2XSDC

Crystal structure of the dimeric oct-6 (pou3f1) pou domain bound to palindromic more dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
128
Chain Sequence
APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*AP)-3'
total genus 43
structure length 128
sequence length 151
ec nomenclature
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xsdC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2xsdC01
2FX0A 2B63J 1B72B 5FLMJ 2Y31A 2IVQA 2VKVA 2COBA 2FD5A 4Y7NJ 4A3EJ 1ZKGA 2GLOA 2HOTA 4GFBA 3S1QJ 4GQMA 1LLIA 4MFDA 2WV1A 4IWRA 3HOUJ 2XPUA 1JUSA 3G1MA 2HQ5A 3EUSA 3CQZJ 3FMYA 2Y30A 1ZZ6A 2WUSR 1QP0A 3TEDA 2ME0A 3RZDJ 2CQXA 3GTPJ 1LCDA 4C3JJ 4W1UA 5F1JA 4BBSJ 2IVBA 4GHJA 4PU7A 2HOSA 1RKWA 1WI3A 2L7FP 2DA1A 1ADRA 1DW9A 2DMNA 3LOCA 3TW6A 3FYMA 1FTTA 5IP6A 5IYBJ 1SFOJ 2ECCA 4I76A 1QQBA 2AHQA 4BY1J 1EFAA 1RESA 4IVZA 2YS9A 2NOGA 3QF3A 1VI0A 2TRTA 2NVXJ 2JA6J 1U9NA 4A3CJ 4CYCA 3GBGA 4A3FJ 1MSEC 2D5VA 1JTYA 4NDWA 5C3EJ 2X9DA 3WHCA 2M9HA 3TP0A 2LYLA 3S17J 2HYJA 3CCYA 5FKMA 3BR1A 3JRGA 2HI3A 1VF9A 2TCTA 2XRLA 3CMYA 1JGGA 4A69C 2NVQJ 2EZKA 4DYRA 4RDUA 1RETA 3ZHIA 3R1FA 2DA2A 2MW8A 4C3IJ 4Z59A 2LYPA 3O9XA 4A3IJ 2R92J 1QPZA 2ME6A 2VPRA 1APLC 3HOZJ 2MEZA 2JVLA 3UKGA 3GTKJ 3BDNA 1DU6A 1O4XA 4A3JJ 2CRGA 3MKLA 1I6HJ 2EZIA 3GTJJ 1BW6A 3BG3A 4A3BJ 4FTHA 3GTOJ 3BQZA 3QQAA 5E3LA 5J1RA 1MBHA 1POUA 1TWAJ 3OSGA 3SCFA 3BR3A 2R93J 4PU3C 1MNMC 2PIJA 4BY7J 1WGXA 5F27A 2R5ZB 1ETKA 3DEWA 2O8KA 3S8QA 1WH7A 4FCYA 1X58A 4X4GA 5EZHA 4PU4C 2AXVA 3FKIJ 5IOYA 2XPVA 4DW6A 4I6ZA 2LVSA 2GBYA 4A3KJ 5M5YJ 2DMQA 5E3MA 2R63A 5K7FA 1X2MA 4YG4A 4M3FA 1ETYA 1BDIA 1R9TJ 1ZZBA 2IUOA 1DWKA 2NS8A 1ETXA 2WB1N 3ZHMA 3FIWA 3IV5A 2B5AA 1D5YA 5FKOA 4UUSA 5EDNA 1B8IB 4M3EA 1L1MA 2JA7J 4UUSB 1B8IA 4XIDA 2E2JJ 1U78A 3G1LA 5EG0A 1UTXA 2AW6A 2AWIA 3Q0UA 1QQAA 2IAIA 2JK3A 5EG0B 1WETA 5GPAA 2AXUA 1TWGJ 3BT9A 1JJ8C 1PRVA 2FQ4A 1R63A 1RZRD 2EZLA 2IV1A 4O8BA 3F51A 9ANTA 4A3LJ 1NK3P 1IC8A 3OMTA 2YUSA 3FISA 5K7HA 1ZS4A 5GP9A 4IA8A 1MBKA 4MIMA 3S1NJ 3DNVB 2QF7A 1QPIA 4UUTA 2LR8A 4V2GA 2ZB9A 2CJJA 3BR2A 1YRNA 3OP9A 1LQCA 1GVDA 1OCPA 1PRAA 1B0NA 2XI8A 3BTJA 3ZQFA 1PUFA 3RZOJ 2XJ3A 3HBLA 1K61A 5IYDJ 4DYCA 3GTLJ 1U9OA 2IBDA 3I4MJ 5EZGA 4XICA 5C4JJ 3A03A 2BJCA 2DA3A 1ZTRA 3LSJA 2EQRA 3BR0A 1ZZ7A 4Y42A 1HDDC 3QPSA 5E3NA 1XS9A 5EF6A 1BL0A 1R69A 3KXAA 3MVPA 5IOZA 4IHWA 1YSEA 3ZQIA 3HOYJ 4FE4A 1BJZA 2BNNA 2IVGA 1JT0A 2KDZA 3LSPA 1TWHJ 4BBRJ 3FK7A 2O4AA 2M0CA 1ZR4A 1ORKA 3GN5A 3BTIA 1OCTC 1WIZA 3GN5B 2JCGA 3WHBA 3HM5A 2NVYJ 2HXIA 1HF0A 1IV6A 1ZUGA 3QWGA 1JUPA 1JFTA 1CQTA 2RAEA 2LP0A 5J1UA 4DZJA 2XPWA 4IHVA 3B6CA 1JKQC 3HZIB 3NARA 3CLCA 3QPLA 4I6UA 1H88C 2A6CA 1AKHB 3BG9A 2LYQA 2LKXA 1AKHA 3M4OJ 1Z77A 3BQYA 1TWCJ 1UXCA 2ICTA 3LISA 2K40A 4M6VA 3BD1A 1W0TA 3K2AA 1POGA 2AO9A 1BDHA 2AUWA 2PUFA 1PNRA 1MSFC 3SJMA 2PUDA 2M2EA 4JX5A 2MQKA 2CSFA 3KJXA 3Q0WA 4MCTA 2ICPA 3PO2J 1W0UA 3I4NJ 2LYJA 1BW5A 1RR7A 1Y7YA 1QP7A 2LLKA 3SCGA 1NEQA 3PXPA 4ABZA 2LYKA 4D7MA 4A93J 2R7ZJ 1JUMA 1UXDA 2OF7A 1JFSA 3C2BA 1FTZA 2KPJA 2JWTA 1UHSA 3SFIA 1X57A 1JKRC 2N8GA 3JREA 3S2DJ 5IPAA 1AU7A 3FYAA 1QRYA 3L1PA 3DCFA 2H8RA 2LCVA 2ECBA 4Z58A 1JKPC 2LK2A 2X48A 2L9RA 1IGNA 1JJ6C 3O8GA 4Z5CA 3PM1A 3H0GJ 1RIOA 2BNOA 2OFYA 5DTDA 1TC3C 1T56A 2ID6A 1GDTA 3LFPA 2E1OA 4FISA 2JA5J 2EH3A 2PUGA 4IHYA 1MBFA 3OQOA 2DA7A 2VI6A 5M5XJ 1IUFA 4XRMA 3BR6A 4J1XA 5F0CA 3BG5A 4AC0A 4NDLA 3OOUA 2WAQN 1FIPA 2K9QA 4G12A 1ZR2A 3ZKCA 1ETVA 5JLWA 1HOMA 2E2HJ 2YU9J 1IDZA 3IH3A 3GBFA 1RZSA 1ZZ8A 3CECA 3JXBC 1I50J 3JRAA 2E19A 3S1RJ 1GT0C 3S2HJ 3D1NI 5J3LA 2K9NA 2WIUB 3GTGJ 1LE8A 2LFBA 4J1WA 1LE8B 4JQDA 3SDGA 2BNMA 3A01A 4MLOA 2O49A 3HOXJ 5F04A 3A02A 1GUUA 3PO3J 4M3DA 1MH3A 2EF8A 4FE7A 2R5YA 3HGGA 2QCOA 1X2LA 1ZGWA 1NERA 1HLVA 1WH8A 2IU7A 2HXOA 4S0HB 3ZQLA 3S15J 2DMPA 1YRNB 3MN2A 4M3BA 1PUFB 5EGOA 3RKQA 5K98B 2DA6A 1TWFJ 2H1KA 2W48A 2KEKA 3BS3A 4YARA 2X6OA 2DMUA 1ZVVA 1MBGA 1ZQ3P 3F52A 2FJ1A 4OB4A 4AUXA 1F36A 2JMWA 2MG4A 4MFEA 1F43A 5DS9A 2LYSA 5A7LA 2L8NA 2CQQA 3B7HA 3OSFA 3VPRA 5F0FA 4I8TA 2PUAA 3QYXA 1P7IA 1FIAA 1OJLA 1NTCA 4B3AA 3TRBA 2DJNA 4I6RA 5BNGA 4X4DA 4D7NA 3TW7A 2LYRA 4Z5HA 4C2MJ 1LCCA 3ZQGA 1XWRA 2NVTJ 3ZQHA 3B6AA 2O9LA 4X4EA 1VFCA 1WPKA 2PUEA 4YG1A 3SCHA 5FKNA 3NAUA 4QIWN 2PPXA 3ZOBA 4J19A 3HB9A 1LFUP 2CUEA 2HDDA 5M5WJ 2GZUA 3RZZA 1RPEL 3Q0VA 1AHDP 4XRSA 4IHXA 4JX6A 1G2HA 3HEFA 1JT6A 5IP7J 1B72A 2XGDA 4FBIA 4YG7B 1X2NA 1GV2A 3O8HA 5JLXA 1WH6A 2R5ZA 3IH4A 1IJWC 3FK6A 2O38A 1Q1VA 1K83J 3H3VK 2GM4A 1GV5A 1S7EA 4M3GA 2OR1L 5C4XJ 3Q3SA 2XB5A 3QQ6A 4F8DA 5M3MJ 3JRFA 2FJRA 2KEIA 3VK0A 4B1RA 1QVTA 2VKEA 4D5CA 1JWLA 1PRUA 4JP0A 1NK2P 4AYBN 3BR5A 3G5GA 3U3WA 1HDPA 3JRCA 3H5TA 1H89C 5FKLA 2L7MP 2ID3A 1PERL 2Y2ZA 3JRIA 1ENHA 3JRDA 2AXZA 1ZPQA 4YBAA 4XK4A 4X4CA 2DA4A 4QTRA 3W6VA 1E3OC 1VNDA 1XG1A 4X4HA 2EBYA 1RPWA 4BXXJ 4X4IA 3HKZN 3OQMA 2R0QC 2Y9ZA 3HDDA 3JXDL 3M3YJ 3LSRA 4Y52J 2MGQA 4MO7A 3S1MJ 2DTZA 2DA5A 2I10A 2K9SA 4EEFG 2DN0A 2XSDC 2E2IJ 3A01B 1ZAYA 4A3DJ 3LNQA 1EF4A 5M3FJ 3G7DA 1FEXA 4RBOA 3F0CA 1XC5A 3CDLA 2KZ8A 2R5YB 3GTQJ 2XIUA 4W97A 4JX4A 4JYKA 1OFCX 1ITYA 3F6WA 1MBEA 3UFDA 2Y9YA 5EGOB 2EZHA 5J1YA 5EYRA 3IVPA 3HOWJ 2XB0X 2IEKA 4JCXA 1ZK8A 2CU7A 2JN6A 2DMTA 1JKOC 4QSHA 1UG2A 4A3MJ 1IRZA 3GTMJ 1ETOA 4X4FA 3E7LA 3TP3A 1SANA 4V2FA 3ZQCA 4PU8A 1H8AC 4L5EA 5HODA 2ELKA 4CYCB 4X6AJ 2HINA 3CROL 2KT0A 3HGYA 3HOVJ 2L49A 3G1OA 1BA5A 1IG7A 3KZ3A 5E3OA 1ETQA 3S16J 1CJGA 2JA8J 1VPWA 2Y0SN 2M8GX 2LTPA 2G0EA 1LFBA 2HSGA 2GRLA 2O7OA 4X4BA 1IDYA 2MSYA 1MBJA 1UMQA 1Z0XA 3K7AJ 4DYQA 5C44J 1SQ8A 4Z5DA 1RKTA 1ZZ9A 2EWTA 4A3GJ 1HCRA 4IEJA 1WCMJ 5FKKA 3JRHA 4DZPA 2P81A 2XGCA 5FJ8J 2NS7A 2CROA 1A6IA 5F0HA 1A5JA 2R1JL 3JRBA 1WH5A 4X1EA 4BKXA 1MH4A 3MLFA 1JH9A 5IYCJ 3OQNA 3JXCL 2PUBA 4C3HJ 3BTCA 4D5FA 4HNVA 2OPTA 2VUMJ 2PE5A 3S14J 1LMB3 1QP4A 2JJ7A 2XCJA 5K7ZA 2LD5A 1ZZCA 2L7ZA 1JTXA 2L0KA 1RZRA 1OSLA 1P7JA 2LY9A 4I6TA 4LOCA 2EBIA 2M34A 4FN3A 2PUCA 2PMZN 1DU0A 1ETWA 1U8BA 3IH2A 3BTLA 5GPCA 5EEAA 1T33A 5FLVA 3OIOA 3JR9A 1Y9QA 5IP9J 2CUFA 1Y1VJ 1Y1WJ 2HOAA 3RQIA 5F08A 4B4CA 2GRMA 4XRSG 1QVUA 2KEJA 4JCYA 3LSGA 1I3QJ 1FJLA 2XGEA 4MCXA
chains in the Genus database with same CATH superfamily
2FX0A 2B63J 2CS3A 4M9XA 1EV7A 1TL8A 3J7YJ 4UV8A 3KPHA 4RGXA 2VKVA 3RIRA 3VOEA 4KITB 2VBWA 2JVGA 1D3YA 1HKSA 3V42A 5IT3A 2PJPA 3RYRA 2HOTA 1UELB 2R4GA 3S1QJ 4MFDA 3UWPA 1RUOA 2VJIA 2A6HF 5HLGA 2LREA 2Y30A 1FYLA 1H9GA 1O3QA 3GTPJ 1UHMA 5F1JA 2IVBA 1LCDA 2HOSA 3OV8A 3WTYC 2R7RA 2L7FP 4IZZA 2DA1A 3RQ4A 1ADRA 4N0BA 3HRSA 1FC3A 3LOCA 4E6KG 5B3SH 2KKOA 5IP6A 4MEXF 4E7SA 4AIJA 1SFOJ 2HDWA 4CHUA 4BY1J 1D0ZA 2YS9A 2NOGA 3QF3A 2YU3A 5E8GA 2IT0A 1O3RA 1JGSA 2OA4A 3DU5A 4XQFA 4A3FJ 2EV6A 1Y8QB 5C3EJ 2X9DA 2OAZA 4HX7A 1WVRA 5AONA 1G6NA 1T2KA 3MZ8A 2HYJA 4HF0A 2F5EA 1VF9A 5HNHA 2XRLA 2WTEA 4A69C 2NVQJ 5CLSA 2X4HA 4G9YA 4M6YA 4DYRA 4RDUA 2BOLA 2W7NA 4GDFA 4OIQF 2MW8A 4C3IJ 1ZG1A 2AQEA 3HZJA 3OYNA 2LYPA 4A3IJ 2E34A 2R92J 4ER7A 3E6DA 4BE0A 1EKEA 2ME6A 1QPZA 2EFOA 3OS1A 2JPCA 1SMTA 1STZA 1I6HJ 2E60A 2EZIA 4A3BJ 1S72I 5E3LA 2D1VA 1ZHFA 1MBHA 2CSOA 1TWAJ 2RVCA 2E1MB 3SCFA 3BR3A 4KN7X 2X6XA 2ZBKA 4BY7J 5F27A 2FBKA 4EJWA 2O8KA 1LEAA 2HYGD 3J7ZI 3FKIJ 4ENJA 3BZKA 5K5OA 2XPVA 4DW6A 2LF7A 4S04A 3F23A 2DMQA 2KFDA 3QU3A 2R63A 2M8EA 5KAIC 1VQNI 2CO5A 4L5IA 2PXBA 4YG4A 4M3FA 3S2WA 3CD6I 1L0OC 2IW5A 2JZYA 5TJJA 2D2WA 4RAYA 4YFNF 4IHSA 5FRNA 2EILH 1B1BA 1BC8C 2HOEA 3KETA 3FM3A 1ZLJA 4HRIA 1ZELA 2QZ8A 1XGSA 2O3FA 1UTXA 5EG0A 2E5NA 5TRDA 4UVAA 2E1NA 1QA6A 1DPRA 2HU9A 2RNJA 4MTDA 4WCGA 2AXUA 1JJ8C 3GX4X 3ELKA 3FXQA 1R4NB 1X4PA 1Z21A 4XKBA 2ZJ2A 4BACA 5BMZA 9ANTA 1NK3P 1IC8A 3OMTA 2YUSA 1ZS4A 1Z1DA 1MBKA 4MIMA 3FHNA 3K4KA 1R7JA 2ZB9A 4U0WA 1RIOH 2K3PA 1YRNA 2V7FA 1LQCA 1GVDA 1PRAA 2FFHA 1B0NA 2XI8A 1W7PD 3W2VA 3EYIA 2ZXIA 2Q1ZB 4A2UA 3VYSB 1U9OA 4CCNA 5B5EC 3I4MJ 2E36A 4XICA 3IL2A 4KIFA 2BJCA 5B66C 2E1CA 4DE8A 4Y42A 3CMAI 5K5QA 3KXAA 3P9KA 4XLCA 4ZYGA 5GAHi 4IHWA 3OYFA 1B9NA 3H3ZA 1YSEA 2GAUA 2MH9A 2V4JC 2KDZA 4ZDLA 1TBXA 2O4AA 4FT8A 1XB4A 1JI8A 2J5OA 3KX2A 4RMNA 5BPDA 1WIZA 2EIJH 3WHBA 1BR1A 2LLWA 2R7XA 1K6OA 2FRHA 2V1XA 2GQQA 2LF8A 2F4MB 2HXIA 2NVUB 1P4AA 1IV6A 1JUPA 3QOWA 1SVLA 1WI9A 4EKGA 2V1NA 4IHVA 4D1QA 3IRQA 2QEXI 2DFFA 4NUBA 1WWXA 4UB8C 3DWLE 3F6OA 3OL4A 4FASD 5TISC 1Z77A 4EQQA 3M4OJ 1HA8A 3BD1A 1BDHA 5LD2C 3BCAA 3S3OA 3DM5A 1PNRA 4J01A 3SJMA 2M2EA 3KJXA 1OR7C 3B02A 2X1EA 1ZAOA 4PUSA 5L3BA 2P5VA 5FROA 4HPQA 3PO2J 1YX5A 1BW5A 3L7WA 1YJNI 2DFHA 2LDUA 5KVRA 3CESA 1CF7A 1JFSA 2LH9A 3DEEA 2ZKZA 4BXUA 1R71A 1FTZA 3I56I 1W5SA 4L5JA 3SFIA 4ETSA 5CVRA 2B9SA 3FMQA 4I7HA 4ZYDA 1Q1HA 2XV4S 1JKRC 2N8GA 3A2KA 3S2DJ 2DW4A 5HDKA 5J4YA 1IRGA 1QRYA 4ER0A 2DYSH 3DCFA 1ZREA 5KCMA 1RZ4A 2WB1A 1KONA 2F5FA 2ECBA 1XSVA 4Z58A 5BS6A 4YFKF 3I54A 4KNYA 2R7UA 4JK1X 5JVTA 2WY7Q 3K10A 4UHTA 4RB2C 3G73A 3RCOA 3DKXA 5L3GA 4IF4A 2BNOA 3VSLA 1Z6TA 1WRJA 2UXXA 4BAYA 5CVUA 2ID6A 1GDTA 3DPLC 2HEOA 2E1OA 1MD0A 4FISA 2M1BA 5E18F 2CYYA 2Z99A 3OQOA 3D5LA 2VQHA 5FO5A 1WSUA 2DQRA 4U88A 3RYPA 1X1AA 3V8KA 4NDLA 4Y4RA 2H6CA 1ZR2A 1FP2A 1ETVA 2VC1A 1HOMA 1S5LC 4DIQA 1IDZA 4YIRX 1UZCA 4Q4ZF 3CZ6A 1I50J 2KRFA 3S3NA 2E19A 1GT0C 4BJ6C 4M73A 4KJZA 3KFWX 3D1NI 4HNTA 3GTGJ 2WBMA 1P4WA 3RKYA 3LQXA 1PP8F 3T8RA 3QP5A 4UXNA 1Y0UA 2V9PA 3A01A 1V4RA 4MLOA 3HOXJ 3IC7A 1K78A 1E17A 1Z05A 4XOTA 2X51A 1MH3A 1NG7A 5FLXZ 2TDXA 3U1KA 2QCOA 2XF6A 2HNHA 1ZGWA 2YPRA 1A6QA 2HXOA 4IX7A 1EJ9A 3CC7I 1NH3A 1YRNB 2XF5A 2EIKH 2QQ8A 2RNGA 1V5EA 1PUFB 4UNOA 3GF2A 2KEKA 2J5PA 3CLQA 3VFZA 3PJRA 4YARA 2DMUA 5HS7A 3IAM2 2B7EA 2QYOA 4E7LA 2LYSA 4DOZA 5H6RA 4KMFA 4UB6C 2QSFX 4HV6A 1IW7F 2XVCA 2PUAA 3QYXA 2QQ9A 1QZXA 3GZDC 5DRYA 4DNCA 3SZPA 2KISA 4LB5A 4ON0A 2X1CA 4D7NA 4P9UA 3F3XA 5HDNA 4C2MJ 5DM7F 3W2WA 3O3KA 3VSKA 2O03A 3GWZA 4L0YB 2ZSHB 1TQMA 1WPKA 4AVZA 4L9NA 5D5XB 3LSIA 3SCHA 2E1MC 4NC7A 1K4TA 2BVMA 1LFUP 1KYZA 2WWYA 2CUEA 1WZ2A 4A12A 2KRHA 3F8FA 4Y13A 4XRSA 3V8JA 1AHDP 1CGPA 1SAUA 3K1PA 5HOOA 5FRMA 3H92A 3R0AA 5IP7J 4FBIA 3R6SA 2LMDA 2LG4A 3IH4A 5CVVA 2FMYA 2IVMA 4AD9A 1IJWC 2O38A 3A9XA 1K83J 2GM4A 2F6CA 3LQQA 4F8DA 3QQ6A 3J7AY 2FJRA 2XC7A 1SEUA 3IAS2 1TT5B 1B6AA 4WK8F 1JWLA 4JP0A 1IN4A 5H6QA 2V3CC 1NK2P 3BR5A 3G5GA 2JUCA 2DYRH 4WWCA 3L2RA 2I8DA 2PI0A 5LGTA 2XHKA 4BXFA 4E7KA 2Z33A 2OV7A 3VYUB 2BY3A 3TGNA 1Z67A 4P96A 1ZPQA 4YBAA 4XK4A 3KP2A 4QTRA 2DOEA 2FUG2 3CCUI 2QKMB 1UAAA 1VNDA 1XG1A 4X4HA 2NS0A 3K70D 1RPWA 4ZYHA 2CMPA 2KIUA 5LHGA 4ER3A 1BI1A 4OBMA 3JXDL 2KJCA 2LBFA 3LSRA 2ESHA 3V7CA 3CCQI 2MGQA 3KYCB 2A69F 5LGNA 4EMSA 2K9MA 2DN0A 1R22A 1PJRA 5DEQA 1OPCA 3LNQA 1EF4A 4M6XA 1S8NA 4WX9A 2PMZA 1ZGJA 3ZXSA 3F0CA 4BDZA 3DF8A 4HSRA 1A35A 5JVGF 4JX4A 1YOVB 3SHFA 4Y3OA 1ITYA 1XN7A 1T38A 2Y9YA 2PXEA 5LLQA 5EGOB 2QQBA 4RB1A 2IEKA 4YRVA 1KU7A 4IXAA 1R4MB 4RAZA 2ZJPF 1JKOC 4QSHA 1KGSA 1WJBA 3E7LA 2H6BA 2EWNA 3GCMA 4MGRA 4V2FA 3D0SA 2ELKA 3OWQA 2HQAA 2MFZA 3BJ6A 5JHFA 2QA4I 3E5XA 1BA5A 4CH7A 3KZ3A 4EATA 4ZZDA 3S16J 1CJGA 2JA8J 2Y0SN 4YELA 3SXYA 2M8GX 3OYAA 2LTPA 3AG1H 3GFIA 5ERIA 2IRFG 4CSWA 2W84A 2GRLA 3WTUC 1MBJA 4OINF 1BC7C 1SQ8A 2EA4A 2DQLA 2EWTA 1HCRA 5FKKA 1WCMJ 3OL3A 2ZMEA 4XLNF 5LHHA 2NNYA 5ILSA 4Q48A 5FJ8J 1Z91A 1SFKA 1A5JA 5LGUA 1MIJA 2R7QA 4XKCA 2PXKA 2P8TA 2A6EF 1BN5A 3OQNA 3JXCL 4F91B 2EB7A 2KIQA 4D5FA 5CPRB 2OPTA 3T5XA 2VUMJ 1LMB3 2XCJA 2LD5A 3RPUA 2EFWA 4EVIA 1RZRA 1OSLA 3ZGKA 4I6TA 3SEZA 3SDBA 2G9WA 4FN3A 1SMYF 2OCEA 3GEZA 4OOIA 3PQKA 3IH2A 1AWCA 2VC0A 2FEZA 2W4SA 2QBYA 3FBNB 3OYJA 2MD5A 2CUFA 3OYCA 3KLNA 2JUGA 4LG3A 3RQIA 2GRMA 1X3ZB 5DV5A 5DUKA 3IKVA 1W7PA 4BH9A 4IQJA 4CYDA 5K1YA 2XGEA 4XLEA 4G94A 4FETA 2VIXA 4EZIA 1WJAA 2EA2A 2LOOA 1R1TA 4Y17A 4M9SA 3DPUA 4PK4A 2COBA 4HLXA 3CMEI 4CCMA 1ZKGA 2ZXHA 4GFBA 2WV1A 4HQMA 4IWRA 2BW3B 1FYMA 1I5ZA 4G7ZF 1E3PA 2BY1A 4XOPA 1JUSA 3EUSA 3DU6A 4ASNA 3FMYA 3HSFA 3LA7A 1KYWA 4V19K 4Q5SF 1YYVA 3GFJA 5ICFA 4W1UA 1OKRA 3NWSA 3TO9A 3JSPA 1W1WE 3CLOA 5E20A 1WI3A 1SD6A 3M9AA 3FXKA 5F64A 5FGMA 3FYMA 1XGMA 1F5TA 3DKWA 5IYBJ 1ZRDA 2ECCA 4I76A 1RESA 1TQIA 5D5UB 3K9TA 5F6FA 3MWMA 1VI0A 5GAEJ 3FXOA 3GBGA 3MQ0A 4M9ZA 2D5VA 5E79C 3EUHC 1DPUA 1OCOH 3WHCA 4ER5A 2CFOA 3S17J 4NQWB 4NNJA 2M7AA 5DD4A 3BR1A 3JRGA 3GZDA 2TCTA 1X1PA 2XGXA 2IGMA 4HZFA 1JGGA 2HVRA 2XAQA 3ZHIA 1SFEA 4M74A 2QQAA 1FWZA 5DTMA 2HS5A 2VPRA 2MEZA 3BWGA 3GTKJ 3C1DA 3TO6A 3OYMA 1ZRCA 1W5TA 3TQNA 2EFPA 2ISYA 4RM2A 3BJAA 4FX4A 3BQZA 1POUA 3QAHA 3K6GA 1G3TA 3OSGA 1EH7A 1FBQA 4PU3C 2PIJA 1WH7A 3CJQB 3K4MA 3I9V2 4ENKA 2VBYA 2A5YB 4PU4C 3SQNA 5IOYA 5LHIA 1QHGA 2LVSA 1LJ9A 1WJCA 2VJJA 5M5YJ 2VXDA 4RB3C 2FNPA 1X3WB 2KMUA 4WF2A 5LRRA 2HPMA 1HKTA 3KCCA 3C3WA 3K2ZA 4I2OA 2IUOA 4RGSA 3WTTC 1DWKA 2NS8A 2WB1N 5LEKA 3ZHMA 2WV0A 2P7CB 1UFMA 2B5AA 2UXNA 3CMMA 4GGGA 2VE9A 4UUSA 1B8IB 1MMDA 1XGOA 5BPIA 3HG9A 1FMWA 1R23A 3ZP5A 1B8IA 4XIDA 3OYGA 1FSEA 1R58A 4A6DA 1U78A 2ZMEB 5E1WA 3KP3A 4BDYA 1ZRFA 1WETA 5GPAA 3OS0A 1UB9A 1U2WA 3NZLA 3ZQQA 1PRVA 2Q0OA 2LSOA 4KT6A 2KIFA 1YO5C 2EZLA 2IV1A 3E6BA 1KA8A 4HQEA 2L02A 2Y69H 4IKFA 5K7HA 3FISA 3RKXA 5GP9A 4IA8A 5KK1A 2M3AA 3S1NJ 3DNVB 4EM0B 4UUTA 5J8CA 4ESJA 2LY2A 4BE1A 2VBXA 3NQOA 3TBIA 1FMVA 2VN2A 2QLZA 5C4JJ 2Z9OA 3HOSA 3BP8A 3VWBA 6PAXA 2YBDA 2VJ4A 3OWTA 1TNTA 2EQRA 2FE3A 2X1DA 3DKYA 1O7FA 2GWRA 3BR0A 5EEHA 1W7PB 4I09A 1W4MA 3GMEA 1BL0A 1R69A 3P9IA 3F8CA 2VQCA 4DE9A 1MDMA 2XAJA 2VKDA 3WTXC 2BNNA 3LSPA 3JAMZ 3FK7A 1XCBA 4BL0B 4KN4X 2WAFA 1LKXA 3LAPA 4IOAF 3HSEA 4N4NB 2K85A 1WHUA 4A0XA 2PFBA 2F5CA 1PYVA 3IHUA 3I59B 4BQOA 1HF0A 2MLKA 1WFXA 1ZUGA 3C2GA 3QWGA 4B48A 3T0YA 3B6CA 3AL0B 3NARA 5HLHA 1H88C 3N4MA 3TOBA 2LKXA 1AKHA 3BQYA 1TWCJ 4CICA 4PZJA 1D8KA 3S3MA 3K2AA 1POGA 2AO9A 5TGTA 1REPC 2FBHA 2CV2A 2AUWA 2PXLA 1MSFC 4RAFA 4MCTA 2CSFA 1MJBA 2ICPA 3KEQA 1S7OA 1MJ9A 1W0UA 4KYWA 3I4NJ 3U2RA 1RR7A 1Y7YA 2FA5A 3AG4H 4FQGA 4ZC3A 2XXPA 1VQPI 2XAFA 4A93J 1JUMA 3G0TA 5F1RA 2W24A 3Q9VA 1EH8A 1UHSA 1YLFA 2G7UA 4JBAA 1X57A 2BZTA 3LMMA 3JREA 1VTNC 1IRXA 1AU7A 3TFLA 3H5NA 2QGUA 3FMRA 4RGRA 1U5TC 3FZVA 2Y0SA 2GXGA 2X85A 1LFPA 4I0AA 1T98A 2X48A 1GHCA 2Z2SB 2IJLA 4RGUA 3R0JA 4HV5A 2HGCA 4Z5CA 1FLIA 1YI2I 3PM1A 4CGZA 3J81Z 2ADUA 4BE2A 2OFYA 1TW3A 2K9LA 3RPQA 2FF4A 3WGHA 3J80Z 3LFPA 4BS9A 1YG2A 2PUGA 2NXNB 1D0XA 2VI6A 4XRMA 1IUFA 3BR6A 2VPLA 4QPQA 4J1XA 3BG5A 4AC0A 2JQ7A 2VB6A 3OOUA 1TTYA 2WAQN 2OZ6A 2A61A 2K3FA 2YU9J 3HIFA 3AAFA 4EJVA 3SFZA 3WTVC 1BI2A 3JXBC 3S1RJ 1V5FA 3MEXA 5J3LA 2VKHA 2LFBA 1VQOI 3OY9A 2C6YA 1GXQA 4J1WA 2XXAA 4XONA 2W00A 3LA3A 4XR6A 2O49A 4AIHA 3A02A 4LG0A 3PO3J 5IT9K 4FE7A 2DK8A 3HGGA 3ULQB 4F93B 3IKTA 1WH8A 5CKTA 4S0HB 3ZQLA 3GUUA 4GXOA 2JPBA 3CUQC 2PXPA 1IZ1A 2DCEA 4M3BA 1I1GA 4QPOA 2ZNYA 2FOWA 3GYHX 5K98B 2DA6A 3E1SA 1UG0A 1IN8A 1ZG3A 2X6OA 5IY5H 1MNDA 1ZVVA 3VDXA 4XKWA 1VZ0A 2WADA 1ZQ3P 2FJ1A 4IJAA 4PFOA 1F43A 1QPMA 5DS9A 5L3CA 3K4NA 3PFYA 3QPTA 3A9ZA 5A7LA 1LB2A 4XSZF 3B7HA 4CDGA 3VPRA 2AXLA 3K1NA 3IP4B 1FIAA 2DU9A 2KHMA 2PN6A 2IGNA 2ZSIB 1R5HA 3LA2A 4HEA2 3TRBA 2FNAA 2DJNA 2MABA 4X4DA 3TW7A 2LYRA 5GADJ 1E0EA 3K0LA 4PJJA 4X4EA 1VFCA 4ZJZA 2PUEA 5AIQA 4YG1A 2JQEA 3BPVA 3DEUA 1YS7A 2QSHX 1DUXC 2HWVA 4QIWN 3MKWB 1QZYA 4WXCA 2E7XA 2ZCWA 2O8XA 4GYGA 3BLYA 2OBPA 1ODDA 2CWEA 2DDAA 3HB9A 1WJDA 3VB2A 1T8IA 2M0MA 1HW5A 4IHXA 1OCZH 1Z3XA 2D1HA 1JT6A 1X1BA 4YG7B 2XGDA 3CCEI 3O8HA 4NC8A 2R5ZA 3KL4A 4X0GA 3T1BA 3F8MA 3HUGB 3FK6A 3FXMA 2Y0MA 3ABLH 2L5QA 3H3VK 2OU2A 4ESFA 2K4JA 3J80K 1MMNA 2HYFA 2OR1L 3Q3SA 4DGWB 2XB5A 4O3MA 1B59A 1JHFA 1T39A 3D5RC 5JR3A 3VK0A 2OJED 3A0BC 1UCRA 2VKEA 1F9NA 1MKMA 4AYBN 2IGKA 1QU3A 3M8FA 2HQNA 3ZN0A 5H20A 3EUHA 1S3JA 4XMYA 2BVLA 3P5JA 5KAFC 1MZBA 4HA8A 2ZNZA 2E35A 2RV8A 5E8IA 3W6VA 2MBFA 1E3OC 2CV0A 1YTYA 2HCSA 4B43A 2OTLI 2KPMA 3PIOF 3ECHA 1T08B 5FFXA 3ZMVA 3SZTA 1V5GA 3DTKA 3S1MJ 2I10A 4EEFG 3DV8A 4G7HF 3HSRA 2BGCA 2E2IJ 3A01B 1MMSA 1ZAYA 1FBUA 5M3FJ 3G7DA 2HVSA 2HCNA 4RBOA 2IA1A 2HVQA 3D5SC 1MMGA 1HBXG 4L9JA 3GTQJ 3H3UA 3G4SI 2DK5A 2XIUA 4CA0A 2V6EA 4JYKA 2Z5UA 4EJUA 4L0ZB 1OFCX 1I6XA 3ZRGA 3UFDA 3ESWB 1FOYA 1OCRH 4AWXB 3HTSB 2EZHA 3KZYA 2XB0X 3OIQA 4JCXA 2JN6A 5HS9A 3MMYB 3H5RA 1IRZA 1ETOA 4G7OF 3DPTA 2GXAA 3SEQA 2CH0A 3OYHA 3E0JB 2KP6A 3HPHA 1E2XA 4EM1A 2L9VA 5D4SA 1P6RA 2R3SA 3QYFA 4CYCB 3OS2A 4X6AJ 1YQAA 2HINA 5J4VA 3HGYA 5DCMA 2L49A 2R7VA 4OMYA 2GZWA 4EKIA 3C2HA 3M1CA 4NQWA 1J0RA 5FFZA 5E3OA 5D5VB 1VPWA 2O5RA 1OYYA 4LG0B 1S6LA 3ROUA 3ZMSA 1QO0D 3A9YA 1K79A 4PGGA 2O7OA 3QPHA 2FQ3A 5BQTA 5L3EA 4BU2A 1Z0XA 3K7AJ 1BI3A 4Z5DA 2KJBA 4XNFA 4LIUA 4A3GJ 1IXRC 3V8LA 3JRHA 1QHHD 1YS6A 1KZHA 2XGCA 5E17F 3HYIA 2CROA 4KMUX 3VYTB 1TT0A 1VQMI 2NOJB 5HVQC 2R1JL 3AL0C 2CQKA 1WH5A 4X1EA 4G6DA 4D9JA 3MLFA 5IYCJ 2YX7A 1BI0A 2PUBA 2KZVA 3PFIA 4C3HJ 2P5LC 3S14J 2LNBA 1LNWA 1WJ5A 2JJ7A 3MAJA 4QWQA 2PXDA 2L0KA 3OYEA 2F4IA 2K5CA 2EBIA 2PMZN 4OAZA 2L2OA 2MC3A 2PX9A 3BTLA 5GPCA 4RB0A 2UWMA 1MJAA 1FNNA 1Y1VJ 2HOAA 2RQPA 3WU0A 5F08A 2DT7B 1BIAA 1QVUA 2KIMA 2RDPA 3G3ZA 3M9LA 2KEJA 4JCYA 3O2PE 2HTJA 2K27A 1B72B 4IRGA 2JTVA 5FLMJ 3ZMDA 2L1PA 2KLOA 2DO7A 5EJCA 3VYRB 3K4BA 4A3EJ 1GXPA 2GLOA 5FB2A 3K1MA 4LK1F 3WE2A 2L3DA 5A2QK 4EGYA 4GQMA 3HOUJ 4UV9A 2XPUA 4PSXA 3E5UA 4F55A 3G1MA 2HQ5A 2ZC2A 3CQZJ 1ZZ6A 1QP0A 1N25A 3TEDA 1X1CA 3RZDJ 2CQXA 3L2QA 4C3JJ 1TP4A 4BBSJ 1ZGAA 4GHJA 4G8XA 4PU7A 1R6RA 1FPQA 3DBRB 1XD7A 4RAGA 2DMNA 3L2VA 1DW9A 3FXUA 2AS5F 2P7VB 5IT9Z 2GA2A 4EJTA 2AHQA 2LKPA 1I3AA 3IUOA 3CDIA 4MQ9F 2TRTA 2NVXJ 1U9NA 4JQFA 2VXZA 5DYMA 1U2ZA 1MSEC 1YX3A 1JTYA 1R1VA 2W82A 2H09A 3CO7C 3TELA 4KFCA 2M9HA 3TP0A 2LYLA 3CJRB 1P2FA 3CCYA 3NRVA 4HF1A 2UV1A 2HI3A 1XMAA 2EZKA 2KZGA 1RETA 1IRFA 5DTRA 2DA2A 1VQ5I 3JAMK 2L01A 4Z59A 1APLC 2DPDA 2JVLA 1D1AA 3UKGA 3BDNA 1DU6A 1O4XA 2CRGA 1HQCA 2YX4A 3DQVC 3GTJJ 3BG3A 3O6BB 1G8XA 2E71A 5ED4A 3GTOJ 3QQAA 3U9GA 5J1RA 1HW2A 4IRHA 2R93J 3SX0A 2JSCA 1MNMC 3ASOH 1WGXA 2R5ZB 3S8QA 1ETKA 3DEWA 1FSHA 2PMUA 2ISZA 1Y39A 3U1DA 1X58A 4R8HA 2B0LA 4HF2A 2GBYA 5DCFA 1Y0NA 1HC8A 2J7UA 3GZCA 5A2QZ 3TDUC 5ICCA 5E3MA 2CUJA 1X2MA 1BR4A 1YIOA 3S8PA 1P4XA 3ZR8X 1ETYA 2LLVA 1BDIA 3HPGA 2E5ZA 4R1HA 2PEXA 1HSTA 1SVMA 1ETXA 5E1ZB 2HFHA 3FIWA 2A07F 3IV5A 4LLNA 1U0JA 1HSJA 4BUPA 3PNTA 2W57A 1NHAA 1JXSA 2DFEA 5EDNA 1L1MA 4M3EA 2W1OA 5D4RA 4HNUA 2JA7J 5DTQA 1X3UA 4E7JA 2AW6A 4LB6B 3G1LA 3QOEA 2XAUA 2ELHA 4MEYF 2AWIA 1QQAA 4C30A 2RKHA 5EG0B 2DOFA 1TWGJ 3BG7A 3BT9A 5EEGA 2FQ4A 2CW7A 1RZRD 2M4HA 2VONA 2XRNA 3F51A 4A3LJ 3HL2A 2P6SA 2QF7A 4LGWA 4V2GA 3BR2A 4DJAA 3GO5A 1YIJI 3M1EA 1OCPA 2HZTA 2NYXA 3G2BA 3PSFA 4ZZLA 4BHCA 3BTJA 3ZQFA 1PUFA 3RZOJ 3K4CA 1NW3A 3HBLA 4IO9F 4DQ2A 4AIDA 5IYDJ 5LEJA 4DYCA 2EV0A 3GTLJ 3PE5A 1PP7U 3BROA 4U87A 5EZGA 1J5YA 3WODF 2GOMA 2P5KA 5DT2A 2DA3A 3ZMUA 2XDVA 3LSJA 2EPFA 4F3QA 1ZZ7A 5LRSA 3A0HC 3WU2C 1P9QC 1HDDC 2NRAC 5EF6A 4KICA 4M71A 2A68F 4BHPA 3ZCOA 3KYLA 4FE4A 1BJZA 2EFQA 3BDDA 2ZJRF 2WY8Q 4BBRJ 3KP4A 1ZR4A 1ACIA 1SAXA 3GN5A 1RC9A 1BBYA 1F1ZA 2VL8A 3F21A 3GN5B 1IXCA 3HM5A 4BJ5C 5J40A 1ZARA 5J47A 4XRFA 3NROA 3ZMZA 1JFTA 1KQ8A 5E1XA 4RLQA 4DZJA 4KA4A 1JKQC 3HZIB 3QPLA 4BGDA 2A6CA 2DJIA 2AQFA 2BE5F 3GUDA 5DUIA 3BG9A 3HKZA 2LYQA 1UXCA 2M30A 3N97A 2ICTA 1W0TA 4P55A 2KQRA 2PUFA 1ZH5A 4KISA 4ZDPA 4JX5A 3I4PA 2HPIA 2MQKA 4HYEA 4B8XA 3BOQA 3DTEA 3AG3H 4PJ0C 3TOAA 4GCVA 2LYJA 2CFXA 3ECOA 3H9JA 1NEQA 1DGWY 3CC2I 3PXPA 2R7ZJ 1UXDA 2OF7A 4RM3A 4L9VA 3CP8A 3L00A 2PMHA 4FX0A 1XSXA 2K86A 4LK0F 4ENNA 3L9FA 2X6WA 4HSTA 1BM9A 3CCSI 2MYSA 3COAC 1W36C 5IPAA 3R09A 3HOTA 2HDCA 4R79A 3L1PA 1IXSB 4OIRF 2R7OA 2AXTC 2IA2A 1DDNA 1JKPC 2LK2A 4XKVA 3HUGA 3RI4A 1QB2A 2L9RA 1TNSA 1JE8A 1IN5A 5KNLA 3L09A 4C2UA 3TDZC 3H0GJ 1O3TA 1RIOA 3CC4I 3R61A 3E6CC 3I0TA 1TC3C 1T56A 4II3A 4S05A 2Z1DA 2GXBA 1TQPA 1O7LA 2FSWA 1KU2A 2JA5J 2EH3A 4Y33A 1QBJA 1VQ9I 1MBFA 2DA7A 5M5XJ 1PUEE 4XN0A 1SFUA 1A04A 4Z6YA 4OIPF 1FIPA 2ZFWA 4I0BA 2Y48A 4NBQA 3ZKCA 1WKMA 1UJ8A 2E2HJ 1D0YA 3IH3A 3CECA 3ZPXA 1Z7LA 2LY1A 5CQGA 1M1EB 5GAGJ 1LVKA 4U0VA 1R00A 3FXJA 3S2HJ 3WGGA 2WIUB 2K9NA 1LE8A 2PQ8A 2JSPA 2MA3A 3FX3A 1LE8B 3I55I 4ANJA 1YITI 2BNMA 4H4KC 4CZCA 2Y75A 3QP6A 1X19A 4M3DA 1B4AA 2MH2A 1R1UA 2EF8A 2DT5A 3OYIA 2R5YA 3CCRI 2ODRD 4XBFA 2KRCA 3VODA 1HLVA 2IU7A 4CO8A 2PXQA 4P5OA 3MN2A 4O8BA 1XMKA 4G6TB 1YHQI 3RKQA 2M87A 1FZPB 3WTWC 1TWFJ 2H1KA 1K4SA 3EQLF 3BS3A 1RNLA 3I58A 2F5DA 3M7GA 3F52A 5H2FC 1J75A 3I71A 2R7FA 4OB4A 4AUXA 3ABKH 2MG4A 1RRJA 3S93A 3CF2A 1K7AA 4I99C 1H0MA 2GA1A 2L8NA 2CQQA 2VT3A 5CQEA 3OSFA 3UNGC 3IWZA 4EJOA 2VODA 4XN3A 3MKYB 5JFRA 5ICEA 3OIPA 3FF5A 3K4JA 5HNFA 4E70A 3OR1C 3TEPA 2LYCA 4I6RA 3QRFF 4CCKA 5BNGA 1VQ6I 1LCCA 3ZQGA 4HX8A 1MNEA 1XWRA 3IWFA 4XLAA 3B6AA 1OISA 3E97A 3ZQHA 2O9LA 2STWA 3DXJF 4B47A 3TL4X 2QBYB 3NAUA 3GXOA 2PPXA 3ML6A 3K4LA 2ELJA 4U7BA 4J19A 