2XSDC

Crystal structure of the dimeric oct-6 (pou3f1) pou domain bound to palindromic more dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
128
Chain Sequence
b'APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*AP)-3'
publication title Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 43
structure length 128
sequence length 151
ec nomenclature
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xsdC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2xsdC01
2ME0A 1IJWC 3ZHIA 1ETOA 3OIOA 2WB1N 3RZDJ 5E3LA 5GPCA 3M4OJ 5DTDA 1JKRC 2X9DA 3IVPA 2BNMA 3ZQCA 3VPRA 2PUAA 2L7ZA 5FKLA 1DWKA 1QP7A 2PPXA 2KT0A 3GTMJ 3MVPA 5IP9J 1RPWA 1BW5A 3JXBC 1FIAA 5M3FJ 3LSGA 4JP0A 2TCTA 3HBLA 1TC3C 1OSLA 1I50J 1ZAYA 1QVTA 2Y9YA 1ETVA 1WIZA 3NAUA 4PU4C 3S8QA 5K7HA 5C4JJ 2DA5A 2LY9A 4V2FA 1LE8A 1PERL 2EF8A 2WAQN 3S2DJ 2IEKA 1DU6A 2HDDA 2DN0A 3GN5B 5F27A 2DTZA 3CMYA 1ENHA 3OOUA 2R5ZB 1SANA 5BNGA 1IRZA 2BNOA 5A7LA 1NTCA 2LP0A 1PRAA 3OP9A 1VNDA 3RZZA 1HCRA 1AKHA 4GQMA 3Q0WA 2QCOA 4FE7A 1JT0A 1SQ8A 5FLMJ 3E7LA 3HM5A 2YU9J 3UFDA 2ECBA 2PIJA 1IDZA 2NS8A 3RQIA 3GTPJ 4X6AJ 2IBDA 3LSRA 1IG7A 2XGDA 5FKMA 2XPUA 2M8GX 4NDLA 5EG0A 5F04A 3HOXJ 3QQAA 4A3CJ 2X48A 3LFPA 1MBFA 5EGOA 3D1NI 1JWLA 4BBSJ 4FN3A 3HDDA 1W0TA 3GTGJ 1QPZA 2MSYA 4YG1A 1JGGA 2K9QA 3LNQA 2GM4A 4C3JJ 4M3EA 4D5FA 4S0HB 4JQDA 3ZQFA 3NARA 5M5YJ 5M5XJ 3FISA 2JA8J 2G0EA 1PNRA 1FEXA 2B5AA 2CQXA 1XG1A 1JFSA 2M2EA 2R0QC 3VK0A 4A3EJ 4YG4A 2CROA 4M3GA 2R5YB 2MQKA 5HODA 5K98B 4X4CA 3BTLA 5EEAA 4MFDA 2PUEA 1IC8A 4JX6A 2EZIA 2XRLA 2XI8A 2ZB9A 2NVXJ 3F0CA 5GP9A 3F52A 2VUMJ 1RZRA 4FCYA 1XWRA 1BDIA 5M5WJ 3CLCA 4UUTA 2AWIA 1OFCX 1LMB3 1JH9A 1WH5A 1GVDA 3A03A 5GPAA 2XPWA 1BL0A 4ABZA 3UKGA 3M3YJ 3HGGA 2LYSA 5K7ZA 3FYMA 4XRSG 2LTPA 1Q1VA 5EZGA 3G1OA 3S1MJ 1LFBA 5IOZA 2EWTA 1MSFC 1ETWA 1IGNA 3BR5A 1EF4A 2LYKA 4Z5HA 2VPRA 3DNVB 2ID6A 1LCDA 4A3MJ 1BDHA 1X2LA 2LYRA 2JN6A 4MFEA 4DYQA 1JTXA 1B8IB 2HSGA 3CROL 1LCCA 1HF0A 4X4HA 3JRAA 3S1QJ 1JJ8C 5E3NA 2GBYA 3ZQLA 1IDYA 2R93J 3BD1A 4O8BA 3GTJJ 2NVTJ 3W6VA 1TWCJ 3Q0VA 2WV1A 4IHYA 2CUFA 3FIWA 1HLVA 1QRYA 2XJ3A 1WH7A 3QPLA 4X4GA 2XPVA 4UUSB 2O38A 1APLC 2CUEA 2VI6A 2CJJA 1JFTA 3S17J 3G1MA 3CDLA 3BG5A 4I8TA 3LOCA 2LD5A 4AC0A 4IHWA 3SCHA 2IUOA 3I4MJ 3PM1A 3JXCL 3FK7A 3ZQHA 4DZPA 2JK3A 3TP0A 1POGA 3MKLA 3QQ6A 3KJXA 2GZUA 4I6TA 2M9HA 4BY7J 4M3FA 4B3AA 1MBEA 2DMPA 2DMUA 2OPTA 3PO2J 5FKOA 1MH3A 1QQAA 1MBHA 2E19A 4LOCA 1PRVA 2EBYA 2CU7A 3ZOBA 4D7NA 1ETXA 1UMQA 2HYJA 4IWRA 1U78A 2HXOA 4MLOA 1DU0A 2FJRA 1AHDP 4AUXA 4X1EA 2DA1A 2LLKA 3GN5A 3G1LA 2L49A 4D7MA 1W0UA 2CSFA 3JRBA 1U8BA 2LR8A 3JRDA 1FJLA 3ZQGA 2L9RA 2XSDC 1I3QJ 3JRFA 2R92J 2LKXA 1X2NA 1IV6A 3QYXA 2IVGA 4I76A 1L1MA 1LLIA 4GHJA 4I6RA 4A3KJ 1NERA 3HB9A 4JX5A 1A5JA 1MBJA 3Q0UA 4QSHA 5FJ8J 4IA8A 4YBAA 2MG4A 2P81A 3SFIA 5E3MA 9ANTA 3F51A 1ETYA 3DEWA 3GBGA 4A3JJ 3S16J 1JKPC 1ZZBA 3FKIJ 2BNNA 4NDWA 5J1UA 3HOVJ 2PUGA 2HOAA 2K9SA 2ICTA 2NS7A 1F43A 2JA5J 1RETA 5J1YA 1H88C 1YRNB 4BKXA 4G12A 1JUMA 3JXDL 3OSGA 4IHXA 1E3OC 1AU7A 2LCVA 3HOUJ 1VF9A 2GRMA 2WIUB 2DA4A 4DZJA 4QTRA 2MW8A 3TEDA 4Z58A 1Y1VJ 2X6OA 5F0FA 1QQBA 1X57A 4A3IJ 1R69A 1QP0A 1RPEL 2D5VA 2JA7J 3H5TA 3HZIB 2PE5A 3BS3A 3BTIA 1H89C 2R5YA 3FYAA 4MCXA 2DA3A 2XB0X 2JMWA 2FD5A 1B72B 3JRCA 3BR2A 2FJ1A 3QPSA 3JRIA 4X4BA 3BTCA 2EZLA 3CQZJ 1TWHJ 5EYRA 1QVUA 1A6IA 5J1RA 1JKOC 4DW6A 2PUCA 5F0HA 4IHVA 5JLWA 1ZPQA 4RDUA 2COBA 2AUWA 3B6AA 2MGQA 2OFYA 1TWGJ 4D5CA 1ZGWA 1R9TJ 2OR1L 2N8GA 2O9LA 2YUSA 1PUFB 2KEIA 2XGCA 3BR0A 1HDDC 2AXVA 1B8IA 5J3LA 1ZK8A 3A01B 1ZZ6A 4PU8A 4M3DA 4A93J 2IVBA 4RBOA 1RZSA 2PUBA 1JT6A 4DYRA 4C3HJ 2QF7A 3G5GA 1WGXA 3OMTA 3ZKCA 4HNVA 3FMYA 3JRHA 1JTYA 1YSEA 3LISA 4J1XA 2JCGA 1NK3P 2E2HJ 4A3GJ 5IPAA 4CYCA 2LYQA 4BBRJ 2KPJA 1RIOA 2TRTA 1CJGA 3L1PA 2DA7A 1VFCA 4BY1J 1ZQ3P 4XIDA 3HOYJ 1OCPA 2O4AA 3O8GA 1MH4A 1RKWA 2KDZA 3S15J 2EH3A 1ZS4A 1EFAA 3B6CA 3BG3A 1HDPA 5IP7J 3BTJA 3JRGA 5EZHA 4IEJA 2DMTA 1GT0C 3JR9A 3BDNA 4YG7B 1ADRA 3I4NJ 1LQCA 1DW9A 2KEKA 1U9OA 4JX4A 1WI3A 2L8NA 1VPWA 3SJMA 1JUPA 3IH4A 1BW6A 2L0KA 2HI3A 3BR1A 3LSJA 4W1UA 3HKZN 3HOWJ 2A6CA 2ICPA 2O7OA 1BJZA 2LYLA 5DS9A 1VI0A 2NOGA 2XIUA 1F36A 2XGEA 2PUFA 2B63J 4M3BA 1R63A 4A3LJ 3MLFA 4J1WA 3JREA 2KZ8A 1ZZ9A 1GUUA 1TWAJ 4JCXA 3BG9A 4PU3C 3IH2A 3KXAA 1SFOJ 2R5ZA 5F0CA 3R1FA 3BT9A 1RKTA 1QPIA 4Y52J 2LVSA 1YRNA 4J19A 4YARA 2ME6A 2VKVA 3O9XA 1ZVVA 2M0CA 5IOYA 4X4FA 1FTZA 3PO3J 3OQNA 2DJNA 1IUFA 2EZHA 3MN2A 2Y0SN 2NVQJ 3EUSA 1WH8A 4W97A 3H0GJ 2K40A 2Y2ZA 4FE4A 1UXDA 1JKQC 2IU7A 2XCJA 4MIMA 1T56A 1ORKA 3H3VK 3GTQJ 4I6UA 1FIPA 5FKNA 3S14J 4Z59A 2IAIA 1QP4A 2NVYJ 4F8DA 2DMQA 1P7IA 4BXXJ 2MEZA 2E1OA 3WHBA 2Y30A 1WETA 2R63A 5K7FA 1B72A 3S1RJ 1OCTC 4A3DJ 3IH3A 1TWFJ 1ETQA 2KEJA 2DA2A 1D5YA 1Y9QA 2EQRA 2IV1A 2ELKA 4MCTA 1NK2P 2HQ5A 4AYBN 3CCYA 1RESA 3S2HJ 2HXIA 2PMZN 2LYPA 5FLVA 3SCGA 3QF3A 4XK4A 2E2IJ 1POUA 2AHQA 2M34A 2AXUA 4M6VA 1FTTA 1CQTA 1PUFA 5IYDJ 2CQQA 1ZR4A 1MNMC 4X4DA 1LE8B 2XB5A 1MBKA 1WCMJ 3HOZJ 3S1NJ 3GTOJ 3A01A 3K7AJ 3LSPA 2K9NA 4JYKA 1Z77A 3K2AA 1WPKA 2YS9A 3G7DA 2HOSA 2O8KA 2DMNA 2H1KA 4FBIA 2BJCA 1Y7YA 1ZTRA 1JJ6C 1AKHB 4EEFG 2L7MP 1MBGA 3C2BA 5JLXA 1PRUA 2DA6A 4XRMA 3BQYA 3DCFA 4I6ZA 1RZRD 3RZOJ 1S7EA 1OJLA 5IYCJ 1GDTA 2I10A 2LYJA 4X4EA 2L7FP 1ZZCA 3PXPA 3FK6A 3ZQIA 2RAEA 2GLOA 2LFBA 2JWTA 4GFBA 4OB4A 5EG0B 5M3MJ 3ZHMA 5IYBJ 3WHCA 3TRBA 1ZR2A 5EGOB 1ITYA 1BA5A 1UG2A 4UUSA 1XS9A 1B0NA 4MO7A 1ZZ8A 2PUDA 2JVLA 2VKEA 4JCYA 3TW6A 1O4XA 1MSEC 1HOMA 4IVZA 4Y7NJ 2H8RA 3TW7A 4QIWN 2FX0A 1X58A 1ETKA 2EZKA 2LK2A 2R1JL 1XC5A 2E2JJ 4A3BJ 1WH6A 5C44J 3BQZA 1ZUGA 3BR3A 5C4XJ 5IP6A 3BR6A 2O49A 4A69C 1K83J 2Y9ZA 5F1JA 1K61A 4DYCA 1LFUP 4C3IJ 2GRLA 3CECA 1ZZ7A 4Y42A 1I6HJ 2IVQA 2CRGA 3B7HA 1UHSA 3GTKJ 1UXCA 4X4IA 2JJ7A 3OQMA 3O8HA 2Y31A 1Y1WJ 2AW6A 4PU7A 4B1RA 3SCFA 2EBIA 5EDNA 3GTLJ 1U9NA 3U3WA 4L5EA 3GBFA 5EF6A 3QWGA 2ECCA 1RR7A 2W48A 3SDGA 1GV2A 5FKKA 4XICA 1JUSA 3HEFA 1T33A 2ID3A 1ZKGA 1NEQA 3KZ3A 2JA6J 3IV5A 2HOTA 2R7ZJ 2AXZA 4FTHA 4CYCB 3RKQA 2FQ4A 1G2HA 2WUSR 1GV5A 1X2MA 4A3FJ 3TP3A 4C2MJ 1P7JA 2HINA 4Z5DA 4Z5CA 3OSFA 5F08A 3A02A 3OQOA 2OF7A 1UTXA 1Z0XA 2AO9A 3Q3SA 3HGYA 5E3OA 1H8AC 4B4CA 5C3EJ 4V2GA 4XRSA 3F6WA 4FISA
chains in the Genus database with same CATH superfamily
1JHFA 1XCBA 4MEYF 1IN6A 1G3SA 5FB2A 2WB1N 4G94A 1D8KA 4F55A 3UR3C 5LEKA 3ZQCA 1ONVA 2PUAA 2L7ZA 5DYMA 2K5CA 2CSOA 4V19K 3MCZA 1BW5A 1RPWA 2WAEA 2PG4A 1SC7A 2R7UA 3I56I 4IXAA 3SX0A 2HDWA 4H4KC 1V4RA 3LSGA 2M8EA 4RLFA 2KIFA 4KT6A 2TCTA 1TC3C 1I50J 2FSWA 1ETVA 1WIZA 3IRRA 2R7TA 4PU4C 3HRTA 1QZZA 2LY9A 3H9QA 2EF8A 2XROA 3F8FA 2DAOA 2HDDA 2DN0A 3CCLI 1R4MB 3DU5A 2DTZA 3GUDA 4E7SA 3D5SC 3GX4X 3TFLA 4R1HA 1WVRA 4Q48A 1IV8A 1ZARA 1QO0D 5LGTA 4ZTFA 3VYSB 3OP9A 1X1AA 1LUJB 3H0DA 1HCRA 3OKZA 3ME5A 2IP2A 5FLMJ 3HM5A 3G73A 2XV4S 4CUGA 2O0YA 2NS8A 4GYGA 4P5OA 2VT2A 2VJ4A 2IBDA 3IRQA 3D5LA 2F5DA 2XPUA 1MNEA 2VLAA 2Q2EB 3QQAA 1MBFA 3FXLA 4B43A 1YI2I 2PJPA 2JQEA 1U2WA 4M9XA 4FN3A 1D1AA 2Q1ZB 1QPZA 2GM4A 4XLHA 3P5JA 3AG3H 4S0HB 3O2PE 4FHTA 1UHMA 3NARA 1W7PA 1GVJA 3U9GA 4YRVA 5M5XJ 2CV2A 2HZTA 3WTZA 2M2EA 2VE8A 1LJ9A 2VKDA 2EILH 5D8LB 2CROA 2PXQA 4FX0A 4M3GA 1U5TA 4QPQA 3JAMZ 5HODA 3BTLA 4KIBA 1FBSA 1YHQI 4JX6A 3S2WA 2EZIA 1LDKB 4CXFA 2ZMEB 1CF7A 2XI8A 4L5JA 4J00A 3GUUA 2DJIA 4OAYA 3ZMUA 2O6GE 3F52A 4FCYA 1BDIA 3DBHB 2DDAA 2V9KA 1KYZA 2M7BA 3H9JA 1WH5A 5FFXA 4ZJZA 5GPAA 3A03A 1YJ9I 2LYSA 2LY1A 2J5PA 3HGGA 3KP7A 2XAHA 3FYMA 5EZGA 1MMAA 2ZJRF 3GZ6A 1EF4A 2LYKA 3ZMDA 2VPRA 1O7LA 2E1NA 2FBHA 2GIZA 2HQAA 4E7ZA 4UV9A 2HSGA 3CROL 4IO9F 3DKWA 3IWFA 3ZQLA 1JJ8C 4WF2A 4GYIA 4EJOA 1LVAA 1TLHB 5HOOA 4X4GA 3FBIB 2BE5F 4DGWB 2O38A 2CUEA 2P8TA 4ZTJA 1PP8F 5H20A 4AIKA 3BG5A 3K4JA 1LNWA 2NNYA 1G3TA 1SVOA 4AC0A 3N97A 5H6RA 5LGUA 3PM1A 2VASA 3JXCL 3ZQHA 2WADA 3VDXA 1FSHA 3OYAA 2STWA 4WWCA 2XF5A 3HHGA 3K2ZA 3KJXA 3QQ6A 2OV7A 2ZXJA 1S6LA 1MBEA 2HGCA 2LDUA 2OPTA 3E6BA 4P9FA 4IKFA 1QQAA 1V5EA 4E7KA 2B7EA 3L00A 3ZOBA 1B9NA 1ETXA 3BPXA 1U6GA 2MC3A 2HYJA 2FBIA 2H8WA 1UFMA 4BUPA 4AUXA 3FXMA 4YFKF 1Z21A 5E1ZB 5ERIA 3V8LA 2RNGA 4LK0F 2L5QA 2COMA 3JRBA 2OC6A 2CG4A 2L9RA 1I3QJ 3QYEA 2AS5F 4IJAA 1IV6A 3QYXA 5DTQA 2L2OA 1R23A 3LQQA 3ZQQA 3VEPA 5E8GA 3VYRB 3OYMA 1OQYA 4GHJA 2PN6A 2UWMA 4FT8A 4IF4A 4A6DA 4QSHA 1SD4A 3FXUA 4UB8C 1IXRC 2VBXA 4YBAA 4J01A 5CVIA 3SZTA 9ANTA 2RVCA 5DM7F 1P4WA 3NEUA 3F51A 1EKEA 3GBGA 3GVAA 1ZZBA 5F1RA 4NDWA 2PUGA 3ZN0A 3K4MA 1UZCA 3E5QA 5E18F 4KN7X 1E3PA 1H88C 3JXDL 3ZCOA 2WBMA 3OMYA 2E1CA 4LB5A 4Q47A 2KZGA 1Y1VJ 4EQQA 4RAZA 2X6OA 5F0FA 1E0EA 2WC2A 1MNDA 2F6CA 5E1XA 4N0BA 2D5VA 3TO9A 2JA7J 2PE5A 2QSFX 4EV0A 5FRMA 2R5YA 3OYBA 1TT5B 4ETSA 3M8FA 1J9IA 3ISPA 4MCXA 1QZYA 5JHUA 4XORA 1VQ6I 2QEXI 2LYCA 4N4OB 1UG0A 2Y48A 1D0YA 2NS0A 3JRIA 3QPSA 2FXAA 3A0HC 4HV6A 2EZLA 3CQZJ 3EUAA 2HWVA 4EQZA 5J1RA 4EM0B 4OIQF 4DW6A 2FBKA 2QBYB 4G6TB 5DTRA 4ESJA 3K1PA 5JLWA 3VWBA 2COBA 4IHVA 3B6AA 2OFYA 1TWGJ 5IT9Z 2JTVA 5E1WA 1GHCA 3K0LA 3KIOA 5L3DA 3IL2A 2DTRA 4BXUA 1PUFB 2GXGA 2OTJI 3EPZA 2O3FA 4MHGA 2XGCA 2BVLA 3K6GA 4IQJA 1QU3A 3C7JA 3OIPA 1B8IA 2K7LA 3RSNA 1ZZ6A 4FX4A 2PQ8A 2FA5A 2ZJPF 5HS9A 2DDBA 4A93J 1YQAA 2QWWA 5GAGi 4NC7A 4BQNA 2X6XA 3PJRA 2CO5A 2NXNB 3E6MA 4OBMA 3HRUA 3ZQ7A 3QPTA 1F4KA 1OYIA 3CZ6A 5D8KB 1JTYA 3JRHA 2IT0A 1U8RA 2R7FA 2XGXA 2F5VA 3GLLA 1O3RA 2E2HJ 5ED4A 3QU6A 4GXOA 1S7OA 2KPJA 1RIOA 4NB5A 4HAMA 2E34A 4LITA 4RA2A 1TL8A 4U7DA 5ILSA 4C2TA 1MH4A 4YIRX 2KDZA 4BDZA 3S15J 2IJLA 4RLQA 1EFAA 1FOWA 5JUWA 3CCVI 5CPRB 3REOA 2QQAA 3F9KA 4EJTA 5EZHA 1BOAA 3K4CA 4B09A 4NHJA 2L3DA 1SAXA 1A04A 5CKTA 3JR9A 1GT0C 2QSHX 3BDNA 4YG7B 2HQNA 2MH9A 3DTEA 3EETA 4A5NA 4BJTA 1WZ2A 3CJQB 1WI3A 1VPWA 5D4SA 2EA2A 3V7CA 2QGUA 1ZH5A 3SZGA 2YBDA 1XDUA 1BR2A 3U3WA 3O3KA 3HKZN 3T8RA 5DS9A 2NOGA 2XKOA 2K9MA 1V55H 2ZC2A 4M3BA 1R63A 3S3NA 3MLFA 3JREA 2KZ8A 1GUUA 4CCJA 5J8CA 3IH2A 1G3WA 4LG0A 4AU7A 3KXAA 2HEOA 1KQ9A 2YX4A 2VIXA 1R1UA 3E6DA 3KFWX 2BBYA 2Z5UA 5F0CA 2YX7A 5J4VA 5D4RA 1RKTA 5AONA 5JI6A 4YFXF 4YARA 2ME6A 2VKVA 4D0PA 4X4FA 1FTZA 3PO3J 2DJNA 1IUFA 2EZHA 3MN2A 4U7BA 4B44A 5HNFA 5BPIA 4ZYGA 4ER0A 2Y69H 1EJ9A 2BEOA 2K9LA 3T5XA 3H0GJ 3WTVC 4AD9A 1JKQC 1CGPA 3OOPA 4I6UA 1X3UA 3V4GA 2NVYJ 3QU3A 2DMQA 2Z2SB 2ZFWA 4OU0A 4ZYHA 2V4JC 3FHNA 4BL0B 2M87A 1W5CC 4L18B 2R63A 2ZFUA 4RMNA 3L9FA 4CCMA 3X2QH 2Z9OA 2DA2A 1HKQA 3M7GA 