ6 I;  4CCO A;  2OF7 A;  3DTE A;  2HS5 A;  3E1S A;  3RKX A;  1HDP A;  1TNS A;  5F08 A;  4OIR F;  4KA4 A;  5DTD A;  2XI8 A;  3W6V A;  1SD5 A;  1LE8 A;  2JRM A;  2E60 A;  2R7Z J;  3U1D A;  1VQ5 I;  1ITY A;  1E17 A;  1IDY A;  5K7H A;  5LD2 C;  1IV8 A;  3UR3 C;  3CJN A;  2ACJ A;  3DV8 A;  5CQG A;  1RIO H;  2DFH A;  3Q0V A;  3IWF A;  2E2J J;  2E1C A;  3F9K A;  3CDI A;  3HPG A;  4C2T A;  1R5H A;  2WAF A;  2ZME B;  5AON A;  5KHD A;  2CW0 F;  4FX0 A;  1U2Z A;  4BAY A;  2HDD A;  3RZO J;  2LR8 A;  3WGG A;  1D0Z A;  5DCM A;  4BBS J;  2HU9 A;  4DBR A;  4ON0 A;  3BD1 A;  1I3Q J;  1S29 A;  3FXU A;  3I64 A;  2YUS A;  3BG6 A;  4C3H J;  2IT0 A;  4U88 A;  4IHV A;  3OV8 A;  1YX5 A;  1BR2 A;  1JTY A;  4EQZ A;  2PXP A;  2ZSI B;  4AYB N;  2K86 A;  3E7L A;  3FBI B;  1NHA A;  1FT9 A;  4PGG A;  1GT0 C;  4PU7 A;  3PNY A;  1WJD A;  1LCC A;  3EDP A;  3LQR A;  1QP4 A;  3OL3 A;  5DS9 A;  3WTY C;  5IYD J;  4NNJ A;  5LHG A;  2YS9 A;  2LCV A;  3GZN B;  2V26 A;  2HI3 A;  3K1M A;  3LSP A;  2G7U A;  1TC3 C;  5HS8 A;  2H8R A;  1HW5 A;  3PL8 A;  5L3F A;  2FXA A;  3JSO A;  1STZ A;  1RZS A;  1JGS A;  3G71 I;  3GW2 A;  3VFZ A;  1JFS A;  4CYD A;  2E36 A;  3BT9 A;  3K4N A;  5EEG A;  1BW5 A;  5DTQ A;  1XPX A;  4D7M A;  1J9I A;  1WQ2 A;  4I99 C;  1HDD C;  5TGT A;  3ME5 A;  1BI2 A;  3MKW B;  1TQP A;  1WCM J;  3LA7 A;  1GHC A;  2PXE A;  2DMN A;  4M9S A;  2QYO A;  3SZG A;  3HYI A;  4Z6Y A;  2OQG A;  3N05 A;  2IGN A;  1JE8 A;  1EH6 A;  2KZG A;  1O7L A;  3HEF A;  2F48 A;  3HSE A;  3I56 I;  1WPK A;  3MKY B;  1S7A A;  2FEZ A;  3F23 A;  2BNM A;  4C3I J;  2AO9 A;  4IOC F;  4C3J J;  3F8M A;  1PUE E;  4HLY A;  2FFH A;  3KEY A;  5F64 A;  2TCT A;  3MFK A;  4IEJ A;  1BBY A;  1BM9 A;  3TBI A;  3TW6 A;  1TP4 A;  2HPI A;  1YX3 A;  4PU4 C;  3BR0 A;  4PZJ A;  1K61 A;  1IO2 A;  2R7U A;  1X3Z B;  1CF7 A;  1XX5 A;  3LAP A;  3HBL A;  1HQ1 A;  2VC0 A;  1UZC A;  5E8G A;  1YTY A;  4YG2 F;  2M1B A;  2DYS H;  3T0Y A;  4S0H B;  4A12 A;  5ICC A;  1WH7 A;  4X4B A;  2V4J C;  1Z21 A;  4ESJ A;  1FZP B;  4BHB A;  3BZK A;  2EFP A;  1H0M A;  3WTX C;  3CF2 A;  3G1O A;  2JA8 J;  1N25 A;  4HF1 A;  1VQ8 I;  4F52 A;  4UUV A;  2VI6 A;  4WF2 A;  4U0W A;  3ULQ B;  4BDY A;  2V9V A;  2Y0S N;  4IXA A;  4XNF A;  2EV0 A;  2LLK A;  1ETX