2XSDC

Crystal structure of the dimeric oct-6 (pou3f1) pou domain bound to palindromic more dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
128
Chain Sequence
APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*AP)-3'
total genus 43
structure length 128
sequence length 151
ec nomenclature
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xsdC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2xsdC01
4Y52J 3S16J 2HDDA 3ZQHA 4IHVA 1WIZA 4C3IJ 1BA5A 4C3JJ 1ZZ7A 4A3EJ 2FJRA 3H3VK 2IEKA 1XWRA 5FKLA 5F1JA 2JK3A 1HF0A 3FYMA 4IWRA 2MQKA 3BT9A 3HOZJ 4A3DJ 1ORKA 2HXOA 2CU7A 5EGOA 3JRCA 3PXPA 2IAIA 3ZQLA 1VPWA 1FJLA 3QF3A 1BW6A 3BG3A 1MBGA 2JWTA 4M3FA 4I76A 5J1YA 1RESA 1ZZ6A 1JKQC 2VI6A 1U78A 1RZRD 4A3BJ 4I6UA 3NARA 2GRLA 3GTJJ 2OPTA 4M6VA 2LYPA 4I6RA 5C44J 4GQMA 2MW8A 3G1LA 1DWKA 3ZHIA 3C2BA 3O9XA 3RKQA 1SANA 1RETA 5M5YJ 3S17J 4BXXJ 2HOAA 2EWTA 1ZVVA 4JX6A 2EZHA 2IV1A 3FK7A 3I4MJ 3JRAA 3S1NJ 1MSFC 4IVZA 2CQQA 3RQIA 1LQCA 3S15J 2AO9A 2YS9A 4X4GA 3IH2A 4B4CA 3JRIA 3M3YJ 4MFDA 1T33A 4BY7J 1UXCA 3H0GJ 3FK6A 4Y7NJ 1JGGA 2N8GA 4OB4A 3BD1A 5BNGA 4FISA 1F43A 5HODA 4XIDA 1QVTA 1AU7A 2YUSA 1ZZ8A 2XPWA 1JJ8C 3Q0UA 2XCJA 3F51A 3Q3SA 5IOYA 2ICTA 4JCXA 1PUFA 3W6VA 4FN3A 1FEXA 2O4AA 2HI3A 3BR6A 3HB9A 4D5FA 5M3MJ 2BNNA 3ZQIA 4AUXA 2DA4A 5DTDA 4JQDA 2DA5A 2DMNA 3O8GA 1RPEL 3BR2A 1HDDC 2O9LA 1X2LA 2E2JJ 2OFYA 2KEJA 2GM4A 4DYQA 5IP6A 4EEFG 4X6AJ 3SCFA 2MGQA 2EF8A 3LOCA 5E3LA 1S7EA 2R63A 1JT0A 3VK0A 3JXCL 3GN5A 3S1QJ 1NEQA 1FTZA 1PRUA 2XI8A 5IOZA 2EZIA 1E3OC 5FKOA 3GTMJ 1QVUA 4BBRJ 2L9RA 3S14J 1POUA 3GTKJ 2R1JL 3EUSA 3LSPA 1BDHA 5FKNA 2TRTA 3BQZA 3OSGA 2K40A 4YARA 1I6HJ 3KJXA 2LYLA 3UKGA 4DYCA 2L49A 2KDZA 1IJWC 2L7FP 2B63J 1FTTA 4M3DA 1VI0A 1WCMJ 4DZJA 4M3GA 1QPIA 4FE7A 2ME6A 2JA6J 1JTYA 3WHCA 1TC3C 1R63A 2LYRA 3CROL 3S1MJ 1VNDA 2G0EA 1G2HA 3S1RJ 3G1OA 1FIPA 3FYAA 1RZSA 1JUSA 1RIOA 3SCGA 5J1RA 1OCPA 2ID3A 1JFSA 3GBFA 5JLXA 4MCXA 2CUEA 2JJ7A 2PMZN 2X48A 2LVSA 2Y9ZA 1LFUP 3HZIB 5EYRA 2R5ZA 9ANTA 3ZQCA 4IA8A 4JCYA 4W1UA 5C4XJ 3OSFA 3HKZN 1HLVA 3GTPJ 1QP0A 2JA5J 2GLOA 1AKHB 4IHWA 4ABZA 4YG7B 1GUUA 5FKMA 5EF6A 5EGOB 4F8DA 3LNQA 4HNVA 1LCDA 1QP7A 1PERL 3SFIA 4PU8A 3GN5B 1OFCX 1ZGWA 2HOSA 1MBFA 3B7HA 4MIMA 2LCVA 3GTQJ 4V2GA 4X4HA 2XSDC 3OIOA 2A6CA 3UFDA 2PUCA 2FD5A 2L7ZA 2WV1A 2W48A 3CMYA 1BW5A 1X57A 2PPXA 1LFBA 2NVQJ 4Z58A 3BDNA 1VF9A 4QSHA 3E7LA 3KXAA 1R9TJ 5EZHA 3HBLA 1AKHA 2PUEA 4O8BA 1K61A 5E3NA 2WAQN 2WB1N 1U8BA 2TCTA 2PE5A 3B6AA 3JXBC 1APLC 3BR3A 4XRMA 1PNRA 2IVQA 5FLMJ 4BBSJ 3HOUJ 1IRZA 3ZHMA 3BTCA 1ZPQA 5M5XJ 4Z59A 2VUMJ 3DNVB 4S0HB 1H88C 4J1XA 4JYKA 4YG1A 5IYBJ 3U3WA 2LKXA 3SDGA 1ITYA 2KEKA 1FIAA 2LLKA 5EZGA 1PRVA 4J1WA 3VPRA 1JUPA 5IP9J 4I6ZA 2MEZA 1RZRA 3B6CA 1PRAA 2KT0A 1D5YA 5M5WJ 1MNMC 3TRBA 5GP9A 3R1FA 1O4XA 3ZOBA 1ZK8A 2LYSA 1JUMA 1EF4A 2ME0A 1QQAA 2OF7A 3QYXA 3ZKCA 2DTZA 1QRYA 1VFCA 3IVPA 2CJJA 1YRNB 1WH6A 1XS9A 1POGA 1CJGA 1ETYA 3PO2J 1IG7A 2LYQA 3O8HA 1JT6A 2VKEA 1YRNA 2GZUA 1A6IA 3BTLA 5EEAA 1DW9A 3I4NJ 2PUBA 2DJNA 1Y7YA 2M9HA 2ELKA 1PUFB 3CCYA 4XRSG 3S8QA 1U9NA 3BR5A 4A93J 4MCTA 2LY9A 3LISA 4GHJA 5E3OA 4A3IJ 3Q0VA 1LCCA 3ZQFA 1WH7A 3RZDJ 3S2HJ 3F0CA 1UTXA 4UUTA 1ZS4A 1ETOA 3MKLA 1UMQA 2MSYA 3HOXJ 2PUDA 3JXDL 2ECCA 5K7FA 3RZZA 4B3AA 3OQOA 1ENHA 1QPZA 2WIUB 2E2HJ 3G1MA 3CLCA 1CQTA 4A3MJ 3JRGA 2LK2A 4B1RA 5EDNA 1WETA 3DCFA 3FISA 2O38A 5EG0B 1UG2A 4X4FA 1NERA 2XB5A 2QCOA 3BG5A 2BNMA 3D1NI 2E1OA 2Y31A 1BL0A 3LFPA 2L0KA 1HCRA 4X4EA 4A69C 3A01A 1LE8A 2ECBA 2B5AA 2K9SA 4PU4C 2DA6A 2R92J 2DA2A 3QPLA 3IH3A 3HGYA 1H89C 4MFEA 4GFBA 3GTGJ 2JN6A 3HOVJ 1JWLA 1W0UA 2KZ8A 2K9NA 1XG1A 1Y1WJ 2LR8A 1TWFJ 1RPWA 2PIJA 2CQXA 2FJ1A 1GV2A 3MVPA 4X4BA 3MLFA 4G12A 2XGEA 3A02A 1X2MA 2D5VA 1Q1VA 1F36A 3OMTA 1MBKA 3K7AJ 2R5YB 1B8IA 2CRGA 3TP3A 2R7ZJ 1A5JA 2I10A 1MH4A 1DU6A 5F0FA 4W97A 2JA8J 3HGGA 2VPRA 3TEDA 1B72B 2HXIA 2PUFA 3G5GA 4YG4A 5F0CA 4BKXA 4C2MJ 1OJLA 2JA7J 5F08A 1LLIA 1HDPA 1JH9A 2LTPA 2FX0A 2JMWA 4MO7A 5F27A 1ZUGA 1Z77A 1ZZBA 2XPVA 2CSFA 5EG0A 3OP9A 5IPAA 1MBJA 1DU0A 5GPAA 2IVBA 1T56A 4X4IA 4A3LJ 2AUWA 3IV5A 2AWIA 3IH4A 3RZOJ 4DW6A 1ZR2A 3S2DJ 2EBYA 2PUAA 2LD5A 1P7JA 3SCHA 1ADRA 1ZR4A 4IHYA 1EFAA 1ETVA 5JLWA 3TW6A 4Z5DA 4M3BA 3BS3A 2NVTJ 3F6WA 1IDZA 3JRDA 2DA7A 2DMQA 2COBA 4MLOA 2NS7A 1Y9QA 4DYRA 3K2AA 2LYJA 2L7MP 2FQ4A 1ETXA 3HOWJ 5DS9A 4Z5HA 1W0TA 1ZZCA 1JTXA 4IEJA 2LFBA 1QQBA 3HM5A 3PO3J 4XRSA 1MBHA 2K9QA 3SJMA 3BQYA 4JP0A 3GTOJ 2LYKA 1TWHJ 5F0HA 3LSJA 3TP0A 2P81A 3CECA 2M34A 1ETWA 2R93J 4CYCB 2O49A 4IHXA 1IC8A 2R5YA 1B8IB 4BY1J 2L8NA 3FIWA 2XRLA 4XK4A 2DA3A 3TW7A 2R5ZB 2GRMA 3F52A 1OSLA 1K83J 1XC5A 4XICA 1NK3P 2EH3A 3QPSA 2ZB9A 1WGXA 2M2EA 1NK2P 2Y30A 1ZTRA 4L5EA 1AHDP 4PU3C 2X6OA 1UHSA 1I50J 1JKOC 3LSGA 4M3EA 2NVYJ 4QTRA 4J19A 2XGDA 1P7IA 1JKPC 2AXZA 2DA1A 1MSEC 5IYDJ 2H8RA 2XB0X 5K7ZA 2EQRA 2KPJA 2HOTA 3JRBA 4A3JJ 3LSRA 3JR9A 1SQ8A 1TWCJ 4Y42A 1I3QJ 1Z0XA 1IGNA 5C4JJ 2JVLA 2AXUA 4RDUA 3OQNA 1U9OA 5C3EJ 1BDIA 1LMB3 2EZKA 3CDLA 3QWGA 2NVXJ 1NTCA 4NDWA 1GDTA 3MN2A 2ICPA 4A3GJ 1TWGJ 4D7MA 3M4OJ 3QQAA 5J1UA 4D5CA 2E2IJ 4FE4A 1OCTC 4PU7A 4DZPA 1GT0C 3GTLJ 1ZQ3P 2AHQA 2Y9YA 3Q0WA 1WPKA 4I8TA 2RAEA 1LE8B 2PUGA 3HDDA 3GBGA 1JJ6C 1X58A 2X9DA 4JX5A 4LOCA 4X1EA 4C3HJ 5GPCA 1MH3A 5F04A 2E19A 4D7NA 4FCYA 1YSEA 1QP4A 2BNOA 1RR7A 3A01B 2XPUA 3FMYA 2M8GX 1B0NA 4UUSA 4FBIA 2VKVA 1RKWA 1WH8A 2DMUA 5A7LA 2OR1L 3BTJA 2CUFA 2DN0A 2IUOA 3WHBA 3BR0A 2GBYA 3FKIJ 3L1PA 4JX4A 2IVGA 2ID6A 2DMTA 2HYJA 3JRHA 4V2FA 1JKRC 4YBAA 4X4CA 1JFTA 1B72A 2H1KA 2KEIA 2O8KA 4RBOA 1WH5A 2EZLA 3CQZJ 4FTHA 1SFOJ 2EBIA 2NS8A 2IU7A 2XGCA 2O7OA 4QIWN 2CROA 1HOMA 2Y0SN 3H5TA 4CYCA 1X2NA 3JREA 2AXVA 2R0QC 1R69A 2AW6A 3BG9A 3NAUA 5FKKA 5IYCJ 1ZZ9A 2XJ3A 3G7DA 1IDYA 2NOGA 3BR1A 1L1MA 2BJCA 5M3FJ 1H8AC 1UXDA 1Y1VJ 5J3LA 2WUSR 3KZ3A 3ZQGA 4I6TA 1ZAYA 1GV5A 2QF7A 1ETKA 3JRFA 3HEFA 2MG4A 2Y2ZA 4A3CJ 1MBEA 2IBDA 5FLVA 2HQ5A 1TWAJ 4Z5CA 2M0CA 3QQ6A 4AC0A 2YU9J 2HINA 3OOUA 4UUSB 3OQMA 1GVDA 5IP7J 2DMPA 5K98B 1IUFA 3PM1A 4A3KJ 4NDLA 3HOYJ 5K7HA 1BJZA 1ZKGA 3BTIA 3DEWA 5FJ8J 2XIUA 4A3FJ 2JCGA 1IV6A 4AYBN 1ETQA 2HSGA 4X4DA 1RKTA 5E3MA 2LP0A 1WI3A 3A03A
chains in the Genus database with same CATH superfamily
2BBYA 4Y52J 1Z1DA 4IHVA 2XSJC 1ON1A 4I02A 4XRFA 1VQMI 1G3WA 4A3EJ 3DBHB 3GZ5A 2XF7A 5CVVA 3F22A 2DFEA 1I6XA 2JK3A 3KE2A 1BIBA 5D6FA 1HF0A 2JTVA 1ORKA 2J5PA 2HXOA 3P9IA 4HBLA 3PUFA 2LBFB 3OS2A 3PXPA 3ZQLA 1VPWA 3QF3A 3JSOA 1R6RA 2OUMA 4HDUA 4HOBA 4CCJA 1LB2A 2X6YA 1K79A 3CCSI 4I6UA 2IJLA 4AD9A 4DE9A 1L3LA 3KPHA 3FMQA 3OYHA 3WGGA 2MW8A 3ZHIA 3E6DA 3F8BA 4F92B 4G9YA 4EGYA 3RKQA 1G4DA 3S17J 2HOAA 1G3SA 3I3LA 4OINF 2EZHA 1RUNA 2VB6A 2IV1A 1FLIA 2MH9A 3CCUI 1MSFC 1PYVA 2CQQA 2EFNA 3RQIA 1LQCA 4WX9A 1OCZH 2XAHA 4BNCA 4B4CA 1KU7A 3TL4X 4XQFA 2M45A 2ZCWA 4OMZA 4B48A 3LFKA 4L0YB 2H8WA 2A6HF 5DTQA 1JGGA 1K6OA 1WJCA 2VQGA 3TGNA 2QUFA 3A1YA 2LG4A 2CMPA 5HODA 1LEAA 2JUGA 2XPWA 1O3QA 3Q0UA 1T98A 2RN7A 3Q3SA 3ZMDA 4MTDA 1U2ZA 3W6VA 4LITA 2Q8KA 4PGGA 1J75A 4AUXA 4R8HA 2PXUA 5L3EA 2DA5A 2XGXA 2K9MA 3E5UA 2OFYA 1XTAA 2E2JJ 1WHUA 4DYQA 4X6AJ 1TL8A 1UFMA 2MGQA 2DQLA 4KT5C 3HXLA 3JXCL 1OLTA 3GN5A 1K6YA 2XI8A 4LD5A 5LHHA 2BY1A 3GTMJ 3OYMA 1FOKA 3S14J 4LLLA 3GTKJ 1IXRC 1IN6A 1BDHA 5FKNA 1P4WA 2LMDA 2V9PA 4PFOA 2ZNYA 4YARA 3QP6A 2DOEA 3CCQI 3QP5A 3ZCOA 4DYCA 3UKGA 3CTAA 4F93B 2B63J 1FTTA 1WCMJ 1X19A 4WXCA 2IGMA 1WZ2A 5ERIA 4FE7A 1QPIA 2LYRA 3GWZA 3H9JA 4E7SA 1TC3C 1ZH5A 2Z9OA 3S1RJ 2GXGA 4HRIA 3IAM2 4PCQA 1W7PA 2PJRA 1JFSA 2A5WA 1CF7B 1HW2A 5GAHi 1ON2A 2DFIA 2M1BA 2X48A 2LVSA 4B47A 1IRGA 5EYRA 3UR3C 2ZJRF 5E1ZB 3OSFA 1A6QA 3HKZN 2FU4A 4BQNA 3P7NA 1AKHB 4IHWA 1ZRDA 2K5CA 3CC2I 2GA2A 4YG7B 1S6LA 5KAIC 2W24A 1DPUA 1FT9A 1XGSA 1TQMA 1V3FA 3L2QA 4RGSA 4II2A 2F5VA 3OY9A 1X1PA 5CQGA 1OFCX 4CCLA 1MBFA 1H0MA 4MIMA 1IO2A 3GTQJ 1QGPA 2DLLA 4KICA 3ROUA 5J8FA 2XSDC 4X4HA 2IA2A 3BZ6A 1JXSA 2OQGA 2L7ZA 1WJFA 4UVCA 2WV1A 2HGCA 2XASA 4CSWA 1HC8A 2GQQA 3RSNA 1X57A 1ZYRF 4LFUA 5EJCA 1VF9A 3AG2H 1W7PB 3E7LA 3IKTA 3H35A 2E7XA 3KLOA 5DV5A 2WAQN 4KN4X 2WB1N 2DYSH 3JXBC 3BR3A 3P9CA 3MMYB 5FLMJ 3LA7A 2IVQA 1V5GA 4KFCA 1IRZA 2A3SA 4NNJA 5HLTA 3TFLA 2M30A 4Y17A 4S0HB 4J1XA 4XKVA 2BZTA 1FNNA 3BLYA 2LKXA 1YS7A 2EINH 3DEEA 2LLKA 1Z7UA 1TT0A 3VPRA 2MEZA 4I6ZA 3FHZA 1RZRA 1G6NA 3B6CA 2DPDA 1S5LC 3X2QH 1D5YA 3R6SA 1MNMC 2R4GA 5F64A 3K1PA 2R7UA 1HXDA 3KYCB 4XLFA 4RB1A 2XAFA 1O4XA 3HYIA 3RYRA 4M74A 3AAFA 2ZJPF 4BE2A 2HVRA 1UHWA 2K27A 4IVNA 3DPUA 4NBQA 1EF4A 2ME0A 1QQAA 1RC9A 3IRQA 1RRJA 2EFWA 2W25A 1BI1A 1QRYA 4CH7A 2CJJA 1XSXA 2IGNA 1VQLI 3I9V2 5H20A 4I0BA 4OAYA 2IW5A 1CJGA 2XDVA 3CMEI 4PSWA 3E0JB 1JT6A 1YW8A 5K1YA 5J6XA 2RNJA 1J2XA 1IF1A 1WVRA 2DJNA 4R1HA 4IHSA 4IQ4A 1Y7YA 2QQAA 2X51A 2FA5A 5E20A 1PUFB 2ELJA 3G73A 3DF8A 5JR3A 3WTVC 1U9NA 1QO0D 3LISA 2UXXA 1B1BA 3QPHA 4LMYA 3Q0VA 3CZ6A 1YX5A 1LCCA 4PDKA 2HFHA 2WB1A 2ZNZA 2CW0F 4NC7A 3ELKA 4LIVA 1EKEA 3TKYA 3MZYA 2JQ7A 3SQNA 3I59B 3RZZA 3G1MA 3FXUA 3ERMA 2KHMA 1R1VA 1IW7F 3RIRA 3FXMA 3QOXA 3PFIA 3CJTB 1J09A 2E5ZA 3JRGA 4A0XA 2LK2A 1LDJA 2HDCA 4B1RA 1WETA 2E36A 1D0YA 1MNEA 4IRIA 4XNFA 3OS0A 2RGVA 3LQXA 4X4FA 3F6VA 2BNMA 3BG5A 3WTUC 2B9SA 2IA1A 3FZVA 2QQ8A 2L0KA 3A01A 1LPQA 3SDBA 2YX4A 1SC7A 4R79A 3AL0B 4PU4C 4MHGA 3CLQA 2QGUA 3L2WA 3IC7A 4WXDA 5TRDA 2IS4A 2EFQA 3VWBA 3HOVJ 1Y0NA 2L9NA 3T0YA 4CUGA 4B8XA 4Q4ZF 2VOPA 5CYVA 1REPC 1XG1A 2OV7A 3PNVA 4E6KG 1TWFJ 1Y1WJ 3A9ZA 2CQXA 4HW0A 4XLNF 4E7IA 4XSZF 5A2QK 2D5VA 1X2MA 4AIDA 1BIAA 1Q1VA 2FNAA 1F36A 2L9SA 3CJNA 3NQOA 5DCFA 4BJTA 4QLCU 3OMTA 2CRGA 1A5JA 1MH4A 1YIOA 2F4OB 3R0AA 3E3VA 4HLYA 1DU6A 3FDYA 4N4OB 3QOPA 5KHDA 2KLOA 1LNWA 3DQVC 3K4CA 5L3GA 4ANJA 3G5GA 3TDUC 4ESFA 4CZCA 2PMHA 1QBJA 3DBRB 5F27A 1ZUGA 4HV5A 4ZDPA 2BV6A 2CSFA 4XKCA 1BI0A 4UY8I 4B43A 2EIMH 3F21A 2JT1A 5GAEJ 2AUWA 1IV8A 3ESWB 1XD7A 2IPQX 3EYYA 1VQ8I 4X4IA 3TQNA 3IH4A 3RZOJ 4DW6A 1ZR2A 2EBYA 2DK8A 1ZRFA 3SCHA 3CUQA 3HG9A 4A6EA 3NROA 2XKOA 2P6SA 3BS3A 4G8XA 4DYRA 3WODF 4KMUX 3KCCA 1NHAA 1WJ5A 2LYJA 3HOWJ 5DS9A 4Z5HA 1JTXA 1QQIA 1R1UA 3ASOH 5IT9Z 3RCOA 2PXEA 2A5YB 3SJMA 2PBIA 4JQFA 4G94A 4ENKA 5GAHJ 1T39A 3TP0A 1Y8RB 2P81A 4YEJA 4XLAA 3CECA 3HRSA 3MD2A 3MQ0A 4CYCB 1B8IB 1O57A 4BQOA 1IN5A 3OMYA 5E18F 3LSIA 3DP7A 3ZQQA 2MABA 2ZB9A 2XHKA 3KEOA 1QA6A 5E1XA 2DTRA 3H5NA 1H9TA 2XGDA 2F5EA 1W4MA 3OYBA 2VQHA 2F5FA 3DEUA 2H8RA 5IYDJ 2XB0X 2KPJA 2EQRA 2HOTA 3VEPA 2P7CB 3IHUA 2IP2A 3AFHA 3RDIA 4AVZA 4A3JJ 1TWCJ 2EIJH 4U88A 3V8LA 3L2RA 3HUGA 4IOAF 2VJ5A 3CCRI 1IGNA 2KKOA 5FFZA 3OYNA 2AXUA 1R36A 2X0LA 3OWQA 1D3YA 4LIUA 1LMB3 2EZKA 1NTCA 1FC3A 3EUHA 1GDTA 3L9FA 2QLZA 3FXOA 1P6RA 2HFZA 4A3GJ 1MD0A 1ZAOA 2E2IJ 5H6QA 3GFIA 4L5JA 4AIJA 1BOBA 3GTLJ 2VJJA 3Q0WA 1WPKA 2AS5F 3OL4A 1VQ4I 3GO5A 5HDGA 5JHFA 3H3ZA 1LE8B 2E1CA 1UCRA 2KRFA 3LSHA 3QWLA 1QPMA 1X58A 3B73A 1SD7A 2X9DA 1DGRM 4G6DA 4X1EA 5JI6A 1E2XA 1MMGA 5HOOA 2E19A 3IV5A 3F23A 3AG1H 3VODA 2BNOA 1RR7A 1B4AA 3O2PE 2GXBA 4RAFA 1V54H 3LSTA 3GZCA 1BM9A 1FX7A 4LJZF 4ETSA 2ZJQF 4OAZA 1N25A 1WH8A 4FBIA 4DE8A 3BTJA 1FOXA 4FASD 3OYJA 3RQ4A 4JX4A 2DMTA 2HYJA 2LF8A 2MYSA 1B72A 2KEIA 4RMNA 1WH5A 2M0MA 2UUZA 2EZLA 3KZYA 5DYMA 3VYTB 4FTHA 2BHYA 4ZZLA 3F9KA 3QOEA 2O7OA 4QIWN 1HOMA 3BOQA 1MKMA 2BYVE 3H5TA 4XLHA 4CYCA 1TP4A 5L3DA 4BACA 3JAMK 3E6BA 2L7KA 2AW6A 1W5TA 3BG9A 3NAUA 2BE5F 3TELA 1FBSA 4LG0B 1IDYA 3PQKA 3M9LA 3PSFA 5M3FJ 1R1TA 2A61A 1Y1VJ 2LNMA 4I99C 3JRFA 3HEFA 4EJOA 2DFFA 5HNFA 3ZMVA 3RKYA 3TEPA 4KYWA 3OYKA 3ABUA 1I1GA 3KFWX 2Y0SA 1Z67A 2E1MC 2F48A 2L4AA 3BCAA 3WTZA 1N77A 3SR4A 1PDNC 1IUFA 3CC4I 3GVAA 3PJRA 1L0OC 2L2OA 1IN4A 2ADUA 2W4SA 1KONA 3L7WA 4XKWA 5DDGA 1RR8C 4IQJA 3HOYJ 2G9WA 1U5TB 2J5OA 3DEWA 1UZCA 2BY2A 1LEBA 2HSGA 1ETQA 4X4DA 3ML6A 2R7RA 2L5QA 5FO5A 1MZBA 3ZMUA 1VQ9I 3P5JA 1LVKA 5GAGJ 4IRHA 5D5XB 3TDZC 3ZQHA 4L18B 2BY0A 3M7GA 3U2RA 1YFHA 3EUAA 4C3IJ 2NS0A 1KZHA 3U1DA 2FJRA 3H3VK 2IT0A 1S7AA 2QENA 5DEQA 5FKLA 3SZGA 4UUVA 1X3ZB 2EA2A 3BZCA 2HCNA 2Q2EB 3BT9A 2LRDA 3HOZJ 4ITVA 1SD4A 1MMSA 2VODA 1QZYA 4I7HA 2JSCA 3PFYA 4EJWA 1GXPA 3I0TA 3OR1C 2PFBA 2HEOA 3EUHC 2CQNA 4I76A 5J1YA 3H36A 4DIQA 5DTMA 2NYXA 2STWA 4JK1X 2DQRA 2LOOA 1XDSA 4I6RA 5C44J 2PI0A 4GCVA 3RTRA 4HQMA 2QSFX 1P9QC 1ZG3A 1SANA 4LK0F 2E34A 2YX7A 5M5YJ 3J81Z 4LB6B 1LQ1A 1ZVVA 5CVUA 3FXLA 3IKVA 1Z7LA 2AQFA 5DD4A 3CF2A 2W7NA 4P55A 4AYBA 4P9FA 3JRAA 1QZXA 3HRTA 4J00A 4KJZA 3JCUC 4ER5A 2AO9A 4X4GA 2Z2SB 2WY7Q 1TQIA 2K02A 4MFDA 1T33A 4BY7J 5FGMA 1U5TA 2XAJA 4I01A 1UXCA 3FK6A 4XLEA 1AWCA 3HIFA 4EJUA 4K2EA 2JPBA 5BNGA 3KYDB 3LQRA 4FISA 3COAC 1F43A 2Y0MA 4XOPA 4D0PA 1O7LA 2OU2A 3MKZA 1QVTA 1YE9A 3HTUA 1AU7A 1ZZ8A 3RPUA 1WJEA 4MQVA 2BXZA 2F4MB 2P8TA 5IY5H 2ICTA 1PUFA 1KGSA 3TO9A 3CUQB 3ASNH 3MKWB 5J4VA 2BNNA 2JA2A 5DTDA 3OYFA 1T0FC 2DYRH 1SD6A 2XROA 2HR3A 1MMAA 2O9LA 2OCCH 3KETA 3PL8A 3OYEA 5E3LA 4EJTA 2EF8A 3M1EA 1S7EA 1RIOH 1U0JA 3S1QJ 5DRYA 1FTZA 1PRUA 5LRRA 2VKHA 5E1WA 5IOZA 1E3OC 4IX7A 1KU9A 1BR1A 1QVUA 4BBRJ 2BY3A 2LLWA 3FXQA 4C2UA 3EUSA 3EETA 1R23A 3BP8A 2TRTA 4BUPA 3BQZA 5BMZA 3R09A 2K40A 4C9YA 4MQ9F 1ZHFA 3E1SA 4AVPA 4CA0A 5LEKA 2QM3A 3GEZA 1LKXA 2XIGA 2KDZA 1I1SA 3K4KA 4DZJA 2VQLA 5KNLA 2DXIA 4II3A 2JZYA 2ME6A 5L3FA 2M4KA 4WK8F 3CROL 4A5MA 1HSJA 3DTEA 4PGHA 1FIPA 5K5RA 3MWMA 3ZGKA 1SFUA 5CQEA 3SCGA 5J1RA 2OD5A 3ABLH 2FOKA 3GBFA 5FFXA 5BS6A 3CC7I 2DFHA 4BDZA 1R71A 4W1UA 3V4GA 1QP0A 1DULA 2GLOA 4XN3A 3CJQB 2IRFG 5CLSA 5CKTA 3K9TA 4V19K 1GUUA 2ZC2A 4WF2A 4ZC3A 2RC4A 5EF6A 4XL9A 5EGOB 4F8DA 2O0YA 4HX7A 4RB2C 3CUOA 1D1CA 4IRGA 4U7BA 4RGXA 4RM3A 5JVTA 3KP6A 3SFIA 4PU8A 1I3AA 1ZGWA 3OKZA 2F5DA 2MH2A 2M5WA 3H5AA 5E79C 3N97A 2HDWA 3OIOA 3K4MA 1MFQC 4RAYA 1A35A 2EB7A 1X1DA 4XBFA 5E8IA 1LFBA 4EV0A 5FLXZ 2NVQJ 3RYPA 3KXAA 4DOZA 1R9TJ 2R3SA 4F55A 1AKHA 4BH9A 5ICEA 4O8BA 2QWWA 2HVQA 1X1AA 4ASNA 4PJ0C 2TCTA 3N05A 3B6AA 4HF0A 1RZ4A 3W2AA 3WG7H 1YITI 2W85A 1CF7A 3HPGA 5D4SA 3WG9A 3H0DA 2W00A 1HQ1A 1BBYA 3FXRA 1MJAA 4Z59A 3DNVB 4M9SA 4B3XA 4H0EA 5D4RA 4L9NA 3DV8A 2OC6A 1QZEA 3ECOA 4IL6C 1BI3A 1S3JA 4BEHB 1FY7A 4RM2A 3SDGA 4DJAA 3CCMI 1O3SA 1F5TA 1ITYA 2KEKA 5EZGA 4U87A 3M9AA 4PFPA 2QEXI 1PRAA 5M5WJ 3L2VA 1IUYA 3A9YA 1O3TA 3ZOBA 1ZK8A 5GADJ 2VBXA 1PVEA 2V9VA 3BG7A 1VQ7I 3BCBA 1VQNI 2JVGA 2OF7A 1CGPA 1OQYA 3D5RC 4M6YA 1XMAA 2QKMB 1WJAA 2DTZA 3ZKCA 4IXAA 3IVPA 2H6BA 4I2OA 1YRNB 1WH6A 3J7AO 1XS9A 3PO2J 1QZZA 1KQ0A 2L01A 2VKEA 5CVIA 5EEAA 2PUBA 2BOLA 2ELKA 2QVOA 3BZKA 1F9NA 2DBBA 2NNNA 1IZ1A 3I56I 4E7KA 1YW9A 3IUOA 2F6CA 3CDHA 4A3IJ 1RNLA 3ZRGA 4ER7A 3F0CA 4EGZA 1ETOA 2JUCA 4GO1A 5LD2C 3HOXJ 2CV2A 3JXDL 3S3OA 3KP5A 2XAQA 2OCEA 1BOAA 1QPZA 4RAGA 3FXJA 2RNGA 4IKFA 3EYIA 2ZXJA 1EH6A 3CDIA 1CQTA 4A3MJ 2VIXA 4UB8C 1C0WA 5JVGF 5FD5A 5EDNA 5J8CA 3CD6I 1Z21A 3P9KA 3DCFA 1DP3A 2HPIA 1FP1D 4WCGA 1LVAA 2FFHA 1R4MB 2E1OA 4UNOA 2B5AA 2W84A 2K9SA 3OS1A 2H1LA 1SFKA 2DA2A 5B1AH 3OYGA 3F6OA 3IH3A 4BE0A 1EA3A 3I4PA 1PUEE 4GFBA 2JN6A 3GTGJ 3S32A 3CJRB 2LR8A 2PIJA 1YS6A 2O6GE 2D1VA 2FJ1A 3MLFA 4M9XA 3U9GA 2HZDA 2RVCA 3ZXSA 2A68F 4XONA 2Z3YA 1X4PA 3KP7A 2BXYA 1R00A 1W7PD 3IWFA 1NG6A 2JA8J 2E1MB 2VPRA 1MNDA 3HGGA 3TEDA 1SEUA 2VBZA 4ENMA 1TNTA 2LREA 4CO8A 4HDVA 3A9XA 1H9GA 4YG4A 3A0BC 3C2HA 4HV6A 2WAEA 1B9NA 5F0CA 4C2MJ 1OJLA 5DUKA 1W36C 1SMTA 1D8KA 2B0LA 4Y33A 5F08A 1LLIA 1HDPA 3R0JA 1MW7A 2LTPA 1V4RA 3F8MA 5IT3A 2ZMEB 2CV0A 2JMWA 1RUOA 2BEOA 3EUKL 1ZZBA 2XPVA 3VOEA 3K0LA 1O7FA 3HPHA 1VTNC 3OP9A 2KIFA 2LKPA 1DQUA 3ABKH 2E7WA 2YPRA 1JGSA 5JHUA 5GPAA 3PE5A 2PXLA 3FMRA 2WC2A 5HS9A 1J5YA 1XN7A 4AM3A 1OCRH 4A2UA 4A3LJ 3M8EA 2AWIA 4RGUA 1SFEA 2RDPA 2P4WA 1KYWA 1ADRA 2Y69H 5LLQA 3QU3A 5ILUA 1X3WB 1ERDA 1EFAA 5JFRA 1SVLA 3EPZA 4P9UA 4D9JA 5DUIA 2DODA 2V1XA 3JRDA 2YSRA 2VN2A 2NS7A 3L09A 2FQ4A 2LFBA 3RKXA 5ILVA 1QQBA 2PMZA 2KZVA 2K3FA 2K9QA 3QYEA 2PXQA 1Z6RA 2Y48A 4RB3C 3IWZA 2LYKA 1TWHJ 3ULQB 1BR2A 1TZLA 3G3ZA 1FP2A 3CMAI 3KP4A 2ZSHB 3C3WA 2HU9A 2CV1A 3K1MA 1K4SA 4BY1J 2H27A 3K1NA 3LMMA 3FIWA 4HX8A 4F7ZA 3F52A 3C2GA 4YIFA 4QPQA 1SD5A 4XICA 2E5NA 1TNSA 1NK3P 1RI7A 3V7SA 3QPSA 2M2EA 3ZMSA 2Y30A 1ZTRA 4WXHA 4I98B 5KCMA 3GFLA 1Y39A 2M87A 4O5VA 2PLYA 4M3EA 4QTRA 3PNYA 5HNHA 5GTHC 3QYFA 1P7IA 2BW3B 3RPQA 1R58A 1MSEC 3W3CA 4N4NB 2P0WA 3LSRA 3JR9A 4BHPA 2IS6A 1T08B 3T8TA 4UVAA 3V7CA 3KP3A 3OV8A 1T6SA 1Z0XA 2JVLA 4IHTA 4NQWA 3CCVI 1J7KA 4BDYA 5C3EJ 1BDIA 1YYVA 4DNCA 2NVXJ 3H92A 3MN2A 1F1ZA 4BAYA 3REOA 2ICPA 5HLGA 1XSDA 2VBWA 3QQAA 5LBQA 5J1UA 2KRCA 4D5CA 4FE4A 1U6GA 2H6CA 2HNHA 3BG6A 1HA8A 2IGOA 2ZBKA 4PU7A 2ESHA 3DBLB 2LLVA 2V26A 2WAFA 4OU0A 4XKBA 2EFOA 3ZMZA 4C3HJ 3HSEA 1MH3A 2H09A 4D7NA 2L4MA 3A01B 2XPUA 3LSMA 2XF5A 2M8GX 5JUWA 1B0NA 3G2BA 2V4JC 2DMUA 4H4KC 2PQ8A 1SAXA 2OR1L 2CUFA 1XMKA 2J7WA 3WHBA 1AOYA 2XVCA 2M7AA 3L1PA 3K10A 4CZZA 4PSXA 3JRHA 4V2FA 3CCJI 3BJAA 4HNTA 3C7JA 2O8KA 2CQKA 2GIVA 4ZYAA 2EV0A 1KYZA 2X1CA 1SFOJ 5DT2A 2R7TA 3FM5A 3K4BA 2Y0SN 2KRHA 5DM7F 1X2NA 2P6TA 1Z9CA 2FQ3A 2XJ3A 3BR1A 2HCSA 2XXAA 3J7YJ 3Q9SA 3ZN0A 1H8AC 3KZ3A 3MZ8A 3NWSA 3LA2A 4M71A 2V1NA 4FHTA 4N0BA 2MG4A 2Y2ZA 3DWLE 4FQGA 2H94A 3V42A 3A0HC 2FOWA 2LC2A 4O3MA 3SEZA 3LA3A 4UV9A 2QBYA 3ONQA 4AC0A 1EH7A 2HINA 3G6EI 3KLNA 4UUSB 4HF1A 1MJBA 2DMPA 5IP7J 2VE9A 5K98B 1YJWI 5FRNA 4MGRA 2A6TA 2JRMA 4NUBA 2IXSA 4A3KJ 2VXDA 4P1WA 2ZMEC 3WTYC 2CO5A 2LNBA 5FJ8J 3TO7A 1IV6A 2OJED 1MGTA 2KL4A 2DK5A 2Z99A 3HOTA 1WI3A 3GXOA 3A03A 4XR6A 1B6AA 2P5VA 2Y75A 2VONA 1WIZA 2HQRA 1S29A 3H1CA 4C30A 2ZKZA 3ZMTA 1TT5B 1YHQI 2R7FA 1YOVB 3CCLI 1XWRA 3ME5A 5F1JA 1XSVA 3SEQA 3K70D 2MQKA 4E7ZA 4M9ZA 3W6KB 3AG4H 5EGOA 3JRCA 5HLIA 3WU1B 1FJLA 1ULYA 1BW6A 2HYFA 4OWRB 1G3YA 5LGNA 2JWTA 1TW3A 2MC3A 4EVIA 3DU5A 1RESA 4YFKF 1ZZ6A 2VI6A 1RZRD 2KPMA 3OIQA 4A3BJ 3NARA 3GTJJ 1OISA 4ZYGA 2DT6A 4M6VA 5ED4A 1D8JA 1T95A 1EH8A 4ZYHA 4GQMA 3G1LA 3V7RA 2HKXA 3Q9VA 2FBIA 2DAOA 3SX0A 2IS2A 1RETA 4BXXJ 4X0GA 2EWTA 1GLNA 2KJBA 2R7WA 4IVZA 4F91B 5IT9K 2YS9A 2LY2A 5CPRB 4ZYDA 2CFXA 4HAMA 3VYRB 1VQKI 3C1DA 4LG3A 2DW4A 5DCMB 3OYDA 5FRMA 3H0GJ 3BJ6A 4Y7NJ 2VE8A 3FF5A 4U0YA 2HQAA 3BD1A 4FT8A 1MDMB 2CUJA 1KU3A 2QSGX 4A12A 1ZN2A 4FX4A 3OOPA 2AXTC 4XIDA 4ZTJA 1D1AA 3L2CA 4IOCF 2XCJA 5IOYA 3WTSC 3CF5F 1Z3XA 3DXJF 2VC1A 2O4AA 2HI3A 1S7OA 3HB9A 3ZQIA 2DA4A 4JQDA 2DMNA 2DO7A 4XN0A 1P4XA 4RS8A 1XMXA 2XAGA 1ZREA 1X2LA 2KEJA 3WU2C 3BPXA 2GM4A 3SCFA 5IP6A 4EEFG 3MCZA 5DSXA 2TDXA 4RB0A 4DBRA 2WA0A 2MFZA 2R63A 3EDPA 1JT0A 3FBNB 3GFMA 4YG2F 4KISA 1NEQA 5LGUA 1N75A 2OAZA 1DP7P 2L9RA 1POUA 3E97A 3FHNA 3DU6A 3OSGA 2K85A 3VDXA 2R7OA 1I6HJ 5B1BH 3KJXA 2CFOA 3BWGA 2LYLA 4GYIA 4M3DA 1VI0A 1Y6IA 4HLXA 1WWXA 3ABMH 4M3GA 1D1BA 2JA6J 5LRSA 3WHCA 3J7AY 1R63A 2VJ4A 4IPAA 5FLXK 1E3HA 2M3AA 5GAGi 2PXDA 3G1OA 2HWVA 3WGIA 5BPDA 1RZSA 3FYAA 3QPTA 1TTYA 2XUBA 4PJLA 1PP7U 1I27A 1ZLKA 2GXAA 1LDDA 4BJ6C 2JJ7A 2PMZN 1LFUP 2OTLI 3HZIB 2R5ZA 1JHHA 4BHBA 9ANTA 1USSA 5F1RA 3ZQCA 1VQPI 2R7VA 4IA8A 4JCYA 5C4XJ 4CYDA 1HLVA 1OKRA 5DM6F 3GTPJ 1NH3A 1U5TC 3GCMA 4HQEA 1GHCA 4BXUA 5FKMA 2DT7B 3AG3H 4IO9F 1OYWA 1YI2I 3ABTA 4HNVA 1LCDA 1QP7A 1PERL 3CESA 2ELHA 3CMMA 3FWEA 2XV4S 4ER3A 1KA8A 4EQZA 4P96A 3M07A 4UXNA 1J0RA 4RLQA 2HOSA 2JVHA 4EKIA 4ZJZA 2LCVA 4OIRF 3W2WA 4U0WA 1Z91A 2HVSA 2A6CA 4Q2JA 3UFDA 2W48A 3O6BB 4ZDLA 3A2KA 1USTA 2I5UA 1HW5A 1BW5A 2DI3A 3DKYA 3SHFA 4KT6A 5EEGA 2A05A 2XF6A 3S3MA 4QSHA 3MEXA 3OIPA 1K78A 3ECHA 2VL8A 3HBLA 1MMDA 1I5ZA 4RA2A 2O03A 1Y8QB 4NB5A 4XM3A 4BQAA 4CXFA 5E3NA 1U8BA 2Q0OA 1APLC 2PXVA 3W6JB 2D2WA 4XRMA 4YIRX 1PNRA 2KIMA 3RJPA 4BBSJ 3I5UA 3BTCA 3CLOA 3WTXC 1H88C 3FM3A 3KEYA 4YG1A 3U3WA 1W1WE 2BVLA 4HG2A 4BS9A 2WV0A 4J1WA 1JUPA 5IP9J 4UB6C 3SYTA 5K5QA 5GP9A 3TRBA 3R1FA 3F3XA 3RI4A 4IF4A 2LYSA 3HZJA 1ZG1A 2NXNB 1S8NA 1JUMA 4TV7A 3DM5A 5FROA 2CWEA 2ACJA 2ISZA 2K7LA 3QYXA 4M72A 2O61A 4QPOA 4CDGA 3WTTC 3NEUA 3CUQC 2E35A 4GRIA 1ETYA 1ZGAA 1IG7A 3GF2A 2CQ7A 1FWZA 3O8HA 4YIIA 4BE1A 2R7QA 1YIJI 5TISC 1DW9A 3I4NJ 1UHMA 2WAQA 2WY8Q 4PJNA 4BXFA 2L3DA 2M9HA 3D5LA 3CCYA 2MLGA 4XRSG 3K4JA 3S8QA 3DKWA 3BR5A 4KMFA 2LY9A 2OZUA 2X6XA 3ISPA 5KK1A 4GHJA 2GWRA 2PXFA 3ZQFA 1X4OA 3S2HJ 2VJIA 3MKLA 2EK5A 1UMQA 2MSYA 2ECCA 5K7FA 1VQ5I 3LQQA 4B3AA 4DGWB 3TOBA 3OQOA 4BYYA 4EQQA 4BL0B 4E7JA 1TW2A 4NHJA 2ZFWA 3TOAA 3KYLA 3CLCA 3WE3A 1XCVA 2DDBA 1XB4A 5H6RA 2UV1A 3GX4X 2Z1DA 1F4KA 2D45A 3WGHA 1XGOA 4HPQA 5D8KB 1YO5C 1T8IA 5EG0B 1UG2A 3MKYB 3CP8A 1E3PA 2XB5A 2QCOA 3JW4A 1HKQA 1YG2A 2Y31A 2YR2A 1PJRA 1FOWA 2A6EF 1BL0A 4A69C 2CSOA 2CGPA 2JRTA 4EMSA 2EV6A 3OWTA 1YJNI 2V1UA 3CCEI 2DA6A 2R92J 4YELA 2FF4A 1JWLA 3HGYA 1H89C 3QRFF 5L3CA 4G7HF 1W0UA 2K9NA 2KFDA 1SFXA 5CVRA 1NW3A 3HKZA 3MVPA 1GV2A 1I39A 1ZELA 4HX4A 3A02A 4G12A 3TO6A 2VXZA 2ZO4A 1B8IA 3TP3A 5F0FA 3T5XA 2QQBA 4BU2A 1B72B 2B7EA 5LGTA 4L9TA 2QSHX 2PUFA 4EM1A 4A0ZA 1BC7C 4KN7X 3OL3A 3PIOF 