3F21A 2IV1A 3J7AY 2XUBA 3AG2H 1NK2P 1EV7A 1W1WE 1LEBA 2HXIA 4XKBA 3ZMVA 4OIPF 2PMZN 2LYPA 5FLVA 1IRFA 3J81K 1FPQA 5GAGJ 2M34A 3CO6C 2ZMEA 1SFUA 1FTTA 5IYDJ 3U1KA 4X4DA 3HOZJ 1WCMJ 3HL2A 3S1NJ 2EV0A 1RUNA 1QB2A 3GTOJ 1ACIA 3F8MA 1WPKA 3H35A 2HOSA 2O8KA 2XAUA 4FBIA 4WXCA 2PXBA 2BJCA 2DYRH 4EJUA 5GAHi 2O03A 5L3FA 3K70D 3F8BA 3S3MA 5BMZA 3C2BA 4BJ6C 5JLXA 3SEZA 2DK8A 2DA6A 1XGSA 4BEHB 5L3GA 4I6ZA 2UZKA 2CUZA 1F9NA 2L7FP 3BJ6A 2P7VB 4M73A 1A35A 4UB6C 2D1VA 2P5LC 1ZG1A 1PVEA 1BC7C 1R36A 1UG2A 1VQKI 4CYDA 3HJEA 2CYYA 5LEJA 1ZGAA 4ESBA 2JVLA 4JCYA 1O4XA 5D5WB 3VB2A 2B9SA 3BZCA 4QIWN 4HSRA 1W7PB 2IRFG 2EZKA 3P9KA 4JK1X 2VB6A 5TGTA 2FNPA 2E2JJ 2LC2A 2Y75A 5C44J 3BQZA 1XDSA 4A3BJ 5IP6A 2DFEA 2ZNZA 3SR4A 2BGCA 1O57A 1U5TB 3BP8A 3RPUD 3CMEI 1S3JA 4KMFA 4XSXF 3RKYA 2NRAC 1ZZ7A 3FF5A 4I99C 3GTKJ 4CGZA 1DQUA 3DF8A 3OQMA 2M5WA 2Y31A 1Y1WJ 1XMXA 2EIJH 4HW0A 4P9UA 1N75A 1R49A 2XAJA 3V42A 1FYMA 2R7RA 2X6YA 3R4KA 2BZTA 3LMMA 1BR1A 2CQ7A 4L5EA 1DPRA 2ECCA 4E70A 4Y13A 3Q5FA 1U3EM 2X1EA 1T33A 2ID3A 1NEQA 3KZ3A 1S7AA 1TQPA 4B8XA 1SFEA 2AXZA 4MGRA 2DODA 1G4DA 2V1DA 4CYCB 3CTAA 1LEAA 2GZWA 5HLTA 2DPUA 4A3FJ 3ERED 4XOPA 1P7JA 4C2MJ 1Z7UA 2XAQA 3VYTB 4Z5DA 4Z5CA 4O5VA 3VSLA 3OSFA 3A02A 2GA1A 4ENKA 2RC4A 2OF7A 1UTXA 2F48A 2AO9A 4A12A 2VN2A 3HGYA 3L2QA 3CC7I 3CMMA 4UVBA 5E3OA 1PP7U 2JVHA 1T39A 3F6WA 2A07F 4AVZA 1REPC 3JTGA 3DV8A 4HQMA 2X9DA 3VPRA 3I55I 4ZYDA 2KT0A 4G7HF 3MVPA 5IP9J 2OD5A 2Z16A 2PPXA 5HNHA 5M3FJ 1J2XA 4JP0A 4HPQA 3HBLA 2X1DA 4EJWA 3JAMK 5GAHJ 1OSLA 1XSDA 3FMRA 2UV1A 3DLAA 2VQLA 4M9SA 3QPHA 5LBQA 3W6KB 4KYWA 3L2WA 3ZPLA 5F27A 3CMYA 1YX3A 4HRAA 3H9GA 1BN5A 3HSFA 5DV5A 3R61A 1NTCA 4ZYEA 3PFYA 2LP0A 3RIRA 1PRAA 1VNDA 2KIUA 3FWEA 5HS8A 5IT3A 1VZ0A 3Q0WA 4FE7A 4RB2C 1JT0A 3OL4A 3UFDA 3CCEI 1K78A 3DTIA 1J0RA 2ECBA 2PIJA 2CQKA 4IRHA 1IDZA 5DEQA 3MKZA 4X6AJ 3LSRA 1IG7A 5LRSA 2DU9A 3MD2A 1F5TA 4LJZF 3GMEA 2G9WA 2M8GX 4NDLA 3F8NA 3QWLA 5BOXA 1NHAA 3BZ6A 4HV5A 2STTA 5EGOA 2A5WA 3GFIA 3HDDA 2JT1A 1YIJI 1VQLI 2K9QA 2WA0A 1LKXA 4M3EA 4R79A 1OKRA 1QZEA 1X3WB 3IHUA 3EUKL 3WGIA 3G6EI 1W5SA 2CQXA 1XG1A 1JFSA 1P9QC 3VK0A 4ER3A 4YG4A 1E3HA 2ESNA 1FYKA 2R5YB 2MQKA 5K98B 4Z2YA 5CQEA 2IVMA 1HA8A 3L2CA 2PUEA 4NNJA 2XRLA 1K6YA 2LG4A 5HS7A 1KZHA 4D9JA 1JI8A 2ZB9A 3ERMA 3MEXA 4CDGA 3BPVA 1ULYA 2R7XA 3F0CA 3OY9A 1T98A 3CJRB 4UY8I 1ZLKA 2Y0MA 3FXKA 1JH9A 1X1CA 4XLEA 5KK1A 3Q9VA 1BL0A 3UKGA 4DOZA 3M3YJ 4XBFA 5K7ZA 3I4PA 3PSIA 2DFIA 4HQEA 1Q1VA 3G1OA 1LFBA 5FLXZ 1MSFC 1IGNA 5J4YA 4Z5HA 2WAFA 2J5OA 2GXAA 1J59A 5B3SH 1LCDA 2LLWA 2LYRA 4YFNF 2JN6A 5KAFC 5CVRA 4DYQA 1B8IB 3BJOA 5K5RA 4X4HA 4JBAA 3S1QJ 2XDVA 1IDYA 2L7KA 2QM3A 3GFJA 3UNGC 3GTJJ 3W6VA 1HLVA 3QPLA 2UXXA 2XPVA 5TISC 4UUSB 1APLC 2VI6A 2L9VA 2P4WA 3S17J 3G1MA 4I8TA 2VC0A 3LOCA 4LLGF 3ML6A 1AWCA 2D1HA 2FE3A 1B4AA 2PX9A 4NC6A 4BQOA 3I4MJ 2HR3A 1E17A 1WQ2A 1I3AA 3FK7A 3TP0A 2NOJB 2VT3A 3BY6A 4I6TA 5FFZA 4CH7A 3MAJA 3EDPA 2EK5A 4M3FA 4HRIA 3AAFA 1OCRH 1RUOA 1QHGA 5FKOA 1MH3A 4I02A 4U0VA 3WU0A 1TTYA 1ZYRF 2E19A 1YW9A 3G4SI 4HX7A 2DO7A 4ASNA 3KETA 2CUJA 1OR7C 2EA4A 5DUKA 2HXOA 1QHHD 3WGHA 5DUIA 2P6SA 2LLKA 3H3UA 2WAQA 4K2EA 3G1LA 3GN5A 3FXJA 2L49A 3GZDC 4L5IA 1W0UA 4XOTA 2X85A 3HC7A 1FJLA 1LDJA 3GZCA 2IGMA 3HYIA 1RZ4A 2LKXA 1IF1A 2IVGA 4BQAA 5GADJ 2VQGA 4I6RA 1J5YA 4GCVA 2QKLB 3V8KA 1FBUA 3AL0B 5IT9K 3OV8A 2MBFA 2F2EA 4LLLA 4IA8A 1QPMA 2L02A 2ESHA 2FUG2 3WE3A 5E3MA 2DPDA 4LG0B 3DEWA 4FQGA 4QWQA 4BJ5C 1QBJA 3FKIJ 2LNBA 3DFGA 3WTUC 2BNNA 2HOAA 4LIUA 1XCVA 2ICTA 1F43A 2L01A 4IPAA 4KICA 1RETA 5J1YA 3L7WA 1R6RA 3LWFA 4G12A 3A9YA 4BEHA 1E3OC 2LCVA 2PFBA 1VF9A 2WIUB 4DZJA 2MW8A 3TEDA 2YU3A 1TQMA 3GWZA 1NG6A 2O5RA 1QQBA 3K69A 1FP2A 4A3IJ 2ELHA 3ONQA 1Q1HA 3HZIB 4A0ZA 3BS3A 2WWYA 1H89C 2R4GA 1IRXA 2VJIA 2Z1DA 2HOEA 3MEJA 2LF8A 4DIQA 2W25A 2DT5A 5CYVA 3C2HA 3VYUB 2XB0X 3PQKA 1Z91A 4YG2F 3A2KA 1BBYA 2BY0A 4HF0A 2HPIA 1HW1A 2GAUA 1BM9A 1R1VA 2VQCA 3JSOA 3PE5A 4N9HA 4HBLA 1T0FA 2E1MB 1JKOC 4LLNA 1R58A 4RDUA 1BOBA 4PGGA 2N8GA 3I3LA 4EKIA 2KEIA 1IXCA 1I27A 1HSJA 3BR0A 1HDDC 3KP2A 4B47A 3GLXA 4ZZDA 4L0YB 5J3LA 2AXVA 4UVCA 3NWSA 4M3DA 3KEYA 3KP6A 3A1YA 2PUBA 1PJRA 1WGXA 1WHUA 3BWGA 3J80Z 2DCEA 4PJJA 3A9ZA 3GO5A 5LHIA 3E5UA 2JCGA 1FMWA 4CYCA 1KGSA 3DBLB 1ZN2A 4PSXA 2A69F 5J40A 3L1PA 1VFCA 2K3FA 2BHYA 4XIDA 1OCPA 5L3BA 3HOYJ 2O4AA 3O8GA 2MA3A 3AKZA 1G6NA 1RKWA 2BY2A 2VJ5A 2HQRA 3B6CA 2MD5A 1K4TA 4PFOA 5IP7J 4ANJA 1XN7A 2OCCH 2QQBA 2CW8A 2VL8A 3S8PA 1DW9A 1SAUA 2WV0A 3QOXA 4JX4A 1X1DA 2L8NA 2PMUA 2IS2A 3ASOH 2NVUB 2GXBA 1A6QA 3I54A 3IH4A 4LIVA 1N78A 3LSJA 3DPLC 3VFZA 2LYLA 2A6HF 2CS3A 1QP4A 1BJZA 1ZREA 1DULA 1M1EB 4RM3A 2VE9A 3C3WA 4ENMA 3TO7A 2XGEA 3M9AA 2ZCWA 2JUCA 1ZZ9A 2IA0A 4JCXA 3P9IA 3BG9A 3CP8A 1IN5A 4CO8A 3K70C 3RKWA 2KMUA 4DNCA 3H1CA 3QYBA 1Y39A 4DBRA 4QPOA 1DUXC 1QPIA 3SQNA 3R09A 3CUQC 4WXDA 4IHTA 1D0ZA 4DE8A 2LF7A 3O9XA 2BOLA 5IOYA 3SYTA 3G71I 1E2XA 2P5KA 4BHPA 1VQMI 2JA2A 5JFRA 1BJAA 4NQWA 4ON0A 4G7ZF 3FM5A 2CGPA 2F4OB 4RS8A 1WH8A 3FXQA 2V9PA 2Y2ZA 1EA3A 2E5NA 4FE4A 1YS7A 2IU7A 3FZVA 4MIMA 3LA2A 1T56A 1ORKA 1X4OA 4KIFA 3GTQJ 2VQHA 3S14J 5FKNA 3UWPA 4Z59A 2IAIA 3TEPA 2JRTA 2ZXIA 2KIMA 4Y17A 5K5QA 1PDNC 3SZPA 2P5VA 2R7VA 3WHBA 3HPHA 3F6VA 3F8CA 1OCTC 1B72A 1EH8A 3IH3A 1SMTA 1TWFJ 3DKXA 1ETQA 4NBQA 2V1UA 3DPUA 1IN8A 4II3A 2BY3A 2V6CA 2XF6A 5GTHC 3IC7A 2EQRA 1D5YA 2XXPA 2KEJA 4MCTA 3OYGA 3FXRA 3S2HJ 5LHGA 2QQ9A 2CQNA 2GOMA 3WU1B 1RC9A 3SCGA 4RGSA 4KMUX 2L9SA 5DD8A 1BR4A 4CA0A 2ZXHA 1WSUA 3CC4I 4G6QA 3A4CA 2GOXB 3QOWA 1MNMC 2XB5A 1MBKA 2L4AA 2MFZA 3EUHA 3LSPA 4BNCA 2K9NA 3FXOA 1YO5C 1Z77A 2ODRD 2YS9A 1P4AA 3HG9A 2R7SA 2RN7A 2H1KA 1OMIA 4XLPF 4HNTA 2VEOA 4I7HA 3M1CA 1ZTRA 2R7QA 4FETA 2L7MP 2PXLA 2E7WA 1PRUA 1K78B 4XRMA 4HLYA 4LB6B 1RZRD 3RZOJ 1S7EA 2K27A 3DTKA 2I10A 3TQNA 2G7UA 2OAZA 2BXZA 2VXZA 2ZSIB 4NC8A 3ZQIA 4KUMA 2JWTA 4FASD 2K3PA 2KDOA 3OYIA 4GFBA 1AOYA 4OB4A 1W5TA 2CV0A 3TRBA 2WY8Q 4HDVA 5EGOB 1ITYA 1BA5A 4UUSA 1TW3A 2VBYA 1B0NA 4P96A 4IVNA 5GTIC 2GA2A 2VKEA 3LSTA 3TW6A 1HOMA 5A2QZ 3D5RC 3TW7A 2LLVA 4U88A 5DDGA 1MJ9A 2FX0A 3RDIA 2LKSA 2R1JL 1MMSA 3DEUA 3TELA 3WODF 4U0YA 5E17F 1T8IA 1GLNA 4YIFA 2EV5A 3DP7A 4Y4RA 5F1JA 1K61A 1LFUP 4ZDLA 1RIOH 3CDHA 3K4NA 2IVQA 2W24A 4X4IA 2AW6A 4PU7A 3CC2I 1HW5A 4Y33A 2DLLA 5EDNA 3GTLJ 3HZJA 4EM1A 3LSMA 2L1PA 3M8EA 1N25A 4BHCA 3WU2C 1A36A 3BDDA 4OMZA 2ISZA 2W48A 2EIKH 2XSJC 3JW4A 1JUSA 2CV1A 3HEFA 2OTLI 3IV5A 5ICGA 3QRFF 1T2KA 1U5TC 2DT6A 2FQ4A 2GIVA 3F72A 3PNYA 1HBXG 2HFZA 1GV5A 2V1NA 1VQ4I 2XRNA 1Z1DA 1IRGA 2J7UA 5KCMA 3OQOA 4IX7A 4Z6YA 2JVGA 1Z0XA 3MQ0A 4A5MA 3Q3SA 3MKYB 4A6EA 4B4CA 5C3EJ 4V2GA 4FISA 1SFXA 2HKOA 3U1DA 3ZHIA 1VTNC 2DI3A 1ON2A 3OIOA 4E7LA 2R7DA 2RGVA 2OCEA 5D5XB 3H3ZA 5GPCA 5DTDA 1ZAOA 3OYDA 3CO7C 1JKRC 3IVPA 2EINH 2YR2A 3FX3A 3H5AA 5CVVA 5FKLA 1DWKA 1QP7A 4XL9A 4PGHA 5TRDA 1FIAA 1ZELA 2EV6A 5J6XA 1I1GA 4E4HA 4B48A 5J8FA 2D45A 3ULQB 3ECOA 4E7IA 1QVTA 1IXSB 5HDGA 2JSPA 1XTAA 3S8QA 1Y8QB 4CICA 5C4JJ 4V2FA 1LE8A 2IEKA 1DU6A 3GN5B 2ISYA 3C18A 1ENHA 4XLNF 3OOUA 2R5ZB 4BE2A 3FHZA 4RGUA 5A7LA 3R60A 3ZR8X 3RZZA 4EJVA 4G7OF 3TKYA 1MMGA 2CMPA 4XKCA 3WE2A 3V7RA 4X0GA 1FLIA 2UXNA 4AVPA 5D5UB 3JSPA 4E7JA 2K4JA 3RQIA 1Z67A 2PXFA 5KVRA 1SEUA 1HXDA 4UNOA 1KQ0A 1UELB 2XGDA 3KE2A 3PNVA 2M45A 4RB0A 5FKMA 1FP1D 4CCLA 1IAWA 1R5ID 1XMKA 2EFNA 4C30A 3TOBA 3WTWC 4M6XA 3N05A 5LHHA 3LFUA 4XKVA 2XVCA 3D1NI 2IS1A 3OWQA 5CVJA 4BBSJ 2PI0A 3RPQA 3GTGJ 1LFPA 4C3JJ 4XLCA 2KIQA 3ASNH 4MTDA 3IUOA 4CCOA 2JA8J 1FZPB 2B5AA 3LL7A 3VSKA 2QQ8A 4AIJA 4XM3A 3HUGA 1NG7A 2KKOA 3DXJF 2HCNA 3I5UA 1HQCA 2ELJA 4X4CA 5EEAA 4LD5A 4TV7A 3L2VA 1KONA 1D1BA 2I5UA 5FROA 3IKVA 5HDNA 2PXVA 1IZ1A 3OYHA 1DP7P 3GFMA 2KZVA 2W85A 5HDKA 1S72I 2AQFA 4PDKA 3PFIA 1G3YA 1TNSA 2VUMJ 1RZRA 3CLCA 1U0JA 2X4HA 5M5WJ 4UUTA 1DGWY 2AWIA 1YIOA 1OFCX 1LMB3 4F7ZA 2FU4A 1SVMA 2XPWA 1U2ZA 3L09A 1LQ1A 4EZIA 3U2RA 1D3YA 3EQLF 2LTPA 2O8XA 1HW2A 4A0YA 3S1MJ 5LLQA 3U21A 3ABKH 4CZZA 1YE9A 4JOMA 3K4LA 3DNVB 4YELA 4BGDA 1RRJA 2KRHA 2QYOA 4F93B 1JTXA 3K1NA 1LCCA 1HF0A 3BJAA 3GF2A 3ABTA 3KYLA 2R93J 1B9MA 4O8BA 3KYCB 2WV1A 1VQ5I 4DQ2A 1UHWA 2CUFA 2KHMA 1WH7A 4LK1F 1B1BA 1V5FA 3KEQA 2QZ8A 1JFTA 2VC1A 1WWXA 2NYXA 2HCSA 4IRIA 1L0OC 2LD5A 4IHWA 2KL4A 2WB1A 3F6OA 3M8JA 5JHFA 5LFAA 3CCQI 2HS5A 3KP5A 4DZPA 3MKLA 2GZUA 1ZLJA 2M9HA 4I01A 4B3AA 2DMPA 2V3CC 2QVOA 3FM3A 1Y6IA 3WGGA 1LPQA 1H9GA 3RQ4A 1MBHA 1B6AA 4LOCA 1PRVA 3GW2A 3C1DA 1BI1A 4CCKA 3MKWB 1UMQA 4IWRA 4L9VA 4MLOA 1DU0A 1AHDP 2FJRA 3GZ5A 2HVRA 1FT9A 4D7MA 1Y56A 1LB2A 2LR8A 3DEEA 3ZQGA 3QP6A 3JRFA 2HFHA 1Z9CA 1X1BA 3AFHA 3H36A 2FEZA 3BCBA 3E5XA 2A68F 2HVSA 2HPMA 2A05A 2MXDA 3HB9A 2R3SA 3BOQA 3Q0UA 5FJ8J 3RYPA 4OAZA 4BH9A 2MG4A 1FOYA 2P81A 2CFOA 4EK9A 4F92B 4EMSA 1ETYA 4ENJA 3F22A 4A3JJ 1JKPC 4L9NA 4E6KG 1STZA 3HOVJ 1KQ8A 3KX2A 2LBFB 1I39A 2X51A 3I9V2 1IUYA 3EYYA 4BKXA 4IHXA 2KRCA 1K4SA 2GRMA 2DA4A 5CQGA 4QTRA 3ELKA 4NQWB 1FMVA 3J7AO 2K85A 3AL0C 1X57A 5DCMB 3K4KA 1R69A 1EH6A 1QP0A 1RPEL 2FQ3A 3H5TA 3KP4A 3BTIA 1T08B 3LA3A 2Z33A 1TW2A 1WI9A 3K4BA 1SD6A 2ACJA 3W3CA 3E6CC 3TMOA 1S9HA 4GGGA 1O3SA 5ICCA 2JMWA 1B72B 3V8JA 3JRCA 4P55A 2HTJA 1TZLA 2FJ1A 1T95A 3H92A 4KISA 4LMYA 2ZKZA 2PUCA 2X1CA 1R1TA 4BHBA 2MGQA 2BXYA 2GWRA 2ZJ2A 4OOIA 5LD2C 2V6EA 3MZYA 4I09A 1R9TJ 1YS6A 1SMYF 5F6FA 2H1LA 4U87A 4U0WA 3FMQA 4QLCU 4PU8A 4MTEA 5BQTA 2IVBA 3QP5A 1JT6A 3DLLF 2DQRA 3I0TA 2FOKA 2QF7A 1VQPI 1SVLA 1QQIA 4WX9A 3CP2A 4AIDA 3FMYA 1ZGJA 2E1MC 1YSEA 3LISA 5B66C 1FC3A 3NRVA 2GQQA 2VOPA 2LYQA 2VXDA 1KU3A 5DSXA 2TRTA 2OBPA 2BYVE 2ZMEC 4BY1J 1ZQ3P 1MKMA 2A6EF 4S05A 3HTSB 2EH3A 4HG2A 2F5FA 4UUVA 1OCOH 3NWTA 4ITVA 1VQOI 1D5VA 4PFPA 1Z7LA 1VQ9I 4IEJA 2DFFA 5HLHA 5D6EA 1ADRA 1LQCA 1XSVA 2G7HA 1EH7A 1U9OA 2KLOA 4L9JA 2OZUA 1IN7A 2JSCA 3SJMA 2OQGA 2B0LA 1L3LA 3GYHX 3WTSC 2L0KA 1RNLA 2HI3A 2OA4A 3BR1A 4W1UA 3HOWJ 4BACA 2ICPA 2EFWA 3DKYA 1F36A 2PUFA 2B63J 3J7ZI 3OL3A 1WJAA 3ZGKA 4A3LJ 3K1MA 4J1WA 4M72A 1TWAJ 2E60A 2QSGX 4L9TA 2R5ZA 2WY7Q 2V9VA 4R8HA 1BI2A 1Z6TA 1NW3A 2VODA 1TT0A 4XONA 4Y52J 4BDYA 3CLQA 3LFKA 1YRNA 4Y15A 4J19A 2R7OA 1ZVVA 2M0CA 3H5RA 3PNTA 1V3FA 2PJRA 3G2BA 3OQNA 3GXOA 1WJ5A 2Y0SN 2QENA 3M1EA 2VJJA 4IZZA 4W97A 2DT7B 5EEGA 2K40A 1UXDA 2XCJA 1WJBA 1YYVA 3LSIA 3H3VK 2K02A 1KU7A 5BPDA 2PXPA 4BXXJ 3IP4B 2MEZA 2E1OA 2V79A 3PL8A 3S1RJ 4A3DJ 5A2QK 3F23A 4EATA 3MWMA 