2XSDC

Crystal structure of the dimeric oct-6 (pou3f1) pou domain bound to palindromic more dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
128
Chain Sequence
APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*AP)-3'
publication title Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 128
sequence length 151
ec nomenclature
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xsdC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2xsdC01
3ZOBA 1FIPA 4X1EA 4X4IA 1X58A 4I8TA 4JX6A 2L9RA 1MBJA 5E3OA 1GT0C 4MCXA 2K9SA 2JJ7A 3IV5A 5HODA 4V2FA 2D5VA 3JXDL 2HQ5A 1IDYA 5IP6A 5FJ8J 2PUDA 4A3JJ 3RQIA 3HOXJ 5M5WJ 1JGGA 2Y2ZA 1RPWA 5IYBJ 2M2EA 2XGDA 3QPSA 4QSHA 3IH3A 2Y31A 3HM5A 1WH8A 2XPUA 4MIMA 4DYCA 4QIWN 5J1YA 4CYCA 2L8NA 3RZZA 5EF6A 1LFUP 1HLVA 1DWKA 1UTXA 1Q1VA 4NDWA 1RZRA 2M8GX 4PU8A 4A3MJ 1PUFB 2R92J 4D7MA 5FKMA 2WAQN 4M3DA 4FTHA 5F0HA 1H88C 1FJLA 2MEZA 3OSGA 2M9HA 1B0NA 2JCGA 5JLWA 5EGOA 1RIOA 4XRSG 1OCPA 3FYMA 3LFPA 2LVSA 3TW7A 5FLVA 1NTCA 3BR2A 1LE8B 3Q0VA 1ETKA 1PERL 3CROL 3A03A 2KT0A 1LCCA 2WB1N 4DW6A 1K61A 4MFEA 1QPIA 2KPJA 2E19A 3VPRA 5EZGA 1WETA 2W48A 1MBHA 4OB4A 4X4FA 1WPKA 2O38A 3GBFA 2AW6A 3HBLA 2OFYA 2JA6J 1QQAA 2LYRA 2VKVA 4DYRA 3DEWA 2AO9A 1FTTA 1ZPQA 1QQBA 2JA5J 2BNNA 4BBRJ 2LFBA 4C3JJ 1AKHA 1YRNB 3TRBA 2JWTA 1LLIA 2NS7A 2PUGA 1VI0A 2KDZA 2XCJA 4EEFG 2WIUB 1P7IA 3GBGA 4A3CJ 2OR1L 9ANTA 5FKLA 3TW6A 2YUSA 1F36A 1CQTA 1JKRC 4F8DA 3K2AA 2IVGA 3HOZJ 2MW8A 2XI8A 3OIOA 2PUCA 5J3LA 1ETVA 1VNDA 1U78A 2M0CA 4JCXA 1X2MA 3C2BA 4NDLA 4UUSA 4FBIA 1DU0A 1F43A 4GQMA 4MCTA 2JK3A 4M3FA 1ADRA 3SFIA 1XC5A 4MO7A 2HI3A 2XPVA 3GTGJ 2LYQA 3G5GA 1QVTA 5J1UA 1R69A 1UMQA 3FIWA 1Y9QA 4W1UA 1VPWA 2X9DA 3G1MA 1ZZ8A 3HOUJ 2E2IJ 1ETWA 2VPRA 5C3EJ 3G7DA 3OSFA 2DMQA 2ICPA 2MSYA 3HOWJ 2M34A 3FISA 1JH9A 5K98B 4AUXA 3NARA 1GDTA 2HSGA 4FE4A 1BDHA 3TP0A 3LISA 3HZIB 2MG4A 2NVXJ 3QF3A 4CYCB 2L49A 3HGYA 3OQOA 2X48A 2DJNA 5F27A 1RKWA 2AHQA 5IPAA 3OP9A 2H1KA 2HXOA 5EEAA 5IOZA 2PMZN 2XB0X 1JTXA 1HOMA 2AWIA 2KEKA 2BJCA 4V2GA 3HDDA 5EGOB 1IC8A 3W6VA 3UFDA 3BTJA 3BG5A 1WH7A 2DMNA 4JYKA 3G1OA 3LSJA 5J1RA 1RR7A 2EZKA 4YBAA 4XK4A 3F0CA 3TP3A 2E2HJ 2VKEA 1SFOJ 3PM1A 2KZ8A 3EUSA 3QQ6A 1HF0A 1IV6A 2DA4A 4J1WA 3S16J 2O7OA 2DMUA 3FYAA 1HCRA 3M3YJ 2EBIA 2NS8A 5M5XJ 1ZQ3P 1FEXA 1ITYA 2MGQA 2PUBA 3GTJJ 1BL0A 1X2LA 4RBOA 1X57A 3KJXA 3CECA 1NK3P 1WH5A 3K7AJ 1IUFA 2GRLA 4G12A 1AKHB 3H3VK 4JCYA 5FKKA 2NVYJ 3F6WA 3Q0WA 3ZQHA 2LD5A 3CLCA 2L0KA 1I50J 3OQMA 2HOTA 1QPZA 2XGCA 4LOCA 1QP4A 1QP7A 2TCTA 2WUSR 3BS3A 4BY7J 4C3IJ 4X4EA 2PIJA 1NK2P 3R1FA 2LK2A 3QQAA 2DA3A 3SDGA 4UUSB 2CUEA 4A3DJ 1R63A 3A02A 3B6AA 3JRBA 4IHXA 5FKNA 2CSFA 3Q0UA 1OCTC 1HDDC 2PUEA 1JJ6C 4MFDA 3S1RJ 2HINA 2PUAA 2DA5A 2EF8A 1TWFJ 3DCFA 1POGA 2IU7A 1TC3C 3CMYA 3GTQJ 4M3GA 1RZSA 2R5ZA 4RDUA 2CU7A 4JQDA 4YARA 4IHYA 3BR5A 1MBGA 1IRZA 1JT6A 1U9NA 2Y9YA 1JKQC 1T56A 4UUTA 2PPXA 5DS9A 2IAIA 1CJGA 4Z5HA 1X2NA 2EQRA 1TWGJ 1ENHA 2JMWA 2QF7A 2BNOA 2A6CA 4X4DA 1GVDA 3JXBC 4BBSJ 1XWRA 1PNRA 3OQNA 1K83J 1PRAA 5FKOA 1RKTA 1GV5A 5F1JA 1JFTA 3RZDJ 1RETA 2Y30A 3KXAA 1BW6A 4C3HJ 3L1PA 3JR9A 4A93J 2R7ZJ 1BW5A 2IUOA 3F52A 4I6UA 5BNGA 2CRGA 2LYPA 4I6TA 1GV2A 4I76A 1ETXA 3JRHA 2O49A 2X6OA 3ZQCA 2Y9ZA 2RAEA 2ME6A 1ETQA 1O4XA 3F51A 5K7ZA 3VK0A 1TWCJ 3MVPA 1JKPC 1JUMA 1EF4A 4A69C 4L5EA 3S1QJ 2CQQA 1SQ8A 1ETOA 1TWAJ 2K9QA 2IV1A 2KEJA 2O9LA 1WH6A 2GM4A 1VF9A 1Y1WJ 3DNVB 2H8RA 1H8AC 3ZKCA 3MLFA 4IHVA 3JXCL 1FTZA 4BKXA 4GHJA 2K9NA 4X4HA 4FE7A 2O8KA 1JUSA 2GBYA 4X6AJ 1ZZ7A 1MBEA 3BR1A 4JX5A 3B7HA 4A3KJ 2GRMA 5C4JJ 3I4NJ 3E7LA 4Z5DA 4JP0A 3GTOJ 2AXVA 3LSGA 2CUFA 2JN6A 3SCHA 1ZKGA 5EDNA 2BNMA 4D5CA 5E3NA 1ZR4A 1VFCA 5M3MJ 3RZOJ 1WI3A 3GTLJ 4A3BJ 1QP0A 2R5ZB 3JRFA 3BR0A 1SANA 5EZHA 4FCYA 1IG7A 2MQKA 1HDPA 4DYQA 4C2MJ 1QRYA 1POUA 1LMB3 1JFSA 3S15J 4MLOA 3MKLA 2COBA 3A01B 2IVQA 3S1MJ 3GTPJ 3WHCA 1E3OC 3S2HJ 4X4GA 1ZGWA 2LLKA 1B72A 4B4CA 3BQYA 4XRMA 2EH3A 3BD1A 3OMTA 4Y42A 5GP9A 4M3EA 2VI6A 2EZLA 4IEJA 2YU9J 5FLMJ 3JRGA 1Z77A 3S2DJ 3ZHIA 5GPCA 1ETYA 5IOYA 4Y52J 5F04A 3S14J 4XIDA 2G0EA 3SCFA 2DMTA 3ZQGA 1WIZA 1YSEA 4YG7B 1JWLA 2DA7A 2IEKA 2GLOA 1ZUGA 2EWTA 1DU6A 1ZAYA 1ZVVA 2HYJA 3LSRA 2DA1A 3GTKJ 3BG9A 5DTDA 2KEIA 1XG1A 3HOYJ 2ZB9A 3Q3SA 2R93J 4IVZA 1T33A 3H5TA 2OF7A 3KZ3A 4X4CA 5E3MA 1JUPA 3QPLA 2CROA 2L7FP 4M3BA 4B3AA 2R5YB 5F0FA 2DTZA 3O8HA 2LR8A 1I6HJ 4Z59A 2I10A 4D7NA 3QWGA 4X4BA 1S7EA 2YS9A 4A3IJ 5EG0B 2IVBA 4JX4A 1MBFA 2LYLA 4BXXJ 5M3FJ 3HOVJ 4ABZA 1LQCA 3FMYA 3GN5A 3PXPA 1PRUA 2CJJA 3PO2J 3O8GA 1B8IA 1MH4A 5C4XJ 2XB5A 3BTLA 1RESA 3HEFA 1AHDP 2HOAA 1ZS4A 3ZQFA 4YG1A 3A01A 3S17J 5IYCJ 3UKGA 1OFCX 1ZR2A 3QYXA 2ID3A 3OOUA 4IHWA 2JA8J 3LOCA 2FJRA 2R63A 2LKXA 4A3GJ 2HOSA 2EBYA 4A3LJ 2N8GA 2P81A 5A7LA 2LY9A 4O8BA 3S1NJ 4J1XA 1NEQA 1ZZ9A 2DA6A 5F0CA 2OPTA 3BTCA 1A6IA 2L7MP 2FQ4A 5F08A 3SJMA 5M5YJ 2L7ZA 3D1NI 1UG2A 3ZQLA 1IJWC 1RZRD 2NOGA 3GTMJ 2Y0SN 1MNMC 1QVUA 2XJ3A 4D5FA 1JT0A 2K40A 2FX0A 3BG3A 5GPAA 3BTIA 2PUFA 1Z0XA 3CQZJ 3JRDA 1B72B 2ECCA 1XS9A 1RPEL 3IH4A 2E1OA 3JREA 4J19A 1MSFC 4YG4A 4GFBA 3FK6A 4I6ZA 1U8BA 1Y7YA 2JA7J 2NVTJ 3NAUA 4FISA 4S0HB 2R5YA 3BT9A 1R9TJ 4XICA 1IDZA 1OJLA 1MBKA 2FD5A 2TRTA 5IP7J 3BQZA 1OSLA 2XRLA 5IP9J 3LSPA 2XSDC 3HGGA 2AXZA 1ORKA 1ZTRA 3I4MJ 2LYJA 2ID6A 5EG0A 1LFBA 4DZPA 4IA8A 4IWRA 3CCYA 2QCOA 1DW9A 3TEDA 2XGEA 1A5JA 3IH2A 4AYBN 1ZZBA 2R1JL 1WGXA 2ICTA 5E3LA 1UHSA 4BY1J 2XPWA 4I6RA 4PU4C 1WCMJ 1PUFA 2E2JJ 4W97A 1Y1VJ 3S8QA 2VUMJ 2DN0A 2AUWA 1UXDA 4FN3A 2EZIA 3BR3A 3PO3J 3JRCA 3FKIJ 1U9OA 3RKQA 2ELKA 3H0GJ 1EFAA 3WHBA 3BDNA 3GN5B 2HDDA 1NERA 5IYDJ 4AC0A 2ME0A 1MH3A 4A3EJ 1LE8A 1B8IB 1IGNA 4PU3C 1G2HA 2PE5A 2LP0A 2EZHA 5EYRA 2ECBA 3LNQA 2GZUA 3BR6A 2B5AA 3M4OJ 3CDLA 1H89C 1JJ8C 1BJZA 1AU7A 1BDIA 2LTPA 5C44J 3ZHMA 3MN2A 3JRAA 2IBDA 2CQXA 2AXUA 2XIUA 2R0QC 1JKOC 2B63J 3SCGA 1I3QJ 1TWHJ 3ZQIA 5JLXA 1W0TA 1BA5A 3O9XA 4B1RA 4Y7NJ 2O4AA 1P7JA 2LYSA 2JVLA 1D5YA 1FIAA 3JRIA 2LYKA 1YRNA 1PRVA 1ZZ6A 4A3FJ 3G1LA 4M6VA 1UXCA 2NVQJ 2FJ1A 2WV1A 3HB9A 1ZK8A 1JTYA 5K7FA 4Z58A 1ZZCA 4QTRA 1W0UA 2DMPA 2DA2A 1GUUA 1MSEC 4PU7A 1L1MA 3HKZN 3FK7A 4XRSA 4Z5CA 5K7HA 1LCDA 1APLC 2LCVA 3U3WA 3IVPA 3B6CA 4HNVA 2HXIA 4DZJA
chains in the Genus database with same CATH superfamily
3S93A 1UELB 4G6QA 4I8TA 1IXCA 2L9RA 5E3OA 2K9SA 3IV5A 2FEZA 5HODA 2VEOA 4V2FA 4M6XA 4OIOF 3JXDL 2CV1A 2XAFA 2LLVA 1WKMA 2FXAA 3K1MA 3KP5A 4GXOA 5E20A 5FJ8J 3QP6A 1R00A 5HDNA 5M5WJ 3KYLA 3L2WA 1RPWA 4EQQA 2X1DA 2IGOA 4AIHA 5J4VA 1WH8A 1R6RA 2XPUA 4DYCA 2L8NA 3H35A 2DLLA 2WBMA 5EF6A 2VL8A 3ZMVA 4FX0A 1UTXA 4NDWA 1JHFA 3SDBA 4PU8A 2GA2A 2R92J 4AVPA 3J81Z 1W7PA 2NS0A 2VN2A 3I56I 1IUYA 3BDDA 2MEZA 2M9HA 5K5QA 1B0NA 5JLWA 4S05A 5EGOA 1XGSA 2I5UA 1XDSA 2LLWA 4GRIA 3VFZA 4AIJA 1E17A 3U1KA 2KT0A 3F6VA 2O3FA 2OCEA 1K78A 1FX7A 1ON1A 2A6EF 2DYSH 1YO5C 3HUGA 1ZGAA 2E19A 1WETA 5LRSA 4ZYHA 4BJTA 4OB4A 5FD5A 2O38A 1TNTA 4CUGA 5JFRA 1KU7A 1R1VA 2JA6J 5B5EC 4HSRA 3TO6A 2E60A 2V6EA 4RLFA 3G73A 3GFJA 1FTTA 1G3SA 2VODA 4BBRJ 2LFBA 1YRNB 2PUGA 1VI0A 2XCJA 3CESA 2RREA 2WV0A 4EEFG 3K69A 2XAGA 3GBGA 1H9TA 3GLLA 1I27A 2E35A 4ER5A 1F36A 2PQ8A 3ULQB 3K2AA 3P9IA 3VDXA 3WE3A 3WODF 4IZZA 2GWRA 2MW8A 2IVGA 2XI8A 4M9SA 4CCNA 4ANJA 1ETVA 2KZVA 4JCXA 4UUSA 3PL8A 5A2QK 1MMDA 3E5XA 5KVRA 2EFOA 1SVMA 4GQMA 4MCTA 2JK3A 4M3FA 3SFIA 1XC5A 1G3YA 2HI3A 2XPVA 3WU2C 2LYQA 3G5GA 3CCRI 3IRRA 2ZJRF 3TFLA 2CV2A 2PXKA 1S7AA 1Y9QA 4W1UA 1VPWA 3GW2A 1ZZ8A 1ETWA 3SZTA 5C3EJ 3OSFA 2DMQA 2ICPA 2M4GA 1W5SA 3K1PA 3KZYA 4FE4A 2XASA 4OIRF 4I09A 3JAMZ 4IQJA 5ICGA 4NNJA 3ME5A 2L49A 4MTDA 3HGYA 4N9IA 1F4KA 2DJNA 1P4XA 1RKWA 1BI3A 4H4KC 2VPLA 1BN5A 1J0RA 1T0FA 2PMZN 1JTXA 4KFCA 2GIVA 2ELJA 1UAAA 4II2A 4Y17A 2ZXIA 3PUFA 2A6HF 4LB6B 2H09A 1UFMA 4NBQA 3W6VA 3V7SA 3BG5A 3UFDA 1R1TA 1WH7A 3FXOA 1PYVA 5J1RA 1RR7A 3H5NA 2KZ8A 3H3UA 4Q48A 5LBQA 4HLXA 4XKBA 1HF0A 2LREA 2P5VA 2DA4A 3M1EA 3OS2A 1R36A 3HKZA 2DODA 1O3TA 1SVLA 3CLQA 2KJCA 3M1CA 3S3NA 1K7AA 4P9UA 5M5XJ 2MGQA 3GLXA 1WJFA 3RKYA 4F91B 3E5UA 2F4OB 1X2LA 4Q5SF 4HQMA 3GUUA 4XMYA 3LSMA 3K7AJ 2GRLA 4G12A 1AKHB 1VQ6I 4XSXF 4JCYA 5AIQA 3VODA 3ML6A 4LJZF 2K9MA 4ZYAA 5D5UB 1QPZA 2FFHA 4HRAA 4LOCA 1QP7A 1CF7A 2TCTA 4X4EA 4BE0A 1MD0A 3BJOA 3R1FA 3QQAA 2C6YA 2QLZA 1EA3A 2HVSA 1LKXA 3K6GA 4A3DJ 4IRGA 1R63A 4PJMA 3BOQA 5FKNA 3Q0UA 2WAQA 3RKXA 2QBYB 4G9YA 2HINA 2PXEA 1WI9A 3PE5A 1HW2A 2PLYA 5BQTA 1TC3C 3CMYA 1RZSA 2R5ZA 2L9VA 3HTSB 5IT9K 4H0EA 4ZYEA 2GXBA 1D5VA 4XKCA 2CU7A 2K3PA 3UNGC 3G0TA 2EILH 3I9V2 3DP7A 4KYWA 2WB1A 2XRNA 1JT6A 2OBPA 1PP7U 5AONA 1KYZA 1U9NA 2IA1A 2JPBA 3ZN1A 1JKQC 4MNUA 1FBSA 3V8LA 2OZ6A 2B0LA 3TO9A 1BR2A 2D2WA 3JXBC 3RYRA 1D1AA 3RQ4A 4F52A 2STWA 4EJOA 2F5EA 3GEZA 5FKOA 1JFTA 1Y8RB 1T08B 3EYIA 3AAFA 2W25A 3L1PA 2FMLA 3ABUA 5H6QA 1QO0D 2CRGA 2D1VA 2DT6A 1GXQA 3JRHA 4E7LA 2JSCA 2BY0A 5CPRB 2O49A 1YQAA 3RIRA 2LNBA 2ME6A 2QSGX 3GVAA 4RGRA 5K7ZA 5KAFC 2RQQA 3VK0A 3IC7A 4XORA 3C7JA 1FMVA 2DT5A 1MIJA 3RJPA 4EM0B 1RI7A 2F6CA 3S1QJ 3KEQA 4MQVA 1FLIA 2CUZA 1YIOA 3F3XA 4L9TA 4CCJA 1DP3A 3I54A 1YITI 3CF5F 1VQ9I 1Y1WJ 2HZTA 3ZKCA 1H8AC 3MLFA 1SAXA 1GVJA 3K4NA 4X4HA 2NYXA 2Z3YA 2BVLA 2GBYA 4Z2YA 3SQNA 3BR1A 2EJRA 1RNLA 3WGHA 4A3KJ 4OWRB 2GRMA 3K4MA 1QB2A 4CHUA 3E7LA 2WC2A 4JQFA 1A36A 2X6YA 3I55I 3FWEA 3SCHA 1ZHFA 3HHGA 4D5CA 3LMMA 5E3NA 2L3DA 1ZR4A 4YRVA 1FNNA 5E1WA 4L9JA 1V5EA 2HU9A 2LYCA 3N97A 2AXLA 2IS6A 2Z9OA 5EZHA 4FCYA 3D5LA 3LFUA 3P9CA 4L9VA 2WAEA 3W2AA 2R7FA 2PXVA 1QRYA 5JR3A 4LLLA 1H0MA 1FY7A 1QZZA 3QU3A 1WHUA 2DTRA 3LA7A 3MKLA 3CC7I 2R7SA 3GTPJ 1I1GA 3LFKA 3FMSA 3KP7A 3FXKA 2ZKZA 3AKZA 3OKZA 2F5VA 4LGWA 4X4GA 1XX5A 3T0YA 2M7AA 2BW3B 2XGXA 3FX3A 2EZLA 1DP7P 4IL6C 3K70C 1WJDA 2A5WA 2YU9J 3SEQA 2IRFG 3S8PA 1GXPA 1R22A 5FLXK 2EWNA 3S14J 3KCCA 2EK5A 2H1LA 3ZQGA 2XXPA 2IEKA 3TMOA 3OL4A 2EWTA 1ZVVA 2RN7A 4AIDA 1VQKI 3GTKJ 1NHAA 1HQCA 1YG2A 3AG2H 5DTDA 1FMWA 3EUKL 3TDUC 3CO7C 2QENA 1V54H 3OYMA 2TDXA 2ZBKA 1E0EA 4IVZA 2R7DA 2CO5A 2O6GE 4X4CA 5E3MA 1JUPA 2QQ8A 1Y8QB 3NDBB 3A9YA 4PCQA 1OQYA 2R5YB 1IW7F 2CW0F 3GUDA 2MABA 4I02A 4ETSA 3B02A 4RGSA 1I6HJ 1SAUA 5LGNA 4Z59A 2H6CA 4NUBA 4P9FA 3JSPA 5EG0B 2VJ5A 5L3DA 1X3ZB 2P6SA 2YX4A 4JX4A 4Y4RA 4FASD 3QWLA 3FMYA 4C30A 3PO2J 3O8GA 1OLTA 5HDKA 3W2WA 1RESA 4N4NB 4YG2F 2QKMB 1AHDP 2HOAA 2STTA 1K6OA 1W4MA 1D0YA 2FOWA 5B1AH 3CMMA 3S17J 5IYCJ 3UKGA 1ZR2A 4B43A 