2H8RA

Hepatocyte nuclear factor 1b bound to dna: mody5 gene product
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
219
structure length
176
Chain Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of disease-causing mutations in hepatocyte nuclear factor 1beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
molecule keywords 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*
total genus 56
structure length 176
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2h8rA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2h8rA01
2R93J 2Y2ZA 4BY7J 2R5ZB 2DN0A 3WHBA 2XGDA 1D5YA 1DU0A 2ID3A 3ZQHA 3HGYA 1GV5A 4GFBA 3S16J 2Y31A 1FIAA 3JREA 2HDDA 5FLMJ 2IV1A 3UFDA 4Z58A 2CUEA 2PMZN 4W1UA 2L7FP 2YU9J 1JWLA 3G1LA 5M3MJ 4J1WA 3BR3A 2JA7J 4MIMA 4Y52J 2EZLA 2HYJA 3BTJA 3S1NJ 3LSPA 2E2IJ 5J3LA 1QPZA 3HOZJ 2E1OA 3Q0VA 2HSGA 4PU4C 1LMB3 3CMYA 2EBYA 4I6ZA 1QQAA 5EDNA 4I76A 3OP9A 1RZRA 2LYSA 1Q1VA 1ITYA 4FCYA 2CJJA 4UUTA 3G1OA 3W6VA 2ME6A 2CQQA 1HDPA 2FQ4A 1EFAA 5K7HA 5DTDA 1JUSA 5J1RA 3G7DA 3LFPA 5EG0A 2O8KA 4I8TA 4M3EA 1ZS4A 2HI3A 3LSRA 2JA6J 1Y1WJ 1JKRC 2X6OA 1ZZ6A 1IDZA 3OOUA 2ID6A 5IYDJ 2OPTA 2ZB9A 3ZQCA 1ZZ7A 2BNNA 3JXDL 1L1MA 2X48A 1NK3P 5JLXA 3KZ3A 4M3FA 2DJNA 4C3IJ 2LYKA 3IVPA 4DW6A 3S8QA 1MSFC 3HZIB 2WAQN 3TW7A 1FTZA 1TC3C 2JVLA 5EGOB 1RIOA 2W48A 4JYKA 2R0QC 9ANTA 1GVDA 1ZKGA 3HBLA 4FE7A 3CDLA 1P7IA 1VFCA 2R63A 1MNMC 5E3LA 3F51A 4A3KJ 1OCPA 2BNOA 2KPJA 1IUFA 1WIZA 2MGQA 4J1XA 2KEKA 2R1JL 2FJRA 5F0FA 2PPXA 2ELKA 4QTRA 4JCYA 1GV2A 1POGA 2AXZA 1VPWA 1JT6A 2PUFA 4JX6A 1ZK8A 4FISA 2A6CA 3PM1A 3BG3A 5K98B 1OFCX 3E7LA 2GZUA 4EEFG 1NTCA 3MN2A 1WH5A 3TEDA 3BG9A 1BA5A 4JCXA 2DTZA 5IP6A 3F52A 3BTIA 5HODA 3VK0A 2PIJA 3UKGA 3ZQLA 3DCFA 3I4NJ 2XI8A 4D7MA 4OB4A 4A3EJ 5JLWA 2DA6A 2NVQJ 2DA4A 4XIDA 1HLVA 2Y0SN 4D5CA 4V2GA 5GPAA 3GTKJ 4I6TA 2IAIA 3BR1A 1BW6A 2QCOA 2HQ5A 3MVPA 2GRLA 1U9OA 2O49A 3JR9A 1MH4A 3JRGA 1RETA 2HINA 2KZ8A 2XPVA 3JXCL 1ZZCA 2EZIA 3BQZA 3LSGA 3S15J 1LQCA 3I4MJ 4S0HB 3GTJJ 1YSEA 3QPSA 1ZZBA 1W0TA 5EEAA 2PUAA 2HOTA 5BNGA 2DMTA 2MQKA 5FKKA 2NVXJ 3A02A 4M3GA 5F04A 1PERL 2DMQA 4DYQA 2L7ZA 2KEIA 3GTMJ 1B8IB 1ZZ8A 1VI0A 1JJ6C 2XIUA 2X9DA 2JJ7A 4FN3A 5E3OA 3NARA 3S2DJ 3H5TA 4M3BA 2LTPA 5FKMA 1NK2P 1MBFA 4A69C 1TWAJ 4YG4A 1R69A 2WUSR 1B72A 2E2JJ 1ZTRA 2L0KA 2K40A 2M0CA 3HM5A 2LD5A 4IVZA 2HOAA 4BXXJ 2JWTA 3FYMA 2DA2A 1UXDA 4UUSB 5J1YA 2O7OA 2EBIA 3S1RJ 2YUSA 3SFIA 1MBJA 1T33A 3TP0A 4X4EA 3B6AA 3CECA 2PUDA 1GT0C 4BBRJ 3LISA 1RESA 2R92J 4PU8A 3G5GA 2AHQA 1P7JA 4C3HJ 1YRNA 4IHYA 1W0UA 4L5EA 3OSFA 5F08A 5DS9A 1T56A 4BY1J 1U8BA 3KXAA 3FMYA 3O8GA 1JFTA 2WV1A 1EF4A 1WH6A 1QPIA 2O38A 1UHSA 1IGNA 3MKLA 1O4XA 2XSDC 3GTGJ 4Z5DA 1SANA 1VF9A 1JUPA 1DW9A 2IEKA 2JA8J 2JCGA 3ZQFA 3PO2J 5EZGA 4Y7NJ 2AXUA 2R5YA 5FKLA 2HXOA 3S1MJ 2QF7A 3BR5A 1ZQ3P 3RZDJ 2I10A 3ZHMA 1A6IA 2M2EA 3BD1A 4XICA 3FIWA 2EWTA 1X2NA 3S2HJ 1ZZ9A 1RZRD 2PE5A 4MFDA 1RKWA 4B3AA 3BR0A 1WI3A 3RZOJ 2DMUA 1IRZA 1B0NA 5IOYA 3WHCA 1IJWC 3ZQIA 1JGGA 3QQ6A 4IEJA 5J1UA 3TP3A 1JKQC 2NS7A 4QSHA 5M5XJ 4NDLA 3CCYA 5C3EJ 4YARA 1JH9A 1ETWA 1RZSA 1ETXA 2LY9A 2H8RA 1RPWA 4NDWA 2NS8A 1BJZA 1SFOJ 2JA5J 2R5ZA 3TRBA 3JRCA 3O9XA 2HXIA 2XRLA 4X4FA 2AW6A 2LCVA 4M6VA 4CYCA 5A7LA 3QYXA 4LOCA 5M5YJ 2E19A 3OQMA 3F0CA 1FIPA 1I50J 1G2HA 3FK7A 2ME0A 1FJLA 3GTQJ 4GQMA 4UUSA 1K83J 2FX0A 1F36A 1NERA 1JKOC 2PUEA 3PO3J 1ETYA 2MG4A 1IDYA 2H1KA 4XRSA 2JN6A 1GUUA 1H88C 3ZQGA 5GP9A 4IHXA 5K7ZA 3IV5A 3JRHA 5C4XJ 1QP7A 4XRSG 2NOGA 4ABZA 3BTCA 1APLC 4A3BJ 2PUGA 1QP0A 2FD5A 1ETVA 3RKQA 1ADRA 3SCHA 3H3VK 1BW5A 5FJ8J 1JT0A 5FKNA 1WH7A 5EYRA 1GDTA 1X57A 2IVBA 2OFYA 2AXVA 2K9NA 2LFBA 1VNDA 4Z59A 3D1NI 2ICPA 2LKXA 3Q0WA 3BT9A 3Q0UA 4PU7A 4MLOA 4X6AJ 3F6WA 3PXPA 1F43A 4Z5HA 1ZVVA 2AUWA 1HF0A 4D7NA 4MCTA 1QQBA 3QPLA 3RZZA 1HOMA 4JP0A 2XB0X 1AHDP 3HKZN 2CRGA 2M34A 1UG2A 5F1JA 1WETA 2TRTA 1X2LA 4HNVA 4FTHA 1WCMJ 1LCCA 1MBEA 5EZHA 3QWGA 1ETKA 3K2AA 2CUFA 2O4AA 3LOCA 4A3MJ 1MH3A 4X4IA 1U9NA 1Y9QA 5F0HA 1ETQA 3G1MA 1XWRA 1UXCA 2VKVA 1BDHA 3TW6A 5IP7J 4X1EA 3JXBC 1RPEL 1SQ8A 3LSJA 3ZOBA 3FYAA 1U78A 1XC5A 3GN5B 4F8DA 2KDZA 3A03A 4J19A 3U3WA 1QRYA 2N8GA 3H0GJ 1B8IA 1AKHB 4Y42A 4AC0A 2VPRA 1JKPC 2LVSA 3HOUJ 3S17J 1XS9A 2XJ3A 1PUFB 4A93J 2EZHA 3K7AJ 2WIUB 3LNQA 1Z77A 3SDGA 1IV6A 2XCJA 2JK3A 4QIWN 4C3JJ 3OQNA 4DZPA 2VKEA 1WH8A 2MSYA 5M3FJ 1LLIA 1K61A 2DA5A 1I6HJ 2IVQA 2XB5A 2GRMA 1ZAYA 2R7ZJ 3JRBA 2BNMA 1TWFJ 3HOXJ 2LR8A 2AWIA 1PNRA 4FE4A 1YRNB 1E3OC 2LYLA 4MFEA 1ORKA 5EF6A 3DNVB 1RR7A 1JUMA 4AYBN 3BTLA 1AKHA 3OSGA 2D5VA 1Z0XA 3Q3SA 1WPKA 4AUXA 1UMQA 4RDUA 4A3GJ 2LYJA 1MBGA 3QF3A 3HOVJ 1X58A 1H89C 1DU6A 4IHVA 4X4GA 4X4BA 2GBYA 1MBKA 4B1RA 1FEXA 2L7MP 2LP0A 2COBA 2DMNA 2P81A 4DYRA 3A01A 4PU3C 2EQRA 1JFSA 1MBHA 3OMTA 3HOYJ 3KJXA 3BQYA 3C2BA 5EGOA 4I6UA 1H8AC 4IHWA 3S14J 5F0CA 2OR1L 4MO7A 3FKIJ 3CLCA 2ECBA 2LYPA 2IBDA 1R9TJ 3BG5A 4FBIA 1BDIA 3VPRA 1OJLA 3BR6A 3HB9A 2JMWA 3IH4A 3CQZJ 2CQXA 1B72B 1MSEC 2GM4A 3M3YJ 4BBSJ 2PUBA 2B5AA 2M9HA 3B6CA 2GLOA 4A3LJ 3GTPJ 1POUA 2DA7A 1NEQA 3JRDA 5M5WJ 4GHJA 3OQOA 1JJ8C 1PUFA 2LK2A 2Y9ZA 1IG7A 3R1FA 1CJGA 1PRVA 2NVYJ 4A3CJ 4IWRA 5IP9J 2Y9YA 3S1QJ 1LFBA 2L8NA 5IYBJ 1XG1A 1TWGJ 2HOSA 4YG7B 2KT0A 1TWCJ 5IOZA 5IPAA 2O9LA 3B7HA 5K7FA 3GTLJ 5IYCJ 3IH3A 1ZPQA 1HCRA 3SCGA 1IC8A 2CROA 4YBAA 4JX5A 4C2MJ 4MCXA 1I3QJ 1JTXA 3BR2A 3BS3A 3QQAA 2M8GX 2MEZA 2VI6A 4V2FA 1WGXA 1LCDA 1QP4A 1OSLA 1ETOA 3SJMA 2Y30A 1ZGWA 2LYQA 1ZR4A 1DWKA 2BJCA 4RBOA 1QVUA 2PUCA 2XPUA 3BDNA 1A5JA 2DA1A 1PRAA 2EZKA 2NVTJ 2XGCA 4DYCA 3A01B 4JX4A 1R63A 3HDDA 3GBFA 4DZJA 3HOWJ 5C44J 3GBGA 3NAUA 3IH2A 3RQIA 3GTOJ 2IUOA 2CSFA 3FK6A 4B4CA 2EF8A 1S7EA 3JRAA 2E2HJ 2XPWA 2EH3A 2FJ1A 2WB1N 2RAEA 3JRIA 4O8BA 3ZKCA 4JQDA 4G12A 3DEWA 2G0EA 1JTYA 2IU7A 3SCFA 4W97A 3FISA 1LE8A 4YG1A 2TCTA 3L1PA 1ZR2A 4A3DJ 2K9SA 4IA8A 1RKTA 4M3DA 1TWHJ 1PRUA 2VUMJ 5GPCA 3GN5A 1HDDC 3M4OJ 1ZUGA 1ENHA 3JRFA 1Y1VJ 1FTTA 2YS9A 1OCTC 2MW8A 3OIOA 1UTXA 2L49A 2R5YB 2AO9A 1LFUP 1Y7YA 4Z5CA 2DA3A 3ZHIA 4X4HA 3O8HA 2KEJA 3CROL 5EG0B 1BL0A 2L9RA 3EUSA 4A3IJ 2CU7A 4XRMA 2LYRA 4X4DA 1LE8B 2IVGA 4X4CA 2DMPA 5E3MA 4CYCB 4A3FJ 5C4JJ 1AU7A 5FLVA 3HEFA 2XGEA 5E3NA 1QVTA 2OF7A 4XK4A 1X2MA 5F27A 2B63J 5FKOA 4D5FA 1CQTA 4I6RA 2ICTA 2LLKA 3HGGA 4A3JJ 2K9QA 3MLFA 4BKXA 2ECCA
chains in the Genus database with same CATH superfamily
4YELA 4AYBA 2R93J 4XLAA 2Y2ZA 1Z3YA 3PUFA 3QOEA 2DOAA 1SD4A 3IAS2 3OWTA 4NNJA 3WG9A 2L4AA 3ZQHA 4E70A 3OV8A 4S05A 1DU0A 2FU4A 3JREA 2IV1A 3UFDA 4Z58A 2L9SA 1IV8A 2L7FP 2YR2A 4KUMA 4M9SA 2DXIA 4OIQF 1BIAA 2KQRA 2RV8A 3CCVI 2JA7J 4ZYDA 2GXAA 2EZLA 2Q2EB 1XSXA 1OCOH 1PVEA 1K7AA 1SMYF 3HOZJ 2IGMA 3E3VA 3Q0VA 5K5OA 4IJAA 2HSGA 2EBYA 4I6ZA 1QQAA 4I76A 1U3EM 1KYWA 2BV6A 2LDUA 2H94A 2V6EA 1OKRA 1Y0UA 3A0BC 2LYSA 2ZXHA 1MZBA 4FCYA 1QZEA 2IPQX 5DUKA 4CH7A 3TEPA 2L7KA 2CQQA 2OJED 5J1RA 1JUSA 2BBYA 3NRVA 2WA0A 4HDVA 2OTLI 2OTJI 3G7DA 2DYRH 3TO6A 4BDYA 3CESA 4E7IA 5BOXA 3X2QH 1CF7B 3LSRA 1ZZ6A 4M73A 2ID6A 3J7AO 2M87A 2D1VA 2MC4A 4F92B 5IYDJ 2BNNA 2QQAA 2PXVA 2XF5A 3J7ZI 4IPAA 2QA4I 1YO5C 1E17A 2D2WA 2LYKA 3IVPA 1Y0NA 4Q47A 4HF1A 3S8QA 2WAQN 1I1SA 2JVLA 2DLLA 3ZR8X 1VFCA 1MNMC 2OC6A 2Z3YA 3JAMZ 2ESHA 2VJIA 3BOQA 3G71I 2Y48A 4HSRA 2BNOA 4P9UA 1WIZA 2MGQA 3LSMA 2H1LA 4PGGA 5DTQA 2FJRA 1KU7A 2ELKA 3KEQA 3VYUB 3OYGA 2W85A 4A6DA 1U2ZA 2AXZA 1IO2A 4EJOA 1JT6A 2PUFA 4I01A 4YFKF 2EILH 2Z9OA 2STWA 2GZUA 1GXQA 1NTCA 2RVCA 2R7FA 2B0LA 2FFHA 1WH5A 4RA2A 4JCXA 3BG9A 2LY1A 3HSFA 2CFXA 2HOEA 2ELJA 4E7SA 4A5NA 2ISZA 1G3SA 1VQKI 3GTKJ 2LBFA 3DU5A 1E0EA 3KZYA 3ECHA 2E5ZA 2Z16A 1MH4A 4GYIA 3HYIA 3AG3H 1TQMA 3LSGA 4EK9A 1YLFA 2Y0MA 2F48A 2GOMA 2UV1A 3ZQ7A 1OR7C 1XCBA 1K6YA 5EEAA 1IRXA 5BNGA 2DMTA 2MQKA 1MGTA 1PERL 4M3GA 2KPMA 3ISPA 3ZCOA 2R7UA 1STZA 2ZSIB 2CW0F 3P9IA 1ZZ8A 1FOKA 1VI0A 5L3DA 4HBLA 4HNUA 2JJ7A 3ROUA 1JJ6C 3L9FA 2MABA 3OYAA 2V4JC 4LMYA 4L18B 1IF1A 5HS8A 2JZYA 2AS5F 2ZSHB 3TGNA 1MBFA 4YG2F 1TL8A 3K0LA 4MQVA 2ZXIA 3QU6A 4Z2YA 3FXLA 1ZTRA 2L0KA 3HM5A 4ESFA 3RCOA 3DPLC 4BL0B 1WSUA 4BXXJ 1I27A 3BY6A 2DA2A 4ENMA 2CW7A 4PCQA 5J1YA 1T8IA 1OMIA 2NYXA 2IJLA 3RSNA 2VJ5A 4ER7A 5FLXZ 3SFIA 1MMDA 1T33A 3EYIA 3CECA 2BY0A 4BBRJ 1RESA 5EEGA 3WTSC 1OYYA 3GZ6A 3KYCB 4DIQA 1UZCA 1ZG1A 4C3HJ 2P5KA 1YI2I 2ZNZA 4OMZA 4L5EA 2XKOA 1DULA 1U8BA 4EM0B 3FMYA 1IUYA 3JAMK 3HRUA 2UZKA 2O38A 4AIKA 1D1CA 1YJNI 3TL4X 2FOKA 3MKLA 3F6VA 4EJVA 2W82A 1R7JA 1SANA 2LNBA 2AQEA 1BI0A 2HYFA 1Z67A 1R00A 4XLNF 4Y7NJ 1W4MA 3H9JA 1K4SA 2PXTA 2HXOA 4BU2A 3SXYA 5KAFC 2VKDA 2HWVA 2QF7A 4PK4A 4EJTA 3BG7A 2QKLB 3DV8A 4U87A 1X2NA 1ZZ9A 1HQ1A 3CUOA 2IS4A 3A2KA 3OS2A 1RKWA 1HA8A 3H9GA 4B3AA 2W1OA 4XN0A 3VSKA 2DMUA 3RZOJ 1B0NA 3K4NA 4XMYA 3QQ6A 5J1UA 4KT6A 3SDBA 4BXUA 4IOAF 2Z2SB 2NS7A 3QFIA 5D4RA 1I5ZA 5C3EJ 1XPXA 2LY9A 1XN7A 2BHZA 3FMRA 4F7ZA 3ZMUA 3CC2I 2ETHA 2EIMH 2JA5J 4G7ZF 3JRCA 4L9VA 4LK1F 1T0FC 3QYXA 3PSIA 1I50J 3F22A 1G2HA 1IXCA 4CCNA 2E1NA 3RTRA 4EJUA 5LEJA 4AIDA 2V9KA 3HOSA 1LPQA 3DP7A 3VOEA 2FX0A 1F36A 4BQAA 4PSXA 3W2AA 3PO3J 3S3NA 1X3ZB 4KA4A 5GTIC 2JN6A 1VQ9I 4GRIA 5C4XJ 3IV5A 1QP7A 4C30A 4LLNA 2NOGA 2CV2A 5DRYA 1XGMA 3BTCA 1APLC 2PXLA 2ZMEC 5B3SH 1TQPA 3K4MA 2FD5A 2KIMA 5AIPA 2LLWA 3WTWC 2KISA 1QGPA 1B6AA 2IVBA 3P9KA 3V8LA 2PMHA 1G59A 4I99C 4H4KC 2AXVA 2K9NA 3D5LA 1YYVA 4MTDA 4OIRF 3BT9A 2IA0A 2LBFB 3F6WA 1UELB 1F43A 4Z5HA 5FRMA 2AUWA 3K4CA 2GWRA 4MCTA 1QQBA 2NAZA 1U8RA 5KAIC 3OYBA 4HQEA 2Q0OA 4M6XA 2HU9A 2JPCA 3K70D 2KIFA 3R61A 5GAGi 3WTYC 2CRGA 2IXSA 1UG2A 3I3LA 1X2LA 1WCMJ 3KP7A 1MBEA 3CCRI 1LCCA 1G4DA 1MMAA 2CUFA 2MD5A 2V1XA 3OIPA 4II2A 3SEZA 4X4IA 1R23A 1Y9QA 4ZYEA 5F0HA 4E7JA 1BDHA 1B1BA 5IP7J 4X1EA 3PNTA 4GDFA 5HOOA 5EJCA 1UG0A 3BJAA 4NB5A 1SQ8A 3KX2A 3K70C 5DCMA 2KLOA 5JI6A 1WJAA 1TT0A 2A6EF 2FMLA 3QYEA 2KDZA 2DFIA 1D0XA 1QRYA 2DYSH 2N8GA 1B8IA 4GGGA 4Y42A 4L9NA 4CO8A 2VPRA 2R7VA 3HOUJ 2XJ3A 5LRSA 4ITVA 2EZHA 2WIUB 1F4KA 5A2QZ 1Z77A 2UUZA 2BHYA 2KKOA 2JK3A 3GX4X 3FXMA 2XIGA 5L3FA 2CQ7A 1Y39A 2KZGA 4PFPA 1I6HJ 1ZAYA 2GRMA 1Y56A 5DSXA 3MZYA 2R7ZJ 1FYMA 2LR8A 3DKYA 3HKZA 1YRNB 1WJDA 1E3OC 4RLFA 4AYBN 4HEA2 3OSGA 4HPQA 3DU6A 2HNHA 1XB4A 4BNCA 4KDPA 4HA8A 4WCGA 2FF4A 4RDUA 4A3GJ 1K78A 1PJRA 3H36A 2VXZA 3HOVJ 1DU6A 1R5ID 4X4GA 5J47A 2X1CA 4X4BA 2GBYA 5CPRB 4EM2A 1D3YA 3A01A 4I98B 4PU3C 1ZRFA 3GVAA 3BQYA 3FWEA 2VC0A 4KIFA 1FOWA 1ZARA 4N0BA 5EGOA 5F0CA 3AG2H 3CLCA 