1Y9QA 1JHHA 1ZG5A 2HQ5A 4AYBN 3CCYA 1RESA 1PUEE 2JPBA 1DDNA 3NROA 3QF3A 1R00A 4MQ9F 3O6BB 4KFCA 2KQRA 2AXUA 4I0AA 1UCRA 2CQQA 1KA8A 2DW4A 2PXUA 1LE8B 2DOEA 1MJAA 2HZDA 1YW8A 2BHZA 5BS6A 3A01A 4XLAA 5IY5H 2A6TA 2DOAA 2KJCA 4JYKA 2PXEA 2V1XA 3K2AA 3ROUA 4HF1A 2DMNA 3COAC 1NH3A 3KZZA 4KT5C 1MZBA 4PK4A 5H2FC 2CW0F 2F5EA 3BZKA 4HLXA 3S93A 3DQVC 3OYEA 4EEFG 1MBGA 2A3SA 2OUMA 4EGYA 1WJEA 4M74A 4YIIA 1TQIA 1WJCA 3BQYA 3DCFA 2XAFA 3ESWB 4OINF 3OS2A 3L2UA 1W36D 4AM3A 5IYCJ 2LYJA 2W7NA 2J7WA 2FRHA 1ZZCA 3I59A 1OISA 5CJ9A 3ZHMA 5M3MJ 5IYBJ 4BAYA 2RKHA 1ZR2A 5HVQC 4E7HA 2V7FA 4CHUA 1R4NB 1XS9A 3BC8A 1QZXA 2RQPA 4EGZA 2HDCA 5LRRA 4DJAA 1V5GA 1T38A 3F3XA 4NUBA 2DK5A 1MSEC 3IAS2 1MFQC 1MD0A 2X6WA 2ZNYA 4EVIA 4Y7NJ 2H8RA 4IVZA 1X58A 1ETKA 2CFXA 2LK2A 1J7KA 3B73A 1XC5A 4F52A 1WH6A 2O49A 5CVUA 1H0MA 3QAHA 4A69C 4ER6A 3HUGB 1FYLA 4DYCA 5FD5A 4C3IJ 1YITI 1HKTA 4MEXF 4S04A 4PUSA 2JZYA 2GRLA 3CECA 4IRGA 2MC4A 1XSXA 4Y42A 3NXHA 1TP4A 2CRGA 1UHSA 3HKZA 5B1BH 3B7HA 2LKPA 4OIOF 4BE1A 4DBQA 2KFDA 1YG2A 3RCOA 4GDFA 2LNMA 5L3CA 4LFUA 2ZO4A 3LA7A 2FNAA 3FDYA 4HDUA 3GBFA 4RGRA 5EF6A 3QWGA 3SDGA 1GV2A 3IAM2 3CCRI 3HHHA 3Q9SA 2LY2A 3D0SA 1P92A 5KAIC 4ZZLA 3ABLH 1YFHA 2PLYA 1MGTA 2VBZA 3SFZA 2EFPA 3KPHA 4FTHA 1WRJA 2WUSR 3BROA 2L9NA 2RQQA 2UUZA 5L3EA 5F64A 1XD7A 2RDPA 3DPTA 3A9XA 1G59A 4I98B 2LBFA 4F3QA 3CESA 1RI7A 3HOSA 2HU9A 4Q5SF 1H8AC 4G6DA 3OYNA 4H0EA 2ME0A 1IJWC 2D2WA 3CF2A 2A61A 1ETOA 2P0WA 1MDMB 2MD0A 1Y8RB 2ICWG 3RZDJ 2DXIA 3G3ZA 2VPLA 1AA7A 3PIPF 5E3LA 3M4OJ 2BNMA 3OIQA 3ZP5A 4IQ4A 5DCMA 3GTMJ 3E3VA 1LDDA 2JQ7A 3MMYB 3JXBC 3OWTA 2JUGA 5E8IA 3G0TA 2Q8KA 2PMZA 3LAJA 1ERDA 4XQFA 2XKPA 1OYWA 2EB7A 4OWRB 1ZAYA 4KJZA 2Y9YA 3NAUA 1XGNA 4C2UA 5K7HA 2DA5A 2PBIA 3NZLA 1PERL 2WAQN 3ZRGA 3S2DJ 4WVLA 4XLFA 1J75A 4XKWA 3RTRA 4ENNA 1I1SA 3BLYA 2KISA 3KCCA 4G9YA 3I64A 5GAEJ 1Z6RA 1SANA 1T6SA 5BNGA 2M4HA 3TDZC 3OS0A 1IRZA 2BNOA 1Y0NA 3ABMH 4WCGA 4ZDOA 1AKHA 3EYIA 4GQMA 1BIAA 2AQEA 2QCOA 1SQ8A 3OYJA 3E7LA 3ABUA 5DM6F 5AIQA 2YU9J 3CMAI 3BG7A 2Z3YA 3PSFA 3GTPJ 4IOCF 2EJRA 5DRTA 3DU6A 2VONA 4RAFA 3S32A 5B1AH 5EG0A 2MLGA 4N4NB 2H6BA 3QYFA 5F04A 5K1YA 4PZJA 1YW7A 3HOXJ 2FMLA 1FBQA 2X48A 3E97A 1OCCH 4BU2A 2IA1A 2H09A 4A3CJ 3LFPA 2KRFA 1MIJA 2F5CA 2E71A 4O6JA 4OIRF 1JWLA 3GZNB 1W0TA 2XXQA 1HQ1A 1HKSA 2MSYA 4YG1A 1JGGA 1KU2A 2M3AA 3LNQA 2RREA 3HPGA 4D5FA 2F4MB 1J09A 3BCAA 4JQDA 3VODA 1R22A 3ZQFA 2H6CA 5M5YJ 3FISA 1PNRA 2G0EA 5EEHA 1FEXA 2KJBA 1QA6A 4PCQA 3LAPA 2R0QC 2IA2A 4A3EJ 2W4SA 4G8XA 5AIPA 4JQFA 3I58A 4ER7A 4MFDA 1IC8A 4LGWA 3DWLE 4A2UA 2NVXJ 3LSHA 5GP9A 3WTTC 3CCJI 3SXYA 2KP6A 2ZBKA 2WTEA 4MNUA 3LQRA 1XWRA 3LSKA 4PSWA 3JTHA 2IGOA 3RYRA 1GVDA 2XXAA 4ABZA 3PQJA 2VKHA 4MQVA 4XRSG 4N9IA 4HX8A 5IOZA 1DPUA 2EWTA 1ETWA 4XR6A 3BR5A 2LREA 2XF7A 3TO6A 5ILUA 2ID6A 4A3MJ 4CZCA 1BDHA 1X2LA 2A5YB 4MFEA 5LGNA 4KDPA 1UB9A 3JRAA 5E3NA 2GBYA 3BD1A 2NVTJ 1Y0UA 2CH0A 1TWCJ 3Q0VA 4IHYA 1XMAA 3FIWA 2V26A 1QRYA 2IGKA 4M9ZA 2XJ3A 1OYYA 4GRIA 4ZDPA 4LG3A 2MYSA 1T0FC 2CJJA 3CDLA 4PJMA 1IW7F 1PYVA 2IUOA 3SCHA 3HOTA 2PMHA 4RAYA 4XSZF 5E79C 2JK3A 2C6YA 1POGA 3CUQB 3KZIC 1VQ8I 4BY7J 5KHDA 2DMUA 2TDXA 1LVKA 3PO2J 2ADUA 1OCZH 2EBYA 1UAAA 3KL4A 2CU7A 2K86A 1QGPA 4D7NA 4YEJA 2DQLA 2EIMH 2W57A 1U78A 2M4GA 5ILVA 1FX7A 2BVMA 2IXSA 3HTUA 4X1EA 2DA1A 4KITB 3CDIA 2MH2A 3R0JA 2CSFA 1U8BA 2YSRA 3JRDA 3RJPA 4IL6C 1TBXA 2XSDC 2R92J 3ECHA 1X2NA 4I76A 1ODDA 1Z05A 1L1MA 1LLIA 2AXLA 4IHSA 4A3KJ 2LOOA 1NERA 1P2FA 4JX5A 3OYCA 1A5JA 1MBJA 3TGNA 3CF5F 4HA8A 3C2GA 1KU9A 4ZYAA 4BE0A 1HSTA 6PAXA 3SFIA 2E7XA 2BW3B 3KP3A 1KYWA 3QFIA 2M30A 3T1BA 3CJNA 3S16J 4GO1A 3HSRA 3M07A 3T8TA 5J1UA 2Q2EA 4RB1A 1Z3YA 2K9SA 5HLGA 2KPMA 1O3TA 2NS7A 4UHTA 1USSA 3PUBA 1I5ZA 2JA5J 1YRNB 1JUMA 1C0WA 3OSGA 5FLXK 1AU7A 2PJRB 3HOUJ 1O3QA 2IS6A 2M0MA 2IW5A 4CSWA 4HEA2 1XGOA 3CLOA 4Z58A 3LQXA 2HYGD 3PIOF 1D0XA 1GXPA 4BYYA 2JRMA 1ON1A 4Q4ZF 2L54A 5H6QA 3FYAA 5TJJA 3ZPXA 2CW7A 1MMNA 2JPCA 3PUFA 3TBIA 1SD5A 1UJ8A 2DA3A 4KN4X 2FD5A 3ZMSA 3BR2A 4X4BA 4WK8F 1YLFA 3BTCA 1RR8C 1I6XA 4I0BA 4BQQA 1TWHJ 2XHKA 1QVUA 5EYRA 3WTYC 1WFXA 1A6IA 4RGXA 3HRSA 3W6JB 4IOAF 5DRYA 4WXHA 3GEZA 1X4PA 5F0HA 1ZPQA 3NQOA 2AUWA 1USTA 2QUFA 4ER5A 4D5CA 1ZGWA 1YOVB 2VOOA 5JVGF 2OR1L 1B59A 2O9LA 2YUSA 2E5ZA 1YTYA 2QKMB 2OQRA 1W4MA 1ZK8A 3A01B 2ZJQF 3QOEA 3R0AA 3R6SA 4L0ZB 1O7FA 3KYDB 3IKTA 4RBOA 5DD4A 1R5GA 2DYSH 3CCSI 1RZSA 4DYRA 4C3HJ 1R7JA 1H9TA 3FKJA 5D5VB 3W2AA 3G5GA 1OR7A 3NDBB 5JR3A 3ZKCA 3OMTA 4B3XA 5FO5A 4HNVA 1ZHFA 3AG4H 1D8JA 5D6FA 1R5HA 3A0BC 1K79A 3S3OA 2LH9A 3W2VA 3GZDA 5DT2A 2EFQA 4J1XA 2LRDA 1NK3P 4A3GJ 5IPAA 4BBRJ 4RM2A 2BY1A 3WG7H 3I59B 1CJGA 1S8NA 2IGNA 2DA7A 4P1WA 5JVTA 3HXLA 3VWSA 3OYKA 2EPFA 3EUHC 3GFLA 3H5NA 2XC7A 4KIGA 1WJFA 1ZS4A 1YJNI 5FD6A 1TNTA 2Q0OA 3BG3A 1MDMA 3OR1C 1HDPA 3BTJA 1S29A 2EWNA 3JRGA 4AIHA 1CF7B 4C9YA 2DMTA 1ZRCA 1XB4A 1JGSA 1FOKA 1F1ZA 3I4NJ 2KEKA 5EJCA 1XX5A 1Z3XA 2X0LA 3RI4A 1JUPA 3HSEA 2P7CB 4HOBA 2Z99A 1BW6A 4HX4A 1D1CA 4ZC3A 1YJWI 5FGMA 2K4BA 4M71A 2ETHA 2A6CA 4I2OA 1A31A 2O7OA 3QODA 4A0XA 1VI0A 1WKMA 2XIUA 4XN3A 2I8DA 2ZXWH 2L4MA 4XNFA 1P6RA 2W1OA 4DE9A 1FWZA 3L2RA 2DOFA 4EKGA 4PU3C 2R7WA 3J7YJ 1SFOJ 1FY7A 4Q2JA 2Y0SA 3WTXC 3KLNA 4AWXB 3R1FA 3SDBA 3BT9A 3B02A 2LVSA 1W36C 4O3MA 1XPXA 2RNJA 4F91B 3CCUI 3DBRB 2HVQA 3OR2C 1IN4A 2PXDA 2H27A 3SEQA 2NNNA 3KEOA 3P7NA 3CD6I 2NVQJ 2XAGA 3EUSA 3JCUC 3K10A 3AG1H 4CCNA 2E35A 5KNLA 2CWEA 3DM5A 1MJBA 4AYBA 1FIPA 3E0JB 2FFHA 5ICFA 4F8DA 4D1QA 3I71A 1P7IA 5DTMA 3CUOA 2XASA 3J80K 2F4IA 2Y30A 3FMSA 3FBNB 4UV8A 3GCMA 4HF2A 2MLKA 1WETA 5K7FA 4RAGA 3P9CA 3OS1A 4KA4A 1FSEA 4KNYA 1V54H 2M1BA 2E36A 3I53A 4RB3C 4M6YA 2H94A 1R71A 2ELKA 4PJNA 5ICEA 2M4KA 3V7SA 2NAZA 2HTSA 1WJDA 2AXTC 2QBYA 2W82A 1K7AA 4XK4A 2W00A 2E2IJ 1POUA 1DP3A 1ZG3A 2AHQA 4M6VA 1BIBA 3BG6A 1CQTA 1PUFA 1VQ7I 1MMDA 1W7PD 1ZR4A 5DCFA 4UVAA 1FNNA 3SHFA 3CCMI 3K7AJ 3TL4X 3MFKA 1MW7A 3G7DA 3K9TA 3CJTB 4XMYA 4ZH4F 1HC8A 1Y7YA 3N4MA 4HYEA 1OLTA 2P6TA 4II2A 5E20A 2QLZA 5J47A 1GXQA 1JJ6C 2W84A 1AKHB 1ZRFA 3ZMTA 1BI3A 5FRNA 4XN0A 1FOXA 2PXKA 3RKXA 1OJLA 2M7AA 1GDTA 2FF4A 4X4EA 4PJLA 3PXPA 1BI0A 3FK6A 1OPCA 2RAEA 2GLOA 2LFBA 1K6OA 5EG0B 3WHCA 2DBBA 4HNUA 2RV8A 4HSTA 3W2WA 4MO7A 1BC8C 1ZZ8A 2OZ6A 2PUDA 3ZN1A 2FOWA 2QA4I 4HZFA 2LSOA 1S5LC 5HLIA 2MABA 3ZMZA 4UXNA 2IS4A 1YX5A 3HRMA 4XRFA 3CUQA 4ESFA 3E1SA 1SFKA 1ZUGA 3BR3A 3TDUC 5C4XJ 3BR6A 1K83J 5CLSA 2Y9ZA 3J81Z 1X19A 1N77A 4Y3OA 5B5EC 1I6HJ 3IWZA 1QNTA 1UXCA 2IPQX 2YPRA 3TOAA 2JJ7A 2LMDA 3O8HA 2ZSHB 2DFHA 3OYLA 1VQNI 2EFOA 4B1RA 3SCFA 1ZRDA 2PEXA 2EBIA 1X3ZB 1G8XA 4BXFA 4OMYA 1U9NA 2OU2A 4EM2A 3KZYA 1SD7A 3KLOA 1X1PA 2HKXA 4PJ0C 1RR7A 3VOEA 1P4XA 3OYFA 5K5OA 3M9LA 5FKKA 4XICA 2FMYA 1ZKGA 3ZXSA 2JA6J 3RPUA 2HOTA 2HNHA 2R7ZJ 2XIGA 3QOPA 3RKQA 1G2HA 2OJED 1JE8A 3WG9A 2BW3A 1X2MA 2BV6A 3TP3A 1XGMA 2HYFA 2HINA 5F08A 1IO2A 3MZ8A 4BS9A 1JXSA 2PXTA 3T0YA 3MZHA 3HIFA 2O61A 2VBWA 4XRSA 1DGRM
chains in the Genus database with same CATH topology
2ME0A 1IJWC 3ZHIA 1ETOA 3OIOA 2WB1N 3RZDJ 5E3LA 5GPCA 3M4OJ 5DTDA 1JKRC 2X9DA 3IVPA 2BNMA 3ZQCA 3VPRA 2PUAA 2L7ZA 5FKLA 1DWKA 1QP7A 2PPXA 2KT0A 3GTMJ 3MVPA 5IP9J 1RPWA 1BW5A 3JXBC 1FIAA 5M3FJ 3LSGA 4JP0A 2TCTA 3HBLA 1TC3C 1OSLA 1I50J 1ZAYA 1QVTA 2Y9YA 1ETVA 1WIZA 3NAUA 4PU4C 3S8QA 5K7HA 5C4JJ 2DA5A 2LY9A 4V2FA 1LE8A 1PERL 2EF8A 2WAQN 3S2DJ 2IEKA 1DU6A 2HDDA 2DN0A 3GN5B 5F27A 2DTZA 3CMYA 1ENHA 3OOUA 2R5ZB 1SANA 5BNGA 1IRZA 2BNOA 5A7LA 1NTCA 2LP0A 1PRAA 3OP9A 1VNDA 3RZZA 1HCRA 1AKHA 4GQMA 3Q0WA 2QCOA 4FE7A 1JT0A 1SQ8A 5FLMJ 3E7LA 3HM5A 2YU9J 3UFDA 2ECBA 2PIJA 1IDZA 2NS8A 3RQIA 3GTPJ 4X6AJ 2IBDA 3LSRA 1IG7A 2XGDA 5FKMA 2XPUA 2M8GX 4NDLA 5EG0A 5F04A 3HOXJ 3QQAA 4A3CJ 2X48A 3LFPA 1MBFA 5EGOA 3D1NI 1JWLA 4BBSJ 4FN3A 3HDDA 1W0TA 3GTGJ 1QPZA 2MSYA 4YG1A 1JGGA 2K9QA 3LNQA 2GM4A 4C3JJ 4M3EA 4D5FA 4S0HB 4JQDA 3ZQFA 3NARA 5M5YJ 5M5XJ 3FISA 2JA8J 2G0EA 1PNRA 1FEXA 2B5AA 2CQXA 1XG1A 1JFSA 2M2EA 2R0QC 3VK0A 4A3EJ 4YG4A 2CROA 4M3GA 2R5YB 2MQKA 5HODA 5K98B 4X4CA 3BTLA 5EEAA 4MFDA 2PUEA 1IC8A 4JX6A 2EZIA 2XRLA 2XI8A 2ZB9A 2NVXJ 3F0CA 5GP9A 3F52A 2VUMJ 1RZRA 4FCYA 1XWRA 1BDIA 5M5WJ 3CLCA 4UUTA 2AWIA 1OFCX 1LMB3 1JH9A 1WH5A 1GVDA 3A03A 5GPAA 2XPWA 1BL0A 4ABZA 3UKGA 3M3YJ 3HGGA 2LYSA 5K7ZA 3FYMA 4XRSG 2LTPA 1Q1VA 5EZGA 3G1OA 3S1MJ 1LFBA 5IOZA 2EWTA 1MSFC 1ETWA 1IGNA 3BR5A 1EF4A 2LYKA 4Z5HA 2VPRA 3DNVB 2ID6A 1LCDA 4A3MJ 1BDHA 1X2LA 2LYRA 2JN6A 4MFEA 4DYQA 1JTXA 1B8IB 2HSGA 3CROL 1LCCA 1HF0A 4X4HA 3JRAA 3S1QJ 1JJ8C 5E3NA 2GBYA 3ZQLA 1IDYA 2R93J 3BD1A 4O8BA 3GTJJ 2NVTJ 3W6VA 1TWCJ 3Q0VA 2WV1A 4IHYA 2CUFA 3FIWA 1HLVA 1QRYA 2XJ3A 1WH7A 3QPLA 4X4GA 2XPVA 4UUSB 2O38A 1APLC 2CUEA 2VI6A 2CJJA 1JFTA 3S17J 3G1MA 3CDLA 3BG5A 4I8TA 3LOCA 2LD5A 4AC0A 4IHWA 3SCHA 2IUOA 3I4MJ 3PM1A 3JXCL 3FK7A 3ZQHA 4DZPA 2JK3A 3TP0A 1POGA 3MKLA 3QQ6A 3KJXA 2GZUA 4I6TA 2M9HA 4BY7J 4M3FA 4B3AA 1MBEA 2DMPA 2DMUA 2OPTA 3PO2J 5FKOA 1MH3A 1QQAA 1MBHA 2E19A 4LOCA 1PRVA 2EBYA 2CU7A 3ZOBA 4D7NA 1ETXA 1UMQA 2HYJA 4IWRA 1U78A 2HXOA 4MLOA 1DU0A 2FJRA 1AHDP 4AUXA 4X1EA 2DA1A 2LLKA 3GN5A 3G1LA 2L49A 4D7MA 1W0UA 2CSFA 3JRBA 1U8BA 2LR8A 3JRDA 1FJLA 3ZQGA 2L9RA 2XSDC 1I3QJ 3JRFA 2R92J 2LKXA 1X2NA 1IV6A 3QYXA 2IVGA 4I76A 1L1MA 1LLIA 4GHJA 4I6RA 4A3KJ 1NERA 3HB9A 4JX5A 1A5JA 1MBJA 3Q0UA 4QSHA 5FJ8J 4IA8A 4YBAA 2MG4A 2P81A 3SFIA 5E3MA 9ANTA 3F51A 1ETYA 3DEWA 3GBGA 4A3JJ 3S16J 1JKPC 1ZZBA 3FKIJ 2BNNA 4NDWA 5J1UA 3HOVJ 2PUGA 2HOAA 2K9SA 2ICTA 2NS7A 1F43A 2JA5J 1RETA 5J1YA 1H88C 1YRNB 4BKXA 4G12A 1JUMA 3JXDL 3OSGA 4IHXA 1E3OC 1AU7A 2LCVA 3HOUJ 1VF9A 2GRMA 2WIUB 2DA4A 4DZJA 4QTRA 2MW8A 3TEDA 4Z58A 1Y1VJ 2X6OA 5F0FA 1QQBA 1X57A 4A3IJ 1R69A 1QP0A 1RPEL 2D5VA 2JA7J 3H5TA 3HZIB 2PE5A 3BS3A 3BTIA 1H89C 2R5YA 3FYAA 4MCXA 2DA3A 2XB0X 2JMWA 2FD5A 1B72B 3JRCA 3BR2A 2FJ1A 3QPSA 3JRIA 4X4BA 3BTCA 2EZLA 3CQZJ 1TWHJ 5EYRA 1QVUA 1A6IA 5J1RA 1JKOC 4DW6A 2PUCA 5F0HA 4IHVA 5JLWA 1ZPQA 4RDUA 2COBA 2AUWA 3B6AA 2MGQA 2OFYA 1TWGJ 4D5CA 1ZGWA 1R9TJ 2OR1L 2N8GA 2O9LA 2YUSA 1PUFB 2KEIA 2XGCA 3BR0A 1HDDC 2AXVA 1B8IA 5J3LA 1ZK8A 3A01B 1ZZ6A 4PU8A 4M3DA 4A93J 2IVBA 4RBOA 1RZSA 2PUBA 1JT6A 4DYRA 4C3HJ 2QF7A 3G5GA 1WGXA 3OMTA 3ZKCA 4HNVA 3FMYA 3JRHA 1JTYA 1YSEA 3LISA 4J1XA 2JCGA 1NK3P 2E2HJ 4A3GJ 5IPAA 4CYCA 2LYQA 4BBRJ 2KPJA 1RIOA 2TRTA 1CJGA 3L1PA 2DA7A 1VFCA 4BY1J 1ZQ3P 4XIDA 3HOYJ 1OCPA 2O4AA 3O8GA 