A;  3EYY A;  4X6A J;  5LHH A;  4O6J A;  3QPL A;  3ZGK A;  1V5E A;  4KN4 X;  6PAX A;  2YX4 A;  5IPA A;  2VPL A;  4I0A A;  1J7K A;  1DPR A;  1E0E A;  2CMP A;  3W2A A;  1JKO C;  4P96 A;  1TWC J;  4RGR A;  5H6Q A;  1ETV A;  2D1V A;  3Q0U A;  3CO7 C;  1QPZ A;  2WTE A;  1OR7 C;  2GAU A;  4L5E A;  4KN7 X;  4BQQ A;  2XGE A;  5LEJ A;  2E2H J;  4XIC A;  1VZ0 A;  2ECC A;  3U2R A;  2O38 A;  5AIQ A;  1BL0 A;  3SEZ A;  2F5V A;  1IXS B;  1RR7 A;  2FE3 A;  1QBJ A;  3HZI B;  4EVI A;  1UHS A;  3TKY A;  2M30 A;  5E1Z B;  3S8P A;  5F1J A;  1O4X A;  3DM5 A;  5K7F A;  2DDB A;  4J19 A;  3DBH B;  5EG0 B;  3IH3 A;  2M4H A;  1LVK A;  1U9O A;  4AIH A;  1ZTR A;  3ABM H;  4IQJ A;  2E2I J;  4CZZ A;  1BI3 A;  4R8H A;  2NOG A;  2M2E A;  2VIX A;  2JJ7 A;  5HLG A;  1IC8 A;  3NXH A;  2KMU A;  4X4I A;  1UHM A;  3QP5 A;  4AVP A;  3BP8 A;  1Y8Q B;  4HV6 A;  4HRA A;  3CMM A;  1ZAY A;  9ANT A;  1OCZ H;  1IN7 A;  2RN7 A;  2FQ4 A;  1DPU A;  3OL4 A;  1MMD A;  1TWA J;  2VBZ A;  3C2B A;  3E5Q A;  3K69 A;  4F7Z A;  4Y15 A;  5M5Y J;  1G4D A;  2DQR A;  3K2Z A;  1T08 B;  4YG1 A;  3U21 A;  2KRF A;  4NC7 A;  2ECB A;  3CLC A;  5JUW A;  3H5T A;  2FU4 A;  4P55 A;  1MNE A;  1UJ8 A;  1JJ8 C;  2NS0 A;  3ASO H;  2J5O A;  1XGO A;  1WIZ A;  2AXV A;  1QQB A;  1R23 A;  4ZYA A;  1P9Q C;  3BTJ A;  4WWC A;  3QFI A;  1W5C C;  1KON A;  4JP0 A;  2BY1 A;  2WWY A;  3CCJ I;  3OYN A;  4LIV A;  4LFU A;  4HQE A;  1XDU A;  2MXD A;  2P0W A;  4Z5C A;  4AID A;  2FNP A;  4RBO A;  5FGM A;  2W00 A;  3SFI A;  2EA2 A;  4UUS B;  3CF5 F;  3FIS A;  1QPM A;  3PNV A;  4ZDP A;  2HSG A;  3PO2 J;  5F27 A;  1Z6R A;  3IKV A;  4XLC A;  4XOT A;  1P92 A;  3KZI C;  2A61 A;  3LSG A;  3RZZ A;  2H09 A;  3BG5 A;  3SXY A;  3FF5 A;  2ZXH A;  1IXR C;  5CQE A;  3SQN A;  3CTA A;  3RKQ A;  2BEO A;  2LRE A;  3CLO A;  2GBY A;  2EIN H;  3PM1 A;  4AWX B;  4MO7 A;  1FSH A;  4LLG F;  4IVZ A;  2L7Z A;  3F72 A;  2MG4 A;  2IA1 A;  3RZD J;  1BIA A;  3NWT A;  3CC7 I;  3D0S A;  2ETH A;  3M3Y J;  3CMA I;  5HLH A;  2E1N A;  3RQI A;  1R58 A;  4HV5 A;  1FLI A;  3KYL A;  3FMQ A;  3PE5 A;  3HHH A;  3CCV I;  3AL0 B;  3CRO L;  4N9H A;  1WH5 A;  5A2Q Z;  2PUC A;  1F9N A;  1TW3 A;  4HST A;  2CSF A;  2DLL A;  2HTS A;  2RAE A;  1Z3X A;  1XG1 A;  1MJ9 A;  2DMQ A;  4DNC A;  