4BKXA 1HSTA 5AIPA 1WKMA 2PXBA 4PJMA 3U1KA 1Z77A 4AU7A 2L54A 3HSRA 5B5EC 2VQCA 5EG0A 5IPAA 1JHFA 3VYUB 2VT2A 1T56A 2VC0A 2FNPA 2NVUB 4EATA 5LHIA 2IVMA 3S2DJ 2JSPA 1GVJA 1VZ0A 4L9VA 2LD5A 2PUAA 3SFZA 2NRAC 2KP6A 5J4YA 4IHYA 1BN5A 3I55I 1ETVA 1DPRA 2K9LA 2M7BA 3TW6A 4M3BA 4Z5DA 2V3CC 1IDZA 4JBAA 2DA7A 4RGRA 2COBA 1UELB 4MLOA 1Y9QA 3K2AA 2V6CA 3TMOA 2L7MP 3DLAA 2ESNA 3QAHA 1ETXA 4U0VA 1W0TA 3JSPA 4IEJA 4AIHA 1ZZCA 3HM5A 3PO3J 4XRSA 4LLGF 1FSEA 4WWCA 2WBMA 3BQYA 4JP0A 4CCMA 1XCBA 4HYEA 5F0HA 3I59A 3LSJA 5FD6A 2PXKA 2HTSA 4FX0A 4ON0A 3OYLA 2R93J 2O49A 4IHXA 4E4HA 1IC8A 2MC4A 3EQLF 1DUXC 2L8NA 3O3KA 2K86A 2XRLA 1SAUA 3TW7A 2GRMA 2M4HA 3S93A 2L1PA 1XC5A 1BC8C 2A07F 2FXAA 2K3PA 2YBDA 4AWXB 4CCKA 3H5RA 4L5EA 2DOFA 1D0ZA 1UHSA 1V5FA 1KU2A 1R5ID 4YFXF 5D5VB 4J19A 2XXPA 5ICGA 1WJBA 1SMYF 2AQEA 2DA1A 3BROA 2KDOA 5K7ZA 1J59A 2QBYB 3ZPXA 2QYOA 2CH0A 1I3QJ 4RLFA 1V55H 5FB2A 3FKJA 3IP4B 5C4JJ 1MMNA 4JOMA 1U8RA 3OQNA 3I54A 5D5UB 3FXKA 2O8XA 3CDLA 4XLPF 1K7AA 5DCMA 5AONA 3G71I 3HRMA 4LB5A 1TWGJ 1LDKB 3D5SC 2UWMA 1OCTC 3N4MA 1Z3YA 2ZSIB 1KQ9A 4B44A 1GT0C 1SVMA 4EK9A 3E5QA 4BGDA 4I8TA 2PXPA 2GIZA 3JTGA 1R5HA 3BY6A 4ESJA 1JJ6C 4JX5A 1G8XA 1B59A 5F04A 1R5GA 3LSKA 2CUZA 4FCYA 1YSEA 3GUUA 2BGCA 1WFXA 3DFGA 3HOSA 5E17F 2FUG2 1G3TA 2VKVA 1RKWA 1LUJB 2IUOA 2WWYA 5J40A 3AKZA 3RKWA 1A36A 1ZRCA 2VOOA 1WSUA 2ID6A 4YBAA 3DTIA 2H1KA 1X1CA 4U7DA 3CQZJ 1OYYA 3KP2A 1Z6TA 4E70A 4ZTFA 1P92A 2NS8A 2RQPA 1T2KA 3ZR8X 1IN7A 2IU7A 4WVLA 2XGCA 3J81K 1J9IA 4E7LA 4HRAA 2V1DA 3ZP5A 2NAZA 4PJJA 1ZZ9A 2M8EA 5FKKA 5IYCJ 1Y0UA 1L1MA 2NOGA 5HS8A 4Y4RA 2BJCA 4DQ2A 1UJ8A 2W57A 1O3RA 4XOTA 4I6TA 4N9HA 3MFKA 3UWPA 4NQWB 1GV5A 1IRXA 4A3CJ 1MBEA 2IBDA 3I71A 2HQ5A 1TWAJ 1Z05A 1ODDA 1T0FA 2EWNA 2M0CA 2FEZA 2Q1ZB 3QQ6A 2YU9J 4O6JA 2KJCA 4CHUA 3OQMA 1GVDA 1DGWY 2PMUA 2LY1A 3GLXA 3PM1A 2HPMA 4HEA2 4NDLA 3U21A 2MA3A 2OA4A 2FE3A 3BTIA 1BJZA 1ZKGA 2XIUA 2GA1A 2ZXIA 2GZWA 4AYBN 2LKSA 1QNTA 3KZIC 1RKTA 3K4LA 5E3MA 3Q5FA 2LP0A 3T1BA 2E71A 1PP8F 3F8FA 4CCOA 4KDPA 3S16J 3VSLA 2HDDA 1FPQA 3VWSA 3LFUA 1ACIA 1ZLJA 2FRHA 1BA5A 4C3JJ 1ZZ7A 1BI2A 4CICA 2IEKA 4EZIA 2HS5A 1OR7C 3FYMA 4IWRA 3BDDA 4IZZA 2XAUA 4A3DJ 4Q47A 2CU7A 4S04A 2E1NA 2EFPA 1IAWA 2IAIA 4A0YA 2V79A 2FSWA 4IJAA 3BG3A 1MBGA 2KIQA 5ICFA 4M3FA 4ZH4F 1K4TA 1JKQC 2LF7A 1U78A 3IRRA 2G7UA 2XXQA 4RAZA 2GRLA 1MDMA 4EKGA 2OPTA 3K2ZA 4UV8A 2LYPA 2NOJB 4F3QA 4Y15A 1DWKA 2VEOA 3C2BA 4E7HA 3O9XA 3DLLF 3MAJA 5D6EA 4JX6A 3PIPF 2WADA 3L00A 4PUSA 1WRJA 3BJOA 4UHTA 3FK7A 3PNTA 1OMIA 5A2QZ 1FYLA 3I4MJ 3S3NA 3S1NJ 2VBYA 1VQ6I 3S15J 3PSIA 3JAMZ 3IL2A 3IH2A 3JRIA 3M3YJ 1YJ9I 4Y3OA 2W1OA 2QKLB 3WE2A 2N8GA 4PZJA 3J80K 4OB4A 3HSFA 3DPTA 2HYGD 2YUSA 1JJ8C 4OOIA 1P2FA 3F72A 4XLCA 3F51A 4ENJA 1X1BA 3TBIA 4JCXA 2EV5A 2AXLA 3D0SA 1FEXA 4FN3A 3LWFA 3BR6A 4D5FA 5M3MJ 5TGTA 2OZ6A 3H9GA 2LDUA 2HQNA 4NC6A 1UB9A 4LLNA 3O8GA 4M73A 1RPEL 3BR2A 1HDDC 2UXNA 4KNYA 3LL7A 4G7OF 2RREA 3I64A 1IXCA 2VT3A 3JTHA 4ZDOA 3LOCA 4OMYA 4NC8A 3VK0A 3QFIA 1FYMA 2EZIA 4G6QA 5FKOA 4MEYF 4AIKA 2FBKA 2R1JL 3LSPA 2I8DA 2EJRA 3MEJA 3B02A 2MXDA 2BHZA 1KQ8A 3HJEA 1ZGJA 3K6GA 2L49A 1IJWC 2L7FP 1E0EA 4Y13A 3E5XA 1JTYA 5DTRA 3PUBA 3S1MJ 1JI8A 1VNDA 2G0EA 2Z5UA 1G2HA 2ZXHA 1FBQA 3KZZA 3QYBA 4G7ZF 1JUSA 1TBXA 1RIOA 1XDUA 1FMWA 3J80Z 1OCPA 2ID3A 4MCXA 1MIJA 5JLXA 1Y56A 1QB2A 3R60A 2CUEA 5KAFC 3NXHA 3CO7C 2Y9ZA 4J01A 3M8FA 3H3UA 4KIGA 2ZXWH 2KIUA 3FX3A 1FOYA 3ZN1A 2JA5J 2OTJI 4ABZA 5GTIC 2V7FA 2ZMEA 3SXYA 3SZTA 1D0XA 1LFPA 1AA7A 2K4JA 3SZPA 2GAUA 1OYIA 4GXOA 3LNQA 2F4IA 5L3BA 3GN5B 4QWQA 3B7HA 3AL0C 1S72I 1SVOA 4V2GA 2R7XA 3L2UA 2PUCA 2F2EA 2FD5A 4XMYA 4BEHA 2OQRA 2IS1A 3G4SI 2CG4A 3K4NA 3CMYA 2PPXA 2VASA 4Z58A 3BDNA 1EV7A 2D1HA 1U2WA 3HUGB 5EZHA 4ER6A 1NG7A 2PUEA 4Q48A 5HDNA 1K61A 3NRVA 2PE5A 3OYIA 4ENNA 1R22A 2O5RA 3HOUJ 3ZHMA 1ZPQA 5M5XJ 3C18A 2VUMJ 3GZDC 2EPFA 3DKXA 1YLFA 4JYKA 5IYBJ 3HHHA 3MZHA 2EA4A 1STZA 1HQCA 1QHHD 1FIAA 3HTSB 1PRVA 2PEXA 4A6DA 1BR4A 1YTYA 2KT0A 2PG4A 2LH9A 2EIKH 5BOXA 4HA8A 2DU9A 3KEQA 3WU0A 4GYGA 5K5OA 2XC7A 3BC8A 1LJ9A 4I0AA 4ER0A 2PJRB 1FMVA 3QU6A 1W5SA 1VFCA 2X1EA 1IRFA 3ERED 1POGA 2UZKA 2LYQA 2MBFA 3GLLA 1YRNA 2GZUA 1A6IA 2LBFA 3BTLA 1XX5A 2RKHA 2C6YA 1ONVA 5HS7A 3VFZA 2XKPA 3V8JA 1K78B 1P4AA 3GFJA 4ZYEA 3DTKA 3OYAA 4PK4A 1XPXA 1N78A 1FBUA 4A93J 4MCTA 5E3OA 4EM0B 1WH7A 3RZDJ 1UTXA 4UUTA 1ZS4A 4Z6YA 3IAS2 4KITB 2PUDA 3F8CA 1YW7A 4MTEA 1ENHA 2PX9A 4LK1F 2WIUB 2E2HJ 1ZARA 2X85A 1FYKA 3I58A 3I53A 4L5IA 1E17A 3QOWA 4B09A 1IXSB 5BQTA 5LEJA 2QQ9A 2IGKA 1R4NB 1G59A 1TLHB 3FISA 4KUMA 2R7SA 2HKOA 4KA4A 2O38A 1NERA 2P5KA 4MNUA 2RQQA 5DD8A 3D1NI 3LFPA 4S05A 5E8GA 3FMSA 1HCRA 4X4EA 3OYCA 1LE8A 2ECBA 3QODA 3QPLA 2P7VB 2Z16A 1WJDA 3PQJA 4MFEA 1S9HA 2KZ8A 1BJAA 5D8LB 1RPWA 1W5CC 1T38A 4X4BA 2PXTA 2W82A 2XGEA 3GZNB 3T8RA 4A5NA 3HL2A 1MBKA 3K7AJ 4BQQA 2R5YB 4XORA 4OBMA 2R7ZJ 2I10A 1A31A 3V8KA 3VYSB 4W97A 4ESBA 2F5CA 1EJ9A 2CYYA 3WTWC 2HXIA 1ZG5A 1V5EA 1OCCH 2ICWG 4YRVA 2R7DA 4F52A 5B66C 2JA7J 2CW8A 1JH9A 4ZZDA 2X4HA 2L9VA 1OR7A 1R49A 2FX0A 2GOMA 4MO7A 3S8PA 5B3SH 2KMUA 1MBJA 3H9QA 1DU0A 2IVBA 5LFAA 3GYHX 3HHGA 1QHGA 5KVRA 3VSKA 4L9JA 3M8JA 4G6TB 3NWTA 4P5OA 1VQOI 3ZQ7A 1P7JA 1ZR4A 5JLWA 2NVTJ 3F6WA 3KL4A 2DMQA 3HRUA 2KQRA 2X6WA 3R4KA 5HVQC 2E60A 4N9IA 2HZTA 1YX3A 3CO6C 1UAAA 2HTJA 5H2FC 1MBHA 2MD0A 3DPLC 2DJIA 2Z33A 3GTOJ 4GDFA 2ISYA 1IN8A 2PN6A 2CS3A 3ZPLA 2RV8A 2M34A 1ETWA 3BPVA 3R61A 2K4BA 2JQEA 2R5YA 3A4CA 5DRTA 4XK4A 2DA3A 1XGNA 4M6XA 2R5ZB 2PJPA 1GXQA 1MJ9A 1W36D 1OSLA 1K83J 3KIOA 4XSXF 4HZFA 2EH3A 1WGXA 1HKSA 1JE8A 1NK2P 1M1EB 1AHDP 1OCOH 1WI9A 4OIPF 4PU3C 2X6OA 2LYCA 1I50J 4Z2YA 1JKOC 3LSGA 3K70C 2MD5A 2NVYJ 3K69A 3GZ6A 2DOAA 1OPCA 5ILSA 1JKPC 2AXZA 3G0TA 4EJVA 2L02A 3JRBA 1SQ8A 5BPIA 2DPUA 2O3FA 4CGZA 2LSOA 1UG0A 2OBPA 4Y42A 3NZLA 3E6MA 1HBXG 4KIBA 2VKDA 3RPUD 2MLKA 2A69F 5J47A 4RDUA 1U9OA 1FZPB 1YQAA 2IA0A 3QWGA 4NDWA 4LG0A 5D5WB 2QA4I 4D7MA 3M4OJ 4C2TA 2CW7A 5EEHA 1FSHA 2ETHA 1DDNA 1XGMA 2DCEA 2WTEA 4DZPA 2DT5A 1ZQ3P 4Q5SF 5CVJA 1R7JA 2AHQA 2Y9YA 2KZGA 4YFNF 2RAEA 4OIOF 2QZ8A 3KX2A 3GBGA 3UNGC 3HDDA 1B9MA 3OR2C 2GOXB 2FMLA 4LOCA 5GPCA 1QP4A 4HSTA 2G7HA 4I09A 2KISA 5CJ9A 3HC7A 4FETA 3W2VA 3FMYA 4L0ZB 2BW3A 2X1DA 4KIFA 4UUSA 5A7LA 2DN0A 4DBQA 4OIQF 4BHCA 3NDBB 3GUDA 2ODRD 1TQPA 3BR0A 2GBYA 3FKIJ 3F8NA 2IVGA 1JKRC 4HF2A 1JFTA 4MEXF 4X4CA 2M4GA 4EM2A 2FBHA 4RBOA 4GGGA 1U3EM 1Q1HA 3J7ZI 5AIQA 2HOEA 5ICCA 2Q2EA 2EBIA 2CROA 3GW2A 2DDAA 4BJ5C 3VB2A 4HNUA 1HKTA 3JREA 1QU3A 2AXVA 2R0QC 5HDKA 1R69A 3G7DA 2PUGA 1WQ2A 2VPLA 2BVMA 1UXDA 5J3LA 2WUSR 1ZAYA 3ZQGA 2P5LC 3LAJA 2QF7A 1ETKA 5F6FA 2COMA 3FBIB 4CCNA 5FLVA 3GMEA 1D5VA 2V9KA 4Z5CA 2JPCA 2XRNA 4HSRA 3OOUA 5TJJA 2EILH 3CP2A 3LAPA 2ZJ2A 5LHGA 1HW1A 3M1CA 4LGWA 5HLHA 3E6CC 2STTA 2V6EA 2YU3A 1X3UA 5K7HA 2FMYA 2J7UA 2ZFUA 6PAXA 4A3FJ 2JCGA 3S2WA 4UVBA 2VLAA 1A04A 2NNYA 4D1QA 3GZDA
chains in the Genus database with same CATH topology
4Y52J 3S16J 2HDDA 3ZQHA 4IHVA 1WIZA 4C3IJ 1BA5A 4C3JJ 1ZZ7A 4A3EJ 2FJRA 3H3VK 2IEKA 1XWRA 5FKLA 5F1JA 2JK3A 1HF0A 3FYMA 4IWRA 2MQKA 3BT9A 3HOZJ 4A3DJ 1ORKA 2HXOA 2CU7A 5EGOA 3JRCA 3PXPA 2IAIA 3ZQLA 1VPWA 1FJLA 3QF3A 1BW6A 3BG3A 1MBGA 2JWTA 4M3FA 4I76A 5J1YA 1RESA 1ZZ6A 1JKQC 2VI6A 1U78A 1RZRD 4A3BJ 4I6UA 3NARA 2GRLA 3GTJJ 2OPTA 4M6VA 2LYPA 4I6RA 5C44J 4GQMA 2MW8A 3G1LA 1DWKA 3ZHIA 3C2BA 3O9XA 3RKQA 1SANA 1RETA 5M5YJ 3S17J 4BXXJ 2HOAA 2EWTA 1ZVVA 4JX6A 2EZHA 2IV1A 3FK7A 3I4MJ 3JRAA 3S1NJ 1MSFC 4IVZA 2CQQA 3RQIA 1LQCA 3S15J 2AO9A 2YS9A 4X4GA 3IH2A 4B4CA 3JRIA 3M3YJ 4MFDA 1T33A 4BY7J 1UXCA 3H0GJ 3FK6A 4Y7NJ 1JGGA 2N8GA 4OB4A 3BD1A 5BNGA 4FISA 1F43A 5HODA 4XIDA 1QVTA 1AU7A 2YUSA 1ZZ8A 2XPWA 1JJ8C 3Q0UA 2XCJA 3F51A 3Q3SA 5IOYA 2ICTA 4JCXA 1PUFA 3W6VA 4FN3A 1FEXA 2O4AA 2HI3A 3BR6A 3HB9A 4D5FA 5M3MJ 2BNNA 3ZQIA 4AUXA 2DA4A 5DTDA 4JQDA 2DA5A 2DMNA 3O8GA 1RPEL 3BR2A 1HDDC 2O9LA 1X2LA 2E2JJ 2OFYA 2KEJA 2GM4A 4DYQA 5IP6A 4EEFG 4X6AJ 3SCFA 2MGQA 2EF8A 3LOCA 5E3LA 1S7EA 2R63A 1JT0A 3VK0A 3JXCL 3GN5A 3S1QJ 1NEQA 1FTZA 1PRUA 2XI8A 5IOZA 2EZIA 1E3OC 5FKOA 3GTMJ 1QVUA 4BBRJ 2L9RA 3S14J 1POUA 3GTKJ 2R1JL 3EUSA 3LSPA 1BDHA 5FKNA 2TRTA 3BQZA 3OSGA 2K40A 4YARA 1I6HJ 3KJXA 2LYLA 3UKGA 4DYCA 2L49A 2KDZA 1IJWC 2L7FP 2B63J 1FTTA 4M3DA 1VI0A 1WCMJ 4DZJA 4M3GA 1QPIA 4FE7A 2ME6A 2JA6J 1JTYA 3WHCA 1TC3C 1R63A 2LYRA 3CROL 3S1MJ 1VNDA 2G0EA 1G2HA 3S1RJ 3G1OA 1FIPA 3FYAA 1RZSA 1JUSA 1RIOA 3SCGA 5J1RA 1OCPA 2ID3A 1JFSA 3GBFA 5JLXA 4MCXA 2CUEA 2JJ7A 2PMZN 2X48A 2LVSA 2Y9ZA 1LFUP 3HZIB 5EYRA 2R5ZA 9ANTA 3ZQCA 4IA8A 4JCYA 4W1UA 5C4XJ 3OSFA 3HKZN 1HLVA 3GTPJ 1QP0A 2JA5J 2GLOA 1AKHB 4IHWA 4ABZA 4YG7B 1GUUA 5FKMA 5EF6A 5EGOB 4F8DA 3LNQA 4HNVA 1LCDA 1QP7A 1PERL 3SFIA 4PU8A 3GN5B 1OFCX 1ZGWA 2HOSA 1MBFA 3B7HA 4MIMA 2LCVA 3GTQJ 4V2GA 4X4HA 2XSDC 3OIOA 2A6CA 3UFDA 2PUCA 2FD5A 2L7ZA 2WV1A 2W48A 3CMYA 1BW5A 1X57A 2PPXA 1LFBA 2NVQJ 4Z58A 3BDNA 1VF9A 4QSHA 3E7LA 3KXAA 1R9TJ 5EZHA 3HBLA 1AKHA 2PUEA 4O8BA 1K61A 5E3NA 2WAQN 2WB1N 1U8BA 2TCTA 2PE5A 3B6AA 3JXBC 1APLC 3BR3A 4XRMA 1PNRA 2IVQA 5FLMJ 4BBSJ 3HOUJ 1IRZA 3ZHMA 3BTCA 1ZPQA 5M5XJ 4Z59A 2VUMJ 3DNVB 4S0HB 1H88C 4J1XA 4JYKA 4YG1A 5IYBJ 3U3WA 2LKXA 3SDGA 1ITYA 2KEKA 1FIAA 2LLKA 5EZGA 1PRVA 4J1WA 3VPRA 1JUPA 5IP9J 4I6ZA 2MEZA 1RZRA 3B6CA 1PRAA 2KT0A 1D5YA 5M5WJ 1MNMC 3TRBA 5GP9A 3R1FA 1O4XA 3ZOBA 1ZK8A 2LYSA 1JUMA 1EF4A 2ME0A 1QQAA 2OF7A 3QYXA 3ZKCA 2DTZA 1QRYA 1VFCA 3IVPA 2CJJA 1YRNB 1WH6A 1XS9A 1POGA 1CJGA 1ETYA 3PO2J 1IG7A 2LYQA 3O8HA 1JT6A 2VKEA 1YRNA 2GZUA 1A6IA 3BTLA 5EEAA 1DW9A 3I4NJ 2PUBA 2DJNA 1Y7YA 2M9HA 2ELKA 1PUFB 3CCYA 4XRSG 3S8QA 1U9NA 3BR5A 4A93J 4MCTA 2LY9A 3LISA 4GHJA 5E3OA 4A3IJ 3Q0VA 1LCCA 3ZQFA 1WH7A 3RZDJ 3S2HJ 3F0CA 1UTXA 4UUTA 1ZS4A 1ETOA 3MKLA 1UMQA 2MSYA 3HOXJ 2PUDA 3JXDL 2ECCA 5K7FA 3RZZA 4B3AA 3OQOA 1ENHA 1QPZA 2WIUB 2E2HJ 3G1MA 3CLCA 1CQTA 4A3MJ 3JRGA 2LK2A 4B1RA 5EDNA 1WETA 3DCFA 3FISA 2O38A 5EG0B 1UG2A 4X4FA 1NERA 2XB5A 2QCOA 3BG5A 2BNMA 3D1NI 2E1OA 2Y31A 1BL0A 3LFPA 2L0KA 1HCRA 4X4EA 4A69C 3A01A 1LE8A 2ECBA 2B5AA 2K9SA 4PU4C 2DA6A 2R92J 2DA2A 3QPLA 3IH3A 3HGYA 1H89C 4MFEA 4GFBA 3GTGJ 2JN6A 3HOVJ 1JWLA 1W0UA 2KZ8A 2K9NA 1XG1A 1Y1WJ 2LR8A 1TWFJ 1RPWA 2PIJA 2CQXA 2FJ1A 1GV2A 3MVPA 4X4BA 3MLFA 4G12A 2XGEA 3A02A 1X2MA 2D5VA 1Q1VA 1F36A 3OMTA 1MBKA 3K7AJ 2R5YB 1B8IA 2CRGA 3TP3A 2R7ZJ 1A5JA 2I10A 1MH4A 1DU6A 