1MH4A 1RKWA 2KDZA 3S15J 2EH3A 1ZS4A 1EFAA 3B6CA 3BG3A 1HDPA 5IP7J 3BTJA 3JRGA 5EZHA 4IEJA 2DMTA 1GT0C 3JR9A 3BDNA 4YG7B 1ADRA 3I4NJ 1LQCA 1DW9A 2KEKA 1U9OA 4JX4A 1WI3A 2L8NA 1VPWA 3SJMA 1JUPA 3IH4A 1BW6A 2L0KA 2HI3A 3BR1A 3LSJA 4W1UA 3HKZN 3HOWJ 2A6CA 2ICPA 2O7OA 1BJZA 2LYLA 5DS9A 1VI0A 2NOGA 2XIUA 1F36A 2XGEA 2PUFA 2B63J 4M3BA 1R63A 4A3LJ 3MLFA 4J1WA 3JREA 2KZ8A 1ZZ9A 1GUUA 1TWAJ 4JCXA 3BG9A 4PU3C 3IH2A 3KXAA 1SFOJ 2R5ZA 5F0CA 3R1FA 3BT9A 1RKTA 1QPIA 4Y52J 2LVSA 1YRNA 4J19A 4YARA 2ME6A 2VKVA 3O9XA 1ZVVA 2M0CA 5IOYA 4X4FA 1FTZA 3PO3J 3OQNA 2DJNA 1IUFA 2EZHA 3MN2A 2Y0SN 2NVQJ 3EUSA 1WH8A 4W97A 3H0GJ 2K40A 2Y2ZA 4FE4A 1UXDA 1JKQC 2IU7A 2XCJA 4MIMA 1T56A 1ORKA 3H3VK 3GTQJ 4I6UA 1FIPA 5FKNA 3S14J 4Z59A 2IAIA 1QP4A 2NVYJ 4F8DA 2DMQA 1P7IA 4BXXJ 2MEZA 2E1OA 3WHBA 2Y30A 1WETA 2R63A 5K7FA 1B72A 3S1RJ 1OCTC 4A3DJ 3IH3A 1TWFJ 1ETQA 2KEJA 2DA2A 1D5YA 1Y9QA 2EQRA 2IV1A 2ELKA 4MCTA 1NK2P 2HQ5A 4AYBN 3CCYA 1RESA 3S2HJ 2HXIA 2PMZN 2LYPA 5FLVA 3SCGA 3QF3A 4XK4A 2E2IJ 1POUA 2AHQA 2M34A 2AXUA 4M6VA 1FTTA 1CQTA 1PUFA 5IYDJ 2CQQA 1ZR4A 1MNMC 4X4DA 1LE8B 2XB5A 1MBKA 1WCMJ 3HOZJ 3S1NJ 3GTOJ 3A01A 3K7AJ 3LSPA 2K9NA 4JYKA 1Z77A 3K2AA 1WPKA 2YS9A 3G7DA 2HOSA 2O8KA 2DMNA 2H1KA 4FBIA 2BJCA 1Y7YA 1ZTRA 1JJ6C 1AKHB 4EEFG 2L7MP 1MBGA 3C2BA 5JLXA 1PRUA 2DA6A 4XRMA 3BQYA 3DCFA 4I6ZA 1RZRD 3RZOJ 1S7EA 1OJLA 5IYCJ 1GDTA 2I10A 2LYJA 4X4EA 2L7FP 1ZZCA 3PXPA 3FK6A 3ZQIA 2RAEA 2GLOA 2LFBA 2JWTA 4GFBA 4OB4A 5EG0B 5M3MJ 3ZHMA 5IYBJ 3WHCA 3TRBA 1ZR2A 5EGOB 1ITYA 1BA5A 1UG2A 4UUSA 1XS9A 1B0NA 4MO7A 1ZZ8A 2PUDA 2JVLA 2VKEA 4JCYA 3TW6A 1O4XA 1MSEC 1HOMA 4IVZA 4Y7NJ 2H8RA 3TW7A 4QIWN 2FX0A 1X58A 1ETKA 2EZKA 2LK2A 2R1JL 1XC5A 2E2JJ 4A3BJ 1WH6A 5C44J 3BQZA 1ZUGA 3BR3A 5C4XJ 5IP6A 3BR6A 2O49A 4A69C 1K83J 2Y9ZA 5F1JA 1K61A 4DYCA 1LFUP 4C3IJ 2GRLA 3CECA 1ZZ7A 4Y42A 1I6HJ 2IVQA 2CRGA 3B7HA 1UHSA 3GTKJ 1UXCA 4X4IA 2JJ7A 3OQMA 3O8HA 2Y31A 1Y1WJ 2AW6A 4PU7A 4B1RA 3SCFA 2EBIA 5EDNA 3GTLJ 1U9NA 3U3WA 4L5EA 3GBFA 5EF6A 3QWGA 2ECCA 1RR7A 2W48A 3SDGA 1GV2A 5FKKA 4XICA 1JUSA 3HEFA 1T33A 2ID3A 1ZKGA 1NEQA 3KZ3A 2JA6J 3IV5A 2HOTA 2R7ZJ 2AXZA 4FTHA 4CYCB 3RKQA 2FQ4A 1G2HA 2WUSR 1GV5A 1X2MA 4A3FJ 3TP3A 4C2MJ 1P7JA 2HINA 4Z5DA 4Z5CA 3OSFA 5F08A 3A02A 3OQOA 2OF7A 1UTXA 1Z0XA 2AO9A 3Q3SA 3HGYA 5E3OA 1H8AC 4B4CA 5C3EJ 4V2GA 4XRSA 3F6WA 4FISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ME0 A;  1IJW C;  3ZHI A;  1ETO A;  3OIO A;  2WB1 N;  3RZD J;  5E3L A;  5GPC A;  3M4O J;  5DTD A;  1JKR C;  2X9D A;  3IVP A;  2BNM A;  3ZQC A;  3VPR A;  2PUA A;  2L7Z A;  5FKL A;  1DWK A;  1QP7 A;  2PPX A;  2KT0 A;  3GTM J;  3MVP A;  5IP9 J;  1RPW A;  1BW5 A;  3JXB C;  1FIA A;  5M3F J;  3LSG A;  4JP0 A;  2TCT A;  3HBL A;  1TC3 C;  1OSL A;  1I50 J;  1ZAY A;  1QVT A;  2Y9Y A;  1ETV A;  1WIZ A;  3NAU A;  4PU4 C;  3S8Q A;  5K7H A;  5C4J J;  2DA5 A;  2LY9 A;  4V2F A;  1LE8 A;  1PER L;  2EF8 A;  2WAQ N;  3S2D J;  2IEK A;  1DU6 A;  2HDD A;  2DN0 A;  3GN5 B;  5F27 A;  2DTZ A;  3CMY A;  1ENH A;  3OOU A;  2R5Z B;  1SAN A;  5BNG A;  1IRZ A;  2BNO A;  5A7L A;  1NTC A;  2LP0 A;  1PRA A;  3OP9 A;  1VND A;  3RZZ A;  1HCR A;  1AKH A;  4GQM A;  3Q0W A;  2QCO A;  4FE7 A;  1JT0 A;  1SQ8 A;  5FLM J;  3E7L A;  3HM5 A;  2YU9 J;  3UFD A;  2ECB A;  2PIJ A;  1IDZ A;  2NS8 A;  3RQI A;  3GTP J;  4X6A J;  2IBD A;  3LSR A;  1IG7 A;  2XGD A;  5FKM A;  2XPU A;  2M8G X;  4NDL A;  5EG0 A;  5F04 A;  3HOX J;  3QQA A;  4A3C J;  2X48 A;  3LFP A;  1MBF A;  5EGO A;  3D1N I;  1JWL A;  4BBS J;  4FN3 A;  3HDD A;  1W0T A;  3GTG J;  1QPZ A;  2MSY A;  4YG1 A;  1JGG A;  2K9Q A;  3LNQ A;  2GM4 A;  4C3J J;  4M3E A;  4D5F A;  4S0H B;  4JQD A;  3ZQF A;  3NAR A;  5M5Y J;  5M5X J;  3FIS A;  2JA8 J;  2G0E A;  1PNR A;  1FEX A;  2B5A A;  2CQX A;  1XG1 A;  1JFS A;  2M2E A;  2R0Q C;  3VK0 A;  4A3E J;  4YG4 A;  2CRO A;  4M3G A;  2R5Y B;  2MQK A;  5HOD A;  5K98 B;  4X4C A;  3BTL A;  5EEA A;  4MFD A;  2PUE A;  1IC8 A;  4JX6 A;  2EZI A;  2XRL A;  2XI8 A;  2ZB9 A;  2NVX J;  3F0C A;  5GP9 A;  3F52 A;  2VUM J;  1RZR A;  4FCY A;  1XWR A;  1BDI A;  5M5W J;  3CLC A;  4UUT A;  2AWI A;  1OFC X;  1LMB 3;  1JH9 A;  1WH5 A;  1GVD A;  3A03 A;  5GPA A;  2XPW A;  1BL0 A;  4ABZ A;  3UKG A;  3M3Y J;  3HGG A;  2LYS A;  5K7Z A;  3FYM A;  4XRS G;  2LTP A;  1Q1V A;  5EZG A;  3G1O A;  3S1M J;  1LFB A;  5IOZ A;  2EWT A;  1MSF C;  1ETW A;  1IGN A;  3BR5 A;  1EF4 A;  2LYK A;  4Z5H A;  2VPR A;  3DNV B;  2ID6 A;  1LCD A;  4A3M J;  1BDH A;  1X2L A;  2LYR A;  2JN6 A;  4MFE A;  4DYQ A;  1JTX A;  1B8I B;  2HSG A;  3CRO L;  1LCC A;  1HF0 A;  4X4H A;  3JRA A;  3S1Q J;  1JJ8 C;  5E3N A;  2GBY A;  3ZQL A;  1IDY A;  2R93 J;  3BD1 A;  4O8B A;  3GTJ J;  2NVT J;  3W6V A;  1TWC J;  3Q0V A;  2WV1 A;  4IHY A;  2CUF A;  3FIW A;  1HLV A;  1QRY A;  2XJ3 A;  1WH7 A;  3QPL A;  4X4G A;  2XPV A;  4UUS B;  2O38 A;  1APL C;  2CUE A;  2VI6 A;  2CJJ A;  1JFT A;  3S17 J;  3G1M A;  3CDL A;  3BG5 A;  4I8T A;  3LOC A;  2LD5 A;  4AC0 A;  4IHW A;  3SCH A;  2IUO A;  3I4M J;  3PM1 A;  3JXC L;  3FK7 A;  3ZQH A;  4DZP A;  2JK3 A;  3TP0 A;  1POG A;  3MKL A;  3QQ6 A;  3KJX A;  2GZU A;  4I6T A;  2M9H A;  4BY7 J;  4M3F A;  4B3A A;  1MBE A;  2DMP A;  2DMU A;  2OPT A;  3PO2 J;  5FKO A;  1MH3 A;  1QQA A;  1MBH A;  2E19 A;  4LOC A;  1PRV A;  2EBY A;  2CU7 A;  3ZOB A;  4D7N A;  1ETX A;  1UMQ A;  2HYJ A;  4IWR A;  1U78 A;  2HXO A;  4MLO A;  1DU0 A;  2FJR A;  1AHD P;  4AUX A;  4X1E A;  2DA1 A;  2LLK A;  3GN5 A;  3G1L A;  2L49 A;  4D7M A;  1W0U A;  2CSF A;  3JRB A;  1U8B A;  2LR8 A;  3JRD A;  1FJL A;  3ZQG A;  2L9R A;  2XSD C;  1I3Q J;  3JRF A;  2R92 J;  2LKX A;  1X2N A;  1IV6 A;  3QYX A;  2IVG A;  4I76 A;  1L1M A;  1LLI A;  4GHJ A;  4I6R A;  4A3K J;  1NER A;  3HB9 A;  4JX5 A;  1A5J A;  1MBJ A;  3Q0U A;  4QSH A;  5FJ8 J;  4IA8 A;  4YBA A;  2MG4 A;  2P81 A;  3SFI A;  5E3M A;  9ANT A;  3F51 A;  1ETY A;  3DEW A;  3GBG A;  4A3J J;  3S16 J;  1JKP C;  1ZZB A;  3FKI J;  2BNN A;  4NDW A;  5J1U A;  3HOV J;  2PUG A;  2HOA A;  2K9S A;  2ICT A;  2NS7 A;  1F43 A;  2JA5 J;  1RET A;  5J1Y A;  1H88 C;  1YRN B;  4BKX A;  4G12 A;  1JUM A;  3JXD L;  3OSG A;  4IHX A;  1E3O C;  1AU7 A;  2LCV A;  3HOU J;  1VF9 A;  2GRM A;  2WIU B;  2DA4 A;  4DZJ A;  4QTR A;  2MW8 A;  3TED A;  4Z58 A;  1Y1V J;  2X6O A;  5F0F A;  1QQB A;  1X57 A;  4A3I J;  1R69 A;  1QP0 A;  1RPE L;  2D5V A;  2JA7 J;  3H5T A;  3HZI B;  2PE5 A;  3BS3 A;  3BTI A;  1H89 C;  2R5Y A;  3FYA A;  4MCX A;  2DA3 A;  2XB0 X;  2JMW A;  2FD5 A;  1B72 B;  3JRC A;  3BR2 A;  2FJ1 A;  3QPS A;  3JRI A;  4X4B A;  3BTC A;  2EZL A;  3CQZ J;  1TWH J;  5EYR A;  1QVU A;  1A6I A;  5J1R A;  1JKO C;  4DW6 A;  2PUC A;  5F0H A;  4IHV A;  5JLW A;  1ZPQ A;  4RDU A;  2COB A;  2AUW A;  3B6A A;  2MGQ A;  2OFY A;  1TWG J;  4D5C A;  1ZGW A;  1R9T J;  2OR1 L;  2N8G A;  2O9L A;  2YUS A;  1PUF B;  2KEI A;  2XGC A;  3BR0 A;  1HDD C;  2AXV A;  1B8I A;  5J3L A;  1ZK8 A;  3A01 B;  1ZZ6 A;  4PU8 A;  4M3D A;  4A93 J;  2IVB A;  4RBO A;  1RZS A;  2PUB A;  1JT6 A;  4DYR A;  4C3H J;  2QF7 A;  3G5G A;  1WGX A;  3OMT A;  3ZKC A;  4HNV A;  3FMY A;  3JRH A;  1JTY A;  1YSE A;  3LIS A;  4J1X A;  2JCG A;  1NK3 P;  2E2H J;  4A3G J;  5IPA A;  4CYC A;  2LYQ A;  4BBR J;  2KPJ A;  1RIO A;  2TRT A;  1CJG A;  3L1P A;  2DA7 A;  1VFC A;  4BY1 J;  1ZQ3 P;  4XID A;  3HOY J;  1OCP A;  2O4A A;  3O8G A;  1MH4 A;  1RKW A;  2KDZ A;  3S15 J;  2EH3 A;  1ZS4 A;  1EFA A;  3B6C A;  3BG3 A;  1HDP A;  5IP7 J;  3BTJ A;  3JRG A;  5EZH A;  4IEJ A;  2DMT A;  1GT0 C;  3JR9 A;  3BDN A;  4YG7 B;  1ADR A;  3I4N J;  1LQC A;  1DW9 A;  2KEK A;  1U9O A;  4JX4 A;  1WI3 A;  2L8N A;  1VPW A;  3SJM A;  1JUP A;  3IH4 A;  1BW6 A;  2L0K A;  2HI3 A;  3BR1 A;  3LSJ A;  4W1U A;  3HKZ N;  3HOW J;  2A6C A;  2ICP A;  2O7O A;  1BJZ A;  2LYL A;  5DS9 A;  1VI0 A;  2NOG A;  2XIU A;  1F36 A;  2XGE A;  2PUF A;  2B63 J;  4M3B A;  1R63 A;  4A3L J;  3MLF A;  4J1W A;  3JRE A;  2KZ8 A;  1ZZ9 A;  1GUU A;  1TWA J;  4JCX A;  3BG9 A;  4PU3 C;  3IH2 A;  3KXA A;  1SFO J;  2R5Z A;  5F0C A;  3R1F A;  3BT9 A;  1RKT A;  1QPI A;  4Y52 J;  2LVS A;  1YRN A;  4J19 A;  4YAR A;  2ME6 A;  2VKV A;  3O9X A;  1ZVV A;  2M0C A;  5IOY A;  4X4F A;  1FTZ A;  3PO3 J;  3OQN A;  2DJN A;  1IUF A;  2EZH A;  3MN2 A;  2Y0S N;  2NVQ J;  3EUS A;  1WH8 A;  4W97 A;  3H0G J;  2K40 A;  2Y2Z A;  4FE4 A;  1UXD A;  1JKQ C;  2IU7 A;  2XCJ A;  4MIM A;  1T56 A;  1ORK A;  3H3V K;  3GTQ J;  4I6U A;  1FIP A;  5FKN A;  3S14 J;  4Z59 A;  2IAI A;  1QP4 A;  2NVY J;  4F8D A;  2DMQ A;  1P7I A;  4BXX J;  2MEZ A;  2E1O A;  3WHB A;  2Y30 A;  1WET A;  2R63 A;  5K7F A;  1B72 A;  3S1R J;  1OCT C;  4A3D J;  3IH3 A;  1TWF J;  1ETQ A;  2KEJ A;  2DA2 A;  1D5Y A;  1Y9Q A;  2EQR A;  2IV1 A;  2ELK A;  4MCT A;  1NK2 P;  2HQ5 A;  4AYB N;  3CCY A;  1RES A;  3S2H J;  2HXI A;  2PMZ N;  2LYP A;  5FLV A;  3SCG A;  3QF3 A;  4XK4 A;  2E2I J;  1POU A;  2AHQ A;  2M34 A;  2AXU A;  4M6V A;  1FTT A;  1CQT A;  1PUF A;  5IYD J;  2CQQ A;  1ZR4 A;  1MNM C;  4X4D A;  1LE8 B;  2XB5 A;  1MBK A;  1WCM J;  3HOZ J;  3S1N J;  3GTO J;  3A01 A;  3K7A J;  3LSP A;  2K9N A;  4JYK A;  1Z77 A;  3K2A A;  1WPK A;  2YS9 A;  3G7D A;  2HOS A;  2O8K A;  2DMN A;  2H1K A;  4FBI A;  2BJC A;  1Y7Y A;  1ZTR A;  1JJ6 C;  1AKH B;  4EEF G;  2L7M P;  1MBG A;  3C2B A;  5JLX A;  1PRU A;  2DA6 A;  4XRM A;  3BQY A;  3DCF A;  4I6Z A;  1RZR D;  3RZO J;  1S7E A;  1OJL A;  5IYC J;  1GDT A;  2I10 A;  2LYJ A;  4X4E A;  2L7F P;  1ZZC A;  3PXP A;  3FK6 A;  3ZQI A;  2RAE A;  2GLO A;  2LFB A;  2JWT A;  4GFB A;  4OB4 A;  5EG0 B;  5M3M J;  3ZHM A;  5IYB J;  3WHC A;  3TRB A;  1ZR2 A;  5EGO B;  1ITY A;  1BA5 A;  1UG2 A;  4UUS A;  1XS9 A;  1B0N A;  4MO7 A;  1ZZ8 A;  2PUD A;  2JVL A;  2VKE A;  4JCY A;  3TW6 A;  1O4X A;  1MSE C;  1HOM A;  4IVZ A;  4Y7N J;  2H8R A;  3TW7 A;  4QIW N;  2FX0 A;  1X58 A;  1ETK A;  2EZK A;  2LK2 A;  2R1J L;  1XC5 A;  2E2J J;  4A3B J;  1WH6 A;  5C44 J;  3BQZ A;  1ZUG A;  3BR3 A;  5C4X J;  5IP6 A;  3BR6 A;  2O49 A;  4A69 C;  1K83 J;  2Y9Z A;  5F1J A;  1K61 A;  4DYC A;  1LFU P;  4C3I J;  2GRL A;  3CEC A;  1ZZ7 A;  4Y42 A;  1I6H J;  2IVQ A;  2CRG A;  3B7H A;  1UHS A;  3GTK J;  1UXC A;  4X4I A;  2JJ7 A;  3OQM A;  3O8H A;  2Y31 A;  1Y1W J;  2AW6 A;  4PU7 A;  4B1R A;  3SCF A;  2EBI A;  5EDN A;  3GTL J;  1U9N A;  3U3W A;  4L5E A;  3GBF A;  5EF6 A;  3QWG A;  2ECC A;  1RR7 A;  2W48 A;  3SDG A;  1GV2 A;  5FKK A;  4XIC A;  1JUS A;  3HEF A;  1T33 A;  2ID3 A;  1ZKG A;  1NEQ A;  3KZ3 A;  2JA6 J;  3IV5 A;  2HOT A;  2R7Z J;  2AXZ A;  4FTH A;  4CYC B;  3RKQ A;  2FQ4 A;  1G2H A;  2WUS R;  1GV5 A;  1X2M A;  4A3F J;  3TP3 A;  4C2M J;  1P7J A;  2HIN A;  4Z5D A;  4Z5C A;  3OSF A;  5F08 A;  3A02 A;  3OQO A;  2OF7 A;  1UTX A;  1Z0X A;  2AO9 A;  3Q3S A;  3HGY A;  5E3O A;  1H8A C;  4B4C A;  5C3E J;  4V2G A;  4XRS A;  3F6W A;  4FIS A; 