3IC7 A;  2X1E A;  4LG0 B;  3RDI A;  3R1F A;  2A6H F;  5EG0 A;  3S3M A;  1QGP A;  2EZL A;  3BG3 A;  2CFO A;  3ROU A;  1GXP A;  2LYR A;  2PG4 A;  4BH9 A;  4XRF A;  4RLF A;  3J81 K;  4LOC A;  4G8X A;  1N78 A;  2PXT A;  3HOX J;  5IT3 A;  4UV9 A;  2MH2 A;  2WAE A;  3BG9 A;  3O3K A;  2Y9Z A;  4RB0 A;  5CVU A;  5KAF C;  4FHT A;  2QBY B;  3WGH A;  4X4E A;  2BVL A;  4Q47 A;  1PRV A;  3FWE A;  3IAM 2;  2FML A;  4BE1 A;  2DK8 A;  2GA1 A;  1NW3 A;  1ETY A;  5EF6 A;  1I5Z A;  1V55 H;  2DA4 A;  2HZT A;  1R71 A;  1BN5 A;  5CJ9 A;  3J81 Z;  4M6V A;  5JLX A;  3SYT A;  2X1D A;  4C2U A;  3ZMT A;  1JJ6 C;  3MAJ A;  5M5W J;  2QM3 A;  2QSF X;  4EJV A;  3CJR B;  1R1U A;  1SD6 A;  2W1O A;  4J1X A;  4W97 A;  3PUB A;  5C4X J;  1P2F A;  3RPQ A;  1IDZ A;  1M1E B;  1SMY F;  4GXO A;  4RAY A;  2PJP A;  5L3D A;  1X1D A;  3KXA A;  2VLA A;  3VPR A;  2O03 A;  2RQP A;  2ZKZ A;  3BPX A;  5E8I A;  5DYM A;  2JN6 A;  3BJA A;  3EQL F;  2KP6 A;  3P9C A;  4PJN A;  5DV5 A;  3U9G A;  3ERE D;  2P5K A;  4RB3 C;  2IU7 A;  1OSL A;  1HC8 A;  4E7H A;  1YE9 A;  4YBA A;  5C44 J;  2FF4 A;  2IUO A;  1C0W A;  2NRA C;  4Q2J A;  4LD5 A;  4UUS A;  4DW6 A;  3EUS A;  3ABU A;  3F6V A;  4E7S A;  2P8T A;  5FKO A;  3J80 K;  4X4C A;  2PN6 A;  1IW7 F;  1FOK A;  4I6U A;  4P9F A;  3VYR B;  2LKP A;  1FP2 A;  4MHG A;  3TDZ C;  1IRX A;  5ILV A;  4XLE A;  2LSO A;  2XB5 A;  2MD5 A;  3GTJ J;  4O5V A;  1X4O A;  1XMX A;  4P5O A;  2MEZ A;  2O4A A;  3TGN A;  2KIM A;  2JRT A;  2R3S A;  1B72 B;  2EPF A;  2VBW A;  3J80 Z;  3OQO A;  2QQA A;  1WJA A;  3E6D A;  3K4B A;  3AG2 H;  2C6Y A;  3S93 A;  1ZR4 A;  1RUO A;  4X0G A;  3E5X A;  1LEB A;  2IGO A;  2L9S A;  5H2F C;  2IA2 A;  1FMW A;  1YHQ I;  3VK0 A;  1GXQ A;  2X9D A;  4AVZ A;  1QZY A;  5E3N A;  3GFI A;  4IRI A;  1OQY A;  4M6Y A;  2QZ8 A;  1D0X A;  1IN8 A;  3QYE A;  4IRG A;  3G5G A;  3PQJ A;  1TT5 B;  1MFQ C;  1ZRC A;  1FNN A;  3C2G A;  1UXD A;  3TDU C;  2PUG A;  1G2H A;  2Z33 A;  1YQA A;  2HDC A;  1X1A A;  3HM5 A;  4LGW A;  3LSM A;  5HDG A;  3MKZ A;  3LA3 A;  1GDT A;  1R22 A;  4LG0 A;  4BDZ A;  3EET A;  2BW3 A;  2PMZ A;  2VOO A;  1DP3 A;  2KLO A;  2G0E A;  3A9Y A;  2A69 F;  2V6C A;  4J00 A;  3BR3 A;  2CUZ A;  2KIF A;  3NWS A;  3BQY A;  3OYK A;  4M3D A;  3OS2 A;  2JMW A;  