3K69A 4ZDLA 3SR4A 2ICWG 3BR6A 3QP6A 4UY8I 4E7LA 2JMWA 3CQZJ 2CQXA 1B72B 1MSEC 3J7AY 2PUBA 3Q9SA 2B5AA 1BBYA 4A3LJ 3S8PA 2FOWA 1NEQA 1YIJI 3U21A 2GAUA 3TKYA 1PRVA 1WJ5A 2M4GA 2OZ6A 2Y9YA 4BJ5C 2Z1DA 2HOSA 1XCVA 2ZFWA 4LIVA 5HLTA 2KT0A 5IPAA 3B7HA 4IQJA 1OCCH 3IH3A 3WGIA 2RKHA 2XUBA 4BQQA 1HCRA 4PUSA 3KCCA 2CROA 2HQRA 2K86A 4BQNA 4MCXA 4EATA 3MD2A 3BS3A 3QQAA 2M8GX 1LCDA 2P6TA 2R7SA 2Y30A 4OWRB 1ZGWA 1ZHFA 2LYQA 4BAYA 4BHPA 3FXUA 3CCJI 2BJCA 2VJ4A 2MD0A 4MNUA 4KNYA 5JR3A 1O3RA 2NVTJ 4HX8A 1KQ0A 2M1BA 1X4PA 2WAEA 1A36A 1R63A 1FOYA 1JHFA 3HOWJ 3GBGA 2K3FA 3KEOA 2HDCA 1RZ4A 3T1BA 3L2WA 5B1BH 1XD7A 3L2VA 2CSFA 4B4CA 2E2HJ 3JRAA 2XPWA 4RB1A 2R7RA 1IZ1A 3R0AA 1VQMI 2CGPA 1ONVA 3DPTA 2A69F 2LKSA 4MEYF 4NHJA 3ESWB 2XAQA 1MJAA 2LMDA 1R58A 1RC9A 2CH0A 2HVQA 3FISA 1VQOI 2E1CA 3NROA 2ZMEB 1ZR2A 1S5LC 1PRUA 2F5CA 5DUIA 1ZUGA 1Y8QB 4G7OF 3FXKA 3E6MA 4A2UA 3H35A 3LSKA 4Y15A 1FTTA 1R4MB 2BXZA 4HG2A 4ENNA 1Z91A 3FM3A 2R5YB 2AO9A 3K6GA 2B9SA 1Y7YA 1FY7A 2DA3A 2FQ3A 4LK0F 3ZHIA 2H6CA 4X4HA 1E2XA 2BYVE 1FX7A 4TV7A 3BROA 5DDGA 2L9RA 3N4MA 2I5UA 4PJ0C 4UVAA 4A3IJ 1SFKA 2BW3B 2VQHA 3TFLA 2R7TA 3FHZA 2IGKA 4CYCB 5C4JJ 3QP5A 1AU7A 3PSFA 2EJRA 1QVTA 2OF7A 1HQCA 1XMKA 3SZPA 2O5RA 2XC7A 5FKOA 2A07F 2ICTA 3WU0A 4ER3A 4A3JJ 2PFBA 4BEHA 2YU3A 3J81K 1ZAOA 1HW5A 3RKXA 1QP0A 3CC7I 2HYGD 2QQ9A 2XGDA 3AG4H 1R5GA 2ZMEA 3OYKA 2XF7A 1YIOA 2PN6A 3DKWA 4NC7A 1FIAA 5FLMJ 4HLXA 3AL0B 4P96A 4W1UA 2OU2A 3GXOA 4HDUA 3MZHA 1JWLA 2F5EA 2X1EA 3BR3A 4HZFA 2A05A 4MIMA 2HYJA 3BTJA 3LMMA 5CYVA 3VODA 4BJTA 2P5LC 1QPZA 3TMOA 2BVMA 2MC3A 2W57A 4PU4C 3A9ZA 3DEEA 3CMYA 3QYFA 2JVHA 4H0EA 3K1PA 1RUNA 3GMEA 4XM3A 3ZMSA 1RZRA 4IHSA 5D5UB 2DJIA 2JRTA 2ME6A 2FQ4A 1OR7A 4ZZLA 3I55I 3AG1H 3Q5FA 3CJRB 4I8TA 3JSPA 2HI3A 2XDVA 1ZRDA 3PIOF 4CDGA 1Z9CA 1U2WA 3JXDL 2J7UA 2X48A 3KE2A 4ESJA 3PQKA 3RJPA 5JLXA 1RRJA 4LB5A 3ASOH 4XOTA 3BLYA 1Y6IA 4DW6A 2DFEA 1MSFC 3HZIB 4U88A 1CGPA 1RIOA 4EZIA 2EIJH 2R0QC 4CGZA 1KYZA 3U2RA 3HBLA 2V1NA 3R60A 4HLYA 2JSCA 2CW8A 1R5HA 3H5NA 3VFZA 3I59A 3LSIA 4MEXF 3F51A 3J80Z 5FRNA 1IUFA 2GIVA 4J1XA 1TW2A 3OYNA 2KEKA 5F0FA 2CUJA 3OWQA 5GAGJ 3OYIA 4A5MA 4J01A 1QNTA 1HSTA 3GLLA 1EA3A 3ASNH 3ERMA 2CS3A 3H3UA 2GOXB 3PM1A 3BG3A 4D0PA 5K98B 1LKXA 3WU2C 3E7LA 3LQXA 3QYBA 3K4LA 2F6CA 4Q2JA 2IGOA 3TEDA 4L0YB 5DD8A 2DTZA 5DYMA 5IP6A 3F52A 3DCFA 1Z6TA 2J7WA 3TOBA 1BOBA 2O8XA 5HVQC 3IRQA 1J5YA 2DA4A 4BACA 1C0WA 2Y0SN 4D5CA 4V2GA 2OCEA 5GPAA 3L09A 4NC6A 4P9FA 4I6TA 3GF2A 1TBXA 4LG0B 1U9OA 4XBFA 3EUAA 3IP4B 1IAWA 2M4HA 3KZZA 4BEHB 2HINA 2F2EA 2XPVA 4ZDOA 2ZO4A 4S0HB 4O3MA 3FXOA 4A6EA 2QBYB 1V5GA 1PP7U 3S2WA 1J9IA 2QWWA 2HOTA 5LFAA 4KIGA 3A02A 4RGXA 4LG3A 2L7ZA 1X1CA 3GTMJ 3QOPA 1P9QC 1Z7LA 5D5XB 2FUG2 1HKTA 5E3OA 3H5TA 1G6NA 4RB0A 3S2DJ 5CQGA 5FKMA 5E8IA 1SAXA 3F21A 1SVLA 1NK2P 1FSHA 2L01A 4EKIA 3HUGA 1IXSB 1TWAJ 3ERED 1SVMA 2WUSR 1B72A 4MGRA 3FZVA 2DODA 3RPQA 1ON2A 4IF4A 3OY9A 2K40A 2XAHA 4OOIA 5ICFA 1T08B 2XASA 3FYMA 1V4RA 3L7WA 3WGGA 1UXDA 4RS8A 5HLIA 2WAQA 3G73A 5DRTA 4M6YA 4XOPA 3S1RJ 1Z21A 4LIUA 1KZHA 5D8KB 2E7XA 2HZDA 3FXJA 3KP3A 4X4EA 1GT0C 3CF2A 3R0JA 3F3XA 4UHTA 3E6DA 2AHQA 2GQQA 5CJ9A 2M0MA 2ZXJA 3DTKA 4IHYA 4IRGA 3UR3C 2VE8A 3M7GA 2GZWA 2DI3A 2V6CA 2XAGA 3WTUC 1T56A 3EUHC 2DQLA 4JQFA 5LBQA 4BY1J 2VJJA 2F5VA 5LHGA 1JFTA 2WV1A 3M1CA 1WH6A 5BQTA 3KL4A 1UFMA 3AKZA 1T38A 1WJBA 4AM3A 1IGNA 2OV7A 2Q1ZB 4EMSA 4YFNF 3QODA 2HQAA 1JUPA 1H9TA 3DTIA 4ZZDA 2IEKA 4RM2A 3WTVC 3ZQFA 3O2PE 2MFZA 1KA8A 3PO2J 3CCMI 3ABLH 5FKLA 2K9MA 4ZJZA 4S04A 1BOAA 4BE2A 2VC1A 3ZHMA 3U9GA 1A6IA 4QWQA 3FIWA 1H9GA 5E20A 3K10A 3VSLA 4XLCA 2EWTA 2D45A 3ZQQA 3G4SI 3LSTA 2M7AA 3AL0C 1FLIA 4EKGA 3BR0A 3KP4A 3LFUA 5HLHA 5D6FA 1ZG5A 2PXFA 3KETA 1NW3A 1JGGA 4AVPA 1Z3XA 4N9IA 2A3SA 4QSHA 4F91B 3DTEA 1XX5A 1JH9A 1AOYA 1RZSA 4WVLA 2W4SA 2HCSA 4L9TA 5ILSA 1SFOJ 3OL4A 4B44A 3O9XA 1D1BA 4B09A 1EH7A 2HXIA 2XRLA 4X4FA 1T0FA 3ZPLA 1U6GA 4RAYA 3QAHA 3GLXA 3D5RC 3PFYA 3MKYB 3GTQJ 4UUSA 1K83J 1YQAA 3OKZA 1S7OA 4KMFA 1JKOC 3HIFA 2EFNA 2LG4A 2WY7Q 2H1KA 4XRSA 3W2WA 4GCVA 1JXSA 1OCZH 2FSWA 5GP9A 5K7ZA 4IHXA 2VODA 1D8KA 4XRSG 4XN3A 1TLHB 2PXPA 3GW2A 3J7YJ 4QPQA 4UXNA 1HBXG 1ZLJA 1BW5A 1S29A 5FKNA 2ELHA 2OFYA 4UUVA 1P4WA 1VNDA 4Z59A 3D1NI 4D9JA 2WBMA 3MWMA 2LKXA 1B9MA 3K4BA 2UWMA 4I0AA 4UV8A 3TDUC 3Q0WA 3Q0UA 5FD5A 1O57A 3PXPA 4BJ6C 2QGUA 5FFZA 1ZVVA 2XXQA 1HF0A 2V3CC 1OQYA 1VQNI 2QM3A 1UAAA 3GYHX 1W1WE 4CYDA 3IUOA 2DQRA 4A0YA 1YITI 2BOLA 2LC2A 3NXHA 2KRFA 2EFOA 4FTHA 2E7WA 5EZHA 3SZGA 3KP2A 3ABTA 1T39A 3N97A 2ZNYA 2PMZA 2Q8KA 3VYTB 5EEHA 4EM1A 2F5DA 3HHHA 1U9NA 4HNTA 3KFWX 1VQ7I 3CD6I 3DQVC 1FBSA 1AA7A 1LNWA 1MDMB 4AU7A 2X0LA 5D5WB 3ZOBA 1R1VA 4IQ4A 2VL8A 2KIQA 1YE9A 1U78A 2VOPA 1QZZA 3GN5B 3A03A 1V5FA 2W7NA 1YS6A 1E3HA 2MH9A 1ZELA 3CTAA 3RQ4A 4AC0A 2VONA 1MW7A 2XVCA 3A4CA 1YOVB 2BY1A 1TP4A 2I8DA 3K7AJ 3SDGA 4D1QA 1IV6A 2XCJA 4QIWN 4C3JJ 5L3CA 1LLIA 4DZPA 2DA5A 2IVQA 2X85A 3GO5A 3HOXJ 4J00A 4R1HA 3W3CA 2CWEA 1PNRA 2JVGA 4XLFA 1NH3A 4MFEA 3DNVB 3LWFA 1MKMA 1JUMA 1RR7A 2XHKA 3OIQA 1AKHA 3ZN0A 4WF2A 3F8BA 1Z0XA 3Q9VA 3Q3SA 4DQ2A 4XLHA 2LYJA 2O03A 3QF3A 3JW4A 2LRDA 5JHFA 2VT3A 2HVSA 3M9LA 1BM9A 4KICA 3LQRA 1ZG3A 4YEJA 2L7MP 1FEXA 2COBA 2RNGA 1DP3A 3VB2A 2EQRA 5D6EA 1MBHA 3OMTA 3HOYJ 4PSWA 3R09A 4UVBA 4M72A 2FBIA 1H8AC 1SFEA 4MO7A 4RGRA 2HKOA 4UB6C 2NS0A 1I39A 4BDZA 2LYPA 2D1HA 3GZNB 3BG5A 3HOTA 1R9TJ 4HRIA 1BDIA 2HQNA 4ZYAA 2MLGA 2PX9A 4ETSA 1S7AA 1B4AA 3IH4A 5H6RA 1HOMA 1W7PD 2JQEA 1QHHD 3B6CA 3ZN1A 2O61A 4KISA 1POUA 3JRDA 4GHJA 2FBHA 2Z99A 3M1EA 5DTRA 3I56I 3P5JA 2LK2A 1JJ8C 3R1FA 1IN4A 3TO9A 1LEBA 1JI8A 1S8NA 4IWRA 1U5TB 2L8NA 4HSTA 2E35A 1SC7A 1XG1A 1FYLA 5IOZA 5K7FA 3V7CA 5IT9Z 3SCGA 1IC8A 1QHGA 2VIXA 2IS6A 2MYSA 4YBAA 3LQQA 1I3QJ 3BR2A 4BS9A 5DT2A 4V2FA 1FP2A 1WGXA 1WJFA 1OSLA 3HTSB 1ETOA 1X1DA 3SJMA 4RAGA 3WTXC 5D5VB 2K3PA 1ZR4A 2KHMA 1QA6A 3E6BA 1ZREA 1DWKA 4RBOA 2PUCA 1OYIA 1X1BA 4DJAA 1A5JA 1PRAA 2CFOA 4HQMA 5FD6A 4RAZA 4YRVA 3WU1B 5LGTA 3A01B 3ZMTA 3EQLF 3GBFA 4G6DA 3T8TA 5C44J 3MKZA 3NAUA 3IH2A 3L2QA 5ICCA 3E5QA 5CVJA 3F23A 2QQBA 2IUOA 2EF8A 3FK6A 1WRJA 1GHCA 2EH3A 4DE8A 3OL3A 4I02A 3ZKCA 4HYEA 4CXFA 2RDPA 2LNMA 4G8XA 3GZDA 2DTRA 3OYLA 1Q1HA 5LGUA 4YG1A 2TCTA 2R7OA 3OOPA 3L1PA 4A3DJ 4IA8A 2AQFA 1VQLI 4ER5A 3ZPXA 4MHGA 1QB2A 3M4OJ 3IL2A 3CZ6A 3GEZA 2DPDA 2CSOA 2WAFA 3HTUA 1BN5A 2QUFA 4DBQA 3CCQI 1K6OA 3ZMZA 1OCTC 3R6SA 1W36D 3M8JA 4Z5CA 5A2QK 2P7VB 1VQ8I 3O8HA 3KLOA 2KJCA 2WTEA 3OR2C 4KFCA 2EFPA 5KCMA 4X4DA 2A5YB 3K1NA 4XKCA 3PQJA 3GFLA 4X4CA 4XSXF 2R7DA 3CUQA 1YW9A 3W6KB 1NG7A 1W5CC 2IW5A 4ON0A 3IC7A 4HF2A 1X2MA 3M9AA 2B63J 2UXXA 2GXBA 4XKBA 2VQLA 3HJEA 2DK8A 3HGGA 4UNOA 1K78B 2H09A 3MLFA 4BKXA 3MZ8A 2ECCA 1O3TA 3HUGB 4AIHA 4F3QA 2ADUA 2R5ZB 3WHBA 1GLNA 1D5YA 1KU3A 1DP7P 2ID3A 1LFPA 4XSZF 2IGNA 1D5VA 2HDDA 5F64A 2CUEA 4IZZA 3G1LA 2G7UA 1Z1DA 4J1WA 3CCEI 4V19K 1YJ9I 3LSPA 2E2IJ 2OQGA 3BJ6A 1F9NA 3B02A 3G2BA 2RC4A 3OS1A 1LQ1A 2VASA 1K79A 2R7XA 4E4HA 5EDNA 2QQ8A 3OP9A 4OBMA 3DPUA 1A35A 3DF8A 4OIOF 4UUTA 2BY3A 2NOJB 4LJZF 2TDXA 1N77A 5ICGA 3BG6A 5EG0A 2O8KA 3I59B 2EK5A 4XNFA 2MA3A 1JKRC 2X6OA 4ER6A 3FYAA 2OPTA 2ZB9A 3ZQCA 3KEYA 2PXQA 1D8JA 1Y8RB 2QSHX 2EV6A 2NXNB 2VE9A 3RKWA 3SX0A 4M3FA 1RNLA 2L54A 3F8MA 1NG6A 4C3IJ 3ZMDA 3W6JB 1FTZA 2AXLA 3RI4A 3QRFF 4IRHA 1R1TA 1GVDA 1ZKGA 1X1AA 3BZKA 4FE7A 3I53A 4NC8A 1MMSA 4RAFA 1TNTA 4L9JA 3UWPA 5E3LA 5K1YA 3V4GA 3KZIC 3OS0A 4ENKA 4WK8F 1RR8C 2PPXA 4JCYA 4I2OA 2X6XA 4BYYA 1DUXC 2P4WA 4BE0A 4QLCU 3HRSA 1TW3A 3M8EA 3QOWA 2B7EA 1LDDA 2XAFA 5B5EC 3TQNA 3OYHA 2COMA 4FISA 2BZTA 5HNFA 5FROA 3MN2A 1ZYRF 4G7HF 3WODF 2MBFA 1V3FA 3EUKL 2IS1A 3ZQLA 3I4NJ 4EGZA 4OB4A 3CUQB 4YIRX 4P55A 5J6XA 2DA6A 5J4VA 3E5XA 4XIDA 2RGVA 1JGSA 1DPUA 1LVKA 1SFXA 3MAJA 3BR1A 2ZJQF 1BW6A 2QCOA 2HQ5A 3MVPA 3RYRA 2GRLA 2O49A 2XROA 2L5QA 3IAM2 3SEQA 1RETA 1Z6RA 2KZ8A 2PJRA 3U1DA 3IKTA 1ZZCA 2WC2A 2EZIA 3BQZA 5F6FA 1LQCA 3I4MJ 4ANJA 4HRAA 5E1ZB 3F72A 5DCFA 2PQ8A 1ZZBA 2RNJA 4BGDA 2CQKA 3A0HC 1W0TA 2HZTA 4I0BA 5FKKA 1W5TA 2FA5A 4KIBA 3RKYA 2KEIA 2P8TA 2EB7A 1X1PA 3FXRA 2X9DA 4FN3A 1G3WA 3FMQA 3JTHA 5K5RA 1XGNA 4M3BA 1KU9A 2LTPA 4EV0A 2QSFX 1D1AA 3E5UA 3HG9A 2EWNA 1R69A 2M30A 2HVRA 4C2UA 2E2JJ 2F4MB 1UHMA 2LD5A 4IVZA 2HOAA 4Y33A 3C2HA 3LAJA 1FWZA 2M45A 4DE9A 3AAFA 1KU2A 2PXEA 2Y0SA 2YUSA 4O5VA 2L1PA 3B6AA 4DGWB 3ML6A 4PU8A 2IRFG 1O7LA 4LFUA 3G5GA 2HDWA 1ZLKA 2K4JA 3IKVA 2YPRA 2IA2A 3QPHA 1W0UA 3ZMVA 5L3EA 5LHIA 1A04A 2P0WA 3K9TA 1YX5A 3FM5A 5CKTA 3KXAA 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3O8GA 3TO7A 2WADA 3V7SA 1HC8A 4PGHA 3PUBA 1O3QA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 3G6EI 4F52A 1QPIA 1EKEA 4E7ZA 3NWTA 1LDKB 3A9XA 1UHSA 3CJTB 5B1AH 2ZJRF 1O4XA 1IW7F 2XSDC 3OYFA 1JE8A 3GTGJ 1V54H 4Z5DA 1VF9A 1DW9A 1NHAA 2JCGA 4RB3C 1ACIA 1J7KA 2CUZA 4PJMA 2YSRA 1SMTA 5ERIA 1YW8A 3VWSA 2AXUA 2R5YA 4IKFA 1HKSA 2FEZA 2IP2A 3L00A 4LLGF 2I10A 3WG7H 1YTYA 3GFIA 2M2EA 5L3BA 5E17F 2FE3A 2MH2A 2OZUA 1QZXA 3EDPA 1L3LA 3K2ZA 1LUJB 2OUMA 2ACJA 2X6YA 4II3A 1IJWC 3WE3A 4R79A 4IEJA 3TP3A 1WQ2A 2YBDA 1VQPI 3K4JA 3I71A 1DPRA 3T8RA 4YARA 1ETXA 2KDOA 1RPWA 2E34A 4XRFA 2KL4A 2OBPA 2RREA 5GADJ 5HLGA 2QYOA 4CCOA 3PJRA 2AW6A 1JHHA 4DNCA 5A7LA 4EJWA 1XDUA 5BMZA 1ERDA 2ME0A 3FBNB 4U0VA 1FJLA 2RN7A 3SQNA 3JSOA 4N4OB 4DOZA 2WB1A 1W7PB 1T98A 3SFZA 2K7LA 1X19A 1IDYA 2HKXA 1GUUA 3I4PA 1H88C 3ZQGA 1EJ9A 3HSRA 2DCEA 4IVNA 3VEPA 2DT6A 4M9ZA 4ABZA 2KRCA 2PUGA 4RGUA 2LYCA 4ZYGA 4QPOA 1ETVA 3FF5A 3H5AA 6PAXA 3L2CA 1ADRA 1OCRH 5E8GA 4BHBA 2LKPA 1QPMA 3SCHA 5B66C 5D8LB 3K1MA 5FJ8J 3VYSB 5EYRA 3HPGA 1GDTA 4OIPF 4NQWA 2DO7A 4I7HA 4CICA 3GWZA 2LFBA 2JRMA 3S3OA 5ICEA 4N4NB 3PNVA 4MLOA 4ZYHA 4C2TA 3WTZA 4CCJA 4CHUA 4A0XA 2EV0A 5HS7A 2MLKA 3RZZA 2LSOA 4JP0A 2UXNA 2VQGA 2LREA 2XKPA 5BPDA 2M34A 5F1JA 1WETA 2TRTA 4HOBA 4EQQA 5JUWA 4KN4X 3QWGA 3ELKA 1ETKA 3CMEI 1PP8F 3IHUA 1R4NB 4OINF 4FQGA 1ETQA 1XWRA 2VKHA 4CZZA 3OYJA 3FBIB 4N9HA 3TW6A 4G9YA 3JXBC 4RMNA 3UNGC 1HW1A 4OAZA 3V42A 2DFFA 2LF7A 3LSJA 2QZ8A 2QBYA 4AIJA 4OMYA 3CJNA 5F1RA 5HS9A 4ER0A 2NVUB 1XC5A 4F8DA 4CSWA 2HFZA 3LFKA 3MEJA 3C3WA 1J75A 2CMPA 3LA2A 3V8JA 4LLLA 1MNDA 1XMAA 3H0GJ 1P6RA 4WXCA 5CVIA 2ODRD 1AKHB 2V1DA 4ZDPA 3S17J 1XS9A 4PJNA 1PUFB 4A93J 3ECOA 2BE5F 5E1XA 2W24A 4ZC3A 2PG4A 1BR1A 1SD5A 3OQNA 2Y69H 2VKEA 1WH8A 5M3FJ 1GXPA 1K61A 