#chains in the Genus database with same CATH topology
 1JHF A;  1XCB A;  4MEY F;  1IN6 A;  1G3S A;  5FB2 A;  2WB1 N;  4G94 A;  1D8K A;  4F55 A;  3UR3 C;  5LEK A;  3ZQC A;  1ONV A;  2PUA A;  2L7Z A;  5DYM A;  2K5C A;  2CSO A;  4V19 K;  3MCZ A;  1BW5 A;  1RPW A;  2WAE A;  2PG4 A;  1SC7 A;  2R7U A;  3I56 I;  4IXA A;  3SX0 A;  2HDW A;  4H4K C;  1V4R A;  3LSG A;  2M8E A;  4RLF A;  2KIF A;  4KT6 A;  2TCT A;  1TC3 C;  1I50 J;  2FSW A;  1ETV A;  1WIZ A;  3IRR A;  2R7T A;  4PU4 C;  3HRT A;  1QZZ A;  2LY9 A;  3H9Q A;  2EF8 A;  2XRO A;  3F8F A;  2DAO A;  2HDD A;  2DN0 A;  3CCL I;  1R4M B;  3DU5 A;  2DTZ A;  3GUD A;  4E7S A;  3D5S C;  3GX4 X;  3TFL A;  4R1H A;  1WVR A;  4Q48 A;  1IV8 A;  1ZAR A;  1QO0 D;  5LGT A;  4ZTF A;  3VYS B;  3OP9 A;  1X1A A;  1LUJ B;  3H0D A;  1HCR A;  3OKZ A;  3ME5 A;  2IP2 A;  5FLM J;  3HM5 A;  3G73 A;  2XV4 S;  4CUG A;  2O0Y A;  2NS8 A;  4GYG A;  4P5O A;  2VT2 A;  2VJ4 A;  2IBD A;  3IRQ A;  3D5L A;  2F5D A;  2XPU A;  1MNE A;  2VLA A;  2Q2E B;  3QQA A;  1MBF A;  3FXL A;  4B43 A;  1YI2 I;  2PJP A;  2JQE A;  1U2W A;  4M9X A;  4FN3 A;  1D1A A;  2Q1Z B;  1QPZ A;  2GM4 A;  4XLH A;  3P5J A;  3AG3 H;  4S0H B;  3O2P E;  4FHT A;  1UHM A;  3NAR A;  1W7P A;  1GVJ A;  3U9G A;  4YRV A;  5M5X J;  2CV2 A;  2HZT A;  3WTZ A;  2M2E A;  2VE8 A;  1LJ9 A;  2VKD A;  2EIL H;  5D8L B;  2CRO A;  2PXQ A;  4FX0 A;  4M3G A;  1U5T A;  4QPQ A;  3JAM Z;  5HOD A;  3BTL A;  4KIB A;  1FBS A;  1YHQ I;  4JX6 A;  3S2W A;  2EZI A;  1LDK B;  4CXF A;  2ZME B;  1CF7 A;  2XI8 A;  4L5J A;  4J00 A;  3GUU A;  2DJI A;  4OAY A;  3ZMU A;  2O6G E;  3F52 A;  4FCY A;  1BDI A;  3DBH B;  2DDA A;  2V9K A;  1KYZ A;  2M7B A;  3H9J A;  1WH5 A;  5FFX A;  4ZJZ A;  5GPA A;  3A03 A;  1YJ9 I;  2LYS A;  2LY1 A;  2J5P A;  3HGG A;  3KP7 A;  2XAH A;  3FYM A;  5EZG A;  1MMA A;  2ZJR F;  3GZ6 A;  1EF4 A;  2LYK A;  3ZMD A;  2VPR A;  1O7L A;  2E1N A;  2FBH A;  2GIZ A;  2HQA A;  4E7Z A;  4UV9 A;  2HSG A;  3CRO L;  4IO9 F;  3DKW A;  3IWF A;  3ZQL A;  1JJ8 C;  4WF2 A;  4GYI A;  4EJO A;  1LVA A;  1TLH B;  5HOO A;  4X4G A;  3FBI B;  2BE5 F;  4DGW B;  2O38 A;  2CUE A;  2P8T A;  4ZTJ A;  1PP8 F;  5H20 A;  4AIK A;  3BG5 A;  3K4J A;  1LNW A;  2NNY A;  1G3T A;  1SVO A;  4AC0 A;  3N97 A;  5H6R A;  5LGU A;  3PM1 A;  2VAS A;  3JXC L;  3ZQH A;  2WAD A;  3VDX A;  1FSH A;  3OYA A;  2STW A;  4WWC A;  2XF5 A;  3HHG A;  3K2Z A;  3KJX A;  3QQ6 A;  2OV7 A;  2ZXJ A;  1S6L A;  1MBE A;  2HGC A;  2LDU A;  2OPT A;  3E6B A;  4P9F A;  4IKF A;  1QQA A;  1V5E A;  4E7K A;  2B7E A;  3L00 A;  3ZOB A;  1B9N A;  1ETX A;  3BPX A;  1U6G A;  2MC3 A;  2HYJ A;  2FBI A;  2H8W A;  1UFM A;  4BUP A;  4AUX A;  3FXM A;  4YFK F;  1Z21 A;  5E1Z B;  5ERI A;  3V8L A;  2RNG A;  4LK0 F;  2L5Q A;  2COM A;  3JRB A;  2OC6 A;  2CG4 A;  2L9R A;  1I3Q J;  3QYE A;  2AS5 F;  4IJA A;  1IV6 A;  3QYX A;  5DTQ A;  2L2O A;  1R23 A;  3LQQ A;  3ZQQ A;  3VEP A;  5E8G A;  3VYR B;  3OYM A;  1OQY A;  4GHJ A;  2PN6 A;  2UWM A;  4FT8 A;  4IF4 A;  4A6D A;  4QSH A;  1SD4 A;  3FXU A;  4UB8 C;  1IXR C;  2VBX A;  4YBA A;  4J01 A;  5CVI A;  3SZT A;  9ANT A;  2RVC A;  5DM7 F;  1P4W A;  3NEU A;  3F51 A;  1EKE A;  3GBG A;  3GVA A;  1ZZB A;  5F1R A;  4NDW A;  2PUG A;  3ZN0 A;  3K4M A;  1UZC A;  3E5Q A;  5E18 F;  4KN7 X;  1E3P A;  1H88 C;  3JXD L;  3ZCO A;  2WBM A;  3OMY A;  2E1C A;  4LB5 A;  4Q47 A;  2KZG A;  1Y1V J;  4EQQ A;  4RAZ A;  2X6O A;  5F0F A;  1E0E A;  2WC2 A;  1MND A;  2F6C A;  5E1X A;  4N0B A;  2D5V A;  3TO9 A;  2JA7 J;  2PE5 A;  2QSF X;  4EV0 A;  5FRM A;  2R5Y A;  3OYB A;  1TT5 B;  4ETS A;  3M8F A;  1J9I A;  3ISP A;  4MCX A;  1QZY A;  5JHU A;  4XOR A;  1VQ6 I;  2QEX I;  2LYC A;  4N4O B;  1UG0 A;  2Y48 A;  1D0Y A;  2NS0 A;  3JRI A;  3QPS A;  2FXA A;  3A0H C;  4HV6 A;  2EZL A;  3CQZ J;  3EUA A;  2HWV A;  4EQZ A;  5J1R A;  4EM0 B;  4OIQ F;  4DW6 A;  2FBK A;  2QBY B;  4G6T B;  5DTR A;  4ESJ A;  3K1P A;  5JLW A;  3VWB A;  2COB A;  4IHV A;  3B6A A;  2OFY A;  1TWG J;  5IT9 Z;  2JTV A;  5E1W A;  1GHC A;  3K0L A;  3KIO A;  5L3D A;  3IL2 A;  2DTR A;  4BXU A;  1PUF B;  2GXG A;  2OTJ I;  3EPZ A;  2O3F A;  4MHG A;  2XGC A;  2BVL A;  3K6G A;  4IQJ A;  1QU3 A;  3C7J A;  3OIP A;  1B8I A;  2K7L A;  3RSN A;  1ZZ6 A;  4FX4 A;  2PQ8 A;  2FA5 A;  2ZJP F;  5HS9 A;  2DDB A;  4A93 J;  1YQA A;  2QWW A;  5GAG i;  4NC7 A;  4BQN A;  2X6X A;  3PJR A;  2CO5 A;  2NXN B;  3E6M A;  4OBM A;  3HRU A;  3ZQ7 A;  3QPT A;  1F4K A;  1OYI A;  3CZ6 A;  5D8K B;  1JTY A;  3JRH A;  2IT0 A;  1U8R A;  2R7F A;  2XGX A;  2F5V A;  3GLL A;  1O3R A;  2E2H J;  5ED4 A;  3QU6 A;  4GXO A;  1S7O A;  2KPJ A;  1RIO A;  4NB5 A;  4HAM A;  2E34 A;  4LIT A;  4RA2 A;  1TL8 A;  4U7D A;  5ILS A;  4C2T A;  1MH4 A;  4YIR X;  2KDZ A;  4BDZ A;  3S15 J;  2IJL A;  4RLQ A;  1EFA A;  1FOW A;  5JUW A;  3CCV I;  5CPR B;  3REO A;  2QQA A;  3F9K A;  4EJT A;  5EZH A;  1BOA A;  3K4C A;  4B09 A;  4NHJ A;  2L3D A;  1SAX A;  1A04 A;  5CKT A;  3JR9 A;  1GT0 C;  2QSH X;  3BDN A;  4YG7 B;  2HQN A;  2MH9 A;  3DTE A;  3EET A;  4A5N A;  4BJT A;  1WZ2 A;  3CJQ B;  1WI3 A;  1VPW A;  5D4S A;  2EA2 A;  3V7C A;  2QGU A;  1ZH5 A;  3SZG A;  2YBD A;  1XDU A;  1BR2 A;  3U3W A;  3O3K A;  3HKZ N;  3T8R A;  5DS9 A;  2NOG A;  2XKO A;  2K9M A;  1V55 H;  2ZC2 A;  4M3B A;  1R63 A;  3S3N A;  3MLF A;  3JRE A;  2KZ8 A;  1GUU A;  4CCJ A;  5J8C A;  3IH2 A;  1G3W A;  4LG0 A;  4AU7 A;  3KXA A;  2HEO A;  1KQ9 A;  2YX4 A;  2VIX A;  1R1U A;  3E6D A;  3KFW X;  2BBY A;  2Z5U A;  5F0C A;  2YX7 A;  5J4V A;  5D4R A;  1RKT A;  5AON A;  5JI6 A;  4YFX F;  4YAR A;  2ME6 A;  2VKV A;  4D0P A;  4X4F A;  1FTZ A;  3PO3 J;  2DJN A;  1IUF A;  2EZH A;  3MN2 A;  4U7B A;  4B44 A;  5HNF A;  5BPI A;  4ZYG A;  4ER0 A;  2Y69 H;  1EJ9 A;  2BEO A;  2K9L A;  3T5X A;  3H0G J;  3WTV C;  4AD9 A;  1JKQ C;  1CGP A;  3OOP A;  4I6U A;  1X3U A;  3V4G A;  2NVY J;  3QU3 A;  2DMQ A;  2Z2S B;  2ZFW A;  4OU0 A;  4ZYH A;  2V4J C;  3FHN A;  4BL0 B;  2M87 A;  1W5C C;  4L18 B;  2R63 A;  2ZFU A;  4RMN A;  3L9F A;  4CCM A;  3X2Q H;  2Z9O A;  2DA2 A;  1HKQ A;  3M7G A;  3F21 A;  2IV1 A;  3J7A Y;  2XUB A;  3AG2 H;  1NK2 P;  1EV7 A;  1W1W E;  1LEB A;  2HXI A;  4XKB A;  3ZMV A;  4OIP F;  2PMZ N;  2LYP A;  5FLV A;  1IRF A;  3J81 K;  1FPQ A;  5GAG J;  2M34 A;  3CO6 C;  2ZME A;  1SFU A;  1FTT A;  5IYD J;  3U1K A;  4X4D A;  3HOZ J;  1WCM J;  3HL2 A;  3S1N J;  2EV0 A;  1RUN A;  1QB2 A;  3GTO J;  1ACI A;  3F8M A;  1WPK A;  3H35 A;  2HOS A;  2O8K A;  2XAU A;  4FBI A;  4WXC A;  2PXB A;  2BJC A;  2DYR H;  4EJU A;  5GAH i;  2O03 A;  5L3F A;  3K70 D;  3F8B A;  3S3M A;  5BMZ A;  3C2B A;  4BJ6 C;  5JLX A;  3SEZ A;  2DK8 A;  2DA6 A;  1XGS A;  4BEH B;  5L3G A;  4I6Z A;  2UZK A;  2CUZ A;  1F9N A;  2L7F P;  3BJ6 A;  2P7V B;  4M73 A;  1A35 A;  4UB6 C;  2D1V A;  2P5L C;  1ZG1 A;  1PVE A;  1BC7 C;  1R36 A;  1UG2 A;  1VQK I;  4CYD A;  3HJE A;  2CYY A;  5LEJ A;  1ZGA A;  4ESB A;  2JVL A;  4JCY A;  1O4X A;  5D5W B;  3VB2 A;  2B9S A;  3BZC A;  4QIW N;  4HSR A;  1W7P B;  2IRF G;  2EZK A;  3P9K A;  4JK1 X;  2VB6 A;  5TGT A;  2FNP A;  2E2J J;  2LC2 A;  2Y75 A;  5C44 J;  3BQZ A;  1XDS A;  4A3B J;  5IP6 A;  2DFE A;  2ZNZ A;  3SR4 A;  2BGC A;  1O57 A;  1U5T B;  3BP8 A;  3RPU D;  3CME I;  1S3J A;  4KMF A;  4XSX F;  3RKY A;  2NRA C;  1ZZ7 A;  3FF5 A;  4I99 C;  3GTK J;  4CGZ A;  1DQU A;  3DF8 A;  3OQM A;  2M5W A;  2Y31 A;  1Y1W J;  1XMX A;  2EIJ H;  4HW0 A;  4P9U A;  1N75 A;  1R49 A;  2XAJ A;  3V42 A;  1FYM A;  2R7R A;  2X6Y A;  3R4K A;  2BZT A;  3LMM A;  1BR1 A;  2CQ7 A;  4L5E A;  1DPR A;  2ECC A;  4E70 A;  4Y13 A;  3Q5F A;  1U3E M;  2X1E A;  1T33 A;  2ID3 A;  1NEQ A;  3KZ3 A;  1S7A A;  1TQP A;  4B8X A;  1SFE A;  2AXZ A;  4MGR A;  2DOD A;  1G4D A;  2V1D A;  4CYC B;  3CTA A;  1LEA A;  2GZW A;  5HLT A;  2DPU A;  4A3F J;  3ERE D;  4XOP A;  1P7J A;  4C2M J;  1Z7U A;  2XAQ A;  3VYT B;  4Z5D A;  4Z5C A;  4O5V A;  3VSL A;  3OSF A;  3A02 A;  2GA1 A;  4ENK A;  2RC4 A;  2OF7 A;  1UTX A;  2F48 A;  2AO9 A;  4A12 A;  2VN2 A;  3HGY A;  3L2Q A;  3CC7 I;  3CMM A;  4UVB A;  5E3O A;  1PP7 U;  2JVH A;  1T39 A;  3F6W A;  2A07 F;  4AVZ A;  1REP C;  3JTG A;  3DV8 A;  4HQM A;  2X9D A;  3VPR A;  3I55 I;  4ZYD A;  2KT0 A;  4G7H F;  3MVP A;  5IP9 J;  2OD5 A;  2Z16 A;  2PPX A;  5HNH A;  5M3F J;  1J2X A;  4JP0 A;  4HPQ A;  3HBL A;  2X1D A;  4EJW A;  3JAM K;  5GAH J;  1OSL A;  1XSD A;  3FMR A;  2UV1 A;  3DLA A;  2VQL A;  4M9S A;  3QPH A;  5LBQ A;  3W6K B;  4KYW A;  3L2W A;  3ZPL A;  5F27 A;  3CMY A;  1YX3 A;  4HRA A;  3H9G A;  1BN5 A;  3HSF A;  5DV5 A;  3R61 A;  1NTC A;  4ZYE A;  3PFY A;  2LP0 A;  3RIR A;  1PRA A;  1VND A;  2KIU A;  3FWE A;  5HS8 A;  5IT3 A;  1VZ0 A;  3Q0W A;  4FE7 A;  4RB2 C;  1JT0 A;  3OL4 A;  3UFD A;  3CCE I;  1K78 A;  3DTI A;  1J0R A;  2ECB A;  2PIJ A;  2CQK A;  4IRH A;  1IDZ A;  5DEQ A;  3MKZ A;  4X6A J;  3LSR A;  1IG7 A;  5LRS A;  2DU9 A;  3MD2 A;  1F5T A;  4LJZ F;  3GME A;  2G9W A;  2M8G X;  4NDL A;  3F8N A;  3QWL A;  5BOX A;  1NHA A;  3BZ6 A;  4HV5 A;  2STT A;  5EGO A;  2A5W A;  3GFI A;  3HDD A;  2JT1 A;  1YIJ I;  1VQL I;  2K9Q A;  2WA0 A;  1LKX A;  4M3E A;  4R79 A;  1OKR A;  1QZE A;  1X3W B;  3IHU A;  3EUK L;  3WGI A;  3G6E I;  1W5S A;  2CQX A;  1XG1 A;  1JFS A;  1P9Q C;  3VK0 A;  4ER3 A;  4YG4 A;  1E3H A;  2ESN A;  1FYK A;  2R5Y B;  2MQK A;  5K98 B;  4Z2Y A;  5CQE A;  2IVM A;  1HA8 A;  3L2C A;  2PUE A;  4NNJ A;  2XRL A;  1K6Y A;  2LG4 A;  5HS7 A;  1KZH A;  4D9J A;  1JI8 A;  2ZB9 A;  3ERM A;  3MEX A;  4CDG A;  3BPV A;  1ULY A;  2R7X A;  3F0C A;  3OY9 A;  1T98 A;  3CJR B;  4UY8 I;  1ZLK A;  