3A9ZA 4CSWA 2JSPA 4IHWA 1W36D 3HJEA 3LOCA 2FJRA 2FSWA 3M8FA 2IGMA 3QAHA 4M74A 5HS8A 2CS3A 4GCVA 2HOSA 3DBHB 4ER3A 4HBLA 4J1XA 1NEQA 5DCFA 4FX4A 3OYAA 2A07F 5F0CA 1A6IA 2L7MP 1CJGA 3ZQLA 2L02A 2NOGA 2RKHA 3BCAA 4HOBA 4MQ9F 1DULA 1QVUA 2BZTA 1XGOA 2XJ3A 4G7HF 2X1CA 1R49A 2HFHA 2OCCH 5GPAA 3HHHA 3JRDA 1X4PA 2HQRA 1MJAA 1ZRDA 2CSOA 1XGMA 3IH4A 3KFWX 2WTEA 4XKWA 2JTVA 4EM2A 3JREA 4GFBA 3KEYA 2B7EA 3ABLH 4YG4A 4EQZA 2NNYA 3CCVI 3QOEA 1R9TJ 4XICA 3OYCA 3PNTA 5IP7J 2XRLA 3ZR8X 4DJAA 5CQGA 2KIFA 3HGGA 1RUNA 3ABTA 2GIZA 4IA8A 4BAYA 1HKQA 2XVCA 1U5TB 4BQNA 3I4PA 4EJWA 3R0AA 2ESNA 2RNGA 1MMNA 2XGEA 3F6OA 2J5PA 2DJIA 3LL7A 2R1JL 2X4HA 1WGXA 2MLKA 3LA3A 3GCMA 1HA8A 4I6RA 5CJ9A 1WFXA 4JK1X 1UB9A 1ZYRF 2VUMJ 1UXDA 4F7ZA 3BPVA 3FKIJ 4RM3A 2IGKA 2IP2A 3I0TA 4RAYA 4XOPA 3T1BA 3WHBA 1XSDA 3GN5B 3K4CA 2KFDA 2Y0MA 1V3FA 5IYDJ 4AC0A 2ME0A 2LRDA 3KLOA 2PE5A 1G2HA 4OMZA 5EYRA 5ICFA 3DBRB 2GZUA 3BR6A 3TGNA 2QQAA 4HEA2 1BDIA 1BOAA 5C44J 3MN2A 3O2PE 3F22A 3GZDC 2PXTA 1BBYA 1MZBA 1TNSA 2YX7A 2XIUA 1R5GA 2CQKA 1I3QJ 4AVZA 3H9JA 5DYMA 3J80K 2E36A 3DEUA 2NRAC 2FU4A 2O0YA 1FSHA 1BA5A 1R5ID 2VE9A 5DCMB 2O4AA 1P7JA 1WJAA 2KIMA 1E3HA 2JVLA 4CCOA 3FXMA 3D5SC 1E2XA 1YRNA 2GQQA 4A3FJ 1UXCA 2NVQJ 3PNYA 2WV1A 2LOOA 4OINF 4BS9A 5KCMA 3CC4I 4QTRA 3MZHA 2F48A 1RR8C 4KMFA 1GUUA 2R7TA 4R79A 3NZLA 3FK7A 1LCDA 2CWEA 5E8GA 2ELHA 1EV7A 3HIFA 3IVPA 3U3WA 3MCZA 4DZJA 4ZYGA 1FIPA 4II3A 1Z7LA 1X58A 1ZN2A 2MFZA 2XHKA 4GGGA 2DI3A 4ESJA 3DTIA 1DGRM 2BXYA 2JJ7A 2UZKA 1BOBA 2LBFA 1P4WA 3J7AO 3GZCA 1T6SA 2K3FA 2HQ5A 3C2HA 1Z3XA 1IDYA 1WRJA 3VEPA 3QRFF 2HVRA 2FF4A 2K86A 4R1HA 1ZRFA 3RPQA 1B9NA 2L2OA 2Y2ZA 2ETHA 3E1SA 4OOIA 1IN6A 1W5TA 3RYPA 5IYBJ 2Y31A 2J7WA 5ILVA 4U0VA 5DD4A 5J1YA 4BGDA 3L09A 4G7ZF 1HBXG 1LFUP 3WGGA 4BDZA 1Q1VA 3BJAA 2M8GX 4LIUA 5FKMA 2M30A 3IWFA 4M3DA 4FTHA 1H88C 1FJLA 4XLAA 3DU6A 3LFPA 3CCLI 4HZFA 2LVSA 3EUHA 3QYEA 3TW7A 3RDIA 2DYRH 1Y0UA 4Y3OA 3BR2A 3R61A 4PZJA 2XF7A 1ETKA 3CROL 4U88A 1XCBA 4XSZF 1TW3A 2R7QA 2FBKA 1K61A 3HTUA 3ABMH 3FXRA 5EZGA 1MBHA 3M07A 4A5NA 2H27A 4X4FA 3GBFA 2OFYA 3C2GA 3ECOA 3DKWA 4XLPF 4DYRA 4UV8A 4ZTJA 3DEWA 5DDGA 2ZJPF 2AO9A 3E6DA 3FBNB 1ZPQA 2OZUA 2Z99A 4KA4A 3H0DA 4N9HA 3M8EA 2JA5J 1AKHA 2BNNA 3TRBA 4F93B 1RUOA 1OR7A 2DT7B 4KMUX 4PFPA 2R7XA 9ANTA 1JI8A 5FKLA 2LY2A 3TW6A 2YUSA 3M7GA 5K5RA 1P6RA 1JKRC 1Z21A 4AYBA 1XB4A 5J3LA 3H3ZA 3ZPLA 2M0CA 1PVEA 1X2MA 3C2BA 3K1NA 1I6XA 2XF5A 4FBIA 1DU0A 1U0JA 1SVOA 2OU2A 5J4YA 4PGHA 2F5CA 3W6JB 4LK0F 5J1UA 1OCZH 2QBYA 2M4HA 3BJ6A 1N78A 2HZDA 1UMQA 4RB3C 3FXQA 1M1EB 3H5RA 2NAZA 3G1MA 2M1BA 2ZMEC 2V1DA 3HOUJ 2E2IJ 2ZMEB 1N75A 3G7DA 2DK5A 4J01A 4KT6A 3HOWJ 2M34A 4AUXA 2E34A 3ERMA 3NARA 4O6JA 2KKOA 1K4SA 1GDTA 3CCSI 1BDHA 3CJRB 3HRTA 3OL3A 2VT2A 2GA1A 3LISA 2Q8KA 1XSVA 3HZIB 3QYBA 3VYTB 3QF3A 3KYCB 4LMYA 3OQOA 2R7WA 3GXOA 5F27A 1Y6IA 5IPAA 1R4MB 2HXOA 2XB0X 3BC8A 2XDVA 5CVUA 2OJED 1YJWI 1HXDA 4ENMA 2EFQA 2XAUA 3CJTB 1IC8A 3ABKH 5FROA 1X4OA 5FB2A 3LSJA 3EYYA 4XK4A 3F0CA 3PQKA 4M9XA 3PM1A 2H6BA 3ZRGA 3IUOA 4BJ5C 5HLHA 2CUJA 1QPMA 3S16J 2O7OA 2P7VB 2ZO4A 5J47A 4LFUA 3M3YJ 5D8KB 4AM3A 2NS8A 2OD5A 3K4KA 3E6MA 3BWGA 3K10A 1QA6A 2PUBA 3T8RA 3KIOA 1YX3A 1EH8A 1YW8A 4XBFA 4RBOA 2UXNA 2O8XA 3ZMUA 1NK3P 3CECA 1IXRC 1WH5A 4EGYA 1VQMI 1EKEA 1KONA 4BEHB 5FKKA 3I71A 2XKPA 4L18B 2L0KA 3OQMA 3GO5A 1J09A 4Z6YA 2JA2A 3BS3A 1YE9A 3DPTA 2PIJA 1MNDA 1KYWA 2KRFA 2DA3A 3MKWB 4KNYA 2CW8A 3OWTA 3B6AA 3JRBA 1X1AA 3WTZA 1YX5A 2CSFA 1UHWA 1HDDC 3FKJA 1U3EM 1DQUA 3MD2A 2VKDA 3TDZC 3DCFA 4UY8I 2XXQA 4XRFA 5TRDA 1WVRA 2WADA 2V1XA 2HCSA 3QFIA 2DCEA 3S32A 2MC4A 4JQDA 3L2CA 3L2RA 3OYGA 4M72A 4YARA 1PJRA 2OTJI 2KQRA 5HVQC 4CXFA 1MBGA 3K0LA 3QYFA 1YHQI 3A0BC 1G3TA 4EZIA 2ZXWH 2PXBA 1TWGJ 3QODA 4AIKA 4BXFA 2COMA 2AQFA 4BXUA 1PRAA 1GV5A 3WTTC 2BW3A 1BC7C 3RZDJ 3M9AA 3HRMA 1BW6A 1YW9A 3JR9A 2PJRA 2KP6A 4UXNA 2XV4S 2E1CA 1BW5A 4I6UA 5D5WB 1RC9A 5JHFA 4I76A 3SFZA 4O3MA 1ETXA 1S29A 3BY6A 1O3QA 3PIPF 2X6OA 2J5OA 3HSEA 3ZQCA 2KDOA 4UV9A 3ZCOA 2RAEA 1ETQA 5ED4A 3CUQA 1H9GA 3IAM2 2ADUA 2M5WA 3RPUD 1JUMA 3DFGA 4PK4A 4HNTA 4O5VA 2XAQA 1S8NA 2WAFA 1I39A 4HDVA 1BM9A 3DXJF 1YIJI 3T5XA 1O7FA 2IVMA 1WH6A 2K7LA 1KZHA 2GM4A 4WXCA 3MAJA 2MA3A 4E4HA 4IHVA 1UJ8A 4GHJA 4HNUA 3KETA 4FQGA 3OWQA 3A4CA 1EH7A 2W85A 5BPIA 2KISA 1BIAA 3B7HA 1MDMB 3Q5FA 1FOXA 1SD5A 5C4JJ 3CJNA 3QPTA 4KJZA 4ZTFA 5GAGJ 2PMZA 2VBYA 3GTOJ 3TBIA 1C0WA 2B9SA 4U0WA 3X2QH 3EETA 4CZZA 1Z05A 3J81K 5EDNA 2BNMA 3R09A 1OYIA 5M3MJ 4IVNA 1GHCA 5J8CA 4QPQA 4RS8A 3PIOF 4G94A 1D1CA 1W5CC 1NG6A 1LUJB 2ZSIB 1Q1HA 4CCMA 3DKYA 1IG7A 1MKMA 4DYQA 2IA2A 1T98A 3G3ZA 1POUA 5FD6A 3QOPA 1OKRA 2VQLA 3BPXA 3A01B 3L2QA 2COBA 3FDYA 4N0BA 3G6EI 4IPAA 2G9WA 1U2WA 5KK1A 1ZGWA 5DRTA 3BQYA 3I5UA 3BD1A 3H5AA 3OMTA 2MH2A 4I2OA 2PI0A 2Z2SB 2XKOA 2VT3A 3ZQ7A 2QVOA 5FLMJ 1VQ5I 3AFHA 1Z77A 3ZHIA 1MFQC 3FF5A 3OV8A 5F04A 3DV8A 3CCMI 2DMTA 1YSEA 2LMDA 5B3SH 5CKTA 4K2EA 2GLOA 1ZUGA 1DU6A 3R60A 2HYJA 3LSRA 2DA1A 4CZCA 1U5TA 5F1RA 3BG9A 1IN7A 2KEIA 4XN3A 5ICCA 5JI6A 3Q3SA 4F55A 1B6AA 3KZ3A 3FXUA 2OF7A 2E7WA 3H5TA 4KDPA 4E7ZA 2ODRD 3HPHA 2X0LA 5ILUA 3QPLA 3V7RA 4B3AA 2CGPA 5F0FA 4E7JA 3H9QA 2QSHX 1B59A 1S7EA 4HV5A 4A3IJ 2IVBA 4BXXJ 3GN5A 3JAMK 1MH4A 2M45A 5D8LB 2VBWA 1SD7A 3OYFA 2PBIA 4ER7A 3NRVA 3JCUC 4RLQA 4XLNF 5DTRA 3ZQFA 2ISZA 4YG1A 1HC8A 4ASNA 4BQAA 1OFCX 1XD7A 1SD4A 1TW2A 3GZDA 5JUWA 3F72A 3OOUA 3QYXA 2KRCA 4KIGA 1USTA 1X1PA 4KISA 2R63A 3IP4B 4C2TA 3RPUA 2GXGA 4OU0A 1VZ0A 5HLIA 4A3GJ 1KU2A 3FXJA 4A3LJ 2N8GA 2P81A 2RC4A 4UVCA 5A7LA 2DA6A 4HAMA 1BI2A 1REPC 1IJWC 2KLOA 3PFYA 5M5YJ 3AG4H 1UG2A 4RGUA 3GZ5A 2Y0SN 1MNMC 4HG2A 1EJ9A 4JBAA 3ASNH 3MMYB 1LEAA 2FX0A 3CUOA 1ZH5A 1XS9A 1MSFC 2K4BA 4P5OA 4HX8A 1IN5A 1HKSA 2JA7J 1D3YA 2DO7A 1LDJA 2WY7Q 4FISA 1TQIA 2RGVA 2K4JA 3OYDA 1OJLA 1XMXA 1MBKA 2FD5A 2TRTA 5FLXZ 3P5JA 4ENKA 1OSLA 4G7OF 2XSDC 1FP2A 1ORKA 1ZTRA 4UB8C 2W57A 2ID6A 1I5ZA 2UV1A 2VE8A 1LFBA 2KL4A 3MQ0A 4LG3A 4UNOA 3TEPA 3TL4X 3WTYC 4IWRA 1YJ9I 3C18A 3SHFA 1HSTA 5DM7F 4CDGA 3N4MA 2XPWA 2EPFA 4PU4C 2LNMA 4EV0A 1LVKA 2I8DA 2KZGA 4S04A 3D5RC 3J7ZI 1VQ8I 2L4MA 3BR3A 3PO3J 3JRCA 1U9OA 2VBZA 2RDPA 1J2XA 4XKVA 1HW1A 2QYOA 1KU9A 2V9PA 2XUBA 3S3OA 3LSTA 1B8IB 1IGNA 4PU3C 2EZHA 2R7RA 3LNQA 2B5AA 1JJ8C 4EJUA 1MGTA 5E1XA 2YU3A 1LEBA 2CQXA 1T39A 2B63J 3SCGA 1TL8A 1MNEA 4EGZA 1P9QC 3WTUC 1YYVA 1F5TA 1W0TA 2V7FA 1FYLA 3BZKA 1FYKA 1D5YA 3JRIA 3CMAI 1T2KA 1PRVA 4U7DA 2FJ1A 1TP4A 1U6GA 3HB9A 3K4JA 3I53A 1ZK8A 2BGCA 2A05A 5K7FA 4IHTA 2PXUA 1A04A 1OYYA 2YSRA 2BY3A 3HUGB 1JHHA 4F3QA 2DA2A 1JXSA 4PU7A 1L1MA 2P5KA 4ITVA 1OPCA 1QZXA 1ZREA 4Z5CA 3DQVC 2P4WA 1T8IA 1FBUA 2CQ7A 3OIQA 1APLC 2LCVA 5DEQA 1PUEE 2XXAA 1DPUA 2HXIA 5D5VB 1D0XA 4C2UA 3KL4A 2FOKA 2MD5A 2PX9A 4JX6A 3SZGA 1MBJA 1GT0C 4ZYDA 3L2UA 3AG3H 3LQRA 2PJPA 3CDIA 4B8XA 3VSLA 2P6TA 4BE2A 3SXYA 3PFIA 4A3JJ 2DFIA 3I64A 1WWXA 4WCGA 3B73A 2F5FA 2ZC2A 2DPDA 2MD0A 2L4AA 4RB2C 2QSFX 3QPSA 4QSHA 3IH3A 1Z7UA 1XTAA 3HM5A 3V4GA 2A5YB 1FOWA 2CH0A 1LJ9A 1OISA 3RZZA 2F4IA 1HLVA 1DWKA 1VQPI 2DAOA 2YPRA 1LVAA 5DRYA 4RA2A 1USSA 1PUFB 3KP6A 1O57A 3HXLA 3A9XA 1NG7A 1J75A 5KNLA 5F0HA 3OSGA 3L2VA 2JCGA 5HOOA 1XDUA 1ZG1A 1OCPA 3TO7A 2LG4A 4ER0A 1UG0A 3KZIC 2HKXA 2XROA 1NTCA 1LE8B 4YELA 3JSOA 4ENJA 5FLVA 3HOTA 4NQWA 1LCCA 3WGIA 3DTEA 4OMYA 4MFEA 2JQEA 4RAZA 5HDGA 4E7IA 2KPJA 4HDUA 2W48A 4P1WA 1LPQA 1PDNC 2AW6A 3HBLA 4F92B 2EV0A 3FM5A 3BZCA 4D9JA 1J9IA 2LYRA 2VXDA 3NXHA 4BE1A 5LD2C 3VYUB 2ZXJA 1J7KA 2VC0A 4RMNA 4UUVA 5GTIC 2PG4A 2OTLI 4UHTA 1LLIA 2JWTA 2NS7A 2R3SA 4BEHA 1P7IA 4A3CJ 2OR1L 4LK1F 5E18F 4YFNF 1S6LA 2HS5A 3HOZJ 4DOZA 2JVHA 1SMTA 2W84A 3ROUA 2HPIA 4BJ6C 1K6YA 3CLOA 1F43A 3LQXA 3LAJA 3HZJA 3L9FA 1I1SA 1GLNA 2DQRA 1XSXA 2OC6A 4A5MA 3FZVA 1R69A 5JVGF 4UVAA 5FRNA 3IL2A 2X9DA 3I3LA 1JE8A 3OY9A 3KP3A 3EQLF 4CGZA 2VPRA 1YS6A 4ZDOA 4ER6A 1CF7B 3BG7A 3FISA 1JH9A 2X51A 4A0XA 2HSGA 3K4LA 4CA0A 3O6BB 5GAGi 3TP0A 4KITB 3MKZA 2MG4A 1OCRH 4R8HA 4CYCB 3U9GA 4DE8A 3VYRB 2M87A 4B48A 2AHQA 2E7XA 2XIGA 5FGMA 1RZ4A 3ZGKA 1HOMA 2AWIA 2BJCA 5H2FC 4HW0A 1AWCA 2HTSA 1WJEA 1ZARA 3I58A 3BTJA 3ZMDA 1FT9A 1EH6A 1FC3A 3DPLC 5E1ZB 3FMRA 2JUGA 2QQ9A 3NWTA 3G1OA 4JYKA 1VQLI 4YBAA 2EZKA 3GYHX 3TP3A 3QQ6A 2VKEA 1SFOJ 2QUFA 1VTNC 2HNHA 2MBFA 2DMUA 4NC6A 1E3PA 4KIFA 4L5JA 1X1DA 4AD9A 3GX4X 4FHTA 2LF7A 2PN6A 1FEXA 3CF2A 2HQNA 1BL0A 1X1BA 3VB2A 3JTGA 1X57A 4U87A 3MFKA 4M73A 4I98B 3E0JB 4D0PA 4E7KA 1J5YA 1LNWA 3H3VK 5L3GA 2XF6A 2NVYJ 3F6WA 3CP2A 5LFAA 3ZQHA 4UVBA 3WE2A 3CLCA 1B1BA 1YLFA 2WUSR 3JTHA 1NK2P 2L9SA 2L01A 3G4SI 2JZYA 3SDGA 2JT1A 2HGCA 3J7YJ 2WWYA 2W24A 2FBIA 5BS6A 2WA0A 2EFNA 2K02A 4HF2A 4MFDA 1Z3YA 2PUAA 4ZC3A 2R7OA 3U2RA 2EF8A 4MEXF 2EINH 1ODDA 3DWLE 3GTQJ 4M3GA 3GZNB 1P2FA 4BDYA 3RCOA 1IF1A 1VQOI 1KGSA 4KN7X 5E8IA 2LC2A 3H92A 3MWMA 3N05A 4IHYA 3C3WA 4WVLA 4Q2JA 4RAFA 1UZCA 2JPCA 3E5QA 5B66C 2Z33A 3WG9A 2Y9YA 5H20A 2PXLA 1G3WA 1S7OA 2CW7A 2L9NA 2PMHA 5LLQA 3F9KA 3MKYB 2NXNB 4HA8A 1X2NA 2EQRA 2JMWA 4X4DA 2PXFA 4IO9F 4BBSJ 3ZP5A 1PNRA 3U21A 1RKTA 5F1JA 4E70A 4KT5C 4C3HJ 2R7ZJ 2IUOA 3F52A 4I6TA 1GV2A 5E79C 5BPDA 1QU3A 3UR3C 1S5LC 2YBDA 3SX0A 2Y9ZA 4BHBA 2DOEA 1MJ9A 2P0WA 2L5QA 1O4XA 4L0ZB 3F51A 3P9KA 4XLHA 1TWCJ 4DBQA 2EB7A 1JKPC 2W82A 1EF4A 2CQQA 1SQ8A 3K70D 3COAC 4Q4ZF 1TWAJ 4B3XA 1Z9CA 2OUMA 2IV1A 2KEJA 3OR1C 1ZG5A 2VLAA 1R23A 1VF9A 3SZPA 1WJCA 1IRFA 3CCUI 1FTZA 1QHHD 4MEYF 4A6DA 1X3WB 2KIUA 2O8KA 1B9MA 2HWVA 3KP4A 4JX5A 3A2KA 2NVUB 5J6XA 3J7AY 5HS7A 2VASA 2E5ZA 3I4NJ 2GOXB 3HYIA 4Z5DA 2L54A 2CUFA 3EUAA 3OYIA 4FT8A 3I59B 2GZWA 2BHZA 3RTRA 1VFCA 5FFXA 3CCJI 2IT0A 1SFXA 1MJBA 4HSTA 2HYGD 2VKHA 2VOPA 4A3BJ 2BEOA 1QP0A 2BHYA 2BXZA 2P7CB 3JRFA 2E1NA 2Z16A 2K5CA 4ZZLA 3HRUA 2MQKA 5LRRA 1F9NA 4D1QA 1Z6TA 3CD6I 4N4OB 1OMIA 5LGUA 3S15J 3K9TA 1YS7A 4I99C 3AG1H 1S9HA 3WG7H 2FA5A 4EATA 5KAIC 2CFXA 4B4CA 1YTYA 3OIPA 3C1DA 3ELKA 5GP9A 4M3EA 2VI6A 1O3SA 4IEJA 3DTKA 3RSNA 1TT5B 5GPCA 3F21A 4Y52J 2EIJH 4XIDA 1QQIA 2G0EA 2F5DA 1WIZA 5BMZA 3LSKA 1ZAYA 4C9YA 1X1CA 5BOXA 1G8XA 4EJVA 4RM2A 3A1YA 3JW4A 5DUKA 4WX9A 1XG1A 3WU0A 2ZB9A 3DLLF 3SR4A 1T33A 3MZYA 2LH9A 5A2QZ 5DTQA 1IN8A 3DEEA 1I3AA 4ZJZA 2L7FP 4M3BA 4BH9A 3DU5A 2DTZA 2LR8A 2QWWA 1QZEA 2ZXHA 3GMEA 2DU9A 2IA0A 2ACJA 3Q9SA 2YS9A 2G7HA 3A0HC 2FUG2 2HR3A 3QOXA 1MBFA 3WTVC 5M3FJ 3HOVJ 1LQCA 1FBQA 1PRUA 2KHMA 1B8IA 5C4XJ 2XB5A 4NHJA 