3V4GA 1BOAA 2CGPA 2HDDA 3E5QA 3NEUA 5M5WJ 4E7HA 3Q0VA 4RA2A 5GAGi 2CUZA 5J6XA 2ZMEC 3KYDB 1YW8A 4ITVA 4ZTFA 1X2NA 1USSA 4TV7A 5JLXA 3CJTB 3FWEA 2A05A 1OQYA 5L3DA 2HFZA 4XL9A 4Y15A 5LBQA 3JRFA 1EH6A 3KP5A 1ZG5A 1QVTA 2L9SA 1PRUA 3GLXA 2HR3A 2ZJQF 3CDHA 3DTIA 2P0WA 2QVOA 3REOA 3U3WA 4I01A 2VQLA 2CV1A 2H1LA 4KIGA 2DTRA 2L7MP 4XLHA 1R36A 2ID3A 1CF7B 1PERL 3A4CA 3GFMA 3JRDA 2IS4A 4CCLA 3CP2A 3U21A 1J9IA 4X4CA 2X0LA 2DA4A 1Z6RA 4KDPA 3H9QA 2RN7A 3NDBB 2K7LA 2NNNA 2EBYA 2OC6A 4BXXJ 4X4IA 3OQMA 2Y9ZA 3HDDA 5CVIA 3M3YJ 1SD5A 4Y52J 2ACJA 2DA5A 2DFIA 3CUOA 2XSDC 2JVHA 4AYBA 1P92A 1FEXA 3FHZA 2RREA 2L9NA 4P1WA 1XC5A 3CDLA 1WQ2A 3MZYA 3I5UA 3W6KB 3H35A 1YFHA 5J8FA 4I02A 3F6WA 2EV5A 3CCVI 2XIGA 3DLLF 3GZNB 1GVJA 3ASNH 5EYRA 3HTUA 1G3YA 1ZK8A 2DMTA 2DDBA 2DT6A 4A3MJ 2OD5A 3GTMJ 3OYKA 3LSHA 4X4FA 3TP3A 4H0EA 3ZQCA 1ZLKA 4NB5A 4PU8A 2PXVA 4L5EA 3HHHA 3BZCA 5HODA 1HKQA 3CROL 1IN7A 2MXDA 3HOVJ 1D8JA 2IP2A 3LAJA 3G71I 4BYYA 1ONVA 2VE8A 2BHYA 3WTZA 3G1OA 4G6QA 2V26A 3JTGA 2MLGA 1YJWI 2VQGA 3H9GA 1K78B 2K02A 2QWWA 1BR2A 2PXUA 1S9HA 4IPAA 3WTSC 3WE3A 4BEHA 2HSGA 4PDKA 3OR2C 5DDGA 4IHTA 2H8WA 1IDYA 2MSYA 5C44J 4ZDOA 2FU4A 1RKTA 1J09A 2Z16A 2EFNA 4IEJA 4M72A 4WXHA 3W2AA 2IS1A 3KP7A 2NS7A 1A6IA 3PSIA 2WC2A 1SD7A 1A36A 1T6SA 1NG6A 3I53A 4BKXA 3KP6A 3AG2H 4CXFA 5DSXA 1JH9A 3CUQB 4HX4A 2XKOA 4OIOF 4EGZA 4HNVA 2PE5A 1XSDA 1QP4A 2V9VA 2OCCH 2IS2A 1JTXA 1ZZCA 2X6YA 5GAHJ 2HQRA 1P7JA 2LY9A 3F8NA 4RS8A 1C0WA 1LDJA 3ABTA 3OYLA 1LDDA 4MNUA 4MTEA 1DU0A 1N78A 3MEJA 1YE9A 1FOWA 5JI6A 5EEAA 2O61A 2F48A 5FLVA 1USTA 3JR9A 3C7JA 1Y9QA 3EETA 3JSOA 1IN6A 2Z3YA 3RKWA 1SVOA 5GTHC 2LRDA 1SD4A 3EUAA 1LVAA 3V7RA 3LSGA 1I3QJ 3KEYA 3K70C 2M7BA 1XGNA 4MCXA 3O9XA 3T8TA 2H94A 2V79A 2A5WA 5ICGA 1Y6IA 2Y31A 2PLYA 2IVQA 4GRIA 2FD5A 4Y7NJ 2BW3A 4E7IA 1LLIA 4I98B 1MW7A 2F5VA 1FOXA 3GW2A 3QU6A 2HKXA 1N75A 2PJRB 3F22A 2ZXWH 4HOBA 2WUSR 2PJRA 1E3HA 3I59A 2ME0A 1R49A 3PUBA 4F7ZA 1D1BA 4LFUA 1FY7A 2VASA 3DFGA 2M4GA 1RKWA 1KQ9A 4HW0A 2MC4A 1U5TB 5HS8A 3TW6A 3GFLA 1FTTA 4GYIA 5DRTA 1IF1A 1VQ8I 2BXYA 1QQBA 1EFAA 4UUVA 4WVLA 2R7WA 4IVZA 4LD5A 5B1BH 2JA6J 4XSXF 3G6EI 4C2TA 4A3CJ 4CYCA 5L3FA 4L9TA 1XX5A 4NDWA 2DI3A 5DCMB 1G4DA 4L18B 2Q8KA 2HZDA 2A6TA 5FKMA 3CJNA 3CMYA 3PNVA 1KU9A 2OZUA 4BNCA 2QKLB 4KT5C 2V6CA 3KEOA 3R1FA 3OOPA 3R60A 3HOZJ 2KDOA 4Q2JA 4A3JJ 3KLOA 3MKLA 3ISPA 2M5WA 4P9FA 1BW6A 4HG2A 3OYDA 1MFQC 4FTHA 4KUMA 2DAOA 2OTJI 2HKOA 4HDVA 4PFPA 1G3WA 1KQ0A 4BQNA 3ABUA 2QSGX 4FCYA 4X4GA 5EZHA 2AXVA 4LITA 2IGOA 4PSWA 4I6ZA 2XXQA 1ON2A 4A3KJ 3GVAA 1FOKA 3QWLA 4HRAA 3HJEA 5K7FA 2P6TA 3HRUA 1ZN2A 2OUMA 3RPUD 1R9TJ 1ZZBA 3BC8A 2FMLA 4B3XA 4PJMA 4HAMA 2R7SA 3LSTA 1D5YA 5FKOA 1Z7UA 1JHHA 4BHBA 1U6GA 4UVCA 2GOXB 4UUSB 2FOKA 2E2JJ 2VJ5A 3Q0UA 1LUJB 2IAIA 2JK3A 2CG4A 3SYTA 2XAHA 1DQUA 3LSKA 3DBHB 3W3CA 4OAYA 3QODA 1BIBA 2LBFB 4CZZA 3LWFA 1R63A 1RUNA 4MHGA 1V54H 4E7ZA 1W5CC 4UVBA 2ESNA 1G59A 1S29A 2QENA 3HRMA 1IUYA 2J7WA 4LLGF 2VOOA 1WJEA 2K4BA 4J00A 1O57A 1QPIA 1IV8A 2LR8A 2CJJA 3OP9A 3LL7A 1U3EM 1V3FA 2XKPA 3MD2A 2XJ3A 2EINH 4YIFA 1K61A 4IOCF 4N9IA 2IBDA 5D8LB 1Y56A 2BY0A 3EUKL 3A03A 1YW7A 1ZTRA 2O0YA 3EDPA 1XTAA 2F4OB 1QNTA 3QPSA 5E3NA 4AIKA 1WJFA 1XS9A 3MVPA 3CF5F 5IOZA 3ZQIA 4XM3A 3HOYJ 2IVGA 1JT0A 4ZTJA 2LNMA 1TWHJ 2XSJC 2DLLA 2M0CA 3HXLA 1ORKA 3MCZA 3ZPLA 3BTIA 1OCTC 2UZKA 1PDNC 1VQKI 3BCBA 1D5VA 2JCGA 1Y8RB 4BEHB 2NVYJ 4YIIA 1XDSA 2Q2EA 1EA3A 4EQZA 1ERDA 3ZQ7A 1T95A 2GIZA 3N05A 1H9TA 2ETHA 3SR4A 4ER6A 1CQTA 2RAEA 2LP0A 3QOPA 5J1UA 4U0YA 2XPWA 2PXFA 2XF7A 1RR8C 3CLCA 4I6UA 5CVJA 1AKHB 1OCCH 2BXZA 1TW2A 5HDGA 2W25A 4XORA 3LISA 1AA7A 1IAWA 1D1CA 2K40A 2RGVA 4M6VA 2H27A 4NHJA 2IA0A 5CYVA 5FD6A 2VT2A 3HC7A 2PUDA 3A1YA 3H0DA 4IRIA 1G3SA 3Q0WA 4NC6A 5LFAA 3QFIA 3HRTA 3L2UA 4OU0A 4ZYAA 1VQ4I 3FM5A 3KE2A 2DBBA 3JCUC 1ZYRF 2LLKA 1FBSA 3M8JA 3SCGA 1QP7A 4ABZA 2LYKA 3WG9A 1XDUA 4D7MA 2JRTA 1QZEA 3Q5FA 3C2BA 5CJ9A 3P9CA 2KPJA 2JWTA 2L4AA 4LJZF 3H5AA 3JTHA 3GZ6A 2WAEA 1Z9CA 1J2XA 2YSRA 1UHWA 4BQQA 3FYAA 2QM3A 1J7KA 2H8RA 2LCVA 4XLFA 3CO6C 3J81K 2BV6A 3I3LA 1IGNA 2YR2A 1JJ6C 5KHDA 3O8GA 2STTA 2L7KA 4IVNA 2FXAA 2ZFUA 2I5UA 2WA0A 3J7AO 2CW8A 2WAQA 2CW0F 4A0YA 5DTDA 4B09A 5JHUA 4IL6C 3WGIA 2DPUA 2R7DA 4IHYA 1LQ1A 3PUFA 4CCJA 3GLLA 4N4OB 5F0CA 3FXLA 4PJLA 4Z2YA 3E3VA 2BYVE 2K9QA 4G12A 5ILUA 2PXTA 1S7AA 3F6VA 5JLWA 2L4MA 2HTSA 1OR7A 2NAZA 4PGHA 1XMXA 1DULA 3GBFA 1RZSA 1ZZ8A 2PG4A 3FBIB 3F9KA 4ESBA 3JRAA 2VBZA 4OMZA 1HQ1A 1RI7A 1F4KA 3TKYA 3TO7A 3MKZA 1AOYA 1BOBA 3H36A 1OYIA 4JQDA 1ULYA 3SDGA 3W6JB 3OYBA 1XPXA 3NWTA 4AM3A 3CCLI 5F04A 4YG2F 1Z3YA 4WXDA 3VWSA 1GUUA 5GTIC 2IXSA 1V55H 5BOXA 2V1DA 4LLLA 2IS6A 1PVEA 2LC2A 3H1CA 1X2LA 4FHTA 1NERA 3S15J 2DMPA 1QZZA 4RLFA 3FDYA 3UR3C 3BG6A 1MMAA 4DBRA 4A0ZA 2MD0A 3CTAA 5D6FA 5EGOA 2VLAA 2W48A 3WU1B 4YFXF 3M8EA 3LFUA 2QUFA 2ICWG 1LDKB 1MBGA 3LQRA 3RDIA 2BEOA 1F36A 2JMWA 4MFEA 3MFKA 4BQAA 3ZMTA 3C18A 3F8BA 3KZZA 3E6MA 4CCOA 3KIOA 4O5VA 2DODA 5F0FA 3ME5A 1OLTA 4I8TA 4EK9A 2BHZA 1P7IA 5K5RA 4Q47A 1OJLA 1NTCA 4B3AA 4LMYA 3VEPA 2ZO4A 2KL4A 4ENMA 2V1UA 3M07A 4Z5HA 1L3LA 3LFKA 2PBIA 1FT9A 4ZH4F 2DOAA 4KIBA 3GZ5A 4HDUA 2L54A 1J59A 2NVTJ 2A3SA 2RC4A 3FMSA 2VOPA 2Q2EB 5FKNA 4D0PA 3ZOBA 1I27A 3QOXA 4B44A 1OMIA 2GZUA 2RQQA 3RZZA 1RPEL 4LIVA 4JX6A 3SZGA 1G2HA 3HEFA 2JA2A 2UUZA 1B72A 5FD5A 1A31A 1I1SA 1TLHB 3QYBA 1GV2A 1KU3A 1WH6A 4F92B 1Q1VA 4A5MA 1GV5A 3CUQA 1VQLI 1S7EA 3EPZA 2CQ7A 2E7WA 4M3GA 4AU7A 5HLIA 2D45A 1QQIA 5C4XJ 2XROA 5M3MJ 2OQRA 3AFHA 2EK5A 2KEIA 5D6EA 3F72A 4PCQA 4B1RA 1SC7A 1HW1A 4D5CA 2XASA 3BZ6A 2V9KA 5D8KB 1LPQA 1HDPA 3JRCA 4HBLA 1FP1D 4EM2A 3H5TA 1H89C 5FKLA 4K2EA 4IQ4A 1FX7A 3I64A 3ONQA 3RSNA 2Y2ZA 3JRIA 2EJRA 2LKSA 1N77A 1ENHA 2AXZA 3JW4A 2OQGA 3ABMH 2GIVA 4U7DA 1QGPA 2F2EA 4JOMA 2XAGA 3OKZA 4A6EA 4HLYA 3HKZN 2R0QC 1MDMB 3WG7H 2VEOA 4MO7A 2DTZA 2K9SA 3X2QH 3QYEA 2M45A 3HHGA 1YW9A 4A3DJ 4C9YA 1XCVA 3IRRA 3ERED 2KZ8A 2R5YB 3DP7A 4E4HA 4W97A 3NXHA 4GO1A 4PJNA 1W36D 3S32A 1YJ9I 1MBEA 2EIMH 3BPXA 4BJTA 1ON1A 5J1YA 3BY6A 3L2CA 3HOWJ 1R5GA 3IVPA 1U5TA 4O6JA 2CU7A 2FBIA 1UG2A 3PNYA 3KZIC 3BJOA 2DXIA 1SANA 1H8AC 4YEJA 5D5WB 3PL8A 3CCMI 1DP3A 2KT0A 3TMOA 3FXRA 1I39A 2XUBA 1IG7A 3DLAA 3RJPA 4MQVA 3Q9SA 1ETQA 3L2WA 1IO2A 3RTRA 5FLXK 1HXDA 2G0EA 2P4WA 5JUWA 1LFBA 2BY2A 1FYKA 3DBLB 1VQ7I 2IPQX 4X4BA 4DYQA 1UMQA 1K6YA 3R4KA 5HLTA 1ZZ9A 4II2A 1BJAA 1TZLA 2ZXJA 2M4KA 4DZPA 1OYWA 2P81A 2JRMA 3OMYA 3CCJI 4XLPF 1MGTA 1GLNA 4ZYEA 1O3SA 5F0HA 3EYYA 2W85A 3JRBA 1R5ID 2JT1A 3B73A 5B1AH 5DD8A 3K69A 1MH4A 4AVPA 1DP7P 4CUGA 3ZN1A 4UY8I 2R7TA 1X1DA 2BBYA 3MZHA 3BTCA 4OWRB 5AIPA 5DM6F 1X4OA 1DGRM 4A5NA 4DBQA 1T0FC 5K7ZA 2L7ZA 3FKJA 3ERMA 4EV0A 1SFXA 3LSMA 3V7SA 2COMA 4LOCA 2M34A 3P7NA 5ILVA 4N9HA 2PUCA 1LEBA 1ETWA 1U8BA 4F52A 1T33A 1B9MA 1T0FA 3OIOA 3PIPF 5IP9J 2O6GE 1U8RA 1Y1WJ 4QLCU 4B4CA 4XRSG 2CQNA 1FJLA 2G7HA 3PQJA 3AKZA
chains in the Genus database with same CATH topology
2FX0A 2B63J 1B72B 5FLMJ 2Y31A 2IVQA 2VKVA 2COBA 2FD5A 4Y7NJ 4A3EJ 1ZKGA 2GLOA 2HOTA 4GFBA 3S1QJ 4GQMA 1LLIA 4MFDA 2WV1A 4IWRA 3HOUJ 2XPUA 1JUSA 3G1MA 2HQ5A 3EUSA 3CQZJ 3FMYA 2Y30A 1ZZ6A 2WUSR 1QP0A 3TEDA 2ME0A 3RZDJ 2CQXA 3GTPJ 1LCDA 4C3JJ 4W1UA 5F1JA 4BBSJ 2IVBA 4GHJA 4PU7A 2HOSA 1RKWA 1WI3A 2L7FP 2DA1A 1ADRA 1DW9A 2DMNA 3LOCA 3TW6A 3FYMA 1FTTA 5IP6A 5IYBJ 1SFOJ 2ECCA 4I76A 1QQBA 2AHQA 4BY1J 1EFAA 1RESA 4IVZA 2YS9A 2NOGA 3QF3A 1VI0A 2TRTA 2NVXJ 2JA6J 1U9NA 4A3CJ 4CYCA 3GBGA 4A3FJ 1MSEC 2D5VA 1JTYA 4NDWA 5C3EJ 2X9DA 3WHCA 2M9HA 3TP0A 2LYLA 3S17J 2HYJA 3CCYA 5FKMA 3BR1A 3JRGA 2HI3A 1VF9A 2TCTA 2XRLA 3CMYA 1JGGA 4A69C 2NVQJ 2EZKA 4DYRA 4RDUA 1RETA 3ZHIA 3R1FA 2DA2A 2MW8A 4C3IJ 4Z59A 2LYPA 3O9XA 4A3IJ 2R92J 1QPZA 2ME6A 2VPRA 1APLC 3HOZJ 2MEZA 2JVLA 3UKGA 3GTKJ 3BDNA 1DU6A 1O4XA 4A3JJ 2CRGA 3MKLA 1I6HJ 2EZIA 3GTJJ 1BW6A 3BG3A 4A3BJ 4FTHA 3GTOJ 3BQZA 3QQAA 5E3LA 5J1RA 1MBHA 1POUA 1TWAJ 3OSGA 3SCFA 3BR3A 2R93J 4PU3C 1MNMC 2PIJA 4BY7J 1WGXA 5F27A 2R5ZB 1ETKA 3DEWA 2O8KA 3S8QA 1WH7A 4FCYA 1X58A 4X4GA 5EZHA 4PU4C 2AXVA 3FKIJ 5IOYA 2XPVA 4DW6A 4I6ZA 2LVSA 2GBYA 4A3KJ 5M5YJ 2DMQA 5E3MA 2R63A 5K7FA 1X2MA 4YG4A 4M3FA 1ETYA 1BDIA 1R9TJ 1ZZBA 2IUOA 1DWKA 2NS8A 1ETXA 2WB1N 3ZHMA 3FIWA 3IV5A 2B5AA 1D5YA 5FKOA 4UUSA 5EDNA 1B8IB 4M3EA 1L1MA 2JA7J 4UUSB 1B8IA 4XIDA 2E2JJ 1U78A 3G1LA 5EG0A 1UTXA 2AW6A 2AWIA 3Q0UA 1QQAA 2IAIA 2JK3A 5EG0B 1WETA 5GPAA 2AXUA 1TWGJ 3BT9A 1JJ8C 1PRVA 2FQ4A 1R63A 1RZRD 2EZLA 2IV1A 4O8BA 3F51A 9ANTA 4A3LJ 1NK3P 1IC8A 3OMTA 2YUSA 3FISA 5K7HA 1ZS4A 5GP9A 4IA8A 1MBKA 4MIMA 3S1NJ 3DNVB 2QF7A 1QPIA 4UUTA 2LR8A 4V2GA 2ZB9A 2CJJA 3BR2A 1YRNA 3OP9A 1LQCA 1GVDA 1OCPA 1PRAA 1B0NA 2XI8A 3BTJA 3ZQFA 1PUFA 3RZOJ 2XJ3A 3HBLA 1K61A 5IYDJ 4DYCA 3GTLJ 1U9OA 2IBDA 3I4MJ 5EZGA 4XICA 5C4JJ 3A03A 2BJCA 2DA3A 1ZTRA 3LSJA 2EQRA 3BR0A 1ZZ7A 4Y42A 1HDDC 3QPSA 5E3NA 1XS9A 5EF6A 1BL0A 1R69A 3KXAA 3MVPA 5IOZA 4IHWA 1YSEA 3ZQIA 3HOYJ 4FE4A 1BJZA 2BNNA 2IVGA 1JT0A 2KDZA 3LSPA 1TWHJ 4BBRJ 3FK7A 2O4AA 2M0CA 1ZR4A 1ORKA 3GN5A 3BTIA 1OCTC 1WIZA 3GN5B 2JCGA 3WHBA 3HM5A 2NVYJ 2HXIA 1HF0A 1IV6A 1ZUGA 3QWGA 1JUPA 1JFTA 1CQTA 2RAEA 2LP0A 5J1UA 4DZJA 2XPWA 4IHVA 3B6CA 1JKQC 3HZIB 3NARA 3CLCA 3QPLA 4I6UA 1H88C 2A6CA 1AKHB 3BG9A 2LYQA 2LKXA 1AKHA 3M4OJ 1Z77A 3BQYA 1TWCJ 1UXCA 2ICTA 3LISA 2K40A 4M6VA 3BD1A 1W0TA 3K2AA 1POGA 2AO9A 1BDHA 2AUWA 2PUFA 1PNRA 1MSFC 3SJMA 2PUDA 2M2EA 4JX5A 2MQKA 2CSFA 3KJXA 3Q0WA 4MCTA 2ICPA 3PO2J 1W0UA 3I4NJ 2LYJA 1BW5A 1RR7A 1Y7YA 1QP7A 2LLKA 3SCGA 1NEQA 3PXPA 4ABZA 2LYKA 4D7MA 4A93J 2R7ZJ 1JUMA 1UXDA 2OF7A 1JFSA 3C2BA 1FTZA 2KPJA 2JWTA 1UHSA 3SFIA 1X57A 1JKRC 2N8GA 3JREA 3S2DJ 5IPAA 1AU7A 3FYAA 1QRYA 3L1PA 3DCFA 2H8RA 2LCVA 2ECBA 4Z58A 1JKPC 2LK2A 2X48A 2L9RA 1IGNA 1JJ6C 3O8GA 4Z5CA 3PM1A 3H0GJ 1RIOA 2BNOA 2OFYA 5DTDA 1TC3C 1T56A 2ID6A 1GDTA 3LFPA 2E1OA 4FISA 2JA5J 2EH3A 2PUGA 4IHYA 1MBFA 3OQOA 2DA7A 2VI6A 5M5XJ 1IUFA 4XRMA 3BR6A 4J1XA 5F0CA 3BG5A 4AC0A 4NDLA 3OOUA 2WAQN 1FIPA 2K9QA 4G12A 1ZR2A 3ZKCA 1ETVA 5JLWA 1HOMA 2E2HJ 2YU9J 1IDZA 3IH3A 3GBFA 1RZSA 1ZZ8A 3CECA 3JXBC 1I50J 3JRAA 2E19A 3S1RJ 1GT0C 3S2HJ 3D1NI 5J3LA 2K9NA 2WIUB 3GTGJ 1LE8A 2LFBA 4J1WA 1LE8B 4JQDA 3SDGA 2BNMA 3A01A 4MLOA 2O49A 3HOXJ 5F04A 3A02A 1GUUA 3PO3J 4M3DA 1MH3A 2EF8A 4FE7A 2R5YA 3HGGA 2QCOA 1X2LA 1ZGWA 1NERA 1HLVA 1WH8A 2IU7A 2HXOA 4S0HB 3ZQLA 3S15J 2DMPA 1YRNB 3MN2A 