3EUHA 3COAC 2O0YA 2HTJA 2XB5A 2NRAC 2NNNA 3JRBA 2BNMA 4O6JA 1FP1D 1WI9A 2VB6A 4AVZA 3HSEA 1ORKA 1FC3A 3LA7A 3OYMA 1ZGJA 3F6OA 2ISYA 3BTLA 3FKJA 2D5VA 2DT5A 3ZGKA 4PFOA 4DBRA 1BI2A 1WPKA 3K4KA 4UB8C 3TBIA 1IN6A 5J4YA 1J2XA 4E6KG 3ZRGA 1WKMA 1X58A 1H89C 3IWZA 2ZJPF 2K27A 3H92A 5IT9K 3J80K 1SVOA 1HSJA 4B1RA 2CO5A 2IA1A 4DYRA 2P81A 2DMNA 1WVRA 1I1GA 4XKVA 1JFSA 2F4OB 3KP5A 1EH6A 3DM5A 3KJXA 3C2BA 1J09A 3RPUA 1O3SA 3REOA 4IHWA 2OR1L 3FKIJ 1WHUA 2OQRA 2ECBA 4P5OA 4FBIA 4U7DA 3VPRA 2KZVA 2BEOA 3BZCA 3HB9A 2O6GE 1MJ9A 2DAOA 4HAMA 2GM4A 5DM7F 4BBSJ 2BXYA 3MQ0A 2M9HA 4KN7X 3M07A 3GTPJ 2DA7A 4C9YA 5HDKA 1IG7A 3CDIA 2QSGX 1CJGA 2NVYJ 4CZCA 4A3CJ 3S1QJ 1EV7A 5GAHJ 1J0RA 1EH8A 3BCAA 4YG7B 2BW3A 2E60A 4K2EA 1N25A 4IXAA 2PJPA 4CUGA 3V7RA 5IYCJ 2GXGA 3VYRB 2CQNA 2P5VA 1ULYA 3DFGA 2X6WA 2P6SA 2VBXA 4C2MJ 4MQ9F 2A6TA 2MEZA 1ZN2A 2K5CA 4PDKA 1USTA 2ZCWA 5TJJA 4MTEA 1QVUA 1IN7A 5JVTA 3ZXSA 2XPUA 1SFUA 2DA1A 4HX4A 3EYYA 2V1UA 1VQ5I 1FZPB 1MIJA 1UB9A 2DDAA 4BXFA 3F9KA 3HDDA 4DZJA 4ASNA 4RGSA 3RQIA 1MMGA 3H5RA 1FMWA 3GTOJ 4NBQA 3F8FA 1PUEE 1L0OC 1S7EA 4NQWB 1P2FA 4FX4A 1HW2A 2VBZA 1LDJA 2RAEA 2W25A 4G12A 3DEWA 1Z7UA 2IU7A 2AXTC 2X1DA 3IWFA 1X3UA 2WWYA 5TISC 2VQCA 1RKTA 1TWHJ 5GPCA 3A1YA 4IOCF 1HDDC 2KMUA 2W84A 3CLOA 4B8XA 2K02A 1QQIA 1FYKA 3KPHA 2YS9A 2MW8A 3OIOA 2IT0A 2X51A 1LFUP 5AIQA 2KEJA 1IRFA 5EG0B 1BL0A 1FT9A 3DBLB 2VBWA 4KJZA 1U5TC 1UJ8A 1W5SA 4RM3A 3CMAI 2CU7A 4XRMA 1LE8B 2IVGA 2DMPA 4A3FJ 3ZP5A 4RB2C 3KLNA 2IVMA 3DBHB 3GFMA 1I3AA 2PXBA 3GUUA 2EINH 2XGEA 5E3NA 3C7JA 2H8WA 2R7QA 1CQTA 5FFXA 1YJWI 2KFDA 2HPMA 2PXKA 5CQEA 2GA1A 1XTAA 2JQ7A 4BY7J 2DN0A 4FT8A 5ILVA 2ZKZA 3HGYA 2Y75A 1GV5A 4GFBA 1IRGA 3S16J 2Y31A 4CCKA 5KNLA 3R4KA 3GCMA 5IT3A 2PMZN 3O3KA 1W36C 1TZLA 2YU9J 1YX3A 2GA2A 5M3MJ 2H6BA 5E18F 4Y52J 4B47A 3S1NJ 5DTMA 5J3LA 1DQUA 2E1OA 2L9NA 3DLAA 1A6QA 5AONA 4IO9F 1VQ4I 1LMB3 1I6XA 4FETA 4UVCA 3NEUA 2R4GA 4XLEA 1X3WB 1R22A 1Q1VA 4E7KA 1ITYA 2CJJA 2XAUA 3G1OA 4ZTFA 1RI7A 3W6VA 1SAUA 1HDPA 1R1UA 4ESBA 3AFHA 5K7HA 5DTDA 2R3SA 1BR2A 1EFAA 5ED4A 4M3EA 3LAPA 1WWXA 1ZS4A 1W7PA 2JT1A 1BC7C 2JA6J 3QOXA 1Y1WJ 2Q2EA 5JHUA 4CCLA 2CYYA 2X4HA 3OOUA 3QPTA 5J40A 1IDZA 1ZZ7A 5TGTA 1L1MA 2H27A 2BVLA 1NK3P 3CDHA 2RQQA 2VOOA 3BPVA 4EVIA 3KZ3A 2DJNA 2JTVA 4WXHA 3TW7A 1TC3C 2PLYA 5EGOB 3CCSI 2W48A 3P9CA 4JYKA 3OR1C 5DM6F 9ANTA 4IHTA 1HXDA 1P7IA 3CDLA 5E1WA 1IN8A 2R63A 1FMVA 2EPFA 3BZ6A 4A3KJ 2QLZA 1OCPA 2KPJA 3MCZA 4IL6C 2ZXWH 3U1KA 2R1JL 3NDBB 3DKXA 4QTRA 2WV0A 1GV2A 2DOFA 1POGA 1VPWA 1S72I 1P92A 4LITA 3H9QA 4JX6A 1ZK8A 3EPZA 2A6CA 1OPCA 1OFCX 1ON1A 4Y17A 1T95A 4EEFG 1YHQI 3HC7A 1BA5A 1O7FA 3BTIA 5HODA 2A68F 3I58A 2PIJA 3VK0A 3UKGA 1A31A 2XI8A 4D7MA 4A3EJ 5JLWA 4EQZA 4HV5A 1MFQC 2NVQJ 5KK1A 2V7FA 1REPC 1HLVA 4PJLA 2VXDA 2FRHA 2IAIA 3CP8A 1N78A 2OCCH 3FX3A 1N75A 2HGCA 4NUBA 4L5IA 2MXDA 3JR9A 3JRGA 2DPUA 1X4OA 2DW4A 4R8HA 4AD9A 4WWCA 3JXCL 3F8NA 1PYVA 3OMYA 3S15J 1G3TA 3GTJJ 1YSEA 1XGSA 3QPSA 2PUAA 1DGWY 5K5QA 2VN2A 3BP8A 1BC8C 1BR4A 3I54A 2NVXJ 5F04A 2DMQA 4DYQA 2HEOA 5HNHA 1B8IB 1QU3A 3T0YA 2XIUA 4JK1X 2L02A 3NARA 2ESNA 3NZLA 4GYGA 1TQIA 2HFHA 4GXOA 1BJAA 2ZC2A 4A69C 4YG4A 2Z5UA 3H3ZA 4M9XA 1WJCA 3HZJA 3WTTC 2M0CA 3IRRA 2JWTA 2PMUA 3NWSA 4UUSB 3JCUC 5D4SA 2O7OA 2EBIA 2LH9A 5LRRA 5LD2C 2HCNA 4BH9A 5H6QA 1HKQA 1FSEA 1MBJA 3CJQB 3TP0A 3CLQA 5DD4A 2PUDA 3LISA 2R92J 2FMYA 4FHTA 2V79A 1P7JA 2E36A 4IRIA 1YRNA 3L2UA 1ZGAA 5LGNA 1ZRCA 3OSFA 3DWLE 5F08A 5DS9A 3CUQC 2KIUA 3LL7A 1R71A 3MKWB 2PBIA 1EF4A 5J8FA 2CV1A 3KP6A 4Y3OA 4LG0A 3A9YA 4Z6YA 2HPIA 3S93A 4BHCA 3GUDA 4UV9A 4KT5C 3PIPF 1LVAA 1ODDA 4RLQA 3I5UA 2EA4A 2JA8J 2VLAA 3BJOA 3SHFA 3GZ5A 5EZGA 2VT2A 3L2RA 3OYDA 4F55A 3GFJA 3KIOA 1MDMA 3S1MJ 3BR5A 3CP2A 2LOOA 4HW0A 3RZDJ 1ZQ3P 5FO5A 3BD1A 1CF7A 4XICA 1KONA 2V26A 3H1CA 3S2HJ 1M1EB 1RZRD 1B9NA 2PE5A 3MFKA 4FASD 2EIKH 4MFDA 1DGRM 2XF6A 4BQOA 1FOXA 1WI3A 1IRZA 2OAZA 3CO6C 5IOYA 1FBUA 3WHCA 1FPQA 5FB2A 3ZQIA 3CCLI 5BPIA 1JKQC 2XXAA 5M5XJ 4NDLA 3CCYA 3BC8A 4WXDA 4Q4ZF 4ZH4F 1ETWA 1G8XA 4CA0A 2H8RA 1T2KA 4NDWA 2NS8A 2NNYA 1BJZA 2A61A 2V9PA 2E1MC 3HRMA 2YX7A 1AWCA 2R5ZA 3TRBA 1FBQA 4JBAA 1VQ6I 2LCVA 4M6VA 4CYCA 1KQ8A 4LOCA 1V55H 2E19A 1F1ZA 3F0CA 3SZTA 1FIPA 4CCMA 5M5YJ 1RIOH 3OQMA 3FK7A 3H0DA 4GQMA 1OYWA 5J8CA 3BWGA 3VWBA 4M74A 1USSA 1NERA 2PUEA 1D0ZA 3BPXA 1BI1A 1V5EA 1QBJA 1ETYA 2WY8Q 2MG4A 4OU0A 5JFRA 3T5XA 2PJRB 2CV0A 2Z33A 4G6TB 3JRHA 3PE5A 3G0TA 5HDGA 3C18A 3FHNA 4LB6B 2G7HA 3FDYA 4A3BJ 4ENJA 5ILUA 2DBBA 1SEUA 1YW7A 2K9LA 3RKQA 2JA2A 4XORA 5CLSA 1LJ9A 4KMUX 4PZJA 3H3VK 1JT0A 1P4AA 1WH7A 2ZFUA 4BE1A 4L0ZB 1X57A 2DFHA 2KJBA 2F5FA 3BDDA 4XONA 4YIFA 4OAYA 2L2OA 2M8EA 5H2FC 2P7CB 2ICPA 4I09A 1T6SA 1R36A 2XAJA 2EFQA 1MJBA 3VDXA 2CG4A 2RQPA 4PU7A 4X6AJ 2M5WA 3HHGA 4IX7A 2ZBKA 4D7NA 3ABMH 3QPLA 5CVUA 2VBYA 1KGSA 2XB0X 3ABKH 5JVGF 1AHDP 5BS6A 3S3MA 3HKZN 3E0JB 1IXRC 2GIZA 3HXLA 1D0YA 4HNVA 2E1MB 1OLTA 2XRNA 2J5OA 3ULQB 1GVJA 2A6HF 3I64A 3K2AA 3HL2A 3DLLF 4Q48A 2O4AA 3FXQA 3LOCA 4A3MJ 1MH3A 5LEKA 2DK5A 2FBKA 3G1MA 3RYPA 1UXCA 2VKVA 5H20A 2QEXI 2DOEA 3GZCA 1RPEL 2A5WA 2E71A 2R7WA 4L5JA 3O6BB 4EGYA 4KYWA 3B73A 4U0WA 2IS2A 4A12A 3EETA 4XLPF 3CO7C 3ONQA 5DCMB 1RUOA 5FLXK 1S3JA 4M71A 3I0TA 4ZTJA 2M7BA 1R49A 4J19A 1WZ2A 3U3WA 2PXUA 3N05A 3FMSA 4HV6A 1FNNA 4WX9A 3KYDB 4F93B 1JKPC 2LVSA 5LHHA 3GZDC 4Y4RA 2HS5A 1U0JA 3NQOA 3MEXA 3LNQA 2J5PA 5KVRA 2VEOA 1YG2A 2MSYA 2JSPA 2LY2A 1LEAA 4JOMA 1TWFJ 4GO1A 5GTHC 1VTNC 2AWIA 1H0MA 4FE4A 3CCUI 2LYLA 2JUCA 4PJJA 5EF6A 2QVOA 5IY5H 5E79C 2F4IA 4YIIA 2XXPA 1XSVA 3TDZC 2O3FA 1XMXA 4G6QA 5KHDA 1WFXA 1UMQA 4AUXA 1MBGA 1SD6A 2JPBA 5HDNA 1XGOA 4IHVA 3F8CA 2E5NA 3QWLA 1MBKA 3D5SC 2LP0A 3E6CC 1B59A 1LB2A 5LLQA 3QU3A 2EA2A 4BUPA 4Y13A 3G3ZA 1IN5A 4I6UA 3C2GA 2QENA 3S14J 2LLVA 4A0ZA 3RDIA 2IBDA 2FNPA 1OJLA 4LD5A 3M3YJ 3P7NA 1QZYA 3J81Z 3KYLA 2GLOA 5GAEJ 2VPLA 1MMNA 1J59A 3OQOA 3DBRB 5DV5A 1OISA 5M5WJ 3SYTA 1PUFA 3C1DA 4HX7A 2Y9ZA 5IP9J 2BY2A 1LFBA 2DDBA 1BIBA 3BCBA 2PXDA 3HRTA 5IYBJ 3S32A 1TWGJ 3JTGA 3E1SA 2STTA 1TWCJ 3DXJF 1F5TA 2K85A 3PL8A 2O9LA 5DEQA 3GTLJ 3V8KA 3OYEA 1QO0D 1UCRA 1ZPQA 2M4KA 2XGXA 3TELA 2QKMB 2XV4S 4LGWA 4JX5A 5FGMA 2DT7B 1PDNC 1JTXA 4AWXB 4G94A 2VI6A 1Z05A 1QP4A 4P1WA 2HR3A 3LA3A 5TRDA 5CVVA 3M8FA 2K4BA 1YS7A 1KQ9A 1UHWA 3CMMA 1DDNA 4X0GA 3BDNA 1E3PA 3RPUD 1MNEA 2EZKA 1BI3A 3I9V2 3PFIA 1TNSA 2XGCA 3WE2A 4DYCA 2OD5A 1K4TA 4JX4A 2LF8A 1MD0A 1TTYA 1SD7A 4YFXF 2EV5A 2PI0A 3E97A 2W00A 2KP6A 2FJ1A 2WB1N 2YX4A 2G9WA 3JRIA 4O8BA 4JQDA 1S9HA 2G0EA 1JTYA 1WJEA 4B48A 2EFWA 3SCFA 4W97A 1XSDA 2L4MA 3LFPA 1LE8A 2K9SA 4M3DA 2JUGA 2FXAA 2VUMJ 4XL9A 3LSHA 3GN5A 3ME5A 5L3GA 2C6YA 1XDSA 1ENHA 4HF0A 3JRFA 1Y1VJ 5CVRA 4E7HA 4Q5SF 1UTXA 1TT5B 2L49A 4XQFA 2L3DA 3PNYA 3CROL 4XR6A 3EUSA 1ZH5A 3DEUA 4XKWA 3MMYB 3W2VA 3CC4I 2LYRA 3OYCA 2XSJC 1S6LA 1VZ0A 2M3AA 2FNAA 5E3MA 3WGHA 1YFHA 1G3YA 1R6RA 2L9VA 2V9VA 5FLVA 3HEFA 5GAHi 3TOAA 4U0YA 4XK4A 4B3XA 5F27A 4FX0A 4U7BA 3HPHA 4D5FA 4I6RA 2LLKA 3RIRA 4B43A 2K9QA 4KITB 2KRHA 3CF5F
chains in the Genus database with same CATH topology
2R93J 2Y2ZA 4BY7J 2R5ZB 2DN0A 3WHBA 2XGDA 1D5YA 1DU0A 2ID3A 3ZQHA 3HGYA 1GV5A 4GFBA 3S16J 2Y31A 1FIAA 3JREA 2HDDA 5FLMJ 2IV1A 3UFDA 4Z58A 2CUEA 2PMZN 4W1UA 2L7FP 2YU9J 1JWLA 3G1LA 5M3MJ 4J1WA 3BR3A 2JA7J 4MIMA 4Y52J 2EZLA 2HYJA 3BTJA 3S1NJ 3LSPA 2E2IJ 5J3LA 1QPZA 3HOZJ 2E1OA 3Q0VA 2HSGA 4PU4C 1LMB3 3CMYA 2EBYA 4I6ZA 1QQAA 5EDNA 4I76A 3OP9A 1RZRA 2LYSA 1Q1VA 1ITYA 4FCYA 2CJJA 4UUTA 3G1OA 3W6VA 2ME6A 2CQQA 1HDPA 2FQ4A 1EFAA 5K7HA 5DTDA 1JUSA 5J1RA 3G7DA 3LFPA 5EG0A 2O8KA 4I8TA 4M3EA 1ZS4A 2HI3A 3LSRA 2JA6J 1Y1WJ 1JKRC 2X6OA 1ZZ6A 1IDZA 3OOUA 2ID6A 5IYDJ 2OPTA 2ZB9A 3ZQCA 1ZZ7A 2BNNA 3JXDL 1L1MA 2X48A 1NK3P 5JLXA 3KZ3A 4M3FA 2DJNA 4C3IJ 2LYKA 3IVPA 4DW6A 3S8QA 1MSFC 3HZIB 2WAQN 3TW7A 1FTZA 1TC3C 2JVLA 5EGOB 1RIOA 2W48A 4JYKA 2R0QC 9ANTA 1GVDA 1ZKGA 3HBLA 4FE7A 3CDLA 1P7IA 1VFCA 2R63A 1MNMC 5E3LA 3F51A 4A3KJ 1OCPA 2BNOA 2KPJA 1IUFA 1WIZA 2MGQA 4J1XA 2KEKA 2R1JL 2FJRA 5F0FA 2PPXA 2ELKA 4QTRA 4JCYA 1GV2A 1POGA 2AXZA 1VPWA 1JT6A 2PUFA 4JX6A 1ZK8A 4FISA 2A6CA 3PM1A 3BG3A 5K98B 1OFCX 3E7LA 2GZUA 4EEFG 1NTCA 3MN2A 1WH5A 3TEDA 3BG9A 1BA5A 4JCXA 2DTZA 5IP6A 3F52A 3BTIA 5HODA 3VK0A 2PIJA 3UKGA 3ZQLA 3DCFA 3I4NJ 2XI8A 4D7MA 4OB4A 4A3EJ 5JLWA 2DA6A 2NVQJ 2DA4A 4XIDA 1HLVA 2Y0SN 4D5CA 4V2GA 5GPAA 3GTKJ 4I6TA 2IAIA 3BR1A 1BW6A 2QCOA 2HQ5A 3MVPA 2GRLA 1U9OA 2O49A 3JR9A 1MH4A 3JRGA 1RETA 2HINA 2KZ8A 2XPVA 3JXCL 1ZZCA 2EZIA 3BQZA 3LSGA 3S15J 1LQCA 3I4MJ 4S0HB 3GTJJ 1YSEA 3QPSA 1ZZBA 1W0TA 5EEAA 2PUAA 2HOTA 5BNGA 2DMTA 2MQKA 5FKKA 2NVXJ 3A02A 4M3GA 5F04A 1PERL 2DMQA 4DYQA 2L7ZA 2KEIA 3GTMJ 1B8IB 1ZZ8A 1VI0A 1JJ6C 2XIUA 2X9DA 2JJ7A 4FN3A 5E3OA 3NARA 3S2DJ 3H5TA 4M3BA 2LTPA 5FKMA 1NK2P 1MBFA 4A69C 1TWAJ 4YG4A 1R69A 2WUSR 1B72A 2E2JJ 1ZTRA 2L0KA 2K40A 2M0CA 3HM5A 2LD5A 4IVZA 2HOAA 4BXXJ 2JWTA 3FYMA 2DA2A 1UXDA 4UUSB 5J1YA 2O7OA 2EBIA 3S1RJ 2YUSA 3SFIA 1MBJA 1T33A 3TP0A 4X4EA 3B6AA 3CECA 2PUDA 1GT0C 4BBRJ 3LISA 1RESA 2R92J 4PU8A 3G5GA 2AHQA 1P7JA 4C3HJ 1YRNA 4IHYA 1W0UA 4L5EA 3OSFA 5F08A 5DS9A 1T56A 4BY1J 1U8BA 3KXAA 3FMYA 3O8GA 1JFTA 2WV1A 1EF4A 1WH6A 1QPIA 2O38A 1UHSA 1IGNA 3MKLA 1O4XA 2XSDC 3GTGJ 4Z5DA 1SANA 1VF9A 1JUPA 1DW9A 2IEKA 2JA8J 2JCGA 3ZQFA 3PO2J 5EZGA 4Y7NJ 2AXUA 2R5YA 5FKLA 2HXOA 3S1MJ 2QF7A 3BR5A 1ZQ3P 3RZDJ 2I10A 3ZHMA 1A6IA 2M2EA 3BD1A 4XICA 3FIWA 2EWTA 1X2NA 3S2HJ 1ZZ9A 1RZRD 2PE5A 4MFDA 1RKWA 4B3AA 3BR0A 1WI3A 3RZOJ 2DMUA 1IRZA 1B0NA 5IOYA 3WHCA 1IJWC 3ZQIA 1JGGA 3QQ6A 4IEJA 5J1UA 3TP3A 1JKQC 2NS7A 4QSHA 5M5XJ 4NDLA 3CCYA 5C3EJ 4YARA 1JH9A 1ETWA 1RZSA 1ETXA 2LY9A 2H8RA 1RPWA 4NDWA 2NS8A 1BJZA 1SFOJ 2JA5J 2R5ZA 3TRBA 3JRCA 3O9XA 2HXIA 2XRLA 4X4FA 2AW6A 2LCVA 4M6VA 4CYCA 5A7LA 3QYXA 4LOCA 5M5YJ 2E19A 3OQMA 3F0CA 1FIPA 1I50J 1G2HA 3FK7A 2ME0A 1FJLA 3GTQJ 4GQMA 4UUSA 1K83J 2FX0A 1F36A 1NERA 1JKOC 2PUEA 3PO3J 1ETYA 2MG4A 1IDYA 2H1KA 4XRSA 2JN6A 1GUUA 1H88C 3ZQGA 5GP9A 4IHXA 5K7ZA 3IV5A 3JRHA 5C4XJ 1QP7A 4XRSG 2NOGA 4ABZA 3BTCA 1APLC 4A3BJ 2PUGA 1QP0A 2FD5A 1ETVA 3RKQA 1ADRA 3SCHA 3H3VK 1BW5A 5FJ8J 1JT0A 5FKNA 1WH7A 5EYRA 1GDTA 1X57A 2IVBA 2OFYA 2AXVA 2K9NA 2LFBA 1VNDA 4Z59A 3D1NI 2ICPA 2LKXA 3Q0WA 3BT9A 3Q0UA 4PU7A 4MLOA 4X6AJ 3F6WA 3PXPA 1F43A 4Z5HA 1ZVVA 2AUWA 1HF0A 4D7NA 4MCTA 1QQBA 3QPLA 3RZZA 1HOMA 4JP0A 2XB0X 1AHDP 3HKZN 2CRGA 2M34A 