2XSDC

Crystal structure of the dimeric oct-6 (pou3f1) pou domain bound to palindromic more dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
128
Chain Sequence
APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*AP)-3'
publication title Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 43
structure length 128
sequence length 151
ec nomenclature
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xsdC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2xsdC01
3O8GA 2G0EA 5GP9A 3GTKJ 3LSPA 2O49A 1JT6A 4CYCB 1HCRA 1PRVA 4MCTA 2PPXA 2JK3A 2X6OA 3F0CA 3Q0UA 3TW6A 4A69C 3JRIA 4IA8A 3PM1A 1GV5A 1XWRA 1R63A 1X2MA 4O8BA 1ETWA 3LISA 4X4BA 5E3LA 2ID6A 5EZHA 1BW6A 5E3NA 2HQ5A 3OP9A 1IG7A 4X4DA 5F0CA 1ZZ6A 3ZKCA 2LFBA 3S8QA 4UUSA 1MBJA 2JA5J 1RZRA 1RIOA 4MFDA 2AXVA 4XIDA 2HOSA 2DA6A 3QQAA 2B63J 3KXAA 1W0TA 1JKPC 4JCXA 3HGYA 2PUEA 3SCGA 3GTQJ 5A7LA 4FE7A 4V2GA 5FKLA 4BBRJ 1PNRA 2R7ZJ 5M5YJ 2MGQA 4L5EA 3BTIA 3FK6A 3MN2A 3F52A 5EGOB 4X4GA 2X48A 2DJNA 5IOYA 4JX6A 3S14J 3CLCA 2EZKA 3BT9A 3JRFA 1U78A 2IAIA 3OQMA 5J1RA 1ZK8A 1AHDP 2KDZA 3OMTA 3VK0A 1MH3A 1DU6A 1E3OC 1LCCA 2LKXA 1XS9A 1P7IA 2IU7A 3MVPA 2R63A 1TWHJ 1H89C 1QP7A 2PUAA 2GLOA 2DA2A 5EF6A 4FE4A 2IUOA 2DMNA 1GT0C 2AXUA 1LFBA 2O9LA 2JMWA 4X4HA 2L49A 1HDPA 1S7EA 3CDLA 4YG7B 3I4MJ 3FMYA 1HF0A 2PE5A 3CROL 2L7FP 5M3MJ 4IHWA 2R5ZA 1IRZA 1QP4A 3G1MA 5F27A 2EBIA 3JXDL 4JX4A 1CJGA 1TWCJ 1ETVA 2AWIA 1TWGJ 3BR0A 2TRTA 4GFBA 4IHVA 3IH3A 1MH4A 5GPCA 2JVLA 4OB4A 1ZS4A 3ZHMA 3HOZJ 5K98B 2IEKA 3BG3A 2DMQA 4QIWN 4YG1A 4FTHA 4DYQA 2JWTA 2GBYA 3ZHIA 3K2AA 1BA5A 4A3JJ 1IDZA 1VI0A 2HXIA 5EG0B 1HLVA 2DA5A 1VFCA 4I6RA 3WHBA 9ANTA 1JTXA 1ZKGA 4BXXJ 2HOAA 1PUFA 2K9NA 1WH6A 1NK2P 1SANA 1I6HJ 2Y30A 2L7ZA 1MBEA 3M3YJ 3DNVB 4B1RA 5FKKA 4F8DA 4Y42A 2WV1A 4Z5HA 3G5GA 1RKTA 2XCJA 2JA7J 2DA4A 5FKNA 2LR8A 1ITYA 3F51A 4AYBN 3ZQFA 4J1WA 2CQQA 1NEQA 1B8IB 1ENHA 4IWRA 1ORKA 3F6WA 3JRGA 2O4AA 4HNVA 1I50J 4D5CA 2CU7A 2K9SA 1R9TJ 2CSFA 1LLIA 2AO9A 4UUSB 1SFOJ 3VPRA 2ME0A 1EFAA 3HOWJ 1ZZCA 1ZZ8A 4PU3C 1BDIA 2OR1L 2EF8A 2FQ4A 3R1FA 3FISA 1X58A 3PXPA 4M3EA 1FJLA 2QF7A 1IC8A 4X6AJ 5J1UA 1YRNA 2L9RA 2CROA 2GRLA 1NK3P 3SFIA 1B0NA 5M3FJ 2MEZA 2XIUA 3TP3A 1WGXA 1F36A 4FISA 5J1YA 2COBA 3QQ6A 3JXBC 3U3WA 2LK2A 4A3GJ 2DA1A 3CMYA 4J19A 4MCXA 3BTLA 4X4EA 3A01A 1IDYA 3RZDJ 5F1JA 2CRGA 3QF3A 2HINA 2R5YA 3BR1A 4BY1J 2GZUA 4A3KJ 1MSFC 4PU4C 1FTTA 2EZLA 2YS9A 3TP0A 2M8GX 2VPRA 3ZQIA 2A6CA 3BD1A 4GHJA 1K83J 4I6ZA 2O8KA 2OFYA 5EEAA 1OFCX 1OJLA 3O8HA 1CQTA 3HOUJ 1Z77A 2Y9YA 4A3LJ 1JKOC 3MKLA 2LYSA 2W48A 2YU9J 1AKHA 3BG9A 1OCTC 2R93J 2R5ZB 2JA6J 1ZVVA 2I10A 3PO3J 3JREA 3CECA 4MIMA 2KEIA 1LFUP 1ETOA 1TWAJ 1ETYA 3OIOA 1BDHA 1XC5A 3HBLA 2JA8J 4GQMA 3OQOA 1EF4A 3B6CA 2JCGA 3E7LA 1F43A 1FTZA 1ZZ7A 4X4IA 2PUGA 1ZR2A 1YSEA 5JLXA 1JFSA 1VPWA 2PUDA 3FIWA 5GPAA 2R0QC 2EZHA 4RDUA 3S1NJ 2AXZA 2EBYA 1BL0A 3H3VK 3O9XA 3KZ3A 4QTRA 2LYJA 1JUSA 2JN6A 4G12A 4EEFG 2WUSR 1APLC 3CQZJ 5F0FA 5EZGA 4M6VA 5C4XJ 2H8RA 1L1MA 4M3DA 5BNGA 4A3IJ 2Y9ZA 5IP7J 1BW5A 3LNQA 2LP0A 1LE8B 4FCYA 1JJ6C 1JGGA 2HSGA 4JYKA 4W1UA 2VKVA 1HOMA 1BJZA 2DMPA 1ZPQA 1P7JA 3TRBA 1X2LA 3IH2A 1X2NA 2BNNA 3FYAA 2LYQA 3NAUA 3SDGA 4JP0A 1U9NA 1UXDA 4ABZA 2DTZA 4I76A 1UG2A 3A03A 1O4XA 3LOCA 1IGNA 3BR6A 3B7HA 3TW7A 2N8GA 4JQDA 4D7MA 2XPWA 2E2JJ 1MBHA 3JRBA 1WIZA 5IYDJ 4NDWA 2AW6A 2XSDC 1T33A 1DU0A 1JT0A 2L0KA 2CQXA 3HB9A 2ME6A 2LYKA 3RKQA 5IOZA 2LLKA 3BDNA 1IUFA 4C3IJ 1UTXA 4A3BJ 1GUUA 2DMTA 2YUSA 3LSJA 5IYCJ 1Y1WJ 4I6UA 4JCYA 3GTPJ 2M0CA 2IVBA 3BTJA 4C3JJ 2NVXJ 1PRUA 3RZZA 3SCFA 3UFDA 2FJ1A 2B5AA 1IJWC 3JRAA 3JXCL 2EQRA 4M3GA 1TC3C 1T56A 3HOYJ 2FD5A 4M3BA 5F0HA 2LYRA 4RBOA 4Z5CA 3A01B 2BJCA 1QPZA 1PRAA 3A02A 3GTLJ 2R5YB 2ECCA 3HOVJ 4A93J 1R69A 2FX0A 4BY7J 1A5JA 2E19A 2LD5A 4XRSA 2GRMA 1D5YA 2HYJA 5J3LA 4B3AA 3GN5A 4A3CJ 1JUMA 1Z0XA 1JFTA 4A3EJ 2X9DA 2NS8A 2LTPA 2NS7A 1TWFJ 1JKQC 2DN0A 3SCHA 1QVTA 3FYMA 3D1NI 2BNMA 5FLVA 2JJ7A 3LSRA 3BS3A 1G2HA 1B72A 5EDNA 4S0HB 3CCYA 1DWKA 2DA7A 1UHSA 1I3QJ 3ZQLA 2NVTJ 3S15J 1Q1VA 3BR5A 3BR2A 3H0GJ 5HODA 4V2FA 4XRSG 4UUTA 5FJ8J 1QVUA 3ZQGA 3S1RJ 2KEJA 1UXCA 3S16J 1RKWA 2AHQA 4AUXA 3G1OA 4C2MJ 3UKGA 2IV1A 2H1KA 1UMQA 1ZUGA 2O38A 1SQ8A 3HKZN 3HDDA 2ZB9A 2E2HJ 2XGDA 4J1XA 3SJMA 1X57A 1ZAYA 3FKIJ 4BBSJ 2IVGA 5DTDA 3S2DJ 3Q0VA 3OQNA 3RQIA 5FLMJ 5IP9J 2MW8A 1U9OA 1QPIA 1XG1A 3DEWA 3I4NJ 3DCFA 2LVSA 2ELKA 2HDDA 1JUPA 1ETKA 2K9QA 2HXOA 3GBFA 4DW6A 4X4FA 1B8IA 4A3FJ 3IVPA 2MG4A 3C2BA 4DYCA 2ICTA 1QQBA 5IP6A 3M4OJ 3FK7A 3LSGA 4PU8A 4Z59A 1ADRA 3JRDA 2KPJA 5C3EJ 4X1EA 4IHXA 1RZSA 1JTYA 3HEFA 3QPLA 2R1JL 2XPVA 2WB1N 1VF9A 1ZQ3P 3QPSA 5IYBJ 1NTCA 2KEKA 4AC0A 4D7NA 5EYRA 3PO2J 1ETQA 4FBIA 2XRLA 4IEJA 5C4JJ 1WCMJ 3TEDA 1PUFB 1WH5A 2E1OA 4Y52J 1NERA 2FJRA 1RETA 1Y7YA 1RPWA 3L1PA 1ZGWA 2OF7A 3K7AJ 3S2HJ 3JR9A 3H5TA 3BQYA 3IV5A 3KJXA 4CYCA 2XGCA 1GV2A 2D5VA 1VNDA 2EZIA 3GTMJ 1LQCA 5E3MA 3S1MJ 5FKOA 1DW9A 2NOGA 2MSYA 5IPAA 2IBDA 2AUWA 2P81A 3HOXJ 1QRYA 4C3HJ 3QWGA 1WH8A 2PMZN 3MLFA 2EH3A 4A3DJ 1K61A 2XI8A 3BR3A 4BKXA 3RZOJ 2DMUA 3HM5A 2ID3A 2MQKA 2XJ3A 4B4CA 4JX5A 4XICA 1LCDA 3ZOBA 2QCOA 5DS9A 1ZTRA 4IVZA 2Y0SN 3GN5B 2WAQN 1ETXA 3Q0WA 3ZQCA 3OOUA 2OPTA 4MFEA 2O7OA 2XB0X 3JRCA 3QYXA 1JWLA 5JLWA 2DA3A 3NARA 4I6TA 5EGOA 1JH9A 1WH7A 5FKMA 2NVQJ 1POUA 1MBFA 4LOCA 1ZZ9A 1A6IA 2TCTA 1Y1VJ 4W97A 1ZZBA 4A3MJ 1QQAA 1YRNB 1FIPA 2PUFA 4Z5DA 1RZRD 1B72B 3EUSA 2M2EA 1FIAA 3WHCA 2BNOA 1MBGA 5M5WJ 2CUFA 1AU7A 3GTGJ 2KZ8A 2L8NA 4M3FA 3Q3SA 2LCVA 3W6VA 2PIJA 4YG4A 1OCPA 2RAEA 2VKEA 3JRHA 3GTOJ 1H8AC 1GDTA 4MLOA 1LMB3 4YBAA 3HZIB 4XK4A 1POGA 3IH4A 2IVQA 4FN3A 1OSLA 1QP0A 4DYRA 1IV6A 2LYLA 2PUBA 1LE8A 1Y9QA 4I8TA 2K40A 4DZPA 4QSHA 3BG5A 2GM4A 2CJJA 4X4CA 5F08A 2M34A 1ZR4A 4IHYA 1AKHB 2WIUB 2L7MP 2LY9A 2VI6A 3G1LA 1W0UA 1PERL 2VUMJ 4YARA 2KT0A 2XPUA 5E3OA 3GTJJ 1JJ8C 2E2IJ 1WETA 2Y31A 4DZJA 3S1QJ 3B6AA 1JKRC 2PUCA 4PU7A 3OSFA 3BQZA 5K7FA 4Z58A 1MBKA 3GBGA 1WI3A 2CUEA 1U8BA 5EG0A 2HOTA 1GVDA 1FEXA 1RR7A 1H88C 2EWTA 5C44J 3G7DA 3S17J 3HGGA 2HI3A 5F04A 2R92J 4MO7A 3LFPA 2LYPA 5K7HA 4Y7NJ 1HDDC 3OSGA 3ZQHA 2XB5A 4XRMA 1RESA 5M5XJ 1MNMC 2M9HA 1RPEL 4NDLA 2NVYJ 3BTCA 1MSEC 2Y2ZA 1WPKA 4D5FA 5K7ZA 2ICPA 2ECBA 2XGEA
chains in the Genus database with same CATH superfamily
1FP2A 2EK5A 2KMUA 3KP2A 4ZYDA 2ZXWH 3LSPA 2F5FA 1RC9A 1FYKA 2H27A 3LAPA 4BEHB 1HCRA 4HEA2 1PRVA 4PFOA 3MAJA 1OCCH 2FOKA 4A69C 4IA8A 1RI7A 2EA4A 2PQ8A 1D5VA 1D3YA 2VIXA 3MFKA 2DTRA 1R63A 1DP7P 1KA8A 4LK0F 4BGDA 5E3LA 5EZHA 5KK1A 5HDGA 1ZZ6A 3GX4X 4PGGA 1RIOA 2AXVA 2DA6A 3QQAA 3KXAA 3DKYA 1JKPC 4JCXA 3M9LA 4HA8A 3BC8A 2PUEA 1IV8A 3SCGA 3GFIA 2VQCA 4EJVA 4FE7A 3PFIA 2WY7Q 3QRFF 5M5YJ 4E6KG 5CVUA 4QLCU 3IHUA 3I58A 2X48A 3IAS2 1IF1A 1LEAA 1VQLI 3FXLA 2EZKA 2L02A 2IAIA 2A3SA 1JI8A 3OMTA 3VK0A 2IU7A 4KUMA 1MJBA 3VEPA 3AAFA 3GMEA 2Y75A 1TWHJ 1WJAA 4XLCA 2JA2A 3H1CA 3SZTA 3OR1C 1H89C 4L18B 4QPOA 2IUOA 2ZNZA 3I5UA 3NRVA 2DMNA 4DBRA 1GT0C 2AXUA 1LFBA 2VBZA 4I01A 4M73A 3OYAA 3F21A 3CDLA 4Q47A 3I4MJ 2DT6A 3TGNA 1HF0A 1W5SA 1E17A 3BROA 3DBRB 4AU7A 3OYJA 1DDNA 2DPDA 2LY1A 4IHWA 1V3FA 4PSWA 1Z05A 2EBIA 2QYOA 4JX4A 5F27A 2ZFUA 4P9UA 1YO5C 3EUHA 4N9IA 1TWGJ 2K3PA 4G6QA 2ETHA 4GFBA 2DMQA 3OOPA 2PEXA 4DYQA 2GBYA 2EINH 1JHHA 3K2AA 4A3JJ 1WSUA 1BA5A 4E7KA 3PUBA 1IDZA 2XC7A 1SD5A 2KFDA 2VBXA 3T1BA 3WHBA 1YQAA 4KIGA 5JFRA 4M6XA 1R7JA 1D1BA 3BZKA 4HYEA 4TV7A 4BXXJ 3FMSA 2K9NA 1VQ4I 4ZYHA 2YR2A 1WH6A 2BE5F 4RM2A 5JUWA 1BBYA 2L7ZA 3M3YJ 2VODA 1K78A 5FKKA 2WV1A 4Z5HA 4Z6YA 1SMTA 2DA4A 2X1DA 3E3VA 3HSFA 1ITYA 4AYBN 3A9XA 2KLOA 4OIRF 2CG4A 4N4NB 5KAIC 1KONA 1SAXA 2PJRA 3OWQA 1Z7UA 5L3FA 1NEQA 3ISPA 2D1HA 2NYXA 2MYSA 2O4AA 1EH6A 4HNVA 2CU7A 2HNHA 3K2ZA 4ESFA 2HPIA 3KZYA 1EKEA 1MKMA 2CSFA 3V4GA 1LLIA 4UUSB 5FFZA 2ME0A 1EFAA 1V5FA 3HOWJ 1DP3A 1ZZCA 2EF8A 4CSWA 2XSJC 4YEJA 4HDVA 3DKXA 1LQ1A 4IRIA 2QQAA 5E1XA 3G0TA 1D0ZA 2QF7A 3TKYA 4X6AJ 3O6BB 5J1UA 3CCMI 2CROA 3OS2A 2J5OA 5HDKA 2XIUA 2MEZA 4WF2A 1VQMI 4EM2A 4B44A 2COBA 3U3WA 4A3GJ 1E3PA 1R58A 2JUGA 4BJ5C 1UHWA 4KIBA 3CMYA 3ZCOA 3CDIA 5LEJA 3WU0A 2HINA 1TT5B 2WADA 2VPLA 2IW5A 3HRSA 1MSFC 2CQKA 4NQWA 1FTTA 2JVGA 2D2WA 3ZQIA 1MMSA 4GHJA 1K83J 1CF7A 1DULA 1U8RA 3CCRI 3FMRA 5CYVA 1HKQA 4OOIA 1CQTA 4NHJA 1Z77A 2CW8A 2Y9YA 1EJ9A 3HRMA 4ASNA 1ZG1A 1MW7A 1MMDA 3SR4A 1AKHA 5GAHi 2R4GA 3BG9A 4PFPA 1I27A 2OQRA 1XGOA 3DPUA 1ZVVA 2I10A 4PGHA 4E4HA 1VTNC 3GZCA 1LFUP 1ETYA 1TT0A 1MJ9A 2FBKA 1XC5A 4K2EA 1R49A 4GQMA 1QPMA 4KN4X 4II3A 4BDZA 4CICA 1EF4A 1U5TB 2CSOA 3QFIA 3FWEA 3E7LA 4BE2A 2RV8A 4G94A 3K70D 1YSEA 2K86A 1VPWA 4EVIA 2EBYA 3OYGA 5J4VA 3WG9A 4QTRA 2PMHA 2FEZA 1DGWY 4RLQA 3H0DA 1W7PB 1XDSA 1APLC 3CQZJ 5EZGA 2IGOA 4N9HA 4ZTJA 5BNGA 4ZZDA 1L1MA 4CH7A 1DQUA 2Z1DA 1HQ1A 2PXEA 3CF5F 1K7AA 2LNBA 4FCYA 4DIQA 1NH3A 1HOMA 2VKVA 1ERDA 5F64A 1I1GA 2DOEA 1ZPQA 1QU3A 3IH2A 1N78A 1V54H 1X2NA 4IXAA 2ZJ2A 2K85A 1U9NA 3K70C 3V7SA 4ABZA 3ZN0A 3A03A 1O4XA 1W5TA 3B7HA 2FNPA 2EB7A 2Y0SA 3CCQI 3SX0A 2N8GA 3LWFA 4RB1A 3BJOA 1HKTA 1HC8A 4NDWA 2V7FA 3WU2C 3CO6C 3H5RA 4KICA 2A61A 1DU0A 5CQEA 1JT0A 1O3TA 3HB9A 4XSZF 3WU1B 2LLKA 1D0YA 4O5VA 4C3IJ 4RS8A 1C0WA 2QUFA 3J7AO 2CFOA 2DI3A 1GUUA 2DLLA 3LSJA 4JCYA 4I6UA 2BBYA 3GTPJ 2IVBA 3BTJA 4C3JJ 1PRUA 3RZZA 4P55A 4DOZA 3JRAA 1QHGA 3H35A 3VYUB 3JXCL 3KL4A 2RKHA 1IRFA 1T38A 3SEQA 4M3BA 5F0HA 1KGSA 2MD0A 3CTAA 3BG7A 2MC4A 3K4JA 2BJCA 2M30A 2ZXHA 4DE8A 4A0YA 1A35A 1TLHB 2DW4A 3HOVJ 4BY7J 1A5JA 2FBIA 2E19A 3KLOA 4EATA 2KZVA 3LSKA 2BV6A 3K1PA 4B3XA 4XRSA 2L4AA 5LHHA 5AIPA 3GN5A 4II2A 4UB6C 2GWRA 1JUMA 1Z0XA 3ERMA 5CQGA 1JFTA 3L2QA 3LA7A 3LAJA 3SCHA 4UV8A 1LVAA 1PP8F 3D1NI 1L0OC 4LLLA 2X1CA 5FLVA 3DQVC 4XN0A 2FUG2 1B72A 2EFPA 1DWKA 1WFXA 4P5OA 1Z6RA 3S15J 1Q1VA 3CCVI 3OY9A 3BR2A 3H0GJ 4L9VA 5HODA 5FJ8J 2X1EA 3S1RJ 1QVUA 3ZQGA 2JQ7A 1WRJA 4CO8A 1S5LC 5E8GA 4YG2F 4OAYA 4M9XA 1KU7A 1Z3YA 3HXLA 3GO5A 1ZUGA 3R61A 4O6JA 2WY8Q 1WJDA 2KIMA 2NNNA 3E5QA 4J1XA 5EEHA 1ZAYA 2ZMEC 2M45A 3FKIJ 1ZG5A 3CUQA 3M8JA 3MQ0A 2BXYA 2QGUA 1MDMB 2PFBA 1QPIA 2ZCWA 4RAFA 1VQNI 2V4JC 3B02A 5B66C 3C7JA 3DCFA 3T5XA 3TDUC 2G7UA 1H9TA 2CH0A 1JUPA 1ETKA 2K9QA 2R7TA 3H9JA 3M1EA 3KLNA 4V19K 3DKWA 4IPAA 3FZVA 4UY8I 2X51A 5GAGi 3R0JA 2MG4A 1F1ZA 5K5RA 1OYWA 3M4OJ 1XMXA 2O5RA 3LSGA 1P4AA 4BDYA 2HVRA 2KPJA 2BHYA 4F92B 1FY7A 2HWVA 1W4MA 2YU3A 3HJEA 1IXCA 4AD9A 2Z9OA 4HPQA 2XPVA 