2H8RA

Hepatocyte nuclear factor 1b bound to dna: mody5 gene product
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
219
structure length
176
Chain Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of disease-causing mutations in hepatocyte nuclear factor 1beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
molecule keywords 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*
total genus 56
structure length 176
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2h8rA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2h8rA01
3I4NJ 2BJCA 2IU7A 3H5TA 3GTLJ 4JX5A 1BW5A 1MBGA 4X4FA 4JYKA 5FJ8J 1Z77A 2ECCA 3E7LA 2PUBA 1WGXA 1SFOJ 2IVBA 3FKIJ 3BDNA 2HOTA 2JA5J 2LYLA 4JQDA 3BR3A 4J1XA 5EEAA 1HF0A 3MKLA 3IH3A 3SFIA 5EDNA 4FN3A 3DEWA 3LFPA 1BL0A 4ABZA 3SJMA 1EF4A 3OIOA 2Y31A 2ECBA 3HB9A 2BNNA 5JLWA 2PUAA 2XRLA 2JA8J 2OFYA 1WCMJ 1RR7A 1VI0A 3HKZN 5J1RA 5K98B 2D5VA 4M3EA 3BD1A 3KZ3A 3GTPJ 4JP0A 4JX6A 3L1PA 2PUCA 2NOGA 2VPRA 1ETKA 2LVSA 4QSHA 4IWRA 2P81A 4YBAA 1U78A 1DU6A 1YSEA 1ETWA 4A3IJ 3SDGA 1CJGA 1ZVVA 2R5YB 1K61A 1ADRA 3U3WA 1DU0A 1YRNB 1U9OA 2M34A 4EEFG 1D5YA 3I4MJ 1XWRA 3BQYA 2CUFA 4A3BJ 2E2HJ 1Y7YA 5M3FJ 3F6WA 1Q1VA 4C2MJ 2RAEA 4IEJA 2L8NA 2PIJA 2OF7A 2ELKA 4IHYA 2LLKA 4JCYA 4DYQA 3QYXA 1H8AC 2R1JL 1WH5A 1TWAJ 3HDDA 3FYAA 5DS9A 2WB1N 3M4OJ 1JWLA 1BDIA 4FE7A 4I6ZA 1XC5A 2M2EA 1ENHA 3S1MJ 1BA5A 3IVPA 1QP0A 5EYRA 3IV5A 4XK4A 5IYCJ 3SCGA 2VKVA 3LSJA 2I10A 3BTIA 1ZTRA 2HOSA 4X6AJ 3GTQJ 4B3AA 2JN6A 4DYRA 2O38A 2L49A 1FTTA 2E1OA 2XGCA 1T33A 2R63A 4Z5DA 1ETXA 1K83J 1VFCA 4IHXA 2N8GA 3MLFA 3BTCA 2R5ZB 2JWTA 1MNMC 1MBKA 3OQOA 4Z5HA 4MFEA 4D7MA 1IGNA 1BDHA 3S15J 3TEDA 2GZUA 5E3NA 3JR9A 4X4IA 1R63A 3HZIB 2LY9A 3H0GJ 1NK3P 2LYQA 1A6IA 2E19A 4BKXA 1GV2A 3HM5A 2EZLA 4MIMA 1U9NA 2XPVA 4Z59A 1RKWA 3TW7A 1QP7A 3ZHIA 2K9SA 3BQZA 3TP0A 3RZDJ 4Z5CA 2GBYA 3BT9A 1ZR4A 5K7ZA 5FKOA 3LSPA 1JTXA 4MCXA 4PU3C 4JCXA 4GHJA 1ITYA 3OOUA 1AHDP 4J1WA 3S14J 4X4HA 2ID6A 1ZKGA 1WPKA 3NAUA 2AWIA 2MW8A 2Y2ZA 1MSEC 2MQKA 4O8BA 2Y9YA 4A3JJ 2NVQJ 5F0CA 4B4CA 3GTGJ 3BR6A 3UFDA 3OQMA 2LYRA 2LTPA 2PUDA 3HOYJ 3B7HA 3OQNA 1AKHA 1XS9A 2DA7A 2OPTA 5J3LA 2LR8A 4RDUA 2Y0SN 3CROL 4A69C 4I6UA 2DMPA 1LFBA 4I6TA 1ZZ8A 3K2AA 2YS9A 1TWGJ 2TRTA 1GUUA 1ZS4A 3GTOJ 1JGGA 1X57A 4I8TA 3NARA 3EUSA 1B0NA 2LP0A 2BNMA 1TWHJ 1P7IA 1F36A 1OCPA 3O8GA 1NEQA 3F51A 1JUSA 2HXIA 3CMYA 4XRSG 2KEIA 5M5XJ 1WETA 1RPWA 1L1MA 4UUSA 1ZZCA 3TRBA 2DA1A 2DMUA 2CQXA 2XPWA 1OSLA 1PRVA 3HEFA 4I6RA 4QIWN 3ZQCA 2VUMJ 3PO3J 2O7OA 3FISA 5K7FA 1SANA 1PUFB 2LD5A 3GN5A 1I3QJ 3PM1A 4CYCB 2PE5A 2EZIA 1ZZ9A 3BG3A 1NTCA 4IHWA 2HOAA 5E3MA 4RBOA 2FJ1A 4HNVA 2CRGA 4X1EA 2GRLA 2WIUB 2HYJA 4C3JJ 5C3EJ 2CSFA 5F0FA 1X2MA 1GDTA 4G12A 1UHSA 1HLVA 3CDLA 1JKPC 1IUFA 2ME0A 3H3VK 2HQ5A 1RZSA 3GN5B 1RIOA 1JUMA 1YRNA 5C4JJ 3JRIA 1JFTA 2O4AA 5F04A 1E3OC 2X48A 2DA4A 1NK2P 3LNQA 4NDLA 3KXAA 3GTKJ 3ZQHA 2LKXA 4I76A 1TC3C 2KEKA 2NS8A 1R69A 3QQ6A 1JFSA 1LCDA 3BR2A 5A7LA 1ZQ3P 2O8KA 3RKQA 1AKHB 1SQ8A 1B72B 2HINA 3TW6A 3BR1A 5FKLA 3FK7A 3OSGA 2PUFA 4UUTA 1JUPA 1PRAA 2CU7A 1QVUA 3JRHA 3CQZJ 1O4XA 1OFCX 2AXZA 2ID3A 1UG2A 2QF7A 3HOZJ 3QPLA 2E2IJ 4C3IJ 1I50J 3D1NI 3HBLA 2LYKA 3B6CA 3HOUJ 4BBSJ 1JTYA 1P7JA 4W97A 3CCYA 2L7ZA 3UKGA 1GVDA 3VPRA 1ZZBA 2XB0X 1UXCA 3LISA 2QCOA 1X58A 1QPIA 4XRSA 2W48A 4BBRJ 2TCTA 2KDZA 2WAQN 3A01B 4A93J 3ZQGA 4CYCA 3RZZA 3F0CA 3BG9A 3O9XA 3B6AA 2A6CA 2CROA 2IVGA 2HXOA 2DJNA 5E3OA 4A3DJ 2PUGA 2G0EA 1NERA 3BR5A 3LOCA 1PRUA 2JVLA 3RQIA 2CQQA 1JKOC 2LYPA 5EGOB 2CUEA 2WUSR 2MGQA 2NVYJ 2LYJA 1AU7A 3GBFA 2IBDA 1H88C 4BY1J 4A3LJ 4IHVA 2LYSA 2H8RA 3HOVJ 2XCJA 1LCCA 3VK0A 2AHQA 3C2BA 2EWTA 1FIAA 1MBHA 3GBGA 1RETA 1RKTA 5E3LA 2IUOA 2DMNA 4X4CA 2ICPA 2ME6A 4D5FA 1APLC 2NVTJ 5EGOA 2LK2A 2NVXJ 3RZOJ 1WH8A 2KPJA 1H89C 1VPWA 2EZHA 3KJXA 2IAIA 2DTZA 3G7DA 4A3CJ 1ZUGA 3GTJJ 2O9LA 1ZZ7A 1UMQA 