5F0FA 4W97A 2JA8J 3HGGA 2VPRA 3TEDA 1B72B 2HXIA 2PUFA 3G5GA 4YG4A 5F0CA 4BKXA 4C2MJ 1OJLA 2JA7J 5F08A 1LLIA 1HDPA 1JH9A 2LTPA 2FX0A 2JMWA 4MO7A 5F27A 1ZUGA 1Z77A 1ZZBA 2XPVA 2CSFA 5EG0A 3OP9A 5IPAA 1MBJA 1DU0A 5GPAA 2IVBA 1T56A 4X4IA 4A3LJ 2AUWA 3IV5A 2AWIA 3IH4A 3RZOJ 4DW6A 1ZR2A 3S2DJ 2EBYA 2PUAA 2LD5A 1P7JA 3SCHA 1ADRA 1ZR4A 4IHYA 1EFAA 1ETVA 5JLWA 3TW6A 4Z5DA 4M3BA 3BS3A 2NVTJ 3F6WA 1IDZA 3JRDA 2DA7A 2DMQA 2COBA 4MLOA 2NS7A 1Y9QA 4DYRA 3K2AA 2LYJA 2L7MP 2FQ4A 1ETXA 3HOWJ 5DS9A 4Z5HA 1W0TA 1ZZCA 1JTXA 4IEJA 2LFBA 1QQBA 3HM5A 3PO3J 4XRSA 1MBHA 2K9QA 3SJMA 3BQYA 4JP0A 3GTOJ 2LYKA 1TWHJ 5F0HA 3LSJA 3TP0A 2P81A 3CECA 2M34A 1ETWA 2R93J 4CYCB 2O49A 4IHXA 1IC8A 2R5YA 1B8IB 4BY1J 2L8NA 3FIWA 2XRLA 4XK4A 2DA3A 3TW7A 2R5ZB 2GRMA 3F52A 1OSLA 1K83J 1XC5A 4XICA 1NK3P 2EH3A 3QPSA 2ZB9A 1WGXA 2M2EA 1NK2P 2Y30A 1ZTRA 4L5EA 1AHDP 4PU3C 2X6OA 1UHSA 1I50J 1JKOC 3LSGA 4M3EA 2NVYJ 4QTRA 4J19A 2XGDA 1P7IA 1JKPC 2AXZA 2DA1A 1MSEC 5IYDJ 2H8RA 2XB0X 5K7ZA 2EQRA 2KPJA 2HOTA 3JRBA 4A3JJ 3LSRA 3JR9A 1SQ8A 1TWCJ 4Y42A 1I3QJ 1Z0XA 1IGNA 5C4JJ 2JVLA 2AXUA 4RDUA 3OQNA 1U9OA 5C3EJ 1BDIA 1LMB3 2EZKA 3CDLA 3QWGA 2NVXJ 1NTCA 4NDWA 1GDTA 3MN2A 2ICPA 4A3GJ 1TWGJ 4D7MA 3M4OJ 3QQAA 5J1UA 4D5CA 2E2IJ 4FE4A 1OCTC 4PU7A 4DZPA 1GT0C 3GTLJ 1ZQ3P 2AHQA 2Y9YA 3Q0WA 1WPKA 4I8TA 2RAEA 1LE8B 2PUGA 3HDDA 3GBGA 1JJ6C 1X58A 2X9DA 4JX5A 4LOCA 4X1EA 4C3HJ 5GPCA 1MH3A 5F04A 2E19A 4D7NA 4FCYA 1YSEA 1QP4A 2BNOA 1RR7A 3A01B 2XPUA 3FMYA 2M8GX 1B0NA 4UUSA 4FBIA 2VKVA 1RKWA 1WH8A 2DMUA 5A7LA 2OR1L 3BTJA 2CUFA 2DN0A 2IUOA 3WHBA 3BR0A 2GBYA 3FKIJ 3L1PA 4JX4A 2IVGA 2ID6A 2DMTA 2HYJA 3JRHA 4V2FA 1JKRC 4YBAA 4X4CA 1JFTA 1B72A 2H1KA 2KEIA 2O8KA 4RBOA 1WH5A 2EZLA 3CQZJ 4FTHA 1SFOJ 2EBIA 2NS8A 2IU7A 2XGCA 2O7OA 4QIWN 2CROA 1HOMA 2Y0SN 3H5TA 4CYCA 1X2NA 3JREA 2AXVA 2R0QC 1R69A 2AW6A 3BG9A 3NAUA 5FKKA 5IYCJ 1ZZ9A 2XJ3A 3G7DA 1IDYA 2NOGA 3BR1A 1L1MA 2BJCA 5M3FJ 1H8AC 1UXDA 1Y1VJ 5J3LA 2WUSR 3KZ3A 3ZQGA 4I6TA 1ZAYA 1GV5A 2QF7A 1ETKA 3JRFA 3HEFA 2MG4A 2Y2ZA 4A3CJ 1MBEA 2IBDA 5FLVA 2HQ5A 1TWAJ 4Z5CA 2M0CA 3QQ6A 4AC0A 2YU9J 2HINA 3OOUA 4UUSB 3OQMA 1GVDA 5IP7J 2DMPA 5K98B 1IUFA 3PM1A 4A3KJ 4NDLA 3HOYJ 5K7HA 1BJZA 1ZKGA 3BTIA 3DEWA 5FJ8J 2XIUA 4A3FJ 2JCGA 1IV6A 4AYBN 1ETQA 2HSGA 4X4DA 1RKTA 5E3MA 2LP0A 1WI3A 3A03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y52 J;  3S16 J;  2HDD A;  3ZQH A;  4IHV A;  1WIZ A;  4C3I J;  1BA5 A;  4C3J J;  1ZZ7 A;  4A3E J;  2FJR A;  3H3V K;  2IEK A;  1XWR A;  5FKL A;  5F1J A;  2JK3 A;  1HF0 A;  3FYM A;  4IWR A;  2MQK A;  3BT9 A;  3HOZ J;  4A3D J;  1ORK A;  2HXO A;  2CU7 A;  5EGO A;  3JRC A;  3PXP A;  2IAI A;  3ZQL A;  1VPW A;  1FJL A;  3QF3 A;  1BW6 A;  3BG3 A;  1MBG A;  2JWT A;  4M3F A;  4I76 A;  5J1Y A;  1RES A;  1ZZ6 A;  1JKQ C;  2VI6 A;  1U78 A;  1RZR D;  4A3B J;  4I6U A;  3NAR A;  2GRL A;  3GTJ J;  2OPT A;  4M6V A;  2LYP A;  4I6R A;  5C44 J;  4GQM A;  2MW8 A;  3G1L A;  1DWK A;  3ZHI A;  3C2B A;  3O9X A;  3RKQ A;  1SAN A;  1RET A;  5M5Y J;  3S17 J;  4BXX J;  2HOA A;  2EWT A;  1ZVV A;  4JX6 A;  2EZH A;  2IV1 A;  3FK7 A;  3I4M J;  3JRA A;  3S1N J;  1MSF C;  4IVZ A;  2CQQ A;  3RQI A;  1LQC A;  3S15 J;  2AO9 A;  2YS9 A;  4X4G A;  3IH2 A;  4B4C A;  3JRI A;  3M3Y J;  4MFD A;  1T33 A;  4BY7 J;  1UXC A;  3H0G J;  3FK6 A;  4Y7N J;  1JGG A;  2N8G A;  4OB4 A;  3BD1 A;  5BNG A;  4FIS A;  1F43 A;  5HOD A;  4XID A;  1QVT A;  1AU7 A;  2YUS A;  1ZZ8 A;  2XPW A;  1JJ8 C;  3Q0U A;  2XCJ A;  3F51 A;  3Q3S A;  5IOY A;  2ICT A;  4JCX A;  1PUF A;  3W6V A;  4FN3 A;  1FEX A;  2O4A A;  2HI3 A;  3BR6 A;  3HB9 A;  4D5F A;  5M3M J;  2BNN A;  3ZQI A;  4AUX A;  2DA4 A;  5DTD A;  4JQD A;  2DA5 A;  2DMN A;  3O8G A;  1RPE L;  3BR2 A;  1HDD C;  2O9L A;  1X2L A;  2E2J J;  2OFY A;  2KEJ A;  2GM4 A;  4DYQ A;  5IP6 A;  4EEF G;  4X6A J;  3SCF A;  2MGQ A;  2EF8 A;  3LOC A;  5E3L A;  1S7E A;  2R63 A;  1JT0 A;  3VK0 A;  3JXC L;  3GN5 A;  3S1Q J;  1NEQ A;  1FTZ A;  1PRU A;  2XI8 A;  5IOZ A;  2EZI A;  1E3O C;  5FKO A;  3GTM J;  1QVU A;  4BBR J;  2L9R A;  3S14 J;  1POU A;  3GTK J;  2R1J L;  3EUS A;  3LSP A;  1BDH A;  5FKN A;  2TRT A;  3BQZ A;  3OSG A;  2K40 A;  4YAR A;  1I6H J;  3KJX A;  2LYL A;  3UKG A;  4DYC A;  2L49 A;  2KDZ A;  1IJW C;  2L7F P;  2B63 J;  1FTT A;  4M3D A;  1VI0 A;  1WCM J;  4DZJ A;  4M3G A;  1QPI A;  4FE7 A;  2ME6 A;  2JA6 J;  1JTY A;  3WHC A;  1TC3 C;  1R63 A;  2LYR A;  3CRO L;  3S1M J;  1VND A;  2G0E A;  1G2H A;  3S1R J;  3G1O A;  1FIP A;  3FYA A;  1RZS A;  1JUS A;  1RIO A;  3SCG A;  5J1R A;  1OCP A;  2ID3 A;  1JFS A;  3GBF A;  5JLX A;  4MCX A;  2CUE A;  2JJ7 A;  2PMZ N;  2X48 A;  2LVS A;  2Y9Z A;  1LFU P;  3HZI B;  5EYR A;  2R5Z A;  9ANT A;  3ZQC A;  4IA8 A;  4JCY A;  4W1U A;  5C4X J;  3OSF A;  3HKZ N;  1HLV A;  3GTP J;  1QP0 A;  2JA5 J;  2GLO A;  1AKH B;  4IHW A;  4ABZ A;  4YG7 B;  1GUU A;  5FKM A;  5EF6 A;  5EGO B;  4F8D A;  3LNQ A;  4HNV A;  1LCD A;  1QP7 A;  1PER L;  3SFI A;  4PU8 A;  3GN5 B;  1OFC X;  1ZGW A;  2HOS A;  1MBF A;  3B7H A;  4MIM A;  2LCV A;  3GTQ J;  4V2G A;  4X4H A;  2XSD C;  3OIO A;  2A6C A;  3UFD A;  2PUC A;  2FD5 A;  2L7Z A;  2WV1 A;  2W48 A;  3CMY A;  1BW5 A;  1X57 A;  2PPX A;  1LFB A;  2NVQ J;  4Z58 A;  3BDN A;  1VF9 A;  4QSH A;  3E7L A;  3KXA A;  1R9T J;  5EZH A;  3HBL A;  1AKH A;  2PUE A;  4O8B A;  1K61 A;  5E3N A;  2WAQ N;  2WB1 N;  1U8B A;  2TCT A;  2PE5 A;  3B6A A;  3JXB C;  1APL C;  3BR3 A;  4XRM A;  1PNR A;  2IVQ A;  5FLM J;  4BBS J;  3HOU J;  1IRZ A;  3ZHM A;  3BTC A;  1ZPQ A;  5M5X J;  4Z59 A;  2VUM J;  3DNV B;  4S0H B;  1H88 C;  4J1X A;  4JYK A;  4YG1 A;  5IYB J;  3U3W A;  2LKX A;  3SDG A;  1ITY A;  2KEK A;  1FIA A;  2LLK A;  5EZG A;  1PRV A;  4J1W A;  3VPR A;  1JUP A;  5IP9 J;  4I6Z A;  2MEZ A;  1RZR A;  3B6C A;  1PRA A;  2KT0 A;  1D5Y A;  5M5W J;  1MNM C;  3TRB A;  5GP9 A;  3R1F A;  1O4X A;  3ZOB A;  1ZK8 A;  2LYS A;  1JUM A;  1EF4 A;  2ME0 A;  1QQA A;  2OF7 A;  3QYX A;  3ZKC A;  2DTZ A;  1QRY A;  1VFC A;  3IVP A;  2CJJ A;  1YRN B;  1WH6 A;  1XS9 A;  1POG A;  1CJG A;  1ETY A;  3PO2 J;  1IG7 A;  2LYQ A;  3O8H A;  1JT6 A;  2VKE A;  1YRN A;  2GZU A;  1A6I A;  3BTL A;  5EEA A;  1DW9 A;  3I4N J;  2PUB A;  2DJN A;  1Y7Y A;  2M9H A;  2ELK A;  1PUF B;  3CCY A;  4XRS G;  3S8Q A;  1U9N A;  3BR5 A;  4A93 J;  4MCT A;  2LY9 A;  3LIS A;  4GHJ A;  5E3O A;  4A3I J;  3Q0V A;  1LCC A;  3ZQF A;  1WH7 A;  3RZD J;  3S2H J;  3F0C A;  1UTX A;  4UUT A;  1ZS4 A;  1ETO A;  3MKL A;  1UMQ A;  2MSY A;  3HOX J;  2PUD A;  3JXD L;  2ECC A;  5K7F A;  3RZZ A;  4B3A A;  3OQO A;  1ENH A;  1QPZ A;  2WIU B;  2E2H J;  3G1M A;  3CLC A;  1CQT A;  4A3M J;  3JRG A;  2LK2 A;  4B1R A;  5EDN A;  1WET A;  3DCF A;  3FIS A;  2O38 A;  5EG0 B;  1UG2 A;  4X4F A;  1NER A;  2XB5 A;  2QCO A;  3BG5 A;  2BNM A;  3D1N I;  2E1O A;  2Y31 A;  1BL0 A;  3LFP A;  2L0K A;  1HCR A;  4X4E A;  4A69 C;  3A01 A;  1LE8 A;  2ECB A;  2B5A A;  2K9S A;  4PU4 C;  2DA6 A;  2R92 J;  2DA2 A;  3QPL A;  3IH3 A;  3HGY A;  1H89 C;  4MFE A;  4GFB A;  3GTG J;  2JN6 A;  3HOV J;  1JWL A;  1W0U A;  2KZ8 A;  2K9N A;  1XG1 A;  1Y1W J;  2LR8 A;  1TWF J;  1RPW A;  2PIJ A;  2CQX A;  2FJ1 A;  1GV2 A;  3MVP A;  4X4B A;  3MLF A;  4G12 A;  2XGE A;  3A02 A;  1X2M A;  2D5V A;  1Q1V A;  1F36 A;  3OMT A;  1MBK A;  3K7A J;  2R5Y B;  1B8I A;  2CRG A;  3TP3 A;  2R7Z J;  1A5J A;  2I10 A;  1MH4 A;  1DU6 A;  5F0F A;  4W97 A;  2JA8 J;  3HGG A;  2VPR A;  3TED A;  1B72 B;  2HXI A;  2PUF A;  3G5G A;  4YG4 A;  5F0C A;  4BKX A;  4C2M J;  1OJL A;  2JA7 J;  5F08 A;  1LLI A;  1HDP A;  1JH9 A;  2LTP A;  2FX0 A;  2JMW A;  4MO7 A;  5F27 A;  1ZUG A;  1Z77 A;  1ZZB A;  2XPV A;  2CSF A;  5EG0 A;  3OP9 A;  5IPA A;  1MBJ A;  1DU0 A;  5GPA A;  2IVB A;  1T56 A;  4X4I A;  4A3L J;  2AUW A;  3IV5 A;  2AWI A;  3IH4 A;  3RZO J;  4DW6 A;  1ZR2 A;  3S2D J;  2EBY A;  2PUA A;  2LD5 A;  1P7J A;  3SCH A;  1ADR A;  1ZR4 A;  4IHY A;  1EFA A;  1ETV A;  5JLW A;  3TW6 A;  4Z5D A;  4M3B A;  3BS3 A;  2NVT J;  3F6W A;  1IDZ A;  3JRD A;  2DA7 A;  2DMQ A;  2COB A;  4MLO A;  2NS7 A;  1Y9Q A;  4DYR A;  3K2A A;  2LYJ A;  2L7M P;  2FQ4 A;  1ETX A;  3HOW J;  5DS9 A;  4Z5H A;  1W0T A;  1ZZC A;  1JTX A;  4IEJ A;  2LFB A;  1QQB A;  3HM5 A;  3PO3 J;  4XRS A;  1MBH A;  2K9Q A;  3SJM A;  3BQY A;  4JP0 A;  3GTO J;  2LYK A;  1TWH J;  5F0H A;  3LSJ A;  3TP0 A;  2P81 A;  3CEC A;  2M34 A;  1ETW A;  2R93 J;  4CYC B;  2O49 A;  4IHX A;  1IC8 A;  2R5Y A;  1B8I B;  4BY1 J;  2L8N A;  3FIW A;  2XRL A;  4XK4 A;  2DA3 A;  3TW7 A;  2R5Z B;  2GRM A;  3F52 A;  1OSL A;  1K83 J;  1XC5 A;  4XIC A;  1NK3 P;  2EH3 A;  3QPS A;  2ZB9 A;  1WGX A;  2M2E A;  1NK2 P;  2Y30 A;  1ZTR A;  4L5E A;  1AHD P;  4PU3 C;  2X6O A;  1UHS A;  1I50 J;  1JKO C;  3LSG A;  4M3E A;  2NVY J;  4QTR A;  4J19 A;  2XGD A;  1P7I A;  1JKP C;  2AXZ A;  2DA1 A;  1MSE C;  5IYD J;  2H8R A;  2XB0 X;  5K7Z A;  2EQR A;  2KPJ A;  2HOT A;  3JRB A;  4A3J J;  3LSR A;  3JR9 A;  1SQ8 A;  1TWC J;  4Y42 A;  1I3Q J;  1Z0X A;  1IGN A;  5C4J J;  2JVL A;  2AXU A;  4RDU A;  3OQN A;  1U9O A;  5C3E J;  1BDI A;  1LMB 3;  2EZK A;  3CDL A;  3QWG A;  2NVX J;  1NTC A;  4NDW A;  1GDT A;  3MN2 A;  2ICP A;  4A3G J;  1TWG J;  4D7M A;  3M4O J;  3QQA A;  5J1U A;  4D5C A;  2E2I J;  4FE4 A;  1OCT C;  4PU7 A;  4DZP A;  1GT0 C;  3GTL J;  1ZQ3 P;  2AHQ A;  2Y9Y A;  3Q0W A;  1WPK A;  4I8T A;  2RAE A;  1LE8 B;  2PUG A;  3HDD A;  3GBG A;  1JJ6 C;  1X58 A;  2X9D A;  4JX5 A;  4LOC A;  4X1E A;  4C3H J;  5GPC A;  1MH3 A;  5F04 A;  2E19 A;  4D7N A;  4FCY A;  1YSE A;  1QP4 A;  2BNO A;  1RR7 A;  3A01 B;  2XPU A;  3FMY A;  2M8G X;  1B0N A;  4UUS A;  4FBI A;  2VKV A;  1RKW A;  1WH8 A;  2DMU A;  5A7L A;  2OR1 L;  3BTJ A;  2CUF A;  2DN0 A;  2IUO A;  3WHB A;  3BR0 A;  2GBY A;  3FKI J;  3L1P A;  4JX4 A;  2IVG A;  2ID6 A;  2DMT A;  2HYJ A;  3JRH A;  4V2F A;  1JKR C;  4YBA A;  4X4C A;  1JFT A;  1B72 A;  2H1K A;  2KEI A;  2O8K A;  4RBO A;  1WH5 A;  2EZL A;  3CQZ J;  4FTH A;  1SFO J;  2EBI A;  2NS8 A;  2IU7 A;  2XGC A;  2O7O A;  4QIW N;  2CRO A;  1HOM A;  2Y0S N;  3H5T A;  4CYC A;  1X2N A;  3JRE A;  2AXV A;  2R0Q C;  1R69 A;  2AW6 A;  3BG9 A;  3NAU A;  5FKK A;  5IYC J;  1ZZ9 A;  2XJ3 A;  3G7D A;  1IDY A;  2NOG A;  3BR1 A;  1L1M A;  2BJC A;  5M3F J;  1H8A C;  1UXD A;  1Y1V J;  5J3L A;  2WUS R;  3KZ3 A;  3ZQG A;  4I6T A;  1ZAY A;  1GV5 A;  2QF7 A;  1ETK A;  3JRF A;  3HEF A;  2MG4 A;  2Y2Z A;  4A3C J;  1MBE A;  2IBD A;  5FLV A;  2HQ5 A;  1TWA J;  4Z5C A;  2M0C A;  3QQ6 A;  4AC0 A;  2YU9 J;  2HIN A;  3OOU A;  4UUS B;  3OQM A;  1GVD A;  5IP7 J;  2DMP A;  5K98 B;  1IUF A;  3PM1 A;  4A3K J;  4NDL A;  3HOY J;  5K7H A;  1BJZ A;  1ZKG A;  3BTI A;  3DEW A;  5FJ8 J;  2XIU A;  4A3F J;  2JCG A;  1IV6 A;  4AYB N;  1ETQ A;  2HSG A;  4X4D A;  1RKT A;  5E3M A;  2LP0 A;  1WI3 A;  3A03 A; 