4GXOA 3M8EA 1FBQA 1N75A 3RYRA 5IYBJ 1SVOA 2UWMA 2DYSH 4ZYAA 3GWZA 1OR7A 2P5LC 5DT2A 1ULYA 3TEDA 1WH5A 5K1YA 1MZBA 1XGSA 1RETA 1PVEA 1ZGWA 4BACA 1K78B 3S2HJ 3ABMH 4BEHA 3KJXA 2PMZA 1VNDA 2EZIA 1LQCA 3OS1A 2IS4A 5L3DA 5E3MA 2GOXB 3GF2A 1G3SA 1R1VA 2P81A 3VB2A 1AA7A 2K5CA 4BE0A 3ULQB 1WZ2A 1X4PA 1K61A 1FOKA 1P92A 3ABTA 2DMUA 2L1PA 2IA2A 3KZIC 4D9JA 3HM5A 1VQ6I 2XJ3A 3TEPA 4B4CA 2X6XA 3OWTA 2QCOA 3KETA 2DFEA 1ZTRA 2DFIA 4IVZA 1LFPA 3ZQCA 2STWA 4L0ZB 2L9SA 2O6GE 3NARA 3PJRA 2LC2A 3K4MA 4ZH4F 2MXDA 3LSMA 3MZHA 3D5LA 3H3UA 4YFNF 1NHAA 2M2EA 2FNAA 1ZGAA 1XGNA 4I99C 2WA0A 5BPIA 3BG6A 2QM3A 2JPBA 2EFQA 2CUFA 2FXAA 4YG4A 2KQRA 3CCJI 5LHIA 3AG4H 3JRHA 4ZTFA 4YBAA 3H5NA 1POGA 3HOTA 1OSLA 2JT1A 3I4PA 4DYRA 1HXDA 1IV6A 2IS1A 1YX3A 5D5WB 2BZTA 4RMNA 4XR6A 4J00A 5GADJ 4BQOA 1H9GA 3LQRA 3BG5A 3WTSC 2ADUA 4IHYA 1AKHB 2MA3A 2L7MP 4GCVA 4KA4A 1PERL 2R7XA 1T2KA 2RREA 2LYCA 3GTJJ 1JJ8C 3DM5A 2K27A 5JHFA 4HLYA 2E7WA 3ME5A 3OSFA 3BQZA 4IOAF 2XAUA 4PU7A 1YE9A 1G4DA 1MBKA 5IT9K 1WI3A 2CUEA 2KZGA 3ONQA 4NUBA 5KVRA 2HOTA 1WJCA 4ER3A 1ZG3A 3KP4A 2HI3A 3LFPA 2RNJA 3WGGA 3WTZA 1SFXA 5E17F 1T95A 5K7HA 2V6EA 1I1SA 2ZJQF 2JQEA 4KMUX 5ILUA 2MC3A 1UFMA 4HV6A 1HSJA 5KAFC 4XRMA 3OYMA 2KISA 1I5ZA 4NDLA 2L9NA 2NVYJ 4YELA 4OIPF 1STZA 4D5FA 2ICPA 1J5YA 2VQGA 2ECBA 5IOZA 2L2OA 4RAZA 3SZGA 3F9KA 4U7BA 4WVLA 4CYCB 1WHUA 3T0YA 2PPXA 2JK3A 1VQ5I 3FKJA 3F0CA 1M1EB 3Q0UA 2QWWA 4F91B 1T8IA 5BOXA 2J7WA 2UZKA 2KKOA 1ETWA 3LISA 3EYYA 4U0YA 4EGZA 2E1NA 3EUHC 4ER6A 2HQ5A 2MLGA 5DDGA 1ZRCA 2MH9A 3I3LA 4UUSA 2JA5J 4HQMA 2VJJA 2PXLA 2HOSA 5LRSA 2R7VA 2LRDA 1KU3A 4BBRJ 3FXOA 2NAZA 2R7ZJ 2VOOA 4DJAA 3BTIA 3FK6A 1OLTA 3MN2A 3RKWA 5EGOB 3F52A 2DJNA 1IRXA 4JX6A 2CQ7A 5LGTA 3L2CA 3S14J 3BT9A 4XLFA 3MCZA 3JRFA 3GEZA 2W25A 1ZK8A 2KDZA 4EZIA 2AQFA 2KRHA 3DFGA 2GAUA 1K6OA 1LCCA 2LKXA 1P7IA 1XTAA 2LF7A 2P6SA 4WK8F 4OMYA 2DBBA 2PUAA 1WJEA 4XLAA 5K5OA 2BW3B 3ERED 4JOMA 4E70A 3HUGA 2JMWA 4U87A 4KNYA 2L49A 3I54A 2DOAA 1HKSA 4YG7B 3E5XA 4P96A 3OYIA 5GAEJ 2PE5A 3CROL 4E7ZA 2FMLA 2ZSHB 5J6XA 4IQJA 3LFKA 1QP4A 1TW3A 3G1MA 3OYKA 2IA0A 4MNUA 4JK1X 2HEOA 4EMSA 2AWIA 4E7SA 1U3EM 2Q1ZB 2F4MB 3QP6A 4IHVA 3ZHMA 3IH3A 5IT9Z 1LVKA 1U5TA 2LKSA 2RNGA 5JHUA 5K98B 3BG3A 5DTQA 2ZBKA 4KITB 2JWTA 2ZJPF 4HX8A 1FZPB 2L54A 2HXIA 3QAHA 2OJED 3CMAI 3CD6I 3OYEA 3TO7A 2RVCA 1WQ2A 2UUZA 2XF7A 1EH8A 1W7PA 1BM9A 2XRNA 2EV5A 3HHHA 1KU9A 2PXVA 4YIFA 1NK2P 1ZAOA 2R3SA 1JXSA 1MBEA 3G4SI 3VDXA 2O8XA 4B1RA 1FBSA 1TQPA 1QBJA 1IN7A 4BNCA 3CF2A 3J7ZI 4ENKA 3PUFA 2RGVA 5KNLA 3ZN1A 5ICFA 3ZQFA 4J1WA 1XMKA 3IAM2 3TBIA 1Y8RB 2CQQA 2FBHA 2O0YA 4HZFA 2F4OB 1PYVA 2EWNA 2L9VA 2PXPA 1X3WB 3DXJF 1LJ9A 1MMGA 1FSHA 1ORKA 3JRGA 3I64A 4U0VA 2XF6A 2VT3A 3TL4X 1KZHA 2IGKA 4L0YB 1K4TA 2ZJRF 1ZELA 3CP2A 4PU3C 1BDIA 2OR1L 5EJCA 2FQ4A 2WBMA 4EQZA 3FISA 1IN4A 3CJRB 2OTJI 3PXPA 2Z99A 4M3EA 4XLHA 3K4KA 1BI1A 1I6XA 2L9RA 4BAYA 3TMOA 3EETA 1B0NA 2R7DA 1F36A 3HTSB 4HG2A 4IHTA 1MGTA 2J7UA 4ER5A 4IX7A 4H0EA 4I7HA 3QPHA 4UXNA 4BU2A 1R5GA 3Q9VA 4F52A 4L9JA 5J47A 3BWGA 4ESJA 3BTLA 1IDYA 3J80Z 3QOEA 3FXJA 2R7QA 3BR1A 1ON2A 2X6YA 3RJPA 5CVJA 1K6YA 3BD1A 3L2UA 4ZDPA 4AVZA 5EEAA 2WC2A 4HX4A 2DT5A 2P8TA 3WTXC 3MWMA 4E7HA 3KZZA 2HZTA 3HOUJ 3DU5A 1TTYA 4A3LJ 3HYIA 2H8WA 2W85A 3U1DA 2K7LA 1X1CA 2MBFA 2XXPA 3RDIA 4PK4A 2R5ZB 2JA6J 1F9NA 2VBYA 4CCNA 3CECA 4MIMA 5DUIA 1ETOA 1TWAJ 3KE2A 4HSRA 5ICGA 1FNNA 1BDHA 3HBLA 2A68F 5FB2A 1SC7A 3B6CA 2E60A 4LK1F 3ASNH 4RGXA 3WGIA 5TRDA 1F43A 1FTZA 1ZZ7A 5BS6A 3EQLF 1O7FA 5GPAA 2CQNA 3L9FA 2EZHA 2HTJA 3KCCA 2AXZA 3S1NJ 1BL0A 2Z33A 3KZ3A 2LYJA 1JUSA 4EEFG 1TL8A 1SD6A 3IL2A 5FLXK 4M6VA 1MDMA 5C4XJ 2H8RA 3DV8A 4M3DA 4MHGA 1ON1A 2CMPA 5IP7J 4CCMA 4LG3A 2DQRA 4CGZA 2BXZA 2HSGA 4JYKA 2W57A 3M8FA 2UXNA 4JP0A 1D1CA 5HNFA 2VQHA 2EPFA 2E36A 4IVNA 1HW5A 2WTEA 3H92A 3LSTA 3OV8A 3BR6A 5FRNA 2WAQA 3TW7A 4R1HA 2QQ9A 4JQDA 3BOQA 3U2RA 5LHGA 3ZPXA 1MBHA 1BR2A 3RTRA 1WIZA 3I55I 3F6VA 5D5UB 2ZXIA 3IP4B 3H5AA 2LNMA 3FX3A 1O3SA 3ZMUA 2LREA 3EDPA 2CQXA 2ME6A 3RKQA 1LEBA 3BDNA 2QKMB 2AXTC 3R0AA 1SFEA 3COAC 1MMAA 4CUGA 4WXHA 2M0CA 3UFDA 5DM6F 3VWSA 1PUEE 1LKXA 2PXBA 3KP6A 2FD5A 3OYBA 3CMEI 2ICWG 3A01B 4XOPA 1R71A 1KQ0A 3GTLJ 5E1ZB 4A93J 3JSOA 2KIFA 3HRUA 3I59B 3K4NA 3S3OA 4GDFA 2WWYA 3J7AY 2VB6A 1OMIA 1ZREA 1W36D 4EK9A 2HYJA 2BYVE 3LMMA 5FFXA 5J3LA 4HF1A 5D4SA 4CYDA 2IVMA 2B0LA 2DFFA 2LDUA 2QSGX 3JTGA 3E6CC 1TWFJ 1XGMA 5DD4A 4WXCA 2DN0A 3NWSA 2GXAA 2VONA 2JJ7A 5LLQA 3CCUI 1G2HA 2KDOA 5EDNA 4P1WA 2DA7A 1OR7C 1UHSA 2XV4S 3PL8A 3REOA 3BR5A 1S72I 2KEJA 1XN7A 1YW8A 3GUDA 4V2FA 4XRSG 2F48A 4C2TA 2QSFX 3S16J 3W2VA 1W36C 5FLXZ 4C2MJ 2IV1A 2UV1A 3EPZA 1SQ8A 5L3CA 3NWTA 1QHHD 2MH2A 3HDDA 3G2BA 2D45A 2ELJA 2QBYB 3M1CA 3HUGB 3W2WA 2IVGA 5DTDA 3Q0VA 1W1WE 3LQQA 5J8CA 3NEUA 3ABKH 2ISYA 3JSPA 3DEWA 1P2FA 2LVSA 3GW2A 2HDCA 2HCSA 1FMWA 2OBPA 4EM0B 3HG9A 4DBQA 4IO9F 4KDPA 2HR3A 4AIDA 5L3EA 4PZJA 1QQBA 4DYCA 2ICTA 5IP6A 1O3QA 3D5SC 1J75A 2WB1A 1TZLA 3F6OA 3V7RA 4Z59A 5HLTA 4BJTA 3H9GA 3H36A 2RN7A 3DBLB 2PXDA 4IHXA 1QZXA 2E1CA 1RZSA 4LB6B 2R1JL 2L5QA 2C6YA 2OC6A 1MMNA 2K02A 1NTCA 5ERIA 3ECOA 3IC7A 4AC0A 5EYRA 2DQLA 3PNTA 4IEJA 2E35A 3F22A 3ZPLA 5C4JJ 1WCMJ 2HKOA 4KMFA 3A9ZA 1R1UA 2E1OA 1NERA 4A12A 1HA8A 2FJRA 1Y7YA 4IJAA 1RPWA 3L1PA 1JGSA 3H5TA 4WXDA 1O57A 4NC6A 4ZJZA 4CYCA 2YBDA 4G7HF 3F8BA 1BJAA 1MFQC 5FKOA 2FA5A 1DW9A 1FP1D 2NOGA 3PQKA 2IBDA 1HBXG 3HOXJ 1ZLKA 3M9AA 3AL0C 3ZMSA 4C3HJ 2PMZN 3MLFA 5TJJA 3CUOA 1FYMA 4A3DJ 3W6KB 2CW0F 1L3LA 2IA1A 3BR3A 3GLXA 4BKXA 4LLNA 2LLWA 5DRYA 1RIOH 4BYYA 2G7HA 3A0BC 1J2XA 4JX5A 1VQ9I 3I0TA 3IRRA 3I71A 2E1MB 4ENNA 3PIPF 4OINF 2HFZA 4HAMA 4UVAA 4BQAA 4G7ZF 2DA3A 5EGOA 1JH9A 2M8EA 4NNJA 1ZZ9A 1MBFA 2TCTA 1B59A 3I53A 4W97A 1ZZBA 2M4HA 2PUFA 3FBNB 4XKCA 3TOBA 2AQEA 3P9IA 4WWCA 4CXFA 5H20A 4GYIA 2BNOA 2X0LA 1MIJA 3WE3A 3RPUA 4M3FA 3Q3SA 2LCVA 3W6VA 2PIJA 2BW3A 2RAEA 1KYWA 1YW7A 1H8AC 4HOBA 2ELHA 3HZIB 1NG6A 4XK4A 2O61A 1ACIA 2IVQA 2LYLA 4ZDLA 3FM3A 2NXNB 4RGUA 4AYBA 3L2VA 4A5NA 2K40A 3P9CA 1Y39A 1RUOA 2GM4A 2CJJA 1LB2A 4B8XA 3P5JA 1QO0D 2WIUB 2K3FA 2LY9A 3G1LA 3PSFA 3CCSI 5ICEA 3MZ8A 2VE8A 1YW9A 2VUMJ 2KT0A 1ODDA 2XPUA 3K4LA 2E2IJ 3E6DA 3RQ4A 1YJWI 2OA4A 3WTYC 1J0RA 1GVJA 1WKMA 2CUJA 1X1AA 5K7FA 5E1WA 2Z5UA 1GXPA 1V5EA 3GBGA 1RR7A 5CVIA 3U1KA 2XF5A 1ZGJA 2ODRD 5DUKA 2AS5F 5KHDA 3K4CA 4Y7NJ 2LG4A 4L5IA 4G6DA 4E7LA 2K4JA 3ZQHA 1RESA 1MNMC 4OU0A 1P4XA 2Y2ZA 2QENA 2E5ZA 2OU2A 4CZZA 4S05A 3O8GA 2G0EA 2PXTA 2B9SA 2HYFA 5B3SH 3K1MA 2A69F 5D5XB 2A07F 4MCTA 1V55H 4EKGA 1W7PD 2HS5A 2X6OA 3R60A 3JRIA 2FRHA 1XWRA 1X2MA 1S29A 5BQTA 5DCMB 3HIFA 4E7IA 3OP9A 3JCUC 3ZKCA 3QU6A 1IG7A 5F0CA 3W3CA 3S8QA 2IS2A 1U5TC 1RZRA 1FOXA 4MFDA 1YS7A 3E0JB 4PCQA 3C2HA 4M9SA 4XIDA 3S3MA 2I5UA 4PJ0C 2B63J 4HX7A 5FROA 3OYNA 4PJNA 3S2WA 3U21A 1FOWA 2M1BA 3MEXA 3GTQJ 1X1BA 5FKLA 1D1AA 4YFXF 2V26A 2AXLA 1FSEA 4L5EA 3OL4A 4XOTA 4FQGA 3X2QH 3V8LA 5IOYA 4DE9A 2F5DA 5DCFA 2DOFA 1XCBA 5HLGA 2H6CA 2FE3A 1U78A 3OQMA 5J1RA 3V42A 4GRIA 1AHDP 1MH3A 1UZCA 3JAMZ 2OV7A 4X0GA 3F23A 1XS9A 3RKYA 3V8JA 3MVPA 2Z16A 1D0XA 1UELB 3R09A 1QP7A 3FHNA 2DA2A 5EF6A 4FE4A 2VL8A 2PXFA 2EFNA 4IKFA 2XKOA 4A6DA 3U9GA 4X4HA 4XRFA 3ZGKA 1DGRM 1HDPA 1S7EA 2L7KA 2LSOA 3A4CA 3RYPA 2L7FP 3B73A 4LIUA 1NW3A 2R5ZA 1XDUA 3JXDL 4EKIA 1K79A 1CJGA 4Q48A 1YIJI 4OBMA 3BR0A 2TRTA 4EGYA 4OB4A 3LFUA 1ZS4A 1HSTA 3LSIA 2IEKA 4I98B 2B7EA 4QIWN 4ER7A 4YG1A 4FTHA 3ML6A 2FU4A 2DDBA 3FXRA 1OCRH 2GA2A 3GUUA 1IN8A 3DLAA 5EG0B 1HLVA 3EUKL 3KIOA 4I6RA 4I0BA 2XVCA 1BOBA 1OQYA 1JTXA 1S7OA 1ZKGA 2HOAA 1BC7C 3VSLA 1Y56A 3KFWX 1I6HJ 1D8JA 1TW2A 3DNVB 2LOOA 4XLNF 5FD5A 5D8KB 3G5GA 2M5WA 1WVRA 3O3KA 5GAHJ 2PBIA 5ED4A 2JA7J 2CS3A 3ZMZA 1IXRC 5FKNA 1FYLA 3F51A 3KYCB 5HLIA 1TP4A 1ENHA 4OIQF 4ZDOA 4IHSA 5F6FA 2OCEA 4D5CA 2K9SA 2XROA 3MKWB 4KT5C 1T0FA 3L00A 3WTTC 2AO9A 1E3HA 3FM5A 3GZDA 2DYRH 3K10A 1X58A 1U6GA 3GFMA 3SQNA 1FJLA 2PXKA 1IC8A 3UWPA 2JSPA 1YRNA 1FT9A 1ZN2A 1BI3A 1Y0NA 4JBAA 5CPRB 2GRLA 3SFIA 3WG7H 3I56I 5M3FJ 5HLHA 1WJ5A 4CCKA 4AVPA 3N97A 2RQPA 2QZ8A 3PIOF 2IT0A 2DA1A 4J19A 1YJNI 4MCXA 3MKZA 2F4IA 3A01A 1SFKA 3K4BA 3RZDJ 1ZRDA 2CRGA 3R6SA 3QF3A 5IY5H 1IXSB 1XSXA 1YIOA 2VKHA 5HS7A 2GZUA 2JTVA 3I59A 4A3KJ 2E71A 2EZLA 2ZO4A 3TP0A 2VPRA 1YHQI 2LY2A 3BPVA 5A2QZ 2O8KA 2OFYA 1OFCX 2M87A 3PE5A 4CA0A 1P9QC 5DEQA 1QGPA 2COMA 5FO5A 4F3QA 2NVUB 4C30A 2L4MA 1FMVA 4Z2YA 1JKOC 2PG4A 2W48A 1X19A 1OCTC 1FWZA 4G7OF 3L09A 3S8PA 2R93J 1T08B 1XSVA 2VC1A 3FXUA 4KFCA 3GXOA 4UVCA 3PO3J 3JREA 4IOCF 4HF0A 5AONA 2JA8J 2ISZA 2DT7B 3LSHA 5L3BA 3OQOA 3GZ5A 3GZ6A 2JCGA 2EIKH 1JFSA 4NBQA 5LGUA 1SEUA 4RDUA 2BEOA 1KYZA 2F5VA 4IZZA 2QQBA 3H3VK 2FQ3A 3O9XA 1KU2A 4B43A 3E1SA 2H6BA 3F8FA 3LA3A 3J80K 4MGRA 4G12A 4U7DA 2QBYA 2M4GA 1WI9A 4OMZA 1ZH5A 3GLLA 1S3JA 5F0FA 2KPMA 3A0HC 4A3IJ 4QWQA 4IRGA 1BW5A 2LP0A 4F7ZA 3HHGA 2NRAC 3CJQB 1JJ6C 4CCJA 4W1UA 1XX5A 2DMPA 4LLGF 2XUBA 1P7JA 3KP3A 6PAXA 3TRBA 2VOPA 1X2LA 4XORA 3GZNB 3W2AA 2BNNA 3FYAA 2LYQA 3NAUA 3NROA 3SDGA 1Z6TA 3WODF 1LNWA 2ZFWA 1IUYA 1UXDA 1BOAA 2VT2A 2ZSIB 2LF8A 5CKTA 3LOCA 3BLYA 4XKVA 2E2JJ 2XPWA 3ZXSA 3MMYB 4F93B 5H6QA 2AW6A 1BI2A 2XSDC 4QPQA 3BPXA 5LD2C 1T33A 4OIOF 1Z91A 2QLZA 1FBUA 3O2PE 3QYBA 5HNHA 2LYKA 4G6TB 3N4MA 2HQRA 5JVTA 4AIJA 3OS0A 3OL3A 3CC2I 3CC4I 1A36A 1VQKI 3CMMA 4A3BJ 2DMTA 3DEUA 1R5HA 3V8KA 4M6YA 4YFKF 5IYCJ 1CGPA 1SVMA 2XDVA 5JI6A 4ON0A 2R7UA 3RSNA 2NVXJ 1ZYRF 3KPHA 4N0BA 2EQRA 2VE9A 4M3GA 1F4KA 1G8XA 5E18F 2JSCA 1T56A 3HOYJ 2EA2A 4ESBA 2PXUA 1QPZA 5GAGJ 1YITI 4ZYGA 3SZPA 1BIBA 3F8NA 3GCMA 4XM3A 4M72A 2R5YB 4E7JA 4I0AA 1R69A 4MQVA 1X3UA 3BDDA 3KP7A 4XONA 2LD5A 1BR1A 2LBFB 3QOPA 1ZRFA 2GRMA 3CJNA 4LG0B 2PN6A 3ABLH 4A3EJ 2KL4A 2NS8A 3K1NA 3G73A 2VKDA 2NS7A 3CO7C 2V3CC 1V5GA 4CCOA 1JKQC 2FFHA 3HC7A 4OWRB 1IAWA 3FYMA 3K6GA 5D8LB 5BPDA 2CV1A 1YS6A 1V4RA 3BS3A 4H4KC 2HCNA 3CC7I 2PMUA 4WCGA 2MD5A 2CWEA 2O3FA 1I3QJ 2NVTJ 1E2XA 3WGHA 3OYCA 3EUAA 3LL7A 4HLXA 3HKZA 4UUTA 2R7RA 1UXCA 4A2UA 1KQ8A 2YX7A 3T8RA 3UKGA 4P9FA 2KJCA 2H1KA 2RQQA 4M9ZA 2O38A 3H9QA 3QYFA 2ZB9A 2OZ6A 1Y8QB 2XGDA 3V7CA 3SJMA 3KX2A 2XIGA 4RGRA 4HNTA 4BBSJ 3H3ZA 1X57A 3FHZA 4ETSA 3S2DJ 3OQNA 3TDZC 5FLMJ 4AIKA 2MW8A 2A6EF 1U9OA 2GQQA 3I4NJ 3RPUD 2ELKA 4LB5A 3L2WA 1VQOI 2VBWA 3G71I 2GOMA 4X4FA 2W82A 4HNUA 1FX7A 3AG1H 3VFZA 1Z3XA 4A3FJ 1OYIA 1B8IA 3IVPA 3C2BA 4ANJA 2ACJA 1QA6A 