4M3BA 1PUFB 5EGOA 3RKQA 5K98B 2DA6A 1TWFJ 2H1KA 2W48A 2KEKA 3BS3A 4YARA 2X6OA 2DMUA 1ZVVA 1MBGA 1ZQ3P 3F52A 2FJ1A 4OB4A 4AUXA 1F36A 2JMWA 2MG4A 4MFEA 1F43A 5DS9A 2LYSA 5A7LA 2L8NA 2CQQA 3B7HA 3OSFA 3VPRA 5F0FA 4I8TA 2PUAA 3QYXA 1P7IA 1FIAA 1OJLA 1NTCA 4B3AA 3TRBA 2DJNA 4I6RA 5BNGA 4X4DA 4D7NA 3TW7A 2LYRA 4Z5HA 4C2MJ 1LCCA 3ZQGA 1XWRA 2NVTJ 3ZQHA 3B6AA 2O9LA 4X4EA 1VFCA 1WPKA 2PUEA 4YG1A 3SCHA 5FKNA 3NAUA 4QIWN 2PPXA 3ZOBA 4J19A 3HB9A 1LFUP 2CUEA 2HDDA 5M5WJ 2GZUA 3RZZA 1RPEL 3Q0VA 1AHDP 4XRSA 4IHXA 4JX6A 1G2HA 3HEFA 1JT6A 5IP7J 1B72A 2XGDA 4FBIA 4YG7B 1X2NA 1GV2A 3O8HA 5JLXA 1WH6A 2R5ZA 3IH4A 1IJWC 3FK6A 2O38A 1Q1VA 1K83J 3H3VK 2GM4A 1GV5A 1S7EA 4M3GA 2OR1L 5C4XJ 3Q3SA 2XB5A 3QQ6A 4F8DA 5M3MJ 3JRFA 2FJRA 2KEIA 3VK0A 4B1RA 1QVTA 2VKEA 4D5CA 1JWLA 1PRUA 4JP0A 1NK2P 4AYBN 3BR5A 3G5GA 3U3WA 1HDPA 3JRCA 3H5TA 1H89C 5FKLA 2L7MP 2ID3A 1PERL 2Y2ZA 3JRIA 1ENHA 3JRDA 2AXZA 1ZPQA 4YBAA 4XK4A 4X4CA 2DA4A 4QTRA 3W6VA 1E3OC 1VNDA 1XG1A 4X4HA 2EBYA 1RPWA 4BXXJ 4X4IA 3HKZN 3OQMA 2R0QC 2Y9ZA 3HDDA 3JXDL 3M3YJ 3LSRA 4Y52J 2MGQA 4MO7A 3S1MJ 2DTZA 2DA5A 2I10A 2K9SA 4EEFG 2DN0A 2XSDC 2E2IJ 3A01B 1ZAYA 4A3DJ 3LNQA 1EF4A 5M3FJ 3G7DA 1FEXA 4RBOA 3F0CA 1XC5A 3CDLA 2KZ8A 2R5YB 3GTQJ 2XIUA 4W97A 4JX4A 4JYKA 1OFCX 1ITYA 3F6WA 1MBEA 3UFDA 2Y9YA 5EGOB 2EZHA 5J1YA 5EYRA 3IVPA 3HOWJ 2XB0X 2IEKA 4JCXA 1ZK8A 2CU7A 2JN6A 2DMTA 1JKOC 4QSHA 1UG2A 4A3MJ 1IRZA 3GTMJ 1ETOA 4X4FA 3E7LA 3TP3A 1SANA 4V2FA 3ZQCA 4PU8A 1H8AC 4L5EA 5HODA 2ELKA 4CYCB 4X6AJ 2HINA 3CROL 2KT0A 3HGYA 3HOVJ 2L49A 3G1OA 1BA5A 1IG7A 3KZ3A 5E3OA 1ETQA 3S16J 1CJGA 2JA8J 1VPWA 2Y0SN 2M8GX 2LTPA 2G0EA 1LFBA 2HSGA 2GRLA 2O7OA 4X4BA 1IDYA 2MSYA 1MBJA 1UMQA 1Z0XA 3K7AJ 4DYQA 5C44J 1SQ8A 4Z5DA 1RKTA 1ZZ9A 2EWTA 4A3GJ 1HCRA 4IEJA 1WCMJ 5FKKA 3JRHA 4DZPA 2P81A 2XGCA 5FJ8J 2NS7A 2CROA 1A6IA 5F0HA 1A5JA 2R1JL 3JRBA 1WH5A 4X1EA 4BKXA 1MH4A 3MLFA 1JH9A 5IYCJ 3OQNA 3JXCL 2PUBA 4C3HJ 3BTCA 4D5FA 4HNVA 2OPTA 2VUMJ 2PE5A 3S14J 1LMB3 1QP4A 2JJ7A 2XCJA 5K7ZA 2LD5A 1ZZCA 2L7ZA 1JTXA 2L0KA 1RZRA 1OSLA 1P7JA 2LY9A 4I6TA 4LOCA 2EBIA 2M34A 4FN3A 2PUCA 2PMZN 1DU0A 1ETWA 1U8BA 3IH2A 3BTLA 5GPCA 5EEAA 1T33A 5FLVA 3OIOA 3JR9A 1Y9QA 5IP9J 2CUFA 1Y1VJ 1Y1WJ 2HOAA 3RQIA 5F08A 4B4CA 2GRMA 4XRSG 1QVUA 2KEJA 4JCYA 3LSGA 1I3QJ 1FJLA 2XGEA 4MCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FX0 A;  2B63 J;  1B72 B;  5FLM J;  2Y31 A;  2IVQ A;  2VKV A;  2COB A;  2FD5 A;  4Y7N J;  4A3E J;  1ZKG A;  2GLO A;  2HOT A;  4GFB A;  3S1Q J;  4GQM A;  1LLI A;  4MFD A;  2WV1 A;  4IWR A;  3HOU J;  2XPU A;  1JUS A;  3G1M A;  2HQ5 A;  3EUS A;  3CQZ J;  3FMY A;  2Y30 A;  1ZZ6 A;  2WUS R;  1QP0 A;  3TED A;  2ME0 A;  3RZD J;  2CQX A;  3GTP J;  1LCD A;  4C3J J;  4W1U A;  5F1J A;  4BBS J;  2IVB A;  4GHJ A;  4PU7 A;  2HOS A;  1RKW A;  1WI3 A;  2L7F P;  2DA1 A;  1ADR A;  1DW9 A;  2DMN A;  3LOC A;  3TW6 A;  3FYM A;  1FTT A;  5IP6 A;  5IYB J;  1SFO J;  2ECC A;  4I76 A;  1QQB A;  2AHQ A;  4BY1 J;  1EFA A;  1RES A;  4IVZ A;  2YS9 A;  2NOG A;  3QF3 A;  1VI0 A;  2TRT A;  2NVX J;  2JA6 J;  1U9N A;  4A3C J;  4CYC A;  3GBG A;  4A3F J;  1MSE C;  2D5V A;  1JTY A;  4NDW A;  5C3E J;  2X9D A;  3WHC A;  2M9H A;  3TP0 A;  2LYL A;  3S17 J;  2HYJ A;  3CCY A;  5FKM A;  3BR1 A;  3JRG A;  2HI3 A;  1VF9 A;  2TCT A;  2XRL A;  3CMY A;  1JGG A;  4A69 C;  2NVQ J;  2EZK A;  4DYR A;  4RDU A;  1RET A;  3ZHI A;  3R1F A;  2DA2 A;  2MW8 A;  4C3I J;  4Z59 A;  2LYP A;  3O9X A;  4A3I J;  2R92 J;  1QPZ A;  2ME6 A;  2VPR A;  1APL C;  3HOZ J;  2MEZ A;  2JVL A;  3UKG A;  3GTK J;  3BDN A;  1DU6 A;  1O4X A;  4A3J J;  2CRG A;  3MKL A;  1I6H J;  2EZI A;  3GTJ J;  1BW6 A;  3BG3 A;  4A3B J;  4FTH A;  3GTO J;  3BQZ A;  3QQA A;  5E3L A;  5J1R A;  1MBH A;  1POU A;  1TWA J;  3OSG A;  3SCF A;  3BR3 A;  2R93 J;  4PU3 C;  1MNM C;  2PIJ A;  4BY7 J;  1WGX A;  5F27 A;  2R5Z B;  1ETK A;  3DEW A;  2O8K A;  3S8Q A;  1WH7 A;  4FCY A;  1X58 A;  4X4G A;  5EZH A;  4PU4 C;  2AXV A;  3FKI J;  5IOY A;  2XPV A;  4DW6 A;  4I6Z A;  2LVS A;  2GBY A;  4A3K J;  5M5Y J;  2DMQ A;  5E3M A;  2R63 A;  5K7F A;  1X2M A;  4YG4 A;  4M3F A;  1ETY A;  1BDI A;  1R9T J;  1ZZB A;  2IUO A;  1DWK A;  2NS8 A;  1ETX A;  2WB1 N;  3ZHM A;  3FIW A;  3IV5 A;  2B5A A;  1D5Y A;  5FKO A;  4UUS A;  5EDN A;  1B8I B;  4M3E A;  1L1M A;  2JA7 J;  4UUS B;  1B8I A;  4XID A;  2E2J J;  1U78 A;  3G1L A;  5EG0 A;  1UTX A;  2AW6 A;  2AWI A;  3Q0U A;  1QQA A;  2IAI A;  2JK3 A;  5EG0 B;  1WET A;  5GPA A;  2AXU A;  1TWG J;  3BT9 A;  1JJ8 C;  1PRV A;  2FQ4 A;  1R63 A;  1RZR D;  2EZL A;  2IV1 A;  4O8B A;  3F51 A;  9ANT A;  4A3L J;  1NK3 P;  1IC8 A;  3OMT A;  2YUS A;  3FIS A;  5K7H A;  1ZS4 A;  5GP9 A;  4IA8 A;  1MBK A;  4MIM A;  3S1N J;  3DNV B;  2QF7 A;  1QPI A;  4UUT A;  2LR8 A;  4V2G A;  2ZB9 A;  2CJJ A;  3BR2 A;  1YRN A;  3OP9 A;  1LQC A;  1GVD A;  1OCP A;  1PRA A;  1B0N A;  2XI8 A;  3BTJ A;  3ZQF A;  1PUF A;  3RZO J;  2XJ3 A;  3HBL A;  1K61 A;  5IYD J;  4DYC A;  3GTL J;  1U9O A;  2IBD A;  3I4M J;  5EZG A;  4XIC A;  5C4J J;  3A03 A;  2BJC A;  2DA3 A;  1ZTR A;  3LSJ A;  2EQR A;  3BR0 A;  1ZZ7 A;  4Y42 A;  1HDD C;  3QPS A;  5E3N A;  1XS9 A;  5EF6 A;  1BL0 A;  1R69 A;  3KXA A;  3MVP A;  5IOZ A;  4IHW A;  1YSE A;  3ZQI A;  3HOY J;  4FE4 A;  1BJZ A;  2BNN A;  2IVG A;  1JT0 A;  2KDZ A;  3LSP A;  1TWH J;  4BBR J;  3FK7 A;  2O4A A;  2M0C A;  1ZR4 A;  1ORK A;  3GN5 A;  3BTI A;  1OCT C;  1WIZ A;  3GN5 B;  2JCG A;  3WHB A;  3HM5 A;  2NVY J;  2HXI A;  1HF0 A;  1IV6 A;  1ZUG A;  3QWG A;  1JUP A;  1JFT A;  1CQT A;  2RAE A;  2LP0 A;  5J1U A;  4DZJ A;  2XPW A;  4IHV A;  3B6C A;  1JKQ C;  3HZI B;  3NAR A;  3CLC A;  3QPL A;  4I6U A;  1H88 C;  2A6C A;  1AKH B;  3BG9 A;  2LYQ A;  2LKX A;  1AKH A;  3M4O J;  1Z77 A;  3BQY A;  1TWC J;  1UXC A;  2ICT A;  3LIS A;  2K40 A;  4M6V A;  3BD1 A;  1W0T A;  3K2A A;  1POG A;  2AO9 A;  1BDH A;  2AUW A;  2PUF A;  1PNR A;  1MSF C;  3SJM A;  2PUD A;  2M2E A;  4JX5 A;  2MQK A;  2CSF A;  3KJX A;  3Q0W A;  4MCT A;  2ICP A;  3PO2 J;  1W0U A;  3I4N J;  2LYJ A;  1BW5 A;  1RR7 A;  1Y7Y A;  1QP7 A;  2LLK A;  3SCG A;  1NEQ A;  3PXP A;  4ABZ A;  2LYK A;  4D7M A;  4A93 J;  2R7Z J;  1JUM A;  1UXD A;  2OF7 A;  1JFS A;  3C2B A;  1FTZ A;  2KPJ A;  2JWT A;  1UHS A;  3SFI A;  1X57 A;  1JKR C;  2N8G A;  3JRE A;  3S2D J;  5IPA A;  1AU7 A;  3FYA A;  1QRY A;  3L1P A;  3DCF A;  2H8R A;  2LCV A;  2ECB A;  4Z58 A;  1JKP C;  2LK2 A;  2X48 A;  2L9R A;  1IGN A;  1JJ6 C;  3O8G A;  4Z5C A;  3PM1 A;  3H0G J;  1RIO A;  2BNO A;  2OFY A;  5DTD A;  1TC3 C;  1T56 A;  2ID6 A;  1GDT A;  3LFP A;  2E1O A;  4FIS A;  2JA5 J;  2EH3 A;  2PUG A;  4IHY A;  1MBF A;  3OQO A;  2DA7 A;  2VI6 A;  5M5X J;  1IUF A;  4XRM A;  3BR6 A;  4J1X A;  5F0C A;  3BG5 A;  4AC0 A;  4NDL A;  3OOU A;  2WAQ N;  1FIP A;  2K9Q A;  4G12 A;  1ZR2 A;  3ZKC A;  1ETV A;  5JLW A;  1HOM A;  2E2H J;  2YU9 J;  1IDZ A;  3IH3 A;  3GBF A;  1RZS A;  1ZZ8 A;  3CEC A;  3JXB C;  1I50 J;  3JRA A;  2E19 A;  3S1R J;  1GT0 C;  3S2H J;  3D1N I;  5J3L A;  2K9N A;  2WIU B;  3GTG J;  1LE8 A;  2LFB A;  4J1W A;  1LE8 B;  4JQD A;  3SDG A;  2BNM A;  3A01 A;  4MLO A;  2O49 A;  3HOX J;  5F04 A;  3A02 A;  1GUU A;  3PO3 J;  4M3D A;  1MH3 A;  2EF8 A;  4FE7 A;  2R5Y A;  3HGG A;  2QCO A;  1X2L A;  1ZGW A;  1NER A;  1HLV A;  1WH8 A;  2IU7 A;  2HXO A;  4S0H B;  3ZQL A;  3S15 J;  2DMP A;  1YRN B;  3MN2 A;  4M3B A;  1PUF B;  5EGO A;  3RKQ A;  5K98 B;  2DA6 A;  1TWF J;  2H1K A;  2W48 A;  2KEK A;  3BS3 A;  4YAR A;  2X6O A;  2DMU A;  1ZVV A;  1MBG A;  1ZQ3 P;  3F52 A;  2FJ1 A;  4OB4 A;  4AUX A;  1F36 A;  2JMW A;  2MG4 A;  4MFE A;  1F43 A;  5DS9 A;  2LYS A;  5A7L A;  2L8N A;  2CQQ A;  3B7H A;  3OSF A;  3VPR A;  5F0F A;  4I8T A;  2PUA A;  3QYX A;  1P7I A;  1FIA A;  1OJL A;  1NTC A;  4B3A A;  3TRB A;  2DJN A;  4I6R A;  5BNG A;  4X4D A;  4D7N A;  3TW7 A;  2LYR A;  4Z5H A;  4C2M J;  1LCC A;  3ZQG A;  1XWR A;  2NVT J;  3ZQH A;  3B6A A;  2O9L A;  4X4E A;  1VFC A;  1WPK A;  2PUE A;  4YG1 A;  3SCH A;  5FKN A;  3NAU A;  4QIW N;  2PPX A;  3ZOB A;  4J19 A;  3HB9 A;  1LFU P;  2CUE A;  2HDD A;  5M5W J;  2GZU A;  3RZZ A;  1RPE L;  3Q0V A;  1AHD P;  4XRS A;  4IHX A;  4JX6 A;  1G2H A;  3HEF A;  1JT6 A;  5IP7 J;  1B72 A;  2XGD A;  4FBI A;  4YG7 B;  1X2N A;  1GV2 A;  3O8H A;  5JLX A;  1WH6 A;  2R5Z A;  3IH4 A;  1IJW C;  3FK6 A;  2O38 A;  1Q1V A;  1K83 J;  3H3V K;  2GM4 A;  1GV5 A;  1S7E A;  4M3G A;  2OR1 L;  5C4X J;  3Q3S A;  2XB5 A;  3QQ6 A;  4F8D A;  5M3M J;  3JRF A;  2FJR A;  2KEI A;  3VK0 A;  4B1R A;  1QVT A;  2VKE A;  4D5C A;  1JWL A;  1PRU A;  4JP0 A;  1NK2 P;  4AYB N;  3BR5 A;  3G5G A;  3U3W A;  1HDP A;  3JRC A;  3H5T A;  1H89 C;  5FKL A;  2L7M P;  2ID3 A;  1PER L;  2Y2Z A;  3JRI A;  1ENH A;  3JRD A;  2AXZ A;  1ZPQ A;  4YBA A;  4XK4 A;  4X4C A;  2DA4 A;  4QTR A;  3W6V A;  1E3O C;  1VND A;  1XG1 A;  4X4H A;  2EBY A;  1RPW A;  4BXX J;  4X4I A;  3HKZ N;  3OQM A;  2R0Q C;  2Y9Z A;  3HDD A;  3JXD L;  3M3Y J;  3LSR A;  4Y52 J;  2MGQ A;  4MO7 A;  3S1M J;  2DTZ A;  2DA5 A;  2I10 A;  2K9S A;  4EEF G;  2DN0 A;  2XSD C;  2E2I J;  3A01 B;  1ZAY A;  4A3D J;  3LNQ A;  1EF4 A;  5M3F J;  3G7D A;  1FEX A;  4RBO A;  3F0C A;  1XC5 A;  3CDL A;  2KZ8 A;  2R5Y B;  3GTQ J;  2XIU A;  4W97 A;  4JX4 A;  4JYK A;  1OFC X;  1ITY A;  3F6W A;  1MBE A;  3UFD A;  2Y9Y A;  5EGO B;  2EZH A;  5J1Y A;  5EYR A;  3IVP A;  3HOW J;  2XB0 X;  2IEK A;  4JCX A;  1ZK8 A;  2CU7 A;  2JN6 A;  2DMT A;  1JKO C;  4QSH A;  1UG2 A;  4A3M J;  1IRZ A;  3GTM J;  1ETO A;  4X4F A;  3E7L A;  3TP3 A;  1SAN A;  4V2F A;  3ZQC A;  4PU8 A;  1H8A C;  4L5E A;  5HOD A;  2ELK A;  4CYC B;  4X6A J;  2HIN A;  3CRO L;  2KT0 A;  3HGY A;  3HOV J;  2L49 A;  3G1O A;  1BA5 A;  1IG7 A;  3KZ3 A;  5E3O A;  1ETQ A;  3S16 J;  1CJG A;  2JA8 J;  1VPW A;  2Y0S N;  2M8G X;  2LTP A;  2G0E A;  1LFB A;  2HSG A;  2GRL A;  2O7O A;  4X4B A;  1IDY A;  2MSY A;  1MBJ A;  1UMQ A;  1Z0X A;  3K7A J;  4DYQ A;  5C44 J;  1SQ8 A;  4Z5D A;  1RKT A;  1ZZ9 A;  2EWT A;  4A3G J;  1HCR A;  4IEJ A;  1WCM J;  5FKK A;  3JRH A;  4DZP A;  2P81 A;  2XGC A;  5FJ8 J;  2NS7 A;  2CRO A;  1A6I A;  5F0H A;  1A5J A;  2R1J L;  3JRB A;  1WH5 A;  4X1E A;  4BKX A;  1MH4 A;  3MLF A;  1JH9 A;  5IYC J;  3OQN A;  3JXC L;  2PUB A;  4C3H J;  3BTC A;  4D5F A;  4HNV A;  2OPT A;  2VUM J;  2PE5 A;  3S14 J;  1LMB 3;  1QP4 A;  2JJ7 A;  2XCJ A;  5K7Z A;  2LD5 A;  1ZZC A;  2L7Z A;  1JTX A;  2L0K A;  1RZR A;  1OSL A;  1P7J A;  2LY9 A;  4I6T A;  4LOC A;  2EBI A;  2M34 A;  4FN3 A;  2PUC A;  2PMZ N;  1DU0 A;  1ETW A;  1U8B A;  3IH2 A;  3BTL A;  5GPC A;  5EEA A;  1T33 A;  5FLV A;  3OIO A;  3JR9 A;  1Y9Q A;  5IP9 J;  2CUF A;  1Y1V J;  1Y1W J;  2HOA A;  3RQI A;  5F08 A;  4B4C A;  2GRM A;  4XRS G;  1QVU A;  2KEJ A;  4JCY A;  3LSG A;  1I3Q J;  1FJL A;  2XGE A;  4MCX A; 