2L9RA 3MN2A 4A3FJ 1IG7A 2KT0A 2EF8A 2AW6A 1FEXA 3S1QJ 1I6HJ 2JA6J 1U8BA 2JK3A 4W1UA 4A3GJ 3ZQFA 4IA8A 3TP3A 4MFDA 5M3MJ 3F52A 1QQBA 2JJ7A 4PU7A 3DNVB 3ZKCA 1ZZ6A 2X9DA 2GLOA 1POUA 1A5JA 2M0CA 2XGEA 4FBIA 4MLOA 4PU8A 3JXBC 4V2GA 2MG4A 2X6OA 5DTDA 1OCTC 3BR0A 4B1RA 2R92J 1ZAYA 1X2NA 4M3BA 2Y9ZA 5FKMA 3JRFA 3IH4A 3BS3A 2EQRA 4M3FA 3OMTA 1LMB3 4Y7NJ 4X4DA 4J19A 4OB4A 3ZQIA 3SCFA 3R1FA 3HOXJ 1EFAA 2BNOA 1ETYA 2XPUA 1ETQA 2EZKA 3BG5A 4AYBN 3LSGA 5EG0B 5C4XJ 4FE4A 3LSRA 2DMTA 4A3KJ 4S0HB 5J1UA 4DZPA 4DW6A 1WH6A 3JRAA 2LFBA 5F27A 3JRCA 4X4EA 1TWCJ 2EBYA 2OR1L 5IP7J 3CLCA 3S1RJ 1HDDC 1B8IB 1ETVA 2FQ4A 3Q0UA 4YG4A 3HGYA 4V2FA 3BTJA 2H1KA 1BJZA 1ETOA 3FMYA 2ICTA 4YG7B 5IPAA 1W0TA 3S2HJ 4DZJA 1JH9A 1ORKA 1HCRA 1POGA 4DYCA 3DCFA 1RPEL 2L0KA 3G1LA 2NS7A 2FX0A 2DA2A 2EH3A 2JMWA 2L7MP 5IYDJ 2IEKA 1LQCA 3HGGA 3Q0WA 3WHCA 3M3YJ 1F43A 1ZGWA 2XSDC 2K9NA 3W6VA 4M3GA 2LCVA 1PNRA 5JLXA 5HODA 3JREA 2JA7J 1IRZA 1HDPA 2GRMA 1QP4A 1Y1WJ 2EBIA 1JJ6C 5EG0A 4YARA 2DA5A 2AXVA 1LLIA 5BNGA 5IOYA 1PUFA 1UTXA 1FIPA 1S7EA 2L7FP 2R0QC 2B63J 2DA3A 5J1YA 2GM4A 2YU9J 2PPXA 5FLMJ 1DWKA 2WV1A 3OP9A 3JRDA 1IDYA 4C3HJ 4UUSB 3BTLA 4D7NA 1MH3A 1Y1VJ 2M8GX 4XIDA 2AUWA 1TWFJ 4PU4C 1RZRD 2YUSA 1QQAA 1Z0XA 4JX4A 2E2JJ 4AC0A 1RESA 1JT0A 1B8IA 2DN0A 2ZB9A 3SCHA 4X4BA 5FLVA 1WIZA 5IYBJ 4LOCA 1VNDA 3S17J 4Y52J 4YG1A 4X4GA 4FISA 1MBEA 5IP9J 1T56A 3JRBA 2JCGA 5C44J 2MEZA 5FKKA 1WH7A 2R93J 2K40A 1JJ8C 1MBJA 5FKNA 1MBFA 2XB5A 3GTMJ 2O49A 2XGDA 2R5YA 3PXPA 1OJLA 5F0HA 2VI6A 4FCYA 5IP6A 1ZPQA 3O8HA 5GPCA 1LE8B 3A01A 5M5WJ 3HOWJ 5EF6A 1PERL 1UXDA 4GFBA 3Q3SA 4MO7A 2K9QA 4M3DA 3S2DJ 1DW9A 3CECA 1W0UA 3JXCL 4A3EJ 5IOZA 3S1NJ 4XRMA 2IV1A 3IH2A 4L5EA 4Z58A 2PMZN 2FD5A 4A3MJ 3OSFA 4XICA 2PUEA 3ZHMA 1VF9A 3ZOBA 4FTHA 3A03A 2HDDA 3QWGA 1LFUP 3S8QA 1QPZA 2IVQA 4QTRA 1BW6A 4NDWA 5M5YJ 3JXDL 2HI3A 9ANTA 1CQTA 1X2LA 2XI8A 4Y42A 1G2HA 1IJWC 2HSGA 2AXUA 1QVTA 3A02A 4AUXA 2CJJA 1MSFC 3FK6A 1RZRA 4BY7J 1JT6A 1QRYA 3QF3A 3G1OA 2R5ZA 5F08A 3PO2J 3Q0VA 5EZHA 1FTZA 3QPSA 5GP9A 1LE8A 3K7AJ 2Y30A 2COBA 1R9TJ 4F8DA 4GQMA 1GV5A 2DMQA 1IDZA 2XJ3A 2XIUA 1WI3A 2MSYA 1FJLA 2B5AA 1MH4A 1XG1A 1JKRC 2R7ZJ 1JKQC 2M9HA 5K7HA 1IV6A 1B72A 1ZR2A 4BXXJ 2FJRA 2AO9A 1HOMA 3QQAA 3JRGA 4IVZA 3ZQLA 1ZK8A 3G5GA 4MCTA 2KEJA 3FYMA 2VKEA 3FIWA 4M6VA 5GPAA 3G1MA 5EZGA 2DA6A 4D5CA 5F1JA 1GT0C 3MVPA 1IC8A 2KZ8A 1Y9QA 3WHBA 3S16J
chains in the Genus database with same CATH superfamily
4BL0B 4XLFA 3H5TA 3GTLJ 1MNDA 2D2WA 2B7EA 2CG4A 2LF7A 4JYKA 2ZSHB 3A1YA 2H09A 3QOPA 4FX0A 4EM2A 2OQGA 1WGXA 2F5EA 4IHTA 3FKIJ 5IT9K 4ER0A 2B0LA 1P4AA 3BDNA 3WTWC 2HOTA 2LYLA 4A5NA 4JQDA 3BR3A 2IS6A 4PCQA 2DPDA 3HJEA 2R7TA 3DEWA 3JCUC 1BL0A 1EF4A 4ESBA 4YG2F 2R7XA 4EV0A 2PXTA 3OIOA 3EUHC 3CDHA 4RGXA 4KISA 1DULA 2G9WA 4KIBA 1BIBA 1UZCA 5JLWA 3SYTA 3EUHA 5J1RA 1UJ8A 4XN0A 2FNPA 3EETA 4M3EA 4CDGA 5DD8A 1IXSB 2QYOA 1BOBA 2LKPA 4OMZA 5KVRA 3PIPF 1Z3XA 2LVSA 4RB0A 4QSHA 4IWRA 2P81A 3MZYA 3RJPA 1YSEA 5J4VA 4E7KA 1ETWA 1AWCA 2R5YB 1ADRA 3U3WA 3HRMA 1DU0A 1RR8C 3OYJA 2MC4A 4ZC3A 1KU7A 4NQWA 4EEFG 4X0GA 3I4MJ 3GLLA 3BQYA 2CUFA 2M8EA 1F4KA 2A5WA 3OR1C 2E2HJ 3ML6A 2RKHA 4IF4A 3TL4X 1XN7A 4IHYA 1O57A 4MNUA 2FF4A 4BACA 1H8AC 2K85A 1TNTA 2DK8A 1TWAJ 2OCEA 1YJWI 3FYAA 3CCLI 2NOJB 4FE7A 3KZIC 2X1EA 1R58A 1XC5A 3ZMTA 3WE3A 3S1MJ 1QP0A 4BE2A 3IV5A 1G4DA 2E5NA 2L4MA 3GMEA 1MDMB 3LSJA 3NQOA 3KIOA 4I98B 4RB2C 3FWEA 3QAHA 4GRIA 4EQZA 1RNLA 2P7CB 1TQMA 4FT8A 3EDPA 3V8KA 2E1OA 2QUFA 2XGCA 2R63A 1FPQA 2Q2EB 3P9KA 2CUJA 1VFCA 5HS9A 3BTCA 3GYHX 3PSFA 4HDUA 4E7JA 4L18B 3OQOA 4Z5HA 1QHHD 3S2WA 3PIOF 1IGNA 1WJEA 1E2XA 2MH9A 1BDHA 1OR7A 2PJRA 1ONVA 2OAZA 4GO1A 3LL7A 4HOBA 3HYIA 3KP2A 2DDBA 3H3ZA 2F5CA 3HZIB 1ZARA 2LYQA 1K78A 3LSHA 1GV2A 3NXHA 2OC6A 1SAUA 4MIMA 3S32A 3DLAA 3BG6A 5E18F 3TW7A 2K9SA 2STTA 1Z05A 3BQZA 3I4PA 4F92B 2ADUA 2GBYA 3RZDJ 2ZSIB 