#chains in the Genus database with same CATH topology
 2BBY A;  4Y52 J;  1Z1D A;  4IHV A;  2XSJ C;  1ON1 A;  4I02 A;  4XRF A;  1VQM I;  1G3W A;  4A3E J;  3DBH B;  3GZ5 A;  2XF7 A;  5CVV A;  3F22 A;  2DFE A;  1I6X A;  2JK3 A;  3KE2 A;  1BIB A;  5D6F A;  1HF0 A;  2JTV A;  1ORK A;  2J5P A;  2HXO A;  3P9I A;  4HBL A;  3PUF A;  2LBF B;  3OS2 A;  3PXP A;  3ZQL A;  1VPW A;  3QF3 A;  3JSO A;  1R6R A;  2OUM A;  4HDU A;  4HOB A;  4CCJ A;  1LB2 A;  2X6Y A;  1K79 A;  3CCS I;  4I6U A;  2IJL A;  4AD9 A;  4DE9 A;  1L3L A;  3KPH A;  3FMQ A;  3OYH A;  3WGG A;  2MW8 A;  3ZHI A;  3E6D A;  3F8B A;  4F92 B;  4G9Y A;  4EGY A;  3RKQ A;  1G4D A;  3S17 J;  2HOA A;  1G3S A;  3I3L A;  4OIN F;  2EZH A;  1RUN A;  2VB6 A;  2IV1 A;  1FLI A;  2MH9 A;  3CCU I;  1MSF C;  1PYV A;  2CQQ A;  2EFN A;  3RQI A;  1LQC A;  4WX9 A;  1OCZ H;  2XAH A;  4BNC A;  4B4C A;  1KU7 A;  3TL4 X;  4XQF A;  2M45 A;  2ZCW A;  4OMZ A;  4B48 A;  3LFK A;  4L0Y B;  2H8W A;  2A6H F;  5DTQ A;  1JGG A;  1K6O A;  1WJC A;  2VQG A;  3TGN A;  2QUF A;  3A1Y A;  2LG4 A;  2CMP A;  5HOD A;  1LEA A;  2JUG A;  2XPW A;  1O3Q A;  3Q0U A;  1T98 A;  2RN7 A;  3Q3S A;  3ZMD A;  4MTD A;  1U2Z A;  3W6V A;  4LIT A;  2Q8K A;  4PGG A;  1J75 A;  4AUX A;  4R8H A;  2PXU A;  5L3E A;  2DA5 A;  2XGX A;  2K9M A;  3E5U A;  2OFY A;  1XTA A;  2E2J J;  1WHU A;  4DYQ A;  4X6A J;  1TL8 A;  1UFM A;  2MGQ A;  2DQL A;  4KT5 C;  3HXL A;  3JXC L;  1OLT A;  3GN5 A;  1K6Y A;  2XI8 A;  4LD5 A;  5LHH A;  2BY1 A;  3GTM J;  3OYM A;  1FOK A;  3S14 J;  4LLL A;  3GTK J;  1IXR C;  1IN6 A;  1BDH A;  5FKN A;  1P4W A;  2LMD A;  2V9P A;  4PFO A;  2ZNY A;  4YAR A;  3QP6 A;  2DOE A;  3CCQ I;  3QP5 A;  3ZCO A;  4DYC A;  3UKG A;  3CTA A;  4F93 B;  2B63 J;  1FTT A;  1WCM J;  1X19 A;  4WXC A;  2IGM A;  1WZ2 A;  5ERI A;  4FE7 A;  1QPI A;  2LYR A;  3GWZ A;  3H9J A;  4E7S A;  1TC3 C;  1ZH5 A;  2Z9O A;  3S1R J;  2GXG A;  4HRI A;  3IAM 2;  4PCQ A;  1W7P A;  2PJR A;  1JFS A;  2A5W A;  1CF7 B;  1HW2 A;  5GAH i;  1ON2 A;  2DFI A;  2M1B A;  2X48 A;  2LVS A;  4B47 A;  1IRG A;  5EYR A;  3UR3 C;  2ZJR F;  5E1Z B;  3OSF A;  1A6Q A;  3HKZ N;  2FU4 A;  4BQN A;  3P7N A;  1AKH B;  4IHW A;  1ZRD A;  2K5C A;  3CC2 I;  2GA2 A;  4YG7 B;  1S6L A;  5KAI C;  2W24 A;  1DPU A;  1FT9 A;  1XGS A;  1TQM A;  1V3F A;  3L2Q A;  4RGS A;  4II2 A;  2F5V A;  3OY9 A;  1X1P A;  5CQG A;  1OFC X;  4CCL A;  1MBF A;  1H0M A;  4MIM A;  1IO2 A;  3GTQ J;  1QGP A;  2DLL A;  4KIC A;  3ROU A;  5J8F A;  2XSD C;  4X4H A;  2IA2 A;  3BZ6 A;  1JXS A;  2OQG A;  2L7Z A;  1WJF A;  4UVC A;  2WV1 A;  2HGC A;  2XAS A;  4CSW A;  1HC8 A;  2GQQ A;  3RSN A;  1X57 A;  1ZYR F;  4LFU A;  5EJC A;  1VF9 A;  3AG2 H;  1W7P B;  3E7L A;  3IKT A;  3H35 A;  2E7X A;  3KLO A;  5DV5 A;  2WAQ N;  4KN4 X;  2WB1 N;  2DYS H;  3JXB C;  3BR3 A;  3P9C A;  3MMY B;  5FLM J;  3LA7 A;  2IVQ A;  1V5G A;  4KFC A;  1IRZ A;  2A3S A;  4NNJ A;  5HLT A;  3TFL A;  2M30 A;  4Y17 A;  4S0H B;  4J1X A;  4XKV A;  2BZT A;  1FNN A;  3BLY A;  2LKX A;  1YS7 A;  2EIN H;  3DEE A;  2LLK A;  1Z7U A;  1TT0 A;  3VPR A;  2MEZ A;  4I6Z A;  3FHZ A;  1RZR A;  1G6N A;  3B6C A;  2DPD A;  1S5L C;  3X2Q H;  1D5Y A;  3R6S A;  1MNM C;  2R4G A;  5F64 A;  3K1P A;  2R7U A;  1HXD A;  3KYC B;  4XLF A;  4RB1 A;  2XAF A;  1O4X A;  3HYI A;  3RYR A;  4M74 A;  3AAF A;  2ZJP F;  4BE2 A;  2HVR A;  1UHW A;  2K27 A;  4IVN A;  3DPU A;  4NBQ A;  1EF4 A;  2ME0 A;  1QQA A;  1RC9 A;  3IRQ A;  1RRJ A;  2EFW A;  2W25 A;  1BI1 A;  1QRY A;  4CH7 A;  2CJJ A;  1XSX A;  2IGN A;  1VQL I;  3I9V 2;  5H20 A;  4I0B A;  4OAY A;  2IW5 A;  1CJG A;  2XDV A;  3CME I;  4PSW A;  3E0J B;  1JT6 A;  1YW8 A;  5K1Y A;  5J6X A;  2RNJ A;  1J2X A;  1IF1 A;  1WVR A;  2DJN A;  4R1H A;  4IHS A;  4IQ4 A;  1Y7Y A;  2QQA A;  2X51 A;  2FA5 A;  5E20 A;  1PUF B;  2ELJ A;  3G73 A;  3DF8 A;  5JR3 A;  3WTV C;  1U9N A;  1QO0 D;  3LIS A;  2UXX A;  1B1B A;  3QPH A;  4LMY A;  3Q0V A;  3CZ6 A;  1YX5 A;  1LCC A;  4PDK A;  2HFH A;  2WB1 A;  2ZNZ A;  2CW0 F;  4NC7 A;  3ELK A;  4LIV A;  1EKE A;  3TKY A;  3MZY A;  2JQ7 A;  3SQN A;  3I59 B;  3RZZ A;  3G1M A;  3FXU A;  3ERM A;  2KHM A;  1R1V A;  1IW7 F;  3RIR A;  3FXM A;  3QOX A;  3PFI A;  3CJT B;  1J09 A;  2E5Z A;  3JRG A;  4A0X A;  2LK2 A;  1LDJ A;  2HDC A;  4B1R A;  1WET A;  2E36 A;  1D0Y A;  1MNE A;  4IRI A;  4XNF A;  3OS0 A;  2RGV A;  3LQX A;  4X4F A;  3F6V A;  2BNM A;  3BG5 A;  3WTU C;  2B9S A;  2IA1 A;  3FZV A;  2QQ8 A;  2L0K A;  3A01 A;  1LPQ A;  3SDB A;  2YX4 A;  1SC7 A;  4R79 A;  3AL0 B;  4PU4 C;  4MHG A;  3CLQ A;  2QGU A;  3L2W A;  3IC7 A;  4WXD A;  5TRD A;  2IS4 A;  2EFQ A;  3VWB A;  3HOV J;  1Y0N A;  2L9N A;  3T0Y A;  4CUG A;  4B8X A;  4Q4Z F;  2VOP A;  5CYV A;  1REP C;  1XG1 A;  2OV7 A;  3PNV A;  4E6K G;  1TWF J;  1Y1W J;  3A9Z A;  2CQX A;  4HW0 A;  4XLN F;  4E7I A;  4XSZ F;  5A2Q K;  2D5V A;  1X2M A;  4AID A;  1BIA A;  1Q1V A;  2FNA A;  1F36 A;  2L9S A;  3CJN A;  3NQO A;  5DCF A;  4BJT A;  4QLC U;  3OMT A;  2CRG A;  1A5J A;  1MH4 A;  1YIO A;  2F4O B;  3R0A A;  3E3V A;  4HLY A;  1DU6 A;  3FDY A;  4N4O B;  3QOP A;  5KHD A;  2KLO A;  1LNW A;  3DQV C;  3K4C A;  5L3G A;  4ANJ A;  3G5G A;  3TDU C;  4ESF A;  4CZC A;  2PMH A;  1QBJ A;  3DBR B;  5F27 A;  1ZUG A;  4HV5 A;  4ZDP A;  2BV6 A;  2CSF A;  4XKC A;  1BI0 A;  4UY8 I;  4B43 A;  2EIM H;  3F21 A;  2JT1 A;  5GAE J;  2AUW A;  1IV8 A;  3ESW B;  1XD7 A;  2IPQ X;  3EYY A;  1VQ8 I;  4X4I A;  3TQN A;  3IH4 A;  3RZO J;  4DW6 A;  1ZR2 A;  2EBY A;  2DK8 A;  1ZRF A;  3SCH A;  3CUQ A;  3HG9 A;  4A6E A;  3NRO A;  2XKO A;  2P6S A;  3BS3 A;  4G8X A;  4DYR A;  3WOD F;  4KMU X;  3KCC A;  1NHA A;  1WJ5 A;  2LYJ A;  3HOW J;  5DS9 A;  4Z5H A;  1JTX A;  1QQI A;  1R1U A;  3ASO H;  5IT9 Z;  3RCO A;  2PXE A;  2A5Y B;  3SJM A;  2PBI A;  4JQF A;  4G94 A;  4ENK A;  5GAH J;  1T39 A;  3TP0 A;  1Y8R B;  2P81 A;  4YEJ A;  4XLA A;  3CEC A;  3HRS A;  3MD2 A;  3MQ0 A;  4CYC B;  1B8I B;  1O57 A;  4BQO A;  1IN5 A;  3OMY A;  5E18 F;  3LSI A;  3DP7 A;  3ZQQ A;  2MAB A;  2ZB9 A;  2XHK A;  3KEO A;  1QA6 A;  5E1X A;  2DTR A;  3H5N A;  1H9T A;  2XGD A;  2F5E A;  1W4M A;  3OYB A;  2VQH A;  2F5F A;  3DEU A;  2H8R A;  5IYD J;  2XB0 X;  2KPJ A;  2EQR A;  2HOT A;  3VEP A;  2P7C B;  3IHU A;  2IP2 A;  3AFH A;  3RDI A;  4AVZ A;  4A3J J;  1TWC J;  2EIJ H;  4U88 A;  3V8L A;  3L2R A;  3HUG A;  4IOA F;  2VJ5 A;  3CCR I;  1IGN A;  2KKO A;  5FFZ A;  3OYN A;  2AXU A;  1R36 A;  2X0L A;  3OWQ A;  1D3Y A;  4LIU A;  1LMB 3;  2EZK A;  1NTC A;  1FC3 A;  3EUH A;  1GDT A;  3L9F A;  2QLZ A;  3FXO A;  1P6R A;  2HFZ A;  4A3G J;  1MD0 A;  1ZAO A;  2E2I J;  5H6Q A;  3GFI A;  4L5J A;  4AIJ A;  1BOB A;  3GTL J;  2VJJ A;  3Q0W A;  1WPK A;  2AS5 F;  3OL4 A;  1VQ4 I;  3GO5 A;  5HDG A;  5JHF A;  3H3Z A;  1LE8 B;  2E1C A;  1UCR A;  2KRF A;  3LSH A;  3QWL A;  1QPM A;  1X58 A;  3B73 A;  1SD7 A;  2X9D A;  1DGR M;  4G6D A;  4X1E A;  5JI6 A;  1E2X A;  1MMG A;  5HOO A;  2E19 A;  3IV5 A;  3F23 A;  3AG1 H;  3VOD A;  2BNO A;  1RR7 A;  1B4A A;  3O2P E;  2GXB A;  4RAF A;  1V54 H;  3LST A;  3GZC A;  1BM9 A;  1FX7 A;  4LJZ F;  4ETS A;  2ZJQ F;  4OAZ A;  1N25 A;  1WH8 A;  4FBI A;  4DE8 A;  3BTJ A;  1FOX A;  4FAS D;  3OYJ A;  3RQ4 A;  4JX4 A;  2DMT A;  2HYJ A;  2LF8 A;  2MYS A;  1B72 A;  2KEI A;  4RMN A;  1WH5 A;  2M0M A;  2UUZ A;  2EZL A;  3KZY A;  5DYM A;  3VYT B;  4FTH A;  2BHY A;  4ZZL A;  3F9K A;  3QOE A;  2O7O A;  4QIW N;  1HOM A;  3BOQ A;  1MKM A;  2BYV E;  3H5T A;  4XLH A;  4CYC A;  1TP4 A;  5L3D A;  4BAC A;  3JAM K;  3E6B A;  2L7K A;  2AW6 A;  1W5T A;  3BG9 A;  3NAU A;  2BE5 F;  3TEL A;  1FBS A;  4LG0 B;  1IDY A;  3PQK A;  3M9L A;  3PSF A;  5M3F J;  1R1T A;  2A61 A;  1Y1V J;  2LNM A;  4I99 C;  3JRF A;  3HEF A;  4EJO A;  2DFF A;  5HNF A;  3ZMV A;  3RKY A;  3TEP A;  4KYW A;  3OYK A;  3ABU A;  1I1G A;  3KFW X;  2Y0S A;  1Z67 A;  2E1M C;  2F48 A;  2L4A A;  3BCA A;  3WTZ A;  1N77 A;  3SR4 A;  1PDN C;  1IUF A;  3CC4 I;  3GVA A;  3PJR A;  1L0O C;  2L2O A;  1IN4 A;  2ADU A;  2W4S A;  1KON A;  3L7W A;  4XKW A;  5DDG A;  1RR8 C;  4IQJ A;  3HOY J;  2G9W A;  1U5T B;  2J5O A;  3DEW A;  1UZC A;  2BY2 A;  1LEB A;  2HSG A;  1ETQ A;  4X4D A;  3ML6 A;  2R7R A;  2L5Q A;  5FO5 A;  1MZB A;  3ZMU A;  1VQ9 I;  3P5J A;  1LVK A;  5GAG J;  4IRH A;  5D5X B;  3TDZ C;  3ZQH A;  4L18 B;  2BY0 A;  3M7G A;  3U2R A;  1YFH A;  3EUA A;  4C3I J;  2NS0 A;  1KZH A;  3U1D A;  2FJR A;  3H3V K;  2IT0 A;  1S7A A;  2QEN A;  5DEQ A;  5FKL A;  3SZG A;  4UUV A;  1X3Z B;  2EA2 A;  3BZC A;  2HCN A;  2Q2E B;  3BT9 A;  2LRD A;  3HOZ J;  4ITV A;  1SD4 A;  1MMS A;  2VOD A;  1QZY A;  4I7H A;  2JSC A;  3PFY A;  4EJW A;  1GXP A;  3I0T A;  3OR1 C;  2PFB A;  2HEO A;  3EUH C;  2CQN A;  4I76 A;  5J1Y A;  3H36 A;  4DIQ A;  5DTM A;  2NYX A;  2STW A;  4JK1 X;  2DQR A;  2LOO A;  1XDS A;  4I6R A;  5C44 J;  2PI0 A;  4GCV A;  3RTR A;  4HQM A;  2QSF X;  1P9Q C;  1ZG3 A;  1SAN A;  4LK0 F;  2E34 A;  2YX7 A;  5M5Y J;  3J81 Z;  4LB6 B;  1LQ1 A;  1ZVV A;  5CVU A;  3FXL A;  3IKV A;  1Z7L A;  2AQF A;  5DD4 A;  3CF2 A;  2W7N A;  4P55 A;  4AYB A;  4P9F A;  3JRA A;  1QZX A;  3HRT A;  4J00 A;  4KJZ A;  3JCU C;  4ER5 A;  2AO9 A;  4X4G A;  2Z2S B;  2WY7 Q;  1TQI A;  2K02 A;  4MFD A;  1T33 A;  4BY7 J;  5FGM A;  1U5T A;  2XAJ A;  4I01 A;  1UXC A;  3FK6 A;  4XLE A;  1AWC A;  3HIF A;  4EJU A;  4K2E A;  2JPB A;  5BNG A;  3KYD B;  3LQR A;  4FIS A;  3COA C;  1F43 A;  2Y0M A;  4XOP A;  4D0P A;  1O7L A;  2OU2 A;  3MKZ A;  1QVT A;  1YE9 A;  3HTU A;  1AU7 A;  1ZZ8 A;  3RPU A;  1WJE A;  4MQV A;  2BXZ A;  2F4M B;  2P8T A;  5IY5 H;  2ICT A;  1PUF A;  1KGS A;  3TO9 