#chains in the Genus database with same CATH topology
 2FX0 A;  2B63 J;  2CS3 A;  4M9X A;  1EV7 A;  1TL8 A;  3J7Y J;  4UV8 A;  3KPH A;  4RGX A;  2VKV A;  3RIR A;  3VOE A;  4KIT B;  2VBW A;  2JVG A;  1D3Y A;  1HKS A;  3V42 A;  5IT3 A;  2PJP A;  3RYR A;  2HOT A;  1UEL B;  2R4G A;  3S1Q J;  4MFD A;  3UWP A;  1RUO A;  2VJI A;  2A6H F;  5HLG A;  2LRE A;  2Y30 A;  1FYL A;  1H9G A;  1O3Q A;  3GTP J;  1UHM A;  5F1J A;  2IVB A;  1LCD A;  2HOS A;  3OV8 A;  3WTY C;  2R7R A;  2L7F P;  4IZZ A;  2DA1 A;  3RQ4 A;  1ADR A;  4N0B A;  3HRS A;  1FC3 A;  3LOC A;  4E6K G;  5B3S H;  2KKO A;  5IP6 A;  4MEX F;  4E7S A;  4AIJ A;  1SFO J;  2HDW A;  4CHU A;  4BY1 J;  1D0Z A;  2YS9 A;  2NOG A;  3QF3 A;  2YU3 A;  5E8G A;  2IT0 A;  1O3R A;  1JGS A;  2OA4 A;  3DU5 A;  4XQF A;  4A3F J;  2EV6 A;  1Y8Q B;  5C3E J;  2X9D A;  2OAZ A;  4HX7 A;  1WVR A;  5AON A;  1G6N A;  1T2K A;  3MZ8 A;  2HYJ A;  4HF0 A;  2F5E A;  1VF9 A;  5HNH A;  2XRL A;  2WTE A;  4A69 C;  2NVQ J;  5CLS A;  2X4H A;  4G9Y A;  4M6Y A;  4DYR A;  4RDU A;  2BOL A;  2W7N A;  4GDF A;  4OIQ F;  2MW8 A;  4C3I J;  1ZG1 A;  2AQE A;  3HZJ A;  3OYN A;  2LYP A;  4A3I J;  2E34 A;  2R92 J;  4ER7 A;  3E6D A;  4BE0 A;  1EKE A;  2ME6 A;  1QPZ A;  2EFO A;  3OS1 A;  2JPC A;  1SMT A;  1STZ A;  1I6H J;  2E60 A;  2EZI A;  4A3B J;  1S72 I;  5E3L A;  2D1V A;  1ZHF A;  1MBH A;  2CSO A;  1TWA J;  2RVC A;  2E1M B;  3SCF A;  3BR3 A;  4KN7 X;  2X6X A;  2ZBK A;  4BY7 J;  5F27 A;  2FBK A;  4EJW A;  2O8K A;  1LEA A;  2HYG D;  3J7Z I;  3FKI J;  4ENJ A;  3BZK A;  5K5O A;  2XPV A;  4DW6 A;  2LF7 A;  4S04 A;  3F23 A;  2DMQ A;  2KFD A;  3QU3 A;  2R63 A;  2M8E A;  5KAI C;  1VQN I;  2CO5 A;  4L5I A;  2PXB A;  4YG4 A;  4M3F A;  3S2W A;  3CD6 I;  1L0O C;  2IW5 A;  2JZY A;  5TJJ A;  2D2W A;  4RAY A;  4YFN F;  4IHS A;  5FRN A;  2EIL H;  1B1B A;  1BC8 C;  2HOE A;  3KET A;  3FM3 A;  1ZLJ A;  4HRI A;  1ZEL A;  2QZ8 A;  1XGS A;  2O3F A;  1UTX A;  5EG0 A;  2E5N A;  5TRD A;  4UVA A;  2E1N A;  1QA6 A;  1DPR A;  2HU9 A;  2RNJ A;  4MTD A;  4WCG A;  2AXU A;  1JJ8 C;  3GX4 X;  3ELK A;  3FXQ A;  1R4N B;  1X4P A;  1Z21 A;  4XKB A;  2ZJ2 A;  4BAC A;  5BMZ A;  9ANT A;  1NK3 P;  1IC8 A;  3OMT A;  2YUS A;  1ZS4 A;  1Z1D A;  1MBK A;  4MIM A;  3FHN A;  3K4K A;  1R7J A;  2ZB9 A;  4U0W A;  1RIO H;  2K3P A;  1YRN A;  2V7F A;  1LQC A;  1GVD A;  1PRA A;  2FFH A;  1B0N A;  2XI8 A;  1W7P D;  3W2V A;  3EYI A;  2ZXI A;  2Q1Z B;  4A2U A;  3VYS B;  1U9O A;  4CCN A;  5B5E C;  3I4M J;  2E36 A;  4XIC A;  3IL2 A;  4KIF A;  2BJC A;  5B66 C;  2E1C A;  4DE8 A;  4Y42 A;  3CMA I;  5K5Q A;  3KXA A;  3P9K A;  4XLC A;  4ZYG A;  5GAH i;  4IHW A;  3OYF A;  1B9N A;  3H3Z A;  1YSE A;  2GAU A;  2MH9 A;  2V4J C;  2KDZ A;  4ZDL A;  1TBX A;  2O4A A;  4FT8 A;  1XB4 A;  1JI8 A;  2J5O A;  3KX2 A;  4RMN A;  5BPD A;  1WIZ A;  2EIJ H;  3WHB A;  1BR1 A;  2LLW A;  2R7X A;  1K6O A;  2FRH A;  2V1X A;  2GQQ A;  2LF8 A;  2F4M B;  2HXI A;  2NVU B;  1P4A A;  1IV6 A;  1JUP A;  3QOW A;  1SVL A;  1WI9 A;  4EKG A;  2V1N A;  4IHV A;  4D1Q A;  3IRQ A;  2QEX I;  2DFF A;  4NUB A;  1WWX A;  4UB8 C;  3DWL E;  3F6O A;  3OL4 A;  4FAS D;  5TIS C;  1Z77 A;  4EQQ A;  3M4O J;  1HA8 A;  3BD1 A;  1BDH A;  5LD2 C;  3BCA A;  3S3O A;  3DM5 A;  1PNR A;  4J01 A;  3SJM A;  2M2E A;  3KJX A;  1OR7 C;  3B02 A;  2X1E A;  1ZAO A;  4PUS A;  5L3B A;  2P5V A;  5FRO A;  4HPQ A;  3PO2 J;  1YX5 A;  1BW5 A;  3L7W A;  1YJN I;  2DFH A;  2LDU A;  5KVR A;  3CES A;  1CF7 A;  1JFS A;  2LH9 A;  3DEE A;  2ZKZ A;  4BXU A;  1R71 A;  1FTZ A;  3I56 I;  1W5S A;  4L5J A;  3SFI A;  4ETS A;  5CVR A;  2B9S A;  3FMQ A;  4I7H A;  4ZYD A;  1Q1H A;  2XV4 S;  1JKR C;  2N8G A;  3A2K A;  3S2D J;  2DW4 A;  5HDK A;  5J4Y A;  1IRG A;  1QRY A;  4ER0 A;  2DYS H;  3DCF A;  1ZRE A;  5KCM A;  1RZ4 A;  2WB1 A;  1KON A;  2F5F A;  2ECB A;  1XSV A;  4Z58 A;  5BS6 A;  4YFK F;  3I54 A;  4KNY A;  2R7U A;  4JK1 X;  5JVT A;  2WY7 Q;  3K10 A;  4UHT A;  4RB2 C;  3G73 A;  3RCO A;  3DKX A;  5L3G A;  4IF4 A;  2BNO A;  3VSL A;  1Z6T A;  1WRJ A;  2UXX A;  4BAY A;  5CVU A;  2ID6 A;  1GDT A;  3DPL C;  2HEO A;  2E1O A;  1MD0 A;  4FIS A;  2M1B A;  5E18 F;  2CYY A;  2Z99 A;  3OQO A;  3D5L A;  2VQH A;  5FO5 A;  1WSU A;  2DQR A;  4U88 A;  3RYP A;  1X1A A;  3V8K A;  4NDL A;  4Y4R A;  2H6C A;  1ZR2 A;  1FP2 A;  1ETV A;  2VC1 A;  1HOM A;  1S5L C;  4DIQ A;  1IDZ A;  4YIR X;  1UZC A;  4Q4Z F;  3CZ6 A;  1I50 J;  2KRF A;  3S3N A;  2E19 A;  1GT0 C;  4BJ6 C;  4M73 A;  4KJZ A;  3KFW X;  3D1N I;  4HNT A;  3GTG J;  2WBM A;  1P4W A;  3RKY A;  3LQX A;  1PP8 F;  3T8R A;  3QP5 A;  4UXN A;  1Y0U A;  2V9P A;  3A01 A;  1V4R A;  4MLO A;  3HOX J;  3IC7 A;  1K78 A;  1E17 A;  1Z05 A;  4XOT A;  2X51 A;  1MH3 A;  1NG7 A;  5FLX Z;  2TDX A;  3U1K A;  2QCO A;  2XF6 A;  2HNH A;  1ZGW A;  2YPR A;  1A6Q A;  2HXO A;  4IX7 A;  1EJ9 A;  3CC7 I;  1NH3 A;  1YRN B;  2XF5 A;  2EIK H;  2QQ8 A;  2RNG A;  1V5E A;  1PUF B;  4UNO A;  3GF2 A;  2KEK A;  2J5P A;  3CLQ A;  3VFZ A;  3PJR A;  4YAR A;  2DMU A;  5HS7 A;  3IAM 2;  2B7E A;  2QYO A;  4E7L A;  2LYS A;  4DOZ A;  5H6R A;  4KMF A;  4UB6 C;  2QSF X;  4HV6 A;  1IW7 F;  2XVC A;  2PUA A;  3QYX A;  2QQ9 A;  1QZX A;  3GZD C;  5DRY A;  4DNC A;  3SZP A;  2KIS A;  4LB5 A;  4ON0 A;  2X1C A;  4D7N A;  4P9U A;  3F3X A;  5HDN A;  4C2M J;  5DM7 F;  3W2W A;  3O3K A;  3VSK A;  2O03 A;  3GWZ A;  4L0Y B;  2ZSH B;  1TQM A;  1WPK A;  4AVZ A;  4L9N A;  5D5X B;  3LSI A;  3SCH A;  2E1M C;  4NC7 A;  1K4T A;  2BVM A;  1LFU P;  1KYZ A;  2WWY A;  2CUE A;  1WZ2 A;  4A12 A;  2KRH A;  3F8F A;  4Y13 A;  4XRS A;  3V8J A;  1AHD P;  1CGP A;  1SAU A;  3K1P A;  5HOO A;  5FRM A;  3H92 A;  3R0A A;  5IP7 J;  4FBI A;  3R6S A;  2LMD A;  2LG4 A;  3IH4 A;  5CVV A;  2FMY A;  2IVM A;  4AD9 A;  1IJW C;  2O38 A;  3A9X A;  1K83 J;  2GM4 A;  2F6C A;  3LQQ A;  4F8D A;  3QQ6 A;  3J7A Y;  2FJR A;  2XC7 A;  1SEU A;  3IAS 2;  1TT5 B;  1B6A A;  4WK8 F;  1JWL A;  4JP0 A;  1IN4 A;  5H6Q A;  2V3C C;  1NK2 P;  3BR5 A;  3G5G A;  2JUC A;  2DYR H;  4WWC A;  3L2R A;  2I8D A;  2PI0 A;  5LGT A;  2XHK A;  4BXF A;  4E7K A;  2Z33 A;  2OV7 A;  3VYU B;  2BY3 A;  3TGN A;  1Z67 A;  4P96 A;  1ZPQ A;  4YBA A;  4XK4 A;  3KP2 A;  4QTR A;  2DOE A;  2FUG 2;  3CCU I;  2QKM B;  1UAA A;  1VND A;  1XG1 A;  4X4H A;  2NS0 A;  3K70 D;  1RPW A;  4ZYH A;  2CMP A;  2KIU A;  5LHG A;  4ER3 A;  1BI1 A;  4OBM A;  3JXD L;  2KJC A;  2LBF A;  3LSR A;  2ESH A;  3V7C A;  3CCQ I;  2MGQ A;  3KYC B;  2A69 F;  5LGN A;  4EMS A;  2K9M A;  2DN0 A;  1R22 A;  1PJR A;  5DEQ A;  1OPC A;  3LNQ A;  1EF4 A;  4M6X A;  1S8N A;  4WX9 A;  2PMZ A;  1ZGJ A;  3ZXS A;  3F0C A;  4BDZ A;  3DF8 A;  4HSR A;  1A35 A;  5JVG F;  4JX4 A;  1YOV B;  3SHF A;  4Y3O A;  1ITY A;  1XN7 A;  1T38 A;  2Y9Y A;  2PXE A;  5LLQ A;  5EGO B;  2QQB A;  4RB1 A;  2IEK A;  4YRV A;  1KU7 A;  4IXA A;  1R4M B;  4RAZ A;  2ZJP F;  1JKO C;  4QSH A;  1KGS A;  1WJB A;  3E7L A;  2H6B A;  2EWN A;  3GCM A;  4MGR A;  4V2F A;  3D0S A;  2ELK A;  3OWQ A;  2HQA A;  2MFZ A;  3BJ6 A;  5JHF A;  2QA4 I;  3E5X A;  1BA5 A;  4CH7 A;  3KZ3 A;  4EAT A;  4ZZD A;  3S16 J;  1CJG A;  2JA8 J;  2Y0S N;  4YEL A;  3SXY A;  2M8G X;  3OYA A;  2LTP A;  3AG1 H;  3GFI A;  5ERI A;  2IRF G;  4CSW A;  2W84 A;  2GRL A;  3WTU C;  1MBJ A;  4OIN F;  1BC7 C;  1SQ8 A;  2EA4 A;  2DQL A;  2EWT A;  1HCR A;  5FKK A;  1WCM J;  3OL3 A;  2ZME A;  4XLN F;  5LHH A;  2NNY A;  5ILS A;  4Q48 A;  5FJ8 J;  1Z91 A;  1SFK A;  1A5J A;  5LGU A;  1MIJ A;  2R7Q A;  4XKC A;  2PXK A;  2P8T A;  2A6E F;  1BN5 A;  3OQN A;  3JXC L;  4F91 B;  2EB7 A;  2KIQ A;  4D5F A;  5CPR B;  2OPT A;  3T5X A;  2VUM J;  1LMB 3;  2XCJ A;  2LD5 A;  3RPU A;  2EFW A;  4EVI A;  1RZR A;  1OSL A;  3ZGK A;  4I6T A;  3SEZ A;  3SDB A;  2G9W A;  4FN3 A;  1SMY F;  2OCE A;  3GEZ A;  4OOI A;  3PQK A;  3IH2 A;  1AWC A;  2VC0 A;  2FEZ A;  2W4S A;  2QBY A;  3FBN B;  3OYJ A;  2MD5 A;  2CUF A;  3OYC A;  3KLN A;  2JUG A;  4LG3 A;  3RQI A;  2GRM A;  1X3Z B;  5DV5 A;  5DUK A;  3IKV A;  1W7P A;  4BH9 A;  4IQJ A;  4CYD A;  5K1Y A;  2XGE A;  4XLE A;  4G94 A;  4FET A;  2VIX A;  4EZI A;  1WJA A;  2EA2 A;  2LOO A;  1R1T A;  4Y17 A;  4M9S A;  3DPU A;  4PK4 A;  2COB A;  4HLX A;  3CME I;  4CCM A;  1ZKG A;  2ZXH A;  4GFB A;  2WV1 A;  4HQM A;  4IWR A;  2BW3 B;  1FYM A;  1I5Z A;  4G7Z F;  1E3P A;  2BY1 A;  4XOP A;  1JUS A;  3EUS A;  3DU6 A;  4ASN A;  3FMY A;  3HSF A;  3LA7 A;  1KYW A;  4V19 K;  4Q5S F;  1YYV A;  3GFJ A;  5ICF A;  4W1U A;  1OKR A;  3NWS A;  3TO9 A;  3JSP A;  1W1W E;  3CLO A;  5E20 A;  1WI3 A;  1SD6 A;  3M9A A;  3FXK A;  5F64 A;  5FGM A;  3FYM A;  1XGM A;  1F5T A;  3DKW A;  5IYB J;  1ZRD A;  2ECC A;  4I76 A;  1RES A;  1TQI A;  5D5U B;  3K9T A;  5F6F A;  3MWM A;  1VI0 A;  5GAE J;  3FXO A;  3GBG A;  3MQ0 A;  4M9Z A;  2D5V A;  5E79 C;  3EUH C;  1DPU A;  1OCO H;  3WHC A;  4ER5 A;  2CFO A;  3S17 J;  4NQW B;  4NNJ A;  2M7A A;  5DD4 A;  3BR1 A;  3JRG A;  3GZD A;  2TCT A;  1X1P A;  2XGX A;  2IGM A;  4HZF A;  1JGG A;  2HVR A;  2XAQ A;  3ZHI A;  1SFE A;  4M74 A;  2QQA A;  1FWZ A;  5DTM A;  2HS5 A;  2VPR A;  2MEZ A;  3BWG A;  3GTK J;  3C1D A;  3TO6 A;  3OYM A;  1ZRC A;  1W5T A;  3TQN A;  2EFP A;  2ISY A;  4RM2 A;  3BJA A;  4FX4 A;  3BQZ A;  1POU A;  3QAH A;  3K6G A;  1G3T A;  3OSG A;  1EH7 A;  1FBQ A;  4PU3 C;  2PIJ A;  1WH7 A;  3CJQ B;  3K4M A;  3I9V 2;  4ENK A;  2VBY A;  2A5Y B;  4PU4 C;  3SQN A;  5IOY A;  5LHI A;  1QHG A;  2LVS A;  1LJ9 A;  1WJC A;  2VJJ A;  5M5Y J;  2VXD A;  4RB3 C;  2FNP A;  1X3W B;  2KMU A;  4WF2 A;  5LRR A;  2HPM A;  1HKT A;  3KCC A;  3C3W A;  3K2Z A;  4I2O A;  2IUO A;  4RGS A;  3WTT