2Y0M A;  3FXK A;  1JH9 A;  1X1C A;  4XLE A;  5KK1 A;  3Q9V A;  1BL0 A;  3UKG A;  4DOZ A;  3M3Y J;  4XBF A;  5K7Z A;  3I4P A;  3PSI A;  2DFI A;  4HQE A;  1Q1V A;  3G1O A;  1LFB A;  5FLX Z;  1MSF C;  1IGN A;  5J4Y A;  4Z5H A;  2WAF A;  2J5O A;  2GXA A;  1J59 A;  5B3S H;  1LCD A;  2LLW A;  2LYR A;  4YFN F;  2JN6 A;  5KAF C;  5CVR A;  4DYQ A;  1B8I B;  3BJO A;  5K5R A;  4X4H A;  4JBA A;  3S1Q J;  2XDV A;  1IDY A;  2L7K A;  2QM3 A;  3GFJ A;  3UNG C;  3GTJ J;  3W6V A;  1HLV A;  3QPL A;  2UXX A;  2XPV A;  5TIS C;  4UUS B;  1APL C;  2VI6 A;  2L9V A;  2P4W A;  3S17 J;  3G1M A;  4I8T A;  2VC0 A;  3LOC A;  4LLG F;  3ML6 A;  1AWC A;  2D1H A;  2FE3 A;  1B4A A;  2PX9 A;  4NC6 A;  4BQO A;  3I4M J;  2HR3 A;  1E17 A;  1WQ2 A;  1I3A A;  3FK7 A;  3TP0 A;  2NOJ B;  2VT3 A;  3BY6 A;  4I6T A;  5FFZ A;  4CH7 A;  3MAJ A;  3EDP A;  2EK5 A;  4M3F A;  4HRI A;  3AAF A;  1OCR H;  1RUO A;  1QHG A;  5FKO A;  1MH3 A;  4I02 A;  4U0V A;  3WU0 A;  1TTY A;  1ZYR F;  2E19 A;  1YW9 A;  3G4S I;  4HX7 A;  2DO7 A;  4ASN A;  3KET A;  2CUJ A;  1OR7 C;  2EA4 A;  5DUK A;  2HXO A;  1QHH D;  3WGH A;  5DUI A;  2P6S A;  2LLK A;  3H3U A;  2WAQ A;  4K2E A;  3G1L A;  3GN5 A;  3FXJ A;  2L49 A;  3GZD C;  4L5I A;  1W0U A;  4XOT A;  2X85 A;  3HC7 A;  1FJL A;  1LDJ A;  3GZC A;  2IGM A;  3HYI A;  1RZ4 A;  2LKX A;  1IF1 A;  2IVG A;  4BQA A;  5GAD J;  2VQG A;  4I6R A;  1J5Y A;  4GCV A;  2QKL B;  3V8K A;  1FBU A;  3AL0 B;  5IT9 K;  3OV8 A;  2MBF A;  2F2E A;  4LLL A;  4IA8 A;  1QPM A;  2L02 A;  2ESH A;  2FUG 2;  3WE3 A;  5E3M A;  2DPD A;  4LG0 B;  3DEW A;  4FQG A;  4QWQ A;  4BJ5 C;  1QBJ A;  3FKI J;  2LNB A;  3DFG A;  3WTU C;  2BNN A;  2HOA A;  4LIU A;  1XCV A;  2ICT A;  1F43 A;  2L01 A;  4IPA A;  4KIC A;  1RET A;  5J1Y A;  3L7W A;  1R6R A;  3LWF A;  4G12 A;  3A9Y A;  4BEH A;  1E3O C;  2LCV A;  2PFB A;  1VF9 A;  2WIU B;  4DZJ A;  2MW8 A;  3TED A;  2YU3 A;  1TQM A;  3GWZ A;  1NG6 A;  2O5R A;  1QQB A;  3K69 A;  1FP2 A;  4A3I J;  2ELH A;  3ONQ A;  1Q1H A;  3HZI B;  4A0Z A;  3BS3 A;  2WWY A;  1H89 C;  2R4G A;  1IRX A;  2VJI A;  2Z1D A;  2HOE A;  3MEJ A;  2LF8 A;  4DIQ A;  2W25 A;  2DT5 A;  5CYV A;  3C2H A;  3VYU B;  2XB0 X;  3PQK A;  1Z91 A;  4YG2 F;  3A2K A;  1BBY A;  2BY0 A;  4HF0 A;  2HPI A;  1HW1 A;  2GAU A;  1BM9 A;  1R1V A;  2VQC A;  3JSO A;  3PE5 A;  4N9H A;  4HBL A;  1T0F A;  2E1M B;  1JKO C;  4LLN A;  1R58 A;  4RDU A;  1BOB A;  4PGG A;  2N8G A;  3I3L A;  4EKI A;  2KEI A;  1IXC A;  1I27 A;  1HSJ A;  3BR0 A;  1HDD C;  3KP2 A;  4B47 A;  3GLX A;  4ZZD A;  4L0Y B;  5J3L A;  2AXV A;  4UVC A;  3NWS A;  4M3D A;  3KEY A;  3KP6 A;  3A1Y A;  2PUB A;  1PJR A;  1WGX A;  1WHU A;  3BWG A;  3J80 Z;  2DCE A;  4PJJ A;  3A9Z A;  3GO5 A;  5LHI A;  3E5U A;  2JCG A;  1FMW A;  4CYC A;  1KGS A;  3DBL B;  1ZN2 A;  4PSX A;  2A69 F;  5J40 A;  3L1P A;  1VFC A;  2K3F A;  2BHY A;  4XID A;  1OCP A;  5L3B A;  3HOY J;  2O4A A;  3O8G A;  2MA3 A;  3AKZ A;  1G6N A;  1RKW A;  2BY2 A;  2VJ5 A;  2HQR A;  3B6C A;  2MD5 A;  1K4T A;  4PFO A;  5IP7 J;  4ANJ A;  1XN7 A;  2OCC H;  2QQB A;  2CW8 A;  2VL8 A;  3S8P A;  1DW9 A;  1SAU A;  2WV0 A;  3QOX A;  4JX4 A;  1X1D A;  2L8N A;  2PMU A;  2IS2 A;  3ASO H;  2NVU B;  2GXB A;  1A6Q A;  3I54 A;  3IH4 A;  4LIV A;  1N78 A;  3LSJ A;  3DPL C;  3VFZ A;  2LYL A;  2A6H F;  2CS3 A;  1QP4 A;  1BJZ A;  1ZRE A;  1DUL A;  1M1E B;  4RM3 A;  2VE9 A;  3C3W A;  4ENM A;  3TO7 A;  2XGE A;  3M9A A;  2ZCW A;  2JUC A;  1ZZ9 A;  2IA0 A;  4JCX A;  3P9I A;  3BG9 A;  3CP8 A;  1IN5 A;  4CO8 A;  3K70 C;  3RKW A;  2KMU A;  4DNC A;  3H1C A;  3QYB A;  1Y39 A;  4DBR A;  4QPO A;  1DUX C;  1QPI A;  3SQN A;  3R09 A;  3CUQ C;  4WXD A;  4IHT A;  1D0Z A;  4DE8 A;  2LF7 A;  3O9X A;  2BOL A;  5IOY A;  3SYT A;  3G71 I;  1E2X A;  2P5K A;  4BHP A;  1VQM I;  2JA2 A;  5JFR A;  1BJA A;  4NQW A;  4ON0 A;  4G7Z F;  3FM5 A;  2CGP A;  2F4O B;  4RS8 A;  1WH8 A;  3FXQ A;  2V9P A;  2Y2Z A;  1EA3 A;  2E5N A;  4FE4 A;  1YS7 A;  2IU7 A;  3FZV A;  4MIM A;  3LA2 A;  1T56 A;  1ORK A;  1X4O A;  4KIF A;  3GTQ J;  2VQH A;  3S14 J;  5FKN A;  3UWP A;  4Z59 A;  2IAI A;  3TEP A;  2JRT A;  2ZXI A;  2KIM A;  4Y17 A;  5K5Q A;  1PDN C;  3SZP A;  2P5V A;  2R7V A;  3WHB A;  3HPH A;  3F6V A;  3F8C A;  1OCT C;  1B72 A;  1EH8 A;  3IH3 A;  1SMT A;  1TWF J;  3DKX A;  1ETQ A;  4NBQ A;  2V1U A;  3DPU A;  1IN8 A;  4II3 A;  2BY3 A;  2V6C A;  2XF6 A;  5GTH C;  3IC7 A;  2EQR A;  1D5Y A;  2XXP A;  2KEJ A;  4MCT A;  3OYG A;  3FXR A;  3S2H J;  5LHG A;  2QQ9 A;  2CQN A;  2GOM A;  3WU1 B;  1RC9 A;  3SCG A;  4RGS A;  4KMU X;  2L9S A;  5DD8 A;  1BR4 A;  4CA0 A;  2ZXH A;  1WSU A;  3CC4 I;  4G6Q A;  3A4C A;  2GOX B;  3QOW A;  1MNM C;  2XB5 A;  1MBK A;  2L4A A;  2MFZ A;  3EUH A;  3LSP A;  4BNC A;  2K9N A;  3FXO A;  1YO5 C;  1Z77 A;  2ODR D;  2YS9 A;  1P4A A;  3HG9 A;  2R7S A;  2RN7 A;  2H1K A;  1OMI A;  4XLP F;  4HNT A;  2VEO A;  4I7H A;  3M1C A;  1ZTR A;  2R7Q A;  4FET A;  2L7M P;  2PXL A;  2E7W A;  1PRU A;  1K78 B;  4XRM A;  4HLY A;  4LB6 B;  1RZR D;  3RZO J;  1S7E A;  2K27 A;  3DTK A;  2I10 A;  3TQN A;  2G7U A;  2OAZ A;  2BXZ A;  2VXZ A;  2ZSI B;  4NC8 A;  3ZQI A;  4KUM A;  2JWT A;  4FAS D;  2K3P A;  2KDO A;  3OYI A;  4GFB A;  1AOY A;  4OB4 A;  1W5T A;  2CV0 A;  3TRB A;  2WY8 Q;  4HDV A;  5EGO B;  1ITY A;  1BA5 A;  4UUS A;  1TW3 A;  2VBY A;  1B0N A;  4P96 A;  4IVN A;  5GTI C;  2GA2 A;  2VKE A;  3LST A;  3TW6 A;  1HOM A;  5A2Q Z;  3D5R C;  3TW7 A;  2LLV A;  4U88 A;  5DDG A;  1MJ9 A;  2FX0 A;  3RDI A;  2LKS A;  2R1J L;  1MMS A;  3DEU A;  3TEL A;  3WOD F;  4U0Y A;  5E17 F;  1T8I A;  1GLN A;  4YIF A;  2EV5 A;  3DP7 A;  4Y4R A;  5F1J A;  1K61 A;  1LFU P;  4ZDL A;  1RIO H;  3CDH A;  3K4N A;  2IVQ A;  2W24 A;  4X4I A;  2AW6 A;  4PU7 A;  3CC2 I;  1HW5 A;  4Y33 A;  2DLL A;  5EDN A;  3GTL J;  3HZJ A;  4EM1 A;  3LSM A;  2L1P A;  3M8E A;  1N25 A;  4BHC A;  3WU2 C;  1A36 A;  3BDD A;  4OMZ A;  2ISZ A;  2W48 A;  2EIK H;  2XSJ C;  3JW4 A;  1JUS A;  2CV1 A;  3HEF A;  2OTL I;  3IV5 A;  5ICG A;  3QRF F;  1T2K A;  1U5T C;  2DT6 A;  2FQ4 A;  2GIV A;  3F72 A;  3PNY A;  1HBX G;  2HFZ A;  1GV5 A;  2V1N A;  1VQ4 I;  2XRN A;  1Z1D A;  1IRG A;  2J7U A;  5KCM A;  3OQO A;  4IX7 A;  4Z6Y A;  2JVG A;  1Z0X A;  3MQ0 A;  4A5M A;  3Q3S A;  3MKY B;  4A6E A;  4B4C A;  5C3E J;  4V2G A;  4FIS A;  1SFX A;  2HKO A;  3U1D A;  3ZHI A;  1VTN C;  2DI3 A;  1ON2 A;  3OIO A;  4E7L A;  2R7D A;  2RGV A;  2OCE A;  5D5X B;  3H3Z A;  5GPC A;  5DTD A;  1ZAO A;  3OYD A;  3CO7 C;  1JKR C;  3IVP A;  2EIN H;  2YR2 A;  3FX3 A;  3H5A A;  5CVV A;  5FKL A;  1DWK A;  1QP7 A;  4XL9 A;  4PGH A;  5TRD A;  1FIA A;  1ZEL A;  2EV6 A;  5J6X A;  1I1G A;  4E4H A;  4B48 A;  5J8F A;  2D45 A;  3ULQ B;  3ECO A;  4E7I A;  1QVT A;  1IXS B;  5HDG A;  2JSP A;  1XTA A;  3S8Q A;  1Y8Q B;  4CIC A;  5C4J J;  4V2F A;  1LE8 A;  2IEK A;  1DU6 A;  3GN5 B;  2ISY A;  3C18 A;  1ENH A;  4XLN F;  3OOU A;  2R5Z B;  4BE2 A;  3FHZ A;  4RGU A;  5A7L A;  3R60 A;  3ZR8 X;  3RZZ A;  4EJV A;  4G7O F;  3TKY A;  1MMG A;  2CMP A;  4XKC A;  3WE2 A;  3V7R A;  4X0G A;  1FLI A;  2UXN A;  4AVP A;  5D5U B;  3JSP A;  4E7J A;  2K4J A;  3RQI A;  1Z67 A;  2PXF A;  5KVR A;  1SEU A;  1HXD A;  4UNO A;  1KQ0 A;  1UEL B;  2XGD A;  3KE2 A;  3PNV A;  2M45 A;  4RB0 A;  5FKM A;  1FP1 D;  4CCL A;  1IAW A;  1R5I D;  1XMK A;  2EFN A;  4C30 A;  3TOB A;  3WTW C;  4M6X A;  3N05 A;  5LHH A;  3LFU A;  4XKV A;  2XVC A;  3D1N I;  2IS1 A;  3OWQ A;  5CVJ A;  4BBS J;  2PI0 A;  3RPQ A;  3GTG J;  1LFP A;  4C3J J;  4XLC A;  2KIQ A;  3ASN H;  4MTD A;  3IUO A;  4CCO A;  2JA8 J;  1FZP B;  2B5A A;  3LL7 A;  3VSK A;  2QQ8 A;  4AIJ A;  4XM3 A;  3HUG A;  1NG7 A;  2KKO A;  3DXJ F;  2HCN A;  3I5U A;  1HQC A;  2ELJ A;  4X4C A;  5EEA A;  4LD5 A;  4TV7 A;  3L2V A;  1KON A;  1D1B A;  2I5U A;  5FRO A;  3IKV A;  5HDN A;  2PXV A;  1IZ1 A;  3OYH A;  1DP7 P;  3GFM A;  2KZV A;  2W85 A;  5HDK A;  1S72 I;  2AQF A;  4PDK A;  3PFI A;  1G3Y A;  1TNS A;  2VUM J;  1RZR A;  3CLC A;  1U0J A;  2X4H A;  5M5W J;  4UUT A;  1DGW Y;  2AWI A;  1YIO A;  1OFC X;  1LMB 3;  4F7Z A;  2FU4 A;  1SVM A;  2XPW A;  1U2Z A;  3L09 A;  1LQ1 A;  4EZI A;  3U2R A;  1D3Y A;  3EQL F;  2LTP A;  2O8X A;  1HW2 A;  4A0Y A;  3S1M J;  5LLQ A;  3U21 A;  3ABK H;  4CZZ A;  1YE9 A;  4JOM A;  3K4L A;  3DNV B;  4YEL A;  4BGD A;  1RRJ A;  2KRH A;  2QYO A;  4F93 B;  1JTX A;  3K1N A;  1LCC A;  1HF0 A;  3BJA A;  3GF2 A;  3ABT A;  3KYL A;  2R93 J;  1B9M A;  4O8B A;  3KYC B;  2WV1 A;  1VQ5 I;  4DQ2 A;  1UHW A;  2CUF A;  2KHM A;  1WH7 A;  4LK1 F;  1B1B A;  1V5F A;  3KEQ A;  2QZ8 A;  1JFT A;  2VC1 A;  1WWX A;  2NYX A;  2HCS A;  4IRI A;  1L0O C;  2LD5 A;  4IHW A;  2KL4 A;  2WB1 A;  3F6O A;  3M8J A;  5JHF A;  5LFA A;  3CCQ I;  2HS5 A;  3KP5 A;  4DZP A;  3MKL A;  2GZU A;  1ZLJ A;  2M9H A;  4I01 A;  4B3A A;  2DMP A;  2V3C C;  2QVO A;  3FM3 A;  1Y6I A;  3WGG A;  1LPQ A;  1H9G A;  3RQ4 A;  1MBH A;  1B6A A;  4LOC A;  1PRV A;  3GW2 A;  3C1D A;  1BI1 A;  4CCK A;  3MKW B;  1UMQ A;  4IWR A;  4L9V A;  4MLO A;  1DU0 A;  1AHD P;  2FJR A;  3GZ5 A;  2HVR A;  1FT9 A;  4D7M A;  1Y56 A;  1LB2 A;  2LR8 A;  3DEE A;  3ZQG A;  3QP6 A;  3JRF A;  2HFH A;  1Z9C A;  1X1B A;  3AFH A;  3H36 A;  2FEZ A;  3BCB A;  3E5X A;  2A68 F;  2HVS A;  2HPM A;  2A05 A;  2MXD A;  3HB9 A;  2R3S A;  3BOQ A;  3Q0U A;  5FJ8 J;  3RYP A;  4OAZ A;  4BH9 A;  2MG4 A;  1FOY A;  2P81 A;  2CFO A;  4EK9 A;  4F92 B;  4EMS A;  1ETY A;  4ENJ A;  3F22 A;  4A3J J;  1JKP C;  4L9N A;  4E6K G;  1STZ A;  3HOV J;  1KQ8 A;  3KX2 A;  2LBF B;  1I39 A;  2X51 A;  3I9V 2;  1IUY A;  3EYY A;  4BKX A;  4IHX A;  2KRC A;  1K4S A;  2GRM A;  2DA4 A;  5CQG A;  4QTR A;  3ELK A;  4NQW B;  1FMV A;  3J7A O;  2K85 A;  3AL0 C;  1X57 A;  5DCM B;  3K4K A;  1R69 A;  1EH6 A;  1QP0 A;  1RPE L;  2FQ3 A;  3H5T A;  3KP4 A;  3BTI A;  1T08 B;  3LA3 A;  2Z33 A;  1TW2 A;  1WI9 A;  3K4B A;  1SD6 A;  2ACJ A;  3W3C A;  3E6C C;  3TMO A;  1S9H A;  4GGG A;  1O3S A;  5ICC A;  2JMW A;  1B72 B;  3V8J A;  3JRC A;  4P55 A;  2HTJ A;  1TZL A;  2FJ1 A;  1T95 A;  3H92 A;  4KIS A;  4LMY A;  2ZKZ A;  2PUC A;  2X1C A;  1R1T A;  4BHB A;  2MGQ A;  2BXY A;  2GWR A;  2ZJ2 A;  4OOI A;  5LD2 C;  2V6E A;  3MZY A;  4I09 