4GDFA 3LSPA 1JTXA 1WJBA 2H6CA 1AOYA 4UY8I 3TO6A 4X4HA 2EFQA 1WPKA 5CLSA 2MW8A 2Y2ZA 2MQKA 2ZMEB 3ESWB 2NVQJ 3GTGJ 3NWTA 3KEQA 2EA2A 2LTPA 5LFAA 3HOYJ 1OCZH 3ELKA 1ZYRF 4QPQA 1OQYA 1LVKA 4GXOA 2Y0SN 5BMZA 2LYCA 2QA4I 4I6UA 1ZZ8A 1ZS4A 5DD4A 1TWGJ 1GUUA 2FBIA 3DTEA 4KDPA 5CVJA 2BNMA 1TWHJ 3O8GA 4A6DA 2HXIA 3FBNB 3LQQA 4XRSG 2KEIA 1WETA 1RPWA 1PP7U 1L1MA 4OINF 1UHMA 2M5WA 2VIXA 2DMUA 2IT0A 2XPWA 4P96A 1IUYA 1OSLA 3I64A 3GZ6A 4EM1A 2M0MA 2V1XA 3FXJA 4QIWN 4BE0A 3PO3J 1JHHA 2XAFA 2O7OA 3V42A 2LD5A 3GN5A 2VBWA 1I3QJ 2CSOA 2PXUA 2HOAA 2HYFA 2VQCA 5E3MA 4HG2A 2E1NA 2ZMEA 2QQAA 4C3JJ 5F0FA 2IPQX 3ZMUA 4AU7A 2L7KA 1UHSA 2KFDA 4CSWA 1IUFA 5GADJ 1ERDA 2K4JA 3GN5B 3ECOA 1RIOA 1YRNA 3CUQA 5DDGA 1IO2A 4KN7X 1D1AA 1PYVA 3CTAA 2P0WA 1B9NA 5BQTA 2LLWA 2O4AA 1MKMA 2ZFUA 5D8LB 3KYLA 3I5UA 3K4CA 4NBQA 3ZQHA 2LKXA 4DOZA 5KAIC 1PJRA 2G7HA 3I54A 2KEKA 1JFSA 1LCDA 5GTIC 2D1HA 2RGVA 3QPTA 3W6KB 2JSCA 5DM7F 2O8KA 4LFUA 2Y0SA 1DQUA 3FX3A 4RGSA 3Q9VA 2HINA 2H8WA 3TW6A 3OSGA 2PUFA 2CU7A 2CV1A 3JRHA 4R1HA 2ID3A 4CYDA 2QF7A 1UELB 3VDXA 3QPLA 4GYIA 1FT9A 1ZN2A 4XRFA 1WHUA 2QWWA 3HTUA 2FU4A 2DLLA 1Y0UA 1EKEA 3C3WA 2HTJA 5JR3A 2X1CA 2I8DA 3C1DA 1ACIA 2QEXI 1YG2A 3R60A 2WC2A 1KA8A 4BBRJ 2KDZA 3DKXA 2EFWA 3A01B 4A93J 1EH8A 4BAYA 4WXCA 1TBXA 2R7SA 2BY1A 3FM3A 1QGPA 1WVRA 1DU6A 2A6CA 3CCJI 1Y8RB 2CROA 2HXOA 2DJNA 4YELA 1QA6A 3K1NA 2G0EA 1NERA 2DK5A 4G7HF 1YYVA 3LMMA 1XSDA 2A3SA 2JVLA 1XPXA 1JKOC 2PXDA 2HVQA 2IGMA 2NVYJ 5KHDA 2LYJA 3MD2A 3GBFA 5D5VB 2LNBA 4A3LJ 3KE2A 4PFPA 4YIFA 4H4KC 4IHVA 2W57A 2K4BA 1ON2A 3RKWA 4IPAA 2AHQA 4CCJA 2EWTA 3TFLA 2IUOA 1RETA 1RKTA 3K6GA 4X4CA 2DMNA 1HBXG 5EEHA 4D5FA 1WJ5A 3RZOJ 2NNYA 1MDMA 1H89C 1VPWA 2EFPA 5HLTA 4UVAA 1J7KA 2O9LA 1LDDA 2L9RA 1V5GA 3SZGA 2AW6A 4WXHA 2DFEA 4L9NA 3AG1H 2Z5UA 2KRHA 3T5XA 2X6WA 4RAZA 5DCFA 4IA8A 3TP3A 1R7JA 3DWLE 2H27A 3OYGA 1BR2A 3F52A 5CYVA 3DNVB 1WKMA 3F8NA 2CW8A 5L3BA 1ZZ6A 3TDZC 2GLOA 1A5JA 3S3OA 2K02A 4PU8A 2L4AA 1CF7B 3GZDC 1P4WA 3QOEA 2R92J 4B1RA 2ESNA 4M3BA 3IH4A 3BS3A 2EQRA 2IA0A 3SHFA 3OMTA 5DEQA 4Y7NJ 1LMB3 3OY9A 3KZYA 2FE3A 4OB4A 2X6XA 3ZQIA 3SCFA 3OIPA 3SEZA 1QHGA 3DM5A 2HKOA 1BI1A 2EZKA 4A12A 5C4XJ 3KP5A 4IX7A 1HKTA 3LSRA 2XXPA 5J1UA 4HDVA 5D4SA 3J80K 1REPC 4ZDPA 1U6GA 5JVTA 3QYFA 3JRAA 4J00A 2DQRA 2LFBA 5D5UB 3CCQI 1TWCJ 3J7ZI 4RM2A 1R22A 3BROA 3CJTB 3S1RJ 1HDDC 2XC7A 1ETVA 3H36A 3Q0UA 3H9JA 4F7ZA 2H1KA 3GUDA 2DT5A 2HYGD 1D0YA 4YG7B 5IPAA 1W0TA 3VWBA 4DJAA 1YW9A 5HOOA 1RIOH 4HX7A 5E79C 3M9LA 1POGA 4DYCA 2GA1A 4DQ2A 4KA4A 2MD5A 4ZDLA 4C2TA 5FRMA 1YIOA 2DA2A 3CCUI 1K7AA 2EH3A 2L7MP 1JXSA 2Y48A 3HGGA 1SMYF 3GFMA 2DOEA 1ZGWA 1DPUA 2J5OA 4DE9A 5JLXA 2FEZA 1XX5A 5HODA 3GLXA 1IRZA 1MIJA 1TT5B 1VQNI 2JVHA 4ZH4F 1Z7LA 2IGNA 3A9YA 1FWZA 2FXAA 4P9FA 2PXEA 2PPXA 3VYTB 2GOMA 2VC1A 3CO6C 1HC8A 3V4GA 3L2WA 3JRDA 4HF1A 3G3ZA 4D7NA 1Y1VJ 2M8GX 4OWRB 1TZLA 2K9MA 5GAGJ 3G4SI 2MXDA 2PXQA 1RESA 1ODDA 3K10A 1X1BA 1OISA 2DN0A 2GIZA 1KU2A 4EK9A 2XF6A 1ZRCA 1OCOH 3OYMA 1O7LA 2VXZA 2HWVA 3F72A 2BW3A 4LOCA 1W5TA 4Y52J 2BY3A 4FISA 3JRBA 2J7WA 2JCGA 1WH7A 2K40A 4LG3A 5JHFA 2IGKA 3AKZA 2R5YA 1YHQI 1FNNA 3M1CA 5IP6A 1ZPQA 3M1EA 3A01A 5EF6A 1HW2A 1PERL 3J7YJ 2K9QA 4ZYGA 3JXCL 1T6SA 3WU0A 4IQ4A 3IH2A 2YR2A 1IZ1A 4L5EA 5CVRA 1YI2I 1P92A 4KYWA 2Z99A 3OSFA 2HKXA 4XICA 3HTSB 3ZOBA 1FY7A 2NVUB 5D5XB 2HDDA 4RAYA 1LFUP 1QPZA 1IXCA 3P9IA 3A9ZA 5HS7A 4Y42A 4ITVA 3RPUA 1QVTA 2LREA 4ON0A 2PEXA 4AUXA 4BUPA 1MSFC 1S8NA 1XMKA 4DE8A 1QRYA 3TGNA 3FMRA 4ZYAA 2XHKA 3EUAA 3F3XA 2R5ZA 2B9SA 2BY0A 3LSMA 3PO2J 1PUEE 1XGNA 1J59A 4PK4A 3FHZA 5EZHA 1BI3A 1FTZA 3QPSA 1OPCA 5GP9A 5IY5H 4CCOA 4F8DA 4M71A 3MEXA 1FYMA 2X0LA 1GV5A 3ZR8X 2XJ3A 2ODRD 2MSYA 4RA2A 1FJLA 4XMYA 3WG9A 2EPFA 2B5AA 3OWQA 1OYWA 2FMLA 2HTSA 3EUKL 3GZDA 2X85A 2M9HA 1B72A 1ZR2A 2FJRA 3QQAA 4AIJA 2VT2A 4MCTA 1A04A 2VKEA 4M6VA 1XSXA 5EZGA 5GPAA 