4XQF A;  2UZK A;  3SCH A;  3BCA A;  4CH7 A;  4DBQ A;  3CC4 I;  3C2H A;  2L01 A;  1X4P A;  2NAZ A;  3RQ4 A;  2QBY A;  4NDW A;  5HDK A;  1MBJ A;  5LFA A;  1POU A;  3O2P E;  3TQN A;  3JR9 A;  1R4M B;  2ADU A;  2PUE A;  4KIS A;  3P9I A;  3K70 C;  1WJE A;  5BQT A;  4G94 A;  5D4S A;  2K9N A;  4BAC A;  2DT5 A;  2GLO A;  2RNJ A;  2DAO A;  5CPR B;  2LD5 A;  3NDB B;  2OU2 A;  2LMD A;  3OYG A;  4GYI A;  3PXP A;  2M45 A;  4N4O B;  3C1D A;  4MTE A;  4UVC A;  3TO7 A;  5K5Q A;  2KEI A;  1HKT A;  4OBM A;  1TZL A;  2W25 A;  5BMZ A;  2Y48 A;  1B4A A;  4ER6 A;  4D1Q A;  4IKF A;  1MMG A;  3W6J B;  1G3Y A;  3LL7 A;  3D5R C;  4A5M A;  1JKQ C;  3MWM A;  3T1B A;  4WCG A;  2PXK A;  1U5T C;  1XS9 A;  2XKO A;  1KU7 A;  4LG3 A;  3S1N J;  1R63 A;  2BY2 A;  1D1B A;  3FKJ A;  2KPM A;  2Q1Z B;  3HPH A;  1I1S A;  4C30 A;  2E34 A;  3PFY A;  4L9T A;  1FBU A;  2JA5 J;  3BRO A;  3RPU A;  3DLL F;  1Y0U A;  3HDD A;  4DJA A;  3QOX A;  3MLF A;  2HEO A;  4MTD A;  1X3U A;  4MQV A;  2W48 A;  2AS5 F;  3H3Z A;  4NC6 A;  1Y9Q A;  3H35 A;  3OWT A;  2DI3 A;  3H0D A;  2K02 A;  1YG2 A;  1BW6 A;  2EK5 A;  5J47 A;  1P7J A;  2PUF A;  2QQB A;  3LSK A;  1B72 A;  4CGZ A;  3G7D A;  4BBR J;  3K4M A;  3J7A O;  3KLN A;  4I6T A;  1U6G A;  5JVT A;  3L2Q A;  4JYK A;  4CA0 A;  4E7I A;  2NXN B;  1BI0 A;  2K3F A;  4HF0 A;  3HSR A;  4MQ9 F;  2RDP A;  4ZYE A;  5J8F A;  2HQ5 A;  3S1M J;  5ICF A;  1LKX A;  1G3T A;  1UFM A;  3WE2 A;  2QWW A;  3K70 D;  4GDF A;  3WTU C;  1XMK A;  4UB8 C;  3BR1 A;  2PE5 A;  1WGX A;  1F43 A;  4HA8 A;  1MBG A;  3HL2 A;  4XLF A;  1XSX A;  4OMY A;  3O9X A;  3SZP A;  4RDU A;  1MH4 A;  2EV6 A;  2ZME C;  1WFX A;  1OKR A;  1O3S A;  4CCM A;  1ZEL A;  3UNG C;  4JX5 A;  2WV0 A;  1S3J A;  3H5A A;  1SAN A;  4XN3 A;  1SFO J;  4DQ2 A;  5FLX K;  3CCM I;  1QA6 A;  2L1P A;  1GV5 A;  3RYP A;  4IL6 C;  2M34 A;  4WXD A;  3S14 J;  1RET A;  4IA8 A;  1V54 H;  2CQQ A;  1OYI A;  1HBX G;  3Q5F A;  4GO1 A;  2KKO A;  3ZPL A;  4CZC A;  1SFE A;  2Z99 A;  3KEO A;  4IPA A;  2HFH A;  3HG9 A;  4QSH A;  1A5J A;  5J1U A;  2IS6 A;  2MQK A;  3OIP A;  2KJC A;  1FSE A;  3QOD A;  2UWM A;  3U1K A;  2CSO A;  4BY1 J;  3JCU C;  4CCN A;  4M71 A;  2H6C A;  3ZCO A;  4KT6 A;  3WE3 A;  3FXR A;  4UVB A;  2JK3 A;  2GZW A;  3M9A A;  1BC7 