A;  1R9T J;  1YS6 A;  1SMY F;  5F6F A;  2H1L A;  4U87 A;  4U0W A;  3FMQ A;  4QLC U;  4PU8 A;  4MTE A;  5BQT A;  2IVB A;  3QP5 A;  1JT6 A;  3DLL F;  2DQR A;  3I0T A;  2FOK A;  2QF7 A;  1VQP I;  1SVL A;  1QQI A;  4WX9 A;  3CP2 A;  4AID A;  3FMY A;  1ZGJ A;  2E1M C;  1YSE A;  3LIS A;  5B66 C;  1FC3 A;  3NRV A;  2GQQ A;  2VOP A;  2LYQ A;  2VXD A;  1KU3 A;  5DSX A;  2TRT A;  2OBP A;  2BYV E;  2ZME C;  4BY1 J;  1ZQ3 P;  1MKM A;  2A6E F;  4S05 A;  3HTS B;  2EH3 A;  4HG2 A;  2F5F A;  4UUV A;  1OCO H;  3NWT A;  4ITV A;  1VQO I;  1D5V A;  4PFP A;  1Z7L A;  1VQ9 I;  4IEJ A;  2DFF A;  5HLH A;  5D6E A;  1ADR A;  1LQC A;  1XSV A;  2G7H A;  1EH7 A;  1U9O A;  2KLO A;  4L9J A;  2OZU A;  1IN7 A;  2JSC A;  3SJM A;  2OQG A;  2B0L A;  1L3L A;  3GYH X;  3WTS C;  2L0K A;  1RNL A;  2HI3 A;  2OA4 A;  3BR1 A;  4W1U A;  3HOW J;  4BAC A;  2ICP A;  2EFW A;  3DKY A;  1F36 A;  2PUF A;  2B63 J;  3J7Z I;  3OL3 A;  1WJA A;  3ZGK A;  4A3L J;  3K1M A;  4J1W A;  4M72 A;  1TWA J;  2E60 A;  2QSG X;  4L9T A;  2R5Z A;  2WY7 Q;  2V9V A;  4R8H A;  1BI2 A;  1Z6T A;  1NW3 A;  2VOD A;  1TT0 A;  4XON A;  4Y52 J;  4BDY A;  3CLQ A;  3LFK A;  1YRN A;  4Y15 A;  4J19 A;  2R7O A;  1ZVV A;  2M0C A;  3H5R A;  3PNT A;  1V3F A;  2PJR A;  3G2B A;  3OQN A;  3GXO A;  1WJ5 A;  2Y0S N;  2QEN A;  3M1E A;  2VJJ A;  4IZZ A;  4W97 A;  2DT7 B;  5EEG A;  2K40 A;  1UXD A;  2XCJ A;  1WJB A;  1YYV A;  3LSI A;  3H3V K;  2K02 A;  1KU7 A;  5BPD A;  2PXP A;  4BXX J;  3IP4 B;  2MEZ A;  2E1O A;  2V79 A;  3PL8 A;  3S1R J;  4A3D J;  5A2Q K;  3F23 A;  4EAT A;  3MWM A;  1Y9Q A;  1JHH A;  1ZG5 A;  2HQ5 A;  4AYB N;  3CCY A;  1RES A;  1PUE E;  2JPB A;  1DDN A;  3NRO A;  3QF3 A;  1R00 A;  4MQ9 F;  3O6B B;  4KFC A;  2KQR A;  2AXU A;  4I0A A;  1UCR A;  2CQQ A;  1KA8 A;  2DW4 A;  2PXU A;  1LE8 B;  2DOE A;  1MJA A;  2HZD A;  1YW8 A;  2BHZ A;  5BS6 A;  3A01 A;  4XLA A;  5IY5 H;  2A6T A;  2DOA A;  2KJC A;  4JYK A;  2PXE A;  2V1X A;  3K2A A;  3ROU A;  4HF1 A;  2DMN A;  3COA C;  1NH3 A;  3KZZ A;  4KT5 C;  1MZB A;  4PK4 A;  5H2F C;  2CW0 F;  2F5E A;  3BZK A;  4HLX A;  3S93 A;  3DQV C;  3OYE A;  4EEF G;  1MBG A;  2A3S A;  2OUM A;  4EGY A;  1WJE A;  4M74 A;  4YII A;  1TQI A;  1WJC A;  3BQY A;  3DCF A;  2XAF A;  3ESW B;  4OIN F;  3OS2 A;  3L2U A;  1W36 D;  4AM3 A;  5IYC J;  2LYJ A;  2W7N A;  2J7W A;  2FRH A;  1ZZC A;  3I59 A;  1OIS A;  5CJ9 A;  3ZHM A;  5M3M J;  5IYB J;  4BAY A;  2RKH A;  1ZR2 A;  5HVQ C;  4E7H A;  2V7F A;  4CHU A;  1R4N B;  1XS9 A;  3BC8 A;  1QZX A;  2RQP A;  4EGZ A;  2HDC A;  5LRR A;  4DJA A;  1V5G A;  1T38 A;  3F3X A;  4NUB A;  2DK5 A;  1MSE C;  3IAS 2;  1MFQ C;  1MD0 A;  2X6W A;  2ZNY A;  4EVI A;  4Y7N J;  2H8R A;  4IVZ A;  1X58 A;  1ETK A;  2CFX A;  2LK2 A;  1J7K A;  3B73 A;  1XC5 A;  4F52 A;  1WH6 A;  2O49 A;  5CVU A;  1H0M A;  3QAH A;  4A69 C;  4ER6 A;  3HUG B;  1FYL A;  4DYC A;  5FD5 A;  4C3I J;  1YIT I;  1HKT A;  4MEX F;  4S04 A;  4PUS A;  2JZY A;  2GRL A;  3CEC A;  4IRG A;  2MC4 A;  1XSX A;  4Y42 A;  3NXH A;  1TP4 A;  2CRG A;  1UHS A;  3HKZ A;  5B1B H;  3B7H A;  2LKP A;  4OIO F;  4BE1 A;  4DBQ A;  2KFD A;  1YG2 A;  3RCO A;  4GDF A;  2LNM A;  5L3C A;  4LFU A;  2ZO4 A;  3LA7 A;  2FNA A;  3FDY A;  4HDU A;  3GBF A;  4RGR A;  5EF6 A;  3QWG A;  3SDG A;  1GV2 A;  3IAM 2;  3CCR I;  3HHH A;  3Q9S A;  2LY2 A;  3D0S A;  1P92 A;  5KAI C;  4ZZL A;  3ABL H;  1YFH A;  2PLY A;  1MGT A;  2VBZ A;  3SFZ A;  2EFP A;  3KPH A;  4FTH A;  1WRJ A;  2WUS R;  3BRO A;  2L9N A;  2RQQ A;  2UUZ A;  5L3E A;  5F64 A;  1XD7 A;  2RDP A;  3DPT A;  3A9X A;  1G59 A;  4I98 B;  2LBF A;  4F3Q A;  3CES A;  1RI7 A;  3HOS A;  2HU9 A;  4Q5S F;  1H8A C;  4G6D A;  3OYN A;  4H0E A;  2ME0 A;  1IJW C;  2D2W A;  3CF2 A;  2A61 A;  1ETO A;  2P0W A;  1MDM B;  2MD0 A;  1Y8R B;  2ICW G;  3RZD J;  2DXI A;  3G3Z A;  2VPL A;  1AA7 A;  3PIP F;  5E3L A;  3M4O J;  2BNM A;  3OIQ A;  3ZP5 A;  4IQ4 A;  5DCM A;  3GTM J;  3E3V A;  1LDD A;  2JQ7 A;  3MMY B;  3JXB C;  3OWT A;  2JUG A;  5E8I A;  3G0T A;  2Q8K A;  2PMZ A;  3LAJ A;  1ERD A;  4XQF A;  2XKP A;  1OYW A;  2EB7 A;  4OWR B;  1ZAY A;  4KJZ A;  2Y9Y A;  3NAU A;  1XGN A;  4C2U A;  5K7H A;  2DA5 A;  2PBI A;  3NZL A;  1PER L;  2WAQ N;  3ZRG A;  3S2D J;  4WVL A;  4XLF A;  1J75 A;  4XKW A;  3RTR A;  4ENN A;  1I1S A;  3BLY A;  2KIS A;  3KCC A;  4G9Y A;  3I64 A;  5GAE J;  1Z6R A;  1SAN A;  1T6S A;  5BNG A;  2M4H A;  3TDZ C;  3OS0 A;  1IRZ A;  2BNO A;  1Y0N A;  3ABM H;  4WCG A;  4ZDO A;  1AKH A;  3EYI A;  4GQM A;  1BIA A;  2AQE A;  2QCO A;  1SQ8 A;  3OYJ A;  3E7L A;  3ABU A;  5DM6 F;  5AIQ A;  2YU9 J;  3CMA I;  3BG7 A;  2Z3Y A;  3PSF A;  3GTP J;  4IOC F;  2EJR A;  5DRT A;  3DU6 A;  2VON A;  4RAF A;  3S32 A;  5B1A H;  5EG0 A;  2MLG A;  4N4N B;  2H6B A;  3QYF A;  5F04 A;  5K1Y A;  4PZJ A;  1YW7 A;  3HOX J;  2FML A;  1FBQ A;  2X48 A;  3E97 A;  1OCC H;  4BU2 A;  2IA1 A;  2H09 A;  4A3C J;  3LFP A;  2KRF A;  1MIJ A;  2F5C A;  2E71 A;  4O6J A;  4OIR F;  1JWL A;  3GZN B;  1W0T A;  2XXQ A;  1HQ1 A;  1HKS A;  2MSY A;  4YG1 A;  1JGG A;  1KU2 A;  2M3A A;  3LNQ A;  2RRE A;  3HPG A;  4D5F A;  2F4M B;  1J09 A;  3BCA A;  4JQD A;  3VOD A;  1R22 A;  3ZQF A;  2H6C A;  5M5Y J;  3FIS A;  1PNR A;  2G0E A;  5EEH A;  1FEX A;  2KJB A;  1QA6 A;  4PCQ A;  3LAP A;  2R0Q C;  2IA2 A;  4A3E J;  2W4S A;  4G8X A;  5AIP A;  4JQF A;  3I58 A;  4ER7 A;  4MFD A;  1IC8 A;  4LGW A;  3DWL E;  4A2U A;  2NVX J;  3LSH A;  5GP9 A;  3WTT C;  3CCJ I;  3SXY A;  2KP6 A;  2ZBK A;  2WTE A;  4MNU A;  3LQR A;  1XWR A;  3LSK A;  4PSW A;  3JTH A;  2IGO A;  3RYR A;  1GVD A;  2XXA A;  4ABZ A;  3PQJ A;  2VKH A;  4MQV A;  4XRS G;  4N9I A;  4HX8 A;  5IOZ A;  1DPU A;  2EWT A;  1ETW A;  4XR6 A;  3BR5 A;  2LRE A;  2XF7 A;  3TO6 A;  5ILU A;  2ID6 A;  4A3M J;  4CZC A;  1BDH A;  1X2L A;  2A5Y B;  4MFE A;  5LGN A;  4KDP A;  1UB9 A;  3JRA A;  5E3N A;  2GBY A;  3BD1 A;  2NVT J;  1Y0U A;  2CH0 A;  1TWC J;  3Q0V A;  4IHY A;  1XMA A;  3FIW A;  2V26 A;  1QRY A;  2IGK A;  4M9Z A;  2XJ3 A;  1OYY A;  4GRI A;  4ZDP A;  4LG3 A;  2MYS A;  1T0F C;  2CJJ A;  3CDL A;  4PJM A;  1IW7 F;  1PYV A;  2IUO A;  3SCH A;  3HOT A;  2PMH A;  4RAY A;  4XSZ F;  5E79 C;  2JK3 A;  2C6Y A;  1POG A;  3CUQ B;  3KZI C;  1VQ8 I;  4BY7 J;  5KHD A;  2DMU A;  2TDX A;  1LVK A;  3PO2 J;  2ADU A;  1OCZ H;  2EBY A;  1UAA A;  3KL4 A;  2CU7 A;  2K86 A;  1QGP A;  4D7N A;  4YEJ A;  2DQL A;  2EIM H;  2W57 A;  1U78 A;  2M4G A;  5ILV A;  1FX7 A;  2BVM A;  2IXS A;  3HTU A;  4X1E A;  2DA1 A;  4KIT B;  3CDI A;  2MH2 A;  3R0J A;  2CSF A;  1U8B A;  2YSR A;  3JRD A;  3RJP A;  4IL6 C;  1TBX A;  2XSD C;  2R92 J;  3ECH A;  1X2N A;  4I76 A;  1ODD A;  1Z05 A;  1L1M A;  1LLI A;  2AXL A;  4IHS A;  4A3K J;  2LOO A;  1NER A;  1P2F A;  4JX5 A;  3OYC A;  1A5J A;  1MBJ A;  3TGN A;  3CF5 F;  4HA8 A;  3C2G A;  1KU9 A;  4ZYA A;  4BE0 A;  1HST A;  6PAX A;  3SFI A;  2E7X A;  2BW3 B;  3KP3 A;  1KYW A;  3QFI A;  2M30 A;  3T1B A;  3CJN A;  3S16 J;  4GO1 A;  3HSR A;  3M07 A;  3T8T A;  5J1U A;  2Q2E A;  4RB1 A;  1Z3Y A;  2K9S A;  5HLG A;  2KPM A;  1O3T A;  2NS7 A;  4UHT A;  1USS A;  3PUB A;  1I5Z A;  2JA5 J;  1YRN B;  1JUM A;  1C0W A;  3OSG A;  5FLX K;  1AU7 A;  2PJR B;  3HOU J;  1O3Q A;  2IS6 A;  2M0M A;  2IW5 A;  4CSW A;  4HEA 2;  1XGO A;  3CLO A;  4Z58 A;  3LQX A;  2HYG D;  3PIO F;  1D0X A;  1GXP A;  4BYY A;  2JRM A;  1ON1 A;  4Q4Z F;  2L54 A;  5H6Q A;  3FYA A;  5TJJ A;  3ZPX A;  2CW7 A;  1MMN A;  2JPC A;  3PUF A;  3TBI A;  1SD5 A;  1UJ8 A;  2DA3 A;  4KN4 X;  2FD5 A;  3ZMS A;  3BR2 A;  4X4B A;  4WK8 F;  1YLF A;  3BTC A;  1RR8 C;  1I6X A;  4I0B A;  4BQQ A;  1TWH J;  2XHK A;  1QVU A;  5EYR A;  3WTY C;  1WFX A;  1A6I A;  4RGX A;  3HRS A;  3W6J B;  4IOA F;  5DRY A;  4WXH A;  3GEZ A;  1X4P A;  5F0H A;  1ZPQ A;  3NQO A;  2AUW A;  1UST A;  2QUF A;  4ER5 A;  4D5C A;  1ZGW A;  1YOV B;  2VOO A;  5JVG F;  2OR1 L;  1B59 A;  2O9L A;  2YUS A;  2E5Z A;  1YTY A;  2QKM B;  2OQR A;  1W4M A;  1ZK8 A;  3A01 B;  2ZJQ F;  3QOE A;  3R0A A;  3R6S A;  4L0Z B;  1O7F A;  3KYD B;  3IKT A;  4RBO A;  5DD4 A;  1R5G A;  2DYS H;  3CCS I;  1RZS A;  4DYR A;  4C3H J;  1R7J A;  1H9T A;  3FKJ A;  5D5V B;  3W2A A;  3G5G A;  1OR7 A;  3NDB B;  5JR3 A;  3ZKC A;  3OMT A;  4B3X A;  5FO5 A;  4HNV A;  1ZHF A;  3AG4 H;  1D8J A;  5D6F A;  1R5H A;  3A0B C;  1K79 A;  3S3O A;  2LH9 A;  3W2V A;  3GZD A;  5DT2 A;  2EFQ A;  4J1X A;  2LRD A;  1NK3 P;  4A3G J;  5IPA A;  4BBR J;  4RM2 A;  2BY1 A;  3WG7 H;  3I59 B;  1CJG A;  1S8N A;  2IGN A;  2DA7 A;  4P1W A;  5JVT A;  3HXL A;  3VWS A;  3OYK A;  2EPF A;  3EUH C;  3GFL A;  3H5N A;  2XC7 A;  4KIG A;  1WJF A;  1ZS4 A;  1YJN I;  5FD6 A;  1TNT A;  2Q0O A;  3BG3 A;  1MDM A;  3OR1 C;  1HDP A;  3BTJ A;  1S29 A;  2EWN A;  3JRG A;  4AIH A;  1CF7 B;  4C9Y A;  2DMT A;  1ZRC A;  1XB4 A;  1JGS A;  1FOK A;  1F1Z A;  3I4N J;  2KEK A;  5EJC A;  1XX5 A;  1Z3X A;  2X0L A;  3RI4 A;  1JUP A;  3HSE A;  2P7C B;  4HOB A;  2Z99 A;  1BW6 A;  4HX4 A;  1D1C A;  4ZC3 A;  1YJW I;  5FGM A;  2K4B A;  4M71 A;  2ETH A;  2A6C A;  4I2O A;  1A31 A;  2O7O A;  3QOD A;  4A0X A;  1VI0 A;  1WKM A;  2XIU A;  4XN3 A;  2I8D A;  2ZXW H;  2L4M A;  4XNF A;  1P6R A;  2W1O A;  4DE9 A;  1FWZ A;  3L2R A;  2DOF A;  4EKG A;  4PU3 C;  2R7W A;  3J7Y J;  1SFO J;  1FY7 A;  4Q2J A;  2Y0S A;  3WTX C;  3KLN A;  4AWX B;  3R1F A;  3SDB A;  3BT9 A;  3B02 A;  2LVS A;  1W36 C;  4O3M A;  1XPX A;  2RNJ A;  4F91 B;  3CCU I;  3DBR B;  2HVQ A;  3OR2 C;  1IN4 A;  2PXD A;  2H27 A;  3SEQ A;  2NNN A;  3KEO A;  3P7N A;  3CD6 I;  2NVQ J;  2XAG A;  3EUS A;  3JCU C;  3K10 A;  3AG1 H;  4CCN A;  2E35 A;  5KNL A;  2CWE A;  3DM5 A;  1MJB A;  4AYB A;  1FIP A;  3E0J B;  2FFH A;  5ICF A;  4F8D A;  4D1Q A;  3I71 A;  1P7I A;  5DTM A;  3CUO A;  2XAS A;  3J80 K;  2F4I A;  2Y30 A;  3FMS A;  3FBN B;  4UV8 A;  3GCM A;  4HF2 A;  2MLK A;  1WET A;  5K7F A;  4RAG A;  3P9C A;  3OS1 A;  4KA4 A;  1FSE A;  4KNY A;  1V54 H;  2M1B A;  2E36 A;  3I53 A;  4RB3 C;  4M6Y A;  2H94 A;  1R71 A;  2ELK A;  4PJN A;  5ICE A;  2M4K A;  3V7S A;  2NAZ A;  2HTS A;  1WJD A;  2AXT C;  2QBY A;  2W82 A;  1K7A A;  4XK4 A;  2W00 A;  2E2I J;  1POU A;  1DP3 A;  1ZG3 A;  2AHQ A;  4M6V A;  1BIB A;  3BG6 A;  