2DA6A 2XROA 1IC8A 4RGRA 1Y9QA 3WHBA 2K3PA 1DGRM 5DCMB 4HPQA 2CO5A 1Q1HA 2ZNZA 3N05A 3KPHA 4RM3A 4OOIA 2VT3A 1KQ0A 4ZZDA 3K9TA 1IN5A 3ZMZA 2W4SA 3E7LA 1S5LC 1H9GA 1LFPA 2A5YB 2PUBA 4PSWA 4UB8C 4XSZF 5E20A 2IVBA 4HV6A 2W25A 1AA7A 2E71A 2K9LA 2W24A 4LLGF 2JQEA 2BW3B 5D6EA 4ZYDA 4J1XA 3MKLA 5EDNA 3SFIA 4PGHA 3VSLA 4BQNA 1T8IA 3LFPA 2VKDA 2Y69H 1G3YA 5TRDA 2GIVA 3DBLB 3M9AA 3MCZA 1R1TA 3IWZA 1DGWY 2ECBA 3JW4A 1R1UA 5CVUA 2JA8J 1WCMJ 1VI0A 3FM5A 3E5QA 3HKZN 5K98B 3BD1A 3RPQA 4BDZA 3GTPJ 3ZMSA 4JX6A 2RNGA 2NOGA 2M4GA 1D8JA 2OTJI 4P5OA 1TT0A 3E0JB 3QYBA 1J2XA 2BHYA 2QQ9A 2RDPA 2CQKA 1R23A 2W85A 3TQNA 3OYDA 1U78A 1DP7P 2CGPA 3KLOA 1CJGA 1K61A 3QOXA 2VJIA 3FXLA 5DRYA 1U9OA 2CFXA 3WU1B 1D5YA 1VQLI 2OZUA 2A6HF 1Q1VA 3SQNA 4IEJA 2PIJA 2OF7A 2ELKA 3H92A 3HUGA 4FETA 2R1JL 3K1MA 1TW2A 3F23A 1BDIA 1X19A 4IRHA 2PBIA 3ZQQA 3LFKA 2M2EA 2XKPA 1BA5A 3IVPA 3H3UA 4I7HA 4XK4A 2VC0A 2ZCWA 2WTEA 5IYCJ 2WA0A 1OMIA 1W4MA 2VKVA 3K4LA 5E17F 3NRVA 2HOSA 3GF2A 2BEOA 4X6AJ 4B3AA 2JN6A 4DYRA 2O38A 4XLAA 1HXDA 4FASD 3F9KA 1K83J 2W1OA 1VQ4I 4IHXA 2R5ZB 2JPBA 2JWTA 2VODA 2HZTA 5HLGA 4MFEA 2NNNA 4PUSA 1MGTA 5DV5A 2CYYA 1UB9A 2V7FA 2KJCA 2GZUA 4BEHA 4X4IA 2CMPA 3F21A 1R63A 3F8FA 2LY9A 3H0GJ 1NH3A 4BHPA 3HM5A 2HFZA 3M8EA 2FRHA 4L5JA 1RKWA 1WJAA 1VQ9I 3ZHIA 3QOWA 3TP0A 1HW5A 1TP4A 2EIJH 2V79A 3BDDA 3ZP5A 1FOXA 3ME5A 4PU3C 4MGRA 4EJOA 3TOBA 4XM3A 3OS0A 1SC7A 2LLVA 2PN6A 1ITYA 4AD9A 2P5LC 4J1WA 2LDUA 4ZZLA 3I53A 2KL4A 3CCEI 5JHUA 2WAEA 4O8BA 2VN2A 2HDWA 2FOWA 1G8XA 3C2GA 4M73A 1FLIA 3I0TA 2LYRA 2PUDA 4YFXF 4NC8A 4ANJA 3OQNA 2GXBA 5JI6A 1XS9A 2LR8A 4RDUA 3CROL 3BP8A 1P9QC 1TLHB 3PE5A 2DMPA 1LFBA 2Z9OA 4I6TA 2YS9A 1BC7C 2TRTA 3W2VA 4EJTA 2VPLA 5B3SH 1X57A 3EUSA 1B0NA 2JRTA 1NW3A 1VQOI 4EVIA 1F36A 1OCPA 3BLYA 4YFKF 3J7AO 1JUSA 3OYEA 1F1ZA 2PI0A 3OOPA 1GVJA 3CMYA 3NZLA 2OV7A 1GLNA 4PGGA 1PRVA 3V7CA 3ABLH 4I6RA 1FBSA 3ZQCA 4HSTA 5L3CA 2QSFX 3K70D 4DBQA 3OS1A 4A0YA 3OS2A 4L0YB 3AG3H 2UXNA 4KITB 3VFZA 2BZTA 1R36A 1PVEA 1VTNC 3QYEA 3HG9A 3OV8A 2HEOA 3WTUC 4RBOA 4HNVA 2AQFA 1J5YA 2CRGA 2GRLA 2V1NA 2WIUB 3K1PA 3DKYA 4F52A 2E5ZA 1SD7A 2GOXB 1HLVA 2PXFA 3CDLA 3ABMH 2CH0A 2ME0A 1RZSA 3R61A 5C4JJ 4ETSA 1T98A 2VQGA 3MMYB 3U1KA 5HNFA 3OYCA 1V55H 5AIPA 3JRIA 4IKFA 4S04A 2X48A 4Q4ZF 2DA4A 3O2PE 3MFKA 1LEBA 2RQQA 1N78A 1I1SA 1O3TA 3DQVC 4RLQA 5HDKA 4NNJA 3PNVA 2NS8A 3W2WA 3BR2A 3QRFF 4Y17A 5A7LA 3CP2A 4AWXB 3HOTA 3RKQA 1AKHB 2Z3YA 3UWPA 3BR1A 5FKLA 4RB3C 4UUTA 1B9MA 1QVUA 4I02A 3OYIA 2VQHA 3U1DA 2C6YA 1SD6A 3CQZJ 1VQ6I 2HQRA 4F91B 5D4RA 2Q1ZB 4XKVA 1GXPA 1D5VA 3HOZJ 1UCRA 2ZXWH 2E2IJ 4NUBA 3TKYA 2LYKA 3IKVA 3B02A 2CS3A 4W97A 3GO5A 3FXUA 4U0VA 5FD5A 2DT6A 3BWGA 1TNSA 1SVLA 1I39A 1T0FA 3G71I 2OCCH 1GVDA 4JK1X 2EIMH 1ZZBA 3RYPA 1UXCA 4RLFA 2HOEA 3L2RA 2QCOA 1X58A 1QPIA 1VQ5I 2W48A 1XGOA 4OAZA 4DBRA 1OLTA 2KQRA 3OMYA 3IWFA 1QPMA 5LHIA 2ZJQF 3BR5A 3LOCA 2RVCA 1FBUA 3RQIA 5J8CA 4BDYA 2VL8A 2CQQA 3C7JA 3CC2I 2V1UA 1TL8A 1F9NA 2LYSA 2DOFA 1N75A 1QZXA 1LCCA 4Z2YA 4CA0A 2VONA 3C2BA 3VYSB 5FD6A 2WY7Q 2EFOA 5E3LA 4B3XA 1APLC 2NVTJ 2XASA 1WH8A 3KLNA 4M74A 2FSWA 3W6JB 2EZHA 3KJXA 3G7DA 4WWCA 1ZZ7A 4HBLA 2KT0A 2JQ7A 5ILVA 3H5NA 4FQGA 2NYXA 2Q2EA 1X1AA 4OIOF 4XORA 2EB7A 5LRSA 1ZRFA 1IN8A 2ZXJA 4XLHA 3ZPXA 1SEUA 2UUZA 2L1PA 2X9DA 4O5VA 3BJAA 2XGEA 4U0WA 4FBIA 4MLOA 1MMDA 1RI7A 1MZBA 2ZNYA 3HXLA 4EATA 4PJ0C 5DTDA 2A68F 1K78B 2QGUA 5DRTA 1X2NA 4HNUA 1XGSA 4A5MA 3JRFA 1DPRA 4WX9A 4CZZA 1K79A 3CCVI 3DU6A 1P4XA 3HRUA 4E7IA 3GUUA 2MFZA 3CCRI 5ED4A 2XPUA 2AXLA 1ETQA 4AYBN 2DYSH 2ZJRF 3LSGA 3KP4A 2XDVA 1WJCA 2DMTA 3ISPA 3IUOA 5GTHC 2YX4A 4DW6A 1WH6A 2XAGA 2L9NA 3OL4A 4WVLA 5F27A 3HPHA 4IRGA 2XVCA 1YJNI 3CLCA 3UNGC 1B8IB 2BXZA 2P7VB 2FNAA 2FQ4A 3I58A 3I59B 1I3AA 5FFZA 5K5RA 1ZLKA 4YG4A 3BTJA 3SDBA 2W84A 3WTXC 2VB6A 3S2HJ 1JH9A 1ORKA 1WI9A 1HCRA 1FOWA 3KP7A 3G1LA 4L5IA 2MC3A 