4BJ6C 2M0MA 3FK7A 4LD5A 1FOYA 1OCOH 4PU8A 3UR3C 3VYSB 5BMZA 3JRDA 2LKPA 5C3EJ 4X1EA 5TISC 1YFHA 1OISA 1JTYA 3HEFA 4R8HA 2WB1N 1VF9A 3QPSA 3ROUA 2FOWA 3KEOA 5HS8A 2ESHA 4KIFA 2IRFG 1QZYA 3NDBB 3DEEA 4BHCA 1RZ4A 2Q2EB 3JTHA 3K7AJ 1GHCA 4GYGA 4ITVA 2ESNA 2L01A 3BQYA 3W6JB 3IV5A 4EQQA 3IKVA 3GTMJ 5CJ9A 1PP7U 2EV6A 4S04A 3S1MJ 3SFZA 2W24A 2MSYA 4L9NA 5IPAA 4BHBA 2AUWA 2V1NA 5DCMA 4L9TA 3K0LA 5K5QA 3QWGA 5J8FA 2EH3A 2HVSA 2HTSA 2XI8A 3ABUA 3HTUA 1TNTA 3RZOJ 3DU6A 3T8TA 3MEJA 5CLSA 3CLOA 3P9KA 1SFUA 4EJUA 2MQKA 1LCDA 2Y48A 4ZZLA 3ZOBA 1YJ9I 1LUJB 3D0SA 4XN3A 2Y0SN 1ETXA 3S3NA 3Q0WA 2OPTA 4MFEA 2Y69H 2OTLI 3QYXA 1JWLA 3AL0B 4BS9A 5DTRA 1QZZA 2JRMA 5D6EA 5DD8A 2IPQX 4XKBA 5DV5A 2Z2SB 1WH7A 5GTIC 2NVQJ 1MNEA 3BJ6A 4AM3A 2EV0A 1Y1VJ 4G8XA 4LMYA 4ZYEA 1QQAA 1LDDA 1YRNB 3OKZA 4Z5DA 1G3TA 3AFHA 1RZRD 2DDAA 2PJPA 3EUSA 1B4AA 1ZLJA 1VQ7I 1FIAA 4A6EA 3CUQC 3E6BA 3VOEA 4RB0A 4RA2A 1MBGA 4YRVA 5M5WJ 1AU7A 1FC3A 3C18A 4WX9A 3AKZA 3IUOA 1OCPA 3AG3H 2DK8A 2L3DA 2DFHA 2E5NA 4M74A 5B5EC 1FLIA 1J7KA 3HPHA 3IH4A 4JQFA 4FN3A 2PUBA 2VASA 1LE8A 1UJ8A 2A05A 1Y9QA 4I8TA 1RNLA 4Y17A 2PLYA 2JRTA 4KISA 4IRHA 1W5CC 2LLVA 4QSHA 4X4CA 3AG2H 3OIPA 1ZR4A 1QB2A 2VI6A 3QOXA 2W84A 4Q4ZF 5LFAA 2HZDA 4G9YA 5E3OA 4J01A 4YARA 3SEZA 1WETA 3B6AA 3OYFA 2VC0A 2ZKZA 2OCCH 2K4BA 4Z58A 1N25A 1HW1A 2GIZA 3OMYA 1NG7A 1S6LA 5EG0A 1U8BA 1GVDA 2VXDA 3CP8A 1USTA 3FXKA 4F55A 4XSXF 5C44J 3S17J 1Q1HA 3HGGA 5F04A 4MO7A 4MTDA 2LYPA 2YSRA 2D1VA 3OSGA 4BL0B 2BY0A 2XB5A 4D1QA 2M9HA 2VXZA 3VODA 2R7SA 2CYYA 4HRAA 1RPEL 1MSEC 3BTCA 4UNOA 3ZRGA 1WPKA 5AIQA 5K7ZA 2HU9A 2MLKA 2XGEA 1HQCA 2HDWA 5GP9A 2O49A 3GTKJ 3HSEA 2JVHA 3C2GA 2PX9A 1JT6A 3KYDB 4U0WA 3TW6A 1SD7A 3PM1A 4FX0A 1GV5A 2ZMEB 4XLEA 1XSDA 4O8BA 4X4BA 2XXAA 1TQMA 4LITA 4PUSA 2ID6A 1BW6A 5E3NA 2IS6A 4X4DA 2LFBA 1BN5A 1MBJA 2P6TA 2W1OA 1ZHFA 5GTHC 5LRRA 1W0TA 4UV9A 1WWXA 2GIVA 3HGYA 4NC8A 4XNFA 1JE8A 3WE2A 5IT3A 5A7LA 1PNRA 4V2GA 2F6CA 2IXSA 2P5KA 3BCBA 3ZQ7A 2BOLA 2MGQA 2F5CA 2W00A 1S8NA 3K9TA 4X4GA 3CDHA 2H94A 1LPQA 1IN6A 4XLPF 3CLCA 1DPRA 1U0JA 2NOJB 2V1UA 1Z7LA 2A5WA 4HDUA 1X3ZB 1DU6A 2DU9A 1E3OC 4LJZF 2R63A 2BVMA 3ASOH 4A5MA 2NS0A 5HVQC 2GLOA 1Y6IA 2E7XA 1R5ID 2Z3YA 3ECHA 4UB8C 4EM1A 2O9LA 4LFUA 2GZWA 2HYGD 4FT8A 3TFLA 3RIRA 2P7CB 2CV2A 3FMYA 3BZ6A 4XKWA 1R6RA 3FXQA 5M3MJ 4KJZA 1IRZA 4NB5A 1T0FC 2E34A 2XASA 1TWCJ 3TO6A 1ETVA 3F72A 3VYRB 5J4YA 4BQQA 5HS9A 2JVLA 3KEQA 1MH4A 5GPCA 2PI0A 3GZDC 1KQ9A 2VQLA 1U2WA 3ZQQA 3SXYA 3HOZJ 2STTA 2X4HA 3L2RA 4M71A 1X1PA 3ZHIA 3OYDA 1VI0A 5E79C 1P6RA 3C1DA 2DA5A 4HW0A 3HOSA 2MABA 1VFCA 3E97A 3EYIA 4EJOA 4RB2C 5DM7F 9ANTA 2JPCA 1R1TA 4B09A 2GXBA 3JAMK 1T6SA 4AWXB 1PUFA 5KCMA 1Z9CA 2W7NA 2BY1A 1SANA 2Y30A 3NXHA 1FPQA 4U88A 2BVLA 4CCLA 3ESWB 3PQJA 4Y42A 4F8DA 3A1YA 2V9KA 4KN7X 1P4WA 4PSXA 1RKTA 3F3XA 2XCJA 2H1LA 2G9WA 3K69A 2LR8A 3M7GA 3QU3A 4HSTA 4XMYA 2OZUA 4AIHA 1PDNC 3IWZA 2DPUA 1QQIA 3KP5A 1EA3A 2KIQA 1B8IB 2DODA 3S32A 1E0EA 1I3AA 4IWRA 3F6WA 2FSWA 3SHFA 1I50J 1R9TJ 4BXUA 3DPLC 1K4SA 4XQFA 2F5EA 3RI4A 1SFOJ 3VPRA 1VQPI 1ZZ8A 2V79A 3TOAA 1BI0A 3R1FA 4HQEA 2A6TA 3LA2A 2O03A 3F8CA 2VLAA 5DTMA 2VJ4A 1J59A 2EJRA 2OAZA 2A6HF 2XAFA 2X85A 4FASD 3CESA 3C3WA 2WAFA 5HDNA 1NK3P 2M4KA 1UAAA 4ZC3A 4BUPA 3TP3A 1WGXA 4FISA 5J1YA 4HF2A 3QQ6A 3JXBC 2LK2A 1SMYF 2IGNA 3CLQA 1G3YA 2VJ5A 5CVRA 2DK5A 1B9NA 4X4EA 5E8IA 5F1JA 4XBFA 2BGCA 2R5YA 3ZP5A 4BY1J 3VYTB 2ZXJA 1G59A 2KP6A 1B1BA 4PU4C 2GA1A 2YS9A 2A6CA 2M8GX 3FDYA 5H6RA 1VZ0A 2LBFA 1YI2I 1WJBA 2HQNA 4I6ZA 2QEXI 1ZARA 4UUVA 3FF5A 1OJLA 3O8HA 4UVBA 4LG0A 5ICCA 1S9HA 1Z21A 3LQXA 1DUXC 3MKLA 2EFWA 2I8DA 2LYSA 2YU9J 1OPCA 3G3ZA 4I09A 2DXIA 1UG0A 5DYMA 1S7AA 3MKYB 1UHMA 5F1RA 1UCRA 3MD2A 2KEIA 4KT6A 2R7WA 2H09A 4PJJA 1X4OA 2QA4I 3OIOA 1XD7A 2XAHA 4IF4A 4RM3A 4Y33A 2XXQA 5FD6A 3J81K 5DRTA 2PUGA 4X4IA 3MZYA 2DJIA 3HZJA 4CDGA 3PSIA 5JLXA 1ZR2A 4PJMA 4Q2JA 2PUDA 3FIWA 4DQ2A 2R0QC 2OQGA 2CGPA 2A5YB 1EH7A 4BQNA 3DTKA 2P4WA 3DTIA 3ZMDA 3DPTA 5ILSA 2EIMH 2JN6A 4CZCA 2WUSR 3IKTA 2EIJH 1R23A 2Y9ZA 2QQ8A 3LNQA 5A2QK 3VSKA 1LE8B 3RCOA 1JGGA 4YIRX 4EV0A 2YPRA 1BJZA 4RLFA 2HVQA 3CZ6A 3J7YJ 2E1MC 2QVOA 1B6AA 3HPGA 1Z67A 2DTZA 1T98A 2FF4A 1G6NA 1UG2A 2HQAA 2QKLB 4I76A 1G3WA 4EJTA 1XB4A 1IGNA 1B9MA 2PJRB 1XPXA 4D7MA 3HRTA 2KRCA 1YX5A 3JRBA 5IYDJ 2MFZA 3DBHB 2V1DA 1BC8C 2VJIA 1A31A 2JUCA 1J09A 2L0KA 5JR3A 1O3RA 2EFOA 2K9MA 1D8KA 1XCVA 3M07A 2P5VA 1IUFA 1REPC 1UTXA 2YUSA 1Y1WJ 1X1DA 2Q2EA 4BHPA 1OKRA 3F8MA 3SCFA 2FJ1A 2KJBA 1IJWC 2XGXA 2B5AA 1LDJA 1RRJA 1R22A 1TC3C 3QPTA 4I02A 2F2EA 2W4SA 4R79A 2LYRA 4RBOA 3GVAA 4Z5CA 2BY2A 4OAZA 1R4MB 2GXGA 1PRAA 3GYHX 3A02A 2RC4A 3IWFA 1QNTA 2ECCA 3I9V2 1IZ1A 2FX0A 4B48A 1R00A 2KRFA 1T39A 4NQWB 2CW7A 1XMAA 3BY6A 2RDPA 4RGSA 3S93A 1CF7B 1OYYA 4HV5A 3ZMTA 1D5YA 1QZEA 4B3AA 4IQ4A 3TO9A 4RAYA 1R36A 3GFJA 4A3CJ 4FETA 2X9DA 4Y3OA 1H0MA 2LTPA 3D5RC 3OIQA 4ENMA 3TELA 4Q5SF 2HOEA 3J81Z 2Y0MA 3NZLA 3A2KA 2BNMA 1IO2A 2OUMA 2K9LA 4DGWB 4L5JA 3LSRA 2V9PA 1N77A 3A9YA 3R4KA 1JHFA 2WAEA 3CCYA 3JW4A 4S0HB 3GFLA 2DAOA 2ZC2A 3ZQLA 4B47A 1O7LA 1EV7A 3E5UA 1BR4A 1MJAA 3OYHA 2Q0OA 3DTEA 4PDKA 5J40A 1RKWA 2AHQA 4AUXA 3G1OA 3BP8A 4UHTA 3ZMVA 1UMQA 2M3AA 2WV0A 3HKZN 4MEXF 3P7NA 2E2HJ 1IW7F 3CCEI 1AWCA 2CFXA 1UB9A 1TBXA 1YG2A 3RQIA 5IP9J 1IN5A 3RKXA 2XAQA 1XG1A 2QSHX 2HDDA 1AOYA 2V9VA 1YOVB 5FGMA 2X6WA 3DLLF 2HPMA 2HXOA 4DNCA 1USSA 2YX4A 2LH9A 1DPUA 1J9IA 2HFHA 3GBFA 2M7BA 4DW6A 1RUNA 4LIVA 2KIUA 4MTEA 5B1AH 1PJRA 1SD4A 4Y13A 4IL6C 4ER0A 1ADRA 4O3MA 5LGNA 3E6MA 2EILH 1GXQA 4C2UA 3BCAA 4A0XA 3QPLA 1Z1DA 3FXMA 4BH9A 1OCZH 3BZCA 1LDKB 3VWBA 1ZQ3P 1A6QA 2FMYA 2R7OA 3FBIB 4NC7A 4KYWA 2KEKA 4D7NA 3NQOA 3RPQA 2PXQA 4A0ZA 3PO2J 1ETQA 4FBIA 2XRLA 2XAGA 2VN2A 1PUFB 3KYLA 4Y52J 3QODA 3Q5FA 3IRQA 3G6EI 2OF7A 2R7FA 3Q9SA 5L3GA 3JR9A 2KHMA 2CUZA 2DO7A 4CHUA 2XGCA 1GV2A 2D5VA 5D4RA 1U2ZA 3HSRA 3QWLA 4Y4RA 3OR2C 5LBQA 2JZYA 1ONVA 2ZMEA 5TGTA 3CJTB 3QP5A 1QRYA 2DCEA 1WH8A 3PNVA 2VEOA 2M7AA 4N4OB 2J5PA 2LMDA 3SDBA 2ID3A 4XICA 4FHTA 2P7VB 5DS9A 3WTUC 4BXFA 3GN5B 2WAQN 1TNSA 3QOWA 2TDXA 3N05A 3OOUA 3PFYA 3QYEA 3PNYA 2IGMA 2O7OA 2XB0X 3BJAA 4MQ9F 5HOOA 5JLWA 3JRCA 4I6TA 5FKMA 1POUA 2NNYA 4LOCA 1A6IA 1WJFA 4A3MJ 1FIPA 4EJWA 5EEGA 1B72B 4GO1A 5FRMA 5D5VB 1TQIA 4RAGA 3WHCA 1SVLA 4RB3C 1YTYA 4I2OA 3GTGJ 3FMQA 2L8NA 2KZ8A 5JVGF 5B1BH 4BE1A 2V1XA 2UXXA 1GLNA 1A04A 1SAUA 3GTOJ 2VKEA 4ENJA 3DWLE 1GDTA 1YLFA 4MLOA 1LMB3 4FX4A 4C9YA 1QP0A 2IP2A 1VQ8I 2XKPA 1HW2A 4YIIA 1RR8C 2BHZA 3WTWC 5D6FA 1Y0UA 3CUQB 2XAJA 5E20A 4MEYF 2CO5A 4DZPA 5H2FC 2BY3A 4D0PA 3OYLA 5F08A 2M34A 3SYTA 1MNDA 2ZNYA 1W0UA 2XHKA 3HL2A 2IJLA 2V6CA 2Y31A 4PJLA 4DZJA 3S1QJ 1JKRC 3ZR8X 2PUCA 3TQNA 3CCLI 2CV0A 3ELKA 3UNGC 1I39A 4GGGA 4HBLA 1FEXA 2HGCA 1IRGA 1H88C 4Y15A 2EWTA 3G7DA 1BIAA 4LGWA 4XL9A 2R92J 5DSXA 1MD0A 3DF8A 5ILVA 3WTVC 3L7WA 2P0WA 5LEKA 1F5TA 1HDDC 3DP7A 2Q8KA 1R4NB 3KEYA 2HKXA 1YYVA 5M5XJ 2OD5A 5CVVA 4HRIA 1QVTA
chains in the Genus database with same CATH topology
3O8GA 2G0EA 5GP9A 3GTKJ 3LSPA 2O49A 1JT6A 4CYCB 1HCRA 1PRVA 4MCTA 2PPXA 2JK3A 2X6OA 3F0CA 3Q0UA 3TW6A 4A69C 3JRIA 4IA8A 3PM1A 1GV5A 1XWRA 1R63A 1X2MA 4O8BA 1ETWA 3LISA 4X4BA 5E3LA 2ID6A 5EZHA 1BW6A 5E3NA 2HQ5A 3OP9A 1IG7A 4X4DA 5F0CA 1ZZ6A 3ZKCA 2LFBA 3S8QA 4UUSA 1MBJA 2JA5J 1RZRA 1RIOA 4MFDA 2AXVA 4XIDA 2HOSA 2DA6A 3QQAA 2B63J 3KXAA 1W0TA 1JKPC 4JCXA 3HGYA 2PUEA 3SCGA 3GTQJ 5A7LA 4FE7A 4V2GA 5FKLA 4BBRJ 1PNRA 2R7ZJ 5M5YJ 2MGQA 4L5EA 3BTIA 3FK6A 3MN2A 3F52A 5EGOB 4X4GA 2X48A 2DJNA 5IOYA 4JX6A 3S14J 3CLCA 2EZKA 3BT9A 3JRFA 1U78A 2IAIA 3OQMA 5J1RA 1ZK8A 1AHDP 2KDZA 3OMTA 3VK0A 1MH3A 1DU6A 1E3OC 1LCCA 2LKXA 1XS9A 1P7IA 2IU7A 3MVPA 2R63A 1TWHJ 1H89C 1QP7A 2PUAA 2GLOA 2DA2A 5EF6A 4FE4A 2IUOA 2DMNA 1GT0C 2AXUA 1LFBA 2O9LA 2JMWA 4X4HA 2L49A 1HDPA 1S7EA 3CDLA 4YG7B 3I4MJ 3FMYA 1HF0A 2PE5A 3CROL 2L7FP 5M3MJ 4IHWA 2R5ZA 1IRZA 1QP4A 3G1MA 5F27A 2EBIA 3JXDL 4JX4A 1CJGA 1TWCJ 1ETVA 2AWIA 1TWGJ 3BR0A 2TRTA 4GFBA 4IHVA 3IH3A 1MH4A 5GPCA 2JVLA 4OB4A 1ZS4A 3ZHMA 3HOZJ 5K98B 2IEKA 3BG3A 2DMQA 4QIWN 4YG1A 4FTHA 4DYQA 2JWTA 2GBYA 3ZHIA 3K2AA 1BA5A 4A3JJ 1IDZA 1VI0A 2HXIA 5EG0B 1HLVA 2DA5A 1VFCA 4I6RA 3WHBA 9ANTA 1JTXA 1ZKGA 4BXXJ 2HOAA 1PUFA 2K9NA 1WH6A 1NK2P 1SANA 1I6HJ 2Y30A 2L7ZA 1MBEA 3M3YJ 3DNVB 4B1RA 5FKKA 4F8DA 4Y42A 2WV1A 4Z5HA 3G5GA 1RKTA 2XCJA 2JA7J 2DA4A 5FKNA 2LR8A 1ITYA 3F51A 4AYBN 3ZQFA 4J1WA 2CQQA 1NEQA 1B8IB 1ENHA 4IWRA 1ORKA 3F6WA 3JRGA 2O4AA 4HNVA 1I50J 4D5CA 2CU7A 2K9SA 1R9TJ 2CSFA 1LLIA 2AO9A 4UUSB 1SFOJ 3VPRA 2ME0A 1EFAA 3HOWJ 1ZZCA 1ZZ8A 4PU3C 1BDIA 2OR1L 2EF8A 2FQ4A 3R1FA 3FISA 1X58A 3PXPA 4M3EA 1FJLA 2QF7A 1IC8A 4X6AJ 5J1UA 1YRNA 2L9RA 2CROA 2GRLA 1NK3P 3SFIA 1B0NA 5M3FJ 2MEZA 2XIUA 3TP3A 1WGXA 1F36A 4FISA 5J1YA 2COBA 3QQ6A 3JXBC 3U3WA 2LK2A 4A3GJ 2DA1A 3CMYA 4J19A 4MCXA 3BTLA 4X4EA 3A01A 1IDYA 3RZDJ 5F1JA 2CRGA 3QF3A 2HINA 2R5YA 3BR1A 4BY1J 2GZUA 4A3KJ 1MSFC 4PU4C 1FTTA 2EZLA 2YS9A 3TP0A 2M8GX 2VPRA 3ZQIA 2A6CA 3BD1A 4GHJA 1K83J 4I6ZA 2O8KA 2OFYA 5EEAA 1OFCX 1OJLA 3O8HA 1CQTA 3HOUJ 1Z77A 2Y9YA 4A3LJ 1JKOC 3MKLA 2LYSA 2W48A 2YU9J 1AKHA 3BG9A 1OCTC 2R93J 2R5ZB 2JA6J 1ZVVA 2I10A 3PO3J 3JREA 3CECA 4MIMA 2KEIA 1LFUP 1ETOA 1TWAJ 1ETYA 3OIOA 1BDHA 1XC5A 3HBLA 2JA8J 4GQMA 3OQOA 1EF4A 3B6CA 2JCGA 3E7LA 1F43A 1FTZA 1ZZ7A 4X4IA 2PUGA 1ZR2A 1YSEA 5JLXA 1JFSA 1VPWA 2PUDA 3FIWA 5GPAA 2R0QC 2EZHA 4RDUA 3S1NJ 2AXZA 2EBYA 1BL0A 3H3VK 3O9XA 3KZ3A 4QTRA 2LYJA 1JUSA 2JN6A 4G12A 4EEFG 2WUSR 1APLC 3CQZJ 5F0FA 5EZGA 4M6VA 5C4XJ 2H8RA 1L1MA 4M3DA 5BNGA 4A3IJ 2Y9ZA 5IP7J 1BW5A 3LNQA 2LP0A 1LE8B 4FCYA 1JJ6C 1JGGA 2HSGA 4JYKA 4W1UA 2VKVA 1HOMA 1BJZA 2DMPA 1ZPQA 1P7JA 3TRBA 1X2LA 3IH2A 1X2NA 2BNNA 3FYAA 2LYQA 3NAUA 3SDGA 4JP0A 1U9NA 1UXDA 4ABZA 2DTZA 4I76A 1UG2A 3A03A 1O4XA 3LOCA 1IGNA 3BR6A 3B7HA 3TW7A 2N8GA 4JQDA 4D7MA 2XPWA 2E2JJ 1MBHA 3JRBA 1WIZA 5IYDJ 4NDWA 2AW6A 2XSDC 1T33A 1DU0A 1JT0A 2L0KA 2CQXA 3HB9A 2ME6A 2LYKA 3RKQA 5IOZA 2LLKA 3BDNA 1IUFA 4C3IJ 1UTXA 4A3BJ 1GUUA 2DMTA 2YUSA 3LSJA 5IYCJ 1Y1WJ 4I6UA 4JCYA 3GTPJ 2M0CA 2IVBA 3BTJA 4C3JJ 2NVXJ 1PRUA 3RZZA 3SCFA 3UFDA 2FJ1A 2B5AA 1IJWC 3JRAA 3JXCL 2EQRA 4M3GA 1TC3C 1T56A 3HOYJ 2FD5A 4M3BA 5F0HA 2LYRA 4RBOA 4Z5CA 3A01B 2BJCA 1QPZA 1PRAA 3A02A 3GTLJ 2R5YB 2ECCA 3HOVJ 4A93J 1R69A 2FX0A 4BY7J 1A5JA 2E19A 2LD5A 4XRSA 2GRMA 1D5YA 2HYJA 5J3LA 4B3AA 3GN5A 4A3CJ 1JUMA 1Z0XA 