C;  2MSY A;  1WJ5 A;  3JXB C;  2K40 A;  2R92 J;  1R5G A;  1MJB A;  2H94 A;  2IEK A;  2MYS A;  1KYZ A;  2DYR H;  4XBF A;  1NK3 P;  3FKI J;  2NNN A;  5J1Y A;  2GOM A;  1VQP I;  1ZAR A;  2F4O B;  3HC7 A;  3F6W A;  4CCL A;  2Z2S B;  2ZBK A;  4I6Z A;  3KYC B;  3ZMZ A;  2BVM A;  4BGD A;  2E1M B;  4A3E J;  2ID3 A;  2XGD A;  4KIB A;  1FYL A;  2XDV A;  3E3V A;  4IJA A;  4OAZ A;  4RGS A;  3OQM A;  4FAS D;  4S05 A;  2N8G A;  1RI7 A;  4EAT A;  2NVX J;  1R49 A;  2R7T A;  4MLO A;  2M8E A;  4XRS G;  2YU9 J;  2NVT J;  3ZQH A;  1U5T B;  2HWV A;  2CFX A;  3JAM K;  4ER5 A; 
#chains in the Genus database with same CATH homology
 2CU7 A;  1WH7 A;  2LKX A;  1DW9 A;  4X4B A;  3MN2 A;  2AWI A;  3CMY A;  3HOZ J;  3G1O A;  2JA8 J;  3H3V K;  1PNR A;  2VI6 A;  1POG A;  5BNG A;  4A3K J;  3S2H J;  2Y0S N;  1MBH A;  2NVY J;  4OB4 A;  2LVS A;  2O49 A;  4G12 A;  2LLK A;  1ETX A;  4XRM A;  4X6A J;  4UUT A;  3QPL A;  4DYR A;  2AW6 A;  4A3F J;  5IPA A;  2WB1 N;  3HGG A;  5E3M A;  2JCG A;  1ZKG A;  1JKO C;  1X57 A;  4D5C A;  1H8A C;  2LYQ A;  2M9H A;  3O8H A;  1TWC J;  1ETV A;  2K9Q A;  3Q0U A;  4C2M J;  2DN0 A;  1QPZ A;  3BR2 A;  2CJJ A;  2Y9Y A;  2XB0 X;  4GHJ A;  2IVG A;  4B1R A;  4L5E A;  5E3O A;  4FE4 A;  2XGE A;  4JX4 A;  2AXU A;  2PPX A;  2E2H J;  1T33 A;  1IRZ A;  4XIC A;  2MGQ A;  2LYS A;  4JQD A;  2ECC A;  5JLW A;  3KJX A;  2O38 A;  1BL0 A;  1GVD A;  2TRT A;  1W0U A;  1RR7 A;  1HLV A;  1ZZC A;  4V2G A;  3HZI B;  1QVU A;  1UHS A;  3F0C A;  3SDG A;  4CYC A;  5F1J A;  5K7Z A;  3ZQI A;  1O4X A;  3ZOB A;  1RPW A;  5K7F A;  2X6O A;  4J19 A;  1R69 A;  5EG0 B;  3IH3 A;  3OQN A;  4A3J J;  1AKH A;  2XRL A;  1U9O A;  1ZTR A;  2E2I J;  1JKP C;  2HIN A;  4B3A A;  1OCP A;  2NOG A;  4YG7 B;  2M2E A;  1BDH A;  2DMU A;  3LOC A;  1SQ8 A;  2JJ7 A;  1IC8 A;  3I4M J;  1JT0 A;  4X4I A;  4IHW A;  1ZAY A;  1ZZ6 A;  2DA7 A;  2KT0 A;  9ANT A;  1X58 A;  1B8I B;  3M4O J;  2FQ4 A;  3C2B A;  1TWA J;  1RPE L;  5M3F J;  3ZQF A;  1IJW C;  3K7A J;  5M5Y J;  2XSD C;  1GV2 A;  2IVQ A;  1JUP A;  1AU7 A;  1FJL A;  4YG1 A;  5FLV A;  1DU6 A;  3JRF A;  1MBF A;  2ECB A;  1UG2 A;  4PU3 C;  1ORK A;  2EBY A;  4AUX A;  3CLC A;  1WH8 A;  2L0K A;  2LYK A;  2LYL A;  3H5T A;  4GFB A;  3ZQG A;  4J1W A;  2LY9 A;  3BQZ A;  1JJ8 C;  3BR5 A;  1ENH A;  1BDI A;  1A6I A;  3HB9 A;  1WIZ A;  2AXV A;  1QQB A;  5EGO A;  1JH9 A;  3BTJ A;  4YG4 A;  2GZU A;  5GPA A;  1TWG J;  2L49 A;  3A02 A;  4JP0 A;  5GPC A;  2VPR A;  2WIU B;  4X4H A;  1LLI A;  1LCD A;  1ETW A;  3BTL A;  2GRL A;  4Z5C A;  2ME0 A;  4M3F A;  4RBO A;  2MW8 A;  1X2L A;  1Y7Y A;  1LQC A;  3SFI A;  4UUS B;  1NEQ A;  3F51 A;  1VF9 A;  3FIS A;  1MSE C;  5K98 B;  4FBI A;  3MKL A;  2DA1 A;  2LYJ A;  1VI0 A;  2L7M P;  3HKZ N;  2HSG A;  3PO2 J;  2EH3 A;  5F27 A;  3MVP A;  4FN3 A;  3DEW A;  4A3M J;  2IAI A;  1QP7 A;  3LSG A;  3RZZ A;  2CUF A;  1ADR A;  3QWG A;  3BTC A;  3BG5 A;  3TP0 A;  1Z0X A;  5C4J J;  3JRB A;  3TP3 A;  4FCY A;  3GTM J;  4I6R A;  1X2N A;  3O8G A;  1MBK A;  1U9N A;  4X4F A;  1JFT A;  3RKQ A;  4XK4 A;  2PUA A;  2GBY A;  3PM1 A;  4ABZ A;  2DTZ A;  3IH2 A;  4MO7 A;  1EFA A;  4IVZ A;  2L7Z A;  2MG4 A;  3TED A;  3JRE A;  3RZD J;  1ZPQ A;  1FEX A;  3ZHM A;  3HOU J;  3M3Y J;  2JA7 J;  4M3E A;  3RQI A;  5EEA A;  5F04 A;  3TRB A;  1JUM A;  2ME6 A;  3UFD A;  4X4G A;  1YSE A;  2O8K A;  3GN5 B;  3CRO L;  1WH5 A;  1QP0 A;  4NDL A;  2DJN A;  2PUC A;  3JRA A;  2CSF A;  3QPS A;  3HGY A;  2RAE A;  2DA2 A;  1XG1 A;  2DMQ A;  3OOU A;  2PUD A;  4M3B A;  1H88 C;  1FIP A;  2LP0 A;  3JRD A;  3R1F A;  5EG0 A;  2BNO A;  1ZZ7 A;  2EZL A;  3BG3 A;  2DMT A;  2R93 J;  2LYR A;  1ETO A;  1PUF B;  2NVQ J;  4LOC A;  5IP7 J;  4BKX A;  5EDN A;  3QQ6 A;  3HOX J;  1DU0 A;  3BG9 A;  1W0T A;  2Y9Z A;  2FX0 A;  3S8Q A;  1VFC A;  2EZI A;  4X4E A;  1PRV A;  1ZZB A;  2XPV A;  3K2A A;  3OMT A;  3FIW A;  1ETY A;  2DA4 A;  5EF6 A;  1B8I A;  2EBI A;  3KZ3 A;  4Z5H A;  4I8T A;  1FIA A;  1ZK8 A;  4M6V A;  5JLX A;  4BXX J;  4MCX A;  1H89 C;  2HOS A;  1WET A;  4O8B A;  3QQA A;  1JJ6 C;  5M5W J;  3GTQ J;  2BNN A;  1IGN A;  2O7O A;  5C3E J;  1ZR2 A;  4A93 J;  4J1X A;  2L8N A;  3DNV B;  4W97 A;  2OR1 L;  5C4X J;  2COB A;  5FKK A;  2VKV A;  1IDZ A;  2D5V A;  4JCX A;  1ETQ A;  1JT6 A;  3KXA A;  3A01 B;  2ID6 A;  3VPR A;  4B4C A;  5FJ8 J;  1YRN B;  2FJR A;  1U8B A;  1RKT A;  3B6A A;  1EF4 A;  3GBF A;  2JN6 A;  3JRG A;  2JVL A;  3IH4 A;  3QYX A;  1ZVV A;  2EZH A;  3ZHI A;  2ELK A;  3BTI A;  2IU7 A;  1OSL A;  3OIO A;  4QIW N;  2HYJ A;  5C44 J;  2IUO A;  