A;  3CUQ B;  3ASN H;  3MKW B;  5J4V A;  2BNN A;  2JA2 A;  5DTD A;  3OYF A;  1T0F C;  2DYR H;  1SD6 A;  2XRO A;  2HR3 A;  1MMA A;  2O9L A;  2OCC H;  3KET A;  3PL8 A;  3OYE A;  5E3L A;  4EJT A;  2EF8 A;  3M1E A;  1S7E A;  1RIO H;  1U0J A;  3S1Q J;  5DRY A;  1FTZ A;  1PRU A;  5LRR A;  2VKH A;  5E1W A;  5IOZ A;  1E3O C;  4IX7 A;  1KU9 A;  1BR1 A;  1QVU A;  4BBR J;  2BY3 A;  2LLW A;  3FXQ A;  4C2U A;  3EUS A;  3EET A;  1R23 A;  3BP8 A;  2TRT A;  4BUP A;  3BQZ A;  5BMZ A;  3R09 A;  2K40 A;  4C9Y A;  4MQ9 F;  1ZHF A;  3E1S A;  4AVP A;  4CA0 A;  5LEK A;  2QM3 A;  3GEZ A;  1LKX A;  2XIG A;  2KDZ A;  1I1S A;  3K4K A;  4DZJ A;  2VQL A;  5KNL A;  2DXI A;  4II3 A;  2JZY A;  2ME6 A;  5L3F A;  2M4K A;  4WK8 F;  3CRO L;  4A5M A;  1HSJ A;  3DTE A;  4PGH A;  1FIP A;  5K5R A;  3MWM A;  3ZGK A;  1SFU A;  5CQE A;  3SCG A;  5J1R A;  2OD5 A;  3ABL H;  2FOK A;  3GBF A;  5FFX A;  5BS6 A;  3CC7 I;  2DFH A;  4BDZ A;  1R71 A;  4W1U A;  3V4G A;  1QP0 A;  1DUL A;  2GLO A;  4XN3 A;  3CJQ B;  2IRF G;  5CLS A;  5CKT A;  3K9T A;  4V19 K;  1GUU A;  2ZC2 A;  4WF2 A;  4ZC3 A;  2RC4 A;  5EF6 A;  4XL9 A;  5EGO B;  4F8D A;  2O0Y A;  4HX7 A;  4RB2 C;  3CUO A;  1D1C A;  4IRG A;  4U7B A;  4RGX A;  4RM3 A;  5JVT A;  3KP6 A;  3SFI A;  4PU8 A;  1I3A A;  1ZGW A;  3OKZ A;  2F5D A;  2MH2 A;  2M5W A;  3H5A A;  5E79 C;  3N97 A;  2HDW A;  3OIO A;  3K4M A;  1MFQ C;  4RAY A;  1A35 A;  2EB7 A;  1X1D A;  4XBF A;  5E8I A;  1LFB A;  4EV0 A;  5FLX Z;  2NVQ J;  3RYP A;  3KXA A;  4DOZ A;  1R9T J;  2R3S A;  4F55 A;  1AKH A;  4BH9 A;  5ICE A;  4O8B A;  2QWW A;  2HVQ A;  1X1A A;  4ASN A;  4PJ0 C;  2TCT A;  3N05 A;  3B6A A;  4HF0 A;  1RZ4 A;  3W2A A;  3WG7 H;  1YIT I;  2W85 A;  1CF7 A;  3HPG A;  5D4S A;  3WG9 A;  3H0D A;  2W00 A;  1HQ1 A;  1BBY A;  3FXR A;  1MJA A;  4Z59 A;  3DNV B;  4M9S A;  4B3X A;  4H0E A;  5D4R A;  4L9N A;  3DV8 A;  2OC6 A;  1QZE A;  3ECO A;  4IL6 C;  1BI3 A;  1S3J A;  4BEH B;  1FY7 A;  4RM2 A;  3SDG A;  4DJA A;  3CCM I;  1O3S A;  1F5T A;  1ITY A;  2KEK A;  5EZG A;  4U87 A;  3M9A A;  4PFP A;  2QEX I;  1PRA A;  5M5W J;  3L2V A;  1IUY A;  3A9Y A;  1O3T A;  3ZOB A;  1ZK8 A;  5GAD J;  2VBX A;  1PVE A;  2V9V A;  3BG7 A;  1VQ7 I;  3BCB A;  1VQN I;  2JVG A;  2OF7 A;  1CGP A;  1OQY A;  3D5R C;  4M6Y A;  1XMA A;  2QKM B;  1WJA A;  2DTZ A;  3ZKC A;  4IXA A;  3IVP A;  2H6B A;  4I2O A;  1YRN B;  1WH6 A;  3J7A O;  1XS9 A;  3PO2 J;  1QZZ A;  1KQ0 A;  2L01 A;  2VKE A;  5CVI A;  5EEA A;  2PUB A;  2BOL A;  2ELK A;  2QVO A;  3BZK A;  1F9N A;  2DBB A;  2NNN A;  1IZ1 A;  3I56 I;  4E7K A;  1YW9 A;  3IUO A;  2F6C A;  3CDH A;  4A3I J;  1RNL A;  3ZRG A;  4ER7 A;  3F0C A;  4EGZ A;  1ETO A;  2JUC A;  4GO1 A;  5LD2 C;  3HOX J;  2CV2 A;  3JXD L;  3S3O A;  3KP5 A;  2XAQ A;  2OCE A;  1BOA A;  1QPZ A;  4RAG A;  3FXJ A;  2RNG A;  4IKF A;  3EYI A;  2ZXJ A;  1EH6 A;  3CDI A;  1CQT A;  4A3M J;  2VIX A;  4UB8 C;  1C0W A;  5JVG F;  5FD5 A;  5EDN A;  5J8C A;  3CD6 I;  1Z21 A;  3P9K A;  3DCF A;  1DP3 A;  2HPI A;  1FP1 D;  4WCG A;  1LVA A;  2FFH A;  1R4M B;  2E1O A;  4UNO A;  2B5A A;  2W84 A;  2K9S A;  3OS1 A;  2H1L A;  1SFK A;  2DA2 A;  5B1A H;  3OYG A;  3F6O A;  3IH3 A;  4BE0 A;  1EA3 A;  3I4P A;  1PUE E;  4GFB A;  2JN6 A;  3GTG J;  3S32 A;  3CJR B;  2LR8 A;  2PIJ A;  1YS6 A;  2O6G E;  2D1V A;  2FJ1 A;  3MLF A;  4M9X A;  3U9G A;  2HZD A;  2RVC A;  3ZXS A;  2A68 F;  4XON A;  2Z3Y A;  1X4P A;  3KP7 A;  2BXY A;  1R00 A;  1W7P D;  3IWF A;  1NG6 A;  2JA8 J;  2E1M B;  2VPR A;  1MND A;  3HGG A;  3TED A;  1SEU A;  2VBZ A;  4ENM A;  1TNT A;  2LRE A;  4CO8 A;  4HDV A;  3A9X A;  1H9G A;  4YG4 A;  3A0B C;  3C2H A;  4HV6 A;  2WAE A;  1B9N A;  5F0C A;  4C2M J;  1OJL A;  5DUK A;  1W36 C;  1SMT A;  1D8K A;  2B0L A;  4Y33 A;  5F08 A;  1LLI A;  1HDP A;  3R0J A;  1MW7 A;  2LTP A;  1V4R A;  3F8M A;  5IT3 A;  2ZME B;  2CV0 A;  2JMW A;  1RUO A;  2BEO A;  3EUK L;  1ZZB A;  2XPV A;  3VOE A;  3K0L A;  1O7F A;  3HPH A;  1VTN C;  3OP9 A;  2KIF A;  2LKP A;  1DQU A;  3ABK H;  2E7W A;  2YPR A;  1JGS A;  5JHU A;  5GPA A;  3PE5 A;  2PXL A;  3FMR A;  2WC2 A;  5HS9 A;  1J5Y A;  1XN7 A;  4AM3 A;  1OCR H;  4A2U A;  4A3L J;  3M8E A;  2AWI A;  4RGU A;  1SFE A;  2RDP A;  2P4W A;  1KYW A;  1ADR A;  2Y69 H;  5LLQ A;  3QU3 A;  5ILU A;  1X3W B;  1ERD A;  1EFA A;  5JFR A;  1SVL A;  3EPZ A;  4P9U A;  4D9J A;  5DUI A;  2DOD A;  2V1X A;  3JRD A;  2YSR A;  2VN2 A;  2NS7 A;  3L09 A;  2FQ4 A;  2LFB A;  3RKX A;  5ILV A;  1QQB A;  2PMZ A;  2KZV A;  2K3F A;  2K9Q A;  3QYE A;  2PXQ A;  1Z6R A;  2Y48 A;  4RB3 C;  3IWZ A;  2LYK A;  1TWH J;  3ULQ B;  1BR2 A;  1TZL A;  3G3Z A;  1FP2 A;  3CMA I;  3KP4 A;  2ZSH B;  3C3W A;  2HU9 A;  2CV1 A;  3K1M A;  1K4S A;  4BY1 J;  2H27 A;  3K1N A;  3LMM A;  3FIW A;  4HX8 A;  4F7Z A;  3F52 A;  3C2G A;  4YIF A;  4QPQ A;  1SD5 A;  4XIC A;  2E5N A;  1TNS A;  1NK3 P;  1RI7 A;  3V7S A;  3QPS A;  2M2E A;  3ZMS A;  2Y30 A;  1ZTR A;  4WXH A;  4I98 B;  5KCM A;  3GFL A;  1Y39 A;  2M87 A;  4O5V A;  2PLY A;  4M3E A;  4QTR A;  3PNY A;  5HNH A;  5GTH C;  3QYF A;  1P7I A;  2BW3 B;  3RPQ A;  1R58 A;  1MSE C;  3W3C A;  4N4N B;  2P0W A;  3LSR A;  3JR9 A;  4BHP A;  2IS6 A;  1T08 B;  3T8T A;  4UVA A;  3V7C A;  3KP3 A;  3OV8 A;  1T6S A;  1Z0X A;  2JVL A;  4IHT A;  4NQW A;  3CCV I;  1J7K A;  4BDY A;  5C3E J;  1BDI A;  1YYV A;  4DNC A;  2NVX J;  3H92 A;  3MN2 A;  1F1Z A;  4BAY A;  3REO A;  2ICP A;  5HLG A;  1XSD A;  2VBW A;  3QQA A;  5LBQ A;  5J1U A;  2KRC A;  4D5C A;  4FE4 A;  1U6G A;  2H6C A;  2HNH A;  3BG6 A;  1HA8 A;  2IGO A;  2ZBK A;  4PU7 A;  2ESH A;  3DBL B;  2LLV A;  2V26 A;  2WAF A;  4OU0 A;  4XKB A;  2EFO A;  3ZMZ A;  4C3H J;  3HSE A;  1MH3 A;  2H09 A;  4D7N A;  2L4M A;  3A01 B;  2XPU A;  3LSM A;  2XF5 A;  2M8G X;  5JUW A;  1B0N A;  3G2B A;  2V4J C;  2DMU A;  4H4K C;  2PQ8 A;  1SAX A;  2OR1 L;  2CUF A;  1XMK A;  2J7W A;  3WHB A;  1AOY A;  2XVC A;  2M7A A;  3L1P A;  3K10 A;  4CZZ A;  4PSX A;  3JRH A;  4V2F A;  3CCJ I;  3BJA A;  4HNT A;  3C7J A;  2O8K A;  2CQK A;  2GIV A;  4ZYA A;  2EV0 A;  1KYZ A;  2X1C A;  1SFO J;  5DT2 A;  2R7T A;  3FM5 A;  3K4B A;  2Y0S N;  2KRH A;  5DM7 F;  1X2N A;  2P6T A;  1Z9C A;  2FQ3 A;  2XJ3 A;  3BR1 A;  2HCS A;  2XXA A;  3J7Y J;  3Q9S A;  3ZN0 A;  1H8A C;  3KZ3 A;  3MZ8 A;  3NWS A;  3LA2 A;  4M71 A;  2V1N A;  4FHT A;  4N0B A;  2MG4 A;  2Y2Z A;  3DWL E;  4FQG A;  2H94 A;  3V42 A;  3A0H C;  2FOW A;  2LC2 A;  4O3M A;  3SEZ A;  3LA3 A;  4UV9 A;  2QBY A;  3ONQ A;  4AC0 A;  1EH7 A;  2HIN A;  3G6E I;  3KLN A;  4UUS B;  4HF1 A;  1MJB A;  2DMP A;  5IP7 J;  2VE9 A;  5K98 B;  1YJW I;  5FRN A;  4MGR A;  2A6T A;  2JRM A;  4NUB A;  2IXS A;  4A3K J;  2VXD A;  4P1W A;  2ZME C;  3WTY C;  2CO5 A;  2LNB A;  5FJ8 J;  3TO7 A;  1IV6 A;  2OJE D;  1MGT A;  2KL4 A;  2DK5 A;  2Z99 A;  3HOT A;  1WI3 A;  3GXO A;  3A03 A;  4XR6 A;  1B6A A;  2P5V A;  2Y75 A;  2VON A;  1WIZ A;  2HQR A;  1S29 A;  3H1C A;  4C30 A;  2ZKZ A;  3ZMT A;  1TT5 B;  1YHQ I;  2R7F A;  1YOV B;  3CCL I;  1XWR A;  3ME5 A;  5F1J A;  1XSV A;  3SEQ A;  3K70 D;  2MQK A;  4E7Z A;  4M9Z A;  3W6K B;  3AG4 H;  5EGO A;  3JRC A;  5HLI A;  3WU1 B;  1FJL A;  1ULY A;  1BW6 A;  2HYF A;  4OWR B;  1G3Y A;  5LGN A;  2JWT A;  1TW3 A;  2MC3 A;  4EVI A;  3DU5 A;  1RES A;  4YFK F;  1ZZ6 A;  2VI6 A;  1RZR D;  2KPM A;  3OIQ A;  4A3B J;  3NAR A;  3GTJ J;  1OIS A;  4ZYG A;  2DT6 A;  4M6V A;  5ED4 A;  1D8J A;  1T95 A;  1EH8 A;  4ZYH A;  4GQM A;  3G1L A;  3V7R A;  2HKX A;  3Q9V A;  2FBI A;  2DAO A;  3SX0 A;  2IS2 A;  1RET A;  4BXX J;  4X0G A;  2EWT A;  1GLN A;  2KJB A;  2R7W A;  4IVZ A;  4F91 B;  5IT9 K;  2YS9 A;  2LY2 A;  5CPR B;  4ZYD A;  2CFX A;  4HAM A;  3VYR B;  1VQK I;  3C1D A;  4LG3 A;  2DW4 A;  5DCM B;  3OYD A;  5FRM A;  3H0G J;  3BJ6 A;  4Y7N J;  2VE8 A;  3FF5 A;  4U0Y A;  2HQA A;  3BD1 A;  4FT8 A;  1MDM B;  2CUJ A;  1KU3 A;  2QSG X;  4A12 A;  1ZN2 A;  4FX4 A;  3OOP A;  2AXT C;  4XID A;  4ZTJ A;  1D1A A;  3L2C A;  4IOC F;  2XCJ A;  5IOY A;  3WTS C;  3CF5 F;  1Z3X A;  3DXJ F;  2VC1 A;  2O4A A;  2HI3 A;  1S7O A;  3HB9 A;  3ZQI A;  2DA4 A;  4JQD A;  2DMN A;  2DO7 A;  4XN0 A;  1P4X A;  4RS8 A;  1XMX A;  2XAG A;  1ZRE A;  1X2L A;  2KEJ A;  3WU2 C;  3BPX A;  2GM4 A;  3SCF A;  5IP6 A;  4EEF G;  3MCZ A;  5DSX A;  2TDX A;  4RB0 A;  4DBR A;  2WA0 A;  2MFZ A;  2R63 A;  3EDP A;  1JT0 A;  3FBN B;  3GFM A;  4YG2 F;  4KIS A;  1NEQ A;  5LGU A;  1N75 A;  2OAZ A;  1DP7 P;  2L9R A;  1POU A;  3E97 A;  3FHN A;  3DU6 A;  3OSG A;  2K85 A;  3VDX A;  2R7O A;  1I6H J;  5B1B H;  3KJX A;  2CFO A;  3BWG A;  2LYL A;  4GYI A;  4M3D A;  1VI0 A;  1Y6I A;  4HLX A;  1WWX A;  3ABM H;  4M3G A;  1D1B A;  2JA6 J;  5LRS A;  3WHC A;  3J7A Y;  1R63 A;  2VJ4 A;  4IPA A;  5FLX K;  1E3H A;  2M3A A;  5GAG i;  2PXD A;  3G1O A;  2HWV A;  3WGI A;  5BPD A;  1RZS A;  3FYA A;  3QPT A;  1TTY A;  2XUB A;  4PJL A;  1PP7 U;  1I27 A;  1ZLK A;  2GXA A;  1LDD A;  4BJ6 C;  2JJ7 A;  2PMZ N;  1LFU P;  2OTL I;  3HZI B;  2R5Z A;  1JHH A;  4BHB A;  9ANT A;  1USS A;  5F1R A;  3ZQC A;  1VQP I;  2R7V A;  4IA8 A;  4JCY A;  5C4X J;  4CYD A;  1HLV A;  1OKR A;  5DM6 F;  3GTP J;  1NH3 A;  1U5T C;  3GCM A;  4HQE A;  1GHC A;  4BXU A;  5FKM A;  2DT7 B;  3AG3 H;  4IO9 F;  1OYW A;  1YI2 I;  3ABT A;  4HNV A;  1LCD A;  1QP7 A;  1PER L;  3CES A;  2ELH A;  3CMM A;  3FWE A;  2XV4 S;  4ER3 A;  1KA8 A;  4EQZ A;  4P96 A;  3M07 A;  4UXN A;  1J0R A;  4RLQ A;  2HOS A;  2JVH A;  4EKI A;  4ZJZ A;  2LCV A;  4OIR F;  3W2W A;  4U0W A;  1Z91 A;  2HVS A;  2A6C A;  4Q2J A;  3UFD A;  2W48 A;  3O6B B;  4ZDL A;  3A2K A;  1UST A;  2I5U A;  1HW5 A;  1BW5 A;  2DI3 A;  3DKY A;  3SHF A;  4KT6 A;  5EEG A;  2A05 A;  2XF6 A;  3S3M A;  4QSH A;  3MEX A;  3OIP A;  1K78 A;  3ECH A;  2VL8 A;  3HBL A;  1MMD A;  1I5Z A;  4RA2 A;  2O03 A;  1Y8Q B;  4NB5 A;  4XM3 A;  4BQA A;  4CXF A;  5E3N A;  1U8B A;  2Q0O A;  1APL C;  2PXV A;  3W6J B;  2D2W A;  4XRM A;  4YIR X;  1PNR A;  2KIM A;  3RJP A;  4BBS J;  3I5U A;  3BTC A;  3CLO A;  3WTX C;  1H88 C;  3FM3 A;  3KEY A;  4YG1 A;  3U3W A;  1W1W E;  2BVL A;  4HG2 A;  4BS9 A;  2WV0 A;  4J1W A;  1JUP A;  5IP9 J;  4UB6 C;  3SYT A;  5K5Q A;  5GP9 A;  3TRB A;  3R1F A;  3F3X A;  3RI4 A;  4IF4 