1JFTA 4A3EJ 2X9DA 2NS8A 2LTPA 2NS7A 1TWFJ 1JKQC 2DN0A 3SCHA 1QVTA 3FYMA 3D1NI 2BNMA 5FLVA 2JJ7A 3LSRA 3BS3A 1G2HA 1B72A 5EDNA 4S0HB 3CCYA 1DWKA 2DA7A 1UHSA 1I3QJ 3ZQLA 2NVTJ 3S15J 1Q1VA 3BR5A 3BR2A 3H0GJ 5HODA 4V2FA 4XRSG 4UUTA 5FJ8J 1QVUA 3ZQGA 3S1RJ 2KEJA 1UXCA 3S16J 1RKWA 2AHQA 4AUXA 3G1OA 4C2MJ 3UKGA 2IV1A 2H1KA 1UMQA 1ZUGA 2O38A 1SQ8A 3HKZN 3HDDA 2ZB9A 2E2HJ 2XGDA 4J1XA 3SJMA 1X57A 1ZAYA 3FKIJ 4BBSJ 2IVGA 5DTDA 3S2DJ 3Q0VA 3OQNA 3RQIA 5FLMJ 5IP9J 2MW8A 1U9OA 1QPIA 1XG1A 3DEWA 3I4NJ 3DCFA 2LVSA 2ELKA 2HDDA 1JUPA 1ETKA 2K9QA 2HXOA 3GBFA 4DW6A 4X4FA 1B8IA 4A3FJ 3IVPA 2MG4A 3C2BA 4DYCA 2ICTA 1QQBA 5IP6A 3M4OJ 3FK7A 3LSGA 4PU8A 4Z59A 1ADRA 3JRDA 2KPJA 5C3EJ 4X1EA 4IHXA 1RZSA 1JTYA 3HEFA 3QPLA 2R1JL 2XPVA 2WB1N 1VF9A 1ZQ3P 3QPSA 5IYBJ 1NTCA 2KEKA 4AC0A 4D7NA 5EYRA 3PO2J 1ETQA 4FBIA 2XRLA 4IEJA 5C4JJ 1WCMJ 3TEDA 1PUFB 1WH5A 2E1OA 4Y52J 1NERA 2FJRA 1RETA 1Y7YA 1RPWA 3L1PA 1ZGWA 2OF7A 3K7AJ 3S2HJ 3JR9A 3H5TA 3BQYA 3IV5A 3KJXA 4CYCA 2XGCA 1GV2A 2D5VA 1VNDA 2EZIA 3GTMJ 1LQCA 5E3MA 3S1MJ 5FKOA 1DW9A 2NOGA 2MSYA 5IPAA 2IBDA 2AUWA 2P81A 3HOXJ 1QRYA 4C3HJ 3QWGA 1WH8A 2PMZN 3MLFA 2EH3A 4A3DJ 1K61A 2XI8A 3BR3A 4BKXA 3RZOJ 2DMUA 3HM5A 2ID3A 2MQKA 2XJ3A 4B4CA 4JX5A 4XICA 1LCDA 3ZOBA 2QCOA 5DS9A 1ZTRA 4IVZA 2Y0SN 3GN5B 2WAQN 1ETXA 3Q0WA 3ZQCA 3OOUA 2OPTA 4MFEA 2O7OA 2XB0X 3JRCA 3QYXA 1JWLA 5JLWA 2DA3A 3NARA 4I6TA 5EGOA 1JH9A 1WH7A 5FKMA 2NVQJ 1POUA 1MBFA 4LOCA 1ZZ9A 1A6IA 2TCTA 1Y1VJ 4W97A 1ZZBA 4A3MJ 1QQAA 1YRNB 1FIPA 2PUFA 4Z5DA 1RZRD 1B72B 3EUSA 2M2EA 1FIAA 3WHCA 2BNOA 1MBGA 5M5WJ 2CUFA 1AU7A 3GTGJ 2KZ8A 2L8NA 4M3FA 3Q3SA 2LCVA 3W6VA 2PIJA 4YG4A 1OCPA 2RAEA 2VKEA 3JRHA 3GTOJ 1H8AC 1GDTA 4MLOA 1LMB3 4YBAA 3HZIB 4XK4A 1POGA 3IH4A 2IVQA 4FN3A 1OSLA 1QP0A 4DYRA 1IV6A 2LYLA 2PUBA 1LE8A 1Y9QA 4I8TA 2K40A 4DZPA 4QSHA 3BG5A 2GM4A 2CJJA 4X4CA 5F08A 2M34A 1ZR4A 4IHYA 1AKHB 2WIUB 2L7MP 2LY9A 2VI6A 3G1LA 1W0UA 1PERL 2VUMJ 4YARA 2KT0A 2XPUA 5E3OA 3GTJJ 1JJ8C 2E2IJ 1WETA 2Y31A 4DZJA 3S1QJ 3B6AA 1JKRC 2PUCA 4PU7A 3OSFA 3BQZA 5K7FA 4Z58A 1MBKA 3GBGA 1WI3A 2CUEA 1U8BA 5EG0A 2HOTA 1GVDA 1FEXA 1RR7A 1H88C 2EWTA 5C44J 3G7DA 3S17J 3HGGA 2HI3A 5F04A 2R92J 4MO7A 3LFPA 2LYPA 5K7HA 4Y7NJ 1HDDC 3OSGA 3ZQHA 2XB5A 4XRMA 1RESA 5M5XJ 1MNMC 2M9HA 1RPEL 4NDLA 2NVYJ 3BTCA 1MSEC 2Y2ZA 1WPKA 4D5FA 5K7ZA 2ICPA 2ECBA 2XGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8G A;  2G0E A;  5GP9 A;  3GTK J;  3LSP A;  2O49 A;  1JT6 A;  4CYC B;  1HCR A;  1PRV A;  4MCT A;  2PPX A;  2JK3 A;  2X6O A;  3F0C A;  3Q0U A;  3TW6 A;  4A69 C;  3JRI A;  4IA8 A;  3PM1 A;  1GV5 A;  1XWR A;  1R63 A;  1X2M A;  4O8B A;  1ETW A;  3LIS A;  4X4B A;  5E3L A;  2ID6 A;  5EZH A;  1BW6 A;  5E3N A;  2HQ5 A;  3OP9 A;  1IG7 A;  4X4D A;  5F0C A;  1ZZ6 A;  3ZKC A;  2LFB A;  3S8Q A;  4UUS A;  1MBJ A;  2JA5 J;  1RZR A;  1RIO A;  4MFD A;  2AXV A;  4XID A;  2HOS A;  2DA6 A;  3QQA A;  2B63 J;  3KXA A;  1W0T A;  1JKP C;  4JCX A;  3HGY A;  2PUE A;  3SCG A;  3GTQ J;  5A7L A;  4FE7 A;  4V2G A;  5FKL A;  4BBR J;  1PNR A;  2R7Z J;  5M5Y J;  2MGQ A;  4L5E A;  3BTI A;  3FK6 A;  3MN2 A;  3F52 A;  5EGO B;  4X4G A;  2X48 A;  2DJN A;  5IOY A;  4JX6 A;  3S14 J;  3CLC A;  2EZK A;  3BT9 A;  3JRF A;  1U78 A;  2IAI A;  3OQM A;  5J1R A;  1ZK8 A;  1AHD P;  2KDZ A;  3OMT A;  3VK0 A;  1MH3 A;  1DU6 A;  1E3O C;  1LCC A;  2LKX A;  1XS9 A;  1P7I A;  2IU7 A;  3MVP A;  2R63 A;  1TWH J;  1H89 C;  1QP7 A;  2PUA A;  2GLO A;  2DA2 A;  5EF6 A;  4FE4 A;  2IUO A;  2DMN A;  1GT0 C;  2AXU A;  1LFB A;  2O9L A;  2JMW A;  4X4H A;  2L49 A;  1HDP A;  1S7E A;  3CDL A;  4YG7 B;  3I4M J;  3FMY A;  1HF0 A;  2PE5 A;  3CRO L;  2L7F P;  5M3M J;  4IHW A;  2R5Z A;  1IRZ A;  1QP4 A;  3G1M A;  5F27 A;  2EBI A;  3JXD L;  4JX4 A;  1CJG A;  1TWC J;  1ETV A;  2AWI A;  1TWG J;  3BR0 A;  2TRT A;  4GFB A;  4IHV A;  3IH3 A;  1MH4 A;  5GPC A;  2JVL A;  4OB4 A;  1ZS4 A;  3ZHM A;  3HOZ J;  5K98 B;  2IEK A;  3BG3 A;  2DMQ A;  4QIW N;  4YG1 A;  4FTH A;  4DYQ A;  2JWT A;  2GBY A;  3ZHI A;  3K2A A;  1BA5 A;  4A3J J;  1IDZ A;  1VI0 A;  2HXI A;  5EG0 B;  1HLV A;  2DA5 A;  1VFC A;  4I6R A;  3WHB A;  9ANT A;  1JTX A;  1ZKG A;  4BXX J;  2HOA A;  1PUF A;  2K9N A;  1WH6 A;  1NK2 P;  1SAN A;  1I6H J;  2Y30 A;  2L7Z A;  1MBE A;  3M3Y J;  3DNV B;  4B1R A;  5FKK A;  4F8D A;  4Y42 A;  2WV1 A;  4Z5H A;  3G5G A;  1RKT A;  2XCJ A;  2JA7 J;  2DA4 A;  5FKN A;  2LR8 A;  1ITY A;  3F51 A;  4AYB N;  3ZQF A;  4J1W A;  2CQQ A;  1NEQ A;  1B8I B;  1ENH A;  4IWR A;  1ORK A;  3F6W A;  3JRG A;  2O4A A;  4HNV A;  1I50 J;  4D5C A;  2CU7 A;  2K9S A;  1R9T J;  2CSF A;  1LLI A;  2AO9 A;  4UUS B;  1SFO J;  3VPR A;  2ME0 A;  1EFA A;  3HOW J;  1ZZC A;  1ZZ8 A;  4PU3 C;  1BDI A;  2OR1 L;  2EF8 A;  2FQ4 A;  3R1F A;  3FIS A;  1X58 A;  3PXP A;  4M3E A;  1FJL A;  2QF7 A;  1IC8 A;  4X6A J;  5J1U A;  1YRN A;  2L9R A;  2CRO A;  2GRL A;  1NK3 P;  3SFI A;  1B0N A;  5M3F J;  2MEZ A;  2XIU A;  3TP3 A;  1WGX A;  1F36 A;  4FIS A;  5J1Y A;  2COB A;  3QQ6 A;  3JXB C;  3U3W A;  2LK2 A;  4A3G J;  2DA1 A;  3CMY A;  4J19 A;  4MCX A;  3BTL A;  4X4E A;  3A01 A;  1IDY A;  3RZD J;  5F1J A;  2CRG A;  3QF3 A;  2HIN A;  2R5Y A;  3BR1 A;  4BY1 J;  2GZU A;  4A3K J;  1MSF C;  4PU4 C;  1FTT A;  2EZL A;  2YS9 A;  3TP0 A;  2M8G X;  2VPR A;  3ZQI A;  2A6C A;  3BD1 A;  4GHJ A;  1K83 J;  4I6Z A;  2O8K A;  2OFY A;  5EEA A;  1OFC X;  1OJL A;  3O8H A;  1CQT A;  3HOU J;  1Z77 A;  2Y9Y A;  4A3L J;  1JKO C;  3MKL A;  2LYS A;  2W48 A;  2YU9 J;  1AKH A;  3BG9 A;  1OCT C;  2R93 J;  2R5Z B;  2JA6 J;  1ZVV A;  2I10 A;  3PO3 J;  3JRE A;  3CEC A;  4MIM A;  2KEI A;  1LFU P;  1ETO A;  1TWA J;  1ETY A;  3OIO A;  1BDH A;  1XC5 A;  3HBL A;  2JA8 J;  4GQM A;  3OQO A;  1EF4 A;  3B6C A;  2JCG A;  3E7L A;  1F43 A;  1FTZ A;  1ZZ7 A;  4X4I A;  2PUG A;  1ZR2 A;  1YSE A;  5JLX A;  1JFS A;  1VPW A;  2PUD A;  3FIW A;  5GPA A;  2R0Q C;  2EZH A;  4RDU A;  3S1N J;  2AXZ A;  2EBY A;  1BL0 A;  3H3V K;  3O9X A;  3KZ3 A;  4QTR A;  2LYJ A;  1JUS A;  2JN6 A;  4G12 A;  4EEF G;  2WUS R;  1APL C;  3CQZ J;  5F0F A;  5EZG A;  4M6V A;  5C4X J;  2H8R A;  1L1M A;  4M3D A;  5BNG A;  4A3I J;  2Y9Z A;  5IP7 J;  1BW5 A;  3LNQ A;  2LP0 A;  1LE8 B;  4FCY A;  1JJ6 C;  1JGG A;  2HSG A;  4JYK A;  4W1U A;  2VKV A;  1HOM A;  1BJZ A;  2DMP A;  1ZPQ A;  1P7J A;  3TRB A;  1X2L A;  3IH2 A;  1X2N A;  2BNN A;  3FYA A;  2LYQ A;  3NAU A;  3SDG A;  4JP0 A;  1U9N A;  1UXD A;  4ABZ A;  2DTZ A;  4I76 A;  1UG2 A;  3A03 A;  1O4X A;  3LOC A;  1IGN A;  3BR6 A;  3B7H A;  3TW7 A;  2N8G A;  4JQD A;  4D7M A;  2XPW A;  2E2J J;  1MBH A;  3JRB A;  1WIZ A;  5IYD J;  4NDW A;  2AW6 A;  2XSD C;  1T33 A;  1DU0 A;  1JT0 A;  2L0K A;  2CQX A;  3HB9 A;  2ME6 A;  2LYK A;  3RKQ A;  5IOZ A;  2LLK A;  3BDN A;  1IUF A;  4C3I J;  1UTX A;  4A3B J;  1GUU A;  2DMT A;  2YUS A;  3LSJ A;  5IYC J;  1Y1W J;  4I6U A;  4JCY A;  3GTP J;  2M0C A;  2IVB A;  3BTJ A;  4C3J J;  2NVX J;  1PRU A;  3RZZ A;  3SCF A;  3UFD A;  2FJ1 A;  2B5A A;  1IJW C;  3JRA A;  3JXC L;  2EQR A;  4M3G A;  1TC3 C;  1T56 A;  3HOY J;  2FD5 A;  4M3B A;  5F0H A;  2LYR A;  4RBO A;  4Z5C A;  3A01 B;  2BJC A;  1QPZ A;  1PRA A;  3A02 A;  3GTL J;  2R5Y B;  2ECC A;  3HOV J;  4A93 J;  1R69 A;  2FX0 A;  4BY7 J;  1A5J A;  2E19 A;  2LD5 A;  4XRS A;  2GRM A;  1D5Y A;  2HYJ A;  5J3L A;  4B3A A;  3GN5 A;  4A3C J;  1JUM A;  1Z0X A;  1JFT A;  4A3E J;  2X9D A;  2NS8 A;  2LTP A;  2NS7 A;  1TWF J;  1JKQ C;  2DN0 A;  3SCH A;  1QVT A;  3FYM A;  3D1N I;  2BNM A;  5FLV A;  2JJ7 A;  3LSR A;  3BS3 A;  1G2H A;  1B72 A;  5EDN A;  4S0H B;  3CCY A;  1DWK A;  2DA7 A;  1UHS A;  1I3Q J;  3ZQL A;  2NVT J;  3S15 J;  1Q1V A;  3BR5 A;  3BR2 A;  3H0G J;  5HOD A;  4V2F A;  4XRS G;  4UUT A;  5FJ8 J;  1QVU A;  3ZQG A;  3S1R J;  2KEJ A;  1UXC A;  3S16 J;  1RKW A;  2AHQ A;  4AUX A;  3G1O A;  4C2M J;  3UKG A;  2IV1 A;  2H1K A;  1UMQ A;  1ZUG A;  2O38 A;  1SQ8 A;  3HKZ N;  3HDD A;  2ZB9 A;  2E2H J;  2XGD A;  4J1X A;  3SJM A;  1X57 A;  1ZAY A;  3FKI J;  4BBS J;  2IVG A;  5DTD A;  3S2D J;  3Q0V A;  3OQN A;  3RQI A;  5FLM J;  5IP9 J;  2MW8 A;  1U9O A;  1QPI A;  1XG1 A;  3DEW A;  3I4N J;  3DCF A;  2LVS A;  2ELK A;  2HDD A;  1JUP A;  1ETK A;  2K9Q A;  2HXO A;  3GBF A;  4DW6 A;  4X4F A;  1B8I A;  4A3F J;  3IVP A;  2MG4 A;  3C2B A;  4DYC A;  2ICT A;  1QQB A;  5IP6 A;  3M4O J;  3FK7 A;  3LSG A;  4PU8 A;  4Z59 A;  1ADR A;  3JRD A;  2KPJ A;  5C3E J;  4X1E A;  4IHX A;  1RZS A;  1JTY A;  3HEF A;  3QPL A;  2R1J L;  2XPV A;  2WB1 N;  1VF9 A;  1ZQ3 P;  3QPS A;  5IYB J;  1NTC A;  2KEK A;  4AC0 A;  4D7N A;  5EYR A;  3PO2 J;  1ETQ A;  4FBI A;  2XRL A;  4IEJ A;  5C4J J;  1WCM J;  3TED A;  1PUF B;  1WH5 A;  2E1O A;  4Y52 J;  1NER A;  2FJR A;  1RET A;  1Y7Y A;  1RPW A;  3L1P A;  1ZGW A;  2OF7 A;  3K7A J;  3S2H J;  3JR9 A;  3H5T A;  3BQY A;  3IV5 A;  3KJX A;  4CYC A;  2XGC A;  1GV2 A;  2D5V A;  1VND A;  2EZI A;  3GTM J;  1LQC A;  5E3M A;  3S1M J;  5FKO A;  1DW9 A;  2NOG A;  2MSY A;  5IPA A;  2IBD A;  2AUW A;  2P81 A;  3HOX J;  1QRY A;  4C3H J;  3QWG A;  1WH8 A;  2PMZ N;  3MLF A;  2EH3 A;  4A3D J;  1K61 A;  2XI8 A;  3BR3 A;  4BKX A;  3RZO J;  2DMU A;  3HM5 A;  2ID3 A;  2MQK A;  2XJ3 A;  4B4C A;  4JX5 A;  4XIC A;  1LCD A;  3ZOB A;  2QCO A;  5DS9 A;  1ZTR A;  4IVZ A;  2Y0S N;  3GN5 B;  2WAQ N;  1ETX A;  3Q0W A;  3ZQC A;  3OOU A;  2OPT A;  4MFE A;  2O7O A;  2XB0 X;  3JRC A;  3QYX A;  1JWL A;  5JLW A;  2DA3 A;  3NAR A;  4I6T A;  5EGO A;  1JH9 A;  1WH7 A;  5FKM A;  2NVQ J;  1POU A;  1MBF A;  4LOC A;  1ZZ9 A;  1A6I A;  2TCT A;  1Y1V J;  4W97 A;  1ZZB A;  4A3M J;  1QQA A;  1YRN B;  1FIP A;  2PUF A;  4Z5D A;  1RZR D;  1B72 B;  3EUS A;  2M2E A;  1FIA A;  3WHC A;  2BNO A;  1MBG A;  5M5W J;  2CUF A;  1AU7 A;  3GTG J;  2KZ8 A;  2L8N A;  4M3F A;  3Q3S A;  2LCV A;  3W6V A;  2PIJ A;  4YG4 A;  1OCP A;  2RAE A;  2VKE A;  3JRH A;  3GTO J;  1H8A C;  1GDT A;  4MLO A;  1LMB 3;  4YBA A;  3HZI B;  4XK4 A;  1POG A;  3IH4 A;  2IVQ A;  4FN3 A;  1OSL A;  1QP0 A;  4DYR A;  1IV6 A;  2LYL A;  2PUB A;  1LE8 A;  1Y9Q A;  4I8T A;  2K40 A;  4DZP A;  4QSH A;  3BG5 A;  2GM4 A;  2CJJ A;  4X4C A;  5F08 A;  2M34 A;  1ZR4 A;  4IHY A;  1AKH B;  2WIU B;  2L7M P;  2LY9 A;  2VI6 A;  3G1L A;  1W0U A;  1PER L;  2VUM J;  4YAR A;  2KT0 A;  2XPU A;  5E3O A;  3GTJ J;  1JJ8 C;  2E2I J;  1WET A;  2Y31 A;  4DZJ A;  3S1Q J;  3B6A A;  1JKR C;  2PUC A;  4PU7 A;  3OSF A;  3BQZ A;  5K7F A;  4Z58 A;  1MBK A;  3GBG A;  1WI3 A;  2CUE A;  1U8B A;  5EG0 A;  2HOT A;  1GVD A;  1FEX A;  1RR7 A;  1H88 C;  2EWT A;  5C44 J;  3G7D A;  3S17 J;  3HGG A;  2HI3 A;  5F04 A;  2R92 J;  4MO7 A;  3LFP A;  2LYP A;  5K7H A;  4Y7N J;  1HDD C;  3OSG A;  3ZQH A;  2XB5 A;  4XRM A;  1RES A;  5M5X J;  1MNM C;  2M9H A;  1RPE L;  4NDL A;  2NVY J;  3BTC A;  1MSE C;  2Y2Z A;  1WPK A;  4D5F A;  5K7Z A;  2ICP A;  2ECB A;  2XGE A; 