C;  1DWK A;  2NS8 A;  2WB1 N;  5LEK A;  3ZHM A;  2WV0 A;  2P7C B;  1UFM A;  2B5A A;  2UXN A;  3CMM A;  4GGG A;  2VE9 A;  4UUS A;  1B8I B;  1MMD A;  1XGO A;  5BPI A;  3HG9 A;  1FMW A;  1R23 A;  3ZP5 A;  1B8I A;  4XID A;  3OYG A;  1FSE A;  1R58 A;  4A6D A;  1U78 A;  2ZME B;  5E1W A;  3KP3 A;  4BDY A;  1ZRF A;  1WET A;  5GPA A;  3OS0 A;  1UB9 A;  1U2W A;  3NZL A;  3ZQQ A;  1PRV A;  2Q0O A;  2LSO A;  4KT6 A;  2KIF A;  1YO5 C;  2EZL A;  2IV1 A;  3E6B A;  1KA8 A;  4HQE A;  2L02 A;  2Y69 H;  4IKF A;  5K7H A;  3FIS A;  3RKX A;  5GP9 A;  4IA8 A;  5KK1 A;  2M3A A;  3S1N J;  3DNV B;  4EM0 B;  4UUT A;  5J8C A;  4ESJ A;  2LY2 A;  4BE1 A;  2VBX A;  3NQO A;  3TBI A;  1FMV A;  2VN2 A;  2QLZ A;  5C4J J;  2Z9O A;  3HOS A;  3BP8 A;  3VWB A;  6PAX A;  2YBD A;  2VJ4 A;  3OWT A;  1TNT A;  2EQR A;  2FE3 A;  2X1D A;  3DKY A;  1O7F A;  2GWR A;  3BR0 A;  5EEH A;  1W7P B;  4I09 A;  1W4M A;  3GME A;  1BL0 A;  1R69 A;  3P9I A;  3F8C A;  2VQC A;  4DE9 A;  1MDM A;  2XAJ A;  2VKD A;  3WTX C;  2BNN A;  3LSP A;  3JAM Z;  3FK7 A;  1XCB A;  4BL0 B;  4KN4 X;  2WAF A;  1LKX A;  3LAP A;  4IOA F;  3HSE A;  4N4N B;  2K85 A;  1WHU A;  4A0X A;  2PFB A;  2F5C A;  1PYV A;  3IHU A;  3I59 B;  4BQO A;  1HF0 A;  2MLK A;  1WFX A;  1ZUG A;  3C2G A;  3QWG A;  4B48 A;  3T0Y A;  3B6C A;  3AL0 B;  3NAR A;  5HLH A;  1H88 C;  3N4M A;  3TOB A;  2LKX A;  1AKH A;  3BQY A;  1TWC J;  4CIC A;  4PZJ A;  1D8K A;  3S3M A;  3K2A A;  1POG A;  2AO9 A;  5TGT A;  1REP C;  2FBH A;  2CV2 A;  2AUW A;  2PXL A;  1MSF C;  4RAF A;  4MCT A;  2CSF A;  1MJB A;  2ICP A;  3KEQ A;  1S7O A;  1MJ9 A;  1W0U A;  4KYW A;  3I4N J;  3U2R A;  1RR7 A;  1Y7Y A;  2FA5 A;  3AG4 H;  4FQG A;  4ZC3 A;  2XXP A;  1VQP I;  2XAF A;  4A93 J;  1JUM A;  3G0T A;  5F1R A;  2W24 A;  3Q9V A;  1EH8 A;  1UHS A;  1YLF A;  2G7U A;  4JBA A;  1X57 A;  2BZT A;  3LMM A;  3JRE A;  1VTN C;  1IRX A;  1AU7 A;  3TFL A;  3H5N A;  2QGU A;  3FMR A;  4RGR A;  1U5T C;  3FZV A;  2Y0S A;  2GXG A;  2X85 A;  1LFP A;  4I0A A;  1T98 A;  2X48 A;  1GHC A;  2Z2S B;  2IJL A;  4RGU A;  3R0J A;  4HV5 A;  2HGC A;  4Z5C A;  1FLI A;  1YI2 I;  3PM1 A;  4CGZ A;  3J81 Z;  2ADU A;  4BE2 A;  2OFY A;  1TW3 A;  2K9L A;  3RPQ A;  2FF4 A;  3WGH A;  3J80 Z;  3LFP A;  4BS9 A;  1YG2 A;  2PUG A;  2NXN B;  1D0X A;  2VI6 A;  4XRM A;  1IUF A;  3BR6 A;  2VPL A;  4QPQ A;  4J1X A;  3BG5 A;  4AC0 A;  2JQ7 A;  2VB6 A;  3OOU A;  1TTY A;  2WAQ N;  2OZ6 A;  2A61 A;  2K3F A;  2YU9 J;  3HIF A;  3AAF A;  4EJV A;  3SFZ A;  3WTV C;  1BI2 A;  3JXB C;  3S1R J;  1V5F A;  3MEX A;  5J3L A;  2VKH A;  2LFB A;  1VQO I;  3OY9 A;  2C6Y A;  1GXQ A;  4J1W A;  2XXA A;  4XON A;  2W00 A;  3LA3 A;  4XR6 A;  2O49 A;  4AIH A;  3A02 A;  4LG0 A;  3PO3 J;  5IT9 K;  4FE7 A;  2DK8 A;  3HGG A;  3ULQ B;  4F93 B;  3IKT A;  1WH8 A;  5CKT A;  4S0H B;  3ZQL A;  3GUU A;  4GXO A;  2JPB A;  3CUQ C;  2PXP A;  1IZ1 A;  2DCE A;  4M3B A;  1I1G A;  4QPO A;  2ZNY A;  2FOW A;  3GYH X;  5K98 B;  2DA6 A;  3E1S A;  1UG0 A;  1IN8 A;  1ZG3 A;  2X6O A;  5IY5 H;  1MND A;  1ZVV A;  3VDX A;  4XKW A;  1VZ0 A;  2WAD A;  1ZQ3 P;  2FJ1 A;  4IJA A;  4PFO A;  1F43 A;  1QPM A;  5DS9 A;  5L3C A;  3K4N A;  3PFY A;  3QPT A;  3A9Z A;  5A7L A;  1LB2 A;  4XSZ F;  3B7H A;  4CDG A;  3VPR A;  2AXL A;  3K1N A;  3IP4 B;  1FIA A;  2DU9 A;  2KHM A;  2PN6 A;  2IGN A;  2ZSI B;  1R5H A;  3LA2 A;  4HEA 2;  3TRB A;  2FNA A;  2DJN A;  2MAB A;  4X4D A;  3TW7 A;  2LYR A;  5GAD J;  1E0E A;  3K0L A;  4PJJ A;  4X4E A;  1VFC A;  4ZJZ A;  2PUE A;  5AIQ A;  4YG1 A;  2JQE A;  3BPV A;  3DEU A;  1YS7 A;  2QSH X;  1DUX C;  2HWV A;  4QIW N;  3MKW B;  1QZY A;  4WXC A;  2E7X A;  2ZCW A;  2O8X A;  4GYG A;  3BLY A;  2OBP A;  1ODD A;  2CWE A;  2DDA A;  3HB9 A;  1WJD A;  3VB2 A;  1T8I A;  2M0M A;  1HW5 A;  4IHX A;  1OCZ H;  1Z3X A;  2D1H A;  1JT6 A;  1X1B A;  4YG7 B;  2XGD A;  3CCE I;  3O8H A;  4NC8 A;  2R5Z A;  3KL4 A;  4X0G A;  3T1B A;  3F8M A;  3HUG B;  3FK6 A;  3FXM A;  2Y0M A;  3ABL H;  2L5Q A;  3H3V K;  2OU2 A;  4ESF A;  2K4J A;  3J80 K;  1MMN A;  2HYF A;  2OR1 L;  3Q3S A;  4DGW B;  2XB5 A;  4O3M A;  1B59 A;  1JHF A;  1T39 A;  3D5R C;  5JR3 A;  3VK0 A;  2OJE D;  3A0B C;  1UCR A;  2VKE A;  1F9N A;  1MKM A;  4AYB N;  2IGK A;  1QU3 A;  3M8F A;  2HQN A;  3ZN0 A;  5H20 A;  3EUH A;  1S3J A;  4XMY A;  2BVL A;  3P5J A;  5KAF C;  1MZB A;  4HA8 A;  2ZNZ A;  2E35 A;  2RV8 A;  5E8I A;  3W6V A;  2MBF A;  1E3O C;  2CV0 A;  1YTY A;  2HCS A;  4B43 A;  2OTL I;  2KPM A;  3PIO F;  3ECH A;  1T08 B;  5FFX A;  3ZMV A;  3SZT A;  1V5G A;  3DTK A;  3S1M J;  2I10 A;  4EEF G;  3DV8 A;  4G7H F;  3HSR A;  2BGC A;  2E2I J;  3A01 B;  1MMS A;  1ZAY A;  1FBU A;  5M3F J;  3G7D A;  2HVS A;  2HCN A;  4RBO A;  2IA1 A;  2HVQ A;  3D5S C;  1MMG A;  1HBX G;  4L9J A;  3GTQ J;  3H3U A;  3G4S I;  2DK5 A;  2XIU A;  4CA0 A;  2V6E A;  4JYK A;  2Z5U A;  4EJU A;  4L0Z B;  1OFC X;  1I6X A;  3ZRG A;  3UFD A;  3ESW B;  1FOY A;  1OCR H;  4AWX B;  3HTS B;  2EZH A;  3KZY A;  2XB0 X;  3OIQ A;  4JCX A;  2JN6 A;  5HS9 A;  3MMY B;  3H5R A;  1IRZ A;  1ETO A;  4G7O F;  3DPT A;  2GXA A;  3SEQ A;  2CH0 A;  3OYH A;  3E0J B;  2KP6 A;  3HPH A;  1E2X A;  4EM1 A;  2L9V A;  5D4S A;  1P6R A;  2R3S A;  3QYF A;  4CYC B;  3OS2 A;  4X6A J;  1YQA A;  2HIN A;  5J4V A;  3HGY A;  5DCM A;  2L49 A;  2R7V A;  4OMY A;  2GZW A;  4EKI A;  3C2H A;  3M1C A;  4NQW A;  1J0R A;  5FFZ A;  5E3O A;  5D5V B;  1VPW A;  2O5R A;  1OYY A;  4LG0 B;  1S6L A;  3ROU A;  3ZMS A;  1QO0 D;  3A9Y A;  1K79 A;  4PGG A;  2O7O A;  3QPH A;  2FQ3 A;  5BQT A;  5L3E A;  4BU2 A;  1Z0X A;  3K7A J;  1BI3 A;  4Z5D A;  2KJB A;  4XNF A;  4LIU A;  4A3G J;  1IXR C;  3V8L A;  3JRH A;  1QHH D;  1YS6 A;  1KZH A;  2XGC A;  5E17 F;  3HYI A;  2CRO A;  4KMU X;  3VYT B;  1TT0 A;  1VQM I;  2NOJ B;  5HVQ C;  2R1J L;  3AL0 C;  2CQK A;  1WH5 A;  4X1E A;  4G6D A;  4D9J A;  3MLF A;  5IYC J;  2YX7 A;  1BI0 A;  2PUB A;  2KZV A;  3PFI A;  4C3H J;  2P5L C;  3S14 J;  2LNB A;  1LNW A;  1WJ5 A;  2JJ7 A;  3MAJ A;  4QWQ A;  2PXD A;  2L0K A;  3OYE A;  2F4I A;  2K5C A;  2EBI A;  2PMZ N;  4OAZ A;  2L2O A;  2MC3 A;  2PX9 A;  3BTL A;  5GPC A;  4RB0 A;  2UWM A;  1MJA A;  1FNN A;  1Y1V J;  2HOA A;  2RQP A;  3WU0 A;  5F08 A;  2DT7 B;  1BIA A;  1QVU A;  2KIM A;  2RDP A;  3G3Z A;  3M9L A;  2KEJ A;  4JCY A;  3O2P E;  2HTJ A;  2K27 A;  1B72 B;  4IRG A;  2JTV A;  5FLM J;  3ZMD A;  2L1P A;  2KLO A;  2DO7 A;  5EJC A;  3VYR B;  3K4B A;  4A3E J;  1GXP A;  2GLO A;  5FB2 A;  3K1M A;  4LK1 F;  3WE2 A;  2L3D A;  5A2Q K;  4EGY A;  4GQM A;  3HOU J;  4UV9 A;  2XPU A;  4PSX A;  3E5U A;  4F55 A;  3G1M A;  2HQ5 A;  2ZC2 A;  3CQZ J;  1ZZ6 A;  1QP0 A;  1N25 A;  3TED A;  1X1C A;  3RZD J;  2CQX A;  3L2Q A;  4C3J J;  1TP4 A;  4BBS J;  1ZGA A;  4GHJ A;  4G8X A;  4PU7 A;  1R6R A;  1FPQ A;  3DBR B;  1XD7 A;  4RAG A;  2DMN A;  3L2V A;  1DW9 A;  3FXU A;  2AS5 F;  2P7V B;  5IT9 Z;  2GA2 A;  4EJT A;  2AHQ A;  2LKP A;  1I3A A;  3IUO A;  3CDI A;  4MQ9 F;  2TRT A;  2NVX J;  1U9N A;  4JQF A;  2VXZ A;  5DYM A;  1U2Z A;  1MSE C;  1YX3 A;  1JTY A;  1R1V A;  2W82 A;  2H09 A;  3CO7 C;  3TEL A;  4KFC A;  2M9H A;  3TP0 A;  2LYL A;  3CJR B;  1P2F A;  3CCY A;  3NRV A;  4HF1 A;  2UV1 A;  2HI3 A;  1XMA A;  2EZK A;  2KZG A;  1RET A;  1IRF A;  5DTR A;  2DA2 A;  1VQ5 I;  3JAM K;  2L01 A;  4Z59 A;  1APL C;  2DPD A;  2JVL A;  1D1A A;  3UKG A;  3BDN A;  1DU6 A;  1O4X A;  2CRG A;  1HQC A;  2YX4 A;  3DQV C;  3GTJ J;  3BG3 A;  3O6B B;  1G8X A;  2E71 A;  5ED4 A;  3GTO J;  3QQA A;  3U9G A;  5J1R A;  1HW2 A;  4IRH A;  2R93 J;  3SX0 A;  2JSC A;  1MNM C;  3ASO H;  1WGX A;  2R5Z B;  3S8Q A;  1ETK A;  3DEW A;  1FSH A;  2PMU A;  2ISZ A;  1Y39 A;  3U1D A;  1X58 A;  4R8H A;  2B0L A;  4HF2 A;  2GBY A;  5DCF A;  1Y0N A;  1HC8 A;  2J7U A;  3GZC A;  5A2Q Z;  3TDU C;  5ICC A;  5E3M A;  2CUJ A;  1X2M A;  1BR4 A;  1YIO A;  3S8P A;  1P4X A;  3ZR8 X;  1ETY A;  2LLV A;  1BDI A;  3HPG A;  2E5Z A;  4R1H A;  2PEX A;  1HST A;  1SVM A;  1ETX A;  5E1Z B;  2HFH A;  3FIW A;  2A07 F;  3IV5 A;  4LLN A;  1U0J A;  1HSJ A;  4BUP A;  3PNT A;  2W57 A;  1NHA A;  1JXS A;  2DFE A;  5EDN A;  1L1M A;  4M3E A;  2W1O A;  5D4R A;  4HNU A;  2JA7 J;  5DTQ A;  1X3U A;  4E7J A;  2AW6 A;  4LB6 B;  3G1L A;  3QOE A;  2XAU A;  2ELH A;  4MEY F;  2AWI A;  1QQA A;  4C30 A;  2RKH A;  5EG0 B;  2DOF A;  1TWG J;  3BG7 A;  3BT9 A;  5EEG A;  2FQ4 A;  2CW7 A;  1RZR D;  2M4H A;  2VON A;  2XRN A;  3F51 A;  4A3L J;  3HL2 A;  2P6S A;  2QF7 A;  4LGW A;  4V2G A;  3BR2 A;  4DJA A;  3GO5 A;  1YIJ I;  3M1E A;  1OCP A;  2HZT A;  2NYX A;  3G2B A;  3PSF A;  4ZZL A;  4BHC A;  3BTJ A;  3ZQF A;  1PUF A;  3RZO J;  3K4C A;  1NW3 A;  3HBL A;  4IO9 F;  4DQ2 A;  4AID A;  5IYD J;  5LEJ A;  4DYC A;  2EV0 A;  3GTL J;  3PE5 A;  1PP7 U;  3BRO A;  4U87 A;  5EZG A;  1J5Y A;  3WOD F;  2GOM A;  2P5K A;  5DT2 A;  2DA3 A;  3ZMU A;  2XDV A;  3LSJ A;  2EPF A;  4F3Q A;  1ZZ7 A;  5LRS A;  3A0H C;  3WU2 C;  1P9Q C;  1HDD C;  2NRA C;  5EF6 A;  4KIC A;  4M71 A;  2A68 F;  4BHP A;  3ZCO A;  3KYL A;  4FE4 A;  1BJZ A;  2EFQ A;  3BDD A;  2ZJR F;  2WY8 Q;  4BBR J;  3KP4 A;  1ZR4 A;  1ACI A;  1SAX A;  3GN5 A;  1RC9 A;  1BBY A;  1F1Z A;  2VL8 A;  3F21 A;  3GN5 B;  1IXC A;  3HM5 A;  4BJ5 C;  5J40 A;  1ZAR A;  5J47 A;  4XRF A;  3NRO A;  3ZMZ A;  1JFT A;  1KQ8 A;  5E1X A;  4RLQ A;  4DZJ A;  4KA4 A;  1JKQ C;  3HZI B;  3QPL A;  4BGD A;  2A6C A;  2DJI A;  2AQF A;  2BE5 F;  3GUD A;  5DUI A;  3BG9 A;  3HKZ A;  2LYQ A;  1UXC A;  2M30 A;  3N97 A;  2ICT A;  1W0T A;  4P55 A;  2KQR A;  2PUF A;  1ZH5 A;  4KIS A;  4ZDP A;  4JX5 A;  3I4P A;  2HPI A;  2MQK A;  4HYE A;  4B8X A;  3BOQ A;  3DTE A;  3AG3 H;  4PJ0 C;  3TOA A;  4GCV A;  2LYJ A;  2CFX A;  3ECO A;  3H9J A;  1NEQ A;  1DGW Y;  3CC2 I;  3PXP A;  2R7Z J;  1UXD A;  2OF7 A;  4RM3 A;  4L9V A;  3CP8 A;  3L00 A;  2PMH A;  4FX0 A;  1XSX A;  2K86 A;  4LK0 F;  4ENN A;  3L9F A;  2X6W A;  4HST A;  1BM9 A;  3CCS I;  2MYS A;  3COA C;  1W36 C;  5IPA A;  3R09 A;  3HOT A;  2HDC A;  4R79 A;  3L1P A;  1IXS B;  4OIR F;  2R7O A;  2AXT C;  2IA2 A;  1DDN A;  1JKP C;  2LK2 A;  4XKV A;  3HUG A;  3RI4 A;  1QB2 A;  2L9R A;  1TNS A;  1JE8 A;  1IN5 A;  5KNL A;  3L09 A;  4C2U A;  3TDZ C;  3H0G