3K4BA 5CVVA 4WWCA 3WTSC 4DE9A 1IZ1A 4IX7A 4P96A 3S2WA 4L9NA 4DQ2A 1R5HA 3FM3A 5D6FA 4HF1A 3DLAA 2ID3A 4J00A 3BG6A 1QNTA 3GF2A 2JA8J 3ZPXA 3PSFA 4XM3A 2MH9A 3WTWC 3UWPA 4XL9A 2EBYA 2V79A 2FBHA 5K5OA 5D4SA 1WSUA 2OQGA 1QGPA 2VOOA 4EK9A 4A0YA 1N25A 3BTCA 3MEJA 1Z91A 2Y75A 2K9LA 5F08A 3GFIA 2L7ZA 2LKPA 5HNFA 1AOYA 1RZRD 2QKLB 3GTMJ 3ZN0A 3DBLB 1BIBA 5L3FA 3E3VA 3REOA 2IS4A 3T8TA 5ILSA 1HSJA 3BG3A 2PUFA 3CQZJ 1B72B 2DOAA 2DDAA 2ECCA 2X6XA 2L1PA 1W1WE 4EVIA 1FP1D 4I6ZA 1U8BA 1Y7YA 2BYVE 1LDKB 3NAUA 3ZMZA 2EV6A 2L7KA 5LEJA 4XQFA 2Y69H 1G59A 1X3UA 4S0HB 2R5YA 1FOYA 2Q0OA 4IKFA 3HPGA 5HNHA 3BQZA 1X19A 3LSPA 2D1HA 3F8NA 2AXZA 2LYJA 2OV7A 2VXZA 2X85A 5EG0A 2MC3A 4DZPA 1D8KA 2FQ3A 2BVMA 3CCYA 4I0AA 4XONA 1DW9A 3ASOH 2QA4I 3TEDA 3KP2A 1A5JA 1IV8A 1ZZBA 4WF2A 2A6TA 5EEHA 2ICTA 1UHSA 4BY1J 4WK8F 1WCMJ 4MHGA 1PUFA 2E2JJ 1Y1VJ 2LBFB 2DN0A 2XC7A 1W36C 4IOAF 4YFKF 4EKGA 3OYJA 2BE5F 2OA4A 3RKQA 1EFAA 4KN4X 5GAHJ 5IT9Z 3BDNA 3K2ZA 2EA4A 2V6CA 1MH3A 4A3EJ 1LE8A 2DXIA 1FSEA 2LP0A 1RIOH 2GAUA 3M4OJ 2E71A 4L5IA 3V8JA 1H89C 1BJZA 2LTPA 1QBJA 4MGRA 2YR2A 2AXUA 2R0QC 1JKOC 4ZDLA 1TWHJ 3OYHA 2ZJQF 2UXXA 3KE2A 5JLXA 2HFZA 3RKWA 4LB5A 1UCRA 3ERED 4XN0A 3KYDB 3FHNA 2LYSA 1MW7A 3EUHC 4IQ4A 2F4MB 1T95A 3HRSA 1OCOH 1U2ZA 2ZFUA 2Q2EB 1FIAA 3LQQA 4EM1A 3NWSA 3H36A 3LSIA 1ZZ6A 4M6VA 5L3EA 3P7NA 2M4KA 4Z58A 4LG0B 1W0UA 1NW3A 1MMSA 1MSEC 4G6TB 4I7HA 2ZSHB 3HKZN 5JVTA 4IOCF 1YW7A 4IXAA 3L7WA 1R71A 5TISC 4PSWA 2V1NA 3QOWA 1VQNI 4ESBA 3B6CA 4HQEA 3HSRA 3ESWB 3QWGA 3ZOBA 4X1EA 4X4IA 1IRXA 1FWZA 4MCXA 1B4AA 3NROA 3CP8A 1OR7C 3QU6A 1JGSA 2D5VA 1R1UA 3TKYA 2PUDA 2FRHA 5IP6A 4QLCU 4A12A 1Z1DA 3AL0C 3RQIA 2PXQA 3CTAA 3HOXJ 1JGGA 4A0ZA 3AL0B 4IHSA 1IN4A 3S3MA 3OYEA 3OMYA 2M2EA 2XGDA 1P4AA 5B1BH 1FYMA 4MIMA 4QIWN 4CYCA 2EV5A 4V19K 5EJCA 2M0MA 3IKTA 1RZRA 4RB1A 5CVJA 4A3MJ 3CDHA 4D7MA 1NH3A 3U1DA 2BY2A 2HQAA 2WAQN 2MLGA 2Y48A 3KPHA 3BROA 4Q47A 3ZMSA 5DCMA 1FOKA 1RIOA 2E1MC 4BUPA 1D8JA 4XRSG 3FYMA 5HS9A 2E1MB 3SEZA 3PJRA 4BHPA 3Q0VA 2Y0SA 1PERL 1XMKA 3A03A 4ZDPA 3CC2I 2WB1N 4DW6A 4NC8A 1K4TA 5L3BA 2GXAA 1QPIA 3FXLA 2NOJB 3VPRA 4B09A 4G8XA 2K27A 4OIQF 1ZLKA 3GFMA 1DDNA 1WPKA 2BOLA 3ISPA 3EPZA 3G71I 2EIMH 4BACA 1QQAA 2VKVA 2W7NA 5HLGA 4HYEA 3OS1A 1QQBA 1OYWA 2M8EA 2ZJ2A 1A31A 4C3JJ 1N77A 3WU1B 2KDZA 3TOBA 2WIUB 3QP5A 3VWBA 3F8MA 1CQTA 4F8DA 1D0ZA 2EFWA 3OIOA 3ONQA 4BHCA 5J40A 3E6CC 2MXDA 2PUCA 1VNDA 3LA2A 6PAXA 1U78A 1V5FA 5DM6F 4NDLA 3H1CA 4CICA 1IO2A 2RV8A 3V42A 1ADRA 4MO7A 3GTGJ 1QVTA 2FE3A 4PJNA 3FIWA 1YFHA 1SFKA 1R7JA 2HKOA 3NQOA 4UB6C 2IXSA 4OAYA 1ZELA 3SYTA 1Y39A 4XOTA 1TQPA 2CFOA 2MSYA 5K1YA 5K98B 1KQ0A 3NEUA 1KQ8A 1L3LA 3LWFA 2V9KA 2DFFA 4KIBA 1XGNA 1SMYF 4YIFA 2NVXJ 2M7BA 1SEUA 4BQQA 3FMQA 2VONA 4PSXA 2X48A 2VJJA 4QWQA 5FO5A 5H6RA 3OS0A 3OP9A 2H1KA 5GADJ 4DNCA 5IOZA 5EEAA 5ICEA 1W7PB 2KEKA 1P92A 3IRQA 4LD5A 4NB5A 4V2GA 3HDDA 3RI4A 5EGOB 2DMNA 2OAZA 3HSFA 4B47A 2E2HJ 5LHIA 4TV7A 3EUSA 1IV6A 2R7VA 1K78B 4J1WA 2V26A 2KMUA 3FYAA 1SD6A 4GYIA 1HCRA 2VJIA 3ZXSA 4BNCA 2EBIA 5CQEA 1BJAA 2E5NA 1ZQ3P 2KIQA 1ITYA 2CMPA 1MMAA 2DFHA 3GTJJ 2VIXA 2W1OA 3DM5A 4M9ZA 1HKTA 2A3SA 2DBBA 2LKSA 4FETA 3KJXA 1G6NA 3LSHA 4RAGA 2RNJA 2IJLA 3BCBA 1ACIA 3PUBA 1IUFA 2PJRB 4U7BA 3L00A 2DPUA 2DFEA 3Q0WA 3TOAA 5KHDA 2LD5A 1LDDA 1I50J 1R58A 2HOTA 2XGCA 3EDPA 2ZMEA 1TZLA 4GO1A 1QP4A 3OYBA 1ZRCA 3CUQC 1KA8A 2LF8A 2JVGA 4BY7J 4C3IJ 5LEKA 3CUQB 4HRIA 2LK2A 5AIPA 3OYNA 4UUSB 2CUEA 1AA7A 2HOEA 3A02A 4ENNA 1F1ZA 4JOMA 4IHXA 2HDWA 1OCTC 2PUEA 3I59A 1JJ6C 4LITA 4QPOA 3S1RJ 2DA5A 2JUCA 1TWFJ 2FNPA 1FPQA 1POGA 3BP8A 1ONVA 3F8BA 1MMGA 2VQGA 4LLGF 2IU7A 2VQCA 4B44A 3IKVA 2AQEA 2P8TA 4RDUA 1TLHB 3CCEI 3BR5A 3R6SA 1QHGA 2NNNA 3V7CA 1IRZA 2W4SA 4AU7A 1LQ1A 1T56A 4UUTA 2ESHA 3KZZA 4XR6A 2PPXA 5DS9A 2CQNA 2ISYA 2IAIA 4Z5HA 2BNOA 2QF7A 1CGPA 1ENHA 3PSIA 1T0FC 2A6CA 1GVDA 3F8FA 3H9GA 2UUZA 3OOPA 1XWRA 3OQNA 1K83J 1HQ1A 3J80Z 5CLSA 1RETA 2Y30A 5TGTA 1ZLJA 3O3KA 2IGNA 2Q1ZB 2VC1A 3LAPA 3KXAA 4A93J 1K79A 2JRMA 5D6EA 4BYYA 5BNGA 2K85A 4ZH4F 2LYPA 2ZCWA 4DIQA 4PUSA 4IJAA 5CVIA 2XAJA 2A69F 5FFZA 1O3RA 5F64A 4KUMA 5GTHC 1ZAOA 4HV6A 1S3JA 4YIRX 2V1UA 3IHUA 2CG4A 4GDFA 5CYVA 3VWSA 3MVPA 4XLFA 4A69C 4L5EA 2J7UA 1ETOA 4XLEA 2P5LC 2K9QA 3KEOA 3ECHA 2IW5A 1KQ9A 2O9LA 1A35A 2W00A 3DNVB 2H8RA 4WXDA 3W3CA 2QQBA 3JXCL 2DQLA 4BKXA 5F6FA 1BI0A 2K9NA 4FE7A 3W6KB 1JUSA 2CYYA 1U5TC 4LIVA 2HDCA 1L0OC 5IY5H 4CH7A 2PEXA 3E6BA 4BU2A 1J59A 1MBEA 1Z6RA 3MZ8A 5EEGA 4X6AJ 4E6KG 1Z67A 1ZZ7A 4HX7A 3TELA 5DV5A 2HCNA 3HG9A 2Z5UA 3TQNA 4A2UA 4JP0A 2AXVA 3LSGA 2JN6A 2EA2A 4M6YA 1ZKGA 5TJJA 5JHUA 2VBXA 2V4JC 3RZOJ 1WI3A 3PNVA 2M3AA 2PXPA 4I01A 5GAHi 1XCVA 1Y0NA 3GTLJ 3HOSA 1RRJA 2R5ZB 1FZPB 3BR0A 1SANA 3CCQI 2H8WA 4PJLA 2ICWG 3BLYA 3WTXC 1T38A 1HDPA 3IWZA 5CVRA 4C2MJ 4E7SA 1ERDA 3G2BA 4YEJA 5DUIA 4PGGA 1YJNI 1SFUA 1LMB3 3KX2A 1JFSA 2LDUA 4MLOA 3DKXA 1LB2A 1DPRA 2IVQA 1U8RA 3D0SA 3S1MJ 4YIIA 3WHCA 1E3OC 3S2HJ 1IAWA 2F2EA 2LLKA 2VB6A 4X0GA 4PJ0C 1B72A 4XRMA 2CV0A 2EH3A 4Y42A 1YOVB 4XLCA 4RGXA 2D45A 1DGWY 1UHMA 4EMSA 3ZMTA 3HL2A 3JRGA 2ZNYA 4PFOA 3S2DJ 2UWMA 3KLNA 4DBRA 2HTJA 1ETYA 2ZNZA 5GAEJ 4CCLA 2O5RA 5IOYA 1A6QA 3HC7A 1TQMA 4HPQA 3SCFA 1JWLA 4YG7B 3VOEA 2IS1A 2DA7A 2VJ4A 4Y15A 4LLNA 1BR1A 4IRHA 5L3CA 1BI1A 2KPMA 4OAZA 2PMUA 5J8FA 3BZ6A 2AS5F 4RB0A 1TTYA 1MDMA 4Y13A 3CJQB 4E7HA 1ZG3A 3HOYJ 4Y33A 3OR2C 2R93J 5D4RA 4ZZDA 1BC8C 2IPQX 3CMEI 4XNFA 1LFPA 2FMYA 2CROA 4MTEA 1HW5A 3GFLA 4L0YB 2FNAA 3F23A 2HYFA 3O8HA 3F8CA 5E17F 2EIKH 4IF4A 2EFPA 2I10A 3W2VA 4D7NA 3CZ6A 4X4BA 1TBXA 5LGTA 1S72I 2DDBA 2LYLA 3PXPA 4A6EA 2QZ8A 4ABZA 2G7UA 2CJJA 2KJBA 2X1EA 3BTLA 3DF8A 3HEFA 1WJ5A 1ZS4A 3GWZA 4EKIA 4P55A 2JQ7A 4ON0A 3R0JA 3A01A 4PDKA 4BL0B 5DT2A 3M8JA 2QEXI 4NC7A 1V4RA 2DW4A 3FBIB 1KU3A 1WQ2A 2RVCA 2RQPA 2IS2A 4GYGA 2VQHA 4IRIA 1G4DA 1BR4A 2ZFWA 1WZ2A 2LKXA 2R7UA 4KICA 2AXTC 1OCCH 1XN7A 2LY9A 4O8BA 2Q2EA 3S1NJ 2HPMA 4DGWB 1ZZ9A 2OPTA 2FQ4A 2DK8A 3SJMA 3OYKA 3D1NI 3V8KA 4LG0A 2QM3A 5ERIA 1IXSB 4CCKA 4OBMA 5D5XB 4D5FA 1W7PD 4I0BA 1JT0A 2PXDA 2K40A 3BTIA 1Z0XA 1RPEL 1O7LA 2E1OA 4J19A 1Y56A 2MYSA 3FK6A 2XSJC 1ULYA 2NVTJ 3OYLA 1IRGA 3BT9A 4WXHA 1IDZA 1SC7A 1VQ4I 3Q9VA 4OIPF 1V5GA 4CYDA 5IP9J 3I4MJ 3IAS2 3FHZA 3PQJA 2QGUA 4CO8A 2QCOA 1XPXA 1PP8F 5LHHA 4AWXB 3IH2A 4AYBN 2O61A 5E3LA 1R4NB 2A61A 1YI2I 1ZGJA 2R4GA 2DOFA 4BQOA 4W97A 3S8QA 5IT3A 2AUWA 2BY1A 4ESFA 4FN3A 5DTMA 2EZIA 2HVQA 1WJBA 2ELKA 2BV6A 3H0GJ 5DD8A 2LSOA 2HDDA 1NERA 4U0YA 2BBYA 1VQ7I 2X6WA 2GOMA 5DSXA 2ECBA 2A68F 2H94A 3CDLA 2HEOA 3CO6C 1AU7A 3ZHMA 3JRAA 1XMAA 2IBDA 3GZ6A 1D1BA 5LHGA 5HLTA 1DUXC 1STZA 3ZQIA 1ON2A 2KRHA 3MEXA 3VYSB 3ZQQA 5FRMA 4EJTA 3E97A 4M71A 4B1RA 3O9XA 4Y7NJ 1TT0A 2XAHA 1SFEA 2JRTA 1QZYA 2LY1A 4PJJA 2Z1DA 2LYKA 1V55H 3G1LA 2V9VA 3DPUA 3R4KA 4YFXF 4NQWB 4HLYA 1JTYA 3M9LA 1ZZCA 2DMPA 4HF0A 2V3CC 4HX4A 2PFBA 3QPHA 4XRSA 5K7HA 4G6DA 2WY8Q 3VSKA 2OQRA 4HNVA 2O03A
chains in the Genus database with same CATH topology
3ZOBA 1FIPA 4X1EA 4X4IA 1X58A 4I8TA 4JX6A 2L9RA 1MBJA 5E3OA 1GT0C 4MCXA 2K9SA 2JJ7A 3IV5A 5HODA 4V2FA 2D5VA 3JXDL 2HQ5A 1IDYA 5IP6A 5FJ8J 2PUDA 4A3JJ 3RQIA 3HOXJ 5M5WJ 1JGGA 2Y2ZA 1RPWA 5IYBJ 2M2EA 2XGDA 3QPSA 4QSHA 3IH3A 2Y31A 3HM5A 1WH8A 2XPUA 4MIMA 4DYCA 4QIWN 5J1YA 4CYCA 2L8NA 3RZZA 5EF6A 1LFUP 1HLVA 1DWKA 1UTXA 1Q1VA 4NDWA 1RZRA 2M8GX 4PU8A 4A3MJ 1PUFB 2R92J 4D7MA 5FKMA 2WAQN 4M3DA 4FTHA 5F0HA 1H88C 1FJLA 2MEZA 3OSGA 2M9HA 1B0NA 2JCGA 5JLWA 5EGOA 1RIOA 4XRSG 1OCPA 3FYMA 3LFPA 2LVSA 3TW7A 5FLVA 1NTCA 3BR2A 1LE8B 3Q0VA 1ETKA 1PERL 3CROL 3A03A 2KT0A 1LCCA 2WB1N 4DW6A 1K61A 4MFEA 1QPIA 2KPJA 2E19A 3VPRA 5EZGA 1WETA 2W48A 1MBHA 4OB4A 4X4FA 1WPKA 2O38A 3GBFA 2AW6A 3HBLA 2OFYA 2JA6J 1QQAA 2LYRA 2VKVA 4DYRA 3DEWA 2AO9A 1FTTA 1ZPQA 1QQBA 2JA5J 2BNNA 4BBRJ 2LFBA 4C3JJ 1AKHA 1YRNB 3TRBA 2JWTA 1LLIA 2NS7A 2PUGA 1VI0A 2KDZA 2XCJA 4EEFG 2WIUB 1P7IA 3GBGA 4A3CJ 2OR1L 9ANTA 5FKLA 3TW6A 2YUSA 1F36A 1CQTA 1JKRC 4F8DA 3K2AA 2IVGA 3HOZJ 2MW8A 2XI8A 3OIOA 2PUCA 5J3LA 1ETVA 1VNDA 1U78A 2M0CA 4JCXA 1X2MA 3C2BA 4NDLA 4UUSA 4FBIA 1DU0A 1F43A 4GQMA 4MCTA 2JK3A 4M3FA 1ADRA 3SFIA 1XC5A 4MO7A 2HI3A 2XPVA 3GTGJ 2LYQA 3G5GA 1QVTA 5J1UA 1R69A 1UMQA 3FIWA 1Y9QA 4W1UA 1VPWA 2X9DA 3G1MA 1ZZ8A 3HOUJ 2E2IJ 1ETWA 2VPRA 5C3EJ 3G7DA 3OSFA 2DMQA 2ICPA 2MSYA 3HOWJ 2M34A 3FISA 1JH9A 5K98B 4AUXA 3NARA 1GDTA 2HSGA 4FE4A 1BDHA 3TP0A 3LISA 3HZIB 2MG4A 2NVXJ 3QF3A 4CYCB 2L49A 3HGYA 3OQOA 2X48A 2DJNA 5F27A 1RKWA 2AHQA 5IPAA 3OP9A 2H1KA 2HXOA 5EEAA 5IOZA 2PMZN 2XB0X 1JTXA 1HOMA 2AWIA 2KEKA 2BJCA 4V2GA 3HDDA 5EGOB 1IC8A 3W6VA 3UFDA 3BTJA 3BG5A 1WH7A 2DMNA 4JYKA 3G1OA 3LSJA 5J1RA 1RR7A 2EZKA 4YBAA 4XK4A 3F0CA 3TP3A 2E2HJ 2VKEA 1SFOJ 3PM1A 2KZ8A 3EUSA 3QQ6A 1HF0A 1IV6A 2DA4A 4J1WA 3S16J 2O7OA 2DMUA 3FYAA 1HCRA 3M3YJ 2EBIA 2NS8A 5M5XJ 1ZQ3P 1FEXA 1ITYA 2MGQA 2PUBA 3GTJJ 1BL0A 1X2LA 4RBOA 1X57A 3KJXA 3CECA 1NK3P 1WH5A 3K7AJ 1IUFA 2GRLA 4G12A 1AKHB 3H3VK 4JCYA 5FKKA 2NVYJ 3F6WA 3Q0WA 3ZQHA 2LD5A 3CLCA 2L0KA 1I50J 3OQMA 2HOTA 1QPZA 2XGCA 4LOCA 1QP4A 1QP7A 2TCTA 2WUSR 3BS3A 4BY7J 4C3IJ 4X4EA 2PIJA 1NK2P 3R1FA 2LK2A 3QQAA 2DA3A 3SDGA 4UUSB 2CUEA 4A3DJ 1R63A 3A02A 3B6AA 3JRBA 4IHXA 5FKNA 2CSFA 3Q0UA 1OCTC 1HDDC 2PUEA 1JJ6C 4MFDA 3S1RJ 2HINA 2PUAA 2DA5A 2EF8A 1TWFJ 3DCFA 1POGA 2IU7A 1TC3C 3CMYA 3GTQJ 4M3GA 1RZSA 2R5ZA 4RDUA 2CU7A 4JQDA 4YARA 4IHYA 3BR5A 1MBGA 1IRZA 1JT6A 1U9NA 2Y9YA 1JKQC 1T56A 4UUTA 2PPXA 5DS9A 2IAIA 1CJGA 4Z5HA 1X2NA 2EQRA 1TWGJ 1ENHA 2JMWA 2QF7A 2BNOA 2A6CA 4X4DA 1GVDA 3JXBC 4BBSJ 1XWRA 1PNRA 3OQNA 1K83J 1PRAA 5FKOA 1RKTA 1GV5A 5F1JA 1JFTA 3RZDJ 1RETA 2Y30A 3KXAA 1BW6A 4C3HJ 3L1PA 3JR9A 4A93J 2R7ZJ 1BW5A 2IUOA 3F52A 4I6UA 5BNGA 2CRGA 2LYPA 4I6TA 1GV2A 4I76A 1ETXA 3JRHA 2O49A 2X6OA 3ZQCA 2Y9ZA 2RAEA 2ME6A 1ETQA 1O4XA 3F51A 5K7ZA 3VK0A 1TWCJ 3MVPA 1JKPC 1JUMA 1EF4A 4A69C 4L5EA 3S1QJ 2CQQA 1SQ8A 1ETOA 1TWAJ 2K9QA 2IV1A 2KEJA 2O9LA 1WH6A 2GM4A 1VF9A 1Y1WJ 3DNVB 2H8RA 1H8AC 3ZKCA 3MLFA 4IHVA 3JXCL 1FTZA 4BKXA 4GHJA 2K9NA 4X4HA 4FE7A 2O8KA 1JUSA 2GBYA 4X6AJ 1ZZ7A 1MBEA 3BR1A 4JX5A 3B7HA 4A3KJ 2GRMA 5C4JJ 3I4NJ 3E7LA 4Z5DA 4JP0A 3GTOJ 2AXVA 3LSGA 2CUFA 2JN6A 3SCHA 1ZKGA 5EDNA 2BNMA 4D5CA 5E3NA 1ZR4A 1VFCA 5M3MJ 3RZOJ 1WI3A 3GTLJ 4A3BJ 1QP0A 2R5ZB 3JRFA 3BR0A 1SANA 5EZHA 4FCYA 1IG7A 2MQKA 1HDPA 4DYQA 4C2MJ 1QRYA 1POUA 1LMB3 1JFSA 3S15J 4MLOA 3MKLA 2COBA 