#chains in the Genus database with same CATH topology
 1FP2 A;  2EK5 A;  2KMU A;  3KP2 A;  4ZYD A;  2ZXW H;  3LSP A;  2F5F A;  1RC9 A;  1FYK A;  2H27 A;  3LAP A;  4BEH B;  1HCR A;  4HEA 2;  1PRV A;  4PFO A;  3MAJ A;  1OCC H;  2FOK A;  4A69 C;  4IA8 A;  1RI7 A;  2EA4 A;  2PQ8 A;  1D5V A;  1D3Y A;  2VIX A;  3MFK A;  2DTR A;  1R63 A;  1DP7 P;  1KA8 A;  4LK0 F;  4BGD A;  5E3L A;  5EZH A;  5KK1 A;  5HDG A;  1ZZ6 A;  3GX4 X;  4PGG A;  1RIO A;  2AXV A;  2DA6 A;  3QQA A;  3KXA A;  3DKY A;  1JKP C;  4JCX A;  3M9L A;  4HA8 A;  3BC8 A;  2PUE A;  1IV8 A;  3SCG A;  3GFI A;  2VQC A;  4EJV A;  4FE7 A;  3PFI A;  2WY7 Q;  3QRF F;  5M5Y J;  4E6K G;  5CVU A;  4QLC U;  3IHU A;  3I58 A;  2X48 A;  3IAS 2;  1IF1 A;  1LEA A;  1VQL I;  3FXL A;  2EZK A;  2L02 A;  2IAI A;  2A3S A;  1JI8 A;  3OMT A;  3VK0 A;  2IU7 A;  4KUM A;  1MJB A;  3VEP A;  3AAF A;  3GME A;  2Y75 A;  1TWH J;  1WJA A;  4XLC A;  2JA2 A;  3H1C A;  3SZT A;  3OR1 C;  1H89 C;  4L18 B;  4QPO A;  2IUO A;  2ZNZ A;  3I5U A;  3NRV A;  2DMN A;  4DBR A;  1GT0 C;  2AXU A;  1LFB A;  2VBZ A;  4I01 A;  4M73 A;  3OYA A;  3F21 A;  3CDL A;  4Q47 A;  3I4M J;  2DT6 A;  3TGN A;  1HF0 A;  1W5S A;  1E17 A;  3BRO A;  3DBR B;  4AU7 A;  3OYJ A;  1DDN A;  2DPD A;  2LY1 A;  4IHW A;  1V3F A;  4PSW A;  1Z05 A;  2EBI A;  2QYO A;  4JX4 A;  5F27 A;  2ZFU A;  4P9U A;  1YO5 C;  3EUH A;  4N9I A;  1TWG J;  2K3P A;  4G6Q A;  2ETH A;  4GFB A;  2DMQ A;  3OOP A;  2PEX A;  4DYQ A;  2GBY A;  2EIN H;  1JHH A;  3K2A A;  4A3J J;  1WSU A;  1BA5 A;  4E7K A;  3PUB A;  1IDZ A;  2XC7 A;  1SD5 A;  2KFD A;  2VBX A;  3T1B A;  3WHB A;  1YQA A;  4KIG A;  5JFR A;  4M6X A;  1R7J A;  1D1B A;  3BZK A;  4HYE A;  4TV7 A;  4BXX J;  3FMS A;  2K9N A;  1VQ4 I;  4ZYH A;  2YR2 A;  1WH6 A;  2BE5 F;  4RM2 A;  5JUW A;  1BBY A;  2L7Z A;  3M3Y J;  2VOD A;  1K78 A;  5FKK A;  2WV1 A;  4Z5H A;  4Z6Y A;  1SMT A;  2DA4 A;  2X1D A;  3E3V A;  3HSF A;  1ITY A;  4AYB N;  3A9X A;  2KLO A;  4OIR F;  2CG4 A;  4N4N B;  5KAI C;  1KON A;  1SAX A;  2PJR A;  3OWQ A;  1Z7U A;  5L3F A;  1NEQ A;  3ISP A;  2D1H A;  2NYX A;  2MYS A;  2O4A A;  1EH6 A;  4HNV A;  2CU7 A;  2HNH A;  3K2Z A;  4ESF A;  2HPI A;  3KZY A;  1EKE A;  1MKM A;  2CSF A;  3V4G A;  1LLI A;  4UUS B;  5FFZ A;  2ME0 A;  1EFA A;  1V5F A;  3HOW J;  1DP3 A;  1ZZC A;  2EF8 A;  4CSW A;  2XSJ C;  4YEJ A;  4HDV A;  3DKX A;  1LQ1 A;  4IRI A;  2QQA A;  5E1X A;  3G0T A;  1D0Z A;  2QF7 A;  3TKY A;  4X6A J;  3O6B B;  5J1U A;  3CCM I;  2CRO A;  3OS2 A;  2J5O A;  5HDK A;  2XIU A;  2MEZ A;  4WF2 A;  1VQM I;  4EM2 A;  4B44 A;  2COB A;  3U3W A;  4A3G J;  1E3P A;  1R58 A;  2JUG A;  4BJ5 C;  1UHW A;  4KIB A;  3CMY A;  3ZCO A;  3CDI A;  5LEJ A;  3WU0 A;  2HIN A;  1TT5 B;  2WAD A;  2VPL A;  2IW5 A;  3HRS A;  1MSF C;  2CQK A;  4NQW A;  1FTT A;  2JVG A;  2D2W A;  3ZQI A;  1MMS A;  4GHJ A;  1K83 J;  1CF7 A;  1DUL A;  1U8R A;  3CCR I;  3FMR A;  5CYV A;  1HKQ A;  4OOI A;  1CQT A;  4NHJ A;  1Z77 A;  2CW8 A;  2Y9Y A;  1EJ9 A;  3HRM A;  4ASN A;  1ZG1 A;  1MW7 A;  1MMD A;  3SR4 A;  1AKH A;  5GAH i;  2R4G A;  3BG9 A;  4PFP A;  1I27 A;  2OQR A;  1XGO A;  3DPU A;  1ZVV A;  2I10 A;  4PGH A;  4E4H A;  1VTN C;  3GZC A;  1LFU P;  1ETY A;  1TT0 A;  1MJ9 A;  2FBK A;  1XC5 A;  4K2E A;  1R49 A;  4GQM A;  1QPM A;  4KN4 X;  4II3 A;  4BDZ A;  4CIC A;  1EF4 A;  1U5T B;  2CSO A;  3QFI A;  3FWE A;  3E7L A;  4BE2 A;  2RV8 A;  4G94 A;  3K70 D;  1YSE A;  2K86 A;  1VPW A;  4EVI A;  2EBY A;  3OYG A;  5J4V A;  3WG9 A;  4QTR A;  2PMH A;  2FEZ A;  1DGW Y;  4RLQ A;  3H0D A;  1W7P B;  1XDS A;  1APL C;  3CQZ J;  5EZG A;  2IGO A;  4N9H A;  4ZTJ A;  5BNG A;  4ZZD A;  1L1M A;  4CH7 A;  1DQU A;  2Z1D A;  1HQ1 A;  2PXE A;  3CF5 F;  1K7A A;  2LNB A;  4FCY A;  4DIQ A;  1NH3 A;  1HOM A;  2VKV A;  1ERD A;  5F64 A;  1I1G A;  2DOE A;  1ZPQ A;  1QU3 A;  3IH2 A;  1N78 A;  1V54 H;  1X2N A;  4IXA A;  2ZJ2 A;  2K85 A;  1U9N A;  3K70 C;  3V7S A;  4ABZ A;  3ZN0 A;  3A03 A;  1O4X A;  1W5T A;  3B7H A;  2FNP A;  2EB7 A;  2Y0S A;  3CCQ I;  3SX0 A;  2N8G A;  3LWF A;  4RB1 A;  3BJO A;  1HKT A;  1HC8 A;  4NDW A;  2V7F A;  3WU2 C;  3CO6 C;  3H5R A;  4KIC A;  2A61 A;  1DU0 A;  5CQE A;  1JT0 A;  1O3T A;  3HB9 A;  4XSZ F;  3WU1 B;  2LLK A;  1D0Y A;  4O5V A;  4C3I J;  4RS8 A;  1C0W A;  2QUF A;  3J7A O;  2CFO A;  2DI3 A;  1GUU A;  2DLL A;  3LSJ A;  4JCY A;  4I6U A;  2BBY A;  3GTP J;  2IVB A;  3BTJ A;  4C3J J;  1PRU A;  3RZZ A;  4P55 A;  4DOZ A;  3JRA A;  1QHG A;  3H35 A;  3VYU B;  3JXC L;  3KL4 A;  2RKH A;  1IRF A;  1T38 A;  3SEQ A;  4M3B A;  5F0H A;  1KGS A;  2MD0 A;  3CTA A;  3BG7 A;  2MC4 A;  3K4J A;  2BJC A;  2M30 A;  2ZXH A;  4DE8 A;  4A0Y A;  1A35 A;  1TLH B;  2DW4 A;  3HOV J;  4BY7 J;  1A5J A;  2FBI A;  2E19 A;  3KLO A;  4EAT A;  2KZV A;  3LSK A;  2BV6 A;  3K1P A;  4B3X A;  4XRS A;  2L4A A;  5LHH A;  5AIP A;  3GN5 A;  4II2 A;  4UB6 C;  2GWR A;  1JUM A;  1Z0X A;  3ERM A;  5CQG A;  1JFT A;  3L2Q A;  3LA7 A;  3LAJ A;  3SCH A;  4UV8 A;  1LVA A;  1PP8 F;  3D1N I;  1L0O C;  4LLL A;  2X1C A;  5FLV A;  3DQV C;  4XN0 A;  2FUG 2;  1B72 A;  2EFP A;  1DWK A;  1WFX A;  4P5O A;  1Z6R A;  3S15 J;  1Q1V A;  3CCV I;  3OY9 A;  3BR2 A;  3H0G J;  4L9V A;  5HOD A;  5FJ8 J;  2X1E A;  3S1R J;  1QVU A;  3ZQG A;  2JQ7 A;  1WRJ A;  4CO8 A;  1S5L C;  5E8G A;  4YG2 F;  4OAY A;  4M9X A;  1KU7 A;  1Z3Y A;  3HXL A;  3GO5 A;  1ZUG A;  3R61 A;  4O6J A;  2WY8 Q;  1WJD A;  2KIM A;  2NNN A;  3E5Q A;  4J1X A;  5EEH A;  1ZAY A;  2ZME C;  2M45 A;  3FKI J;  1ZG5 A;  3CUQ A;  3M8J A;  3MQ0 A;  2BXY A;  2QGU A;  1MDM B;  2PFB A;  1QPI A;  2ZCW A;  4RAF A;  1VQN I;  2V4J C;  3B02 A;  5B66 C;  3C7J A;  3DCF A;  3T5X A;  3TDU C;  2G7U A;  1H9T A;  2CH0 A;  1JUP A;  1ETK A;  2K9Q A;  2R7T A;  3H9J A;  3M1E A;  3KLN A;  4V19 K;  3DKW A;  4IPA A;  3FZV A;  4UY8 I;  2X51 A;  5GAG i;  3R0J A;  2MG4 A;  1F1Z A;  5K5R A;  1OYW A;  3M4O J;  1XMX A;  2O5R A;  3LSG A;  1P4A A;  4BDY A;  2HVR A;  2KPJ A;  2BHY A;  4F92 B;  1FY7 A;  2HWV A;  1W4M A;  2YU3 A;  3HJE A;  1IXC A;  4AD9 A;  2Z9O A;  4HPQ A;  2XPV A;  4GXO A;  3M8E A;  1FBQ A;  1N75 A;  3RYR A;  5IYB J;  1SVO A;  2UWM A;  2DYS H;  4ZYA A;  3GWZ A;  1OR7 A;  2P5L C;  5DT2 A;  1ULY A;  3TED A;  1WH5 A;  5K1Y A;  1MZB A;  1XGS A;  1RET A;  1PVE A;  1ZGW A;  4BAC A;  1K78 B;  3S2H J;  3ABM H;  4BEH A;  3KJX A;  2PMZ A;  1VND A;  2EZI A;  1LQC A;  3OS1 A;  2IS4 A;  5L3D A;  5E3M A;  2GOX B;  3GF2 A;  1G3S A;  1R1V A;  2P81 A;  3VB2 A;  1AA7 A;  2K5C A;  4BE0 A;  3ULQ B;  1WZ2 A;  1X4P A;  1K61 A;  1FOK A;  1P92 A;  3ABT A;  2DMU A;  2L1P A;  2IA2 A;  3KZI C;  4D9J A;  3HM5 A;  1VQ6 I;  2XJ3 A;  3TEP A;  4B4C A;  2X6X A;  3OWT A;  2QCO A;  3KET A;  2DFE A;  1ZTR A;  2DFI A;  4IVZ A;  1LFP A;  3ZQC A;  2STW A;  4L0Z B;  2L9S A;  2O6G E;  3NAR A;  3PJR A;  2LC2 A;  3K4M A;  4ZH4 F;  2MXD A;  3LSM A;  3MZH A;  3D5L A;  3H3U A;  4YFN F;  1NHA A;  2M2E A;  2FNA A;  1ZGA A;  1XGN A;  4I99 C;  2WA0 A;  5BPI A;  3BG6 A;  2QM3 A;  2JPB A;  2EFQ A;  2CUF A;  2FXA A;  4YG4 A;  2KQR A;  3CCJ I;  5LHI A;  3AG4 H;  3JRH A;  4ZTF A;  4YBA A;  3H5N A;  1POG A;  3HOT A;  1OSL A;  2JT1 A;  3I4P A;  4DYR A;  1HXD A;  1IV6 A;  2IS1 A;  1YX3 A;  5D5W B;  2BZT A;  4RMN A;  4XR6 A;  4J00 A;  5GAD J;  4BQO A;  1H9G A;  3LQR A;  3BG5 A;  3WTS C;  2ADU A;  4IHY A;  1AKH B;  2MA3 A;  2L7M P;  4GCV A;  4KA4 A;  1PER L;  2R7X A;  1T2K A;  2RRE A;  2LYC A;  3GTJ J;  1JJ8 C;  3DM5 A;  2K27 A;  5JHF A;  4HLY A;  2E7W A;  3ME5 A;  3OSF A;  3BQZ A;  4IOA F;  2XAU A;  4PU7 A;  1YE9 A;  1G4D A;  1MBK A;  5IT9 K;  1WI3 A;  2CUE A;  2KZG A;  3ONQ A;  4NUB A;  5KVR A;  2HOT A;  1WJC A;  4ER3 A;  1ZG3 A;  3KP4 A;  2HI3 A;  3LFP A;  2RNJ A;  3WGG A;  3WTZ A;  1SFX A;  5E17 F;  1T95 A;  5K7H A;  2V6E A;  1I1S A;  2ZJQ F;  2JQE A;  4KMU X;  5ILU A;  2MC3 A;  1UFM A;  4HV6 A;  1HSJ A;  5KAF C;  4XRM A;  3OYM A;  2KIS A;  1I5Z A;  4NDL A;  2L9N A;  2NVY J;  4YEL A;  4OIP F;  1STZ A;  4D5F A;  2ICP A;  1J5Y A;  2VQG A;  2ECB A;  5IOZ A;  2L2O A;  4RAZ A;  3SZG A;  3F9K A;  4U7B A;  4WVL A;  4CYC B;  1WHU A;  3T0Y A;  2PPX A;  2JK3 A;  1VQ5 I;  3FKJ A;  3F0C A;  1M1E B;  3Q0U A;  2QWW A;  4F91 B;  1T8I A;  5BOX A;  2J7W A;  2UZK A;  2KKO A;  1ETW A;  3LIS A;  3EYY A;  4U0Y A;  4EGZ A;  2E1N A;  3EUH C;  4ER6 A;  2HQ5 A;  2MLG A;  5DDG A;  1ZRC A;  2MH9 A;  3I3L A;  4UUS A;  2JA5 J;  4HQM A;  2VJJ A;  2PXL A;  2HOS A;  5LRS A;  2R7V A;  2LRD A;  1KU3 A;  4BBR J;  3FXO A;  2NAZ A;  2R7Z J;  2VOO A;  4DJA A;  3BTI A;  3FK6 A;  1OLT A;  3MN2 A;  3RKW A;  5EGO B;  3F52 A;  2DJN A;  1IRX A;  4JX6 A;  2CQ7 A;  5LGT A;  3L2C A;  3S14 J;  3BT9 A;  4XLF A;  3MCZ A;  3JRF A;  3GEZ A;  2W25 A;  1ZK8 A;  2KDZ A;  4EZI A;  2AQF A;  2KRH A;  3DFG A;  2GAU A;  1K6O A;  1LCC A;  2LKX A;  1P7I A;  1XTA A;  2LF7 A;  2P6S A;  4WK8 F;  4OMY A;  2DBB A;  2PUA A;  1WJE A;  4XLA A;  5K5O A;  2BW3 B;  3ERE D;  4JOM A;  4E70 A;  3HUG A;  2JMW A;  4U87 A;  4KNY A;  2L49 A;  3I54 A;  2DOA A;  1HKS A;  4YG7 B;  3E5X A;  4P96 A;  3OYI A;  5GAE J;  2PE5 A;  3CRO L;  4E7Z A;  2FML A;  2ZSH B;  5J6X A;  4IQJ A;  3LFK A;  1QP4 A;  1TW3 A;  3G1M A;  3OYK A;  2IA0 A;  4MNU A;  4JK1 X;  2HEO A;  4EMS A;  2AWI A;  4E7S A;  1U3E M;  2Q1Z B;  2F4M B;  3QP6 A;  4IHV A;  3ZHM A;  3IH3 A;  5IT9 Z;  1LVK A;  1U5T A;  2LKS A;  2RNG A;  5JHU A;  5K98 B;  3BG3 A;  5DTQ A;  2ZBK A;  4KIT B;  2JWT A;  2ZJP F;  4HX8 A;  1FZP B;  2L54 A;  2HXI A;  3QAH A;  2OJE D;  3CMA I;  3CD6 I;  3OYE A;  3TO7 A;  2RVC A;  1WQ2 A;  2UUZ A;  2XF7 A;  1EH8 