4E7SA 4M72A 2FX0A 2XV4S 3P5JA 5IYDJ 3SEQA 3HHHA 3Q0WA 3WHCA 3M3YJ 4ZTJA 1R71A 2LCVA 1F5TA 1WSUA 3A0BC 1ZG3A 3WGHA 3JREA 2ETHA 4CZCA 3KFWX 2A05A 2MBFA 2GRMA 3ZMDA 1Y1WJ 1JJ6C 5EG0A 4E4HA 5BNGA 5IOYA 1W5CC 3U21A 3MKZA 1PUFA 4I2OA 3QP5A 1S7EA 3WGGA 2L7FP 1UTXA 2IA1A 4RS8A 3RTRA 1Y56A 4BQOA 4EQQA 1W36C 2Z2SB 5FLMJ 1DWKA 2J5PA 1ZLJA 2V6CA 2WY8Q 3ONQA 4NC7A 1MH3A 2AUWA 4XIDA 1TWFJ 2E1MB 4Y15A 1ZG1A 1R1VA 2HCNA 3EYIA 3CJRB 1N77A 1MMNA 2CQNA 3FMSA 1JT0A 3K4MA 3RQ4A 1IXRC 1V3FA 3E5XA 5F1RA 4EGYA 5D5WB 1LEAA 1U0JA 1U5TC 2WADA 4KT5C 1YITI 1WIZA 3A9XA 3D5SC 3QU3A 1FYKA 2VOPA 1MBEA 3MWMA 4WF2A 2EV5A 5FKKA 3OL3A 1MBJA 1MBFA 4XN3A 1MFQC 4Q48A 4BH9A 4EJVA 2O49A 1SMTA 1OJLA 5F0HA 5BPIA 1RRJA 3G6EI 2E1CA 1DUXC 3ZMVA 3L2QA 3K70C 1S7AA 3ASNH 4AM3A 2ESHA 3A4CA 4GFBA 5ICEA 1TW3A 3HSEA 1XTAA 2KIMA 3LQXA 3CECA 1W0UA 2XUBA 4CXFA 2IV1A 2DW4A 4ER5A 2JUGA 2PMZN 1Y39A 1A35A 2PUEA 3ZHMA 4FTHA 2DAOA 2M87A 4E70A 2LRDA 2H94A 1HA8A 2IVQA 2MD0A 5GAHJ 1BW6A 4NDWA 4ZTFA 3GCMA 4FX4A 2R7VA 1K4SA 1V4RA 3JXDL 3E5UA 9ANTA 2DO7A 2XI8A 2V26A 1SFKA 1G2HA 2ZMEC 1GXQA 1ZGAA 3DFGA 2DYRH 2OBPA 1T2KA 1RZRA 3FK6A 1KU9A 1IN7A 5E8IA 3OYKA 1QO0D 3DU5A 1IAWA 1OCRH 1QZEA 4WXDA 3CP8A 3PL8A 3V8LA 2E35A 4HSRA 4EM0B 4BYYA 2E60A 1USSA 1LE8A 2Y30A 4XL9A 1R9TJ 1X3ZB 2PXLA 2AS5F 4AVPA 3V8JA 2A07F 1IDZA 5HDNA 3CUQC 1WI3A 4KFCA 1FBQA 1Z3YA 2ICWG 4LJZF 5ICFA 4LD5A 2XF7A 5HVQC 4ZDOA 4MEXF 5K7HA 1IV6A 1FC3A 4BXXJ 1R00A 4YIRX 1YS7A 1XMXA 4IVZA 1B59A 2VQLA 3G5GA 1YOVB 3SFZA 5H2FC 4YRVA 4R8HA 3G1MA 3CUQB 5F1JA 1I1GA 3MVPA 4M6YA 2KRCA 5A2QZ 4G6DA 3RKXA 3S16J 2BY2A 2HU9A 3I4NJ 3HL2A 3ERMA 3MAJA 1I6XA 4B8XA 4JX5A 4U87A 1BW5A 1I27A 3SXYA 4KNYA 4XLPF 1YX3A 5FJ8J 4H0EA 1USTA 4QWQA 2OUMA 1T38A 1QZYA 2V9VA 1LNWA 3PUFA 3SZTA 2JA5J 1Z21A 2IRFG 1HF0A 2KZVA 2E36A 1IRGA 2HPIA 2XAJA 2K3FA 3SJMA 4OAYA 3RYRA 5L3EA 4Q5SF 5ERIA 1X3WB 3FXOA 2Y31A 3KP3A 3HB9A 5F64A 2BNNA 3ZCOA 4BXFA 2XRLA 2OFYA 2QSHX 1MMAA 1RR7A 4M6XA 4IQJA 1U2ZA 3DTIA 2PX9A 2K27A 3LSIA 3VWSA 2PXBA 4N4OB 2PLYA 1TQIA 3L9FA 1T0FC 4HEA2 3DPUA 1HQ1A 3L1PA 1XMAA 2VPRA 5F6FA 5JVGF 2PUCA 2YX7A 5L3DA 2COMA 2OJED 4MTEA 4LLNA 4QPOA 2F4OB 2RREA 3SDGA 3CDIA 1U5TA 4PFOA 5KNLA 3JSPA 2M34A 2KLOA 3S8PA 4A3BJ 3T0YA 1SVOA 5M3FJ 3S3NA 2RAEA 3MKWB 3QP6A 2L8NA 1JGSA 4HYEA 4JCYA 4P1WA 2IW5A 2WB1A 3QYXA 1GHCA 4PJNA 2P4WA 2HVRA 4LG0A 5A2QK 4P9UA 1XCBA 2KMUA 5B66C 5HLHA 1JWLA 1U5TB 3GXOA 1FZPB 1V5EA 5EYRA 3JAMK 5DTMA 3BPXA 1FX7A 3F22A 3MKYB 2EA4A 2XRNA 4ESJA 1EH7A 5D8KB 3NWSA 2I10A 3BTIA 1ZTRA 2QVOA 3GTQJ 3D5RC 3FDYA 1FTTA 1T33A 1ETXA 4IXAA 3MLFA 4XR6A 3OYHA 3RKYA 2XAUA 1MBKA 3E97A 2LNMA 2ELHA 4D7MA 4UV9A 2ELJA 3EYYA 2V4JC 3KCCA 4I99C 3ZXSA 2EFNA 3S15J 2CW0F 1FMWA 2PQ8A 3JR9A 4OIQF 2AXTC 3DTKA 4N0BA 5AONA 1MJBA 3I9V2 1O3SA 5BPDA 1NK3P 4U88A 4P55A 1U9NA 2XPVA 2A61A 4GCVA 1LDJA 1Z91A 2A6TA 2DODA 3B73A 3MQ0A 4G9YA 1BM9A 4LMYA 1PDNC 1WJFA 4Z59A 5IT9Z 2VBYA 3L2CA 3J80Z 3BT9A 1BOAA 3R09A 1JHFA 5K7ZA 1C0WA 4MCXA 2Q8KA 4GHJA 4E6KG 3IKTA 1G59A 3ROUA 3S14J 2EWNA 1K6OA 2ID6A 3KX2A 2AWIA 2DI3A 3DF8A 2Z16A 2X1DA 1D8KA 3OYAA 1LVAA 1SD4A 3TBIA 3HIFA 4II2A 4ASNA 2P6SA 1W36D 3QFIA 2LBFA 3CCMI 1IRFA 1AKHA 3P9CA 2DA7A 2OPTA 3HHGA 2QKLB 2QM3A 5J3LA 3TO7A 3QU6A 4A69C 1YJ9I 3PNYA 1D3YA 4PDKA 2Y75A 2HZDA 5LGNA 3RSNA 4WCGA 2DPUA 3RI4A 1ZH5A 4IZZA 4ENMA 4E7ZA 2KRFA 2EV0A 2LG4A 1W7PD 3J7AY 4LK0F 3K4JA 2HR3A 2ZJPF 3MZ8A 1SFUA 1A36A 1WZ2A 4UUSA 2A69F 3RPUD 2CQXA 4MHGA 4YIIA 2EK5A 2QLZA 1EJ9A 2P6TA 1J09A 3CF2A 2ZXIA 3PQJA 4BGDA 1SANA 5FB2A 1KONA 1EA3A 1ZZ9A 3BG3A 4HV5A 4IHWA 2M45A 3M7GA 2EJRA 4X1EA 4RMNA 3CLQA 2DFHA 3BZKA 5C3EJ 2CSFA 3PSIA 4OU0A 4G12A 1OYYA 2HCSA 1XB4A 5LD2C 1JKPC 3H3VK 3FXKA 3WGIA 2NS0A 1JUMA 3CMEI 1O3RA 2W82A 1MJAA 2MLKA 1JFTA 1Y6IA 4XOPA 2FBKA 3OWTA 2JA2A 5LRRA 5L3FA 1D1BA 2JPCA 2V3CC 3LAPA 4DNCA 1NK2P 5K5QA 2KISA 3KXAA 3GTKJ 1FSHA 4CCNA 2IGOA 4AYBA 