3A01B 2IVQA 3S1MJ 3GTPJ 3WHCA 1E3OC 3S2HJ 4X4GA 1ZGWA 2LLKA 1B72A 4B4CA 3BQYA 4XRMA 2EH3A 3BD1A 3OMTA 4Y42A 5GP9A 4M3EA 2VI6A 2EZLA 4IEJA 2YU9J 5FLMJ 3JRGA 1Z77A 3S2DJ 3ZHIA 5GPCA 1ETYA 5IOYA 4Y52J 5F04A 3S14J 4XIDA 2G0EA 3SCFA 2DMTA 3ZQGA 1WIZA 1YSEA 4YG7B 1JWLA 2DA7A 2IEKA 2GLOA 1ZUGA 2EWTA 1DU6A 1ZAYA 1ZVVA 2HYJA 3LSRA 2DA1A 3GTKJ 3BG9A 5DTDA 2KEIA 1XG1A 3HOYJ 2ZB9A 3Q3SA 2R93J 4IVZA 1T33A 3H5TA 2OF7A 3KZ3A 4X4CA 5E3MA 1JUPA 3QPLA 2CROA 2L7FP 4M3BA 4B3AA 2R5YB 5F0FA 2DTZA 3O8HA 2LR8A 1I6HJ 4Z59A 2I10A 4D7NA 3QWGA 4X4BA 1S7EA 2YS9A 4A3IJ 5EG0B 2IVBA 4JX4A 1MBFA 2LYLA 4BXXJ 5M3FJ 3HOVJ 4ABZA 1LQCA 3FMYA 3GN5A 3PXPA 1PRUA 2CJJA 3PO2J 3O8GA 1B8IA 1MH4A 5C4XJ 2XB5A 3BTLA 1RESA 3HEFA 1AHDP 2HOAA 1ZS4A 3ZQFA 4YG1A 3A01A 3S17J 5IYCJ 3UKGA 1OFCX 1ZR2A 3QYXA 2ID3A 3OOUA 4IHWA 2JA8J 3LOCA 2FJRA 2R63A 2LKXA 4A3GJ 2HOSA 2EBYA 4A3LJ 2N8GA 2P81A 5A7LA 2LY9A 4O8BA 3S1NJ 4J1XA 1NEQA 1ZZ9A 2DA6A 5F0CA 2OPTA 3BTCA 1A6IA 2L7MP 2FQ4A 5F08A 3SJMA 5M5YJ 2L7ZA 3D1NI 1UG2A 3ZQLA 1IJWC 1RZRD 2NOGA 3GTMJ 2Y0SN 1MNMC 1QVUA 2XJ3A 4D5FA 1JT0A 2K40A 2FX0A 3BG3A 5GPAA 3BTIA 2PUFA 1Z0XA 3CQZJ 3JRDA 1B72B 2ECCA 1XS9A 1RPEL 3IH4A 2E1OA 3JREA 4J19A 1MSFC 4YG4A 4GFBA 3FK6A 4I6ZA 1U8BA 1Y7YA 2JA7J 2NVTJ 3NAUA 4FISA 4S0HB 2R5YA 3BT9A 1R9TJ 4XICA 1IDZA 1OJLA 1MBKA 2FD5A 2TRTA 5IP7J 3BQZA 1OSLA 2XRLA 5IP9J 3LSPA 2XSDC 3HGGA 2AXZA 1ORKA 1ZTRA 3I4MJ 2LYJA 2ID6A 5EG0A 1LFBA 4DZPA 4IA8A 4IWRA 3CCYA 2QCOA 1DW9A 3TEDA 2XGEA 1A5JA 3IH2A 4AYBN 1ZZBA 2R1JL 1WGXA 2ICTA 5E3LA 1UHSA 4BY1J 2XPWA 4I6RA 4PU4C 1WCMJ 1PUFA 2E2JJ 4W97A 1Y1VJ 3S8QA 2VUMJ 2DN0A 2AUWA 1UXDA 4FN3A 2EZIA 3BR3A 3PO3J 3JRCA 3FKIJ 1U9OA 3RKQA 2ELKA 3H0GJ 1EFAA 3WHBA 3BDNA 3GN5B 2HDDA 1NERA 5IYDJ 4AC0A 2ME0A 1MH3A 4A3EJ 1LE8A 1B8IB 1IGNA 4PU3C 1G2HA 2PE5A 2LP0A 2EZHA 5EYRA 2ECBA 3LNQA 2GZUA 3BR6A 2B5AA 3M4OJ 3CDLA 1H89C 1JJ8C 1BJZA 1AU7A 1BDIA 2LTPA 5C44J 3ZHMA 3MN2A 3JRAA 2IBDA 2CQXA 2AXUA 2XIUA 2R0QC 1JKOC 2B63J 3SCGA 1I3QJ 1TWHJ 3ZQIA 5JLXA 1W0TA 1BA5A 3O9XA 4B1RA 4Y7NJ 2O4AA 1P7JA 2LYSA 2JVLA 1D5YA 1FIAA 3JRIA 2LYKA 1YRNA 1PRVA 1ZZ6A 4A3FJ 3G1LA 4M6VA 1UXCA 2NVQJ 2FJ1A 2WV1A 3HB9A 1ZK8A 1JTYA 5K7FA 4Z58A 1ZZCA 4QTRA 1W0UA 2DMPA 2DA2A 1GUUA 1MSEC 4PU7A 1L1MA 3HKZN 3FK7A 4XRSA 4Z5CA 5K7HA 1LCDA 1APLC 2LCVA 3U3WA 3IVPA 3B6CA 4HNVA 2HXIA 4DZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZOB A;  1FIP A;  4X1E A;  4X4I A;  1X58 A;  4I8T A;  4JX6 A;  2L9R A;  1MBJ A;  5E3O A;  1GT0 C;  4MCX A;  2K9S A;  2JJ7 A;  3IV5 A;  5HOD A;  4V2F A;  2D5V A;  3JXD L;  2HQ5 A;  1IDY A;  5IP6 A;  5FJ8 J;  2PUD A;  4A3J J;  3RQI A;  3HOX J;  5M5W J;  1JGG A;  2Y2Z A;  1RPW A;  5IYB J;  2M2E A;  2XGD A;  3QPS A;  4QSH A;  3IH3 A;  2Y31 A;  3HM5 A;  1WH8 A;  2XPU A;  4MIM A;  4DYC A;  4QIW N;  5J1Y A;  4CYC A;  2L8N A;  3RZZ A;  5EF6 A;  1LFU P;  1HLV A;  1DWK A;  1UTX A;  1Q1V A;  4NDW A;  1RZR A;  2M8G X;  4PU8 A;  4A3M J;  1PUF B;  2R92 J;  4D7M A;  5FKM A;  2WAQ N;  4M3D A;  4FTH A;  5F0H A;  1H88 C;  1FJL A;  2MEZ A;  3OSG A;  2M9H A;  1B0N A;  2JCG A;  5JLW A;  5EGO A;  1RIO A;  4XRS G;  1OCP A;  3FYM A;  3LFP A;  2LVS A;  3TW7 A;  5FLV A;  1NTC A;  3BR2 A;  1LE8 B;  3Q0V A;  1ETK A;  1PER L;  3CRO L;  3A03 A;  2KT0 A;  1LCC A;  2WB1 N;  4DW6 A;  1K61 A;  4MFE A;  1QPI A;  2KPJ A;  2E19 A;  3VPR A;  5EZG A;  1WET A;  2W48 A;  1MBH A;  4OB4 A;  4X4F A;  1WPK A;  2O38 A;  3GBF A;  2AW6 A;  3HBL A;  2OFY A;  2JA6 J;  1QQA A;  2LYR A;  2VKV A;  4DYR A;  3DEW A;  2AO9 A;  1FTT A;  1ZPQ A;  1QQB A;  2JA5 J;  2BNN A;  4BBR J;  2LFB A;  4C3J J;  1AKH A;  1YRN B;  3TRB A;  2JWT A;  1LLI A;  2NS7 A;  2PUG A;  1VI0 A;  2KDZ A;  2XCJ A;  4EEF G;  2WIU B;  1P7I A;  3GBG A;  4A3C J;  2OR1 L;  9ANT A;  5FKL A;  3TW6 A;  2YUS A;  1F36 A;  1CQT A;  1JKR C;  4F8D A;  3K2A A;  2IVG A;  3HOZ J;  2MW8 A;  2XI8 A;  3OIO A;  2PUC A;  5J3L A;  1ETV A;  1VND A;  1U78 A;  2M0C A;  4JCX A;  1X2M A;  3C2B A;  4NDL A;  4UUS A;  4FBI A;  1DU0 A;  1F43 A;  4GQM A;  4MCT A;  2JK3 A;  4M3F A;  1ADR A;  3SFI A;  1XC5 A;  4MO7 A;  2HI3 A;  2XPV A;  3GTG J;  2LYQ A;  3G5G A;  1QVT A;  5J1U A;  1R69 A;  1UMQ A;  3FIW A;  1Y9Q A;  4W1U A;  1VPW A;  2X9D A;  3G1M A;  1ZZ8 A;  3HOU J;  2E2I J;  1ETW A;  2VPR A;  5C3E J;  3G7D A;  3OSF A;  2DMQ A;  2ICP A;  2MSY A;  3HOW J;  2M34 A;  3FIS A;  1JH9 A;  5K98 B;  4AUX A;  3NAR A;  1GDT A;  2HSG A;  4FE4 A;  1BDH A;  3TP0 A;  3LIS A;  3HZI B;  2MG4 A;  2NVX J;  3QF3 A;  4CYC B;  2L49 A;  3HGY A;  3OQO A;  2X48 A;  2DJN A;  5F27 A;  1RKW A;  2AHQ A;  5IPA A;  3OP9 A;  2H1K A;  2HXO A;  5EEA A;  5IOZ A;  2PMZ N;  2XB0 X;  1JTX A;  1HOM A;  2AWI A;  2KEK A;  2BJC A;  4V2G A;  3HDD A;  5EGO B;  1IC8 A;  3W6V A;  3UFD A;  3BTJ A;  3BG5 A;  1WH7 A;  2DMN A;  4JYK A;  3G1O A;  3LSJ A;  5J1R A;  1RR7 A;  2EZK A;  4YBA A;  4XK4 A;  3F0C A;  3TP3 A;  2E2H J;  2VKE A;  1SFO J;  3PM1 A;  2KZ8 A;  3EUS A;  3QQ6 A;  1HF0 A;  1IV6 A;  2DA4 A;  4J1W A;  3S16 J;  2O7O A;  2DMU A;  3FYA A;  1HCR A;  3M3Y J;  2EBI A;  2NS8 A;  5M5X J;  1ZQ3 P;  1FEX A;  1ITY A;  2MGQ A;  2PUB A;  3GTJ J;  1BL0 A;  1X2L A;  4RBO A;  1X57 A;  3KJX A;  3CEC A;  1NK3 P;  1WH5 A;  3K7A J;  1IUF A;  2GRL A;  4G12 A;  1AKH B;  3H3V K;  4JCY A;  5FKK A;  2NVY J;  3F6W A;  3Q0W A;  3ZQH A;  2LD5 A;  3CLC A;  2L0K A;  1I50 J;  3OQM A;  2HOT A;  1QPZ A;  2XGC A;  4LOC A;  1QP4 A;  1QP7 A;  2TCT A;  2WUS R;  3BS3 A;  4BY7 J;  4C3I J;  4X4E A;  2PIJ A;  1NK2 P;  3R1F A;  2LK2 A;  3QQA A;  2DA3 A;  3SDG A;  4UUS B;  2CUE A;  4A3D J;  1R63 A;  3A02 A;  3B6A A;  3JRB A;  4IHX A;  5FKN A;  2CSF A;  3Q0U A;  1OCT C;  1HDD C;  2PUE A;  1JJ6 C;  4MFD A;  3S1R J;  2HIN A;  2PUA A;  2DA5 A;  2EF8 A;  1TWF J;  3DCF A;  1POG A;  2IU7 A;  1TC3 C;  3CMY A;  3GTQ J;  4M3G A;  1RZS A;  2R5Z A;  4RDU A;  2CU7 A;  4JQD A;  4YAR A;  4IHY A;  3BR5 A;  1MBG A;  1IRZ A;  1JT6 A;  1U9N A;  2Y9Y A;  1JKQ C;  1T56 A;  4UUT A;  2PPX A;  5DS9 A;  2IAI A;  1CJG A;  4Z5H A;  1X2N A;  2EQR A;  1TWG J;  1ENH A;  2JMW A;  2QF7 A;  2BNO A;  2A6C A;  4X4D A;  1GVD A;  3JXB C;  4BBS J;  1XWR A;  1PNR A;  3OQN A;  1K83 J;  1PRA A;  5FKO A;  1RKT A;  1GV5 A;  5F1J A;  1JFT A;  3RZD J;  1RET A;  2Y30 A;  3KXA A;  1BW6 A;  4C3H J;  3L1P A;  3JR9 A;  4A93 J;  2R7Z J;  1BW5 A;  2IUO A;  3F52 A;  4I6U A;  5BNG A;  2CRG A;  2LYP A;  4I6T A;  1GV2 A;  4I76 A;  1ETX A;  3JRH A;  2O49 A;  2X6O A;  3ZQC A;  2Y9Z A;  2RAE A;  2ME6 A;  1ETQ A;  1O4X A;  3F51 A;  5K7Z A;  3VK0 A;  1TWC J;  3MVP A;  1JKP C;  1JUM A;  1EF4 A;  4A69 C;  4L5E A;  3S1Q J;  2CQQ A;  1SQ8 A;  1ETO A;  1TWA J;  2K9Q A;  2IV1 A;  2KEJ A;  2O9L A;  1WH6 A;  2GM4 A;  1VF9 A;  1Y1W J;  3DNV B;  2H8R A;  1H8A C;  3ZKC A;  3MLF A;  4IHV A;  3JXC L;  1FTZ A;  4BKX A;  4GHJ A;  2K9N A;  4X4H A;  4FE7 A;  2O8K A;  1JUS A;  2GBY A;  4X6A J;  1ZZ7 A;  1MBE A;  3BR1 A;  4JX5 A;  3B7H A;  4A3K J;  2GRM A;  5C4J J;  3I4N J;  3E7L A;  4Z5D A;  4JP0 A;  3GTO J;  2AXV A;  3LSG A;  2CUF A;  2JN6 A;  3SCH A;  1ZKG A;  5EDN A;  2BNM A;  4D5C A;  5E3N A;  1ZR4 A;  1VFC A;  5M3M J;  3RZO J;  1WI3 A;  3GTL J;  4A3B J;  1QP0 A;  2R5Z B;  3JRF A;  3BR0 A;  1SAN A;  5EZH A;  4FCY A;  1IG7 A;  2MQK A;  1HDP A;  4DYQ A;  4C2M J;  1QRY A;  1POU A;  1LMB 3;  1JFS A;  3S15 J;  4MLO A;  3MKL A;  2COB A;  3A01 B;  2IVQ A;  3S1M J;  3GTP J;  3WHC A;  1E3O C;  3S2H J;  4X4G A;  1ZGW A;  2LLK A;  1B72 A;  4B4C A;  3BQY A;  4XRM A;  2EH3 A;  3BD1 A;  3OMT A;  4Y42 A;  5GP9 A;  4M3E A;  2VI6 A;  2EZL A;  4IEJ A;  2YU9 J;  5FLM J;  3JRG A;  1Z77 A;  3S2D J;  3ZHI A;  5GPC A;  1ETY A;  5IOY A;  4Y52 J;  5F04 A;  3S14 J;  4XID A;  2G0E A;  3SCF A;  2DMT A;  3ZQG A;  1WIZ A;  1YSE A;  4YG7 B;  1JWL A;  2DA7 A;  2IEK A;  2GLO A;  1ZUG A;  2EWT A;  1DU6 A;  1ZAY A;  1ZVV A;  2HYJ A;  3LSR A;  2DA1 A;  3GTK J;  3BG9 A;  5DTD A;  2KEI A;  1XG1 A;  3HOY J;  2ZB9 A;  3Q3S A;  2R93 J;  4IVZ A;  1T33 A;  3H5T A;  2OF7 A;  3KZ3 A;  4X4C A;  5E3M A;  1JUP A;  3QPL A;  2CRO A;  2L7F P;  4M3B A;  4B3A A;  2R5Y B;  5F0F A;  2DTZ A;  3O8H A;  2LR8 A;  1I6H J;  4Z59 A;  2I10 A;  4D7N A;  3QWG A;  4X4B A;  1S7E A;  2YS9 A;  4A3I J;  5EG0 B;  2IVB A;  4JX4 A;  1MBF A;  2LYL A;  4BXX J;  5M3F J;  3HOV J;  4ABZ A;  1LQC A;  3FMY A;  3GN5 A;  3PXP A;  1PRU A;  2CJJ A;  3PO2 J;  3O8G A;  1B8I A;  1MH4 A;  5C4X J;  2XB5 A;  3BTL A;  1RES A;  3HEF A;  1AHD P;  2HOA A;  1ZS4 A;  3ZQF A;  4YG1 A;  3A01 A;  3S17 J;  5IYC J;  3UKG A;  1OFC X;  1ZR2 A;  3QYX A;  2ID3 A;  3OOU A;  4IHW A;  2JA8 J;  3LOC A;  2FJR A;  2R63 A;  2LKX A;  4A3G J;  2HOS A;  2EBY A;  4A3L J;  2N8G A;  2P81 A;  5A7L A;  2LY9 A;  4O8B A;  3S1N J;  4J1X A;  1NEQ A;  1ZZ9 A;  2DA6 A;  5F0C A;  2OPT A;  3BTC A;  1A6I A;  2L7M P;  2FQ4 A;  5F08 A;  3SJM A;  5M5Y J;  2L7Z A;  3D1N I;  1UG2 A;  3ZQL A;  1IJW C;  1RZR D;  2NOG A;  3GTM J;  2Y0S N;  1MNM C;  1QVU A;  2XJ3 A;  4D5F A;  1JT0 A;  2K40 A;  2FX0 A;  3BG3 A;  5GPA A;  3BTI A;  2PUF A;  1Z0X A;  3CQZ J;  3JRD A;  1B72 B;  2ECC A;  1XS9 A;  1RPE L;  3IH4 A;  2E1O A;  3JRE A;  4J19 A;  1MSF C;  4YG4 A;  4GFB A;  3FK6 A;  4I6Z A;  1U8B A;  1Y7Y A;  2JA7 J;  2NVT J;  3NAU A;  4FIS A;  4S0H B;  2R5Y A;  3BT9 A;  1R9T J;  4XIC A;  1IDZ A;  1OJL A;  1MBK A;  2FD5 A;  2TRT A;  5IP7 J;  3BQZ A;  1OSL A;  2XRL A;  5IP9 J;  3LSP A;  2XSD C;  3HGG A;  2AXZ A;  1ORK A;  1ZTR A;  3I4M J;  2LYJ A;  2ID6 A;  5EG0 A;  1LFB A;  4DZP A;  4IA8 A;  4IWR A;  3CCY A;  2QCO A;  1DW9 A;  3TED A;  2XGE A;  1A5J A;  3IH2 A;  4AYB N;  1ZZB A;  2R1J L;  1WGX A;  2ICT A;  5E3L A;  1UHS A;  4BY1 J;  2XPW A;  4I6R A;  4PU4 C;  1WCM J;  1PUF A;  2E2J J;  4W97 A;  1Y1V J;  3S8Q A;  2VUM J;  2DN0 A;  2AUW A;  1UXD A;  4FN3 A;  2EZI A;  3BR3 A;  3PO3 J;  3JRC A;  3FKI J;  1U9O A;  3RKQ A;  2ELK A;  3H0G J;  1EFA A;  3WHB A;  3BDN A;  3GN5 B;  2HDD A;  1NER A;  5IYD J;  4AC0 A;  2ME0 A;  1MH3 A;  4A3E J;  1LE8 A;  1B8I B;  1IGN A;  4PU3 C;  1G2H A;  2PE5 A;  2LP0 A;  2EZH A;  5EYR A;  2ECB A;  3LNQ A;  2GZU A;  3BR6 A;  2B5A A;  3M4O J;  3CDL A;  1H89 C;  1JJ8 C;  1BJZ A;  1AU7 A;  1BDI A;  2LTP A;  5C44 J;  3ZHM A;  3MN2 A;  3JRA A;  2IBD A;  2CQX A;  2AXU A;  2XIU A;  2R0Q C;  1JKO C;  2B63 J;  3SCG A;  1I3Q J;  1TWH J;  3ZQI A;  5JLX A;  1W0T A;  1BA5 A;  3O9X A;  4B1R A;  4Y7N J;  2O4A A;  1P7J A;  2LYS A;  2JVL A;  1D5Y A;  1FIA A;  3JRI A;  2LYK A;  1YRN A;  1PRV A;  1ZZ6 A;  4A3F J;  3G1L A;  4M6V A;  1UXC A;  2NVQ J;  2FJ1 A;  2WV1 A;  3HB9 A;  1ZK8 A;  1JTY A;  5K7F A;  4Z58 A;  1ZZC A;  4QTR A;  1W0U A;  2DMP A;  2DA2 A;  1GUU A;  1MSE C;  4PU7 A;  1L1M A;  3HKZ N;  3FK7 A;  4XRS A;  4Z5C A;  5K7H A;  1LCD A;  1APL C;  2LCV A;  3U3W A;  3IVP A;  3B6C A;  4HNV A;  2HXI A;  4DZJ A; 