A;  1W7P A;  1BM9 A;  2XRN A;  2EV5 A;  3HHH A;  1KU9 A;  2PXV A;  4YIF A;  1NK2 P;  1ZAO A;  2R3S A;  1JXS A;  1MBE A;  3G4S I;  3VDX A;  2O8X A;  4B1R A;  1FBS A;  1TQP A;  1QBJ A;  1IN7 A;  4BNC A;  3CF2 A;  3J7Z I;  4ENK A;  3PUF A;  2RGV A;  5KNL A;  3ZN1 A;  5ICF A;  3ZQF A;  4J1W A;  1XMK A;  3IAM 2;  3TBI A;  1Y8R B;  2CQQ A;  2FBH A;  2O0Y A;  4HZF A;  2F4O B;  1PYV A;  2EWN A;  2L9V A;  2PXP A;  1X3W B;  3DXJ F;  1LJ9 A;  1MMG A;  1FSH A;  1ORK A;  3JRG A;  3I64 A;  4U0V A;  2XF6 A;  2VT3 A;  3TL4 X;  1KZH A;  2IGK A;  4L0Y B;  1K4T A;  2ZJR F;  1ZEL A;  3CP2 A;  4PU3 C;  1BDI A;  2OR1 L;  5EJC A;  2FQ4 A;  2WBM A;  4EQZ A;  3FIS A;  1IN4 A;  3CJR B;  2OTJ I;  3PXP A;  2Z99 A;  4M3E A;  4XLH A;  3K4K A;  1BI1 A;  1I6X A;  2L9R A;  4BAY A;  3TMO A;  3EET A;  1B0N A;  2R7D A;  1F36 A;  3HTS B;  4HG2 A;  4IHT A;  1MGT A;  2J7U A;  4ER5 A;  4IX7 A;  4H0E A;  4I7H A;  3QPH A;  4UXN A;  4BU2 A;  1R5G A;  3Q9V A;  4F52 A;  4L9J A;  5J47 A;  3BWG A;  4ESJ A;  3BTL A;  1IDY A;  3J80 Z;  3QOE A;  3FXJ A;  2R7Q A;  3BR1 A;  1ON2 A;  2X6Y A;  3RJP A;  5CVJ A;  1K6Y A;  3BD1 A;  3L2U A;  4ZDP A;  4AVZ A;  5EEA A;  2WC2 A;  4HX4 A;  2DT5 A;  2P8T A;  3WTX C;  3MWM A;  4E7H A;  3KZZ A;  2HZT A;  3HOU J;  3DU5 A;  1TTY A;  4A3L J;  3HYI A;  2H8W A;  2W85 A;  3U1D A;  2K7L A;  1X1C A;  2MBF A;  2XXP A;  3RDI A;  4PK4 A;  2R5Z B;  2JA6 J;  1F9N A;  2VBY A;  4CCN A;  3CEC A;  4MIM A;  5DUI A;  1ETO A;  1TWA J;  3KE2 A;  4HSR A;  5ICG A;  1FNN A;  1BDH A;  3HBL A;  2A68 F;  5FB2 A;  1SC7 A;  3B6C A;  2E60 A;  4LK1 F;  3ASN H;  4RGX A;  3WGI A;  5TRD A;  1F43 A;  1FTZ A;  1ZZ7 A;  5BS6 A;  3EQL F;  1O7F A;  5GPA A;  2CQN A;  3L9F A;  2EZH A;  2HTJ A;  3KCC A;  2AXZ A;  3S1N J;  1BL0 A;  2Z33 A;  3KZ3 A;  2LYJ A;  1JUS A;  4EEF G;  1TL8 A;  1SD6 A;  3IL2 A;  5FLX K;  4M6V A;  1MDM A;  5C4X J;  2H8R A;  3DV8 A;  4M3D A;  4MHG A;  1ON1 A;  2CMP A;  5IP7 J;  4CCM A;  4LG3 A;  2DQR A;  4CGZ A;  2BXZ A;  2HSG A;  4JYK A;  2W57 A;  3M8F A;  2UXN A;  4JP0 A;  1D1C A;  5HNF A;  2VQH A;  2EPF A;  2E36 A;  4IVN A;  1HW5 A;  2WTE A;  3H92 A;  3LST A;  3OV8 A;  3BR6 A;  5FRN A;  2WAQ A;  3TW7 A;  4R1H A;  2QQ9 A;  4JQD A;  3BOQ A;  3U2R A;  5LHG A;  3ZPX A;  1MBH A;  1BR2 A;  3RTR A;  1WIZ A;  3I55 I;  3F6V A;  5D5U B;  2ZXI A;  3IP4 B;  3H5A A;  2LNM A;  3FX3 A;  1O3S A;  3ZMU A;  2LRE A;  3EDP A;  2CQX A;  2ME6 A;  3RKQ A;  1LEB A;  3BDN A;  2QKM B;  2AXT C;  3R0A A;  1SFE A;  3COA C;  1MMA A;  4CUG A;  4WXH A;  2M0C A;  3UFD A;  5DM6 F;  3VWS A;  1PUE E;  1LKX A;  2PXB A;  3KP6 A;  2FD5 A;  3OYB A;  3CME I;  2ICW G;  3A01 B;  4XOP A;  1R71 A;  1KQ0 A;  3GTL J;  5E1Z B;  4A93 J;  3JSO A;  2KIF A;  3HRU A;  3I59 B;  3K4N A;  3S3O A;  4GDF A;  2WWY A;  3J7A Y;  2VB6 A;  1OMI A;  1ZRE A;  1W36 D;  4EK9 A;  2HYJ A;  2BYV E;  3LMM A;  5FFX A;  5J3L A;  4HF1 A;  5D4S A;  4CYD A;  2IVM A;  2B0L A;  2DFF A;  2LDU A;  2QSG X;  3JTG A;  3E6C C;  1TWF J;  1XGM A;  5DD4 A;  4WXC A;  2DN0 A;  3NWS A;  2GXA A;  2VON A;  2JJ7 A;  5LLQ A;  3CCU I;  1G2H A;  2KDO A;  5EDN A;  4P1W A;  2DA7 A;  1OR7 C;  1UHS A;  2XV4 S;  3PL8 A;  3REO A;  3BR5 A;  1S72 I;  2KEJ A;  1XN7 A;  1YW8 A;  3GUD A;  4V2F A;  4XRS G;  2F48 A;  4C2T A;  2QSF X;  3S16 J;  3W2V A;  1W36 C;  5FLX Z;  4C2M J;  2IV1 A;  2UV1 A;  3EPZ A;  1SQ8 A;  5L3C A;  3NWT A;  1QHH D;  2MH2 A;  3HDD A;  3G2B A;  2D45 A;  2ELJ A;  2QBY B;  3M1C A;  3HUG B;  3W2W A;  2IVG A;  5DTD A;  3Q0V A;  1W1W E;  3LQQ A;  5J8C A;  3NEU A;  3ABK H;  2ISY A;  3JSP A;  3DEW A;  1P2F A;  2LVS A;  3GW2 A;  2HDC A;  2HCS A;  1FMW A;  2OBP A;  4EM0 B;  3HG9 A;  4DBQ A;  4IO9 F;  4KDP A;  2HR3 A;  4AID A;  5L3E A;  4PZJ A;  1QQB A;  4DYC A;  2ICT A;  5IP6 A;  1O3Q A;  3D5S C;  1J75 A;  2WB1 A;  1TZL A;  3F6O A;  3V7R A;  4Z59 A;  5HLT A;  4BJT A;  3H9G A;  3H36 A;  2RN7 A;  3DBL B;  2PXD A;  4IHX A;  1QZX A;  2E1C A;  1RZS A;  4LB6 B;  2R1J L;  2L5Q A;  2C6Y A;  2OC6 A;  1MMN A;  2K02 A;  1NTC A;  5ERI A;  3ECO A;  3IC7 A;  4AC0 A;  5EYR A;  2DQL A;  3PNT A;  4IEJ A;  2E35 A;  3F22 A;  3ZPL A;  5C4J J;  1WCM J;  2HKO A;  4KMF A;  3A9Z A;  1R1U A;  2E1O A;  1NER A;  4A12 A;  1HA8 A;  2FJR A;  1Y7Y A;  4IJA A;  1RPW A;  3L1P A;  1JGS A;  3H5T A;  4WXD A;  1O57 A;  4NC6 A;  4ZJZ A;  4CYC A;  2YBD A;  4G7H F;  3F8B A;  1BJA A;  1MFQ C;  5FKO A;  2FA5 A;  1DW9 A;  1FP1 D;  2NOG A;  3PQK A;  2IBD A;  1HBX G;  3HOX J;  1ZLK A;  3M9A A;  3AL0 C;  3ZMS A;  4C3H J;  2PMZ N;  3MLF A;  5TJJ A;  3CUO A;  1FYM A;  4A3D J;  3W6K B;  2CW0 F;  1L3L A;  2IA1 A;  3BR3 A;  3GLX A;  4BKX A;  4LLN A;  2LLW A;  5DRY A;  1RIO H;  4BYY A;  2G7H A;  3A0B C;  1J2X A;  4JX5 A;  1VQ9 I;  3I0T A;  3IRR A;  3I71 A;  2E1M B;  4ENN A;  3PIP F;  4OIN F;  2HFZ A;  4HAM A;  4UVA A;  4BQA A;  4G7Z F;  2DA3 A;  5EGO A;  1JH9 A;  2M8E A;  4NNJ A;  1ZZ9 A;  1MBF A;  2TCT A;  1B59 A;  3I53 A;  4W97 A;  1ZZB A;  2M4H A;  2PUF A;  3FBN B;  4XKC A;  3TOB A;  2AQE A;  3P9I A;  4WWC A;  4CXF A;  5H20 A;  4GYI A;  2BNO A;  2X0L A;  1MIJ A;  3WE3 A;  3RPU A;  4M3F A;  3Q3S A;  2LCV A;  3W6V A;  2PIJ A;  2BW3 A;  2RAE A;  1KYW A;  1YW7 A;  1H8A C;  4HOB A;  2ELH A;  3HZI B;  1NG6 A;  4XK4 A;  2O61 A;  1ACI A;  2IVQ A;  2LYL A;  4ZDL A;  3FM3 A;  2NXN B;  4RGU A;  4AYB A;  3L2V A;  4A5N A;  2K40 A;  3P9C A;  1Y39 A;  1RUO A;  2GM4 A;  2CJJ A;  1LB2 A;  4B8X A;  3P5J A;  1QO0 D;  2WIU B;  2K3F A;  2LY9 A;  3G1L A;  3PSF A;  3CCS I;  5ICE A;  3MZ8 A;  2VE8 A;  1YW9 A;  2VUM J;  2KT0 A;  1ODD A;  2XPU A;  3K4L A;  2E2I J;  3E6D A;  3RQ4 A;  1YJW I;  2OA4 A;  3WTY C;  1J0R A;  1GVJ A;  1WKM A;  2CUJ A;  1X1A A;  5K7F A;  5E1W A;  2Z5U A;  1GXP A;  1V5E A;  3GBG A;  1RR7 A;  5CVI A;  3U1K A;  2XF5 A;  1ZGJ A;  2ODR D;  5DUK A;  2AS5 F;  5KHD A;  3K4C A;  4Y7N J;  2LG4 A;  4L5I A;  4G6D A;  4E7L A;  2K4J A;  3ZQH A;  1RES A;  1MNM C;  4OU0 A;  1P4X A;  2Y2Z A;  2QEN A;  2E5Z A;  2OU2 A;  4CZZ A;  4S05 A;  3O8G A;  2G0E A;  2PXT A;  2B9S A;  2HYF A;  5B3S H;  3K1M A;  2A69 F;  5D5X B;  2A07 F;  4MCT A;  1V55 H;  4EKG A;  1W7P D;  2HS5 A;  2X6O A;  3R60 A;  3JRI A;  2FRH A;  1XWR A;  1X2M A;  1S29 A;  5BQT A;  5DCM B;  3HIF A;  4E7I A;  3OP9 A;  3JCU C;  3ZKC A;  3QU6 A;  1IG7 A;  5F0C A;  3W3C A;  3S8Q A;  2IS2 A;  1U5T C;  1RZR A;  1FOX A;  4MFD A;  1YS7 A;  3E0J B;  4PCQ A;  3C2H A;  4M9S A;  4XID A;  3S3M A;  2I5U A;  4PJ0 C;  2B63 J;  4HX7 A;  5FRO A;  3OYN A;  4PJN A;  3S2W A;  3U21 A;  1FOW A;  2M1B A;  3MEX A;  3GTQ J;  1X1B A;  5FKL A;  1D1A A;  4YFX F;  2V26 A;  2AXL A;  1FSE A;  4L5E A;  3OL4 A;  4XOT A;  4FQG A;  3X2Q H;  3V8L A;  5IOY A;  4DE9 A;  2F5D A;  5DCF A;  2DOF A;  1XCB A;  5HLG A;  2H6C A;  2FE3 A;  1U78 A;  3OQM A;  5J1R A;  3V42 A;  4GRI A;  1AHD P;  1MH3 A;  1UZC A;  3JAM Z;  2OV7 A;  4X0G A;  3F23 A;  1XS9 A;  3RKY A;  3V8J A;  3MVP A;  2Z16 A;  1D0X A;  1UEL B;  3R09 A;  1QP7 A;  3FHN A;  2DA2 A;  5EF6 A;  4FE4 A;  2VL8 A;  2PXF A;  2EFN A;  4IKF A;  2XKO A;  4A6D A;  3U9G A;  4X4H A;  4XRF A;  3ZGK A;  1DGR M;  1HDP A;  1S7E A;  2L7K A;  2LSO A;  3A4C A;  3RYP A;  2L7F P;  3B73 A;  4LIU A;  1NW3 A;  2R5Z A;  1XDU A;  3JXD L;  4EKI A;  1K79 A;  1CJG A;  4Q48 A;  1YIJ I;  4OBM A;  3BR0 A;  2TRT A;  4EGY A;  4OB4 A;  3LFU A;  1ZS4 A;  1HST A;  3LSI A;  2IEK A;  4I98 B;  2B7E A;  4QIW N;  4ER7 A;  4YG1 A;  4FTH A;  3ML6 A;  2FU4 A;  2DDB A;  3FXR A;  1OCR H;  2GA2 A;  3GUU A;  1IN8 A;  3DLA A;  5EG0 B;  1HLV A;  3EUK L;  3KIO A;  4I6R A;  4I0B A;  2XVC A;  1BOB A;  1OQY A;  1JTX A;  1S7O A;  1ZKG A;  2HOA A;  1BC7 C;  3VSL A;  1Y56 A;  3KFW X;  1I6H J;  1D8J A;  1TW2 A;  3DNV B;  2LOO A;  4XLN F;  5FD5 A;  5D8K B;  3G5G A;  2M5W A;  1WVR A;  3O3K A;  5GAH J;  2PBI A;  5ED4 A;  2JA7 J;  2CS3 A;  3ZMZ A;  1IXR C;  5FKN A;  1FYL A;  3F51 A;  3KYC B;  5HLI A;  1TP4 A;  1ENH A;  4OIQ F;  4ZDO A;  4IHS A;  5F6F A;  2OCE A;  4D5C A;  2K9S A;  2XRO A;  3MKW B;  4KT5 C;  1T0F A;  3L00 A;  3WTT C;  2AO9 A;  1E3H A;  3FM5 A;  3GZD A;  2DYR H;  3K10 A;  1X58 A;  1U6G A;  3GFM A;  3SQN A;  1FJL A;  2PXK A;  1IC8 A;  3UWP A;  2JSP A;  1YRN A;  1FT9 A;  1ZN2 A;  1BI3 A;  1Y0N A;  4JBA A;  5CPR B;  2GRL A;  3SFI A;  3WG7 H;  3I56 I;  5M3F J;  5HLH A;  1WJ5 A;  4CCK A;  4AVP A;  3N97 A;  2RQP A;  2QZ8 A;  3PIO F;  2IT0 A;  2DA1 A;  4J19 A;  1YJN I;  4MCX A;  3MKZ A;  2F4I A;  3A01 A;  1SFK A;  3K4B A;  3RZD J;  1ZRD A;  2CRG A;  3R6S A;  3QF3 A;  5IY5 H;  1IXS B;  1XSX A;  1YIO A;  2VKH A;  5HS7 A;  2GZU A;  2JTV A;  3I59 A;  4A3K J;  2E71 A;  2EZL A;  2ZO4 A;  3TP0 A;  2VPR A;  1YHQ I;  2LY2 A;  3BPV A;  5A2Q Z;  2O8K A;  2OFY A;  1OFC X;  2M87 A;  3PE5 A;  4CA0 A;  1P9Q C;  5DEQ A;  1QGP A;  2COM A;  5FO5 A;  4F3Q A;  2NVU B;  4C30 A;  2L4M A;  1FMV A;  4Z2Y A;  1JKO C;  2PG4 A;  2W48 A;  1X19 A;  1OCT C;  1FWZ A;  4G7O F;  3L09 A;  3S8P A;  2R93 J;  1T08 B;  1XSV A;  2VC1 A;  3FXU A;  4KFC A;  3GXO A;  4UVC A;  3PO3 J;  3JRE A;  4IOC F;  4HF0 A;  5AON A;  2JA8 J;  2ISZ A;  2DT7 B;  3LSH A;  5L3B A;  3OQO A;  3GZ5 A;  3GZ6 A;  2JCG A;  2EIK H;  1JFS A;  4NBQ A;  5LGU A;  1SEU A;  4RDU A;  2BEO A;  1KYZ A;  2F5V A;  4IZZ A;  2QQB A;  3H3V K;  2FQ3 A;  3O9X A;  1KU2 A;  4B43 A;  3E1S A;  2H6B A;  3F8F A;  3LA3 A;  3J80 K;  4MGR A;  4G12 A;  4U7D A;  2QBY A;  2M4G A;  1WI9 A;  4OMZ A;  1ZH5 A;  3GLL A;  1S3J A;  5F0F A;  2KPM A;  3A0H C;  4A3I J;  4QWQ A;  4IRG A;  1BW5 A;  2LP0 A;  4F7Z A;  3HHG A;  2NRA C;  3CJQ B;  1JJ6 C;  4CCJ A;  4W1U A;  1XX5 A;  2DMP A;  4LLG F;  2XUB A;  1P7J A;  3KP3 A;  6PAX A;  3TRB A;  2VOP A;  1X2L A;  4XOR A;  3GZN B;  3W2A A;  2BNN A;  3FYA A;  2LYQ A;  3NAU A;  3NRO A;  3SDG A;  1Z6T A;  3WOD F;  1LNW A;  2ZFW A;  1IUY A;  1UXD A;  1BOA A;  2VT2 A;  2ZSI B;  2LF8 A;  5CKT A;  3LOC A;  3BLY A;  4XKV A;  2E2J J;  2XPW A;  3ZXS A;  3MMY B;  4F93 B;  5H6Q A;  2AW6 A;  1BI2 A;  2XSD C;  4QPQ A;  3BPX A;  5LD2 C;  1T33 A;  4OIO F;  1Z91 A;  2QLZ A;  1FBU A;  3O2P E;  3QYB A;  5HNH A;  2LYK A;  4G6T B;  3N4M A;  2HQR A;  5JVT A;  4AIJ A;  3OS0 A;  3OL3 A;  3CC2 I;  3CC4 