2P5KA 3GZNB 2PXPA 2F5DA 4ZJZA 2RN7A 2YBDA 2DFIA 4RGUA 2XGXA 4CHUA 4E7LA 2CQ7A 3QWLA 5KAFC 2CWEA 3HC7A 2QENA 2WAFA 3DV8A 1PRAA 5ICCA 5HS8A 1J75A 1OFCX 3CUOA 1UG2A 3F6VA 4Q2JA 4HF0A 1IW7F 1UAAA 2IXSA 4AIKA 3CCYA 2FBHA 2O0YA 2L2OA 4XLEA 2NRAC 4KIGA 4XONA 1FP1D 1ULYA 1Z6RA 3HSFA 3VPRA 1MMSA 2LSOA 2DTRA 2TCTA 2KZGA 2WAQN 3G0TA 3ZQGA 4CYCA 2L9SA 2M7BA 3B6AA 2Z1DA 3OYFA 3OYNA 2F4IA 1OKRA 2IVGA 2PUGA 3TELA 2EINH 4F3QA 4I09A 2LYPA 5EGOB 2WUSR 3GVAA 5FGMA 1BIAA 1YTYA 1AU7A 2IBDA 1H88C 4BY1J 1YS6A 3M8JA 2H8RA 2ZBKA 1XGMA 2M4KA 4HQMA 1K6YA 2R7RA 3VK0A 3SR4A 1FIAA 1S9HA 1IF1A 1R4MB 2VE8A 2ME6A 2NVXJ 2KPJA 2R7WA 2WV0A 3ZQ7A 2V1DA 1ZUGA 2L02A 3GTJJ 3COAC 1UMQA 3MN2A 3GZ5A 4DGWB 1VQMI 2JSPA 5CPRB 3JTHA 5DUKA 5E1WA 1IG7A 3FBIB 4IRIA 1FEXA 5DSXA 1ZREA 3S1QJ 1I6HJ 4IL6C 1S3JA 2JK3A 4JCXA 4LLLA 3KEOA 3ZQFA 1IV8A 3M07A 2HQNA 5LLQA 3WU2C 1KQ8A 1ZRDA 3OR2C 2UXXA 3CMAI 1WJDA 1QQBA 4M9XA 2JJ7A 4PU7A 3CF5F 3ZKCA 2RV8A 3HZJA 1POUA 4UB6C 2O5RA 3JXBC 3H1CA 2MG4A 4I0AA 3NEUA 2X6OA 1G3WA 1R6RA 2MH2A 3ZPLA 1WRJA 3AG4H 1OCTC 3BR0A 2Y9ZA 5FKMA 4HA8A 3J81Z 1S72I 1BR1A 4IOAF 2O3FA 4G7OF 1EFAA 1JE8A 3BG5A 5EG0B 1IN4A 4FE4A 4U7DA 4A3KJ 2P8TA 3IRQA 4DZPA 2DFFA 2BXYA 1OCCH 1XCVA 3JRCA 3WE2A 3NDBB 1MW7A 3DLLF 2HFHA 2EBYA 1NG6A 4CGZA 1YO5C 2NXNB 2ZJ2A 3VSKA 5JUWA 1BJZA 5H20A 1D0ZA 2YU3A 3FMYA 3E6DA 2KKOA 3BY6A 1W5SA 2QQ8A 4DZJA 5E1ZB 3WODF 1KGSA 3WTSC 4ZYEA 3ABTA 2L0KA 2NS7A 1N25A 2MA3A 4K2EA 4B43A 3PJRA 3FHNA 4KMFA 2JMWA 2R7UA 2IEKA 4LG0B 1FOYA 1F43A 2XSDC 2K9NA 4A6EA 4B47A 4M3GA 3W6VA 4A0ZA 5DYMA 1PNRA 2R7FA 5D6FA 5TGTA 4AIDA 2R4GA 1QP4A 1HW1A 5B1BH 5LHGA 1MD0A 1X1CA 1ZGJA 4C9YA 2DA5A 3GEZA 2AXVA 1LLIA 3E6MA 4KMUX 2F2EA 1FIPA 2BHZA 3LA3A 3IC7A 2B63J 4KICA 3AL0B 2E7XA 2GM4A 5GAEJ 4BQAA 5LEKA 4L9JA 2IJLA 2KP6A 2JTVA 1KZHA 2WV1A 3BJOA 4Y3OA 4G6TB 4BE1A 3DEEA 5ILSA 2WAQA 1RZRD 4PU4C 3R4KA 2YUSA 4XOTA 1Z0XA 1W1WE 2DCEA 4JX4A 3KZZA 5LHHA 4AC0A 2E2JJ 2CUZA 3TDUC 3BZ6A 2JT1A 5IT3A 1R4NB 1V5FA 1B8IA 2UV1A 3SCHA 2MABA 3WG7H 4X4BA 5FLVA 3CLOA 1MMGA 4BU2A 2V9PA 2KPMA 1VNDA 3S17J 4YG1A 4X4GA 2H6BA 2K5CA 1CGPA 3F6OA 1UHWA 3ULQB 5C44J 2MEZA 4HLXA 4BJ6C 4BHCA 1JJ8C 5FKNA 3VYRB 2JUCA 2XB5A 2ZKZA 3GTMJ 5K1YA 2VI6A 1E3HA 5FROA 3E1SA 4XQFA 4F93B 3KYDB 4FCYA 3O8HA 2QQBA 3P7NA 3GFIA 3JSOA 3CZ6A 3KL4A 1UXDA 3S2DJ 1DW9A 4M3DA 3W3CA 1RC9A 4UXNA 3ERED 4A3EJ 1X1PA 1T08B 2PMUA 4XKBA 1VF9A 1KYZA 3QWGA 3A03A 3RDIA 4BJTA 4XNFA 1HKQA 4ESFA 2LBFB 2HI3A 4JBAA 1X2LA 1D0XA 1B1BA 2RNJA 4G6QA 2FA5A 2KIUA 2WBMA 4XKWA 1YX5A 4BY7J 5LGTA 1JT6A 3L09A 3QF3A 3I3LA 2BBYA 2FFHA 2OU2A 4N4NB 4XLCA 5H6QA 3Q0VA 1S29A 3O3KA 3U9GA 3K7AJ 4G7ZF 2COBA 3DXJF 5BS6A 3F8BA 4ER3A 2EILH 4LITA 4LB6B 3CC7I 2DMQA 4U7BA 3LAJA 1B4AA 4NC6A 3N97A 1YW8A 4XKCA 1R5ID 1XG1A 4G94A 2JZYA 4AIHA 1MNEA 1JKQC 2JRMA 4IOCF 3TO9A 3H5AA 1HOMA 4LIUA 3JRGA 4XLNF 2DBBA 3ZQLA 2VOOA 2E34A 2KEJA 3HPGA 4N9HA 2TDXA 4FHTA 2VJ4A 4D5CA 2KZ8A 3AL0C 2DDAA 1LPQA 2VUMJ 2VJJA 3HSRA 1LDKB 1FYLA 3WTZA 2BJCA 2IU7A 1WWXA 3QPHA 4X4FA 1MBGA 3E6CC 4DIQA 1X1DA 1JI8A 1Z77A 2ECCA 6PAXA 2P5VA 2PJPA 1SFOJ 2O61A 1Y8QB 2VLAA 4L9VA 4EJUA 3PNTA 1EH6A 3GX4X 2OQRA 2DU9A 5EEAA 3IH3A 4IVNA 4LB5A 3HRSA 4FN3A 2L01A 2BVMA 1VQ8I 4ABZA 3KP6A 2LC2A 3S93A 2J7UA 3VB2A 3K4KA 2QKMB 2AQEA 1BN5A 4OBMA 5CJ9A 2VEOA 2PUAA 3VODA 3GZCA 1UG0A 3ECHA 1R5GA 3K69A 3LFUA 1J9IA 4C30A 2X4HA 2D5VA 1XDUA 3KZ3A 2VBXA 1X3UA 1LB2A 1KYWA 2IA2A 4JP0A 4PJJA 4IHSA 1ETKA 2IS2A 2H1LA 2DOAA 4J01A 5EJCA 4YBAA 4UVBA 2DXIA 2F5VA 4A3IJ 1R49A 1ZVVA 3TMOA 3BJ6A 1XDSA 1YRNB 1ZHFA 4OIPF 3J81K 2BV6A 1XWRA 4PZJA 4HLYA 1Y7YA 3F6WA 4XBFA 4C2MJ 4KUMA 3CMMA 4U0YA 2RQPA 3CESA 2LLKA 4DYQA 4NB5A 4CICA 3PQKA 1WH5A 3R0JA 3HDDA 3FXRA 2WB1N 5DS9A 3M4OJ 4GYGA 3K4BA 4I6ZA 2K86A 1ENHA 3Q9SA 3OYBA 2R7DA 1D1CA 2Y0MA 3SCGA 4ZYHA 3ZRGA 3F8CA 4XSXF 2R3SA 1XD7A 1OYIA 3VEPA 1O7FA 4N9IA 2L49A 1SFEA 2XF5A 4UV8A 