A;  2LYS A;  3HZJ A;  1ZG1 A;  2NXN B;  1S8N A;  1JUM A;  4TV7 A;  3DM5 A;  5FRO A;  2CWE A;  2ACJ A;  2ISZ A;  2K7L A;  3QYX A;  4M72 A;  2O61 A;  4QPO A;  4CDG A;  3WTT C;  3NEU A;  3CUQ C;  2E35 A;  4GRI A;  1ETY A;  1ZGA A;  1IG7 A;  3GF2 A;  2CQ7 A;  1FWZ A;  3O8H A;  4YII A;  4BE1 A;  2R7Q A;  1YIJ I;  5TIS C;  1DW9 A;  3I4N J;  1UHM A;  2WAQ A;  2WY8 Q;  4PJN A;  4BXF A;  2L3D A;  2M9H A;  3D5L A;  3CCY A;  2MLG A;  4XRS G;  3K4J A;  3S8Q A;  3DKW A;  3BR5 A;  4KMF A;  2LY9 A;  2OZU A;  2X6X A;  3ISP A;  5KK1 A;  4GHJ A;  2GWR A;  2PXF A;  3ZQF A;  1X4O A;  3S2H J;  2VJI A;  3MKL A;  2EK5 A;  1UMQ A;  2MSY A;  2ECC A;  5K7F A;  1VQ5 I;  3LQQ A;  4B3A A;  4DGW B;  3TOB A;  3OQO A;  4BYY A;  4EQQ A;  4BL0 B;  4E7J A;  1TW2 A;  4NHJ A;  2ZFW A;  3TOA A;  3KYL A;  3CLC A;  3WE3 A;  1XCV A;  2DDB A;  1XB4 A;  5H6R A;  2UV1 A;  3GX4 X;  2Z1D A;  1F4K A;  2D45 A;  3WGH A;  1XGO A;  4HPQ A;  5D8K B;  1YO5 C;  1T8I A;  5EG0 B;  1UG2 A;  3MKY B;  3CP8 A;  1E3P A;  2XB5 A;  2QCO A;  3JW4 A;  1HKQ A;  1YG2 A;  2Y31 A;  2YR2 A;  1PJR A;  1FOW A;  2A6E F;  1BL0 A;  4A69 C;  2CSO A;  2CGP A;  2JRT A;  4EMS A;  2EV6 A;  3OWT A;  1YJN I;  2V1U A;  3CCE I;  2DA6 A;  2R92 J;  4YEL A;  2FF4 A;  1JWL A;  3HGY A;  1H89 C;  3QRF F;  5L3C A;  4G7H F;  1W0U A;  2K9N A;  2KFD A;  1SFX A;  5CVR A;  1NW3 A;  3HKZ A;  3MVP A;  1GV2 A;  1I39 A;  1ZEL A;  4HX4 A;  3A02 A;  4G12 A;  3TO6 A;  2VXZ A;  2ZO4 A;  1B8I A;  3TP3 A;  5F0F A;  3T5X A;  2QQB A;  4BU2 A;  1B72 B;  2B7E A;  5LGT A;  4L9T A;  2QSH X;  2PUF A;  4EM1 A;  4A0Z A;  1BC7 C;  4KN7 X;  3OL3 A;  3PIO F;  4BKX A;  1HST A;  5AIP A;  1WKM A;  2PXB A;  4PJM A;  3U1K A;  1Z77 A;  4AU7 A;  2L54 A;  3HSR A;  5B5E C;  2VQC A;  5EG0 A;  5IPA A;  1JHF A;  3VYU B;  2VT2 A;  1T56 A;  2VC0 A;  2FNP A;  2NVU B;  4EAT A;  5LHI A;  2IVM A;  3S2D J;  2JSP A;  1GVJ A;  1VZ0 A;  4L9V A;  2LD5 A;  2PUA A;  3SFZ A;  2NRA C;  2KP6 A;  5J4Y A;  4IHY A;  1BN5 A;  3I55 I;  1ETV A;  1DPR A;  2K9L A;  2M7B A;  3TW6 A;  4M3B A;  4Z5D A;  2V3C C;  1IDZ A;  4JBA A;  2DA7 A;  4RGR A;  2COB A;  1UEL B;  4MLO A;  1Y9Q A;  3K2A A;  2V6C A;  3TMO A;  2L7M P;  3DLA A;  2ESN A;  3QAH A;  1ETX A;  4U0V A;  1W0T A;  3JSP A;  4IEJ A;  4AIH A;  1ZZC A;  3HM5 A;  3PO3 J;  4XRS A;  4LLG F;  1FSE A;  4WWC A;  2WBM A;  3BQY A;  4JP0 A;  4CCM A;  1XCB A;  4HYE A;  5F0H A;  3I59 A;  3LSJ A;  5FD6 A;  2PXK A;  2HTS A;  4FX0 A;  4ON0 A;  3OYL A;  2R93 J;  2O49 A;  4IHX A;  4E4H A;  1IC8 A;  2MC4 A;  3EQL F;  1DUX C;  2L8N A;  3O3K A;  2K86 A;  2XRL A;  1SAU A;  3TW7 A;  2GRM A;  2M4H A;  3S93 A;  2L1P A;  1XC5 A;  1BC8 C;  2A07 F;  2FXA A;  2K3P A;  2YBD A;  4AWX B;  4CCK A;  3H5R A;  4L5E A;  2DOF A;  1D0Z A;  1UHS A;  1V5F A;  1KU2 A;  1R5I D;  4YFX F;  5D5V B;  4J19 A;  2XXP A;  5ICG A;  1WJB A;  1SMY F;  2AQE A;  2DA1 A;  3BRO A;  2KDO A;  5K7Z A;  1J59 A;  2QBY B;  3ZPX A;  2QYO A;  2CH0 A;  1I3Q J;  4RLF A;  1V55 H;  5FB2 A;  3FKJ A;  3IP4 B;  5C4J J;  1MMN A;  4JOM A;  1U8R A;  3OQN A;  3I54 A;  5D5U B;  3FXK A;  2O8X A;  3CDL A;  4XLP F;  1K7A A;  5DCM A;  5AON A;  3G71 I;  3HRM A;  4LB5 A;  1TWG J;  1LDK B;  3D5S C;  2UWM A;  1OCT C;  3N4M A;  1Z3Y A;  2ZSI B;  1KQ9 A;  4B44 A;  1GT0 C;  1SVM A;  4EK9 A;  3E5Q A;  4BGD A;  4I8T A;  2PXP A;  2GIZ A;  3JTG A;  1R5H A;  3BY6 A;  4ESJ A;  1JJ6 C;  4JX5 A;  1G8X A;  1B59 A;  5F04 A;  1R5G A;  3LSK A;  2CUZ A;  4FCY A;  1YSE A;  3GUU A;  2BGC A;  1WFX A;  3DFG A;  3HOS A;  5E17 F;  2FUG 2;  1G3T A;  2VKV A;  1RKW A;  1LUJ B;  2IUO A;  2WWY A;  5J40 A;  3AKZ A;  3RKW A;  1A36 A;  1ZRC A;  2VOO A;  1WSU A;  2ID6 A;  4YBA A;  3DTI A;  2H1K A;  1X1C A;  4U7D A;  3CQZ J;  1OYY A;  3KP2 A;  1Z6T A;  4E70 A;  4ZTF A;  1P92 A;  2NS8 A;  2RQP A;  1T2K A;  3ZR8 X;  1IN7 A;  2IU7 A;  4WVL A;  2XGC A;  3J81 K;  1J9I A;  4E7L A;  4HRA A;  2V1D A;  3ZP5 A;  2NAZ A;  4PJJ A;  1ZZ9 A;  2M8E A;  5FKK A;  5IYC J;  1Y0U A;  1L1M A;  2NOG A;  5HS8 A;  4Y4R A;  2BJC A;  4DQ2 A;  1UJ8 A;  2W57 A;  1O3R A;  4XOT A;  4I6T A;  4N9H A;  3MFK A;  3UWP A;  4NQW B;  1GV5 A;  1IRX A;  4A3C J;  1MBE A;  2IBD A;  3I71 A;  2HQ5 A;  1TWA J;  1Z05 A;  1ODD A;  1T0F A;  2EWN A;  2M0C A;  2FEZ A;  2Q1Z B;  3QQ6 A;  2YU9 J;  4O6J A;  2KJC A;  4CHU A;  3OQM A;  1GVD A;  1DGW Y;  2PMU A;  2LY1 A;  3GLX A;  3PM1 A;  2HPM A;  4HEA 2;  4NDL A;  3U21 A;  2MA3 A;  2OA4 A;  2FE3 A;  3BTI A;  1BJZ A;  1ZKG A;  2XIU A;  2GA1 A;  2ZXI A;  2GZW A;  4AYB N;  2LKS A;  1QNT A;  3KZI C;  1RKT A;  3K4L A;  5E3M A;  3Q5F A;  2LP0 A;  3T1B A;  2E71 A;  1PP8 F;  3F8F A;  4CCO A;  4KDP A;  3S16 J;  3VSL A;  2HDD A;  1FPQ A;  3VWS A;  3LFU A;  1ACI A;  1ZLJ A;  2FRH A;  1BA5 A;  4C3J J;  1ZZ7 A;  1BI2 A;  4CIC A;  2IEK A;  4EZI A;  2HS5 A;  1OR7 C;  3FYM A;  4IWR A;  3BDD A;  4IZZ A;  2XAU A;  4A3D J;  4Q47 A;  2CU7 A;  4S04 A;  2E1N A;  2EFP A;  1IAW A;  2IAI A;  4A0Y A;  2V79 A;  2FSW A;  4IJA A;  3BG3 A;  1MBG A;  2KIQ A;  5ICF A;  4M3F A;  4ZH4 F;  1K4T A;  1JKQ C;  2LF7 A;  1U78 A;  3IRR A;  2G7U A;  2XXQ A;  4RAZ A;  2GRL A;  1MDM A;  4EKG A;  2OPT A;  3K2Z A;  4UV8 A;  2LYP A;  2NOJ B;  4F3Q A;  4Y15 A;  1DWK A;  2VEO A;  3C2B A;  4E7H A;  3O9X A;  3DLL F;  3MAJ A;  5D6E A;  4JX6 A;  3PIP F;  2WAD A;  3L00 A;  4PUS A;  1WRJ A;  3BJO A;  4UHT A;  3FK7 A;  3PNT A;  1OMI A;  5A2Q Z;  1FYL A;  3I4M J;  3S3N A;  3S1N J;  2VBY A;  1VQ6 I;  3S15 J;  3PSI A;  3JAM Z;  3IL2 A;  3IH2 A;  3JRI A;  3M3Y J;  1YJ9 I;  4Y3O A;  2W1O A;  2QKL B;  3WE2 A;  2N8G A;  4PZJ A;  3J80 K;  4OB4 A;  3HSF A;  3DPT A;  2HYG D;  2YUS A;  1JJ8 C;  4OOI A;  1P2F A;  3F72 A;  4XLC A;  3F51 A;  4ENJ A;  1X1B A;  3TBI A;  4JCX A;  2EV5 A;  2AXL A;  3D0S A;  1FEX A;  4FN3 A;  3LWF A;  3BR6 A;  4D5F A;  5M3M J;  5TGT A;  2OZ6 A;  3H9G A;  2LDU A;  2HQN A;  4NC6 A;  1UB9 A;  4LLN A;  3O8G A;  4M73 A;  1RPE L;  3BR2 A;  1HDD C;  2UXN A;  4KNY A;  3LL7 A;  4G7O F;  2RRE A;  3I64 A;  1IXC A;  2VT3 A;  3JTH A;  4ZDO A;  3LOC A;  4OMY A;  4NC8 A;  3VK0 A;  3QFI A;  1FYM A;  2EZI A;  4G6Q A;  5FKO A;  4MEY F;  4AIK A;  2FBK A;  2R1J L;  3LSP A;  2I8D A;  2EJR A;  3MEJ A;  3B02 A;  2MXD A;  2BHZ A;  1KQ8 A;  3HJE A;  1ZGJ A;  3K6G A;  2L49 A;  1IJW C;  2L7F P;  1E0E A;  4Y13 A;  3E5X A;  1JTY A;  5DTR A;  3PUB A;  3S1M J;  1JI8 A;  1VND A;  2G0E A;  2Z5U A;  1G2H A;  2ZXH A;  1FBQ A;  3KZZ A;  3QYB A;  4G7Z F;  1JUS A;  1TBX A;  1RIO A;  1XDU A;  1FMW A;  3J80 Z;  1OCP A;  2ID3 A;  4MCX A;  1MIJ A;  5JLX A;  1Y56 A;  1QB2 A;  3R60 A;  2CUE A;  5KAF C;  3NXH A;  3CO7 C;  2Y9Z A;  4J01 A;  3M8F A;  3H3U A;  4KIG A;  2ZXW H;  2KIU A;  3FX3 A;  1FOY A;  3ZN1 A;  2JA5 J;  2OTJ I;  4ABZ A;  5GTI C;  2V7F A;  2ZME A;  3SXY A;  3SZT A;  1D0X A;  1LFP A;  1AA7 A;  2K4J A;  3SZP A;  2GAU A;  1OYI A;  4GXO A;  3LNQ A;  2F4I A;  5L3B A;  3GN5 B;  4QWQ A;  3B7H A;  3AL0 C;  1S72 I;  1SVO A;  4V2G A;  2R7X A;  3L2U A;  2PUC A;  2F2E A;  2FD5 A;  4XMY A;  4BEH A;  2OQR A;  2IS1 A;  3G4S I;  2CG4 A;  3K4N A;  3CMY A;  2PPX A;  2VAS A;  4Z58 A;  3BDN A;  1EV7 A;  2D1H A;  1U2W A;  3HUG B;  5EZH A;  4ER6 A;  1NG7 A;  2PUE A;  4Q48 A;  5HDN A;  1K61 A;  3NRV A;  2PE5 A;  3OYI A;  4ENN A;  1R22 A;  2O5R A;  3HOU J;  3ZHM A;  1ZPQ A;  5M5X J;  3C18 A;  2VUM J;  3GZD C;  2EPF A;  3DKX A;  1YLF A;  4JYK A;  5IYB J;  3HHH A;  3MZH A;  2EA4 A;  1STZ A;  1HQC A;  1QHH D;  1FIA A;  3HTS B;  1PRV A;  2PEX A;  4A6D A;  1BR4 A;  1YTY A;  2KT0 A;  2PG4 A;  2LH9 A;  2EIK H;  5BOX A;  4HA8 A;  2DU9 A;  3KEQ A;  3WU0 A;  4GYG A;  5K5O A;  2XC7 A;  3BC8 A;  1LJ9 A;  4I0A A;  4ER0 A;  2PJR B;  1FMV A;  3QU6 A;  1W5S A;  1VFC A;  2X1E A;  1IRF A;  3ERE D;  1POG A;  2UZK A;  2LYQ A;  2MBF A;  3GLL A;  1YRN A;  2GZU A;  1A6I A;  2LBF A;  3BTL A;  1XX5 A;  2RKH A;  2C6Y A;  1ONV A;  5HS7 A;  3VFZ A;  2XKP A;  3V8J A;  1K78 B;  1P4A A;  3GFJ A;  4ZYE A;  3DTK A;  3OYA A;  4PK4 A;  1XPX A;  1N78 A;  1FBU A;  4A93 J;  4MCT A;  5E3O A;  4EM0 B;  1WH7 A;  3RZD J;  1UTX A;  4UUT A;  1ZS4 A;  4Z6Y A;  3IAS 2;  4KIT B;  2PUD A;  3F8C A;  1YW7 A;  4MTE A;  1ENH A;  2PX9 A;  4LK1 F;  2WIU B;  2E2H J;  1ZAR A;  2X85 A;  1FYK A;  3I58 A;  3I53 A;  4L5I A;  1E17 A;  3QOW A;  4B09 A;  1IXS B;  5BQT A;  5LEJ A;  2QQ9 A;  2IGK A;  1R4N B;  1G59 A;  1TLH B;  3FIS A;  4KUM A;  2R7S A;  2HKO A;  4KA4 A;  2O38 A;  1NER A;  2P5K A;  4MNU A;  2RQQ A;  5DD8 A;  3D1N I;  3LFP A;  4S05 A;  5E8G A;  3FMS A;  1HCR A;  4X4E A;  3OYC A;  1LE8 A;  2ECB A;  3QOD A;  3QPL A;  2P7V B;  2Z16 A;  1WJD A;  3PQJ A;  4MFE A;  1S9H A;  2KZ8 A;  1BJA A;  5D8L B;  1RPW A;  1W5C C;  1T38 A;  4X4B A;  2PXT A;  2W82 A;  2XGE A;  3GZN B;  3T8R A;  4A5N A;  3HL2 A;  1MBK A;  3K7A J;  4BQQ A;  2R5Y B;  4XOR A;  4OBM A;  2R7Z J;  2I10 A;  1A31 A;  3V8K A;  3VYS B;  4W97 A;  4ESB A;  2F5C A;  1EJ9 A;  2CYY A;  3WTW C;  2HXI A;  1ZG5 A;  1V5E A;  1OCC H;  2ICW G;  4YRV A;  2R7D A;  4F52 A;  5B66 C;  2JA7 J;  2CW8 A;  1JH9 A;  4ZZD A;  2X4H A;  2L9V A;  1OR7 A;  1R49 A;  2FX0 A;  2GOM A;  4MO7 A;  3S8P A;  5B3S H;  2KMU A;  1MBJ A;  3H9Q A;  1DU0 A;  2IVB A;  5LFA A;  3GYH X;  3HHG A;  1QHG A;  5KVR A;  3VSK A;  4L9J A;  3M8J A;  4G6T B;  3NWT A;  4P5O A;  1VQO I;  3ZQ7 A;  1P7J A;  1ZR4 A;  5JLW A;  2NVT J;  3F6W A;  3KL4 A;  2DMQ A;  3HRU A;  2KQR A;  2X6W A;  3R4K A;  5HVQ C;  2E60 A;  4N9I A;  2HZT A;  1YX3 A;  3CO6 C;  1UAA A;  2HTJ A;  5H2F C;  1MBH A;  2MD0 A;  3DPL C;  2DJI A;  2Z33 A;  3GTO J;  4GDF A;  2ISY A;  1IN8 A;  2PN6 A;  2CS3 A;  3ZPL A;  2RV8 A;  2M34 A;  1ETW A;  3BPV A;  3R61 A;  2K4B A;  2JQE A;  2R5Y A;  3A4C A;  5DRT A;  4XK4 A;  2DA3 A;  1XGN A;  4M6X A;  2R5Z B;  2PJP A;  1GXQ A;  1MJ9 A;  1W36 D;  1OSL A;  1K83 J;  3KIO A;  4XSX F;  4HZF A;  2EH3 A;  1WGX A;  1HKS A;  1JE8 A;  1NK2 P;  1M1E B;  1AHD P;  1OCO H;  1WI9 A;  4OIP F;  4PU3 C;  2X6O A;  2LYC A;  1I50 J;  4Z2Y A;  1JKO C;  3LSG A;  3K70 C;  2MD5 A;  2NVY J;  3K69 A;  3GZ6 A;  2DOA A;  1OPC A;  5ILS A;  1JKP C;  2AXZ A;  3G0T A;  4EJV A;  2L02 A;  3JRB A;  1SQ8 A;  5BPI A;  2DPU A;  2O3F A;  