1CQT A;  1PUF A;  1VQ7 I;  1MMD A;  1W7P D;  1ZR4 A;  5DCF A;  4UVA A;  1FNN A;  3SHF A;  3CCM I;  3K7A J;  3TL4 X;  3MFK A;  1MW7 A;  3G7D A;  3K9T A;  3CJT B;  4XMY A;  4ZH4 F;  1HC8 A;  1Y7Y A;  3N4M A;  4HYE A;  1OLT A;  2P6T A;  4II2 A;  5E20 A;  2QLZ A;  5J47 A;  1GXQ A;  1JJ6 C;  2W84 A;  1AKH B;  1ZRF A;  3ZMT A;  1BI3 A;  5FRN A;  4XN0 A;  1FOX A;  2PXK A;  3RKX A;  1OJL A;  2M7A A;  1GDT A;  2FF4 A;  4X4E A;  4PJL A;  3PXP A;  1BI0 A;  3FK6 A;  1OPC A;  2RAE A;  2GLO A;  2LFB A;  1K6O A;  5EG0 B;  3WHC A;  2DBB A;  4HNU A;  2RV8 A;  4HST A;  3W2W A;  4MO7 A;  1BC8 C;  1ZZ8 A;  2OZ6 A;  2PUD A;  3ZN1 A;  2FOW A;  2QA4 I;  4HZF A;  2LSO A;  1S5L C;  5HLI A;  2MAB A;  3ZMZ A;  4UXN A;  2IS4 A;  1YX5 A;  3HRM A;  4XRF A;  3CUQ A;  4ESF A;  3E1S A;  1SFK A;  1ZUG A;  3BR3 A;  3TDU C;  5C4X J;  3BR6 A;  1K83 J;  5CLS A;  2Y9Z A;  3J81 Z;  1X19 A;  1N77 A;  4Y3O A;  5B5E C;  1I6H J;  3IWZ A;  1QNT A;  1UXC A;  2IPQ X;  2YPR A;  3TOA A;  2JJ7 A;  2LMD A;  3O8H A;  2ZSH B;  2DFH A;  3OYL A;  1VQN I;  2EFO A;  4B1R A;  3SCF A;  1ZRD A;  2PEX A;  2EBI A;  1X3Z B;  1G8X A;  4BXF A;  4OMY A;  1U9N A;  2OU2 A;  4EM2 A;  3KZY A;  1SD7 A;  3KLO A;  1X1P A;  2HKX A;  4PJ0 C;  1RR7 A;  3VOE A;  1P4X A;  3OYF A;  5K5O A;  3M9L A;  5FKK A;  4XIC A;  2FMY A;  1ZKG A;  3ZXS A;  2JA6 J;  3RPU A;  2HOT A;  2HNH A;  2R7Z J;  2XIG A;  3QOP A;  3RKQ A;  1G2H A;  2OJE D;  1JE8 A;  3WG9 A;  2BW3 A;  1X2M A;  2BV6 A;  3TP3 A;  1XGM A;  2HYF A;  2HIN A;  5F08 A;  1IO2 A;  3MZ8 A;  4BS9 A;  1JXS A;  2PXT A;  3T0Y A;  3MZH A;  3HIF A;  2O61 A;  2VBW A;  4XRS A;  1DGR M; 
#chains in the Genus database with same CATH homology
 2ME0 A;  1IJW C;  3ZHI A;  1ETO A;  3OIO A;  2WB1 N;  3RZD J;  5E3L A;  5GPC A;  3M4O J;  5DTD A;  1JKR C;  2X9D A;  3IVP A;  2BNM A;  3ZQC A;  3VPR A;  2PUA A;  2L7Z A;  5FKL A;  1DWK A;  1QP7 A;  2PPX A;  2KT0 A;  3GTM J;  3MVP A;  5IP9 J;  1RPW A;  1BW5 A;  3JXB C;  1FIA A;  5M3F J;  3LSG A;  4JP0 A;  2TCT A;  3HBL A;  1TC3 C;  1OSL A;  1I50 J;  1ZAY A;  1QVT A;  2Y9Y A;  1ETV A;  1WIZ A;  3NAU A;  4PU4 C;  3S8Q A;  5K7H A;  5C4J J;  2DA5 A;  2LY9 A;  4V2F A;  1LE8 A;  1PER L;  2EF8 A;  2WAQ N;  3S2D J;  2IEK A;  1DU6 A;  2HDD A;  2DN0 A;  3GN5 B;  5F27 A;  2DTZ A;  3CMY A;  1ENH A;  3OOU A;  2R5Z B;  1SAN A;  5BNG A;  1IRZ A;  2BNO A;  5A7L A;  1NTC A;  2LP0 A;  1PRA A;  3OP9 A;  1VND A;  3RZZ A;  1HCR A;  1AKH A;  4GQM A;  3Q0W A;  2QCO A;  4FE7 A;  1JT0 A;  1SQ8 A;  5FLM J;  3E7L A;  3HM5 A;  2YU9 J;  3UFD A;  2ECB A;  2PIJ A;  1IDZ A;  2NS8 A;  3RQI A;  3GTP J;  4X6A J;  2IBD A;  3LSR A;  1IG7 A;  2XGD A;  5FKM A;  2XPU A;  2M8G X;  4NDL A;  5EG0 A;  5F04 A;  3HOX J;  3QQA A;  4A3C J;  2X48 A;  3LFP A;  1MBF A;  5EGO A;  3D1N I;  1JWL A;  4BBS J;  4FN3 A;  3HDD A;  1W0T A;  3GTG J;  1QPZ A;  2MSY A;  4YG1 A;  1JGG A;  2K9Q A;  3LNQ A;  2GM4 A;  4C3J J;  4M3E A;  4D5F A;  4S0H B;  4JQD A;  3ZQF A;  3NAR A;  5M5Y J;  5M5X J;  3FIS A;  2JA8 J;  2G0E A;  1PNR A;  1FEX A;  2B5A A;  2CQX A;  1XG1 A;  1JFS A;  2M2E A;  2R0Q C;  3VK0 A;  4A3E J;  4YG4 A;  2CRO A;  4M3G A;  2R5Y B;  2MQK A;  5HOD A;  5K98 B;  4X4C A;  3BTL A;  5EEA A;  4MFD A;  2PUE A;  1IC8 A;  4JX6 A;  2EZI A;  2XRL A;  2XI8 A;  2ZB9 A;  2NVX J;  3F0C A;  5GP9 A;  3F52 A;  2VUM J;  1RZR A;  4FCY A;  1XWR A;  1BDI A;  5M5W J;  3CLC A;  4UUT A;  2AWI A;  1OFC X;  1LMB 3;  1JH9 A;  1WH5 A;  1GVD A;  3A03 A;  5GPA A;  2XPW A;  1BL0 A;  4ABZ A;  3UKG A;  3M3Y J;  3HGG A;  2LYS A;  5K7Z A;  3FYM A;  4XRS G;  2LTP A;  1Q1V A;  5EZG A;  3G1O A;  3S1M J;  1LFB A;  5IOZ A;  2EWT A;  1MSF C;  1ETW A;  1IGN A;  3BR5 A;  1EF4 A;  2LYK A;  4Z5H A;  2VPR A;  3DNV B;  2ID6 A;  1LCD A;  4A3M J;  1BDH A;  1X2L A;  2LYR A;  2JN6 A;  4MFE A;  4DYQ A;  1JTX A;  1B8I B;  2HSG A;  3CRO L;  1LCC A;  1HF0 A;  4X4H A;  3JRA A;  3S1Q J;  1JJ8 C;  5E3N A;  2GBY A;  3ZQL A;  1IDY A;  2R93 J;  3BD1 A;  4O8B A;  3GTJ J;  2NVT J;  3W6V A;  1TWC J;  3Q0V A;  2WV1 A;  4IHY A;  2CUF A;  3FIW A;  1HLV A;  1QRY A;  2XJ3 A;  1WH7 A;  3QPL A;  4X4G A;  2XPV A;  4UUS B;  2O38 A;  1APL C;  2CUE A;  2VI6 A;  2CJJ A;  1JFT A;  3S17 J;  3G1M A;  3CDL A;  3BG5 A;  4I8T A;  3LOC A;  2LD5 A;  4AC0 A;  4IHW A;  3SCH A;  2IUO A;  3I4M J;  3PM1 A;  3JXC L;  3FK7 A;  3ZQH A;  4DZP A;  2JK3 A;  3TP0 A;  1POG A;  3MKL A;  3QQ6 A;  3KJX A;  2GZU A;  4I6T A;  2M9H A;  4BY7 J;  4M3F A;  4B3A A;  1MBE A;  2DMP A;  2DMU A;  2OPT A;  3PO2 J;  5FKO A;  1MH3 A;  1QQA A;  1MBH A;  2E19 A;  4LOC A;  1PRV A;  2EBY A;  2CU7 A;  3ZOB A;  4D7N A;  1ETX A;  1UMQ A;  2HYJ A;  4IWR A;  1U78 A;  2HXO A;  4MLO A;  1DU0 A;  2FJR A;  1AHD P;  4AUX A;  4X1E A;  2DA1 A;  2LLK A;  3GN5 A;  3G1L A;  2L49 A;  4D7M A;  1W0U A;  2CSF A;  3JRB A;  1U8B A;  2LR8 A;  3JRD A;  1FJL A;  3ZQG A;  2L9R A;  2XSD C;  1I3Q J;  3JRF A;  2R92 J;  2LKX A;  1X2N A;  1IV6 A;  3QYX A;  2IVG A;  4I76 A;  1L1M A;  1LLI A;  4GHJ A;  4I6R A;  4A3K J;  1NER A;  3HB9 A;  4JX5 A;  1A5J A;  1MBJ A;  3Q0U A;  4QSH A;  5FJ8 J;  4IA8 A;  4YBA A;  2MG4 A;  2P81 A;  3SFI A;  5E3M A;  9ANT A;  3F51 A;  1ETY A;  3DEW A;  3GBG A;  4A3J J;  3S16 J;  1JKP C;  1ZZB A;  3FKI J;  2BNN A;  4NDW A;  5J1U A;  3HOV J;  2PUG A;  2HOA A;  2K9S A;  2ICT A;  2NS7 A;  1F43 A;  2JA5 J;  1RET A;  5J1Y A;  1H88 C;  1YRN B;  4BKX A;  4G12 A;  1JUM A;  3JXD L;  3OSG A;  4IHX A;  1E3O C;  1AU7 A;  2LCV A;  3HOU J;  1VF9 A;  2GRM A;  2WIU B;  2DA4 A;  4DZJ A;  4QTR A;  2MW8 A;  3TED A;  4Z58 A;  1Y1V J;  2X6O A;  5F0F A;  1QQB A;  1X57 A;  4A3I J;  1R69 A;  1QP0 A;  1RPE L;  2D5V A;  2JA7 J;  3H5T A;  3HZI B;  2PE5 A;  3BS3 A;  3BTI A;  1H89 C;  2R5Y A;  3FYA A;  4MCX A;  2DA3 A;  2XB0 X;  2JMW A;  2FD5 A;  1B72 B;  3JRC A;  3BR2 A;  2FJ1 A;  3QPS A;  3JRI A;  4X4B A;  3BTC A;  2EZL A;  3CQZ J;  1TWH J;  5EYR A;  1QVU A;  1A6I A;  5J1R A;  1JKO C;  4DW6 A;  2PUC A;  5F0H A;  4IHV A;  5JLW A;  1ZPQ A;  4RDU A;  2COB A;  2AUW A;  3B6A A;  2MGQ A;  2OFY A;  1TWG J;  4D5C A;  1ZGW A;  1R9T J;  2OR1 L;  2N8G A;  2O9L A;  2YUS A;  1PUF B;  2KEI A;  2XGC A;  3BR0 A;  1HDD C;  2AXV A;  1B8I A;  5J3L A;  1ZK8 A;  3A01 B;  1ZZ6 A;  4PU8 A;  4M3D A;  4A93 J;  2IVB A;  4RBO A;  1RZS A;  2PUB A;  1JT6 A;  4DYR A;  4C3H J;  2QF7 A;  3G5G A;  1WGX A;  3OMT A;  3ZKC A;  4HNV A;  3FMY A;  3JRH A;  1JTY A;  1YSE A;  3LIS A;  4J1X A;  2JCG A;  1NK3 P;  2E2H J;  4A3G J;  5IPA A;  4CYC A;  2LYQ A;  4BBR J;  2KPJ A;  1RIO A;  2TRT A;  1CJG A;  3L1P A;  2DA7 A;  1VFC A;  4BY1 J;  1ZQ3 P;  4XID A;  3HOY J;  1OCP A;  2O4A A;  3O8G A;  1MH4 A;  1RKW A;  2KDZ A;  3S15 J;  2EH3 A;  1ZS4 A;  1EFA A;  3B6C A;  3BG3 A;  1HDP A;  5IP7 J;  3BTJ A;  3JRG A;  5EZH A;  4IEJ A;  2DMT A;  1GT0 C;  3JR9 A;  3BDN A;  4YG7 B;  1ADR A;  3I4N J;  1LQC A;  1DW9 A;  2KEK A;  1U9O A;  4JX4 A;  1WI3 A;  2L8N A;  1VPW A;  3SJM A;  1JUP A;  3IH4 A;  1BW6 A;  2L0K A;  2HI3 A;  3BR1 A;  3LSJ A;  4W1U A;  3HKZ N;  3HOW J;  2A6C A;  2ICP A;  2O7O A;  1BJZ A;  2LYL A;  5DS9 A;  1VI0 A;  2NOG A;  2XIU A;  1F36 A;  2XGE A;  2PUF A;  2B63 J;  4M3B A;  1R63 A;  4A3L J;  3MLF A;  4J1W A;  3JRE A;  2KZ8 A;  1ZZ9 A;  1GUU A;  1TWA J;  4JCX A;  3BG9 A;  4PU3 C;  3IH2 A;  3KXA A;  1SFO J;  2R5Z A;  5F0C A;  3R1F A;  3BT9 A;  1RKT A;  1QPI A;  4Y52 J;  2LVS A;  1YRN A;  4J19 A;  4YAR A;  2ME6 A;  2VKV A;  3O9X A;  1ZVV A;  2M0C A;  5IOY A;  4X4F A;  1FTZ A;  3PO3 J;  3OQN A;  2DJN A;  1IUF A;  2EZH A;  3MN2 A;  2Y0S N;  2NVQ J;  3EUS A;  1WH8 A;  4W97 A;  3H0G J;  2K40 A;  2Y2Z A;  4FE4 A;  1UXD A;  1JKQ C;  2IU7 A;  2XCJ A;  4MIM A;  1T56 A;  1ORK A;  3H3V K;  3GTQ J;  4I6U A;  1FIP A;  5FKN A;  3S14 J;  4Z59 A;  2IAI A;  1QP4 A;  2NVY J;  4F8D A;  2DMQ A;  1P7I A;  4BXX J;  2MEZ A;  2E1O A;  3WHB A;  2Y30 A;  1WET A;  2R63 A;  5K7F A;  1B72 A;  3S1R J;  1OCT C;  4A3D J;  3IH3 A;  1TWF J;  1ETQ A;  2KEJ A;  2DA2 A;  1D5Y A;  1Y9Q A;  2EQR A;  2IV1 A;  2ELK A;  4MCT A;  1NK2 P;  2HQ5 A;  4AYB N;  3CCY A;  1RES A;  3S2H J;  2HXI A;  2PMZ N;  2LYP A;  5FLV A;  3SCG A;  3QF3 A;  4XK4 A;  2E2I J;  1POU A;  2AHQ A;  2M34 A;  2AXU A;  4M6V A;  1FTT A;  1CQT A;  1PUF A;  5IYD J;  2CQQ A;  1ZR4 A;  1MNM C;  4X4D A;  1LE8 B;  2XB5 A;  1MBK A;  1WCM J;  3HOZ J;  3S1N J;  3GTO J;  3A01 A;  3K7A J;  3LSP A;  2K9N A;  4JYK A;  1Z77 A;  3K2A A;  1WPK A;  2YS9 A;  3G7D A;  2HOS A;  2O8K A;  2DMN A;  2H1K A;  4FBI A;  2BJC A;  1Y7Y A;  1ZTR A;  1JJ6 C;  1AKH B;  4EEF G;  2L7M P;  1MBG A;  3C2B A;  5JLX A;  1PRU A;  2DA6 A;  4XRM A;  3BQY A;  3DCF A;  4I6Z A;  1RZR D;  3RZO J;  1S7E A;  1OJL A;  5IYC J;  1GDT A;  2I10 A;  2LYJ A;  4X4E A;  2L7F P;  1ZZC A;  3PXP A;  3FK6 A;  3ZQI A;  2RAE A;  2GLO A;  2LFB A;  2JWT A;  4GFB A;  4OB4 A;  5EG0 B;  5M3M J;  3ZHM A;  5IYB J;  3WHC A;  3TRB A;  1ZR2 A;  5EGO B;  1ITY A;  1BA5 A;  1UG2 A;  4UUS A;  1XS9 A;  1B0N A;  4MO7 A;  1ZZ8 A;  2PUD A;  2JVL A;  2VKE A;  4JCY A;  3TW6 A;  1O4X A;  1MSE C;  1HOM A;  4IVZ A;  4Y7N J;  2H8R A;  3TW7 A;  4QIW N;  2FX0 A;  1X58 A;  1ETK A;  2EZK A;  2LK2 A;  2R1J L;  1XC5 A;  2E2J J;  4A3B J;  1WH6 A;  5C44 J;  3BQZ A;  1ZUG A;  3BR3 A;  5C4X J;  5IP6 A;  3BR6 A;  2O49 A;  4A69 C;  1K83 J;  2Y9Z A;  5F1J A;  1K61 A;  4DYC A;  1LFU P;  4C3I J;  2GRL A;  3CEC A;  1ZZ7 A;  4Y42 A;  1I6H J;  2IVQ A;  2CRG A;  3B7H A;  1UHS A;  3GTK J;  1UXC A;  4X4I A;  2JJ7 A;  3OQM A;  3O8H A;  2Y31 A;  1Y1W J;  2AW6 A;  4PU7 A;  4B1R A;  3SCF A;  2EBI A;  5EDN A;  3GTL J;  1U9N A;  3U3W A;  4L5E A;  3GBF A;  5EF6 A;  3QWG A;  2ECC A;  1RR7 A;  2W48 A;  3SDG A;  1GV2 A;  5FKK A;  4XIC A;  1JUS A;  3HEF A;  1T33 A;  2ID3 A;  1ZKG A;  1NEQ A;  3KZ3 A;  2JA6 J;  3IV5 A;  2HOT A;  2R7Z J;  2AXZ A;  4FTH A;  4CYC B;  3RKQ A;  2FQ4 A;  1G2H A;  2WUS R;  1GV5 A;  1X2M A;  4A3F J;  3TP3 A;  4C2M J;  1P7J A;  2HIN A;  4Z5D A;  4Z5C A;  3OSF A;  5F08 A;  3A02 A;  3OQO A;  2OF7 A;  1UTX A;  1Z0X A;  2AO9 A;  3Q3S A;  3HGY A;  5E3O A;  1H8A C;  4B4C A;  5C3E J;  4V2G A;  4XRS A;  3F6W A;  4FIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...