1QQIA 4Z5DA 3DPLC 3ASOH 1ON1A 5CVVA 2N8GA 3TOAA 1IRXA 1MNMC 3L7WA 4WK8F 4HF2A 3SX0A 1U2WA 2GZWA 4ENJA 3FMQA 1TTYA 3A2KA 2ZFWA 1HSTA 3DBRB 4KN4X 4S05A 3TEDA 5E3NA 4JQFA 2CV2A 4LK1F 1A6IA 2E19A 3ZGKA 4BKXA 1RUOA 5BOXA 2EZLA 3IHUA 3TEPA 3KYCB 1KQ9A 2E1MC 3K4NA 4BHBA 4UUVA 4OMYA 1QP7A 2MYSA 3AFHA 1QU3A 5DM6F 3MZHA 2K7LA 4Z5CA 1ZR4A 1TQPA 3V7RA 3T1BA 5FKOA 2ISYA 1FMVA 3OOUA 1Z9CA 1AHDP 3O6BB 4L9TA 1ZKGA 5LEJA 3G73A 3NAUA 3AAFA 5FLXZ 1MSEC 2XAQA 2Y9YA 4A3JJ 5F0CA 4B4CA 3IAM2 2OD5A 3BR6A 3H35A 3UFDA 2QBYB 3OQMA 3B7HA 3D0SA 4BNCA 4O6JA 5B1AH 3HUGB 1YQAA 2XSJC 4B44A 1H9TA 3CJQB 1A31A 2IP2A 3K2AA 1E3PA 1BI0A 3GTOJ 1JGGA 1QNTA 4MQ9F 4I8TA 3NARA 2LP0A 3FXQA 1P7IA 3F51A 1NEQA 3C2HA 1ZAOA 3WTVC 4Z6YA 5CQGA 5M5XJ 1ZZCA 3TRBA 1H0MA 3GW2A 2DA1A 2F5FA 2OTLI 3HEFA 4QLCU 1U3EM 4HX8A 2O8XA 5FO5A 1T95A 3S3MA 4CH7A 3FISA 4GGGA 1T39A 4NHJA 5K7FA 1PUFB 4CCLA 3EPZA 3CD6I 3AG2H 3PM1A 4CYCB 2PE5A 2EZIA 1KU3A 3OIQA 1NTCA 2FJ1A 3E6BA 4RAGA 3ABUA 2HYJA 1BBYA 3DP7A 3LA7A 3NROA 2DT7B 4BXUA 1X2MA 1GDTA 1LQ1A 1SAXA 4D0PA 3N4MA 3L00A 1Y0NA 2HQ5A 1ZG5A 4YFNF 5FLXK 4HX4A 5F04A 1E3OC 5CQEA 1WFXA 2KHMA 3KEYA 5AIQA 3LNQA 4LIVA 3RCOA 4NDLA 3CJNA 5HNHA 2VBZA 4PSXA 2GAUA 4I76A 4E7HA 1TC3C 1V54H 4MTDA 1R69A 1NHAA 3QQ6A 3PUBA 2W00A 1M1EB 3K2ZA 1DDNA 1XSVA 2ZO4A 1ZQ3P 3MEJA 4UHTA 1RZ4A 4BBSJ 3DEUA 1SQ8A 3HRTA 3VOEA 1B72B 2KIFA 3FK7A 5H6RA 2M1BA 4RAFA 1JUPA 3D5LA 2I5UA 3FXMA 5E8GA 1VQPI 1O4XA 2AXZA 5ILUA 3OKZA 1I5ZA 1Z6TA 1X4PA 3ZN1A 4C3IJ 1I50J 3GWZA 3D1NI 1O3QA 4UNOA 3HBLA 2KIQA 2PFBA 3B6CA 4HW0A 4ENKA 1JTYA 1P7JA 3IL2A 4HRIA 3HOUJ 5K5OA 2QSGX 3REOA 2XAHA 2M4HA 2L7ZA 1ZELA 5J4YA 2VXDA 3UKGA 1YFHA 3FKJA 2PMZA 2XB0X 3LISA 5J6XA 2ZC2A 3C18A 4KIFA 4XRSA 3L2UA 5TISC 1FOKA 3RZZA 3F0CA 3BG9A 2NAZA 3O9XA 1SFXA 1QB2A 5CKTA 2Z33A 1BR4A 5E3OA 4A3DJ 1X4OA 3CCSI 1PRUA 3KETA 3IRRA 2HPMA 1RUNA 4Q47A 4CUGA 2ACJA 2LMDA 2OA4A 4KT6A 2UZKA 2CUEA 2MGQA 4I0BA 3V7SA 2VE9A 3HOVJ 2XCJA 2XXAA 5DTRA 1PP8F 1HKSA 2GXGA 3BG7A 1L0OC 5DUIA 3JTGA 2F4MB 2M30A 1MBHA 3GBGA 1S7OA 2ICPA 4ER6A 5EGOA 1UFMA 2LK2A 3BZCA 3I56I 1K4TA 4B48A 1WQ2A 3BOQA 2GWRA 4KJZA 2IAIA 2DTZA 2HGCA 4A3CJ 2D1VA 4Y4RA 2PMHA 4A3FJ 4HQEA 2EF8A 2XIGA 4IJAA 1HQCA 1LJ9A 5FFXA 2WWYA 2JA6J 1U8BA 2VKHA 4W1UA 4A3GJ 1EV7A 2DQLA 4MFDA 5M3MJ 2E7WA 4LGWA 2QZ8A 3UR3C 5J40A 2M0CA 5HDGA 2FUG2 1Z7UA 2GA2A 4V2GA 2L3DA 3GFLA 2Q0OA 1R5HA 5B5EC 3H0DA 2IS4A 1ZAYA 2XXQA 1BI2A 2W7NA 2L54A 3HKZA 4M3FA 3T8RA 5J47A 3I71A 2V9KA 4PJMA 4J19A 3FZVA 4X4DA 3BCBA 3K0LA 3I59A 3R1FA 2VASA 3HOXJ 3WTYC 3DBHB 2BNOA 2HDCA 1ETYA 1G3TA 3EQLF 4BEHB 2FOKA 5L3GA 2OZ6A 5TJJA 4EKIA 4S0HB 4B09A 4A0XA 2O03A 5GAHi 2F6CA 2L9VA 1Z1DA 2ISZA 4X4EA 4G8XA 3ZN0A 2OR1L 5IP7J 1DP3A 4Y13A 5KCMA 1A6QA 4Y33A 3HGYA 4V2FA 5DTQA 2HVSA 2XKOA 3G2BA 1ETOA 1VQ7I 5HLIA 4HRAA 2ICTA 2CV0A 2CFOA 3W2AA 2HNHA 4EMSA 4EGZA 1YE9A 4OIRF 3CO7C 3QODA 4M9ZA 2GQQA 3DCFA 1RPEL 4CO8A 2JVGA 4II3A 3PFYA 1VQKI 5LGUA 1U8RA 3VYUB 1LQCA 5DCMA 4IO9F 2EV6A 4D1QA 2UWMA 2JA7J 2VJ5A 4JOMA 2RC4A 1HDPA 1G6NA 3HOSA 2EBIA 4ENNA 4YARA 2X6YA 4BJ5C 4HZFA 1QBJA 4AVZA 2STWA 2R0QC 2DA3A 5J1YA 2YU9J 4PJLA 3WTTC 1VZ0A 3OP9A 5EEGA 1IDYA 4C3HJ 4UUSB 5DT2A 3BTLA 1BJAA 2LY2A 2IVMA 2LF8A 3H5RA 4RB1A 1QQAA 1LUJB 3LQRA 3H9GA 2ZB9A 2LOOA 1G3SA 2R7QA 1E17A 2PJRB 5IYBJ 2F48A 5ICGA 4HAMA 3Q5FA 4EZIA 3LA2A 5IP9J 3T8TA 1T56A 1STZA 5KK1A 3BCAA 2R93J 2M3AA 3H9QA 2X51A 2XGDA 3PXPA 2PXKA 1W7PB 5FRNA 2DJIA 2BE5F 2FQ3A 5GPCA 1LE8B 3F8MA 5M5WJ 3HOWJ 1L3LA 2G7UA 3Q3SA 4MO7A 3JAMZ 2A6EF 1CF7A 4CCKA 5IOZA 4BS9A 4XRMA 3S1NJ 4F55A 5CVIA 2PXVA 5LBQA 5E1XA 4Z58A 2FD5A 3R6SA 4A3MJ 2R7OA 2PG4A 3FF5A 2O6GE 1YW7A 3S8QA 2ZXHA 1W7PA 4QTRA 4HNTA 4TV7A 5GAGi 2YSRA 5M5YJ 3L2VA 2LY1A 4R79A 1LKXA 2HS5A 3BPVA 4MQVA 1CQTA 2HQAA 1P2FA 4NQWB 4UVCA 1OR7C 1IJWC 2HSGA 3DPTA 2AXUA 2LKSA 2BVLA 4YEJA 1SVMA 3A02A 3I55I 4L0ZB 2CJJA 2BYVE 3LSKA 4A2UA 1P6RA 3E3VA 4ER7A 3A0HC 2LH9A 3G1OA 2L5QA 2FMYA 3U2RA 5F08A 4C2UA 2KJBA 3SZPA 3OYLA 4D9JA 1NG7A 1S6LA 3BC8A 1IN6A 3IP4B 3LWFA 1HSJA 5JFRA 4GQMA 4CCMA 3RIRA 1BC8C 3R0AA 2BGCA 2XIUA 2GXAA 2EIKH 4BQQA 5J8FA 3M8FA 3CC4I 1E0EA 1Z67A 3X2QH 1MH4A 3DKWA 1YIJI 1JKRC 2R7ZJ 2KDOA 2D45A 3GFJA 4M9SA 3PFIA 2YPRA 1J0RA 1QZZA 2AO9A 1FSEA 2V6EA 2IS1A 2MLGA 4V19K 2CW7A 1SD5A 4I01A 2M7AA 1FP2A 3IAS2 1ZK8A 4EKGA 2BOLA 3LSTA 2QBYA 4O3MA 3FYMA 3FIWA 3ABKH 1B6AA 4MEYF 1GT0C 1MJ9A 1YLFA 4EJWA