4CGZ A;  2LSO A;  1UG0 A;  2OBP A;  4Y42 A;  3NZL A;  3E6M A;  1HBX G;  4KIB A;  2VKD A;  3RPU D;  2MLK A;  2A69 F;  5J47 A;  4RDU A;  1U9O A;  1FZP B;  1YQA A;  2IA0 A;  3QWG A;  4NDW A;  4LG0 A;  5D5W B;  2QA4 I;  4D7M A;  3M4O J;  4C2T A;  2CW7 A;  5EEH A;  1FSH A;  2ETH A;  1DDN A;  1XGM A;  2DCE A;  2WTE A;  4DZP A;  2DT5 A;  1ZQ3 P;  4Q5S F;  5CVJ A;  1R7J A;  2AHQ A;  2Y9Y A;  2KZG A;  4YFN F;  2RAE A;  4OIO F;  2QZ8 A;  3KX2 A;  3GBG A;  3UNG C;  3HDD A;  1B9M A;  3OR2 C;  2GOX B;  2FML A;  4LOC A;  5GPC A;  1QP4 A;  4HST A;  2G7H A;  4I09 A;  2KIS A;  5CJ9 A;  3HC7 A;  4FET A;  3W2V A;  3FMY A;  4L0Z B;  2BW3 A;  2X1D A;  4KIF A;  4UUS A;  5A7L A;  2DN0 A;  4DBQ A;  4OIQ F;  4BHC A;  3NDB B;  3GUD A;  2ODR D;  1TQP A;  3BR0 A;  2GBY A;  3FKI J;  3F8N A;  2IVG A;  1JKR C;  4HF2 A;  1JFT A;  4MEX F;  4X4C A;  2M4G A;  4EM2 A;  2FBH A;  4RBO A;  4GGG A;  1U3E M;  1Q1H A;  3J7Z I;  5AIQ A;  2HOE A;  5ICC A;  2Q2E A;  2EBI A;  2CRO A;  3GW2 A;  2DDA A;  4BJ5 C;  3VB2 A;  4HNU A;  1HKT A;  3JRE A;  1QU3 A;  2AXV A;  2R0Q C;  5HDK A;  1R69 A;  3G7D A;  2PUG A;  1WQ2 A;  2VPL A;  2BVM A;  1UXD A;  5J3L A;  2WUS R;  1ZAY A;  3ZQG A;  2P5L C;  3LAJ A;  2QF7 A;  1ETK A;  5F6F A;  2COM A;  3FBI B;  4CCN A;  5FLV A;  3GME A;  1D5V A;  2V9K A;  4Z5C A;  2JPC A;  2XRN A;  4HSR A;  3OOU A;  5TJJ A;  2EIL H;  3CP2 A;  3LAP A;  2ZJ2 A;  5LHG A;  1HW1 A;  3M1C A;  4LGW A;  5HLH A;  3E6C C;  2STT A;  2V6E A;  2YU3 A;  1X3U A;  5K7H A;  2FMY A;  2J7U A;  2ZFU A;  6PAX A;  4A3F J;  2JCG A;  3S2W A;  4UVB A;  2VLA A;  1A04 A;  2NNY A;  4D1Q A;  3GZD A; 
#chains in the Genus database with same CATH homology
 4Y52 J;  3S16 J;  2HDD A;  3ZQH A;  4IHV A;  1WIZ A;  4C3I J;  1BA5 A;  4C3J J;  1ZZ7 A;  4A3E J;  2FJR A;  3H3V K;  2IEK A;  1XWR A;  5FKL A;  5F1J A;  2JK3 A;  1HF0 A;  3FYM A;  4IWR A;  2MQK A;  3BT9 A;  3HOZ J;  4A3D J;  1ORK A;  2HXO A;  2CU7 A;  5EGO A;  3JRC A;  3PXP A;  2IAI A;  3ZQL A;  1VPW A;  1FJL A;  3QF3 A;  1BW6 A;  3BG3 A;  1MBG A;  2JWT A;  4M3F A;  4I76 A;  5J1Y A;  1RES A;  1ZZ6 A;  1JKQ C;  2VI6 A;  1U78 A;  1RZR D;  4A3B J;  4I6U A;  3NAR A;  2GRL A;  3GTJ J;  2OPT A;  4M6V A;  2LYP A;  4I6R A;  5C44 J;  4GQM A;  2MW8 A;  3G1L A;  1DWK A;  3ZHI A;  3C2B A;  3O9X A;  3RKQ A;  1SAN A;  1RET A;  5M5Y J;  3S17 J;  4BXX J;  2HOA A;  2EWT A;  1ZVV A;  4JX6 A;  2EZH A;  2IV1 A;  3FK7 A;  3I4M J;  3JRA A;  3S1N J;  1MSF C;  4IVZ A;  2CQQ A;  3RQI A;  1LQC A;  3S15 J;  2AO9 A;  2YS9 A;  4X4G A;  3IH2 A;  4B4C A;  3JRI A;  3M3Y J;  4MFD A;  1T33 A;  4BY7 J;  1UXC A;  3H0G J;  3FK6 A;  4Y7N J;  1JGG A;  2N8G A;  4OB4 A;  3BD1 A;  5BNG A;  4FIS A;  1F43 A;  5HOD A;  4XID A;  1QVT A;  1AU7 A;  2YUS A;  1ZZ8 A;  2XPW A;  1JJ8 C;  3Q0U A;  2XCJ A;  3F51 A;  3Q3S A;  5IOY A;  2ICT A;  4JCX A;  1PUF A;  3W6V A;  4FN3 A;  1FEX A;  2O4A A;  2HI3 A;  3BR6 A;  3HB9 A;  4D5F A;  5M3M J;  2BNN A;  3ZQI A;  4AUX A;  2DA4 A;  5DTD A;  4JQD A;  2DA5 A;  2DMN A;  3O8G A;  1RPE L;  3BR2 A;  1HDD C;  2O9L A;  1X2L A;  2E2J J;  2OFY A;  2KEJ A;  2GM4 A;  4DYQ A;  5IP6 A;  4EEF G;  4X6A J;  3SCF A;  2MGQ A;  2EF8 A;  3LOC A;  5E3L A;  1S7E A;  2R63 A;  1JT0 A;  3VK0 A;  3JXC L;  3GN5 A;  3S1Q J;  1NEQ A;  1FTZ A;  1PRU A;  2XI8 A;  5IOZ A;  2EZI A;  1E3O C;  5FKO A;  3GTM J;  1QVU A;  4BBR J;  2L9R A;  3S14 J;  1POU A;  3GTK J;  2R1J L;  3EUS A;  3LSP A;  1BDH A;  5FKN A;  2TRT A;  3BQZ A;  3OSG A;  2K40 A;  4YAR A;  1I6H J;  3KJX A;  2LYL A;  3UKG A;  4DYC A;  2L49 A;  2KDZ A;  1IJW C;  2L7F P;  2B63 J;  1FTT A;  4M3D A;  1VI0 A;  1WCM J;  4DZJ A;  4M3G A;  1QPI A;  4FE7 A;  2ME6 A;  2JA6 J;  1JTY A;  3WHC A;  1TC3 C;  1R63 A;  2LYR A;  3CRO L;  3S1M J;  1VND A;  2G0E A;  1G2H A;  3S1R J;  3G1O A;  1FIP A;  3FYA A;  1RZS A;  1JUS A;  1RIO A;  3SCG A;  5J1R A;  1OCP A;  2ID3 A;  1JFS A;  3GBF A;  5JLX A;  4MCX A;  2CUE A;  2JJ7 A;  2PMZ N;  2X48 A;  2LVS A;  2Y9Z A;  1LFU P;  3HZI B;  5EYR A;  2R5Z A;  9ANT A;  3ZQC A;  4IA8 A;  4JCY A;  4W1U A;  5C4X J;  3OSF A;  3HKZ N;  1HLV A;  3GTP J;  1QP0 A;  2JA5 J;  2GLO A;  1AKH B;  4IHW A;  4ABZ A;  4YG7 B;  1GUU A;  5FKM A;  5EF6 A;  5EGO B;  4F8D A;  3LNQ A;  4HNV A;  1LCD A;  1QP7 A;  1PER L;  3SFI A;  4PU8 A;  3GN5 B;  1OFC X;  1ZGW A;  2HOS A;  1MBF A;  3B7H A;  4MIM A;  2LCV A;  3GTQ J;  4V2G A;  4X4H A;  2XSD C;  3OIO A;  2A6C A;  3UFD A;  2PUC A;  2FD5 A;  2L7Z A;  2WV1 A;  2W48 A;  3CMY A;  1BW5 A;  1X57 A;  2PPX A;  1LFB A;  2NVQ J;  4Z58 A;  3BDN A;  1VF9 A;  4QSH A;  3E7L A;  3KXA A;  1R9T J;  5EZH A;  3HBL A;  1AKH A;  2PUE A;  4O8B A;  1K61 A;  5E3N A;  2WAQ N;  2WB1 N;  1U8B A;  2TCT A;  2PE5 A;  3B6A A;  3JXB C;  1APL C;  3BR3 A;  4XRM A;  1PNR A;  2IVQ A;  5FLM J;  4BBS J;  3HOU J;  1IRZ A;  3ZHM A;  3BTC A;  1ZPQ A;  5M5X J;  4Z59 A;  2VUM J;  3DNV B;  4S0H B;  1H88 C;  4J1X A;  4JYK A;  4YG1 A;  5IYB J;  3U3W A;  2LKX A;  3SDG A;  1ITY A;  2KEK A;  1FIA A;  2LLK A;  5EZG A;  1PRV A;  4J1W A;  3VPR A;  1JUP A;  5IP9 J;  4I6Z A;  2MEZ A;  1RZR A;  3B6C A;  1PRA A;  2KT0 A;  1D5Y A;  5M5W J;  1MNM C;  3TRB A;  5GP9 A;  3R1F A;  1O4X A;  3ZOB A;  1ZK8 A;  2LYS A;  1JUM A;  1EF4 A;  2ME0 A;  1QQA A;  2OF7 A;  3QYX A;  3ZKC A;  2DTZ A;  1QRY A;  1VFC A;  3IVP A;  2CJJ A;  1YRN B;  1WH6 A;  1XS9 A;  1POG A;  1CJG A;  1ETY A;  3PO2 J;  1IG7 A;  2LYQ A;  3O8H A;  1JT6 A;  2VKE A;  1YRN A;  2GZU A;  1A6I A;  3BTL A;  5EEA A;  1DW9 A;  3I4N J;  2PUB A;  2DJN A;  1Y7Y A;  2M9H A;  2ELK A;  1PUF B;  3CCY A;  4XRS G;  3S8Q A;  1U9N A;  3BR5 A;  4A93 J;  4MCT A;  2LY9 A;  3LIS A;  4GHJ A;  5E3O A;  4A3I J;  3Q0V A;  1LCC A;  3ZQF A;  1WH7 A;  3RZD J;  3S2H J;  3F0C A;  1UTX A;  4UUT A;  1ZS4 A;  1ETO A;  3MKL A;  1UMQ A;  2MSY A;  3HOX J;  2PUD A;  3JXD L;  2ECC A;  5K7F A;  3RZZ A;  4B3A A;  3OQO A;  1ENH A;  1QPZ A;  2WIU B;  2E2H J;  3G1M A;  3CLC A;  1CQT A;  4A3M J;  3JRG A;  2LK2 A;  4B1R A;  5EDN A;  1WET A;  3DCF A;  3FIS A;  2O38 A;  5EG0 B;  1UG2 A;  4X4F A;  1NER A;  2XB5 A;  2QCO A;  3BG5 A;  2BNM A;  3D1N I;  2E1O A;  2Y31 A;  1BL0 A;  3LFP A;  2L0K A;  1HCR A;  4X4E A;  4A69 C;  3A01 A;  1LE8 A;  2ECB A;  2B5A A;  2K9S A;  4PU4 C;  2DA6 A;  2R92 J;  2DA2 A;  3QPL A;  3IH3 A;  3HGY A;  1H89 C;  4MFE A;  4GFB A;  3GTG J;  2JN6 A;  3HOV J;  1JWL A;  1W0U A;  2KZ8 A;  2K9N A;  1XG1 A;  1Y1W J;  2LR8 A;  1TWF J;  1RPW A;  2PIJ A;  2CQX A;  2FJ1 A;  1GV2 A;  3MVP A;  4X4B A;  3MLF A;  4G12 A;  2XGE A;  3A02 A;  1X2M A;  2D5V A;  1Q1V A;  1F36 A;  3OMT A;  1MBK A;  3K7A J;  2R5Y B;  1B8I A;  2CRG A;  3TP3 A;  2R7Z J;  1A5J A;  2I10 A;  1MH4 A;  1DU6 A;  5F0F A;  4W97 A;  2JA8 J;  3HGG A;  2VPR A;  3TED A;  1B72 B;  2HXI A;  2PUF A;  3G5G A;  4YG4 A;  5F0C A;  4BKX A;  4C2M J;  1OJL A;  2JA7 J;  5F08 A;  1LLI A;  1HDP A;  1JH9 A;  2LTP A;  2FX0 A;  2JMW A;  4MO7 A;  5F27 A;  1ZUG A;  1Z77 A;  1ZZB A;  2XPV A;  2CSF A;  5EG0 A;  3OP9 A;  5IPA A;  1MBJ A;  1DU0 A;  5GPA A;  2IVB A;  1T56 A;  4X4I A;  4A3L J;  2AUW A;  3IV5 A;  2AWI A;  3IH4 A;  3RZO J;  4DW6 A;  1ZR2 A;  3S2D J;  2EBY A;  2PUA A;  2LD5 A;  1P7J A;  3SCH A;  1ADR A;  1ZR4 A;  4IHY A;  1EFA A;  1ETV A;  5JLW A;  3TW6 A;  4Z5D A;  4M3B A;  3BS3 A;  2NVT J;  3F6W A;  1IDZ A;  3JRD A;  2DA7 A;  2DMQ A;  2COB A;  4MLO A;  2NS7 A;  1Y9Q A;  4DYR A;  3K2A A;  2LYJ A;  2L7M P;  2FQ4 A;  1ETX A;  3HOW J;  5DS9 A;  4Z5H A;  1W0T A;  1ZZC A;  1JTX A;  4IEJ A;  2LFB A;  1QQB A;  3HM5 A;  3PO3 J;  4XRS A;  1MBH A;  2K9Q A;  3SJM A;  3BQY A;  4JP0 A;  3GTO J;  2LYK A;  1TWH J;  5F0H A;  3LSJ A;  3TP0 A;  2P81 A;  3CEC A;  2M34 A;  1ETW A;  2R93 J;  4CYC B;  2O49 A;  4IHX A;  1IC8 A;  2R5Y A;  1B8I B;  4BY1 J;  2L8N A;  3FIW A;  2XRL A;  4XK4 A;  2DA3 A;  3TW7 A;  2R5Z B;  2GRM A;  3F52 A;  1OSL A;  1K83 J;  1XC5 A;  4XIC A;  1NK3 P;  2EH3 A;  3QPS A;  2ZB9 A;  1WGX A;  2M2E A;  1NK2 P;  2Y30 A;  1ZTR A;  4L5E A;  1AHD P;  4PU3 C;  2X6O A;  1UHS A;  1I50 J;  1JKO C;  3LSG A;  4M3E A;  2NVY J;  4QTR A;  4J19 A;  2XGD A;  1P7I A;  1JKP C;  2AXZ A;  2DA1 A;  1MSE C;  5IYD J;  2H8R A;  2XB0 X;  5K7Z A;  2EQR A;  2KPJ A;  2HOT A;  3JRB A;  4A3J J;  3LSR A;  3JR9 A;  1SQ8 A;  1TWC J;  4Y42 A;  1I3Q J;  1Z0X A;  1IGN A;  5C4J J;  2JVL A;  2AXU A;  4RDU A;  3OQN A;  1U9O A;  5C3E J;  1BDI A;  1LMB 3;  2EZK A;  3CDL A;  3QWG A;  2NVX J;  1NTC A;  4NDW A;  1GDT A;  3MN2 A;  2ICP A;  4A3G J;  1TWG J;  4D7M A;  3M4O J;  3QQA A;  5J1U A;  4D5C A;  2E2I J;  4FE4 A;  1OCT C;  4PU7 A;  4DZP A;  1GT0 C;  3GTL J;  1ZQ3 P;  2AHQ A;  2Y9Y A;  3Q0W A;  1WPK A;  4I8T A;  2RAE A;  1LE8 B;  2PUG A;  3HDD A;  3GBG A;  1JJ6 C;  1X58 A;  2X9D A;  4JX5 A;  4LOC A;  4X1E A;  4C3H J;  5GPC A;  1MH3 A;  5F04 A;  2E19 A;  4D7N A;  4FCY A;  1YSE A;  1QP4 A;  2BNO A;  1RR7 A;  3A01 B;  2XPU A;  3FMY A;  2M8G X;  1B0N A;  4UUS A;  4FBI A;  2VKV A;  1RKW A;  1WH8 A;  2DMU A;  5A7L A;  2OR1 L;  3BTJ A;  2CUF A;  2DN0 A;  2IUO A;  3WHB A;  3BR0 A;  2GBY A;  3FKI J;  3L1P A;  4JX4 A;  2IVG A;  2ID6 A;  2DMT A;  2HYJ A;  3JRH A;  4V2F A;  1JKR C;  4YBA A;  4X4C A;  1JFT A;  1B72 A;  2H1K A;  2KEI A;  2O8K A;  4RBO A;  1WH5 A;  2EZL A;  3CQZ J;  4FTH A;  1SFO J;  2EBI A;  2NS8 A;  2IU7 A;  2XGC A;  2O7O A;  4QIW N;  2CRO A;  1HOM A;  2Y0S N;  3H5T A;  4CYC A;  1X2N A;  3JRE A;  2AXV A;  2R0Q C;  1R69 A;  2AW6 A;  3BG9 A;  3NAU A;  5FKK A;  5IYC J;  1ZZ9 A;  2XJ3 A;  3G7D A;  1IDY A;  2NOG A;  3BR1 A;  1L1M A;  2BJC A;  5M3F J;  1H8A C;  1UXD A;  1Y1V J;  5J3L A;  2WUS R;  3KZ3 A;  3ZQG A;  4I6T A;  1ZAY A;  1GV5 A;  2QF7 A;  1ETK A;  3JRF A;  3HEF A;  2MG4 A;  2Y2Z A;  4A3C J;  1MBE A;  2IBD A;  5FLV A;  2HQ5 A;  1TWA J;  4Z5C A;  2M0C A;  3QQ6 A;  4AC0 A;  2YU9 J;  2HIN A;  3OOU A;  4UUS B;  3OQM A;  1GVD A;  5IP7 J;  2DMP A;  5K98 B;  1IUF A;  3PM1 A;  4A3K J;  4NDL A;  3HOY J;  5K7H A;  1BJZ A;  1ZKG A;  3BTI A;  3DEW A;  5FJ8 J;  2XIU A;  4A3F J;  2JCG A;  1IV6 A;  4AYB N;  1ETQ A;  2HSG A;  4X4D A;  1RKT A;  5E3M A;  2LP0 A;  1WI3 A;  3A03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...