1UG2A 5F1JA 1WETA 2TRTA 1X2LA 4HNVA 4FTHA 1WCMJ 1LCCA 1MBEA 5EZHA 3QWGA 1ETKA 3K2AA 2CUFA 2O4AA 3LOCA 4A3MJ 1MH3A 4X4IA 1U9NA 1Y9QA 5F0HA 1ETQA 3G1MA 1XWRA 1UXCA 2VKVA 1BDHA 3TW6A 5IP7J 4X1EA 3JXBC 1RPEL 1SQ8A 3LSJA 3ZOBA 3FYAA 1U78A 1XC5A 3GN5B 4F8DA 2KDZA 3A03A 4J19A 3U3WA 1QRYA 2N8GA 3H0GJ 1B8IA 1AKHB 4Y42A 4AC0A 2VPRA 1JKPC 2LVSA 3HOUJ 3S17J 1XS9A 2XJ3A 1PUFB 4A93J 2EZHA 3K7AJ 2WIUB 3LNQA 1Z77A 3SDGA 1IV6A 2XCJA 2JK3A 4QIWN 4C3JJ 3OQNA 4DZPA 2VKEA 1WH8A 2MSYA 5M3FJ 1LLIA 1K61A 2DA5A 1I6HJ 2IVQA 2XB5A 2GRMA 1ZAYA 2R7ZJ 3JRBA 2BNMA 1TWFJ 3HOXJ 2LR8A 2AWIA 1PNRA 4FE4A 1YRNB 1E3OC 2LYLA 4MFEA 1ORKA 5EF6A 3DNVB 1RR7A 1JUMA 4AYBN 3BTLA 1AKHA 3OSGA 2D5VA 1Z0XA 3Q3SA 1WPKA 4AUXA 1UMQA 4RDUA 4A3GJ 2LYJA 1MBGA 3QF3A 3HOVJ 1X58A 1H89C 1DU6A 4IHVA 4X4GA 4X4BA 2GBYA 1MBKA 4B1RA 1FEXA 2L7MP 2LP0A 2COBA 2DMNA 2P81A 4DYRA 3A01A 4PU3C 2EQRA 1JFSA 1MBHA 3OMTA 3HOYJ 3KJXA 3BQYA 3C2BA 5EGOA 4I6UA 1H8AC 4IHWA 3S14J 5F0CA 2OR1L 4MO7A 3FKIJ 3CLCA 2ECBA 2LYPA 2IBDA 1R9TJ 3BG5A 4FBIA 1BDIA 3VPRA 1OJLA 3BR6A 3HB9A 2JMWA 3IH4A 3CQZJ 2CQXA 1B72B 1MSEC 2GM4A 3M3YJ 4BBSJ 2PUBA 2B5AA 2M9HA 3B6CA 2GLOA 4A3LJ 3GTPJ 1POUA 2DA7A 1NEQA 3JRDA 5M5WJ 4GHJA 3OQOA 1JJ8C 1PUFA 2LK2A 2Y9ZA 1IG7A 3R1FA 1CJGA 1PRVA 2NVYJ 4A3CJ 4IWRA 5IP9J 2Y9YA 3S1QJ 1LFBA 2L8NA 5IYBJ 1XG1A 1TWGJ 2HOSA 4YG7B 2KT0A 1TWCJ 5IOZA 5IPAA 2O9LA 3B7HA 5K7FA 3GTLJ 5IYCJ 3IH3A 1ZPQA 1HCRA 3SCGA 1IC8A 2CROA 4YBAA 4JX5A 4C2MJ 4MCXA 1I3QJ 1JTXA 3BR2A 3BS3A 3QQAA 2M8GX 2MEZA 2VI6A 4V2FA 1WGXA 1LCDA 1QP4A 1OSLA 1ETOA 3SJMA 2Y30A 1ZGWA 2LYQA 1ZR4A 1DWKA 2BJCA 4RBOA 1QVUA 2PUCA 2XPUA 3BDNA 1A5JA 2DA1A 1PRAA 2EZKA 2NVTJ 2XGCA 4DYCA 3A01B 4JX4A 1R63A 3HDDA 3GBFA 4DZJA 3HOWJ 5C44J 3GBGA 3NAUA 3IH2A 3RQIA 3GTOJ 2IUOA 2CSFA 3FK6A 4B4CA 2EF8A 1S7EA 3JRAA 2E2HJ 2XPWA 2EH3A 2FJ1A 2WB1N 2RAEA 3JRIA 4O8BA 3ZKCA 4JQDA 4G12A 3DEWA 2G0EA 1JTYA 2IU7A 3SCFA 4W97A 3FISA 1LE8A 4YG1A 2TCTA 3L1PA 1ZR2A 4A3DJ 2K9SA 4IA8A 1RKTA 4M3DA 1TWHJ 1PRUA 2VUMJ 5GPCA 3GN5A 1HDDC 3M4OJ 1ZUGA 1ENHA 3JRFA 1Y1VJ 1FTTA 2YS9A 1OCTC 2MW8A 3OIOA 1UTXA 2L49A 2R5YB 2AO9A 1LFUP 1Y7YA 4Z5CA 2DA3A 3ZHIA 4X4HA 3O8HA 2KEJA 3CROL 5EG0B 1BL0A 2L9RA 3EUSA 4A3IJ 2CU7A 4XRMA 2LYRA 4X4DA 1LE8B 2IVGA 4X4CA 2DMPA 5E3MA 4CYCB 4A3FJ 5C4JJ 1AU7A 5FLVA 3HEFA 2XGEA 5E3NA 1QVTA 2OF7A 4XK4A 1X2MA 5F27A 2B63J 5FKOA 4D5FA 1CQTA 4I6RA 2ICTA 2LLKA 3HGGA 4A3JJ 2K9QA 3MLFA 4BKXA 2ECCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 J;  2Y2Z A;  4BY7 J;  2R5Z B;  2DN0 A;  3WHB A;  2XGD A;  1D5Y A;  1DU0 A;  2ID3 A;  3ZQH A;  3HGY A;  1GV5 A;  4GFB A;  3S16 J;  2Y31 A;  1FIA A;  3JRE A;  2HDD A;  5FLM J;  2IV1 A;  3UFD A;  4Z58 A;  2CUE A;  2PMZ N;  4W1U A;  2L7F P;  2YU9 J;  1JWL A;  3G1L A;  5M3M J;  4J1W A;  3BR3 A;  2JA7 J;  4MIM A;  4Y52 J;  2EZL A;  2HYJ A;  3BTJ A;  3S1N J;  3LSP A;  2E2I J;  5J3L A;  1QPZ A;  3HOZ J;  2E1O A;  3Q0V A;  2HSG A;  4PU4 C;  1LMB 3;  3CMY A;  2EBY A;  4I6Z A;  1QQA A;  5EDN A;  4I76 A;  3OP9 A;  1RZR A;  2LYS A;  1Q1V A;  1ITY A;  4FCY A;  2CJJ A;  4UUT A;  3G1O A;  3W6V A;  2ME6 A;  2CQQ A;  1HDP A;  2FQ4 A;  1EFA A;  5K7H A;  5DTD A;  1JUS A;  5J1R A;  3G7D A;  3LFP A;  5EG0 A;  2O8K A;  4I8T A;  4M3E A;  1ZS4 A;  2HI3 A;  3LSR A;  2JA6 J;  1Y1W J;  1JKR C;  2X6O A;  1ZZ6 A;  1IDZ A;  3OOU A;  2ID6 A;  5IYD J;  2OPT A;  2ZB9 A;  3ZQC A;  1ZZ7 A;  2BNN A;  3JXD L;  1L1M A;  2X48 A;  1NK3 P;  5JLX A;  3KZ3 A;  4M3F A;  2DJN A;  4C3I J;  2LYK A;  3IVP A;  4DW6 A;  3S8Q A;  1MSF C;  3HZI B;  2WAQ N;  3TW7 A;  1FTZ A;  1TC3 C;  2JVL A;  5EGO B;  1RIO A;  2W48 A;  4JYK A;  2R0Q C;  9ANT A;  1GVD A;  1ZKG A;  3HBL A;  4FE7 A;  3CDL A;  1P7I A;  1VFC A;  2R63 A;  1MNM C;  5E3L A;  3F51 A;  4A3K J;  1OCP A;  2BNO A;  2KPJ A;  1IUF A;  1WIZ A;  2MGQ A;  4J1X A;  2KEK A;  2R1J L;  2FJR A;  5F0F A;  2PPX A;  2ELK A;  4QTR A;  4JCY A;  1GV2 A;  1POG A;  2AXZ A;  1VPW A;  1JT6 A;  2PUF A;  4JX6 A;  1ZK8 A;  4FIS A;  2A6C A;  3PM1 A;  3BG3 A;  5K98 B;  1OFC X;  3E7L A;  2GZU A;  4EEF G;  1NTC A;  3MN2 A;  1WH5 A;  3TED A;  3BG9 A;  1BA5 A;  4JCX A;  2DTZ A;  5IP6 A;  3F52 A;  3BTI A;  5HOD A;  3VK0 A;  2PIJ A;  3UKG A;  3ZQL A;  3DCF A;  3I4N J;  2XI8 A;  4D7M A;  4OB4 A;  4A3E J;  5JLW A;  2DA6 A;  2NVQ J;  2DA4 A;  4XID A;  1HLV A;  2Y0S N;  4D5C A;  4V2G A;  5GPA A;  3GTK J;  4I6T A;  2IAI A;  3BR1 A;  1BW6 A;  2QCO A;  2HQ5 A;  3MVP A;  2GRL A;  1U9O A;  2O49 A;  3JR9 A;  1MH4 A;  3JRG A;  1RET A;  2HIN A;  2KZ8 A;  2XPV A;  3JXC L;  1ZZC A;  2EZI A;  3BQZ A;  3LSG A;  3S15 J;  1LQC A;  3I4M J;  4S0H B;  3GTJ J;  1YSE A;  3QPS A;  1ZZB A;  1W0T A;  5EEA A;  2PUA A;  2HOT A;  5BNG A;  2DMT A;  2MQK A;  5FKK A;  2NVX J;  3A02 A;  4M3G A;  5F04 A;  1PER L;  2DMQ A;  4DYQ A;  2L7Z A;  2KEI A;  3GTM J;  1B8I B;  1ZZ8 A;  1VI0 A;  1JJ6 C;  2XIU A;  2X9D A;  2JJ7 A;  4FN3 A;  5E3O A;  3NAR A;  3S2D J;  3H5T A;  4M3B A;  2LTP A;  5FKM A;  1NK2 P;  1MBF A;  4A69 C;  1TWA J;  4YG4 A;  1R69 A;  2WUS R;  1B72 A;  2E2J J;  1ZTR A;  2L0K A;  2K40 A;  2M0C A;  3HM5 A;  2LD5 A;  4IVZ A;  2HOA A;  4BXX J;  2JWT A;  3FYM A;  2DA2 A;  1UXD A;  4UUS B;  5J1Y A;  2O7O A;  2EBI A;  3S1R J;  2YUS A;  3SFI A;  1MBJ A;  1T33 A;  3TP0 A;  4X4E A;  3B6A A;  3CEC A;  2PUD A;  1GT0 C;  4BBR J;  3LIS A;  1RES A;  2R92 J;  4PU8 A;  3G5G A;  2AHQ A;  1P7J A;  4C3H J;  1YRN A;  4IHY A;  1W0U A;  4L5E A;  3OSF A;  5F08 A;  5DS9 A;  1T56 A;  4BY1 J;  1U8B A;  3KXA A;  3FMY A;  3O8G A;  1JFT A;  2WV1 A;  1EF4 A;  1WH6 A;  1QPI A;  2O38 A;  1UHS A;  1IGN A;  3MKL A;  1O4X A;  2XSD C;  3GTG J;  4Z5D A;  1SAN A;  1VF9 A;  1JUP A;  1DW9 A;  2IEK A;  2JA8 J;  2JCG A;  3ZQF A;  3PO2 J;  5EZG A;  4Y7N J;  2AXU A;  2R5Y A;  5FKL A;  2HXO A;  3S1M J;  2QF7 A;  3BR5 A;  1ZQ3 P;  3RZD J;  2I10 A;  3ZHM A;  1A6I A;  2M2E A;  3BD1 A;  4XIC A;  3FIW A;  2EWT A;  1X2N A;  3S2H J;  1ZZ9 A;  1RZR D;  2PE5 A;  4MFD A;  1RKW A;  4B3A A;  3BR0 A;  1WI3 A;  3RZO J;  2DMU A;  1IRZ A;  1B0N A;  5IOY A;  3WHC A;  1IJW C;  3ZQI A;  1JGG A;  3QQ6 A;  4IEJ A;  5J1U A;  3TP3 A;  1JKQ C;  2NS7 A;  4QSH A;  5M5X J;  4NDL A;  3CCY A;  5C3E J;  4YAR A;  1JH9 A;  1ETW A;  1RZS A;  1ETX A;  2LY9 A;  2H8R A;  1RPW A;  4NDW A;  2NS8 A;  1BJZ A;  1SFO J;  2JA5 J;  2R5Z A;  3TRB A;  3JRC A;  3O9X A;  2HXI A;  2XRL A;  4X4F A;  2AW6 A;  2LCV A;  4M6V A;  4CYC A;  5A7L A;  3QYX A;  4LOC A;  5M5Y J;  2E19 A;  3OQM A;  3F0C A;  1FIP A;  1I50 J;  1G2H A;  3FK7 A;  2ME0 A;  1FJL A;  3GTQ J;  4GQM A;  4UUS A;  1K83 J;  2FX0 A;  1F36 A;  1NER A;  1JKO C;  2PUE A;  3PO3 J;  1ETY A;  2MG4 A;  1IDY A;  2H1K A;  4XRS A;  2JN6 A;  1GUU A;  1H88 C;  3ZQG A;  5GP9 A;  4IHX A;  5K7Z A;  3IV5 A;  3JRH A;  5C4X J;  1QP7 A;  4XRS G;  2NOG A;  4ABZ A;  3BTC A;  1APL C;  4A3B J;  2PUG A;  1QP0 A;  2FD5 A;  1ETV A;  3RKQ A;  1ADR A;  3SCH A;  3H3V K;  1BW5 A;  5FJ8 J;  1JT0 A;  5FKN A;  1WH7 A;  5EYR A;  1GDT A;  1X57 A;  2IVB A;  2OFY A;  2AXV A;  2K9N A;  2LFB A;  1VND A;  4Z59 A;  3D1N I;  2ICP A;  2LKX A;  3Q0W A;  3BT9 A;  3Q0U A;  4PU7 A;  4MLO A;  4X6A J;  3F6W A;  3PXP A;  1F43 A;  4Z5H A;  1ZVV A;  2AUW A;  1HF0 A;  4D7N A;  4MCT A;  1QQB A;  3QPL A;  3RZZ A;  1HOM A;  4JP0 A;  2XB0 X;  1AHD P;  3HKZ N;  2CRG A;  2M34 A;  1UG2 A;  5F1J A;  1WET A;  2TRT A;  1X2L A;  4HNV A;  4FTH A;  1WCM J;  1LCC A;  1MBE A;  5EZH A;  3QWG A;  1ETK A;  3K2A A;  2CUF A;  2O4A A;  3LOC A;  4A3M J;  1MH3 A;  4X4I A;  1U9N A;  1Y9Q A;  5F0H A;  1ETQ A;  3G1M A;  1XWR A;  1UXC A;  2VKV A;  1BDH A;  3TW6 A;  5IP7 J;  4X1E A;  3JXB C;  1RPE L;  1SQ8 A;  3LSJ A;  3ZOB A;  3FYA A;  1U78 A;  1XC5 A;  3GN5 B;  4F8D A;  2KDZ A;  3A03 A;  4J19 A;  3U3W A;  1QRY A;  2N8G A;  3H0G J;  1B8I A;  1AKH B;  4Y42 A;  4AC0 A;  2VPR A;  1JKP C;  2LVS A;  3HOU J;  3S17 J;  1XS9 A;  2XJ3 A;  1PUF B;  4A93 J;  2EZH A;  3K7A J;  2WIU B;  3LNQ A;  1Z77 A;  3SDG A;  1IV6 A;  2XCJ A;  2JK3 A;  4QIW N;  4C3J J;  3OQN A;  4DZP A;  2VKE A;  1WH8 A;  2MSY A;  5M3F J;  1LLI A;  1K61 A;  2DA5 A;  1I6H J;  2IVQ A;  2XB5 A;  2GRM A;  1ZAY A;  2R7Z J;  3JRB A;  2BNM A;  1TWF J;  3HOX J;  2LR8 A;  2AWI A;  1PNR A;  4FE4 A;  1YRN B;  1E3O C;  2LYL A;  4MFE A;  1ORK A;  5EF6 A;  3DNV B;  1RR7 A;  1JUM A;  4AYB N;  3BTL A;  1AKH A;  3OSG A;  2D5V A;  1Z0X A;  3Q3S A;  1WPK A;  4AUX A;  1UMQ A;  4RDU A;  4A3G J;  2LYJ A;  1MBG A;  3QF3 A;  3HOV J;  1X58 A;  1H89 C;  1DU6 A;  4IHV A;  4X4G A;  4X4B A;  2GBY A;  1MBK A;  4B1R A;  1FEX A;  2L7M P;  2LP0 A;  2COB A;  2DMN A;  2P81 A;  4DYR A;  3A01 A;  4PU3 C;  2EQR A;  1JFS A;  1MBH A;  3OMT A;  3HOY J;  3KJX A;  3BQY A;  3C2B A;  5EGO A;  4I6U A;  1H8A C;  4IHW A;  3S14 J;  5F0C A;  2OR1 L;  4MO7 A;  3FKI J;  3CLC A;  2ECB A;  2LYP A;  2IBD A;  1R9T J;  3BG5 A;  4FBI A;  1BDI A;  3VPR A;  1OJL A;  3BR6 A;  3HB9 A;  2JMW A;  3IH4 A;  3CQZ J;  2CQX A;  1B72 B;  1MSE C;  2GM4 A;  3M3Y J;  4BBS J;  2PUB A;  2B5A A;  2M9H A;  3B6C A;  2GLO A;  4A3L J;  3GTP J;  1POU A;  2DA7 A;  1NEQ A;  3JRD A;  5M5W J;  4GHJ A;  3OQO A;  1JJ8 C;  1PUF A;  2LK2 A;  2Y9Z A;  1IG7 A;  3R1F A;  1CJG A;  1PRV A;  2NVY J;  4A3C J;  4IWR A;  5IP9 J;  2Y9Y A;  3S1Q J;  1LFB A;  2L8N A;  5IYB J;  1XG1 A;  1TWG J;  2HOS A;  4YG7 B;  2KT0 A;  1TWC J;  5IOZ A;  5IPA A;  2O9L A;  3B7H A;  5K7F A;  3GTL J;  5IYC J;  3IH3 A;  1ZPQ A;  1HCR A;  3SCG A;  1IC8 A;  2CRO A;  4YBA A;  4JX5 A;  4C2M J;  4MCX A;  1I3Q J;  1JTX A;  3BR2 A;  3BS3 A;  3QQA A;  2M8G X;  2MEZ A;  2VI6 A;  4V2F A;  1WGX A;  1LCD A;  1QP4 A;  1OSL A;  1ETO A;  3SJM A;  2Y30 A;  1ZGW A;  2LYQ A;  1ZR4 A;  1DWK A;  2BJC A;  4RBO A;  1QVU A;  2PUC A;  2XPU A;  3BDN A;  1A5J A;  2DA1 A;  1PRA A;  2EZK A;  2NVT J;  2XGC A;  4DYC A;  3A01 B;  4JX4 A;  1R63 A;  3HDD A;  3GBF A;  4DZJ A;  3HOW J;  5C44 J;  3GBG A;  3NAU A;  3IH2 A;  3RQI A;  3GTO J;  2IUO A;  2CSF A;  3FK6 A;  4B4C A;  2EF8 A;  1S7E A;  3JRA A;  2E2H J;  2XPW A;  2EH3 A;  2FJ1 A;  2WB1 N;  2RAE A;  3JRI A;  4O8B A;  3ZKC A;  4JQD A;  4G12 A;  3DEW A;  2G0E A;  1JTY A;  2IU7 A;  3SCF A;  4W97 A;  3FIS A;  1LE8 A;  4YG1 A;  2TCT A;  3L1P A;  1ZR2 A;  4A3D J;  2K9S A;  4IA8 A;  1RKT A;  4M3D A;  1TWH J;  1PRU A;  2VUM J;  5GPC A;  3GN5 A;  1HDD C;  3M4O J;  1ZUG A;  1ENH A;  3JRF A;  1Y1V J;  1FTT A;  2YS9 A;  1OCT C;  2MW8 A;  3OIO A;  1UTX A;  2L49 A;  2R5Y B;  2AO9 A;  1LFU P;  1Y7Y A;  4Z5C A;  2DA3 A;  3ZHI A;  4X4H A;  3O8H A;  2KEJ A;  3CRO L;  5EG0 B;  1BL0 A;  2L9R A;  3EUS A;  4A3I J;  2CU7 A;  4XRM A;  2LYR A;  4X4D A;  1LE8 B;  2IVG A;  4X4C A;  2DMP A;  5E3M A;  4CYC B;  4A3F J;  5C4J J;  1AU7 A;  5FLV A;  3HEF A;  2XGE A;  5E3N A;  1QVT A;  2OF7 A;  4XK4 A;  1X2M A;  5F27 A;  2B63 J;  5FKO A;  4D5F A;  1CQT A;  4I6R A;  2ICT A;  2LLK A;  3HGG A;  4A3J J;  2K9Q A;  3MLF A;  4BKX A;  2ECC A; 