#chains in the Genus database with same CATH topology
 3S93 A;  1UEL B;  4G6Q A;  4I8T A;  1IXC A;  2L9R A;  5E3O A;  2K9S A;  3IV5 A;  2FEZ A;  5HOD A;  2VEO A;  4V2F A;  4M6X A;  4OIO F;  3JXD L;  2CV1 A;  2XAF A;  2LLV A;  1WKM A;  2FXA A;  3K1M A;  3KP5 A;  4GXO A;  5E20 A;  5FJ8 J;  3QP6 A;  1R00 A;  5HDN A;  5M5W J;  3KYL A;  3L2W A;  1RPW A;  4EQQ A;  2X1D A;  2IGO A;  4AIH A;  5J4V A;  1WH8 A;  1R6R A;  2XPU A;  4DYC A;  2L8N A;  3H35 A;  2DLL A;  2WBM A;  5EF6 A;  2VL8 A;  3ZMV A;  4FX0 A;  1UTX A;  4NDW A;  1JHF A;  3SDB A;  4PU8 A;  2GA2 A;  2R92 J;  4AVP A;  3J81 Z;  1W7P A;  2NS0 A;  2VN2 A;  3I56 I;  1IUY A;  3BDD A;  2MEZ A;  2M9H A;  5K5Q A;  1B0N A;  5JLW A;  4S05 A;  5EGO A;  1XGS A;  2I5U A;  1XDS A;  2LLW A;  4GRI A;  3VFZ A;  4AIJ A;  1E17 A;  3U1K A;  2KT0 A;  3F6V A;  2O3F A;  2OCE A;  1K78 A;  1FX7 A;  1ON1 A;  2A6E F;  2DYS H;  1YO5 C;  3HUG A;  1ZGA A;  2E19 A;  1WET A;  5LRS A;  4ZYH A;  4BJT A;  4OB4 A;  5FD5 A;  2O38 A;  1TNT A;  4CUG A;  5JFR A;  1KU7 A;  1R1V A;  2JA6 J;  5B5E C;  4HSR A;  3TO6 A;  2E60 A;  2V6E A;  4RLF A;  3G73 A;  3GFJ A;  1FTT A;  1G3S A;  2VOD A;  4BBR J;  2LFB A;  1YRN B;  2PUG A;  1VI0 A;  2XCJ A;  3CES A;  2RRE A;  2WV0 A;  4EEF G;  3K69 A;  2XAG A;  3GBG A;  1H9T A;  3GLL A;  1I27 A;  2E35 A;  4ER5 A;  1F36 A;  2PQ8 A;  3ULQ B;  3K2A A;  3P9I A;  3VDX A;  3WE3 A;  3WOD F;  4IZZ A;  2GWR A;  2MW8 A;  2IVG A;  2XI8 A;  4M9S A;  4CCN A;  4ANJ A;  1ETV A;  2KZV A;  4JCX A;  4UUS A;  3PL8 A;  5A2Q K;  1MMD A;  3E5X A;  5KVR A;  2EFO A;  1SVM A;  4GQM A;  4MCT A;  2JK3 A;  4M3F A;  3SFI A;  1XC5 A;  1G3Y A;  2HI3 A;  2XPV A;  3WU2 C;  2LYQ A;  3G5G A;  3CCR I;  3IRR A;  2ZJR F;  3TFL A;  2CV2 A;  2PXK A;  1S7A A;  1Y9Q A;  4W1U A;  1VPW A;  3GW2 A;  1ZZ8 A;  1ETW A;  3SZT A;  5C3E J;  3OSF A;  2DMQ A;  2ICP A;  2M4G A;  1W5S A;  3K1P A;  3KZY A;  4FE4 A;  2XAS A;  4OIR F;  4I09 A;  3JAM Z;  4IQJ A;  5ICG A;  4NNJ A;  3ME5 A;  2L49 A;  4MTD A;  3HGY A;  4N9I A;  1F4K A;  2DJN A;  1P4X A;  1RKW A;  1BI3 A;  4H4K C;  2VPL A;  1BN5 A;  1J0R A;  1T0F A;  2PMZ N;  1JTX A;  4KFC A;  2GIV A;  2ELJ A;  1UAA A;  4II2 A;  4Y17 A;  2ZXI A;  3PUF A;  2A6H F;  4LB6 B;  2H09 A;  1UFM A;  4NBQ A;  3W6V A;  3V7S A;  3BG5 A;  3UFD A;  1R1T A;  1WH7 A;  3FXO A;  1PYV A;  5J1R A;  1RR7 A;  3H5N A;  2KZ8 A;  3H3U A;  4Q48 A;  5LBQ A;  4HLX A;  4XKB A;  1HF0 A;  2LRE A;  2P5V A;  2DA4 A;  3M1E A;  3OS2 A;  1R36 A;  3HKZ A;  2DOD A;  1O3T A;  1SVL A;  3CLQ A;  2KJC A;  3M1C A;  3S3N A;  1K7A A;  4P9U A;  5M5X J;  2MGQ A;  3GLX A;  1WJF A;  3RKY A;  4F91 B;  3E5U A;  2F4O B;  1X2L A;  4Q5S F;  4HQM A;  3GUU A;  4XMY A;  3LSM A;  3K7A J;  2GRL A;  4G12 A;  1AKH B;  1VQ6 I;  4XSX F;  4JCY A;  5AIQ A;  3VOD A;  3ML6 A;  4LJZ F;  2K9M A;  4ZYA A;  5D5U B;  1QPZ A;  2FFH A;  4HRA A;  4LOC A;  1QP7 A;  1CF7 A;  2TCT A;  4X4E A;  4BE0 A;  1MD0 A;  3BJO A;  3R1F A;  3QQA A;  2C6Y A;  2QLZ A;  1EA3 A;  2HVS A;  1LKX A;  3K6G A;  4A3D J;  4IRG A;  1R63 A;  4PJM A;  3BOQ A;  5FKN A;  3Q0U A;  2WAQ A;  3RKX A;  2QBY B;  4G9Y A;  2HIN A;  2PXE A;  1WI9 A;  3PE5 A;  1HW2 A;  2PLY A;  5BQT A;  1TC3 C;  3CMY A;  1RZS A;  2R5Z A;  2L9V A;  3HTS B;  5IT9 K;  4H0E A;  4ZYE A;  2GXB A;  1D5V A;  4XKC A;  2CU7 A;  2K3P A;  3UNG C;  3G0T A;  2EIL H;  3I9V 2;  3DP7 A;  4KYW A;  2WB1 A;  2XRN A;  1JT6 A;  2OBP A;  1PP7 U;  5AON A;  1KYZ A;  1U9N A;  2IA1 A;  2JPB A;  3ZN1 A;  1JKQ C;  4MNU A;  1FBS A;  3V8L A;  2OZ6 A;  2B0L A;  3TO9 A;  1BR2 A;  2D2W A;  3JXB C;  3RYR A;  1D1A A;  3RQ4 A;  4F52 A;  2STW A;  4EJO A;  2F5E A;  3GEZ A;  5FKO A;  1JFT A;  1Y8R B;  1T08 B;  3EYI A;  3AAF A;  2W25 A;  3L1P A;  2FML A;  3ABU A;  5H6Q A;  1QO0 D;  2CRG A;  2D1V A;  2DT6 A;  1GXQ A;  3JRH A;  4E7L A;  2JSC A;  2BY0 A;  5CPR B;  2O49 A;  1YQA A;  3RIR A;  2LNB A;  2ME6 A;  2QSG X;  3GVA A;  4RGR A;  5K7Z A;  5KAF C;  2RQQ A;  3VK0 A;  3IC7 A;  4XOR A;  3C7J A;  1FMV A;  2DT5 A;  1MIJ A;  3RJP A;  4EM0 B;  1RI7 A;  2F6C A;  3S1Q J;  3KEQ A;  4MQV A;  1FLI A;  2CUZ A;  1YIO A;  3F3X A;  4L9T A;  4CCJ A;  1DP3 A;  3I54 A;  1YIT I;  3CF5 F;  1VQ9 I;  1Y1W J;  2HZT A;  3ZKC A;  1H8A C;  3MLF A;  1SAX A;  1GVJ A;  3K4N A;  4X4H A;  2NYX A;  2Z3Y A;  2BVL A;  2GBY A;  4Z2Y A;  3SQN A;  3BR1 A;  2EJR A;  1RNL A;  3WGH A;  4A3K J;  4OWR B;  2GRM A;  3K4M A;  1QB2 A;  4CHU A;  3E7L A;  2WC2 A;  4JQF A;  1A36 A;  2X6Y A;  3I55 I;  3FWE A;  3SCH A;  1ZHF A;  3HHG A;  4D5C A;  3LMM A;  5E3N A;  2L3D A;  1ZR4 A;  4YRV A;  1FNN A;  5E1W A;  4L9J A;  1V5E A;  2HU9 A;  2LYC A;  3N97 A;  2AXL A;  2IS6 A;  2Z9O A;  5EZH A;  4FCY A;  3D5L A;  3LFU A;  3P9C A;  4L9V A;  2WAE A;  3W2A A;  2R7F A;  2PXV A;  1QRY A;  5JR3 A;  4LLL A;  1H0M A;  1FY7 A;  1QZZ A;  3QU3 A;  1WHU A;  2DTR A;  3LA7 A;  3MKL A;  3CC7 I;  2R7S A;  3GTP J;  1I1G A;  3LFK A;  3FMS A;  3KP7 A;  3FXK A;  2ZKZ A;  3AKZ A;  3OKZ A;  2F5V A;  4LGW A;  4X4G A;  1XX5 A;  3T0Y A;  2M7A A;  2BW3 B;  2XGX A;  3FX3 A;  2EZL A;  1DP7 P;  4IL6 C;  3K70 C;  1WJD A;  2A5W A;  2YU9 J;  3SEQ A;  2IRF G;  3S8P A;  1GXP A;  1R22 A;  5FLX K;  2EWN A;  3S14 J;  3KCC A;  2EK5 A;  2H1L A;  3ZQG A;  2XXP A;  2IEK A;  3TMO A;  3OL4 A;  2EWT A;  1ZVV A;  2RN7 A;  4AID A;  1VQK I;  3GTK J;  1NHA A;  1HQC A;  1YG2 A;  3AG2 H;  5DTD A;  1FMW A;  3EUK L;  3TDU C;  3CO7 C;  2QEN A;  1V54 H;  3OYM A;  2TDX A;  2ZBK A;  1E0E A;  4IVZ A;  2R7D A;  2CO5 A;  2O6G E;  4X4C A;  5E3M A;  1JUP A;  2QQ8 A;  1Y8Q B;  3NDB B;  3A9Y A;  4PCQ A;  1OQY A;  2R5Y B;  1IW7 F;  2CW0 F;  3GUD A;  2MAB A;  4I02 A;  4ETS A;  3B02 A;  4RGS A;  1I6H J;  1SAU A;  5LGN A;  4Z59 A;  2H6C A;  4NUB A;  4P9F A;  3JSP A;  5EG0 B;  2VJ5 A;  5L3D A;  1X3Z B;  2P6S A;  2YX4 A;  4JX4 A;  4Y4R A;  4FAS D;  3QWL A;  3FMY A;  4C30 A;  3PO2 J;  3O8G A;  1OLT A;  5HDK A;  3W2W A;  1RES A;  4N4N B;  4YG2 F;  2QKM B;  1AHD P;  2HOA A;  2STT A;  1K6O A;  1W4M A;  1D0Y A;  2FOW A;  5B1A H;  3CMM A;  3S17 J;  5IYC J;  3UKG A;  1ZR2 A;  4B43 A;  3A9Z A;  4CSW A;  2JSP A;  4IHW A;  1W36 D;  3HJE A;  3LOC A;  2FJR A;  2FSW A;  3M8F A;  2IGM A;  3QAH A;  4M74 A;  5HS8 A;  2CS3 A;  4GCV A;  2HOS A;  3DBH B;  4ER3 A;  4HBL A;  4J1X A;  1NEQ A;  5DCF A;  4FX4 A;  3OYA A;  2A07 F;  5F0C A;  1A6I A;  2L7M P;  1CJG A;  3ZQL A;  2L02 A;  2NOG A;  2RKH A;  3BCA A;  4HOB A;  4MQ9 F;  1DUL A;  1QVU A;  2BZT A;  1XGO A;  2XJ3 A;  4G7H F;  2X1C A;  1R49 A;  2HFH A;  2OCC H;  5GPA A;  3HHH A;  3JRD A;  1X4P A;  2HQR A;  1MJA A;  1ZRD A;  2CSO A;  1XGM A;  3IH4 A;  3KFW X;  2WTE A;  4XKW A;  2JTV A;  4EM2 A;  3JRE A;  4GFB A;  3KEY A;  2B7E A;  3ABL H;  4YG4 A;  4EQZ A;  2NNY A;  3CCV I;  3QOE A;  1R9T J;  4XIC A;  3OYC A;  3PNT A;  5IP7 J;  2XRL A;  3ZR8 X;  4DJA A;  5CQG A;  2KIF A;  3HGG A;  1RUN A;  3ABT A;  2GIZ A;  4IA8 A;  4BAY A;  1HKQ A;  2XVC A;  1U5T B;  4BQN A;  3I4P A;  4EJW A;  3R0A A;  2ESN A;  2RNG A;  1MMN A;  2XGE A;  3F6O A;  2J5P A;  2DJI A;  3LL7 A;  2R1J L;  2X4H A;  1WGX A;  2MLK A;  3LA3 A;  3GCM A;  1HA8 A;  4I6R A;  5CJ9 A;  1WFX A;  4JK1 X;  1UB9 A;  1ZYR F;  2VUM J;  1UXD A;  4F7Z A;  3BPV A;  3FKI J;  4RM3 A;  2IGK A;  2IP2 A;  3I0T A;  4RAY A;  4XOP A;  3T1B A;  3WHB A;  1XSD A;  3GN5 B;  3K4C A;  2KFD A;  2Y0M A;  1V3F A;  5IYD J;  4AC0 A;  2ME0 A;  2LRD A;  3KLO A;  2PE5 A;  1G2H A;  4OMZ A;  5EYR A;  5ICF A;  3DBR B;  2GZU A;  3BR6 A;  3TGN A;  2QQA A;  4HEA 2;  1BDI A;  1BOA A;  5C44 J;  3MN2 A;  3O2P E;  3F22 A;  3GZD C;  2PXT A;  1BBY A;  1MZB A;  1TNS A;  2YX7 A;  2XIU A;  1R5G A;  2CQK A;  1I3Q J;  4AVZ A;  3H9J A;  5DYM A;  3J80 K;  2E36 A;  3DEU A;  2NRA C;  2FU4 A;  2O0Y A;  1FSH A;  1BA5 A;  1R5I D;  2VE9 A;  5DCM B;  2O4A A;  1P7J A;  1WJA A;  2KIM A;  1E3H A;  2JVL A;  4CCO A;  3FXM A;  3D5S C;  1E2X A;  1YRN A;  2GQQ A;  4A3F J;  1UXC A;  2NVQ J;  3PNY A;  2WV1 A;  2LOO A;  4OIN F;  4BS9 A;  5KCM A;  3CC4 I;  4QTR A;  3MZH A;  2F48 A;  1RR8 C;  4KMF A;  1GUU A;  2R7T A;  4R79 A;  3NZL A;  3FK7 A;  1LCD A;  2CWE A;  5E8G A;  2ELH A;  1EV7 A;  3HIF A;  3IVP A;  3U3W A;  3MCZ A;  4DZJ A;  4ZYG A;  1FIP A;  4II3 A;  1Z7L A;  1X58 A;  1ZN2 A;  2MFZ A;  2XHK A;  4GGG A;  2DI3 A;  4ESJ A;  3DTI A;  1DGR M;  2BXY A;  2JJ7 A;  2UZK A;  1BOB A;  2LBF A;  1P4W A;  3J7A O;  3GZC A;  1T6S A;  2K3F A;  2HQ5 A;  3C2H A;  1Z3X A;  1IDY A;  1WRJ A;  3VEP A;  3QRF F;  2HVR A;  2FF4 A;  2K86 A;  4R1H A;  1ZRF A;  3RPQ A;  1B9N A;  2L2O A;  2Y2Z A;  2ETH A;  3E1S A;  4OOI A;  1IN6 A;  1W5T A;  3RYP A;  5IYB J;  2Y31 A;  2J7W A;  5ILV A;  4U0V A;  5DD4 A;  5J1Y A;  4BGD A;  3L09 A;  4G7Z F;  1HBX G;  1LFU P;  3WGG A;  4BDZ A;  1Q1V A;  3BJA A;  2M8G X;  4LIU A;  5FKM A;  2M30 A;  3IWF A;  4M3D A;  4FTH A;  1H88 C;  1FJL A;  4XLA A;  3DU6 A;  3LFP A;  3CCL I;  4HZF A;  2LVS A;  3EUH A;  3QYE A;  3TW7 A;  3RDI A;  2DYR H;  1Y0U A;  4Y3O A;  3BR2 A;  3R61 A;  4PZJ A;  2XF7 A;  1ETK A;  3CRO L;  4U88 A;  1XCB A;  4XSZ F;  1TW3 A;  2R7Q A;  2FBK A;  1K61 A;  3HTU A;  3ABM H;  3FXR A;  5EZG A;  1MBH A;  3M07 A;  4A5N A;  2H27 A;  4X4F A;  3GBF A;  2OFY A;  3C2G A;  3ECO A;  3DKW A;  4XLP F;  4DYR A;  4UV8 A;  4ZTJ A;  3DEW A;  5DDG A;  2ZJP F;  2AO9 A;  3E6D A;  3FBN B;  1ZPQ A;  2OZU A;  2Z99 A;  4KA4 A;  3H0D A;  4N9H A;  3M8E A;  2JA5 J;  1AKH A;  2BNN A;  3TRB A;  4F93 B;  1RUO A;  1OR7 A;  2DT7 B;  4KMU X;  4PFP A;  2R7X A;  9ANT A;  1JI8 A;  5FKL A;  2LY2 A;  3TW6 A;  2YUS A;  3M7G A;  5K5R A;  1P6R A;  