J;  1O3T A;  1RIO A;  3CC4 I;  3R61 A;  3E6C C;  3I0T A;  1TC3 C;  1T56 A;  4II3 A;  4S05 A;  2Z1D A;  2GXB A;  1TQP A;  1O7L A;  2FSW A;  1KU2 A;  2JA5 J;  2EH3 A;  4Y33 A;  1QBJ A;  1VQ9 I;  1MBF A;  2DA7 A;  5M5X J;  1PUE E;  4XN0 A;  1SFU A;  1A04 A;  4Z6Y A;  4OIP F;  1FIP A;  2ZFW A;  4I0B A;  2Y48 A;  4NBQ A;  3ZKC A;  1WKM A;  1UJ8 A;  2E2H J;  1D0Y A;  3IH3 A;  3CEC A;  3ZPX A;  1Z7L A;  2LY1 A;  5CQG A;  1M1E B;  5GAG J;  1LVK A;  4U0V A;  1R00 A;  3FXJ A;  3S2H J;  3WGG A;  2WIU B;  2K9N A;  1LE8 A;  2PQ8 A;  2JSP A;  2MA3 A;  3FX3 A;  1LE8 B;  3I55 I;  4ANJ A;  1YIT I;  2BNM A;  4H4K C;  4CZC A;  2Y75 A;  3QP6 A;  1X19 A;  4M3D A;  1B4A A;  2MH2 A;  1R1U A;  2EF8 A;  2DT5 A;  3OYI A;  2R5Y A;  3CCR I;  2ODR D;  4XBF A;  2KRC A;  3VOD A;  1HLV A;  2IU7 A;  4CO8 A;  2PXQ A;  4P5O A;  3MN2 A;  4O8B A;  1XMK A;  4G6T B;  1YHQ I;  3RKQ A;  2M87 A;  1FZP B;  3WTW C;  1TWF J;  2H1K A;  1K4S A;  3EQL F;  3BS3 A;  1RNL A;  3I58 A;  2F5D A;  3M7G A;  3F52 A;  5H2F C;  1J75 A;  3I71 A;  2R7F A;  4OB4 A;  4AUX A;  3ABK H;  2MG4 A;  1RRJ A;  3S93 A;  3CF2 A;  1K7A A;  4I99 C;  1H0M A;  2GA1 A;  2L8N A;  2CQQ A;  2VT3 A;  5CQE A;  3OSF A;  3UNG C;  3IWZ A;  4EJO A;  2VOD A;  4XN3 A;  3MKY B;  5JFR A;  5ICE A;  3OIP A;  3FF5 A;  3K4J A;  5HNF A;  4E70 A;  3OR1 C;  3TEP A;  2LYC A;  4I6R A;  3QRF F;  4CCK A;  5BNG A;  1VQ6 I;  1LCC A;  3ZQG A;  4HX8 A;  1MNE A;  1XWR A;  3IWF A;  4XLA A;  3B6A A;  1OIS A;  3E97 A;  3ZQH A;  2O9L A;  2STW A;  3DXJ F;  4B47 A;  3TL4 X;  2QBY B;  3NAU A;  3GXO A;  2PPX A;  3ML6 A;  3K4L A;  2ELJ A;  4U7B A;  4J19 A;  3V4G A;  1BOA A;  2CGP A;  2HDD A;  3E5Q A;  3NEU A;  5M5W J;  4E7H A;  3Q0V A;  4RA2 A;  5GAG i;  2CUZ A;  5J6X A;  2ZME C;  3KYD B;  1YW8 A;  4ITV A;  4ZTF A;  1X2N A;  1USS A;  4TV7 A;  5JLX A;  3CJT B;  3FWE A;  2A05 A;  1OQY A;  5L3D A;  2HFZ A;  4XL9 A;  4Y15 A;  5LBQ A;  3JRF A;  1EH6 A;  3KP5 A;  1ZG5 A;  1QVT A;  2L9S A;  1PRU A;  3GLX A;  2HR3 A;  2ZJQ F;  3CDH A;  3DTI A;  2P0W A;  2QVO A;  3REO A;  3U3W A;  4I01 A;  2VQL A;  2CV1 A;  2H1L A;  4KIG A;  2DTR A;  2L7M P;  4XLH A;  1R36 A;  2ID3 A;  1CF7 B;  1PER L;  3A4C A;  3GFM A;  3JRD A;  2IS4 A;  4CCL A;  3CP2 A;  3U21 A;  1J9I A;  4X4C A;  2X0L A;  2DA4 A;  1Z6R A;  4KDP A;  3H9Q A;  2RN7 A;  3NDB B;  2K7L A;  2NNN A;  2EBY A;  2OC6 A;  4BXX J;  4X4I A;  3OQM A;  2Y9Z A;  3HDD A;  5CVI A;  3M3Y J;  1SD5 A;  4Y52 J;  2ACJ A;  2DA5 A;  2DFI A;  3CUO A;  2XSD C;  2JVH A;  4AYB A;  1P92 A;  1FEX A;  3FHZ A;  2RRE A;  2L9N A;  4P1W A;  1XC5 A;  3CDL A;  1WQ2 A;  3MZY A;  3I5U A;  3W6K B;  3H35 A;  1YFH A;  5J8F A;  4I02 A;  3F6W A;  2EV5 A;  3CCV I;  2XIG A;  3DLL F;  3GZN B;  1GVJ A;  3ASN H;  5EYR A;  3HTU A;  1G3Y A;  1ZK8 A;  2DMT A;  2DDB A;  2DT6 A;  4A3M J;  2OD5 A;  3GTM J;  3OYK A;  3LSH A;  4X4F A;  3TP3 A;  4H0E A;  3ZQC A;  1ZLK A;  4NB5 A;  4PU8 A;  2PXV A;  4L5E A;  3HHH A;  3BZC A;  5HOD A;  1HKQ A;  3CRO L;  1IN7 A;  2MXD A;  3HOV J;  1D8J A;  2IP2 A;  3LAJ A;  3G71 I;  4BYY A;  1ONV A;  2VE8 A;  2BHY A;  3WTZ A;  3G1O A;  4G6Q A;  2V26 A;  3JTG A;  2MLG A;  1YJW I;  2VQG A;  3H9G A;  1K78 B;  2K02 A;  2QWW A;  1BR2 A;  2PXU A;  1S9H A;  4IPA A;  3WTS C;  3WE3 A;  4BEH A;  2HSG A;  4PDK A;  3OR2 C;  5DDG A;  4IHT A;  2H8W A;  1IDY A;  2MSY A;  5C44 J;  4ZDO A;  2FU4 A;  1RKT A;  1J09 A;  2Z16 A;  2EFN A;  4IEJ A;  4M72 A;  4WXH A;  3W2A A;  2IS1 A;  3KP7 A;  2NS7 A;  1A6I A;  3PSI A;  2WC2 A;  1SD7 A;  1A36 A;  1T6S A;  1NG6 A;  3I53 A;  4BKX A;  3KP6 A;  3AG2 H;  4CXF A;  5DSX A;  1JH9 A;  3CUQ B;  4HX4 A;  2XKO A;  4OIO F;  4EGZ A;  4HNV A;  2PE5 A;  1XSD A;  1QP4 A;  2V9V A;  2OCC H;  2IS2 A;  1JTX A;  1ZZC A;  2X6Y A;  5GAH J;  2HQR A;  1P7J A;  2LY9 A;  3F8N A;  4RS8 A;  1C0W A;  1LDJ A;  3ABT A;  3OYL A;  1LDD A;  4MNU A;  4MTE A;  1DU0 A;  1N78 A;  3MEJ A;  1YE9 A;  1FOW A;  5JI6 A;  5EEA A;  2O61 A;  2F48 A;  5FLV A;  1UST A;  3JR9 A;  3C7J A;  1Y9Q A;  3EET A;  3JSO A;  1IN6 A;  2Z3Y A;  3RKW A;  1SVO A;  5GTH C;  2LRD A;  1SD4 A;  3EUA A;  1LVA A;  3V7R A;  3LSG A;  1I3Q J;  3KEY A;  3K70 C;  2M7B A;  1XGN A;  4MCX A;  3O9X A;  3T8T A;  2H94 A;  2V79 A;  2A5W A;  5ICG A;  1Y6I A;  2Y31 A;  2PLY A;  2IVQ A;  4GRI A;  2FD5 A;  4Y7N J;  2BW3 A;  4E7I A;  1LLI A;  4I98 B;  1MW7 A;  2F5V A;  1FOX A;  3GW2 A;  3QU6 A;  2HKX A;  1N75 A;  2PJR B;  3F22 A;  2ZXW H;  4HOB A;  2WUS R;  2PJR A;  1E3H A;  3I59 A;  2ME0 A;  1R49 A;  3PUB A;  4F7Z A;  1D1B A;  4LFU A;  1FY7 A;  2VAS A;  3DFG A;  2M4G A;  1RKW A;  1KQ9 A;  4HW0 A;  2MC4 A;  1U5T B;  5HS8 A;  3TW6 A;  3GFL A;  1FTT A;  4GYI A;  5DRT A;  1IF1 A;  1VQ8 I;  2BXY A;  1QQB A;  1EFA A;  4UUV A;  4WVL A;  2R7W A;  4IVZ A;  4LD5 A;  5B1B H;  2JA6 J;  4XSX F;  3G6E I;  4C2T A;  4A3C J;  4CYC A;  5L3F A;  4L9T A;  1XX5 A;  4NDW A;  2DI3 A;  5DCM B;  1G4D A;  4L18 B;  2Q8K A;  2HZD A;  2A6T A;  5FKM A;  3CJN A;  3CMY A;  3PNV A;  1KU9 A;  2OZU A;  4BNC A;  2QKL B;  4KT5 C;  2V6C A;  3KEO A;  3R1F A;  3OOP A;  3R60 A;  3HOZ J;  2KDO A;  4Q2J A;  4A3J J;  3KLO A;  3MKL A;  3ISP A;  2M5W A;  4P9F A;  1BW6 A;  4HG2 A;  3OYD A;  1MFQ C;  4FTH A;  4KUM A;  2DAO A;  2OTJ I;  2HKO A;  4HDV A;  4PFP A;  1G3W A;  1KQ0 A;  4BQN A;  3ABU A;  2QSG X;  4FCY A;  4X4G A;  5EZH A;  2AXV A;  4LIT A;  2IGO A;  4PSW A;  4I6Z A;  2XXQ A;  1ON2 A;  4A3K J;  3GVA A;  1FOK A;  3QWL A;  4HRA A;  3HJE A;  5K7F A;  2P6T A;  3HRU A;  1ZN2 A;  2OUM A;  3RPU D;  1R9T J;  1ZZB A;  3BC8 A;  2FML A;  4B3X A;  4PJM A;  4HAM A;  2R7S A;  3LST A;  1D5Y A;  5FKO A;  1Z7U A;  1JHH A;  4BHB A;  1U6G A;  4UVC A;  2GOX B;  4UUS B;  2FOK A;  2E2J J;  2VJ5 A;  3Q0U A;  1LUJ B;  2IAI A;  2JK3 A;  2CG4 A;  3SYT A;  2XAH A;  1DQU A;  3LSK A;  3DBH B;  3W3C A;  4OAY A;  3QOD A;  1BIB A;  2LBF B;  4CZZ A;  3LWF A;  1R63 A;  1RUN A;  4MHG A;  1V54 H;  4E7Z A;  1W5C C;  4UVB A;  2ESN A;  1G59 A;  1S29 A;  2QEN A;  3HRM A;  1IUY A;  2J7W A;  4LLG F;  2VOO A;  1WJE A;  2K4B A;  4J00 A;  1O57 A;  1QPI A;  1IV8 A;  2LR8 A;  2CJJ A;  3OP9 A;  3LL7 A;  1U3E M;  1V3F A;  2XKP A;  3MD2 A;  2XJ3 A;  2EIN H;  4YIF A;  1K61 A;  4IOC F;  4N9I A;  2IBD A;  5D8L B;  1Y56 A;  2BY0 A;  3EUK L;  3A03 A;  1YW7 A;  1ZTR A;  2O0Y A;  3EDP A;  1XTA A;  2F4O B;  1QNT A;  3QPS A;  5E3N A;  4AIK A;  1WJF A;  1XS9 A;  3MVP A;  3CF5 F;  5IOZ A;  3ZQI A;  4XM3 A;  3HOY J;  2IVG A;  1JT0 A;  4ZTJ A;  2LNM A;  1TWH J;  2XSJ C;  2DLL A;  2M0C A;  3HXL A;  1ORK A;  3MCZ A;  3ZPL A;  3BTI A;  1OCT C;  2UZK A;  1PDN C;  1VQK I;  3BCB A;  1D5V A;  2JCG A;  1Y8R B;  4BEH B;  2NVY J;  4YII A;  1XDS A;  2Q2E A;  1EA3 A;  4EQZ A;  1ERD A;  3ZQ7 A;  1T95 A;  2GIZ A;  3N05 A;  1H9T A;  2ETH A;  3SR4 A;  4ER6 A;  1CQT A;  2RAE A;  2LP0 A;  3QOP A;  5J1U A;  4U0Y A;  2XPW A;  2PXF A;  2XF7 A;  1RR8 C;  3CLC A;  4I6U A;  5CVJ A;  1AKH B;  1OCC H;  2BXZ A;  1TW2 A;  5HDG A;  2W25 A;  4XOR A;  3LIS A;  1AA7 A;  1IAW A;  1D1C A;  2K40 A;  2RGV A;  4M6V A;  2H27 A;  4NHJ A;  2IA0 A;  5CYV A;  5FD6 A;  2VT2 A;  3HC7 A;  2PUD A;  3A1Y A;  3H0D A;  4IRI A;  1G3S A;  3Q0W A;  4NC6 A;  5LFA A;  3QFI A;  3HRT A;  3L2U A;  4OU0 A;  4ZYA A;  1VQ4 I;  3FM5 A;  3KE2 A;  2DBB A;  3JCU C;  1ZYR F;  2LLK A;  1FBS A;  3M8J A;  3SCG A;  1QP7 A;  4ABZ A;  2LYK A;  3WG9 A;  1XDU A;  4D7M A;  2JRT A;  1QZE A;  3Q5F A;  3C2B A;  5CJ9 A;  3P9C A;  2KPJ A;  2JWT A;  2L4A A;  4LJZ F;  3H5A A;  3JTH A;  3GZ6 A;  2WAE A;  1Z9C A;  1J2X A;  2YSR A;  1UHW A;  4BQQ A;  3FYA A;  2QM3 A;  1J7K A;  2H8R A;  2LCV A;  4XLF A;  3CO6 C;  3J81 K;  2BV6 A;  3I3L A;  1IGN A;  2YR2 A;  1JJ6 C;  5KHD A;  3O8G A;  2STT A;  2L7K A;  4IVN A;  2FXA A;  2ZFU A;  2I5U A;  2WA0 A;  3J7A O;  2CW8 A;  2WAQ A;  2CW0 F;  4A0Y A;  5DTD A;  4B09 A;  5JHU A;  4IL6 C;  3WGI A;  2DPU A;  2R7D A;  4IHY A;  1LQ1 A;  3PUF A;  4CCJ A;  3GLL A;  4N4O B;  5F0C A;  3FXL A;  4PJL A;  4Z2Y A;  3E3V A;  2BYV E;  2K9Q A;  4G12 A;  5ILU A;  2PXT A;  1S7A A;  3F6V A;  5JLW A;  2L4M A;  2HTS A;  1OR7 A;  2NAZ A;  4PGH A;  1XMX A;  1DUL A;  3GBF A;  1RZS A;  1ZZ8 A;  2PG4 A;  3FBI B;  3F9K A;  4ESB A;  3JRA A;  2VBZ A;  4OMZ A;  1HQ1 A;  1RI7 A;  1F4K A;  3TKY A;  3TO7 A;  3MKZ A;  1AOY A;  1BOB A;  3H36 A;  1OYI A;  4JQD A;  1ULY A;  3SDG A;  3W6J B;  3OYB A;  1XPX A;  3NWT A;  4AM3 A;  3CCL I;  5F04 A;  4YG2 F;  1Z3Y A;  4WXD A;  3VWS A;  1GUU A;  5GTI C;  2IXS A;  1V55 H;  5BOX A;  2V1D A;  4LLL A;  2IS6 A;  1PVE A;  2LC2 A;  3H1C A;  1X2L A;  4FHT A;  1NER A;  3S15 J;  2DMP A;  1QZZ A;  4RLF A;  3FDY A;  3UR3 C;  3BG6 A;  1MMA A;  4DBR A;  4A0Z A;  2MD0 A;  3CTA A;  5D6F A;  5EGO A;  2VLA A;  2W48 A;  3WU1 B;  4YFX F;  3M8E A;  3LFU A;  2QUF A;  2ICW G;  1LDK B;  1MBG A;  3LQR A;  3RDI A;  2BEO A;  1F36 A;  2JMW A;  4MFE A;  3MFK A;  4BQA A;  3ZMT A;  3C18 A;  3F8B A;  3KZZ A;  3E6M A;  4CCO A;  3KIO A;  4O5V A;  2DOD A;  5F0F A;  3ME5 A;  1OLT A;  4I8T A;  4EK9 A;  2BHZ A;  1P7I A;  5K5R A;  4Q47 A;  1OJL A;  1NTC A;  4B3A A;  4LMY A;  3VEP A;  2ZO4 A;  2KL4 A;  4ENM A;  2V1U A;  3M07 A;  4Z5H A;  1L3L A;  3LFK A;  2PBI A;  1FT9 A;  4ZH4 F;  2DOA A;  4KIB A;  3GZ5 A;  4HDU A;  2L54 A;  1J59 A;  2NVT J;  2A3S A;  2RC4 A;  3FMS A;  2VOP A;  2Q2E B;  5FKN A;  4D0P A;  3ZOB A;  1I27 A;  3QOX A;  4B44 A;  1OMI A;  2GZU A;  2RQQ A;  3RZZ A;  1RPE L;  4LIV A;  4JX6 A;  3SZG A;  1G2H A;  3HEF A;  2JA2 A;  2UUZ A;  1B72 A;  5FD5 A;  1A31 A;  1I1S A;  1TLH B;  3QYB A;  1GV2 A;  1KU3 A;  1WH6 A;  4F92 B;  1Q1V A;  4A5M A;  1GV5 A;  3CUQ A;  1VQL I;  1S7E A;  3EPZ A;  2CQ7 A;  2E7W A;  4M3G A;  4AU7 A;  5HLI A;  2D45 A;  1QQI A;  5C4X J;  2XRO A;  5M3M J;  2OQR A;  3AFH A;  2EK5 A;  2KEI A;  5D6E A;  3F72 A;  4PCQ A;  4B1R A;  1SC7 A;  1HW1 A;  4D5C A;  2XAS A;  3BZ6 A;  2V9K A;  5D8K B;  1LPQ A;  1HDP A;  3JRC A;  4HBL A;  1FP1 D;  4EM2 A;  3H5T A;  1H89 C;  5FKL A;  4K2E A;  4IQ4 A;  1FX7 A;  3I64 A;  3ONQ A;  3RSN A;  2Y2Z A;  3JRI A;  2EJR A;  2LKS A;  1N77 A;  1ENH A;  2AXZ A;  3JW4 A;  2OQG A;  3ABM H;  2GIV A;  4U7D A;  1QGP A;  2F2E A;  