#chains in the Genus database with same CATH topology
 4YEL A;  4AYB A;  2R93 J;  4XLA A;  2Y2Z A;  1Z3Y A;  3PUF A;  3QOE A;  2DOA A;  1SD4 A;  3IAS 2;  3OWT A;  4NNJ A;  3WG9 A;  2L4A A;  3ZQH A;  4E70 A;  3OV8 A;  4S05 A;  1DU0 A;  2FU4 A;  3JRE A;  2IV1 A;  3UFD A;  4Z58 A;  2L9S A;  1IV8 A;  2L7F P;  2YR2 A;  4KUM A;  4M9S A;  2DXI A;  4OIQ F;  1BIA A;  2KQR A;  2RV8 A;  3CCV I;  2JA7 J;  4ZYD A;  2GXA A;  2EZL A;  2Q2E B;  1XSX A;  1OCO H;  1PVE A;  1K7A A;  1SMY F;  3HOZ J;  2IGM A;  3E3V A;  3Q0V A;  5K5O A;  4IJA A;  2HSG A;  2EBY A;  4I6Z A;  1QQA A;  4I76 A;  1U3E M;  1KYW A;  2BV6 A;  2LDU A;  2H94 A;  2V6E A;  1OKR A;  1Y0U A;  3A0B C;  2LYS A;  2ZXH A;  1MZB A;  4FCY A;  1QZE A;  2IPQ X;  5DUK A;  4CH7 A;  3TEP A;  2L7K A;  2CQQ A;  2OJE D;  5J1R A;  1JUS A;  2BBY A;  3NRV A;  2WA0 A;  4HDV A;  2OTL I;  2OTJ I;  3G7D A;  2DYR H;  3TO6 A;  4BDY A;  3CES A;  4E7I A;  5BOX A;  3X2Q H;  1CF7 B;  3LSR A;  1ZZ6 A;  4M73 A;  2ID6 A;  3J7A O;  2M87 A;  2D1V A;  2MC4 A;  4F92 B;  5IYD J;  2BNN A;  2QQA A;  2PXV A;  2XF5 A;  3J7Z I;  4IPA A;  2QA4 I;  1YO5 C;  1E17 A;  2D2W A;  2LYK A;  3IVP A;  1Y0N A;  4Q47 A;  4HF1 A;  3S8Q A;  2WAQ N;  1I1S A;  2JVL A;  2DLL A;  3ZR8 X;  1VFC A;  1MNM C;  2OC6 A;  2Z3Y A;  3JAM Z;  2ESH A;  2VJI A;  3BOQ A;  3G71 I;  2Y48 A;  4HSR A;  2BNO A;  4P9U A;  1WIZ A;  2MGQ A;  3LSM A;  2H1L A;  4PGG A;  5DTQ A;  2FJR A;  1KU7 A;  2ELK A;  3KEQ A;  3VYU B;  3OYG A;  2W85 A;  4A6D A;  1U2Z A;  2AXZ A;  1IO2 A;  4EJO A;  1JT6 A;  2PUF A;  4I01 A;  4YFK F;  2EIL H;  2Z9O A;  2STW A;  2GZU A;  1GXQ A;  1NTC A;  2RVC A;  2R7F A;  2B0L A;  2FFH A;  1WH5 A;  4RA2 A;  4JCX A;  3BG9 A;  2LY1 A;  3HSF A;  2CFX A;  2HOE A;  2ELJ A;  4E7S A;  4A5N A;  2ISZ A;  1G3S A;  1VQK I;  3GTK J;  2LBF A;  3DU5 A;  1E0E A;  3KZY A;  3ECH A;  2E5Z A;  2Z16 A;  1MH4 A;  4GYI A;  3HYI A;  3AG3 H;  1TQM A;  3LSG A;  4EK9 A;  1YLF A;  2Y0M A;  2F48 A;  2GOM A;  2UV1 A;  3ZQ7 A;  1OR7 C;  1XCB A;  1K6Y A;  5EEA A;  1IRX A;  5BNG A;  2DMT A;  2MQK A;  1MGT A;  1PER L;  4M3G A;  2KPM A;  3ISP A;  3ZCO A;  2R7U A;  1STZ A;  2ZSI B;  2CW0 F;  3P9I A;  1ZZ8 A;  1FOK A;  1VI0 A;  5L3D A;  4HBL A;  4HNU A;  2JJ7 A;  3ROU A;  1JJ6 C;  3L9F A;  2MAB A;  3OYA A;  2V4J C;  4LMY A;  4L18 B;  1IF1 A;  5HS8 A;  2JZY A;  2AS5 F;  2ZSH B;  3TGN A;  1MBF A;  4YG2 F;  1TL8 A;  3K0L A;  4MQV A;  2ZXI A;  3QU6 A;  4Z2Y A;  3FXL A;  1ZTR A;  2L0K A;  3HM5 A;  4ESF A;  3RCO A;  3DPL C;  4BL0 B;  1WSU A;  4BXX J;  1I27 A;  3BY6 A;  2DA2 A;  4ENM A;  2CW7 A;  4PCQ A;  5J1Y A;  1T8I A;  1OMI A;  2NYX A;  2IJL A;  3RSN A;  2VJ5 A;  4ER7 A;  5FLX Z;  3SFI A;  1MMD A;  1T33 A;  3EYI A;  3CEC A;  2BY0 A;  4BBR J;  1RES A;  5EEG A;  3WTS C;  1OYY A;  3GZ6 A;  3KYC B;  4DIQ A;  1UZC A;  1ZG1 A;  4C3H J;  2P5K A;  1YI2 I;  2ZNZ A;  4OMZ A;  4L5E A;  2XKO A;  1DUL A;  1U8B A;  4EM0 B;  3FMY A;  1IUY A;  3JAM K;  3HRU A;  2UZK A;  2O38 A;  4AIK A;  1D1C A;  1YJN I;  3TL4 X;  2FOK A;  3MKL A;  3F6V A;  4EJV A;  2W82 A;  1R7J A;  1SAN A;  2LNB A;  2AQE A;  1BI0 A;  2HYF A;  1Z67 A;  1R00 A;  4XLN F;  4Y7N J;  1W4M A;  3H9J A;  1K4S A;  2PXT A;  2HXO A;  4BU2 A;  3SXY A;  5KAF C;  2VKD A;  2HWV A;  2QF7 A;  4PK4 A;  4EJT A;  3BG7 A;  2QKL B;  3DV8 A;  4U87 A;  1X2N A;  1ZZ9 A;  1HQ1 A;  3CUO A;  2IS4 A;  3A2K A;  3OS2 A;  1RKW A;  1HA8 A;  3H9G A;  4B3A A;  2W1O A;  4XN0 A;  3VSK A;  2DMU A;  3RZO J;  1B0N A;  3K4N A;  4XMY A;  3QQ6 A;  5J1U A;  4KT6 A;  3SDB A;  4BXU A;  4IOA F;  2Z2S B;  2NS7 A;  3QFI A;  5D4R A;  1I5Z A;  5C3E J;  1XPX A;  2LY9 A;  1XN7 A;  2BHZ A;  3FMR A;  4F7Z A;  3ZMU A;  3CC2 I;  2ETH A;  2EIM H;  2JA5 J;  4G7Z F;  3JRC A;  4L9V A;  4LK1 F;  1T0F C;  3QYX A;  3PSI A;  1I50 J;  3F22 A;  1G2H A;  1IXC A;  4CCN A;  2E1N A;  3RTR A;  4EJU A;  5LEJ A;  4AID A;  2V9K A;  3HOS A;  1LPQ A;  3DP7 A;  3VOE A;  2FX0 A;  1F36 A;  4BQA A;  4PSX A;  3W2A A;  3PO3 J;  3S3N A;  1X3Z B;  4KA4 A;  5GTI C;  2JN6 A;  1VQ9 I;  4GRI A;  5C4X J;  3IV5 A;  1QP7 A;  4C30 A;  4LLN A;  2NOG A;  2CV2 A;  5DRY A;  1XGM A;  3BTC A;  1APL C;  2PXL A;  2ZME C;  5B3S H;  1TQP A;  3K4M A;  2FD5 A;  2KIM A;  5AIP A;  2LLW A;  3WTW C;  2KIS A;  1QGP A;  1B6A A;  2IVB A;  3P9K A;  3V8L A;  2PMH A;  1G59 A;  4I99 C;  4H4K C;  2AXV A;  2K9N A;  3D5L A;  1YYV A;  4MTD A;  4OIR F;  3BT9 A;  2IA0 A;  2LBF B;  3F6W A;  1UEL B;  1F43 A;  4Z5H A;  5FRM A;  2AUW A;  3K4C A;  2GWR A;  4MCT A;  1QQB A;  2NAZ A;  1U8R A;  5KAI C;  3OYB A;  4HQE A;  2Q0O A;  4M6X A;  2HU9 A;  2JPC A;  3K70 D;  2KIF A;  3R61 A;  5GAG i;  3WTY C;  2CRG A;  2IXS A;  1UG2 A;  3I3L A;  1X2L A;  1WCM J;  3KP7 A;  1MBE A;  3CCR I;  1LCC A;  1G4D A;  1MMA A;  2CUF A;  2MD5 A;  2V1X A;  3OIP A;  4II2 A;  3SEZ A;  4X4I A;  1R23 A;  1Y9Q A;  4ZYE A;  5F0H A;  4E7J A;  1BDH A;  1B1B A;  5IP7 J;  4X1E A;  3PNT A;  4GDF A;  5HOO A;  5EJC A;  1UG0 A;  3BJA A;  4NB5 A;  1SQ8 A;  3KX2 A;  3K70 C;  5DCM A;  2KLO A;  5JI6 A;  1WJA A;  1TT0 A;  2A6E F;  2FML A;  3QYE A;  2KDZ A;  2DFI A;  1D0X A;  1QRY A;  2DYS H;  2N8G A;  1B8I A;  4GGG A;  4Y42 A;  4L9N A;  4CO8 A;  2VPR A;  2R7V A;  3HOU J;  2XJ3 A;  5LRS A;  4ITV A;  2EZH A;  2WIU B;  1F4K A;  5A2Q Z;  1Z77 A;  2UUZ A;  2BHY A;  2KKO A;  2JK3 A;  3GX4 X;  3FXM A;  2XIG A;  5L3F A;  2CQ7 A;  1Y39 A;  2KZG A;  4PFP A;  1I6H J;  1ZAY A;  2GRM A;  1Y56 A;  5DSX A;  3MZY A;  2R7Z J;  1FYM A;  2LR8 A;  3DKY A;  3HKZ A;  1YRN B;  1WJD A;  1E3O C;  4RLF A;  4AYB N;  4HEA 2;  3OSG A;  4HPQ A;  3DU6 A;  2HNH A;  1XB4 A;  4BNC A;  4KDP A;  4HA8 A;  4WCG A;  2FF4 A;  4RDU A;  4A3G J;  1K78 A;  1PJR A;  3H36 A;  2VXZ A;  3HOV J;  1DU6 A;  1R5I D;  4X4G A;  5J47 A;  2X1C A;  4X4B A;  2GBY A;  5CPR B;  4EM2 A;  1D3Y A;  3A01 A;  4I98 B;  4PU3 C;  1ZRF A;  3GVA A;  3BQY A;  3FWE A;  2VC0 A;  4KIF A;  1FOW A;  1ZAR A;  4N0B A;  5EGO A;  5F0C A;  3AG2 H;  3CLC A;  3K69 A;  4ZDL A;  3SR4 A;  2ICW G;  3BR6 A;  3QP6 A;  4UY8 I;  4E7L A;  2JMW A;  3CQZ J;  2CQX A;  1B72 B;  1MSE C;  3J7A Y;  2PUB A;  3Q9S A;  2B5A A;  1BBY A;  4A3L J;  3S8P A;  2FOW A;  1NEQ A;  1YIJ I;  3U21 A;  2GAU A;  3TKY A;  1PRV A;  1WJ5 A;  2M4G A;  2OZ6 A;  2Y9Y A;  4BJ5 C;  2Z1D A;  2HOS A;  1XCV A;  2ZFW A;  4LIV A;  5HLT A;  2KT0 A;  5IPA A;  3B7H A;  4IQJ A;  1OCC H;  3IH3 A;  3WGI A;  2RKH A;  2XUB A;  4BQQ A;  1HCR A;  4PUS A;  3KCC A;  2CRO A;  2HQR A;  2K86 A;  4BQN A;  4MCX A;  4EAT A;  3MD2 A;  3BS3 A;  3QQA A;  2M8G X;  1LCD A;  2P6T A;  2R7S A;  2Y30 A;  4OWR B;  1ZGW A;  1ZHF A;  2LYQ A;  4BAY A;  4BHP A;  3FXU A;  3CCJ I;  2BJC A;  2VJ4 A;  2MD0 A;  4MNU A;  4KNY A;  5JR3 A;  1O3R A;  2NVT J;  4HX8 A;  1KQ0 A;  2M1B A;  1X4P A;  2WAE A;  1A36 A;  1R63 A;  1FOY A;  1JHF A;  3HOW J;  3GBG A;  2K3F A;  3KEO A;  2HDC A;  1RZ4 A;  3T1B A;  3L2W A;  5B1B H;  1XD7 A;  3L2V A;  2CSF A;  4B4C A;  2E2H J;  3JRA A;  2XPW A;  4RB1 A;  2R7R A;  1IZ1 A;  3R0A A;  1VQM I;  2CGP A;  1ONV A;  3DPT A;  2A69 F;  2LKS A;  4MEY F;  4NHJ A;  3ESW B;  2XAQ A;  1MJA A;  2LMD A;  1R58 A;  1RC9 A;  2CH0 A;  2HVQ A;  3FIS A;  1VQO I;  2E1C A;  3NRO A;  2ZME B;  1ZR2 A;  1S5L C;  1PRU A;  2F5C A;  5DUI A;  1ZUG A;  1Y8Q B;  4G7O F;  3FXK A;  3E6M A;  4A2U A;  3H35 A;  3LSK A;  4Y15 A;  1FTT A;  1R4M B;  2BXZ A;  4HG2 A;  4ENN A;  1Z91 A;  3FM3 A;  2R5Y B;  2AO9 A;  3K6G A;  2B9S A;  1Y7Y A;  1FY7 A;  2DA3 A;  2FQ3 A;  4LK0 F;  3ZHI A;  2H6C A;  4X4H A;  1E2X A;  2BYV E;  1FX7 A;  4TV7 A;  3BRO A;  5DDG A;  2L9R A;  3N4M A;  2I5U A;  4PJ0 C;  4UVA A;  4A3I J;  1SFK A;  2BW3 B;  2VQH A;  3TFL A;  2R7T A;  3FHZ A;  2IGK A;  4CYC B;  5C4J J;  3QP5 A;  1AU7 A;  3PSF A;  2EJR A;  1QVT A;  2OF7 A;  1HQC A;  1XMK A;  3SZP A;  2O5R A;  2XC7 A;  5FKO A;  2A07 F;  2ICT A;  3WU0 A;  4ER3 A;  4A3J J;  2PFB A;  4BEH A;  2YU3 A;  3J81 K;  1ZAO A;  1HW5 A;  3RKX A;  1QP0 A;  3CC7 I;  2HYG D;  2QQ9 A;  2XGD A;  3AG4 H;  1R5G A;  2ZME A;  3OYK A;  2XF7 A;  1YIO A;  2PN6 A;  3DKW A;  4NC7 A;  1FIA A;  5FLM J;  4HLX A;  3AL0 B;  4P96 A;  4W1U A;  2OU2 A;  3GXO A;  4HDU A;  3MZH A;  1JWL A;  2F5E A;  2X1E A;  3BR3 A;  4HZF A;  2A05 A;  4MIM A;  2HYJ A;  3BTJ A;  3LMM A;  5CYV A;  3VOD A;  4BJT A;  2P5L C;  1QPZ A;  3TMO A;  2BVM A;  2MC3 A;  2W57 A;  4PU4 C;  3A9Z A;  3DEE A;  3CMY A;  3QYF A;  2JVH A;  4H0E A;  3K1P A;  1RUN A;  3GME A;  4XM3 A;  3ZMS A;  1RZR A;  4IHS A;  5D5U B;  2DJI A;  2JRT A;  2ME6 A;  2FQ4 A;  1OR7 A;  4ZZL A;  3I55 I;  3AG1 H;  3Q5F A;  3CJR B;  4I8T A;  3JSP A;  2HI3 A;  2XDV A;  1ZRD A;  3PIO F;  4CDG A;  1Z9C A;  1U2W A;  3JXD L;  2J7U A;  2X48 A;  3KE2 A;  4ESJ A;  3PQK A;  3RJP A;  5JLX A;  1RRJ A;  4LB5 A;  3ASO H;  4XOT A;  3BLY A;  1Y6I A;  4DW6 A;  2DFE A;  1MSF C;  3HZI B;  4U88 A;  1CGP A;  1RIO A;  4EZI A;  2EIJ H;  2R0Q C;  4CGZ A;  1KYZ A;  3U2R A;  3HBL A;  2V1N A;  3R60 A;  4HLY A;  2JSC A;  2CW8 A;  1R5H A;  3H5N A;  3VFZ A;  3I59 A;  3LSI A;  4MEX F;  3F51 A;  3J80 Z;  5FRN A;  1IUF A;  2GIV A;  4J1X A;  1TW2 A;  3OYN A;  2KEK A;  5F0F A;  2CUJ A;  3OWQ A;  5GAG J;  3OYI A;  4A5M A;  4J01 A;  1QNT A;  1HST A;  3GLL A;  1EA3 A;  3ASN H;  3ERM A;  2CS3 A;  3H3U A;  2GOX B;  3PM1 A;  3BG3 A;  4D0P A;  5K98 B;  1LKX A;  3WU2 C;  3E7L A;  3LQX A;  3QYB A;  3K4L A;  2F6C A;  4Q2J A;  2IGO A;  3TED A;  4L0Y B;  5DD8 A;  2DTZ A;  5DYM A;  5IP6 A;  3F52 A;  3DCF A;  1Z6T A;  2J7W A;  3TOB A;  1BOB A;  2O8X A;  5HVQ C;  3IRQ A;  1J5Y A;  2DA4 A;  4BAC A;  1C0W A;  2Y0S N;  4D5C A;  4V2G A;  2OCE A;  5GPA A;  3L09 A;  4NC6 A;  4P9F A;  4I6T A;  3GF2 A;  1TBX A;  4LG0 B;  1U9O A;  4XBF A;  3EUA A;  3IP4 B;  1IAW A;  2M4H A;  3KZZ A;  4BEH B;  2HIN A;  2F2E A;  2XPV A;  4ZDO A;  2ZO4 A;  4S0H B;  4O3M A;  3FXO A;  4A6E A;  2QBY B;  1V5G A;  1PP7 U;  3S2W A;  1J9I A;  2QWW A;  2HOT A;  5LFA A;  4KIG A;  3A02 A;  4RGX A;  4LG3 A;  2L7Z A;  1X1C A;  3GTM J;  3QOP A;  1P9Q C;  1Z7L A;  5D5X B;  2FUG 2;  1HKT A;  5E3O A;  3H5T A;  1G6N A;  4RB0 A;  3S2D J;  5CQG A;  5FKM A;  5E8I A;  1SAX A;  3F21 A;  1SVL A;  1NK2 P;  1FSH A;  2L01 A;  4EKI A;  3HUG A;  1IXS B;  1TWA J;  3ERE D;  1SVM A;  2WUS R;  1B72 A;  4MGR A;  3FZV A;  2DOD A;  3RPQ A;  1ON2 A;  4IF4 A;  3OY9 A;  2K40 A;  2XAH A;  4OOI A;  5ICF A;  1T08 B;  2XAS A;  3FYM A;  1V4R A;  3L7W A;  3WGG A;  1UXD A;  4RS8 A;  5HLI A;  2WAQ A;  3G73 A;  5DRT A;  4M6Y A;  4XOP A;  3S1R J;  1Z21 A;  4LIU A;  1KZH A;  5D8K B;  2E7X A;  2HZD A;  3FXJ A;  3KP3 A;  4X4E A;  1GT0 C;  3CF2 A;  3R0J A;  3F3X A;  4UHT A;  3E6D A;  2AHQ A;  2GQQ A;  5CJ9 A;  2M0M A;  2ZXJ A;  3DTK A;  4IHY A;  4IRG A;  3UR3 C;  2VE8 A;  3M7G A;  2GZW A;  2DI3 A;  2V6C A;  2XAG A;  3WTU C;  1T56 A;  3EUH C;  2DQL A;  4JQF A;  5LBQ A;  4BY1 J;  2VJJ A;  2F5V A;  5LHG A;  1JFT A;  2WV1 A;  3M1C A;  1WH6 A;  5BQT A;  3KL4 A;  1UFM A;  3AKZ A;  1T38 A;  1WJB A;  4AM3 A;  1IGN A;  2OV7 A;  2Q1Z B;  4EMS A;  4YFN F;  3QOD A;  2HQA A;  1JUP A;  1H9T A;  3DTI A;  4ZZD A;  2IEK A;  4RM2 A;  3WTV C;  3ZQF A;  3O2P E;  2MFZ A;  1KA8 A;  3PO2 J;  3CCM I;  3ABL H;  5FKL A;  2K9M A;  4ZJZ A;  4S04 A;  1BOA A;  4BE2 A;  2VC1 A;  3ZHM A;  3U9G A;  1A6I A;  4QWQ A;  3FIW A;  1H9G A;  5E20 A;  3K10 A;  3VSL A;  4XLC A;  2EWT A;  2D45 A;  3ZQQ A;  3G4S I;  3LST A;  2M7A A;  3AL0 C;  1FLI A;  4EKG A;  3BR0 A;  3KP4 A;  3LFU A;  5HLH A;  5D6F A;  1ZG5 A;  2PXF A;  3KET A;  1NW3 A;  1JGG A;  4AVP A;  1Z3X A;  4N9I A;  2A3S A;  4QSH A;  4F91 B;  3DTE A;  1XX5 A;  1JH9 A;  1AOY A;  1RZS A;  4WVL A;  2W4S A;  2HCS A;  4L9T A;  5ILS A;  1SFO J;  3OL4 A;  4B44 A;  3O9X A;  1D1B A;  4B09 A;  1EH7 A;  2HXI A;  2XRL A;  4X4F A;  1T0F A;  3ZPL A;  1U6G A;  4RAY A;  3QAH A;  3GLX A;  3D5R C;  3PFY A;  3MKY B;  3GTQ J;  4UUS A;  1K83 J;  1YQA A;  3OKZ A;  1S7O A;  4KMF A;  1JKO C;  3HIF A;  2EFN A;  2LG4 A;  2WY7 Q;  2H1K A;  4XRS A;  3W2W A;  4GCV A;  1JXS A;  1OCZ H;  2FSW A;  5GP9 A;  5K7Z A;  4IHX A;  2VOD A;  1D8K A;  4XRS G;  4XN3 A;  1TLH B;  2PXP A;  3GW2 A;  3J7Y J;  4QPQ A;  4UXN A;  1HBX G;  1ZLJ A;  1BW5 A;  1S29 A;  5FKN A;  2ELH A;  2OFY A;  4UUV A;  1P4W A;  1VND A;  4Z59 A;  3D1N I;  4D9J A;  2WBM A;  3MWM A;  2LKX A;  1B9M A;  3K4B A;  2UWM A;  4I0A A;  4UV8 A;  3TDU C;  3Q0W A;  3Q0U A;  5FD5 A;  1O57 A;  3PXP A;  4BJ6 C;  2QGU A;  5FFZ A;  1ZVV A;  2XXQ A;  1HF0 A;  2V3C C;  1OQY A;  1VQN I;  2QM3 A;  1UAA A;  3GYH X;  1W1W E;  4CYD A;  3IUO A;  2DQR A;  4A0Y A;  1YIT I;  2BOL A;  2LC2 A;  3NXH A;  2KRF A;  2EFO A;  4FTH A;  2E7W A;  5EZH A;  3SZG A;  3KP2 A;  3ABT A;  1T39 A;  3N97 A;  2ZNY A;  2PMZ A;  2Q8K A;  3VYT B;  5EEH A;  4EM1 A;  2F5D A;  3HHH A;  1U9N A;  4HNT A;  3KFW X;  1VQ7 I;  3CD6 I;  3DQV C;  1FBS A;  1AA7 A;  1LNW A;  1MDM B;  4AU7 A;  2X0L A;  5D5W B;  3ZOB A;  1R1V A;  4IQ4 A;  2VL8 A;  2KIQ A;  1YE9 A;  1U78 A;  2VOP A;  1QZZ A;  3GN5 B;  3A03 A;  1V5F A;  2W7N A;  1YS6 A;  1E3H A;  2MH9 A;  1ZEL A;  3CTA A;  3RQ4 A;  4AC0 A;  2VON A;  1MW7 A;  2XVC A;  3A4C A;  1YOV B;  2BY1 A;  1TP4 A;  2I8D A;  3K7A J;  3SDG A;  4D1Q A;  1IV6 A;  2XCJ A;  4QIW N;  4C3J J;  5L3C A;  1LLI A;  4DZP A;  2DA5 A;  2IVQ A;  2X85 A;  3GO5 A;  3HOX J;  4J00 A;  4R1H A;  3W3C A;  2CWE A;  1PNR A;  2JVG A;  4XLF A;  1NH3 A;  4MFE A;  3DNV B;  3LWF A;  1MKM A;  1JUM A;  1RR7 A;  2XHK A;  3OIQ A;  1AKH A;  3ZN0 A;  4WF2 A;  3F8B A;  1Z0X A;  3Q9V A;  3Q3S A;  4DQ2 A;  4XLH A;  2LYJ A;  2O03 A;  3QF3 A;  3JW4 A;  2LRD A;  5JHF A;  2VT3 A;  2HVS A;  3M9L A;  1BM9 A;  4KIC A;  3LQR A;  1ZG3 A;  4YEJ A;  2L7M P;  1FEX A;  2COB A;  2RNG A;  1DP3 A;  3VB2 A;  2EQR A;  5D6E A;  1MBH A;  3OMT A;  3HOY J;  4PSW A;  3R09 A;  4UVB A;  4M72 A;  2FBI A;  1H8A C;  1SFE A;  4MO7 A;  4RGR A;  2HKO A;  4UB6 C;  2NS0 A;  1I39 A;  4BDZ A;  2LYP A;  2D1H A;  3GZN B;  3BG5 A;  3HOT A;  1R9T J;  4HRI A;  1BDI A;  2HQN A;  4ZYA A;  2MLG A;  2PX9 A;  4ETS A;  1S7A A;  1B4A A;  3IH4 A;  5H6R A;  1HOM A;  1W7P D;  2JQE A;  1QHH D;  3B6C A;  3ZN1 A;  2O61 A;  4KIS A;  1POU A;  3JRD A;  4GHJ A;  2FBH A;  2Z99 A;  3M1E A;  5DTR A;  3I56 I;  3P5J A;  2LK2 A;  1JJ8 C;  3R1F A;  1IN4 A;  3TO9 A;  1LEB A;  1JI8 A;  1S8N A;  4IWR A;  1U5T B;  2L8N A;  4HST A;  2E35 A;  1SC7 A;  1XG1 A;  1FYL A;  5IOZ A;  5K7F A;  3V7C A;  5IT9 Z;  3SCG A;  1IC8 A;  1QHG A;  2VIX A;  2IS6 A;  2MYS A;  4YBA A;  3LQQ A;  1I3Q J;  3BR2 A;  4BS9 A;  5DT2 A;  4V2F A;  1FP2 A;  1WGX A;  1WJF A;  1OSL A;  3HTS B;  1ETO A;  1X1D A;  3SJM A;  4RAG A;  3WTX C;  5D5V B;  2K3P A;  1ZR4 A;  2KHM A;  1QA6 A;  3E6B A;  1ZRE A;  1DWK A;  4RBO A;  2PUC A;  1OYI A;  1X1B A;  4DJA A;  1A5J A;  1PRA A;  2CFO A;  4HQM A;  5FD6 A;  4RAZ A;  4YRV A;  3WU1 B;  5LGT A;  3A01 B;  3ZMT A;  3EQL F;  3GBF A;  4G6D A;  3T8T A;  5C44 J;  3MKZ A;  3NAU A;  3IH2 A;  3L2Q A;  5ICC A;  3E5Q A;  5CVJ A;  3F23 A;  2QQB A;  2IUO A;  2EF8 A;  3FK6 A;  1WRJ A;  1GHC A;  2EH3 A;  4DE8 A;  3OL3 A;  4I02 A;  3ZKC A;  4HYE A;  4CXF A;  2RDP A;  2LNM A;  4G8X A;  3GZD A;  2DTR A;  3OYL A;  1Q1H A;  5LGU A;  4YG1 A;  2TCT A;  2R7O A;  3OOP A;  3L1P A;  4A3D J;  4IA8 A;  2AQF A;  1VQL I;  4ER5 A;  3ZPX A;  4MHG A;  1QB2 A;  3M4O J;  3IL2 A;  3CZ6 A;  3GEZ A;  2DPD A;  2CSO A;  2WAF A;  3HTU A;  1BN5 A;  2QUF A;  4DBQ A;  3CCQ I;  1K6O A;  3ZMZ A;  1OCT C;  3R6S A;  1W36 D;  3M8J A;  4Z5C A;  5A2Q K;  2P7V B;  1VQ8 I;  3O8H A;  3KLO A;  2KJC A;  2WTE A;  3OR2 C;  4KFC A;  2EFP A;  5KCM A;  4X4D A;  2A5Y B;  3K1N A;  4XKC A;  3PQJ A;  3GFL A;  4X4C A;  4XSX F;  2R7D A;  3CUQ A;  1YW9 A;  3W6K B;  1NG7 A;  1W5C C;  2IW5 A;  4ON0 A;  3IC7 A;  4HF2 A;  1X2M A;  3M9A A;  2B63 J;  2UXX A;  2GXB A;  4XKB A;  2VQL A;  3HJE A;  2DK8 A;  3HGG A;  4UNO A;  1K78 B;  2H09 A;  3MLF A;  4BKX A;  3MZ8 A;  2ECC A;  1O3T A;  3HUG B;  4AIH A;  4F3Q A;  2ADU A;  2R5Z B;  3WHB A;  1GLN A;  1D5Y A;  1KU3 A;  1DP7 P;  2ID3 A;  1LFP A;  4XSZ F;  2IGN A;  1D5V A;  2HDD A;  5F64 A;  2CUE A;  4IZZ A;  3G1L A;  2G7U A;  1Z1D A;  4J1W A;  3CCE I;  4V19 K;  1YJ9 I;  3LSP A;  2E2I J;  2OQG A;  3BJ6 A;  1F9N A;  3B02 A;  3G2B A;  2RC4 A;  3OS1 A;  1LQ1 A;  2VAS A;  1K79 A;  2R7X A;  4E4H A;  5EDN A;  2QQ8 A;  3OP9 A;  4OBM A;  3DPU A;  1A35 A;  3DF8 A;  4OIO F;  4UUT A;  2BY3 A;  2NOJ B;  4LJZ F;  2TDX A;  1N77 A;  5ICG A;  3BG6 A;  5EG0 A;  2O8K A;  3I59 B;  2EK5 A;  4XNF A;  2MA3 A;  1JKR C;  2X6O A;  4ER6 A;  3FYA A;  2OPT A;  2ZB9 A;  3ZQC A;  3KEY A;  2PXQ A;  1D8J A;  1Y8R B;  2QSH X;  2EV6 A;  2NXN B;  2VE9 A;  3RKW A;  3SX0 A;  4M3F A;  1RNL A;  2L54 A;  3F8M A;  1NG6 A;  4C3I J;  3ZMD A;  3W6J B;  1FTZ A;  2AXL A;  3RI4 A;  3QRF F;  4IRH A;  1R1T A;  1GVD A;  1ZKG A;  1X1A A;  3BZK A;  4FE7 A;  3I53 A;  4NC8 A;  1MMS A;  4RAF A;  1TNT A;  4L9J A;  3UWP A;  5E3L A;  5K1Y A;  3V4G A;  3KZI C;  3OS0 A;  4ENK A;  4WK8 F;  1RR8 C;  2PPX A;  4JCY A;  4I2O A;  2X6X A;  4BYY A;  1DUX C;  2P4W A;  4BE0 A;  4QLC U;  3HRS A;  1TW3 A;  3M8E A;  3QOW A;  2B7E A;  1LDD A;  2XAF A;  5B5E C;  3TQN A;  3OYH A;  2COM A;  4FIS A;  2BZT A;  5HNF A;  5FRO A;  3MN2 A;  1ZYR F;  4G7H F;  3WOD F;  2MBF A;  1V3F A;  3EUK L;  2IS1 A;  3ZQL A;  3I4N J;  4EGZ A;  4OB4 A;  3CUQ B;  4YIR X;  4P55 A;  5J6X A;  2DA6 A;  5J4V A;  3E5X A;  4XID A;  2RGV A;  1JGS A;  1DPU A;  1LVK A;  1SFX A;  3MAJ A;  3BR1 A;  2ZJQ F;  1BW6 A;  2QCO A;  2HQ5 A;  3MVP A;  3RYR A;  2GRL A;  2O49 A;  2XRO A;  2L5Q A;  3IAM 2;  3SEQ A;  1RET A;  1Z6R A;  2KZ8 A;  2PJR A;  3U1D A;  3IKT A;  1ZZC A;  2WC2 A;  2EZI A;  3BQZ A;  5F6F A;  1LQC A;  3I4M J;  4ANJ A;  4HRA A;  5E1Z B;  3F72 A;  5DCF A;  2PQ8 A;  1ZZB A;  2RNJ A;  4BGD A;  2CQK A;  3A0H C;  1W0T A;  2HZT A;  4I0B A;  5FKK A;  1W5T A;  2FA5 A;  4KIB A;  3RKY A;  2KEI A;  2P8T A;  2EB7 A;  1X1P A;  3FXR A;  2X9D A;  4FN3 A;  1G3W A;  3FMQ A;  3JTH A;  5K5R A;  1XGN A;  4M3B A;  1KU9 A;  2LTP A;  4EV0 A;  2QSF X;  1D1A A;  3E5U A;  3HG9 A;  2EWN A;  1R69 A;  2M30 A;  2HVR A;  4C2U A;  2E2J J;  2F4M B;  1UHM A;  2LD5 A;  4IVZ A;  2HOA A;  4Y33 A;  3C2H A;  3LAJ A;  1FWZ A;  2M45 A;  4DE9 A;  3AAF A;  1KU2 A;  2PXE A;  2Y0S A;  2YUS A;  4O5V A;  2L1P A;  3B6A A;  4DGW B;  3ML6 A;  4PU8 A;  2IRF G;  1O7L A;  4LFU A;  3G5G A;  2HDW A;  1ZLK A;  2K4J A;  3IKV A;  2YPR A;  2IA2 A;  3QPH A;  1W0U A;  3ZMV A;  5L3E A;  5LHI A;  1A04 A;  2P0W A;  3K9T A;  1YX5 A;  3FM5 A;  5CKT A;  3KXA A;  2ZJ2 A;  3ABU A;  2HTS A;  2OA4 A;  1P4X A;  3O8G A;  3TO7 A;  2WAD A;  3V7S A;  1HC8 A;  4PGH A;  3PUB A;  1O3Q A;  2DU9 A;  3D0S A;  2BGC A;  1U5T A;  2PEX A;  3G6E I;  4F52 A;  1QPI A;  1EKE A;  4E7Z A;  3NWT A;  1LDK B;  3A9X A;  1UHS A;  3CJT B;  5B1A H;  2ZJR F;  1O4X A;  1IW7 F;  2XSD C;  3OYF A;  1JE8 A;  3GTG J;  1V54 H;  4Z5D A;  1VF9 A;  1DW9 A;  1NHA A;  2JCG A;  4RB3 C;  1ACI A;  1J7K A;  2CUZ A;  4PJM A;  2YSR A;  1SMT A;  5ERI A;  1YW8 A;  3VWS A;  2AXU A;  2R5Y A;  4IKF A;  1HKS A;  2FEZ A;  2IP2 A;  3L00 A;  4LLG F;  2I10 A;  3WG7 H;  1YTY A;  3GFI A;  2M2E A;  5L3B A;  5E17 F;  2FE3 A;  2MH2 A;  2OZU A;  1QZX A;  3EDP A;  1L3L A;  3K2Z A;  1LUJ B;  2OUM A;  2ACJ A;  2X6Y A;  4II3 A;  1IJW C;  3WE3 A;  4R79 A;  4IEJ A;  3TP3 A;  1WQ2 A;  2YBD A;  1VQP I;  3K4J A;  3I71 A;  1DPR A;  3T8R A;  4YAR A;  1ETX A;  2KDO A;  1RPW A;  2E34 A;  4XRF A;  2KL4 A;  2OBP A;  2RRE A;  5GAD J;  5HLG A;  2QYO A;  4CCO A;  3PJR A;  2AW6 A;  1JHH A;  4DNC A;  5A7L A;  4EJW A;  1XDU A;  5BMZ A;  1ERD A;  2ME0 A;  3FBN B;  4U0V A;  1FJL A;  2RN7 A;  3SQN A;  3JSO A;  4N4O B;  4DOZ A;  2WB1 A;  1W7P B;  1T98 A;  3SFZ A;  2K7L