3DCF A;  3LIS A;  4YBA A;  2R63 A;  2AUW A;  2PIJ A;  2QF7 A;  4UUS A;  4DW6 A;  1P7I A;  3CEC A;  3EUS A;  5IYC J;  2B63 J;  5FKO A;  3L1P A;  4X4C A;  1RZR D;  2ICP A;  4QTR A;  3BS3 A;  4Y52 J;  4A3I J;  4I6U A;  1Y1V J;  2OPT A;  2CRO A;  3GTO J;  1FTZ A;  4A3G J;  1LE8 B;  1Y1W J;  2XB5 A;  1U78 A;  1Z77 A;  5EZG A;  5J1R A;  2R5Z B;  3GTJ J;  4IHY A;  2MEZ A;  2O4A A;  4XID A;  2EWT A;  2Y2Z A;  1B72 B;  2X48 A;  3FYM A;  5J3L A;  3Q0W A;  3H0G J;  2WUS R;  3OQO A;  4FTH A;  1TWF J;  4Z5D A;  1ZR4 A;  2DMP A;  1MNM C;  1DWK A;  1D5Y A;  2GRM A;  1RZR A;  4DYC A;  1WI3 A;  4EEF G;  1UXC A;  2AXZ A;  3NAU A;  1MSF C;  3S1R J;  3VK0 A;  1IUF A;  2DA3 A;  2X9D A;  5E3N A;  4IWR A;  3G1M A;  4MIM A;  4Z58 A;  3OSF A;  4A3D J;  3ZKC A;  3LNQ A;  1I50 J;  3G5G A;  3GN5 A;  2KEJ A;  1B0N A;  1UTX A;  5M3M J;  1NTC A;  3Q3S A;  1UXD A;  1ZGW A;  2PUG A;  1G2H A;  1TWH J;  3HM5 A;  2B5A A;  3JXD L;  1L1M A;  1BJZ A;  1GDT A;  2PMZ N;  3JRH A;  1QPI A;  5F0C A;  3JXC L;  5GP9 A;  2XJ3 A;  1VPW A;  3JRC A;  1IG7 A;  3IV5 A;  4GQM A;  2R0Q C;  2IVB A;  5FKL A;  2G0E A;  4X4D A;  3OSG A;  1JTX A;  1PUF A;  1I6H J;  3BR3 A;  3LSJ A;  2BJC A;  1ZZ9 A;  3BQY A;  2EF8 A;  2IV1 A;  1QVT A;  3QF3 A;  4M3D A;  2XCJ A;  2JMW A;  5F0H A;  1OJL A;  5IP9 J;  4MFD A;  4PU8 A;  3SCH A;  1F36 A;  4X1E A;  3A03 A;  1OFC X;  5F0F A;  3G1L A;  2KPJ A;  2CUE A;  2HOT A;  4NDW A;  2JWT A;  2L7F P;  1MBJ A;  1POU A;  3JR9 A;  2PUE A;  2P81 A;  4JX6 A;  2AHQ A;  1CQT A;  2GM4 A;  3HOY J;  4FE7 A;  1PER L;  1GUU A;  2K9N A;  3PO3 J;  2GLO A;  4Y7N J;  2LD5 A;  1MH3 A;  1IV6 A;  3GTP J;  3CCY A;  3PXP A;  2LFB A;  1QRY A;  3B6C A;  3A01 A;  2WAQ N;  4D5F A;  2KEI A;  5FLM J;  2OFY A;  1YRN A;  3SCG A;  3OP9 A;  1HCR A;  3HOW J;  2LTP A;  1LFB A;  3S15 J;  3SCF A;  1S7E A;  5IOY A;  4A3B J;  3TW7 A;  1JKQ C;  1UMQ A;  2DA6 A;  5FKN A;  2JA6 J;  4MFE A;  2CRG A;  2CQX A;  1XS9 A;  2R5Y B;  1E3O C;  2O9L A;  3S1N J;  4A3C J;  3B7H A;  3WHB A;  1XWR A;  2M0C A;  2Y30 A;  1R63 A;  3BR6 A;  1FTT A;  2EZK A;  4Y42 A;  3JRI A;  1RES A;  3I4N J;  3GTG J;  2PUB A;  2KDZ A;  2XIU A;  3BDN A;  2OF7 A;  3S16 J;  3FK7 A;  1MBE A;  5HOD A;  2JA5 J;  2XPW A;  1HDP A;  3HDD A;  5F08 A;  