I;  1A36 A;  1VQK I;  3CMM A;  4A3B J;  2DMT A;  3DEU A;  1R5H A;  3V8K A;  4M6Y A;  4YFK F;  5IYC J;  1CGP A;  1SVM A;  2XDV A;  5JI6 A;  4ON0 A;  2R7U A;  3RSN A;  2NVX J;  1ZYR F;  3KPH A;  4N0B A;  2EQR A;  2VE9 A;  4M3G A;  1F4K A;  1G8X A;  5E18 F;  2JSC A;  1T56 A;  3HOY J;  2EA2 A;  4ESB A;  2PXU A;  1QPZ A;  5GAG J;  1YIT I;  4ZYG A;  3SZP A;  1BIB A;  3F8N A;  3GCM A;  4XM3 A;  4M72 A;  2R5Y B;  4E7J A;  4I0A A;  1R69 A;  4MQV A;  1X3U A;  3BDD A;  3KP7 A;  4XON A;  2LD5 A;  1BR1 A;  2LBF B;  3QOP A;  1ZRF A;  2GRM A;  3CJN A;  4LG0 B;  2PN6 A;  3ABL H;  4A3E J;  2KL4 A;  2NS8 A;  3K1N A;  3G73 A;  2VKD A;  2NS7 A;  3CO7 C;  2V3C C;  1V5G A;  4CCO A;  1JKQ C;  2FFH A;  3HC7 A;  4OWR B;  1IAW A;  3FYM A;  3K6G A;  5D8L B;  5BPD A;  2CV1 A;  1YS6 A;  1V4R A;  3BS3 A;  4H4K C;  2HCN A;  3CC7 I;  2PMU A;  4WCG A;  2MD5 A;  2CWE A;  2O3F A;  1I3Q J;  2NVT J;  1E2X A;  3WGH A;  3OYC A;  3EUA A;  3LL7 A;  4HLX A;  3HKZ A;  4UUT A;  2R7R A;  1UXC A;  4A2U A;  1KQ8 A;  2YX7 A;  3T8R A;  3UKG A;  4P9F A;  2KJC A;  2H1K A;  2RQQ A;  4M9Z A;  2O38 A;  3H9Q A;  3QYF A;  2ZB9 A;  2OZ6 A;  1Y8Q B;  2XGD A;  3V7C A;  3SJM A;  3KX2 A;  2XIG A;  4RGR A;  4HNT A;  4BBS J;  3H3Z A;  1X57 A;  3FHZ A;  4ETS A;  3S2D J;  3OQN A;  3TDZ C;  5FLM J;  4AIK A;  2MW8 A;  2A6E F;  1U9O A;  2GQQ A;  3I4N J;  3RPU D;  2ELK A;  4LB5 A;  3L2W A;  1VQO I;  2VBW A;  3G71 I;  2GOM A;  4X4F A;  2W82 A;  4HNU A;  1FX7 A;  3AG1 H;  3VFZ A;  1Z3X A;  4A3F J;  1OYI A;  1B8I A;  3IVP A;  3C2B A;  4ANJ A;  2ACJ A;  1QA6 A;  4BJ6 C;  2M0M A;  3FK7 A;  4LD5 A;  1FOY A;  1OCO H;  4PU8 A;  3UR3 C;  3VYS B;  5BMZ A;  3JRD A;  2LKP A;  5C3E J;  4X1E A;  5TIS C;  1YFH A;  1OIS A;  1JTY A;  3HEF A;  4R8H A;  2WB1 N;  1VF9 A;  3QPS A;  3ROU A;  2FOW A;  3KEO A;  5HS8 A;  2ESH A;  4KIF A;  2IRF G;  1QZY A;  3NDB B;  3DEE A;  4BHC A;  1RZ4 A;  2Q2E B;  3JTH A;  3K7A J;  1GHC A;  4GYG A;  4ITV A;  2ESN A;  2L01 A;  3BQY A;  3W6J B;  3IV5 A;  4EQQ A;  3IKV A;  3GTM J;  5CJ9 A;  1PP7 U;  2EV6 A;  4S04 A;  3S1M J;  3SFZ A;  2W24 A;  2MSY A;  4L9N A;  5IPA A;  4BHB A;  2AUW A;  2V1N A;  5DCM A;  4L9T A;  3K0L A;  5K5Q A;  3QWG A;  5J8F A;  2EH3 A;  2HVS A;  2HTS A;  2XI8 A;  3ABU A;  3HTU A;  1TNT A;  3RZO J;  3DU6 A;  3T8T A;  3MEJ A;  5CLS A;  3CLO A;  3P9K A;  1SFU A;  4EJU A;  2MQK A;  1LCD A;  2Y48 A;  4ZZL A;  3ZOB A;  1YJ9 I;  1LUJ B;  3D0S A;  4XN3 A;  2Y0S N;  1ETX A;  3S3N A;  3Q0W A;  2OPT A;  4MFE A;  2Y69 H;  2OTL I;  3QYX A;  1JWL A;  3AL0 B;  4BS9 A;  5DTR A;  1QZZ A;  2JRM A;  5D6E A;  5DD8 A;  2IPQ X;  4XKB A;  5DV5 A;  2Z2S B;  1WH7 A;  5GTI C;  2NVQ J;  1MNE A;  3BJ6 A;  4AM3 A;  2EV0 A;  1Y1V J;  4G8X A;  4LMY A;  4ZYE A;  1QQA A;  1LDD A;  1YRN B;  3OKZ A;  4Z5D A;  1G3T A;  3AFH A;  1RZR D;  2DDA A;  2PJP A;  3EUS A;  1B4A A;  1ZLJ A;  1VQ7 I;  1FIA A;  4A6E A;  3CUQ C;  3E6B A;  3VOE A;  4RB0 A;  4RA2 A;  1MBG A;  4YRV A;  5M5W J;  1AU7 A;  1FC3 A;  3C18 A;  4WX9 A;  3AKZ A;  3IUO A;  1OCP A;  3AG3 H;  2DK8 A;  2L3D A;  2DFH A;  2E5N A;  4M74 A;  5B5E C;  1FLI A;  1J7K A;  3HPH A;  3IH4 A;  4JQF A;  4FN3 A;  2PUB A;  2VAS A;  1LE8 A;  1UJ8 A;  2A05 A;  1Y9Q A;  4I8T A;  1RNL A;  4Y17 A;  2PLY A;  2JRT A;  4KIS A;  4IRH A;  1W5C C;  2LLV A;  4QSH A;  4X4C A;  3AG2 H;  3OIP A;  1ZR4 A;  1QB2 A;  2VI6 A;  3QOX A;  2W84 A;  4Q4Z F;  5LFA A;  2HZD A;  4G9Y A;  5E3O A;  4J01 A;  4YAR A;  3SEZ A;  1WET A;  3B6A A;  3OYF A;  2VC0 A;  2ZKZ A;  2OCC H;  2K4B A;  4Z58 A;  1N25 A;  1HW1 A;  2GIZ A;  3OMY A;  1NG7 A;  1S6L A;  5EG0 A;  1U8B A;  1GVD A;  2VXD A;  3CP8 A;  1UST A;  3FXK A;  4F55 A;  4XSX F;  5C44 J;  3S17 J;  1Q1H A;  3HGG A;  5F04 A;  4MO7 A;  4MTD A;  2LYP A;  2YSR A;  2D1V A;  3OSG A;  4BL0 B;  2BY0 A;  2XB5 A;  4D1Q A;  2M9H A;  2VXZ A;  3VOD A;  2R7S A;  2CYY A;  4HRA A;  1RPE L;  1MSE C;  3BTC A;  4UNO A;  3ZRG A;  1WPK A;  5AIQ A;  5K7Z A;  2HU9 A;  2MLK A;  2XGE A;  1HQC A;  2HDW A;  5GP9 A;  2O49 A;  3GTK J;  3HSE A;  2JVH A;  3C2G A;  2PX9 A;  1JT6 A;  3KYD B;  4U0W A;  3TW6 A;  1SD7 A;  3PM1 A;  4FX0 A;  1GV5 A;  2ZME B;  4XLE A;  1XSD A;  4O8B A;  4X4B A;  2XXA A;  1TQM A;  4LIT A;  4PUS A;  2ID6 A;  1BW6 A;  5E3N A;  2IS6 A;  4X4D A;  2LFB A;  1BN5 A;  1MBJ A;  2P6T A;  2W1O A;  1ZHF A;  5GTH C;  5LRR A;  1W0T A;  4UV9 A;  1WWX A;  2GIV A;  3HGY A;  4NC8 A;  4XNF A;  1JE8 A;  3WE2 A;  5IT3 A;  5A7L A;  1PNR A;  4V2G A;  2F6C A;  2IXS A;  2P5K A;  3BCB A;  3ZQ7 A;  2BOL A;  2MGQ A;  2F5C A;  2W00 A;  1S8N A;  3K9T A;  4X4G A;  3CDH A;  2H94 A;  1LPQ A;  1IN6 A;  4XLP F;  3CLC A;  1DPR A;  1U0J A;  2NOJ B;  2V1U A;  1Z7L A;  2A5W A;  4HDU A;  1X3Z B;  1DU6 A;  2DU9 A;  1E3O C;  4LJZ F;  2R63 A;  2BVM A;  3ASO H;  4A5M A;  2NS0 A;  5HVQ C;  2GLO A;  1Y6I A;  2E7X A;  1R5I D;  2Z3Y A;  3ECH A;  4UB8 C;  4EM1 A;  2O9L A;  4LFU A;  2GZW A;  2HYG D;  4FT8 A;  3TFL A;  3RIR A;  2P7C B;  2CV2 A;  3FMY A;  3BZ6 A;  4XKW A;  1R6R A;  3FXQ A;  5M3M J;  4KJZ A;  1IRZ A;  4NB5 A;  1T0F C;  2E34 A;  2XAS A;  1TWC J;  3TO6 A;  1ETV A;  3F72 A;  3VYR B;  5J4Y A;  4BQQ A;  5HS9 A;  2JVL A;  3KEQ A;  1MH4 A;  5GPC A;  2PI0 A;  3GZD C;  1KQ9 A;  2VQL A;  1U2W A;  3ZQQ A;  3SXY A;  3HOZ J;  2STT A;  2X4H A;  3L2R A;  4M71 A;  1X1P A;  3ZHI A;  3OYD A;  1VI0 A;  5E79 C;  1P6R A;  3C1D A;  2DA5 A;  4HW0 A;  3HOS A;  2MAB A;  1VFC A;  3E97 A;  3EYI A;  4EJO A;  4RB2 C;  5DM7 F;  9ANT A;  2JPC A;  1R1T A;  4B09 A;  2GXB A;  3JAM K;  1T6S A;  4AWX B;  1PUF A;  5KCM A;  1Z9C A;  2W7N A;  2BY1 A;  1SAN A;  2Y30 A;  3NXH A;  1FPQ A;  4U88 A;  2BVL A;  4CCL A;  3ESW B;  3PQJ A;  4Y42 A;  4F8D A;  3A1Y A;  2V9K A;  4KN7 X;  1P4W A;  4PSX A;  1RKT A;  3F3X A;  2XCJ A;  2H1L A;  2G9W A;  3K69 A;  2LR8 A;  3M7G A;  3QU3 A;  4HST A;  4XMY A;  2OZU A;  4AIH A;  1PDN C;  3IWZ A;  2DPU A;  1QQI A;  3KP5 A;  1EA3 A;  2KIQ A;  1B8I B;  2DOD A;  3S32 A;  1E0E A;  1I3A A;  4IWR A;  3F6W A;  2FSW A;  3SHF A;  1I50 J;  1R9T J;  4BXU A;  3DPL C;  1K4S A;  4XQF A;  2F5E A;  3RI4 A;  1SFO J;  3VPR A;  1VQP I;  1ZZ8 A;  2V79 A;  3TOA A;  1BI0 A;  3R1F A;  4HQE A;  2A6T A;  3LA2 A;  2O03 A;  3F8C A;  2VLA A;  5DTM A;  2VJ4 A;  1J59 A;  2EJR A;  2OAZ A;  2A6H F;  2XAF A;  2X85 A;  4FAS D;  3CES A;  3C3W A;  2WAF A;  5HDN A;  1NK3 P;  2M4K A;  1UAA A;  4ZC3 A;  4BUP A;  3TP3 A;  1WGX A;  4FIS A;  5J1Y A;  4HF2 A;  3QQ6 A;  3JXB C;  2LK2 A;  1SMY F;  2IGN A;  3CLQ A;  1G3Y A;  2VJ5 A;  5CVR A;  2DK5 A;  1B9N A;  4X4E A;  5E8I A;  5F1J A;  4XBF A;  2BGC A;  2R5Y A;  3ZP5 A;  4BY1 J;  3VYT B;  2ZXJ A;  1G59 A;  2KP6 A;  1B1B A;  4PU4 C;  2GA1 A;  2YS9 A;  2A6C A;  2M8G X;  3FDY A;  5H6R A;  1VZ0 A;  2LBF A;  1YI2 I;  1WJB A;  2HQN A;  4I6Z A;  2QEX I;  1ZAR A;  4UUV A;  3FF5 A;  1OJL A;  3O8H A;  4UVB A;  4LG0 A;  5ICC A;  1S9H A;  1Z21 A;  3LQX A;  1DUX C;  3MKL A;  2EFW A;  2I8D A;  2LYS A;  2YU9 J;  1OPC A;  3G3Z A;  4I09 A;  2DXI A;  1UG0 A;  5DYM A;  1S7A A;  3MKY B;  1UHM A;  5F1R A;  1UCR A;  3MD2 A;  2KEI A;  4KT6 A;  2R7W A;  2H09 A;  4PJJ A;  1X4O A;  2QA4 I;  3OIO A;  1XD7 A;  2XAH A;  4IF4 A;  4RM3 A;  4Y33 A;  2XXQ A;  5FD6 A;  3J81 K;  5DRT A;  2PUG A;  4X4I A;  3MZY A;  2DJI A;  3HZJ A;  4CDG A;  3PSI A;  5JLX A;  1ZR2 A;  4PJM A;  4Q2J A;  2PUD A;  3FIW A;  4DQ2 A;  2R0Q C;  2OQG A;  2CGP A;  2A5Y B;  1EH7 A;  4BQN A;  3DTK A;  2P4W A;  3DTI A;  3ZMD A;  3DPT A;  5ILS A;  2EIM H;  2JN6 A;  4CZC A;  2WUS R;  3IKT A;  2EIJ H;  1R23 A;  2Y9Z A;  2QQ8 A;  3LNQ A;  5A2Q K;  3VSK A;  1LE8 B;  3RCO A;  1JGG A;  4YIR X;  4EV0 A;  2YPR A;  1BJZ A;  4RLF A;  2HVQ A;  3CZ6 A;  3J7Y J;  2E1M C;  2QVO A;  1B6A A;  3HPG A;  1Z67 A;  2DTZ A;  1T98 A;  2FF4 A;  1G6N A;  1UG2 A;  2HQA A;  2QKL B;  4I76 A;  1G3W A;  4EJT A;  1XB4 A;  1IGN A;  1B9M A;  2PJR B;  1XPX A;  4D7M A;  3HRT A;  2KRC A;  1YX5 A;  3JRB A;  5IYD J;  2MFZ A;  3DBH B;  2V1D A;  1BC8 C;  2VJI A;  1A31 A;  2JUC A;  1J09 A;  2L0K A;  5JR3 A;  1O3R A;  2EFO A;  2K9M A;  1D8K A;  1XCV A;  3M07 A;  2P5V A;  1IUF A;  1REP C;  1UTX A;  2YUS A;  1Y1W J;  1X1D A;  2Q2E A;  4BHP A;  1OKR A;  3F8M A;  3SCF A;  2FJ1 A;  2KJB A;  1IJW C;  2XGX A;  2B5A A;  1LDJ A;  1RRJ A;  1R22 A;  1TC3 C;  3QPT A;  4I02 A;  2F2E A;  2W4S A;  4R79 A;  2LYR A;  4RBO A;  3GVA A;  4Z5C A;  2BY2 A;  4OAZ A;  1R4M B;  2GXG A;  1PRA A;  3GYH X;  3A02 A;  2RC4 A;  3IWF A;  1QNT A;  2ECC A;  3I9V 2;  1IZ1 A;  2FX0 A;  4B48 A;  1R00 A;  2KRF A;  1T39 A;  4NQW B;  2CW7 A;  1XMA A;  3BY6 A;  2RDP A;  4RGS A;  3S93 A;  1CF7 B;  1OYY A;  4HV5 A;  3ZMT A;  1D5Y A;  1QZE A;  4B3A A;  4IQ4 A;  3TO9 A;  4RAY A;  1R36 A;  3GFJ A;  4A3C J;  4FET A;  2X9D A;  4Y3O A;  1H0M A;  2LTP A;  3D5R C;  3OIQ A;  4ENM A;  3TEL A;  4Q5S F;  2HOE A;  3J81 Z;  2Y0M A;  3NZL A;  3A2K A;  2BNM A;  1IO2 A;  2OUM A;  2K9L A;  4DGW B;  4L5J A;  3LSR A;  2V9P A;  1N77 A;  3A9Y A;  3R4K A;  1JHF A;  2WAE A;  3CCY A;  3JW4 A;  4S0H B;  3GFL A;  2DAO A;  2ZC2 A;  3ZQL A;  4B47 A;  1O7L A;  1EV7 A;  3E5U A;  1BR4 A;  1MJA A;  3OYH A;  2Q0O A;  3DTE A;  4PDK A;  5J40 A;  1RKW A;  2AHQ A;  4AUX A;  3G1O A;  3BP8 A;  4UHT A;  3ZMV A;  1UMQ A;  2M3A A;  2WV0 A;  3HKZ N;  4MEX F;  3P7N A;  2E2H J;  1IW7 F;  3CCE I;  1AWC A;  2CFX A;  1UB9 A;  1TBX A;  1YG2 A;  3RQI A;  5IP9 J;  1IN5 A;  3RKX A;  2XAQ A;  1XG1 A;  2QSH X;  2HDD A;  1AOY A;  2V9V A;  1YOV B;  5FGM A;  2X6W A;  3DLL F;  2HPM A;  2HXO A;  4DNC A;  1USS A;  2YX4 A;  2LH9 A;  1DPU A;  1J9I A;  2HFH A;  3GBF A;  2M7B A;  4DW6 A;  1RUN A;  4LIV A;  2KIU A;  4MTE A;  5B1A H;  1PJR A;  1SD4 A;  4Y13 A;  4IL6 C;  4ER0 A;  1ADR A;  4O3M A;  5LGN A;  3E6M A;  2EIL H;  1GXQ A;  4C2U A;  3BCA A;  4A0X A;  3QPL A;  1Z1D A;  3FXM A;  4BH9 A;  1OCZ H;  3BZC A;  1LDK B;  3VWB A;  1ZQ3 P;  1A6Q A;  2FMY A;  2R7O A;  3FBI B;  4NC7 A;  4KYW A;  2KEK A;  4D7N A;  3NQO A;  3RPQ A;  2PXQ A;  4A0Z A;  3PO2 J;  1ETQ A;  4FBI A;  2XRL A;  2XAG A;  2VN2 A;  1PUF B;  3KYL A;  4Y52 J;  3QOD A;  3Q5F A;  3IRQ A;  3G6E I;  2OF7 A;  2R7F A;  3Q9S A;  5L3G A;  3JR9 A;  2KHM A;  2CUZ A;  