1JKR C;  1Z21 A;  4AYB A;  1XB4 A;  5J3L A;  3H3Z A;  3ZPL A;  2M0C A;  1PVE A;  1X2M A;  3C2B A;  3K1N A;  1I6X A;  2XF5 A;  4FBI A;  1DU0 A;  1U0J A;  1SVO A;  2OU2 A;  5J4Y A;  4PGH A;  2F5C A;  3W6J B;  4LK0 F;  5J1U A;  1OCZ H;  2QBY A;  2M4H A;  3BJ6 A;  1N78 A;  2HZD A;  1UMQ A;  4RB3 C;  3FXQ A;  1M1E B;  3H5R A;  2NAZ A;  3G1M A;  2M1B A;  2ZME C;  2V1D A;  3HOU J;  2E2I J;  2ZME B;  1N75 A;  3G7D A;  2DK5 A;  4J01 A;  4KT6 A;  3HOW J;  2M34 A;  4AUX A;  2E34 A;  3ERM A;  3NAR A;  4O6J A;  2KKO A;  1K4S A;  1GDT A;  3CCS I;  1BDH A;  3CJR B;  3HRT A;  3OL3 A;  2VT2 A;  2GA1 A;  3LIS A;  2Q8K A;  1XSV A;  3HZI B;  3QYB A;  3VYT B;  3QF3 A;  3KYC B;  4LMY A;  3OQO A;  2R7W A;  3GXO A;  5F27 A;  1Y6I A;  5IPA A;  1R4M B;  2HXO A;  2XB0 X;  3BC8 A;  2XDV A;  5CVU A;  2OJE D;  1YJW I;  1HXD A;  4ENM A;  2EFQ A;  2XAU A;  3CJT B;  1IC8 A;  3ABK H;  5FRO A;  1X4O A;  5FB2 A;  3LSJ A;  3EYY A;  4XK4 A;  3F0C A;  3PQK A;  4M9X A;  3PM1 A;  2H6B A;  3ZRG A;  3IUO A;  4BJ5 C;  5HLH A;  2CUJ A;  1QPM A;  3S16 J;  2O7O A;  2P7V B;  2ZO4 A;  5J47 A;  4LFU A;  3M3Y J;  5D8K B;  4AM3 A;  2NS8 A;  2OD5 A;  3K4K A;  3E6M A;  3BWG A;  3K10 A;  1QA6 A;  2PUB A;  3T8R A;  3KIO A;  1YX3 A;  1EH8 A;  1YW8 A;  4XBF A;  4RBO A;  2UXN A;  2O8X A;  3ZMU A;  1NK3 P;  3CEC A;  1IXR C;  1WH5 A;  4EGY A;  1VQM I;  1EKE A;  1KON A;  4BEH B;  5FKK A;  3I71 A;  2XKP A;  4L18 B;  2L0K A;  3OQM A;  3GO5 A;  1J09 A;  4Z6Y A;  2JA2 A;  3BS3 A;  1YE9 A;  3DPT A;  2PIJ A;  1MND A;  1KYW A;  2KRF A;  2DA3 A;  3MKW B;  4KNY A;  2CW8 A;  3OWT A;  3B6A A;  3JRB A;  1X1A A;  3WTZ A;  1YX5 A;  2CSF A;  1UHW A;  1HDD C;  3FKJ A;  1U3E M;  1DQU A;  3MD2 A;  2VKD A;  3TDZ C;  3DCF A;  4UY8 I;  2XXQ A;  4XRF A;  5TRD A;  1WVR A;  2WAD A;  2V1X A;  2HCS A;  3QFI A;  2DCE A;  3S32 A;  2MC4 A;  4JQD A;  3L2C A;  3L2R A;  3OYG A;  4M72 A;  4YAR A;  1PJR A;  2OTJ I;  2KQR A;  5HVQ C;  4CXF A;  1MBG A;  3K0L A;  3QYF A;  1YHQ I;  3A0B C;  1G3T A;  4EZI A;  2ZXW H;  2PXB A;  1TWG J;  3QOD A;  4AIK A;  4BXF A;  2COM A;  2AQF A;  4BXU A;  1PRA A;  1GV5 A;  3WTT C;  2BW3 A;  1BC7 C;  3RZD J;  3M9A A;  3HRM A;  1BW6 A;  1YW9 A;  3JR9 A;  2PJR A;  2KP6 A;  4UXN A;  2XV4 S;  2E1C A;  1BW5 A;  4I6U A;  5D5W B;  1RC9 A;  5JHF A;  4I76 A;  3SFZ A;  4O3M A;  1ETX A;  1S29 A;  3BY6 A;  1O3Q A;  3PIP F;  2X6O A;  2J5O A;  3HSE A;  3ZQC A;  2KDO A;  4UV9 A;  3ZCO A;  2RAE A;  1ETQ A;  5ED4 A;  3CUQ A;  1H9G A;  3IAM 2;  2ADU A;  2M5W A;  3RPU D;  1JUM A;  3DFG A;  4PK4 A;  4HNT A;  4O5V A;  2XAQ A;  1S8N A;  2WAF A;  1I39 A;  4HDV A;  1BM9 A;  3DXJ F;  1YIJ I;  3T5X A;  1O7F A;  2IVM A;  1WH6 A;  2K7L A;  1KZH A;  2GM4 A;  4WXC A;  3MAJ A;  2MA3 A;  4E4H A;  4IHV A;  1UJ8 A;  4GHJ A;  4HNU A;  3KET A;  4FQG A;  3OWQ A;  3A4C A;  1EH7 A;  2W85 A;  5BPI A;  2KIS A;  1BIA A;  3B7H A;  1MDM B;  3Q5F A;  1FOX A;  1SD5 A;  5C4J J;  3CJN A;  3QPT A;  4KJZ A;  4ZTF A;  5GAG J;  2PMZ A;  2VBY A;  3GTO J;  3TBI A;  1C0W A;  2B9S A;  4U0W A;  3X2Q H;  3EET A;  4CZZ A;  1Z05 A;  3J81 K;  5EDN A;  2BNM A;  3R09 A;  1OYI A;  5M3M J;  4IVN A;  1GHC A;  5J8C A;  4QPQ A;  4RS8 A;  3PIO F;  4G94 A;  1D1C A;  1W5C C;  1NG6 A;  1LUJ B;  2ZSI B;  1Q1H A;  4CCM A;  3DKY A;  1IG7 A;  1MKM A;  4DYQ A;  2IA2 A;  1T98 A;  3G3Z A;  1POU A;  5FD6 A;  3QOP A;  1OKR A;  2VQL A;  3BPX A;  3A01 B;  3L2Q A;  2COB A;  3FDY A;  4N0B A;  3G6E I;  4IPA A;  2G9W A;  1U2W A;  5KK1 A;  1ZGW A;  5DRT A;  3BQY A;  3I5U A;  3BD1 A;  3H5A A;  3OMT A;  2MH2 A;  4I2O A;  2PI0 A;  2Z2S B;  2XKO A;  2VT3 A;  3ZQ7 A;  2QVO A;  5FLM J;  1VQ5 I;  3AFH A;  1Z77 A;  3ZHI A;  1MFQ C;  3FF5 A;  3OV8 A;  5F04 A;  3DV8 A;  3CCM I;  2DMT A;  1YSE A;  2LMD A;  5B3S H;  5CKT A;  4K2E A;  2GLO A;  1ZUG A;  1DU6 A;  3R60 A;  2HYJ A;  3LSR A;  2DA1 A;  4CZC A;  1U5T A;  5F1R A;  3BG9 A;  1IN7 A;  2KEI A;  4XN3 A;  5ICC A;  5JI6 A;  3Q3S A;  4F55 A;  1B6A A;  3KZ3 A;  3FXU A;  2OF7 A;  2E7W A;  3H5T A;  4KDP A;  4E7Z A;  2ODR D;  3HPH A;  2X0L A;  5ILU A;  3QPL A;  3V7R A;  4B3A A;  2CGP A;  5F0F A;  4E7J A;  3H9Q A;  2QSH X;  1B59 A;  1S7E A;  4HV5 A;  4A3I J;  2IVB A;  4BXX J;  3GN5 A;  3JAM K;  1MH4 A;  2M45 A;  5D8L B;  2VBW A;  1SD7 A;  3OYF A;  2PBI A;  4ER7 A;  3NRV A;  3JCU C;  4RLQ A;  4XLN F;  5DTR A;  3ZQF A;  2ISZ A;  4YG1 A;  1HC8 A;  4ASN A;  4BQA A;  1OFC X;  1XD7 A;  1SD4 A;  1TW2 A;  3GZD A;  5JUW A;  3F72 A;  3OOU A;  3QYX A;  2KRC A;  4KIG A;  1UST A;  1X1P A;  4KIS A;  2R63 A;  3IP4 B;  4C2T A;  3RPU A;  2GXG A;  4OU0 A;  1VZ0 A;  5HLI A;  4A3G J;  1KU2 A;  3FXJ A;  4A3L J;  2N8G A;  2P81 A;  2RC4 A;  4UVC A;  5A7L A;  2DA6 A;  4HAM A;  1BI2 A;  1REP C;  1IJW C;  2KLO A;  3PFY A;  5M5Y J;  3AG4 H;  1UG2 A;  4RGU A;  3GZ5 A;  2Y0S N;  1MNM C;  4HG2 A;  1EJ9 A;  4JBA A;  3ASN H;  3MMY B;  1LEA A;  2FX0 A;  3CUO A;  1ZH5 A;  1XS9 A;  1MSF C;  2K4B A;  4P5O A;  4HX8 A;  1IN5 A;  1HKS A;  2JA7 J;  1D3Y A;  2DO7 A;  1LDJ A;  2WY7 Q;  4FIS A;  1TQI A;  2RGV A;  2K4J A;  3OYD A;  1OJL A;  1XMX A;  1MBK A;  2FD5 A;  2TRT A;  5FLX Z;  3P5J A;  4ENK A;  1OSL A;  4G7O F;  2XSD C;  1FP2 A;  1ORK A;  1ZTR A;  4UB8 C;  2W57 A;  2ID6 A;  1I5Z A;  2UV1 A;  2VE8 A;  1LFB A;  2KL4 A;  3MQ0 A;  4LG3 A;  4UNO A;  3TEP A;  3TL4 X;  3WTY C;  4IWR A;  1YJ9 I;  3C18 A;  3SHF A;  1HST A;  5DM7 F;  4CDG A;  3N4M A;  2XPW A;  2EPF A;  4PU4 C;  2LNM A;  4EV0 A;  1LVK A;  2I8D A;  2KZG A;  4S04 A;  3D5R C;  3J7Z I;  1VQ8 I;  2L4M A;  3BR3 A;  3PO3 J;  3JRC A;  1U9O A;  2VBZ A;  2RDP A;  1J2X A;  4XKV A;  1HW1 A;  2QYO A;  1KU9 A;  2V9P A;  2XUB A;  3S3O A;  3LST A;  1B8I B;  1IGN A;  4PU3 C;  2EZH A;  2R7R A;  3LNQ A;  2B5A A;  1JJ8 C;  4EJU A;  1MGT A;  5E1X A;  2YU3 A;  1LEB A;  2CQX A;  1T39 A;  2B63 J;  3SCG A;  1TL8 A;  1MNE A;  4EGZ A;  1P9Q C;  3WTU C;  1YYV A;  1F5T A;  1W0T A;  2V7F A;  1FYL A;  3BZK A;  1FYK A;  1D5Y A;  3JRI A;  3CMA I;  1T2K A;  1PRV A;  4U7D A;  2FJ1 A;  1TP4 A;  1U6G A;  3HB9 A;  3K4J A;  3I53 A;  1ZK8 A;  2BGC A;  2A05 A;  5K7F A;  4IHT A;  2PXU A;  1A04 A;  1OYY A;  2YSR A;  2BY3 A;  3HUG B;  1JHH A;  4F3Q A;  2DA2 A;  1JXS A;  4PU7 A;  1L1M A;  2P5K A;  4ITV A;  1OPC A;  1QZX A;  1ZRE A;  4Z5C A;  3DQV C;  2P4W A;  1T8I A;  1FBU A;  2CQ7 A;  3OIQ A;  1APL C;  2LCV A;  5DEQ A;  1PUE E;  2XXA A;  1DPU A;  2HXI A;  5D5V B;  1D0X A;  4C2U A;  3KL4 A;  2FOK A;  2MD5 A;  2PX9 A;  4JX6 A;  3SZG A;  1MBJ A;  1GT0 C;  4ZYD A;  3L2U A;  3AG3 H;  3LQR A;  2PJP A;  3CDI A;  4B8X A;  3VSL A;  2P6T A;  4BE2 A;  3SXY A;  3PFI A;  4A3J J;  2DFI A;  3I64 A;  1WWX A;  4WCG A;  3B73 A;  2F5F A;  2ZC2 A;  2DPD A;  2MD0 A;  2L4A A;  4RB2 C;  2QSF X;  3QPS A;  4QSH A;  3IH3 A;  1Z7U A;  1XTA A;  3HM5 A;  3V4G A;  2A5Y B;  1FOW A;  2CH0 A;  1LJ9 A;  1OIS A;  3RZZ A;  2F4I A;  1HLV A;  1DWK A;  1VQP I;  2DAO A;  2YPR A;  1LVA A;  5DRY A;  4RA2 A;  1USS A;  1PUF B;  3KP6 A;  1O57 A;  3HXL A;  3A9X A;  1NG7 A;  1J75 A;  5KNL A;  5F0H A;  3OSG A;  3L2V A;  2JCG A;  5HOO A;  1XDU A;  1ZG1 A;  1OCP A;  3TO7 A;  2LG4 A;  4ER0 A;  1UG0 A;  3KZI C;  2HKX A;  2XRO A;  1NTC A;  1LE8 B;  4YEL A;  3JSO A;  4ENJ A;  5FLV A;  3HOT A;  4NQW A;  1LCC A;  3WGI A;  3DTE A;  4OMY A;  4MFE A;  2JQE A;  4RAZ A;  5HDG A;  4E7I A;  2KPJ A;  4HDU A;  2W48 A;  4P1W A;  1LPQ A;  1PDN C;  2AW6 A;  3HBL A;  4F92 B;  2EV0 A;  3FM5 A;  3BZC A;  4D9J A;  1J9I A;  2LYR A;  2VXD A;  3NXH A;  4BE1 A;  5LD2 C;  3VYU B;  2ZXJ A;  1J7K A;  2VC0 A;  4RMN A;  4UUV A;  5GTI C;  2PG4 A;  2OTL I;  4UHT A;  1LLI A;  2JWT A;  2NS7 A;  2R3S A;  4BEH A;  1P7I A;  4A3C J;  2OR1 L;  4LK1 F;  5E18 F;  4YFN F;  1S6L A;  2HS5 A;  3HOZ J;  4DOZ A;  2JVH A;  1SMT A;  2W84 A;  3ROU A;  2HPI A;  4BJ6 C;  1K6Y A;  3CLO A;  1F43 A;  3LQX A;  3LAJ A;  3HZJ A;  3L9F A;  1I1S A;  1GLN A;  2DQR A;  1XSX A;  2OC6 A;  4A5M A;  3FZV A;  1R69 A;  5JVG F;  4UVA A;  5FRN A;  3IL2 A;  2X9D A;  3I3L A;  1JE8 A;  3OY9 A;  3KP3 A;  3EQL F;  4CGZ A;  2VPR A;  1YS6 A;  4ZDO A;  4ER6 A;  1CF7 B;  3BG7 A;  3FIS A;  1JH9 A;  2X51 A;  4A0X A;  2HSG A;  3K4L A;  4CA0 A;  3O6B B;  5GAG i;  3TP0 A;  4KIT B;  3MKZ A;  2MG4 A;  1OCR H;  4R8H A;  4CYC B;  3U9G A;  4DE8 A;  3VYR B;  2M87 A;  4B48 A;  2AHQ A;  2E7X A;  2XIG A;  5FGM A;  1RZ4 A;  3ZGK A;  1HOM A;  2AWI A;  2BJC A;  5H2F C;  4HW0 A;  1AWC A;  2HTS A;  1WJE A;  1ZAR A;  3I58 A;  3BTJ A;  3ZMD A;  1FT9 A;  1EH6 A;  1FC3 A;  3DPL C;  5E1Z B;  3FMR A;  2JUG A;  2QQ9 A;  3NWT A;  3G1O A;  4JYK A;  1VQL I;  4YBA A;  2EZK A;  3GYH X;  3TP3 A;  3QQ6 A;  2VKE A;  1SFO J;  2QUF A;  1VTN C;  2HNH A;  2MBF A;  2DMU A;  4NC6 A;  1E3P A;  4KIF A;  4L5J A;  1X1D A;  4AD9 A;  3GX4 X;  4FHT A;  2LF7 A;  2PN6 A;  1FEX A;  3CF2 A;  2HQN A;  1BL0 A;  1X1B A;  3VB2 A;  3JTG A;  1X57 A;  4U87 A;  3MFK A;  4M73 A;  4I98 B;  3E0J B;  4D0P A;  4E7K A;  1J5Y A;  1LNW A;  3H3V K;  5L3G A;  2XF6 A;  2NVY J;  3F6W A;  3CP2 A;  5LFA A;  3ZQH A;  4UVB A;  3WE2 A;  3CLC A;  1B1B A;  1YLF A;  2WUS R;  3JTH A;  1NK2 P;  2L9S A;  2L01 A;  3G4S I;  2JZY A;  3SDG A;  2JT1 A;  2HGC A;  3J7Y J;  2WWY A;  2W24 A;  2FBI A;  5BS6 A;  2WA0 A;  2EFN A;  2K02 A;  4HF2 A;  4MFD A;  1Z3Y A;  2PUA A;  4ZC3 A;  2R7O A;  3U2R A;  2EF8 A;  4MEX F;  2EIN H;  1ODD A;  3DWL E;  3GTQ J;  4M3G A;  3GZN B;  1P2F A;  4BDY A;  3RCO A;  1IF1 A;  1VQO I;  1KGS A;  4KN7 X;  5E8I A;  2LC2 A;  3H92 A;  3MWM A;  3N05 A;  4IHY A;  3C3W A;  4WVL A;  4Q2J A;  4RAF A;  1UZC A;  2JPC A;  3E5Q A;  5B66 C;  2Z33 A;  3WG9 A;  2Y9Y A;  5H20 A;  2PXL A;  1G3W A;  1S7O A;  2CW7 A;  2L9N A;  2PMH A;  5LLQ A;  3F9K A;  3MKY B;  2NXN B;  4HA8 A;  1X2N A;  2EQR A;  2JMW A;  4X4D A;  2PXF A;  4IO9 F;  4BBS J;  3ZP5 A;  1PNR A;  3U21 A;  1RKT A;  5F1J A;  4E70 A;  4KT5 C;  4C3H J;  2R7Z J;  2IUO A;  3F52 A;  4I6T A;  1GV2 A;  5E79 C;  5BPD A;  1QU3 A;  3UR3 C;  1S5L C;  2YBD A;  3SX0 A;  2Y9Z A;  4BHB A;  2DOE A;  1MJ9 A;  2P0W A;  2L5Q A;  1O4X A;  4L0Z B;  3F51 A;  3P9K A;  4XLH A;  1TWC J;  4DBQ A;  2EB7 A;  1JKP C;  2W82 A;  1EF4 A;  2CQQ A;  1SQ8 A;  3K70 D;  