4JOM A;  2XAG A;  3OKZ A;  4A6E A;  4HLY A;  3HKZ N;  2R0Q C;  1MDM B;  3WG7 H;  2VEO A;  4MO7 A;  2DTZ A;  2K9S A;  3X2Q H;  3QYE A;  2M45 A;  3HHG A;  1YW9 A;  4A3D J;  4C9Y A;  1XCV A;  3IRR A;  3ERE D;  2KZ8 A;  2R5Y B;  3DP7 A;  4E4H A;  4W97 A;  3NXH A;  4GO1 A;  4PJN A;  1W36 D;  3S32 A;  1YJ9 I;  1MBE A;  2EIM H;  3BPX A;  4BJT A;  1ON1 A;  5J1Y A;  3BY6 A;  3L2C A;  3HOW J;  1R5G A;  3IVP A;  1U5T A;  4O6J A;  2CU7 A;  2FBI A;  1UG2 A;  3PNY A;  3KZI C;  3BJO A;  2DXI A;  1SAN A;  1H8A C;  4YEJ A;  5D5W B;  3PL8 A;  3CCM I;  1DP3 A;  2KT0 A;  3TMO A;  3FXR A;  1I39 A;  2XUB A;  1IG7 A;  3DLA A;  3RJP A;  4MQV A;  3Q9S A;  1ETQ A;  3L2W A;  1IO2 A;  3RTR A;  5FLX K;  1HXD A;  2G0E A;  2P4W A;  5JUW A;  1LFB A;  2BY2 A;  1FYK A;  3DBL B;  1VQ7 I;  2IPQ X;  4X4B A;  4DYQ A;  1UMQ A;  1K6Y A;  3R4K A;  5HLT A;  1ZZ9 A;  4II2 A;  1BJA A;  1TZL A;  2ZXJ A;  2M4K A;  4DZP A;  1OYW A;  2P81 A;  2JRM A;  3OMY A;  3CCJ I;  4XLP F;  1MGT A;  1GLN A;  4ZYE A;  1O3S A;  5F0H A;  3EYY A;  2W85 A;  3JRB A;  1R5I D;  2JT1 A;  3B73 A;  5B1A H;  5DD8 A;  3K69 A;  1MH4 A;  4AVP A;  1DP7 P;  4CUG A;  3ZN1 A;  4UY8 I;  2R7T A;  1X1D A;  2BBY A;  3MZH A;  3BTC A;  4OWR B;  5AIP A;  5DM6 F;  1X4O A;  1DGR M;  4A5N A;  4DBQ A;  1T0F C;  5K7Z A;  2L7Z A;  3FKJ A;  3ERM A;  4EV0 A;  1SFX A;  3LSM A;  3V7S A;  2COM A;  4LOC A;  2M34 A;  3P7N A;  5ILV A;  4N9H A;  2PUC A;  1LEB A;  1ETW A;  1U8B A;  4F52 A;  1T33 A;  1B9M A;  1T0F A;  3OIO A;  3PIP F;  5IP9 J;  2O6G E;  1U8R A;  1Y1W J;  4QLC U;  4B4C A;  4XRS G;  2CQN A;  1FJL A;  2G7H A;  3PQJ A;  3AKZ A; 
#chains in the Genus database with same CATH homology
 2FX0 A;  2B63 J;  1B72 B;  5FLM J;  2Y31 A;  2IVQ A;  2VKV A;  2COB A;  2FD5 A;  4Y7N J;  4A3E J;  1ZKG A;  2GLO A;  2HOT A;  4GFB A;  3S1Q J;  4GQM A;  1LLI A;  4MFD A;  2WV1 A;  4IWR A;  3HOU J;  2XPU A;  1JUS A;  3G1M A;  2HQ5 A;  3EUS A;  3CQZ J;  3FMY A;  2Y30 A;  1ZZ6 A;  2WUS R;  1QP0 A;  3TED A;  2ME0 A;  3RZD J;  2CQX A;  3GTP J;  1LCD A;  4C3J J;  4W1U A;  5F1J A;  4BBS J;  2IVB A;  4GHJ A;  4PU7 A;  2HOS A;  1RKW A;  1WI3 A;  2L7F P;  2DA1 A;  1ADR A;  1DW9 A;  2DMN A;  3LOC A;  3TW6 A;  3FYM A;  1FTT A;  5IP6 A;  5IYB J;  1SFO J;  2ECC A;  4I76 A;  1QQB A;  2AHQ A;  4BY1 J;  1EFA A;  1RES A;  4IVZ A;  2YS9 A;  2NOG A;  3QF3 A;  1VI0 A;  2TRT A;  2NVX J;  2JA6 J;  1U9N A;  4A3C J;  4CYC A;  3GBG A;  4A3F J;  1MSE C;  2D5V A;  1JTY A;  4NDW A;  5C3E J;  2X9D A;  3WHC A;  2M9H A;  3TP0 A;  2LYL A;  3S17 J;  2HYJ A;  3CCY A;  5FKM A;  3BR1 A;  3JRG A;  2HI3 A;  1VF9 A;  2TCT A;  2XRL A;  3CMY A;  1JGG A;  4A69 C;  2NVQ J;  2EZK A;  4DYR A;  4RDU A;  1RET A;  3ZHI A;  3R1F A;  2DA2 A;  2MW8 A;  4C3I J;  4Z59 A;  2LYP A;  3O9X A;  4A3I J;  2R92 J;  1QPZ A;  2ME6 A;  2VPR A;  1APL C;  3HOZ J;  2MEZ A;  2JVL A;  3UKG A;  3GTK J;  3BDN A;  1DU6 A;  1O4X A;  4A3J J;  2CRG A;  3MKL A;  1I6H J;  2EZI A;  3GTJ J;  1BW6 A;  3BG3 A;  4A3B J;  4FTH A;  3GTO J;  3BQZ A;  3QQA A;  5E3L A;  5J1R A;  1MBH A;  1POU A;  1TWA J;  3OSG A;  3SCF A;  3BR3 A;  2R93 J;  4PU3 C;  1MNM C;  2PIJ A;  4BY7 J;  1WGX A;  5F27 A;  2R5Z B;  1ETK A;  3DEW A;  2O8K A;  3S8Q A;  1WH7 A;  4FCY A;  1X58 A;  4X4G A;  5EZH A;  4PU4 C;  2AXV A;  3FKI J;  5IOY A;  2XPV A;  4DW6 A;  4I6Z A;  2LVS A;  2GBY A;  4A3K J;  5M5Y J;  2DMQ A;  5E3M A;  2R63 A;  5K7F A;  1X2M A;  4YG4 A;  4M3F A;  1ETY A;  1BDI A;  1R9T J;  1ZZB A;  2IUO A;  1DWK A;  2NS8 A;  1ETX A;  2WB1 N;  3ZHM A;  3FIW A;  3IV5 A;  2B5A A;  1D5Y A;  5FKO A;  4UUS A;  5EDN A;  1B8I B;  4M3E A;  1L1M A;  2JA7 J;  4UUS B;  1B8I A;  4XID A;  2E2J J;  1U78 A;  3G1L A;  5EG0 A;  1UTX A;  2AW6 A;  2AWI A;  3Q0U A;  1QQA A;  2IAI A;  2JK3 A;  5EG0 B;  1WET A;  5GPA A;  2AXU A;  1TWG J;  3BT9 A;  1JJ8 C;  1PRV A;  2FQ4 A;  1R63 A;  1RZR D;  2EZL A;  2IV1 A;  4O8B A;  3F51 A;  9ANT A;  4A3L J;  1NK3 P;  1IC8 A;  3OMT A;  2YUS A;  3FIS A;  5K7H A;  1ZS4 A;  5GP9 A;  4IA8 A;  1MBK A;  4MIM A;  3S1N J;  3DNV B;  2QF7 A;  1QPI A;  4UUT A;  2LR8 A;  4V2G A;  2ZB9 A;  2CJJ A;  3BR2 A;  1YRN A;  3OP9 A;  1LQC A;  1GVD A;  1OCP A;  1PRA A;  1B0N A;  2XI8 A;  3BTJ A;  3ZQF A;  1PUF A;  3RZO J;  2XJ3 A;  3HBL A;  1K61 A;  5IYD J;  4DYC A;  3GTL J;  1U9O A;  2IBD A;  3I4M J;  5EZG A;  4XIC A;  5C4J J;  3A03 A;  2BJC A;  2DA3 A;  1ZTR A;  3LSJ A;  2EQR A;  3BR0 A;  1ZZ7 A;  4Y42 A;  1HDD C;  3QPS A;  5E3N A;  1XS9 A;  5EF6 A;  1BL0 A;  1R69 A;  3KXA A;  3MVP A;  5IOZ A;  4IHW A;  1YSE A;  3ZQI A;  3HOY J;  4FE4 A;  1BJZ A;  2BNN A;  2IVG A;  1JT0 A;  2KDZ A;  3LSP A;  1TWH J;  4BBR J;  3FK7 A;  2O4A A;  2M0C A;  1ZR4 A;  1ORK A;  3GN5 A;  3BTI A;  1OCT C;  1WIZ A;  3GN5 B;  2JCG A;  3WHB A;  3HM5 A;  2NVY J;  2HXI A;  1HF0 A;  1IV6 A;  1ZUG A;  3QWG A;  1JUP A;  1JFT A;  1CQT A;  2RAE A;  2LP0 A;  5J1U A;  4DZJ A;  2XPW A;  4IHV A;  3B6C A;  1JKQ C;  3HZI B;  3NAR A;  3CLC A;  3QPL A;  4I6U A;  1H88 C;  2A6C A;  1AKH B;  3BG9 A;  2LYQ A;  2LKX A;  1AKH A;  3M4O J;  1Z77 A;  3BQY A;  1TWC J;  1UXC A;  2ICT A;  3LIS A;  2K40 A;  4M6V A;  3BD1 A;  1W0T A;  3K2A A;  1POG A;  2AO9 A;  1BDH A;  2AUW A;  2PUF A;  1PNR A;  1MSF C;  3SJM A;  2PUD A;  2M2E A;  4JX5 A;  2MQK A;  2CSF A;  3KJX A;  3Q0W A;  4MCT A;  2ICP A;  3PO2 J;  1W0U A;  3I4N J;  2LYJ A;  1BW5 A;  1RR7 A;  1Y7Y A;  1QP7 A;  2LLK A;  3SCG A;  1NEQ A;  3PXP A;  4ABZ A;  2LYK A;  4D7M A;  4A93 J;  2R7Z J;  1JUM A;  1UXD A;  2OF7 A;  1JFS A;  3C2B A;  1FTZ A;  2KPJ A;  2JWT A;  1UHS A;  3SFI A;  1X57 A;  1JKR C;  2N8G A;  3JRE A;  3S2D J;  5IPA A;  1AU7 A;  3FYA A;  1QRY A;  3L1P A;  3DCF A;  2H8R A;  2LCV A;  2ECB A;  4Z58 A;  1JKP C;  2LK2 A;  2X48 A;  2L9R A;  1IGN A;  1JJ6 C;  3O8G A;  4Z5C A;  3PM1 A;  3H0G J;  1RIO A;  2BNO A;  2OFY A;  5DTD A;  1TC3 C;  1T56 A;  2ID6 A;  1GDT A;  3LFP A;  2E1O A;  4FIS A;  2JA5 J;  2EH3 A;  2PUG A;  4IHY A;  1MBF A;  3OQO A;  2DA7 A;  2VI6 A;  5M5X J;  1IUF A;  4XRM A;  3BR6 A;  4J1X A;  5F0C A;  3BG5 A;  4AC0 A;  4NDL A;  3OOU A;  2WAQ N;  1FIP A;  2K9Q A;  4G12 A;  1ZR2 A;  3ZKC A;  1ETV A;  5JLW A;  1HOM A;  2E2H J;  2YU9 J;  1IDZ A;  3IH3 A;  3GBF A;  1RZS A;  1ZZ8 A;  3CEC A;  3JXB C;  1I50 J;  3JRA A;  2E19 A;  3S1R J;  1GT0 C;  3S2H J;  3D1N I;  5J3L A;  2K9N A;  2WIU B;  3GTG J;  1LE8 A;  2LFB A;  4J1W A;  1LE8 B;  4JQD A;  3SDG A;  2BNM A;  3A01 A;  4MLO A;  2O49 A;  3HOX J;  5F04 A;  3A02 A;  1GUU A;  3PO3 J;  4M3D A;  1MH3 A;  2EF8 A;  4FE7 A;  2R5Y A;  3HGG A;  2QCO A;  1X2L A;  1ZGW A;  1NER A;  1HLV A;  1WH8 A;  2IU7 A;  2HXO A;  4S0H B;  3ZQL A;  3S15 J;  2DMP A;  1YRN B;  3MN2 A;  4M3B A;  1PUF B;  5EGO A;  3RKQ A;  5K98 B;  2DA6 A;  1TWF J;  2H1K A;  2W48 A;  2KEK A;  3BS3 A;  4YAR A;  2X6O A;  2DMU A;  1ZVV A;  1MBG A;  1ZQ3 P;  3F52 A;  2FJ1 A;  4OB4 A;  4AUX A;  1F36 A;  2JMW A;  2MG4 A;  4MFE A;  1F43 A;  5DS9 A;  2LYS A;  5A7L A;  2L8N A;  2CQQ A;  3B7H A;  3OSF A;  3VPR A;  5F0F A;  4I8T A;  2PUA A;  3QYX A;  1P7I A;  1FIA A;  1OJL A;  1NTC A;  4B3A A;  3TRB A;  2DJN A;  4I6R A;  5BNG A;  4X4D A;  4D7N A;  3TW7 A;  2LYR A;  4Z5H A;  4C2M J;  1LCC A;  3ZQG A;  1XWR A;  2NVT J;  3ZQH A;  3B6A A;  2O9L A;  4X4E A;  1VFC A;  1WPK A;  2PUE A;  4YG1 A;  3SCH A;  5FKN A;  3NAU A;  4QIW N;  2PPX A;  3ZOB A;  4J19 A;  3HB9 A;  1LFU P;  2CUE A;  2HDD A;  5M5W J;  2GZU A;  3RZZ A;  1RPE L;  3Q0V A;  1AHD P;  4XRS A;  4IHX A;  4JX6 A;  1G2H A;  3HEF A;  1JT6 A;  5IP7 J;  1B72 A;  2XGD A;  4FBI A;  4YG7 B;  1X2N A;  1GV2 A;  3O8H A;  5JLX A;  1WH6 A;  2R5Z A;  3IH4 A;  1IJW C;  3FK6 A;  2O38 A;  1Q1V A;  1K83 J;  3H3V K;  2GM4 A;  1GV5 A;  1S7E A;  4M3G A;  2OR1 L;  5C4X J;  3Q3S A;  2XB5 A;  3QQ6 A;  4F8D A;  5M3M J;  3JRF A;  2FJR A;  2KEI A;  3VK0 A;  4B1R A;  1QVT A;  2VKE A;  4D5C A;  1JWL A;  1PRU A;  4JP0 A;  1NK2 P;  4AYB N;  3BR5 A;  3G5G A;  3U3W A;  1HDP A;  3JRC A;  3H5T A;  1H89 C;  5FKL A;  2L7M P;  2ID3 A;  1PER L;  2Y2Z A;  3JRI A;  1ENH A;  3JRD A;  2AXZ A;  1ZPQ A;  4YBA A;  4XK4 A;  4X4C A;  2DA4 A;  4QTR A;  3W6V A;  1E3O C;  1VND A;  1XG1 A;  4X4H A;  2EBY A;  1RPW A;  4BXX J;  4X4I A;  3HKZ N;  3OQM A;  2R0Q C;  2Y9Z A;  3HDD A;  3JXD L;  3M3Y J;  3LSR A;  4Y52 J;  2MGQ A;  4MO7 A;  3S1M J;  2DTZ A;  2DA5 A;  2I10 A;  2K9S A;  4EEF G;  2DN0 A;  2XSD C;  2E2I J;  3A01 B;  1ZAY A;  4A3D J;  3LNQ A;  1EF4 A;  5M3F J;  3G7D A;  1FEX A;  4RBO A;  3F0C A;  1XC5 A;  3CDL A;  2KZ8 A;  2R5Y B;  3GTQ J;  2XIU A;  4W97 A;  4JX4 A;  4JYK A;  1OFC X;  1ITY A;  3F6W A;  1MBE A;  3UFD A;  2Y9Y A;  5EGO B;  2EZH A;  5J1Y A;  5EYR A;  3IVP A;  3HOW J;  2XB0 X;  2IEK A;  4JCX A;  1ZK8 A;  2CU7 A;  2JN6 A;  2DMT A;  1JKO C;  4QSH A;  1UG2 A;  4A3M J;  1IRZ A;  3GTM J;  1ETO A;  4X4F A;  3E7L A;  3TP3 A;  1SAN A;  4V2F A;  3ZQC A;  4PU8 A;  1H8A C;  4L5E A;  5HOD A;  2ELK A;  4CYC B;  4X6A J;  2HIN A;  3CRO L;  2KT0 A;  3HGY A;  3HOV J;  2L49 A;  3G1O A;  1BA5 A;  1IG7 A;  3KZ3 A;  5E3O A;  1ETQ A;  3S16 J;  1CJG A;  2JA8 J;  1VPW A;  2Y0S N;  2M8G X;  2LTP A;  2G0E A;  1LFB A;  2HSG A;  2GRL A;  2O7O A;  4X4B A;  1IDY A;  2MSY A;  1MBJ A;  1UMQ A;  1Z0X A;  3K7A J;  4DYQ A;  5C44 J;  1SQ8 A;  4Z5D A;  1RKT A;  1ZZ9 A;  2EWT A;  4A3G J;  1HCR A;  4IEJ A;  1WCM J;  5FKK A;  3JRH A;  4DZP A;  2P81 A;  2XGC A;  5FJ8 J;  2NS7 A;  2CRO A;  1A6I A;  5F0H A;  1A5J A;  2R1J L;  3JRB A;  1WH5 A;  4X1E A;  4BKX A;  1MH4 A;  3MLF A;  1JH9 A;  5IYC J;  3OQN A;  3JXC L;  2PUB A;  4C3H J;  3BTC A;  4D5F A;  4HNV A;  2OPT A;  2VUM J;  2PE5 A;  3S14 J;  1LMB 3;  1QP4 A;  2JJ7 A;  2XCJ A;  5K7Z A;  2LD5 A;  1ZZC A;  2L7Z A;  1JTX A;  2L0K A;  1RZR A;  1OSL A;  1P7J A;  2LY9 A;  4I6T A;  4LOC A;  2EBI A;  2M34 A;  4FN3 A;  2PUC A;  2PMZ N;  1DU0 A;  1ETW A;  1U8B A;  3IH2 A;  3BTL A;  5GPC A;  5EEA A;  1T33 A;  5FLV A;  3OIO A;  3JR9 A;  1Y9Q A;  5IP9 J;  2CUF A;  1Y1V J;  1Y1W J;  2HOA A;  3RQI A;  5F08 A;  4B4C A;  2GRM A;  4XRS G;  1QVU A;  2KEJ A;  4JCY A;  3LSG A;  1I3Q J;  1FJL A;  2XGE A;  4MCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...