2DO7 A;  4CHU A;  2XGC A;  1GV2 A;  2D5V A;  5D4R A;  1U2Z A;  3HSR A;  3QWL A;  4Y4R A;  3OR2 C;  5LBQ A;  2JZY A;  1ONV A;  2ZME A;  5TGT A;  3CJT B;  3QP5 A;  1QRY A;  2DCE A;  1WH8 A;  3PNV A;  2VEO A;  2M7A A;  4N4O B;  2J5P A;  2LMD A;  3SDB A;  2ID3 A;  4XIC A;  4FHT A;  2P7V B;  5DS9 A;  3WTU C;  4BXF A;  3GN5 B;  2WAQ N;  1TNS A;  3QOW A;  2TDX A;  3N05 A;  3OOU A;  3PFY A;  3QYE A;  3PNY A;  2IGM A;  2O7O A;  2XB0 X;  3BJA A;  4MQ9 F;  5HOO A;  5JLW A;  3JRC A;  4I6T A;  5FKM A;  1POU A;  2NNY A;  4LOC A;  1A6I A;  1WJF A;  4A3M J;  1FIP A;  4EJW A;  5EEG A;  1B72 B;  4GO1 A;  5FRM A;  5D5V B;  1TQI A;  4RAG A;  3WHC A;  1SVL A;  4RB3 C;  1YTY A;  4I2O A;  3GTG J;  3FMQ A;  2L8N A;  2KZ8 A;  5JVG F;  5B1B H;  4BE1 A;  2V1X A;  2UXX A;  1GLN A;  1A04 A;  1SAU A;  3GTO J;  2VKE A;  4ENJ A;  3DWL E;  1GDT A;  1YLF A;  4MLO A;  1LMB 3;  4FX4 A;  4C9Y A;  1QP0 A;  2IP2 A;  1VQ8 I;  2XKP A;  1HW2 A;  4YII A;  1RR8 C;  2BHZ A;  3WTW C;  5D6F A;  1Y0U A;  3CUQ B;  2XAJ A;  5E20 A;  4MEY F;  2CO5 A;  4DZP A;  5H2F C;  2BY3 A;  4D0P A;  3OYL A;  5F08 A;  2M34 A;  3SYT A;  1MND A;  2ZNY A;  1W0U A;  2XHK A;  3HL2 A;  2IJL A;  2V6C A;  2Y31 A;  4PJL A;  4DZJ A;  3S1Q J;  1JKR C;  3ZR8 X;  2PUC A;  3TQN A;  3CCL I;  2CV0 A;  3ELK A;  3UNG C;  1I39 A;  4GGG A;  4HBL A;  1FEX A;  2HGC A;  1IRG A;  1H88 C;  4Y15 A;  2EWT A;  3G7D A;  1BIA A;  4LGW A;  4XL9 A;  2R92 J;  5DSX A;  1MD0 A;  3DF8 A;  5ILV A;  3WTV C;  3L7W A;  2P0W A;  5LEK A;  1F5T A;  1HDD C;  3DP7 A;  2Q8K A;  1R4N B;  3KEY A;  2HKX A;  1YYV A;  5M5X J;  2OD5 A;  5CVV A;  4HRI A;  1QVT A; 
#chains in the Genus database with same CATH homology
 3O8G A;  2G0E A;  5GP9 A;  3GTK J;  3LSP A;  2O49 A;  1JT6 A;  4CYC B;  1HCR A;  1PRV A;  4MCT A;  2PPX A;  2JK3 A;  2X6O A;  3F0C A;  3Q0U A;  3TW6 A;  4A69 C;  3JRI A;  4IA8 A;  3PM1 A;  1GV5 A;  1XWR A;  1R63 A;  1X2M A;  4O8B A;  1ETW A;  3LIS A;  4X4B A;  5E3L A;  2ID6 A;  5EZH A;  1BW6 A;  5E3N A;  2HQ5 A;  3OP9 A;  1IG7 A;  4X4D A;  5F0C A;  1ZZ6 A;  3ZKC A;  2LFB A;  3S8Q A;  4UUS A;  1MBJ A;  2JA5 J;  1RZR A;  1RIO A;  4MFD A;  2AXV A;  4XID A;  2HOS A;  2DA6 A;  3QQA A;  2B63 J;  3KXA A;  1W0T A;  1JKP C;  4JCX A;  3HGY A;  2PUE A;  3SCG A;  3GTQ J;  5A7L A;  4FE7 A;  4V2G A;  5FKL A;  4BBR J;  1PNR A;  2R7Z J;  5M5Y J;  2MGQ A;  4L5E A;  3BTI A;  3FK6 A;  3MN2 A;  3F52 A;  5EGO B;  4X4G A;  2X48 A;  2DJN A;  5IOY A;  4JX6 A;  3S14 J;  3CLC A;  2EZK A;  3BT9 A;  3JRF A;  1U78 A;  2IAI A;  3OQM A;  5J1R A;  1ZK8 A;  1AHD P;  2KDZ A;  3OMT A;  3VK0 A;  1MH3 A;  1DU6 A;  1E3O C;  1LCC A;  2LKX A;  1XS9 A;  1P7I A;  2IU7 A;  3MVP A;  2R63 A;  1TWH J;  1H89 C;  1QP7 A;  2PUA A;  2GLO A;  2DA2 A;  5EF6 A;  4FE4 A;  2IUO A;  2DMN A;  1GT0 C;  2AXU A;  1LFB A;  2O9L A;  2JMW A;  4X4H A;  2L49 A;  1HDP A;  1S7E A;  3CDL A;  4YG7 B;  3I4M J;  3FMY A;  1HF0 A;  2PE5 A;  3CRO L;  2L7F P;  5M3M J;  4IHW A;  2R5Z A;  1IRZ A;  1QP4 A;  3G1M A;  5F27 A;  2EBI A;  3JXD L;  4JX4 A;  1CJG A;  1TWC J;  1ETV A;  2AWI A;  1TWG J;  3BR0 A;  2TRT A;  4GFB A;  4IHV A;  3IH3 A;  1MH4 A;  5GPC A;  2JVL A;  4OB4 A;  1ZS4 A;  3ZHM A;  3HOZ J;  5K98 B;  2IEK A;  3BG3 A;  2DMQ A;  4QIW N;  4YG1 A;  4FTH A;  4DYQ A;  2JWT A;  2GBY A;  3ZHI A;  3K2A A;  1BA5 A;  4A3J J;  1IDZ A;  1VI0 A;  2HXI A;  5EG0 B;  1HLV A;  2DA5 A;  1VFC A;  4I6R A;  3WHB A;  9ANT A;  1JTX A;  1ZKG A;  4BXX J;  2HOA A;  1PUF A;  2K9N A;  1WH6 A;  1NK2 P;  1SAN A;  1I6H J;  2Y30 A;  2L7Z A;  1MBE A;  3M3Y J;  3DNV B;  4B1R A;  5FKK A;  4F8D A;  4Y42 A;  2WV1 A;  4Z5H A;  3G5G A;  1RKT A;  2XCJ A;  2JA7 J;  2DA4 A;  5FKN A;  2LR8 A;  1ITY A;  3F51 A;  4AYB N;  3ZQF A;  4J1W A;  2CQQ A;  1NEQ A;  1B8I B;  1ENH A;  4IWR A;  1ORK A;  3F6W A;  3JRG A;  2O4A A;  4HNV A;  1I50 J;  4D5C A;  2CU7 A;  2K9S A;  1R9T J;  2CSF A;  1LLI A;  2AO9 A;  4UUS B;  1SFO J;  3VPR A;  2ME0 A;  1EFA A;  3HOW J;  1ZZC A;  1ZZ8 A;  4PU3 C;  1BDI A;  2OR1 L;  2EF8 A;  2FQ4 A;  3R1F A;  3FIS A;  1X58 A;  3PXP A;  4M3E A;  1FJL A;  2QF7 A;  1IC8 A;  4X6A J;  5J1U A;  1YRN A;  2L9R A;  2CRO A;  2GRL A;  1NK3 P;  3SFI A;  1B0N A;  5M3F J;  2MEZ A;  2XIU A;  3TP3 A;  1WGX A;  1F36 A;  4FIS A;  5J1Y A;  2COB A;  3QQ6 A;  3JXB C;  3U3W A;  2LK2 A;  4A3G J;  2DA1 A;  3CMY A;  4J19 A;  4MCX A;  3BTL A;  4X4E A;  3A01 A;  1IDY A;  3RZD J;  5F1J A;  2CRG A;  3QF3 A;  2HIN A;  2R5Y A;  3BR1 A;  4BY1 J;  2GZU A;  4A3K J;  1MSF C;  4PU4 C;  1FTT A;  2EZL A;  2YS9 A;  3TP0 A;  2M8G X;  2VPR A;  3ZQI A;  2A6C A;  3BD1 A;  4GHJ A;  1K83 J;  4I6Z A;  2O8K A;  2OFY A;  5EEA A;  1OFC X;  1OJL A;  3O8H A;  1CQT A;  3HOU J;  1Z77 A;  2Y9Y A;  4A3L J;  1JKO C;  3MKL A;  2LYS A;  2W48 A;  2YU9 J;  1AKH A;  3BG9 A;  1OCT C;  2R93 J;  2R5Z B;  2JA6 J;  1ZVV A;  2I10 A;  3PO3 J;  3JRE A;  3CEC A;  4MIM A;  2KEI A;  1LFU P;  1ETO A;  1TWA J;  1ETY A;  3OIO A;  1BDH A;  1XC5 A;  3HBL A;  2JA8 J;  4GQM A;  3OQO A;  1EF4 A;  3B6C A;  2JCG A;  3E7L A;  1F43 A;  1FTZ A;  1ZZ7 A;  4X4I A;  2PUG A;  1ZR2 A;  1YSE A;  5JLX A;  1JFS A;  1VPW A;  2PUD A;  3FIW A;  5GPA A;  2R0Q C;  2EZH A;  4RDU A;  3S1N J;  2AXZ A;  2EBY A;  1BL0 A;  3H3V K;  3O9X A;  3KZ3 A;  4QTR A;  2LYJ A;  1JUS A;  2JN6 A;  4G12 A;  4EEF G;  2WUS R;  1APL C;  3CQZ J;  5F0F A;  5EZG A;  4M6V A;  5C4X J;  2H8R A;  1L1M A;  4M3D A;  5BNG A;  4A3I J;  2Y9Z A;  5IP7 J;  1BW5 A;  3LNQ A;  2LP0 A;  1LE8 B;  4FCY A;  1JJ6 C;  1JGG A;  2HSG A;  4JYK A;  4W1U A;  2VKV A;  1HOM A;  1BJZ A;  2DMP A;  1ZPQ A;  1P7J A;  3TRB A;  1X2L A;  3IH2 A;  1X2N A;  2BNN A;  3FYA A;  2LYQ A;  3NAU A;  3SDG A;  4JP0 A;  1U9N A;  1UXD A;  4ABZ A;  2DTZ A;  4I76 A;  1UG2 A;  3A03 A;  1O4X A;  3LOC A;  1IGN A;  3BR6 A;  3B7H A;  3TW7 A;  2N8G A;  4JQD A;  4D7M A;  2XPW A;  2E2J J;  1MBH A;  3JRB A;  1WIZ A;  5IYD J;  4NDW A;  2AW6 A;  2XSD C;  1T33 A;  1DU0 A;  1JT0 A;  2L0K A;  2CQX A;  3HB9 A;  2ME6 A;  2LYK A;  3RKQ A;  5IOZ A;  2LLK A;  3BDN A;  1IUF A;  4C3I J;  1UTX A;  4A3B J;  1GUU A;  2DMT A;  2YUS A;  3LSJ A;  5IYC J;  1Y1W J;  4I6U A;  4JCY A;  3GTP J;  2M0C A;  2IVB A;  3BTJ A;  4C3J J;  2NVX J;  1PRU A;  3RZZ A;  3SCF A;  3UFD A;  2FJ1 A;  2B5A A;  1IJW C;  3JRA A;  3JXC L;  2EQR A;  4M3G A;  1TC3 C;  1T56 A;  3HOY J;  2FD5 A;  4M3B A;  5F0H A;  2LYR A;  4RBO A;  4Z5C A;  3A01 B;  2BJC A;  1QPZ A;  1PRA A;  3A02 A;  3GTL J;  2R5Y B;  2ECC A;  3HOV J;  4A93 J;  1R69 A;  2FX0 A;  4BY7 J;  1A5J A;  2E19 A;  2LD5 A;  4XRS A;  2GRM A;  1D5Y A;  2HYJ A;  5J3L A;  4B3A A;  3GN5 A;  4A3C J;  1JUM A;  1Z0X A;  1JFT A;  4A3E J;  2X9D A;  2NS8 A;  2LTP A;  2NS7 A;  1TWF J;  1JKQ C;  2DN0 A;  3SCH A;  1QVT A;  3FYM A;  3D1N I;  2BNM A;  5FLV A;  2JJ7 A;  3LSR A;  3BS3 A;  1G2H A;  1B72 A;  5EDN A;  4S0H B;  3CCY A;  1DWK A;  2DA7 A;  1UHS A;  1I3Q J;  3ZQL A;  2NVT J;  3S15 J;  1Q1V A;  3BR5 A;  3BR2 A;  3H0G J;  5HOD A;  4V2F A;  4XRS G;  4UUT A;  5FJ8 J;  1QVU A;  3ZQG A;  3S1R J;  2KEJ A;  1UXC A;  3S16 J;  1RKW A;  2AHQ A;  4AUX A;  3G1O A;  4C2M J;  3UKG A;  2IV1 A;  2H1K A;  1UMQ A;  1ZUG A;  2O38 A;  1SQ8 A;  3HKZ N;  3HDD A;  2ZB9 A;  2E2H J;  2XGD A;  4J1X A;  3SJM A;  1X57 A;  1ZAY A;  3FKI J;  4BBS J;  2IVG A;  5DTD A;  3S2D J;  3Q0V A;  3OQN A;  3RQI A;  5FLM J;  5IP9 J;  2MW8 A;  1U9O A;  1QPI A;  1XG1 A;  3DEW A;  3I4N J;  3DCF A;  2LVS A;  2ELK A;  2HDD A;  1JUP A;  1ETK A;  2K9Q A;  2HXO A;  3GBF A;  4DW6 A;  4X4F A;  1B8I A;  4A3F J;  3IVP A;  2MG4 A;  3C2B A;  4DYC A;  2ICT A;  1QQB A;  5IP6 A;  3M4O J;  3FK7 A;  3LSG A;  4PU8 A;  4Z59 A;  1ADR A;  3JRD A;  2KPJ A;  5C3E J;  4X1E A;  4IHX A;  1RZS A;  1JTY A;  3HEF A;  3QPL A;  2R1J L;  2XPV A;  2WB1 N;  1VF9 A;  1ZQ3 P;  3QPS A;  5IYB J;  1NTC A;  2KEK A;  4AC0 A;  4D7N A;  5EYR A;  3PO2 J;  1ETQ A;  4FBI A;  2XRL A;  4IEJ A;  5C4J J;  1WCM J;  3TED A;  1PUF B;  1WH5 A;  2E1O A;  4Y52 J;  1NER A;  2FJR A;  1RET A;  1Y7Y A;  1RPW A;  3L1P A;  1ZGW A;  2OF7 A;  3K7A J;  3S2H J;  3JR9 A;  3H5T A;  3BQY A;  3IV5 A;  3KJX A;  4CYC A;  2XGC A;  1GV2 A;  2D5V A;  1VND A;  2EZI A;  3GTM J;  1LQC A;  5E3M A;  3S1M J;  5FKO A;  1DW9 A;  2NOG A;  2MSY A;  5IPA A;  2IBD A;  2AUW A;  2P81 A;  3HOX J;  1QRY A;  4C3H J;  3QWG A;  1WH8 A;  2PMZ N;  3MLF A;  2EH3 A;  4A3D J;  1K61 A;  2XI8 A;  3BR3 A;  4BKX A;  3RZO J;  2DMU A;  3HM5 A;  2ID3 A;  2MQK A;  2XJ3 A;  4B4C A;  4JX5 A;  4XIC A;  1LCD A;  3ZOB A;  2QCO A;  5DS9 A;  1ZTR A;  4IVZ A;  2Y0S N;  3GN5 B;  2WAQ N;  1ETX A;  3Q0W A;  3ZQC A;  3OOU A;  2OPT A;  4MFE A;  2O7O A;  2XB0 X;  3JRC A;  3QYX A;  1JWL A;  5JLW A;  2DA3 A;  3NAR A;  4I6T A;  5EGO A;  1JH9 A;  1WH7 A;  5FKM A;  2NVQ J;  1POU A;  1MBF A;  4LOC A;  1ZZ9 A;  1A6I A;  2TCT A;  1Y1V J;  4W97 A;  1ZZB A;  4A3M J;  1QQA A;  1YRN B;  1FIP A;  2PUF A;  4Z5D A;  1RZR D;  1B72 B;  3EUS A;  2M2E A;  1FIA A;  3WHC A;  2BNO A;  1MBG A;  5M5W J;  2CUF A;  1AU7 A;  3GTG J;  2KZ8 A;  2L8N A;  4M3F A;  3Q3S A;  2LCV A;  3W6V A;  2PIJ A;  4YG4 A;  1OCP A;  2RAE A;  2VKE A;  3JRH A;  3GTO J;  1H8A C;  1GDT A;  4MLO A;  1LMB 3;  4YBA A;  3HZI B;  4XK4 A;  1POG A;  3IH4 A;  2IVQ A;  4FN3 A;  1OSL A;  1QP0 A;  4DYR A;  1IV6 A;  2LYL A;  2PUB A;  1LE8 A;  1Y9Q A;  4I8T A;  2K40 A;  4DZP A;  4QSH A;  3BG5 A;  2GM4 A;  2CJJ A;  4X4C A;  5F08 A;  2M34 A;  1ZR4 A;  4IHY A;  1AKH B;  2WIU B;  2L7M P;  2LY9 A;  2VI6 A;  3G1L A;  1W0U A;  1PER L;  2VUM J;  4YAR A;  2KT0 A;  2XPU A;  5E3O A;  3GTJ J;  1JJ8 C;  2E2I J;  1WET A;  2Y31 A;  4DZJ A;  3S1Q J;  3B6A A;  1JKR C;  2PUC A;  4PU7 A;  3OSF A;  3BQZ A;  5K7F A;  4Z58 A;  1MBK A;  3GBG A;  1WI3 A;  2CUE A;  1U8B A;  5EG0 A;  2HOT A;  1GVD A;  1FEX A;  1RR7 A;  1H88 C;  2EWT A;  5C44 J;  3G7D A;  3S17 J;  3HGG A;  2HI3 A;  5F04 A;  2R92 J;  4MO7 A;  3LFP A;  2LYP A;  5K7H A;  4Y7N J;  1HDD C;  3OSG A;  3ZQH A;  2XB5 A;  4XRM A;  1RES A;  5M5X J;  1MNM C;  2M9H A;  1RPE L;  4NDL A;  2NVY J;  3BTC A;  1MSE C;  2Y2Z A;  1WPK A;  4D5F A;  5K7Z A;  2ICP A;  2ECB A;  2XGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...