3COA C;  4Q4Z F;  1TWA J;  4B3X A;  1Z9C A;  2OUM A;  2IV1 A;  2KEJ A;  3OR1 C;  1ZG5 A;  2VLA A;  1R23 A;  1VF9 A;  3SZP A;  1WJC A;  1IRF A;  3CCU I;  1FTZ A;  1QHH D;  4MEY F;  4A6D A;  1X3W B;  2KIU A;  2O8K A;  1B9M A;  2HWV A;  3KP4 A;  4JX5 A;  3A2K A;  2NVU B;  5J6X A;  3J7A Y;  5HS7 A;  2VAS A;  2E5Z A;  3I4N J;  2GOX B;  3HYI A;  4Z5D A;  2L54 A;  2CUF A;  3EUA A;  3OYI A;  4FT8 A;  3I59 B;  2GZW A;  2BHZ A;  3RTR A;  1VFC A;  5FFX A;  3CCJ I;  2IT0 A;  1SFX A;  1MJB A;  4HST A;  2HYG D;  2VKH A;  2VOP A;  4A3B J;  2BEO A;  1QP0 A;  2BHY A;  2BXZ A;  2P7C B;  3JRF A;  2E1N A;  2Z16 A;  2K5C A;  4ZZL A;  3HRU A;  2MQK A;  5LRR A;  1F9N A;  4D1Q A;  1Z6T A;  3CD6 I;  4N4O B;  1OMI A;  5LGU A;  3S15 J;  3K9T A;  1YS7 A;  4I99 C;  3AG1 H;  1S9H A;  3WG7 H;  2FA5 A;  4EAT A;  5KAI C;  2CFX A;  4B4C A;  1YTY A;  3OIP A;  3C1D A;  3ELK A;  5GP9 A;  4M3E A;  2VI6 A;  1O3S A;  4IEJ A;  3DTK A;  3RSN A;  1TT5 B;  5GPC A;  3F21 A;  4Y52 J;  2EIJ H;  4XID A;  1QQI A;  2G0E A;  2F5D A;  1WIZ A;  5BMZ A;  3LSK A;  1ZAY A;  4C9Y A;  1X1C A;  5BOX A;  1G8X A;  4EJV A;  4RM2 A;  3A1Y A;  3JW4 A;  5DUK A;  4WX9 A;  1XG1 A;  3WU0 A;  2ZB9 A;  3DLL F;  3SR4 A;  1T33 A;  3MZY A;  2LH9 A;  5A2Q Z;  5DTQ A;  1IN8 A;  3DEE A;  1I3A A;  4ZJZ A;  2L7F P;  4M3B A;  4BH9 A;  3DU5 A;  2DTZ A;  2LR8 A;  2QWW A;  1QZE A;  2ZXH A;  3GME A;  2DU9 A;  2IA0 A;  2ACJ A;  3Q9S A;  2YS9 A;  2G7H A;  3A0H C;  2FUG 2;  2HR3 A;  3QOX A;  1MBF A;  3WTV C;  5M3F J;  3HOV J;  1LQC A;  1FBQ A;  1PRU A;  2KHM A;  1B8I A;  5C4X J;  2XB5 A;  4NHJ A;  3K4B A;  5CVV A;  4WWC A;  3WTS C;  4DE9 A;  1IZ1 A;  4IX7 A;  4P96 A;  3S2W A;  4L9N A;  4DQ2 A;  1R5H A;  3FM3 A;  5D6F A;  4HF1 A;  3DLA A;  2ID3 A;  4J00 A;  3BG6 A;  1QNT A;  3GF2 A;  2JA8 J;  3ZPX A;  3PSF A;  4XM3 A;  2MH9 A;  3WTW C;  3UWP A;  4XL9 A;  2EBY A;  2V79 A;  2FBH A;  5K5O A;  5D4S A;  1WSU A;  2OQG A;  1QGP A;  2VOO A;  4EK9 A;  4A0Y A;  1N25 A;  3BTC A;  3MEJ A;  1Z91 A;  2Y75 A;  2K9L A;  5F08 A;  3GFI A;  2L7Z A;  2LKP A;  5HNF A;  1AOY A;  1RZR D;  2QKL B;  3GTM J;  3ZN0 A;  3DBL B;  1BIB A;  5L3F A;  3E3V A;  3REO A;  2IS4 A;  3T8T A;  5ILS A;  1HSJ A;  3BG3 A;  2PUF A;  3CQZ J;  1B72 B;  2DOA A;  2DDA A;  2ECC A;  2X6X A;  2L1P A;  1W1W E;  4EVI A;  1FP1 D;  4I6Z A;  1U8B A;  1Y7Y A;  2BYV E;  1LDK B;  3NAU A;  3ZMZ A;  2EV6 A;  2L7K A;  5LEJ A;  4XQF A;  2Y69 H;  1G59 A;  1X3U A;  4S0H B;  2R5Y A;  1FOY A;  2Q0O A;  4IKF A;  3HPG A;  5HNH A;  3BQZ A;  1X19 A;  3LSP A;  2D1H A;  3F8N A;  2AXZ A;  2LYJ A;  2OV7 A;  2VXZ A;  2X85 A;  5EG0 A;  2MC3 A;  4DZP A;  1D8K A;  2FQ3 A;  2BVM A;  3CCY A;  4I0A A;  4XON A;  1DW9 A;  3ASO H;  2QA4 I;  3TED A;  3KP2 A;  1A5J A;  1IV8 A;  1ZZB A;  4WF2 A;  2A6T A;  5EEH A;  2ICT A;  1UHS A;  4BY1 J;  4WK8 F;  1WCM J;  4MHG A;  1PUF A;  2E2J J;  1Y1V J;  2LBF B;  2DN0 A;  2XC7 A;  1W36 C;  4IOA F;  4YFK F;  4EKG A;  3OYJ A;  2BE5 F;  2OA4 A;  3RKQ A;  1EFA A;  4KN4 X;  5GAH J;  5IT9 Z;  3BDN A;  3K2Z A;  2EA4 A;  2V6C A;  1MH3 A;  4A3E J;  1LE8 A;  2DXI A;  1FSE A;  2LP0 A;  1RIO H;  2GAU A;  3M4O J;  2E71 A;  4L5I A;  3V8J A;  1H89 C;  1BJZ A;  2LTP A;  1QBJ A;  4MGR A;  2YR2 A;  2AXU A;  2R0Q C;  1JKO C;  4ZDL A;  1TWH J;  3OYH A;  2ZJQ F;  2UXX A;  3KE2 A;  5JLX A;  2HFZ A;  3RKW A;  4LB5 A;  1UCR A;  3ERE D;  4XN0 A;  3KYD B;  3FHN A;  2LYS A;  1MW7 A;  3EUH C;  4IQ4 A;  2F4M B;  1T95 A;  3HRS A;  1OCO H;  1U2Z A;  2ZFU A;  2Q2E B;  1FIA A;  3LQQ A;  4EM1 A;  3NWS A;  3H36 A;  3LSI A;  1ZZ6 A;  4M6V A;  5L3E A;  3P7N A;  2M4K A;  4Z58 A;  4LG0 B;  1W0U A;  1NW3 A;  1MMS A;  1MSE C;  4G6T B;  4I7H A;  2ZSH B;  3HKZ N;  5JVT A;  4IOC F;  1YW7 A;  4IXA A;  3L7W A;  1R71 A;  5TIS C;  4PSW A;  2V1N A;  3QOW A;  1VQN I;  4ESB A;  3B6C A;  4HQE A;  3HSR A;  3ESW B;  3QWG A;  3ZOB A;  4X1E A;  4X4I A;  1IRX A;  1FWZ A;  4MCX A;  1B4A A;  3NRO A;  3CP8 A;  1OR7 C;  3QU6 A;  1JGS A;  2D5V A;  1R1U A;  3TKY A;  2PUD A;  2FRH A;  5IP6 A;  4QLC U;  4A12 A;  1Z1D A;  3AL0 C;  3RQI A;  2PXQ A;  3CTA A;  3HOX J;  1JGG A;  4A0Z A;  3AL0 B;  4IHS A;  1IN4 A;  3S3M A;  3OYE A;  3OMY A;  2M2E A;  2XGD A;  1P4A A;  5B1B H;  1FYM A;  4MIM A;  4QIW N;  4CYC A;  2EV5 A;  4V19 K;  5EJC A;  2M0M A;  3IKT A;  1RZR A;  4RB1 A;  5CVJ A;  4A3M J;  3CDH A;  4D7M A;  1NH3 A;  3U1D A;  2BY2 A;  2HQA A;  2WAQ N;  2MLG A;  2Y48 A;  3KPH A;  3BRO A;  4Q47 A;  3ZMS A;  5DCM A;  1FOK A;  1RIO A;  2E1M C;  4BUP A;  1D8J A;  4XRS G;  3FYM A;  5HS9 A;  2E1M B;  3SEZ A;  3PJR A;  4BHP A;  3Q0V A;  2Y0S A;  1PER L;  1XMK A;  3A03 A;  4ZDP A;  3CC2 I;  2WB1 N;  4DW6 A;  4NC8 A;  1K4T A;  5L3B A;  2GXA A;  1QPI A;  3FXL A;  2NOJ B;  3VPR A;  4B09 A;  4G8X A;  2K27 A;  4OIQ F;  1ZLK A;  3GFM A;  1DDN A;  1WPK A;  2BOL A;  3ISP A;  3EPZ A;  3G71 I;  2EIM H;  4BAC A;  1QQA A;  2VKV A;  2W7N A;  5HLG A;  4HYE A;  3OS1 A;  1QQB A;  1OYW A;  2M8E A;  2ZJ2 A;  1A31 A;  4C3J J;  1N77 A;  3WU1 B;  2KDZ A;  3TOB A;  2WIU B;  3QP5 A;  3VWB A;  3F8M A;  1CQT A;  4F8D A;  1D0Z A;  2EFW A;  3OIO A;  3ONQ A;  4BHC A;  5J40 A;  3E6C C;  2MXD A;  2PUC A;  1VND A;  3LA2 A;  6PAX A;  1U78 A;  1V5F A;  5DM6 F;  4NDL A;  3H1C A;  4CIC A;  1IO2 A;  2RV8 A;  3V42 A;  1ADR A;  4MO7 A;  3GTG J;  1QVT A;  2FE3 A;  4PJN A;  3FIW A;  1YFH A;  1SFK A;  1R7J A;  2HKO A;  3NQO A;  4UB6 C;  2IXS A;  4OAY A;  1ZEL A;  3SYT A;  1Y39 A;  4XOT A;  1TQP A;  2CFO A;  2MSY A;  5K1Y A;  5K98 B;  1KQ0 A;  3NEU A;  1KQ8 A;  1L3L A;  3LWF A;  2V9K A;  2DFF A;  4KIB A;  1XGN A;  1SMY F;  4YIF A;  2NVX J;  2M7B A;  1SEU A;  4BQQ A;  3FMQ A;  2VON A;  4PSX A;  2X48 A;  2VJJ A;  4QWQ A;  5FO5 A;  5H6R A;  3OS0 A;  3OP9 A;  2H1K A;  5GAD J;  4DNC A;  5IOZ A;  5EEA A;  5ICE A;  1W7P B;  2KEK A;  1P92 A;  3IRQ A;  4LD5 A;  4NB5 A;  4V2G A;  3HDD A;  3RI4 A;  5EGO B;  2DMN A;  2OAZ A;  3HSF A;  4B47 A;  2E2H J;  5LHI A;  4TV7 A;  3EUS A;  1IV6 A;  2R7V A;  1K78 B;  4J1W A;  2V26 A;  2KMU A;  3FYA A;  1SD6 A;  4GYI A;  1HCR A;  2VJI A;  3ZXS A;  4BNC A;  2EBI A;  5CQE A;  1BJA A;  2E5N A;  1ZQ3 P;  2KIQ A;  1ITY A;  2CMP A;  1MMA A;  2DFH A;  3GTJ J;  2VIX A;  2W1O A;  3DM5 A;  4M9Z A;  1HKT A;  2A3S A;  2DBB A;  2LKS A;  4FET A;  3KJX A;  1G6N A;  3LSH A;  4RAG A;  2RNJ A;  2IJL A;  3BCB A;  1ACI A;  3PUB A;  1IUF A;  2PJR B;  4U7B A;  3L00 A;  2DPU A;  2DFE A;  3Q0W A;  3TOA A;  5KHD A;  2LD5 A;  1LDD A;  1I50 J;  1R58 A;  2HOT A;  2XGC A;  3EDP A;  2ZME A;  1TZL A;  4GO1 A;  1QP4 A;  3OYB A;  1ZRC A;  3CUQ C;  1KA8 A;  2LF8 A;  2JVG A;  4BY7 J;  4C3I J;  5LEK A;  3CUQ B;  4HRI A;  2LK2 A;  5AIP A;  3OYN A;  4UUS B;  2CUE A;  1AA7 A;  2HOE A;  3A02 A;  4ENN A;  1F1Z A;  4JOM A;  4IHX A;  2HDW A;  1OCT C;  2PUE A;  3I59 A;  1JJ6 C;  4LIT A;  4QPO A;  3S1R J;  2DA5 A;  2JUC A;  1TWF J;  2FNP A;  1FPQ A;  1POG A;  3BP8 A;  1ONV A;  3F8B A;  1MMG A;  2VQG A;  4LLG F;  2IU7 A;  2VQC A;  4B44 A;  3IKV A;  2AQE A;  2P8T A;  4RDU A;  1TLH B;  3CCE I;  3BR5 A;  3R6S A;  1QHG A;  2NNN A;  3V7C A;  1IRZ A;  2W4S A;  4AU7 A;  1LQ1 A;  1T56 A;  4UUT A;  2ESH A;  3KZZ A;  4XR6 A;  2PPX A;  5DS9 A;  2CQN A;  2ISY A;  2IAI A;  4Z5H A;  2BNO A;  2QF7 A;  1CGP A;  1ENH A;  3PSI A;  1T0F C;  2A6C A;  1GVD A;  3F8F A;  3H9G A;  2UUZ A;  3OOP A;  1XWR A;  3OQN A;  1K83 J;  1HQ1 A;  3J80 Z;  5CLS A;  1RET A;  2Y30 A;  5TGT A;  1ZLJ A;  3O3K A;  2IGN A;  2Q1Z B;  2VC1 A;  3LAP A;  3KXA A;  4A93 J;  1K79 A;  2JRM A;  5D6E A;  4BYY A;  5BNG A;  2K85 A;  4ZH4 F;  2LYP A;  2ZCW A;  4DIQ A;  4PUS A;  4IJA A;  5CVI A;  2XAJ A;  2A69 F;  5FFZ A;  1O3R A;  5F64 A;  4KUM A;  5GTH C;  1ZAO A;  4HV6 A;  1S3J A;  4YIR X;  2V1U A;  3IHU A;  2CG4 A;  4GDF A;  5CYV A;  3VWS A;  3MVP A;  4XLF A;  4A69 C;  4L5E A;  2J7U A;  1ETO A;  4XLE A;  2P5L C;  2K9Q A;  3KEO A;  3ECH A;  2IW5 A;  1KQ9 A;  2O9L A;  1A35 A;  2W00 A;  3DNV B;  2H8R A;  4WXD A;  3W3C A;  2QQB A;  3JXC L;  2DQL A;  4BKX A;  5F6F A;  1BI0 A;  2K9N A;  4FE7 A;  3W6K B;  1JUS A;  2CYY A;  1U5T C;  4LIV A;  2HDC A;  1L0O C;  5IY5 H;  4CH7 A;  2PEX A;  3E6B A;  4BU2 A;  1J59 A;  1MBE A;  1Z6R A;  3MZ8 A;  5EEG A;  4X6A J;  4E6K G;  1Z67 A;  1ZZ7 A;  4HX7 A;  3TEL A;  5DV5 A;  2HCN A;  3HG9 A;  2Z5U A;  3TQN A;  4A2U A;  4JP0 A;  2AXV A;  3LSG A;  2JN6 A;  2EA2 A;  4M6Y A;  1ZKG A;  5TJJ A;  5JHU A;  2VBX A;  2V4J C;  3RZO J;  1WI3 A;  3PNV A;  2M3A A;  2PXP A;  4I01 A;  5GAH i;  1XCV A;  1Y0N A;  3GTL J;  3HOS A;  1RRJ A;  2R5Z B;  1FZP B;  3BR0 A;  1SAN A;  3CCQ I;  2H8W A;  4PJL A;  2ICW G;  3BLY A;  3WTX C;  1T38 A;  1HDP A;  3IWZ A;  5CVR A;  4C2M J;  4E7S A;  1ERD A;  3G2B A;  4YEJ A;  5DUI A;  4PGG A;  1YJN I;  1SFU A;  1LMB 3;  3KX2 A;  1JFS A;  2LDU A;  4MLO A;  3DKX A;  1LB2 A;  1DPR A;  2IVQ A;  1U8R A;  3D0S A;  3S1M J;  4YII A;  3WHC A;  1E3O C;  3S2H J;  1IAW A;  2F2E A;  2LLK A;  2VB6 A;  4X0G A;  4PJ0 C;  1B72 A;  4XRM A;  2CV0 A;  2EH3 A;  4Y42 A;  1YOV B;  4XLC A;  4RGX A;  2D45 A;  1DGW Y;  1UHM A;  4EMS A;  3ZMT A;  3HL2 A;  3JRG A;  2ZNY A;  4PFO A;  3S2D J;  2UWM A;  3KLN A;  4DBR A;  2HTJ A;  1ETY A;  2ZNZ A;  5GAE J;  4CCL A;  2O5R A;  5IOY A;  1A6Q A;  3HC7 A;  1TQM A;  4HPQ A;  3SCF A;  1JWL A;  4YG7 B;  3VOE A;  2IS1 A;  2DA7 A;  2VJ4 A;  4Y15 A;  4LLN A;  1BR1 A;  4IRH A;  5L3C A;  1BI1 A;  2KPM A;  4OAZ A;  2PMU A;  5J8F A;  3BZ6 A;  2AS5 F;  4RB0 A;  1TTY A;  1MDM A;  4Y13 A;  3CJQ B;  4E7H A;  1ZG3 A;  3HOY J;  4Y33 A;  3OR2 C;  2R93 J;  5D4R A;  4ZZD A;  1BC8 C;  2IPQ X;  3CME I;  4XNF A;  1LFP A;  2FMY A;  2CRO A;  4MTE A;  1HW5 A;  3GFL A;  4L0Y B;  2FNA A;  3F23 A;  2HYF A;  3O8H A;  3F8C A;  5E17 F;  2EIK H;  4IF4 A;  2EFP A;  2I10 A;  3W2V A;  4D7N A;  3CZ6 A;  4X4B A;  1TBX A;  5LGT A;  1S72 I;  2DDB A;  2LYL A;  3PXP A;  4A6E A;  2QZ8 A;  4ABZ A;  2G7U A;  2CJJ A;  2KJB A;  2X1E A;  3BTL A;  3DF8 A;  3HEF A;  1WJ5 A;  1ZS4 A;  3GWZ A;  4EKI A;  4P55 A;  2JQ7 A;  4ON0 A;  3R0J A;  3A01 A;  4PDK A;  4BL0 B;  5DT2 A;  3M8J A;  2QEX I;  4NC7 A;  1V4R A;  2DW4 A;  3FBI B;  1KU3 A;  1WQ2 A;  2RVC A;  2RQP A;  2IS2 