A;  1X19 A;  1IDY A;  2HKX A;  1GUU A;  3I4P A;  1H88 C;  3ZQG A;  1EJ9 A;  3HSR A;  2DCE A;  4IVN A;  3VEP A;  2DT6 A;  4M9Z A;  4ABZ A;  2KRC A;  2PUG A;  4RGU A;  2LYC A;  4ZYG A;  4QPO A;  1ETV A;  3FF5 A;  3H5A A;  6PAX A;  3L2C A;  1ADR A;  1OCR H;  5E8G A;  4BHB A;  2LKP A;  1QPM A;  3SCH A;  5B66 C;  5D8L B;  3K1M A;  5FJ8 J;  3VYS B;  5EYR A;  3HPG A;  1GDT A;  4OIP F;  4NQW A;  2DO7 A;  4I7H A;  4CIC A;  3GWZ A;  2LFB A;  2JRM A;  3S3O A;  5ICE A;  4N4N B;  3PNV A;  4MLO A;  4ZYH A;  4C2T A;  3WTZ A;  4CCJ A;  4CHU A;  4A0X A;  2EV0 A;  5HS7 A;  2MLK A;  3RZZ A;  2LSO A;  4JP0 A;  2UXN A;  2VQG A;  2LRE A;  2XKP A;  5BPD A;  2M34 A;  5F1J A;  1WET A;  2TRT A;  4HOB A;  4EQQ A;  5JUW A;  4KN4 X;  3QWG A;  3ELK A;  1ETK A;  3CME I;  1PP8 F;  3IHU A;  1R4N B;  4OIN F;  4FQG A;  1ETQ A;  1XWR A;  2VKH A;  4CZZ A;  3OYJ A;  3FBI B;  4N9H A;  3TW6 A;  4G9Y A;  3JXB C;  4RMN A;  3UNG C;  1HW1 A;  4OAZ A;  3V42 A;  2DFF A;  2LF7 A;  3LSJ A;  2QZ8 A;  2QBY A;  4AIJ A;  4OMY A;  3CJN A;  5F1R A;  5HS9 A;  4ER0 A;  2NVU B;  1XC5 A;  4F8D A;  4CSW A;  2HFZ A;  3LFK A;  3MEJ A;  3C3W A;  1J75 A;  2CMP A;  3LA2 A;  3V8J A;  4LLL A;  1MND A;  1XMA A;  3H0G J;  1P6R A;  4WXC A;  5CVI A;  2ODR D;  1AKH B;  2V1D A;  4ZDP A;  3S17 J;  1XS9 A;  4PJN A;  1PUF B;  4A93 J;  3ECO A;  2BE5 F;  5E1X A;  2W24 A;  4ZC3 A;  2PG4 A;  1BR1 A;  1SD5 A;  3OQN A;  2Y69 H;  2VKE A;  1WH8 A;  5M3F J;  1GXP A;  1K61 A;  3EUH A;  3COA C;  2O0Y A;  2HTJ A;  2XB5 A;  2NRA C;  2NNN A;  3JRB A;  2BNM A;  4O6J A;  1FP1 D;  1WI9 A;  2VB6 A;  4AVZ A;  3HSE A;  1ORK A;  1FC3 A;  3LA7 A;  3OYM A;  1ZGJ A;  3F6O A;  2ISY A;  3BTL A;  3FKJ A;  2D5V A;  2DT5 A;  3ZGK A;  4PFO A;  4DBR A;  1BI2 A;  1WPK A;  3K4K A;  4UB8 C;  3TBI A;  1IN6 A;  5J4Y A;  1J2X A;  4E6K G;  3ZRG A;  1WKM A;  1X58 A;  1H89 C;  3IWZ A;  2ZJP F;  2K27 A;  3H92 A;  5IT9 K;  3J80 K;  1SVO A;  1HSJ A;  4B1R A;  2CO5 A;  2IA1 A;  4DYR A;  2P81 A;  2DMN A;  1WVR A;  1I1G A;  4XKV A;  1JFS A;  2F4O B;  3KP5 A;  1EH6 A;  3DM5 A;  3KJX A;  3C2B A;  1J09 A;  3RPU A;  1O3S A;  3REO A;  4IHW A;  2OR1 L;  3FKI J;  1WHU A;  2OQR A;  2ECB A;  4P5O A;  4FBI A;  4U7D A;  3VPR A;  2KZV A;  2BEO A;  3BZC A;  3HB9 A;  2O6G E;  1MJ9 A;  2DAO A;  4HAM A;  2GM4 A;  5DM7 F;  4BBS J;  2BXY A;  3MQ0 A;  2M9H A;  4KN7 X;  3M07 A;  3GTP J;  2DA7 A;  4C9Y A;  5HDK A;  1IG7 A;  3CDI A;  2QSG X;  1CJG A;  2NVY J;  4CZC A;  4A3C J;  3S1Q J;  1EV7 A;  5GAH J;  1J0R A;  1EH8 A;  3BCA A;  4YG7 B;  2BW3 A;  2E60 A;  4K2E A;  1N25 A;  4IXA A;  2PJP A;  4CUG A;  3V7R A;  5IYC J;  2GXG A;  3VYR B;  2CQN A;  2P5V A;  1ULY A;  3DFG A;  2X6W A;  2P6S A;  2VBX A;  4C2M J;  4MQ9 F;  2A6T A;  2MEZ A;  1ZN2 A;  2K5C A;  4PDK A;  1UST A;  2ZCW A;  5TJJ A;  4MTE A;  1QVU A;  1IN7 A;  5JVT A;  3ZXS A;  2XPU A;  1SFU A;  2DA1 A;  4HX4 A;  3EYY A;  2V1U A;  1VQ5 I;  1FZP B;  1MIJ A;  1UB9 A;  2DDA A;  4BXF A;  3F9K A;  3HDD A;  4DZJ A;  4ASN A;  4RGS A;  3RQI A;  1MMG A;  3H5R A;  1FMW A;  3GTO J;  4NBQ A;  3F8F A;  1PUE E;  1L0O C;  1S7E A;  4NQW B;  1P2F A;  4FX4 A;  1HW2 A;  2VBZ A;  1LDJ A;  2RAE A;  2W25 A;  4G12 A;  3DEW A;  1Z7U A;  2IU7 A;  2AXT C;  2X1D A;  3IWF A;  1X3U A;  2WWY A;  5TIS C;  2VQC A;  1RKT A;  1TWH J;  5GPC A;  3A1Y A;  4IOC F;  1HDD C;  2KMU A;  2W84 A;  3CLO A;  4B8X A;  2K02 A;  1QQI A;  1FYK A;  3KPH A;  2YS9 A;  2MW8 A;  3OIO A;  2IT0 A;  2X51 A;  1LFU P;  5AIQ A;  2KEJ A;  1IRF A;  5EG0 B;  1BL0 A;  1FT9 A;  3DBL B;  2VBW A;  4KJZ A;  1U5T C;  1UJ8 A;  1W5S A;  4RM3 A;  3CMA I;  2CU7 A;  4XRM A;  1LE8 B;  2IVG A;  2DMP A;  4A3F J;  3ZP5 A;  4RB2 C;  3KLN A;  2IVM A;  3DBH B;  3GFM A;  1I3A A;  2PXB A;  3GUU A;  2EIN H;  2XGE A;  5E3N A;  3C7J A;  2H8W A;  2R7Q A;  1CQT A;  5FFX A;  1YJW I;  2KFD A;  2HPM A;  2PXK A;  5CQE A;  2GA1 A;  1XTA A;  2JQ7 A;  4BY7 J;  2DN0 A;  4FT8 A;  5ILV A;  2ZKZ A;  3HGY A;  2Y75 A;  1GV5 A;  4GFB A;  1IRG A;  3S16 J;  2Y31 A;  4CCK A;  5KNL A;  3R4K A;  3GCM A;  5IT3 A;  2PMZ N;  3O3K A;  1W36 C;  1TZL A;  2YU9 J;  1YX3 A;  2GA2 A;  5M3M J;  2H6B A;  5E18 F;  4Y52 J;  4B47 A;  3S1N J;  5DTM A;  5J3L A;  1DQU A;  2E1O A;  2L9N A;  3DLA A;  1A6Q A;  5AON A;  4IO9 F;  1VQ4 I;  1LMB 3;  1I6X A;  4FET A;  4UVC A;  3NEU A;  2R4G A;  4XLE A;  1X3W B;  1R22 A;  1Q1V A;  4E7K A;  1ITY A;  2CJJ A;  2XAU A;  3G1O A;  4ZTF A;  1RI7 A;  3W6V A;  1SAU A;  1HDP A;  1R1U A;  4ESB A;  3AFH A;  5K7H A;  5DTD A;  2R3S A;  1BR2 A;  1EFA A;  5ED4 A;  4M3E A;  3LAP A;  1WWX A;  1ZS4 A;  1W7P A;  2JT1 A;  1BC7 C;  2JA6 J;  3QOX A;  1Y1W J;  2Q2E A;  5JHU A;  4CCL A;  2CYY A;  2X4H A;  3OOU A;  3QPT A;  5J40 A;  1IDZ A;  1ZZ7 A;  5TGT A;  1L1M A;  2H27 A;  2BVL A;  1NK3 P;  3CDH A;  2RQQ A;  2VOO A;  3BPV A;  4EVI A;  3KZ3 A;  2DJN A;  2JTV A;  4WXH A;  3TW7 A;  1TC3 C;  2PLY A;  5EGO B;  3CCS I;  2W48 A;  3P9C A;  4JYK A;  3OR1 C;  5DM6 F;  9ANT A;  4IHT A;  1HXD A;  1P7I A;  3CDL A;  5E1W A;  1IN8 A;  2R63 A;  1FMV A;  2EPF A;  3BZ6 A;  4A3K J;  2QLZ A;  1OCP A;  2KPJ A;  3MCZ A;  4IL6 C;  2ZXW H;  3U1K A;  2R1J L;  3NDB B;  3DKX A;  4QTR A;  2WV0 A;  1GV2 A;  2DOF A;  1POG A;  1VPW A;  1S72 I;  1P92 A;  4LIT A;  3H9Q A;  4JX6 A;  1ZK8 A;  3EPZ A;  2A6C A;  1OPC A;  1OFC X;  1ON1 A;  4Y17 A;  1T95 A;  4EEF G;  1YHQ I;  3HC7 A;  1BA5 A;  1O7F A;  3BTI A;  5HOD A;  2A68 F;  3I58 A;  2PIJ A;  3VK0 A;  3UKG A;  1A31 A;  2XI8 A;  4D7M A;  4A3E J;  5JLW A;  4EQZ A;  4HV5 A;  1MFQ C;  2NVQ J;  5KK1 A;  2V7F A;  1REP C;  1HLV A;  4PJL A;  2VXD A;  2FRH A;  2IAI A;  3CP8 A;  1N78 A;  2OCC H;  3FX3 A;  1N75 A;  2HGC A;  4NUB A;  4L5I A;  2MXD A;  3JR9 A;  3JRG A;  2DPU A;  1X4O A;  2DW4 A;  4R8H A;  4AD9 A;  4WWC A;  3JXC L;  3F8N A;  1PYV A;  3OMY A;  3S15 J;  1G3T A;  3GTJ J;  1YSE A;  1XGS A;  3QPS A;  2PUA A;  1DGW Y;  5K5Q A;  2VN2 A;  3BP8 A;  1BC8 C;  1BR4 A;  3I54 A;  2NVX J;  5F04 A;  2DMQ A;  4DYQ A;  2HEO A;  5HNH A;  1B8I B;  1QU3 A;  3T0Y A;  2XIU A;  4JK1 X;  2L02 A;  3NAR A;  2ESN A;  3NZL A;  4GYG A;  1TQI A;  2HFH A;  4GXO A;  1BJA A;  2ZC2 A;  4A69 C;  4YG4 A;  2Z5U A;  3H3Z A;  4M9X A;  1WJC A;  3HZJ A;  3WTT C;  2M0C A;  3IRR A;  2JWT A;  2PMU A;  3NWS A;  4UUS B;  3JCU C;  5D4S A;  2O7O A;  2EBI A;  2LH9 A;  5LRR A;  5LD2 C;  2HCN A;  4BH9 A;  5H6Q A;  1HKQ A;  1FSE A;  1MBJ A;  3CJQ B;  3TP0 A;  3CLQ A;  5DD4 A;  2PUD A;  3LIS A;  2R92 J;  2FMY A;  4FHT A;  2V79 A;  1P7J A;  2E36 A;  4IRI A;  1YRN A;  3L2U A;  1ZGA A;  5LGN A;  1ZRC A;  3OSF A;  3DWL E;  5F08 A;  5DS9 A;  3CUQ C;  2KIU A;  3LL7 A;  1R71 A;  3MKW B;  2PBI A;  1EF4 A;  5J8F A;  2CV1 A;  3KP6 A;  4Y3O A;  4LG0 A;  3A9Y A;  4Z6Y A;  2HPI A;  3S93 A;  4BHC A;  3GUD A;  4UV9 A;  4KT5 C;  3PIP F;  1LVA A;  1ODD A;  4RLQ A;  3I5U A;  2EA4 A;  2JA8 J;  2VLA A;  3BJO A;  3SHF A;  3GZ5 A;  5EZG A;  2VT2 A;  3L2R A;  3OYD A;  4F55 A;  3GFJ A;  3KIO A;  1MDM A;  3S1M J;  3BR5 A;  3CP2 A;  2LOO A;  4HW0 A;  3RZD J;  1ZQ3 P;  5FO5 A;  3BD1 A;  1CF7 A;  4XIC A;  1KON A;  2V26 A;  3H1C A;  3S2H J;  1M1E B;  1RZR D;  1B9N A;  2PE5 A;  3MFK A;  4FAS D;  2EIK H;  4MFD A;  1DGR M;  2XF6 A;  4BQO A;  1FOX A;  1WI3 A;  1IRZ A;  2OAZ A;  3CO6 C;  5IOY A;  1FBU A;  3WHC A;  1FPQ A;  5FB2 A;  3ZQI A;  3CCL I;  5BPI A;  1JKQ C;  2XXA A;  5M5X J;  4NDL A;  3CCY A;  3BC8 A;  4WXD A;  4Q4Z F;  4ZH4 F;  1ETW A;  1G8X A;  4CA0 A;  2H8R A;  1T2K A;  4NDW A;  2NS8 A;  2NNY A;  1BJZ A;  2A61 A;  2V9P A;  2E1M C;  3HRM A;  2YX7 A;  1AWC A;  2R5Z A;  3TRB A;  1FBQ A;  4JBA A;  1VQ6 I;  2LCV A;  4M6V A;  4CYC A;  1KQ8 A;  4LOC A;  1V55 H;  2E19 A;  1F1Z A;  3F0C A;  3SZT A;  1FIP A;  4CCM A;  5M5Y J;  1RIO H;  3OQM A;  3FK7 A;  3H0D A;  4GQM A;  1OYW A;  5J8C A;  3BWG A;  3VWB A;  4M74 A;  1USS A;  1NER A;  2PUE A;  1D0Z A;  3BPX A;  1BI1 A;  1V5E A;  1QBJ A;  1ETY A;  2WY8 Q;  2MG4 A;  4OU0 A;  5JFR A;  3T5X A;  2PJR B;  2CV0 A;  2Z33 A;  4G6T B;  3JRH A;  3PE5 A;  3G0T A;  5HDG A;  3C18 A;  3FHN A;  4LB6 B;  2G7H A;  3FDY A;  4A3B J;  4ENJ A;  5ILU A;  2DBB A;  1SEU A;  1YW7 A;  2K9L A;  3RKQ A;  2JA2 A;  4XOR A;  5CLS A;  1LJ9 A;  4KMU X;  4PZJ A;  3H3V K;  1JT0 A;  1P4A A;  1WH7 A;  2ZFU A;  4BE1 A;  4L0Z B;  1X57 A;  2DFH A;  2KJB A;  2F5F A;  3BDD A;  4XON A;  4YIF A;  4OAY A;  2L2O A;  2M8E A;  5H2F C;  2P7C B;  2ICP A;  4I09 A;  1T6S A;  1R36 A;  2XAJ A;  2EFQ A;  1MJB A;  3VDX A;  2CG4 A;  2RQP A;  4PU7 A;  4X6A J;  2M5W A;  3HHG A;  4IX7 A;  2ZBK A;  4D7N A;  3ABM H;  3QPL A;  5CVU A;  2VBY A;  1KGS A;  2XB0 X;  3ABK H;  5JVG F;  1AHD P;  5BS6 A;  3S3M A;  3HKZ N;  3E0J B;  1IXR C;  2GIZ A;  3HXL A;  1D0Y A;  4HNV A;  2E1M B;  1OLT A;  2XRN A;  2J5O A;  3ULQ B;  1GVJ A;  2A6H F;  3I64 A;  3K2A A;  3HL2 A;  3DLL F;  4Q48 A;  2O4A A;  3FXQ A;  3LOC A;  4A3M J;  1MH3 A;  5LEK A;  2DK5 A;  2FBK A;  3G1M A;  3RYP A;  1UXC A;  2VKV A;  5H20 A;  2QEX I;  2DOE A;  3GZC A;  1RPE L;  2A5W A;  2E71 A;  2R7W A;  4L5J A;  3O6B B;  4EGY A;  4KYW A;  3B73 A;  4U0W A;  2IS2 A;  4A12 A;  3EET A;  4XLP F;  3CO7 C;  3ONQ A;  5DCM B;  1RUO A;  5FLX K;  1S3J A;  4M71 A;  3I0T A;  4ZTJ A;  2M7B A;  1R49 A;  4J19 A;  1WZ2 A;  3U3W A;  2PXU A;  3N05 A;  3FMS A;  4HV6 A;  1FNN A;  4WX9 A;  3KYD B;  4F93 B;  1JKP C;  2LVS A;  5LHH A;  3GZD C;  4Y4R A;  2HS5 A;  1U0J A;  3NQO A;  3MEX A;  3LNQ A;  2J5P A;  5KVR A;  2VEO A;  1YG2 A;  2MSY A;  2JSP A;  2LY2 A;  1LEA A;  4JOM A;  1TWF J;  4GO1 A;  5GTH C;  1VTN C;  2AWI A;  1H0M A;  4FE4 A;  3CCU I;  2LYL A;  2JUC A;  4PJJ A;  5EF6 A;  2QVO A;  5IY5 H;  5E79 C;  2F4I A;  4YII A;  2XXP A;  1XSV A;  3TDZ C;  2O3F A;  1XMX A;  4G6Q A;  5KHD A;  1WFX A;  1UMQ A;  4AUX A;  1MBG A;  1SD6 A;  2JPB A;  5HDN A;  1XGO A;  4IHV A;  3F8C A;  2E5N A;  3QWL A;  1MBK A;  3D5S C;  2LP0 A;  3E6C C;  1B59 A;  1LB2 A;  5LLQ A;  3QU3 A;  2EA2 A;  4BUP A;  4Y13 A;  3G3Z A;  1IN5 A;  4I6U A;  3C2G A;  2QEN A;  3S14 J;  2LLV A;  4A0Z A;  3RDI A;  2IBD A;  2FNP A;  1OJL A;  4LD5 A;  3M3Y J;  3P7N A;  1QZY A;  3J81 Z;  3KYL A;  2GLO A;  5GAE J;  2VPL A;  1MMN A;  1J59 A;  3OQO A;  3DBR