1XC5 A;  3FK6 A;  5FKM A;  4DZJ A;  4A3L J;  3MLF A;  4IHX A;  5A7L A;  5DTD A;  2XI8 A;  3W6V A;  2VKE A;  2W48 A;  2R7Z J;  1LE8 A;  1ITY A;  1Y9Q A;  2R5Z A;  4JCY A;  1QQA A;  1IDY A;  5K7H A;  1LFU P;  1BW6 A;  5IYB J;  2E19 A;  3GTK J;  1P7J A;  2PUF A;  4D7N A;  1ZQ3 P;  3Q0V A;  1B72 A;  2E2J J;  3G7D A;  2HOA A;  4BBR J;  3FYA A;  2I10 A;  1HF0 A;  4I6T A;  4JYK A;  3F52 A;  2NS7 A;  1JWL A;  3S1Q J;  3SJM A;  5EZH A;  3GTL J;  1PRA A;  1PRU A;  1ETK A;  2HDD A;  4XRS A;  2HQ5 A;  1CJG A;  2HXI A;  3S1M J;  3RZO J;  1APL C;  2VUM J;  2LR8 A;  4FIS A;  2HXO A;  4BY7 J;  4BBS J;  2ICT A;  3BR1 A;  2XPU A;  3BD1 A;  2PE5 A;  1I3Q J;  1WGX A;  1F43 A;  1NER A;  1MBG A;  4DYQ A;  2YUS A;  4C3H J;  5IP6 A;  3LSR A;  3NAR A;  3S17 J;  4IHV A;  3O9X A;  4RDU A;  3WHC A;  1JTY A;  1MH4 A;  1LMB 3;  4PU7 A;  4AYB N;  3E7L A;  4M3G A;  1GT0 C;  1JKR C;  1LCC A;  4JX5 A;  2LK2 A;  2ZB9 A;  1R9T J;  4MCT A;  4F8D A;  1QP4 A;  5DS9 A;  1SAN A;  3GBG A;  5IYD J;  1SFO J;  4CYC B;  2YS9 A;  2LCV A;  1GV5 A;  4IA8 A;  2HI3 A;  2M34 A;  3S14 J;  1RET A;  3LSP A;  1TC3 C;  2H8R A;  4W1U A;  1ZS4 A;  1VND A;  2KEK A;  1AKH B;  1OCT C;  1RZS A;  3CDL A;  2CQQ A;  4I76 A;  1JFS A;  1BW5 A;  3BT9 A;  1Q1V A;  1ZUG A;  4QSH A;  1A5J A;  5J1U A;  1X2M A;  2MQK A;  4D7M A;  1HDD C;  4BY1 J;  2L9R A;  2WV1 A;  1JUS A;  2M8G X;  1WCM J;  2DA5 A;  3D1N I;  1K83 J;  3U3W A;  2DMN A;  2JK3 A;  3LFP A;  2A6C A;  2IBD A;  2MSY A;  1RIO A;  5EYR A;  3FMY A;  3JXB C;  2K40 A;  5M5X J;  2R92 J;  3HEF A;  2IEK A;  3IVP A;  2LYP A;  1WPK A;  4DZP A;  1NK3 P;  4V2F A;  2FD5 A;  2K9S A;  3FKI J;  3HOV J;  5J1Y A;  3CQZ J;  1RKW A;  4C3I J;  3ZQC A;  2AO9 A;  1JGG A;  5IOZ A;  2BNM A;  2KZ8 A;  4C3J J;  4I6Z A;  3F6W A;  4HNV A;  2R1J L;  2FJ1 A;  4A3E J;  2ID3 A;  5E3L A;  2TCT A;  2XGD A;  4AC0 A;  4IEJ A;  4Z59 A;  2EQR A;  5EGO B;  3TW6 A;  3S2D J;  2R5Y A;  1ZZ8 A;  3OQM A;  3UKG A;  4A69 C;  2N8G A;  4YAR A;  4PU4 C;  2H1K A;  3BR0 A;  2NVX J;  1BA5 A;  1AHD P;  2NS8 A;  1NK2 P;  4MLO A;  1K61 A;  4XRS G;  2YU9 J;  2NVT J;  3HBL A;  3ZQH A;  2QCO A;  1HOM A;  1WH6 A;  2Y31 A;  2E1O A;  2XGC A;  1T56 A;  4S0H B;  3ZQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...