A;  4GYG A;  2VQH A;  4IRI A;  1G4D A;  1BR4 A;  2ZFW A;  1WZ2 A;  2LKX A;  2R7U A;  4KIC A;  2AXT C;  1OCC H;  1XN7 A;  2LY9 A;  4O8B A;  2Q2E A;  3S1N J;  2HPM A;  4DGW B;  1ZZ9 A;  2OPT A;  2FQ4 A;  2DK8 A;  3SJM A;  3OYK A;  3D1N I;  3V8K A;  4LG0 A;  2QM3 A;  5ERI A;  1IXS B;  4CCK A;  4OBM A;  5D5X B;  4D5F A;  1W7P D;  4I0B A;  1JT0 A;  2PXD A;  2K40 A;  3BTI A;  1Z0X A;  1RPE L;  1O7L A;  2E1O A;  4J19 A;  1Y56 A;  2MYS A;  3FK6 A;  2XSJ C;  1ULY A;  2NVT J;  3OYL A;  1IRG A;  3BT9 A;  4WXH A;  1IDZ A;  1SC7 A;  1VQ4 I;  3Q9V A;  4OIP F;  1V5G A;  4CYD A;  5IP9 J;  3I4M J;  3IAS 2;  3FHZ A;  3PQJ A;  2QGU A;  4CO8 A;  2QCO A;  1XPX A;  1PP8 F;  5LHH A;  4AWX B;  3IH2 A;  4AYB N;  2O61 A;  5E3L A;  1R4N B;  2A61 A;  1YI2 I;  1ZGJ A;  2R4G A;  2DOF A;  4BQO A;  4W97 A;  3S8Q A;  5IT3 A;  2AUW A;  2BY1 A;  4ESF A;  4FN3 A;  5DTM A;  2EZI A;  2HVQ A;  1WJB A;  2ELK A;  2BV6 A;  3H0G J;  5DD8 A;  2LSO A;  2HDD A;  1NER A;  4U0Y A;  2BBY A;  1VQ7 I;  2X6W A;  2GOM A;  5DSX A;  2ECB A;  2A68 F;  2H94 A;  3CDL A;  2HEO A;  3CO6 C;  1AU7 A;  3ZHM A;  3JRA A;  1XMA A;  2IBD A;  3GZ6 A;  1D1B A;  5LHG A;  5HLT A;  1DUX C;  1STZ A;  3ZQI A;  1ON2 A;  2KRH A;  3MEX A;  3VYS B;  3ZQQ A;  5FRM A;  4EJT A;  3E97 A;  4M71 A;  4B1R A;  3O9X A;  4Y7N J;  1TT0 A;  2XAH A;  1SFE A;  2JRT A;  1QZY A;  2LY1 A;  4PJJ A;  2Z1D A;  2LYK A;  1V55 H;  3G1L A;  2V9V A;  3DPU A;  3R4K A;  4YFX F;  4NQW B;  4HLY A;  1JTY A;  3M9L A;  1ZZC A;  2DMP A;  4HF0 A;  2V3C C;  4HX4 A;  2PFB A;  3QPH A;  4XRS A;  5K7H A;  4G6D A;  2WY8 Q;  3VSK A;  2OQR A;  4HNV A;  2O03 A; 
#chains in the Genus database with same CATH homology
 3ZOB A;  1FIP A;  4X1E A;  4X4I A;  1X58 A;  4I8T A;  4JX6 A;  2L9R A;  1MBJ A;  5E3O A;  1GT0 C;  4MCX A;  2K9S A;  2JJ7 A;  3IV5 A;  5HOD A;  4V2F A;  2D5V A;  3JXD L;  2HQ5 A;  1IDY A;  5IP6 A;  5FJ8 J;  2PUD A;  4A3J J;  3RQI A;  3HOX J;  5M5W J;  1JGG A;  2Y2Z A;  1RPW A;  5IYB J;  2M2E A;  2XGD A;  3QPS A;  4QSH A;  3IH3 A;  2Y31 A;  3HM5 A;  1WH8 A;  2XPU A;  4MIM A;  4DYC A;  4QIW N;  5J1Y A;  4CYC A;  2L8N A;  3RZZ A;  5EF6 A;  1LFU P;  1HLV A;  1DWK A;  1UTX A;  1Q1V A;  4NDW A;  1RZR A;  2M8G X;  4PU8 A;  4A3M J;  1PUF B;  2R92 J;  4D7M A;  5FKM A;  2WAQ N;  4M3D A;  4FTH A;  5F0H A;  1H88 C;  1FJL A;  2MEZ A;  3OSG A;  2M9H A;  1B0N A;  2JCG A;  5JLW A;  5EGO A;  1RIO A;  4XRS G;  1OCP A;  3FYM A;  3LFP A;  2LVS A;  3TW7 A;  5FLV A;  1NTC A;  3BR2 A;  1LE8 B;  3Q0V A;  1ETK A;  1PER L;  3CRO L;  3A03 A;  2KT0 A;  1LCC A;  2WB1 N;  4DW6 A;  1K61 A;  4MFE A;  1QPI A;  2KPJ A;  2E19 A;  3VPR A;  5EZG A;  1WET A;  2W48 A;  1MBH A;  4OB4 A;  4X4F A;  1WPK A;  2O38 A;  3GBF A;  2AW6 A;  3HBL A;  2OFY A;  2JA6 J;  1QQA A;  2LYR A;  2VKV A;  4DYR A;  3DEW A;  2AO9 A;  1FTT A;  1ZPQ A;  1QQB A;  2JA5 J;  2BNN A;  4BBR J;  2LFB A;  4C3J J;  1AKH A;  1YRN B;  3TRB A;  2JWT A;  1LLI A;  2NS7 A;  2PUG A;  1VI0 A;  2KDZ A;  2XCJ A;  4EEF G;  2WIU B;  1P7I A;  3GBG A;  4A3C J;  2OR1 L;  9ANT A;  5FKL A;  3TW6 A;  2YUS A;  1F36 A;  1CQT A;  1JKR C;  4F8D A;  3K2A A;  2IVG A;  3HOZ J;  2MW8 A;  2XI8 A;  3OIO A;  2PUC A;  5J3L A;  1ETV A;  1VND A;  1U78 A;  2M0C A;  4JCX A;  1X2M A;  3C2B A;  4NDL A;  4UUS A;  4FBI A;  1DU0 A;  1F43 A;  4GQM A;  4MCT A;  2JK3 A;  4M3F A;  1ADR A;  3SFI A;  1XC5 A;  4MO7 A;  2HI3 A;  2XPV A;  3GTG J;  2LYQ A;  3G5G A;  1QVT A;  5J1U A;  1R69 A;  1UMQ A;  3FIW A;  1Y9Q A;  4W1U A;  1VPW A;  2X9D A;  3G1M A;  1ZZ8 A;  3HOU J;  2E2I J;  1ETW A;  2VPR A;  5C3E J;  3G7D A;  3OSF A;  2DMQ A;  2ICP A;  2MSY A;  3HOW J;  2M34 A;  3FIS A;  1JH9 A;  5K98 B;  4AUX A;  3NAR A;  1GDT A;  2HSG A;  4FE4 A;  1BDH A;  3TP0 A;  3LIS A;  3HZI B;  2MG4 A;  2NVX J;  3QF3 A;  4CYC B;  2L49 A;  3HGY A;  3OQO A;  2X48 A;  2DJN A;  5F27 A;  1RKW A;  2AHQ A;  5IPA A;  3OP9 A;  2H1K A;  2HXO A;  5EEA A;  5IOZ A;  2PMZ N;  2XB0 X;  1JTX A;  1HOM A;  2AWI A;  2KEK A;  2BJC A;  4V2G A;  3HDD A;  5EGO B;  1IC8 A;  3W6V A;  3UFD A;  3BTJ A;  3BG5 A;  1WH7 A;  2DMN A;  4JYK A;  3G1O A;  3LSJ A;  5J1R A;  1RR7 A;  2EZK A;  4YBA A;  4XK4 A;  3F0C A;  3TP3 A;  2E2H J;  2VKE A;  1SFO J;  3PM1 A;  2KZ8 A;  3EUS A;  3QQ6 A;  1HF0 A;  1IV6 A;  2DA4 A;  4J1W A;  3S16 J;  2O7O A;  2DMU A;  3FYA A;  1HCR A;  3M3Y J;  2EBI A;  2NS8 A;  5M5X J;  1ZQ3 P;  1FEX A;  1ITY A;  2MGQ A;  2PUB A;  3GTJ J;  1BL0 A;  1X2L A;  4RBO A;  1X57 A;  3KJX A;  3CEC A;  1NK3 P;  1WH5 A;  3K7A J;  1IUF A;  2GRL A;  4G12 A;  1AKH B;  3H3V K;  4JCY A;  5FKK A;  2NVY J;  3F6W A;  3Q0W A;  3ZQH A;  2LD5 A;  3CLC A;  2L0K A;  1I50 J;  3OQM A;  2HOT A;  1QPZ A;  2XGC A;  4LOC A;  1QP4 A;  1QP7 A;  2TCT A;  2WUS R;  3BS3 A;  4BY7 J;  4C3I J;  4X4E A;  2PIJ A;  1NK2 P;  3R1F A;  2LK2 A;  3QQA A;  2DA3 A;  3SDG A;  4UUS B;  2CUE A;  4A3D J;  1R63 A;  3A02 A;  3B6A A;  3JRB A;  4IHX A;  5FKN A;  2CSF A;  3Q0U A;  1OCT C;  1HDD C;  2PUE A;  1JJ6 C;  4MFD A;  3S1R J;  2HIN A;  2PUA A;  2DA5 A;  2EF8 A;  1TWF J;  3DCF A;  1POG A;  2IU7 A;  1TC3 C;  3CMY A;  3GTQ J;  4M3G A;  1RZS A;  2R5Z A;  4RDU A;  2CU7 A;  4JQD A;  4YAR A;  4IHY A;  3BR5 A;  1MBG A;  1IRZ A;  1JT6 A;  1U9N A;  2Y9Y A;  1JKQ C;  1T56 A;  4UUT A;  2PPX A;  5DS9 A;  2IAI A;  1CJG A;  4Z5H A;  1X2N A;  2EQR A;  1TWG J;  1ENH A;  2JMW A;  2QF7 A;  2BNO A;  2A6C A;  4X4D A;  1GVD A;  3JXB C;  4BBS J;  1XWR A;  1PNR A;  3OQN A;  1K83 J;  1PRA A;  5FKO A;  1RKT A;  1GV5 A;  5F1J A;  1JFT A;  3RZD J;  1RET A;  2Y30 A;  3KXA A;  1BW6 A;  4C3H J;  3L1P A;  3JR9 A;  4A93 J;  2R7Z J;  1BW5 A;  2IUO A;  3F52 A;  4I6U A;  5BNG A;  2CRG A;  2LYP A;  4I6T A;  1GV2 A;  4I76 A;  1ETX A;  3JRH A;  2O49 A;  2X6O A;  3ZQC A;  2Y9Z A;  2RAE A;  2ME6 A;  1ETQ A;  1O4X A;  3F51 A;  5K7Z A;  3VK0 A;  1TWC J;  3MVP A;  1JKP C;  1JUM A;  1EF4 A;  4A69 C;  4L5E A;  3S1Q J;  2CQQ A;  1SQ8 A;  1ETO A;  1TWA J;  2K9Q A;  2IV1 A;  2KEJ A;  2O9L A;  1WH6 A;  2GM4 A;  1VF9 A;  1Y1W J;  3DNV B;  2H8R A;  1H8A C;  3ZKC A;  3MLF A;  4IHV A;  3JXC L;  1FTZ A;  4BKX A;  4GHJ A;  2K9N A;  4X4H A;  4FE7 A;  2O8K A;  1JUS A;  2GBY A;  4X6A J;  1ZZ7 A;  1MBE A;  3BR1 A;  4JX5 A;  3B7H A;  4A3K J;  2GRM A;  5C4J J;  3I4N J;  3E7L A;  4Z5D A;  4JP0 A;  3GTO J;  2AXV A;  3LSG A;  2CUF A;  2JN6 A;  3SCH A;  1ZKG A;  5EDN A;  2BNM A;  4D5C A;  5E3N A;  1ZR4 A;  1VFC A;  5M3M J;  3RZO J;  1WI3 A;  3GTL J;  4A3B J;  1QP0 A;  2R5Z B;  3JRF A;  3BR0 A;  1SAN A;  5EZH A;  4FCY A;  1IG7 A;  2MQK A;  1HDP A;  4DYQ A;  4C2M J;  1QRY A;  1POU A;  1LMB 3;  1JFS A;  3S15 J;  4MLO A;  3MKL A;  2COB A;  3A01 B;  2IVQ A;  3S1M J;  3GTP J;  3WHC A;  1E3O C;  3S2H J;  4X4G A;  1ZGW A;  2LLK A;  1B72 A;  4B4C A;  3BQY A;  4XRM A;  2EH3 A;  3BD1 A;  3OMT A;  4Y42 A;  5GP9 A;  4M3E A;  2VI6 A;  2EZL A;  4IEJ A;  2YU9 J;  5FLM J;  3JRG A;  1Z77 A;  3S2D J;  3ZHI A;  5GPC A;  1ETY A;  5IOY A;  4Y52 J;  5F04 A;  3S14 J;  4XID A;  2G0E A;  3SCF A;  2DMT A;  3ZQG A;  1WIZ A;  1YSE A;  4YG7 B;  1JWL A;  2DA7 A;  2IEK A;  2GLO A;  1ZUG A;  2EWT A;  1DU6 A;  1ZAY A;  1ZVV A;  2HYJ A;  3LSR A;  2DA1 A;  3GTK J;  3BG9 A;  5DTD A;  2KEI A;  1XG1 A;  3HOY J;  2ZB9 A;  3Q3S A;  2R93 J;  4IVZ A;  1T33 A;  3H5T A;  2OF7 A;  3KZ3 A;  4X4C A;  5E3M A;  1JUP A;  3QPL A;  2CRO A;  2L7F P;  4M3B A;  4B3A A;  2R5Y B;  5F0F A;  2DTZ A;  3O8H A;  2LR8 A;  1I6H J;  4Z59 A;  2I10 A;  4D7N A;  3QWG A;  4X4B A;  1S7E A;  2YS9 A;  4A3I J;  5EG0 B;  2IVB A;  4JX4 A;  1MBF A;  2LYL A;  4BXX J;  5M3F J;  3HOV J;  4ABZ A;  1LQC A;  3FMY A;  3GN5 A;  3PXP A;  1PRU A;  2CJJ A;  3PO2 J;  3O8G A;  1B8I A;  1MH4 A;  5C4X J;  2XB5 A;  3BTL A;  1RES A;  3HEF A;  1AHD P;  2HOA A;  1ZS4 A;  3ZQF A;  4YG1 A;  3A01 A;  3S17 J;  5IYC J;  3UKG A;  1OFC X;  1ZR2 A;  3QYX A;  2ID3 A;  3OOU A;  4IHW A;  2JA8 J;  3LOC A;  2FJR A;  2R63 A;  2LKX A;  4A3G J;  2HOS A;  2EBY A;  4A3L J;  2N8G A;  2P81 A;  5A7L A;  2LY9 A;  4O8B A;  3S1N J;  4J1X A;  1NEQ A;  1ZZ9 A;  2DA6 A;  5F0C A;  2OPT A;  3BTC A;  1A6I A;  2L7M P;  2FQ4 A;  5F08 A;  3SJM A;  5M5Y J;  2L7Z A;  3D1N I;  1UG2 A;  3ZQL A;  1IJW C;  1RZR D;  2NOG A;  3GTM J;  2Y0S N;  1MNM C;  1QVU A;  2XJ3 A;  4D5F A;  1JT0 A;  2K40 A;  2FX0 A;  3BG3 A;  5GPA A;  3BTI A;  2PUF A;  1Z0X A;  3CQZ J;  3JRD A;  1B72 B;  2ECC A;  1XS9 A;  1RPE L;  3IH4 A;  2E1O A;  3JRE A;  4J19 A;  1MSF C;  4YG4 A;  4GFB A;  3FK6 A;  4I6Z A;  1U8B A;  1Y7Y A;  2JA7 J;  2NVT J;  3NAU A;  4FIS A;  4S0H B;  2R5Y A;  3BT9 A;  1R9T J;  4XIC A;  1IDZ A;  1OJL A;  1MBK A;  2FD5 A;  2TRT A;  5IP7 J;  3BQZ A;  1OSL A;  2XRL A;  5IP9 J;  3LSP A;  2XSD C;  3HGG A;  2AXZ A;  1ORK A;  1ZTR A;  3I4M J;  2LYJ A;  2ID6 A;  5EG0 A;  1LFB A;  4DZP A;  4IA8 A;  4IWR A;  3CCY A;  2QCO A;  1DW9 A;  3TED A;  2XGE A;  1A5J A;  3IH2 A;  4AYB N;  1ZZB A;  2R1J L;  1WGX A;  2ICT A;  5E3L A;  1UHS A;  4BY1 J;  2XPW A;  4I6R A;  4PU4 C;  1WCM J;  1PUF A;  2E2J J;  4W97 A;  1Y1V J;  3S8Q A;  2VUM J;  2DN0 A;  2AUW A;  1UXD A;  4FN3 A;  2EZI A;  3BR3 A;  3PO3 J;  3JRC A;  3FKI J;  1U9O A;  3RKQ A;  2ELK A;  3H0G J;  1EFA A;  3WHB A;  3BDN A;  3GN5 B;  2HDD A;  1NER A;  5IYD J;  4AC0 A;  2ME0 A;  1MH3 A;  4A3E J;  1LE8 A;  1B8I B;  1IGN A;  4PU3 C;  1G2H A;  2PE5 A;  2LP0 A;  2EZH A;  5EYR A;  2ECB A;  3LNQ A;  2GZU A;  3BR6 A;  2B5A A;  3M4O J;  3CDL A;  1H89 C;  1JJ8 C;  1BJZ A;  1AU7 A;  1BDI A;  2LTP A;  5C44 J;  3ZHM A;  3MN2 A;  3JRA A;  2IBD A;  2CQX A;  2AXU A;  2XIU A;  2R0Q C;  1JKO C;  2B63 J;  3SCG A;  1I3Q J;  1TWH J;  3ZQI A;  5JLX A;  1W0T A;  1BA5 A;  3O9X A;  4B1R A;  4Y7N J;  2O4A A;  1P7J A;  2LYS A;  2JVL A;  1D5Y A;  1FIA A;  3JRI A;  2LYK A;  1YRN A;  1PRV A;  1ZZ6 A;  4A3F J;  3G1L A;  4M6V A;  1UXC A;  2NVQ J;  2FJ1 A;  2WV1 A;  3HB9 A;  1ZK8 A;  1JTY A;  5K7F A;  4Z58 A;  1ZZC A;  4QTR A;  1W0U A;  2DMP A;  2DA2 A;  1GUU A;  1MSE C;  4PU7 A;  1L1M A;  3HKZ N;  3FK7 A;  4XRS A;  4Z5C A;  5K7H A;  1LCD A;  1APL C;  2LCV A;  3U3W A;  3IVP A;  3B6C A;  4HNV A;  2HXI A;  4DZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...