B;  5DV5 A;  1OIS A;  5M5W J;  3SYT A;  1PUF A;  3C1D A;  4HX7 A;  2Y9Z A;  5IP9 J;  2BY2 A;  1LFB A;  2DDB A;  1BIB A;  3BCB A;  2PXD A;  3HRT A;  5IYB J;  3S32 A;  1TWG J;  3JTG A;  3E1S A;  2STT A;  1TWC J;  3DXJ F;  1F5T A;  2K85 A;  3PL8 A;  2O9L A;  5DEQ A;  3GTL J;  3V8K A;  3OYE A;  1QO0 D;  1UCR A;  1ZPQ A;  2M4K A;  2XGX A;  3TEL A;  2QKM B;  2XV4 S;  4LGW A;  4JX5 A;  5FGM A;  2DT7 B;  1PDN C;  1JTX A;  4AWX B;  4G94 A;  2VI6 A;  1Z05 A;  1QP4 A;  4P1W A;  2HR3 A;  3LA3 A;  5TRD A;  5CVV A;  3M8F A;  2K4B A;  1YS7 A;  1KQ9 A;  1UHW A;  3CMM A;  1DDN A;  4X0G A;  3BDN A;  1E3P A;  3RPU D;  1MNE A;  2EZK A;  1BI3 A;  3I9V 2;  3PFI A;  1TNS A;  2XGC A;  3WE2 A;  4DYC A;  2OD5 A;  1K4T A;  4JX4 A;  2LF8 A;  1MD0 A;  1TTY A;  1SD7 A;  4YFX F;  2EV5 A;  2PI0 A;  3E97 A;  2W00 A;  2KP6 A;  2FJ1 A;  2WB1 N;  2YX4 A;  2G9W A;  3JRI A;  4O8B A;  4JQD A;  1S9H A;  2G0E A;  1JTY A;  1WJE A;  4B48 A;  2EFW A;  3SCF A;  4W97 A;  1XSD A;  2L4M A;  3LFP A;  1LE8 A;  2K9S A;  4M3D A;  2JUG A;  2FXA A;  2VUM J;  4XL9 A;  3LSH A;  3GN5 A;  3ME5 A;  5L3G A;  2C6Y A;  1XDS A;  1ENH A;  4HF0 A;  3JRF A;  1Y1V J;  5CVR A;  4E7H A;  4Q5S F;  1UTX A;  1TT5 B;  2L49 A;  4XQF A;  2L3D A;  3PNY A;  3CRO L;  4XR6 A;  3EUS A;  1ZH5 A;  3DEU A;  4XKW A;  3MMY B;  3W2V A;  3CC4 I;  2LYR A;  3OYC A;  2XSJ C;  1S6L A;  1VZ0 A;  2M3A A;  2FNA A;  5E3M A;  3WGH A;  1YFH A;  1G3Y A;  1R6R A;  2L9V A;  2V9V A;  5FLV A;  3HEF A;  5GAH i;  3TOA A;  4U0Y A;  4XK4 A;  4B3X A;  5F27 A;  4FX0 A;  4U7B A;  3HPH A;  4D5F A;  4I6R A;  2LLK A;  3RIR A;  4B43 A;  2K9Q A;  4KIT B;  2KRH A;  3CF5 F; 
#chains in the Genus database with same CATH homology
 2R93 J;  2Y2Z A;  4BY7 J;  2R5Z B;  2DN0 A;  3WHB A;  2XGD A;  1D5Y A;  1DU0 A;  2ID3 A;  3ZQH A;  3HGY A;  1GV5 A;  4GFB A;  3S16 J;  2Y31 A;  1FIA A;  3JRE A;  2HDD A;  5FLM J;  2IV1 A;  3UFD A;  4Z58 A;  2CUE A;  2PMZ N;  4W1U A;  2L7F P;  2YU9 J;  1JWL A;  3G1L A;  5M3M J;  4J1W A;  3BR3 A;  2JA7 J;  4MIM A;  4Y52 J;  2EZL A;  2HYJ A;  3BTJ A;  3S1N J;  3LSP A;  2E2I J;  5J3L A;  1QPZ A;  3HOZ J;  2E1O A;  3Q0V A;  2HSG A;  4PU4 C;  1LMB 3;  3CMY A;  2EBY A;  4I6Z A;  1QQA A;  5EDN A;  4I76 A;  3OP9 A;  1RZR A;  2LYS A;  1Q1V A;  1ITY A;  4FCY A;  2CJJ A;  4UUT A;  3G1O A;  3W6V A;  2ME6 A;  2CQQ A;  1HDP A;  2FQ4 A;  1EFA A;  5K7H A;  5DTD A;  1JUS A;  5J1R A;  3G7D A;  3LFP A;  5EG0 A;  2O8K A;  4I8T A;  4M3E A;  1ZS4 A;  2HI3 A;  3LSR A;  2JA6 J;  1Y1W J;  1JKR C;  2X6O A;  1ZZ6 A;  1IDZ A;  3OOU A;  2ID6 A;  5IYD J;  2OPT A;  2ZB9 A;  3ZQC A;  1ZZ7 A;  2BNN A;  3JXD L;  1L1M A;  2X48 A;  1NK3 P;  5JLX A;  3KZ3 A;  4M3F A;  2DJN A;  4C3I J;  2LYK A;  3IVP A;  4DW6 A;  3S8Q A;  1MSF C;  3HZI B;  2WAQ N;  3TW7 A;  1FTZ A;  1TC3 C;  2JVL A;  5EGO B;  1RIO A;  2W48 A;  4JYK A;  2R0Q C;  9ANT A;  1GVD A;  1ZKG A;  3HBL A;  4FE7 A;  3CDL A;  1P7I A;  1VFC A;  2R63 A;  1MNM C;  5E3L A;  3F51 A;  4A3K J;  1OCP A;  2BNO A;  2KPJ A;  1IUF A;  1WIZ A;  2MGQ A;  4J1X A;  2KEK A;  2R1J L;  2FJR A;  5F0F A;  2PPX A;  2ELK A;  4QTR A;  4JCY A;  1GV2 A;  1POG A;  2AXZ A;  1VPW A;  1JT6 A;  2PUF A;  4JX6 A;  1ZK8 A;  4FIS A;  2A6C A;  3PM1 A;  3BG3 A;  5K98 B;  1OFC X;  3E7L A;  2GZU A;  4EEF G;  1NTC A;  3MN2 A;  1WH5 A;  3TED A;  3BG9 A;  1BA5 A;  4JCX A;  2DTZ A;  5IP6 A;  3F52 A;  3BTI A;  5HOD A;  3VK0 A;  2PIJ A;  3UKG A;  3ZQL A;  3DCF A;  3I4N J;  2XI8 A;  4D7M A;  4OB4 A;  4A3E J;  5JLW A;  2DA6 A;  2NVQ J;  2DA4 A;  4XID A;  1HLV A;  2Y0S N;  4D5C A;  4V2G A;  5GPA A;  3GTK J;  4I6T A;  2IAI A;  3BR1 A;  1BW6 A;  2QCO A;  2HQ5 A;  3MVP A;  2GRL A;  1U9O A;  2O49 A;  3JR9 A;  1MH4 A;  3JRG A;  1RET A;  2HIN A;  2KZ8 A;  2XPV A;  3JXC L;  1ZZC A;  2EZI A;  3BQZ A;  3LSG A;  3S15 J;  1LQC A;  3I4M J;  4S0H B;  3GTJ J;  1YSE A;  3QPS A;  1ZZB A;  1W0T A;  5EEA A;  2PUA A;  2HOT A;  5BNG A;  2DMT A;  2MQK A;  5FKK A;  2NVX J;  3A02 A;  4M3G A;  5F04 A;  1PER L;  2DMQ A;  4DYQ A;  2L7Z A;  2KEI A;  3GTM J;  1B8I B;  1ZZ8 A;  1VI0 A;  1JJ6 C;  2XIU A;  2X9D A;  2JJ7 A;  4FN3 A;  5E3O A;  3NAR A;  3S2D J;  3H5T A;  4M3B A;  2LTP A;  5FKM A;  1NK2 P;  1MBF A;  4A69 C;  1TWA J;  4YG4 A;  1R69 A;  2WUS R;  1B72 A;  2E2J J;  1ZTR A;  2L0K A;  2K40 A;  2M0C A;  3HM5 A;  2LD5 A;  4IVZ A;  2HOA A;  4BXX J;  2JWT A;  3FYM A;  2DA2 A;  1UXD A;  4UUS B;  5J1Y A;  2O7O A;  2EBI A;  3S1R J;  2YUS A;  3SFI A;  1MBJ A;  1T33 A;  3TP0 A;  4X4E A;  3B6A A;  3CEC A;  2PUD A;  1GT0 C;  4BBR J;  3LIS A;  1RES A;  2R92 J;  4PU8 A;  3G5G A;  2AHQ A;  1P7J A;  4C3H J;  1YRN A;  4IHY A;  1W0U A;  4L5E A;  3OSF A;  5F08 A;  5DS9 A;  1T56 A;  4BY1 J;  1U8B A;  3KXA A;  3FMY A;  3O8G A;  1JFT A;  2WV1 A;  1EF4 A;  1WH6 A;  1QPI A;  2O38 A;  1UHS A;  1IGN A;  3MKL A;  1O4X A;  2XSD C;  3GTG J;  4Z5D A;  1SAN A;  1VF9 A;  1JUP A;  1DW9 A;  2IEK A;  2JA8 J;  2JCG A;  3ZQF A;  3PO2 J;  5EZG A;  4Y7N J;  2AXU A;  2R5Y A;  5FKL A;  2HXO A;  3S1M J;  2QF7 A;  3BR5 A;  1ZQ3 P;  3RZD J;  2I10 A;  3ZHM A;  1A6I A;  2M2E A;  3BD1 A;  4XIC A;  3FIW A;  2EWT A;  1X2N A;  3S2H J;  1ZZ9 A;  1RZR D;  2PE5 A;  4MFD A;  1RKW A;  4B3A A;  3BR0 A;  1WI3 A;  3RZO J;  2DMU A;  1IRZ A;  1B0N A;  5IOY A;  3WHC A;  1IJW C;  3ZQI A;  1JGG A;  3QQ6 A;  4IEJ A;  5J1U A;  3TP3 A;  1JKQ C;  2NS7 A;  4QSH A;  5M5X J;  4NDL A;  3CCY A;  5C3E J;  4YAR A;  1JH9 A;  1ETW A;  1RZS A;  1ETX A;  2LY9 A;  2H8R A;  1RPW A;  4NDW A;  2NS8 A;  1BJZ A;  1SFO J;  2JA5 J;  2R5Z A;  3TRB A;  3JRC A;  3O9X A;  2HXI A;  2XRL A;  4X4F A;  2AW6 A;  2LCV A;  4M6V A;  4CYC A;  5A7L A;  3QYX A;  4LOC A;  5M5Y J;  2E19 A;  3OQM A;  3F0C A;  1FIP A;  1I50 J;  1G2H A;  3FK7 A;  2ME0 A;  1FJL A;  3GTQ J;  4GQM A;  4UUS A;  1K83 J;  2FX0 A;  1F36 A;  1NER A;  1JKO C;  2PUE A;  3PO3 J;  1ETY A;  2MG4 A;  1IDY A;  2H1K A;  4XRS A;  2JN6 A;  1GUU A;  1H88 C;  3ZQG A;  5GP9 A;  4IHX A;  5K7Z A;  3IV5 A;  3JRH A;  5C4X J;  1QP7 A;  4XRS G;  2NOG A;  4ABZ A;  3BTC A;  1APL C;  4A3B J;  2PUG A;  1QP0 A;  2FD5 A;  1ETV A;  3RKQ A;  1ADR A;  3SCH A;  3H3V K;  1BW5 A;  5FJ8 J;  1JT0 A;  5FKN A;  1WH7 A;  5EYR A;  1GDT A;  1X57 A;  2IVB A;  2OFY A;  2AXV A;  2K9N A;  2LFB A;  1VND A;  4Z59 A;  3D1N I;  2ICP A;  2LKX A;  3Q0W A;  3BT9 A;  3Q0U A;  4PU7 A;  4MLO A;  4X6A J;  3F6W A;  3PXP A;  1F43 A;  4Z5H A;  1ZVV A;  2AUW A;  1HF0 A;  4D7N A;  4MCT A;  1QQB A;  3QPL A;  3RZZ A;  1HOM A;  4JP0 A;  2XB0 X;  1AHD P;  3HKZ N;  2CRG A;  2M34 A;  1UG2 A;  5F1J A;  1WET A;  2TRT A;  1X2L A;  4HNV A;  4FTH A;  1WCM J;  1LCC A;  1MBE A;  5EZH A;  3QWG A;  1ETK A;  3K2A A;  2CUF A;  2O4A A;  3LOC A;  4A3M J;  1MH3 A;  4X4I A;  1U9N A;  1Y9Q A;  5F0H A;  1ETQ A;  3G1M A;  1XWR A;  1UXC A;  2VKV A;  1BDH A;  3TW6 A;  5IP7 J;  4X1E A;  3JXB C;  1RPE L;  1SQ8 A;  3LSJ A;  3ZOB A;  3FYA A;  1U78 A;  1XC5 A;  3GN5 B;  4F8D A;  2KDZ A;  3A03 A;  4J19 A;  3U3W A;  1QRY A;  2N8G A;  3H0G J;  1B8I A;  1AKH B;  4Y42 A;  4AC0 A;  2VPR A;  1JKP C;  2LVS A;  3HOU J;  3S17 J;  1XS9 A;  2XJ3 A;  1PUF B;  4A93 J;  2EZH A;  3K7A J;  2WIU B;  3LNQ A;  1Z77 A;  3SDG A;  1IV6 A;  2XCJ A;  2JK3 A;  4QIW N;  4C3J J;  3OQN A;  4DZP A;  2VKE A;  1WH8 A;  2MSY A;  5M3F J;  1LLI A;  1K61 A;  2DA5 A;  1I6H J;  2IVQ A;  2XB5 A;  2GRM A;  1ZAY A;  2R7Z J;  3JRB A;  2BNM A;  1TWF J;  3HOX J;  2LR8 A;  2AWI A;  1PNR A;  4FE4 A;  1YRN B;  1E3O C;  2LYL A;  4MFE A;  1ORK A;  5EF6 A;  3DNV B;  1RR7 A;  1JUM A;  4AYB N;  3BTL A;  1AKH A;  3OSG A;  2D5V A;  1Z0X A;  3Q3S A;  1WPK A;  4AUX A;  1UMQ A;  4RDU A;  4A3G J;  2LYJ A;  1MBG A;  3QF3 A;  3HOV J;  1X58 A;  1H89 C;  1DU6 A;  4IHV A;  4X4G A;  4X4B A;  2GBY A;  1MBK A;  4B1R A;  1FEX A;  2L7M P;  2LP0 A;  2COB A;  2DMN A;  2P81 A;  4DYR A;  3A01 A;  4PU3 C;  2EQR A;  1JFS A;  1MBH A;  3OMT A;  3HOY J;  3KJX A;  3BQY A;  3C2B A;  5EGO A;  4I6U A;  1H8A C;  4IHW A;  3S14 J;  5F0C A;  2OR1 L;  4MO7 A;  3FKI J;  3CLC A;  2ECB A;  2LYP A;  2IBD A;  1R9T J;  3BG5 A;  4FBI A;  1BDI A;  3VPR A;  1OJL A;  3BR6 A;  3HB9 A;  2JMW A;  3IH4 A;  3CQZ J;  2CQX A;  1B72 B;  1MSE C;  2GM4 A;  3M3Y J;  4BBS J;  2PUB A;  2B5A A;  2M9H A;  3B6C A;  2GLO A;  4A3L J;  3GTP J;  1POU A;  2DA7 A;  1NEQ A;  3JRD A;  5M5W J;  4GHJ A;  3OQO A;  1JJ8 C;  1PUF A;  2LK2 A;  2Y9Z A;  1IG7 A;  3R1F A;  1CJG A;  1PRV A;  2NVY J;  4A3C J;  4IWR A;  5IP9 J;  2Y9Y A;  3S1Q J;  1LFB A;  2L8N A;  5IYB J;  1XG1 A;  1TWG J;  2HOS A;  4YG7 B;  2KT0 A;  1TWC J;  5IOZ A;  5IPA A;  2O9L A;  3B7H A;  5K7F A;  3GTL J;  5IYC J;  3IH3 A;  1ZPQ A;  1HCR A;  3SCG A;  1IC8 A;  2CRO A;  4YBA A;  4JX5 A;  4C2M J;  4MCX A;  1I3Q J;  1JTX A;  3BR2 A;  3BS3 A;  3QQA A;  2M8G X;  2MEZ A;  2VI6 A;  4V2F A;  1WGX A;  1LCD A;  1QP4 A;  1OSL A;  1ETO A;  3SJM A;  2Y30 A;  1ZGW A;  2LYQ A;  1ZR4 A;  1DWK A;  2BJC A;  4RBO A;  1QVU A;  2PUC A;  2XPU A;  3BDN A;  1A5J A;  2DA1 A;  1PRA A;  2EZK A;  2NVT J;  2XGC A;  4DYC A;  3A01 B;  4JX4 A;  1R63 A;  3HDD A;  3GBF A;  4DZJ A;  3HOW J;  5C44 J;  3GBG A;  3NAU A;  3IH2 A;  3RQI A;  3GTO J;  2IUO A;  2CSF A;  3FK6 A;  4B4C A;  2EF8 A;  1S7E A;  3JRA A;  2E2H J;  2XPW A;  2EH3 A;  2FJ1 A;  2WB1 N;  2RAE A;  3JRI A;  4O8B A;  3ZKC A;  4JQD A;  4G12 A;  3DEW A;  2G0E A;  1JTY A;  2IU7 A;  3SCF A;  4W97 A;  3FIS A;  1LE8 A;  4YG1 A;  2TCT A;  3L1P A;  1ZR2 A;  4A3D J;  2K9S A;  4IA8 A;  1RKT A;  4M3D A;  1TWH J;  1PRU A;  2VUM J;  5GPC A;  3GN5 A;  1HDD C;  3M4O J;  1ZUG A;  1ENH A;  3JRF A;  1Y1V J;  1FTT A;  2YS9 A;  1OCT C;  2MW8 A;  3OIO A;  1UTX A;  2L49 A;  2R5Y B;  2AO9 A;  1LFU P;  1Y7Y A;  4Z5C A;  2DA3 A;  3ZHI A;  4X4H A;  3O8H A;  2KEJ A;  3CRO L;  5EG0 B;  1BL0 A;  2L9R A;  3EUS A;  4A3I J;  2CU7 A;  4XRM A;  2LYR A;  4X4D A;  1LE8 B;  2IVG A;  4X4C A;  2DMP A;  5E3M A;  4CYC B;  4A3F J;  5C4J J;  1AU7 A;  5FLV A;  3HEF A;  2XGE A;  5E3N A;  1QVT A;  2OF7 A;  4XK4 A;  1X2M A;  5F27 A;  2B63 J;  5FKO A;  4D5F A;  1CQT A;  4I6R A;  2ICT A;  2LLK A;  3HGG A;  4A3J J;  2K9Q A;  3MLF A;  4BKX A;  2ECC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...