chains in the Genus database with same CATH topology
3I4NJ 2BJCA 2IU7A 3H5TA 3GTLJ 4JX5A 1BW5A 1MBGA 4X4FA 4JYKA 5FJ8J 1Z77A 2ECCA 3E7LA 2PUBA 1WGXA 1SFOJ 2IVBA 3FKIJ 3BDNA 2HOTA 2JA5J 2LYLA 4JQDA 3BR3A 4J1XA 5EEAA 1HF0A 3MKLA 3IH3A 3SFIA 5EDNA 4FN3A 3DEWA 3LFPA 1BL0A 4ABZA 3SJMA 1EF4A 3OIOA 2Y31A 2ECBA 3HB9A 2BNNA 5JLWA 2PUAA 2XRLA 2JA8J 2OFYA 1WCMJ 1RR7A 1VI0A 3HKZN 5J1RA 5K98B 2D5VA 4M3EA 3BD1A 3KZ3A 3GTPJ 4JP0A 4JX6A 3L1PA 2PUCA 2NOGA 2VPRA 1ETKA 2LVSA 4QSHA 4IWRA 2P81A 4YBAA 1U78A 1DU6A 1YSEA 1ETWA 4A3IJ 3SDGA 1CJGA 1ZVVA 2R5YB 1K61A 1ADRA 3U3WA 1DU0A 1YRNB 1U9OA 2M34A 4EEFG 1D5YA 3I4MJ 1XWRA 3BQYA 2CUFA 4A3BJ 2E2HJ 1Y7YA 5M3FJ 3F6WA 1Q1VA 4C2MJ 2RAEA 4IEJA 2L8NA 2PIJA 2OF7A 2ELKA 4IHYA 2LLKA 4JCYA 4DYQA 3QYXA 1H8AC 2R1JL 1WH5A 1TWAJ 3HDDA 3FYAA 5DS9A 2WB1N 3M4OJ 1JWLA 1BDIA 4FE7A 4I6ZA 1XC5A 2M2EA 1ENHA 3S1MJ 1BA5A 3IVPA 1QP0A 5EYRA 3IV5A 4XK4A 5IYCJ 3SCGA 2VKVA 3LSJA 2I10A 3BTIA 1ZTRA 2HOSA 4X6AJ 3GTQJ 4B3AA 2JN6A 4DYRA 2O38A 2L49A 1FTTA 2E1OA 2XGCA 1T33A 2R63A 4Z5DA 1ETXA 1K83J 1VFCA 4IHXA 2N8GA 3MLFA 3BTCA 2R5ZB 2JWTA 1MNMC 1MBKA 3OQOA 4Z5HA 4MFEA 4D7MA 1IGNA 1BDHA 3S15J 3TEDA 2GZUA 5E3NA 3JR9A 4X4IA 1R63A 3HZIB 2LY9A 3H0GJ 1NK3P 2LYQA 1A6IA 2E19A 4BKXA 1GV2A 3HM5A 2EZLA 4MIMA 1U9NA 2XPVA 4Z59A 1RKWA 3TW7A 1QP7A 3ZHIA 2K9SA 3BQZA 3TP0A 3RZDJ 4Z5CA 2GBYA 3BT9A 1ZR4A 5K7ZA 5FKOA 3LSPA 1JTXA 4MCXA 4PU3C 4JCXA 4GHJA 1ITYA 3OOUA 1AHDP 4J1WA 3S14J 4X4HA 2ID6A 1ZKGA 1WPKA 3NAUA 2AWIA 2MW8A 2Y2ZA 1MSEC 2MQKA 4O8BA 2Y9YA 4A3JJ 2NVQJ 5F0CA 4B4CA 3GTGJ 3BR6A 3UFDA 3OQMA 2LYRA 2LTPA 2PUDA 3HOYJ 3B7HA 3OQNA 1AKHA 1XS9A 2DA7A 2OPTA 5J3LA 2LR8A 4RDUA 2Y0SN 3CROL 4A69C 4I6UA 2DMPA 1LFBA 4I6TA 1ZZ8A 3K2AA 2YS9A 1TWGJ 2TRTA 1GUUA 1ZS4A 3GTOJ 1JGGA 1X57A 4I8TA 3NARA 3EUSA 1B0NA 2LP0A 2BNMA 1TWHJ 1P7IA 1F36A 1OCPA 3O8GA 1NEQA 3F51A 1JUSA 2HXIA 3CMYA 4XRSG 2KEIA 5M5XJ 1WETA 1RPWA 1L1MA 4UUSA 1ZZCA 3TRBA 2DA1A 2DMUA 2CQXA 2XPWA 1OSLA 1PRVA 3HEFA 4I6RA 4QIWN 3ZQCA 2VUMJ 3PO3J 2O7OA 3FISA 5K7FA 1SANA 1PUFB 2LD5A 3GN5A 1I3QJ 3PM1A 4CYCB 2PE5A 2EZIA 1ZZ9A 3BG3A 1NTCA 4IHWA 2HOAA 5E3MA 4RBOA 2FJ1A 4HNVA 2CRGA 4X1EA 2GRLA 2WIUB 2HYJA 4C3JJ 5C3EJ 2CSFA 5F0FA 1X2MA 1GDTA 4G12A 1UHSA 1HLVA 3CDLA 1JKPC 1IUFA 2ME0A 3H3VK 2HQ5A 1RZSA 3GN5B 1RIOA 1JUMA 1YRNA 5C4JJ 3JRIA 1JFTA 2O4AA 5F04A 1E3OC 2X48A 2DA4A 1NK2P 3LNQA 4NDLA 3KXAA 3GTKJ 3ZQHA 2LKXA 4I76A 1TC3C 2KEKA 2NS8A 1R69A 3QQ6A 1JFSA 1LCDA 3BR2A 5A7LA 1ZQ3P 2O8KA 3RKQA 1AKHB 1SQ8A 1B72B 2HINA 3TW6A 3BR1A 5FKLA 3FK7A 3OSGA 2PUFA 4UUTA 1JUPA 1PRAA 2CU7A 1QVUA 3JRHA 3CQZJ 1O4XA 1OFCX 2AXZA 2ID3A 1UG2A 2QF7A 3HOZJ 3QPLA 2E2IJ 4C3IJ 1I50J 3D1NI 3HBLA 2LYKA 3B6CA 3HOUJ 4BBSJ 1JTYA 1P7JA 4W97A 3CCYA 2L7ZA 3UKGA 1GVDA 3VPRA 1ZZBA 2XB0X 1UXCA 3LISA 2QCOA 1X58A 1QPIA 4XRSA 2W48A 4BBRJ 2TCTA 2KDZA 2WAQN 3A01B 4A93J 3ZQGA 4CYCA 3RZZA 3F0CA 3BG9A 3O9XA 3B6AA 2A6CA 2CROA 2IVGA 2HXOA 2DJNA 5E3OA 4A3DJ 2PUGA 2G0EA 1NERA 3BR5A 3LOCA 1PRUA 2JVLA 3RQIA 2CQQA 1JKOC 2LYPA 5EGOB 2CUEA 2WUSR 2MGQA 2NVYJ 2LYJA 1AU7A 3GBFA 2IBDA 1H88C 4BY1J 4A3LJ 4IHVA 2LYSA 2H8RA 3HOVJ 2XCJA 1LCCA 3VK0A 2AHQA 3C2BA 2EWTA 1FIAA 1MBHA 3GBGA 1RETA 1RKTA 5E3LA 2IUOA 2DMNA 4X4CA 2ICPA 2ME6A 4D5FA 1APLC 2NVTJ 5EGOA 2LK2A 2NVXJ 3RZOJ 1WH8A 2KPJA 1H89C 1VPWA 2EZHA 3KJXA 2IAIA 2DTZA 3G7DA 4A3CJ 1ZUGA 3GTJJ 2O9LA 1ZZ7A 1UMQA 2L9RA 3MN2A 4A3FJ 1IG7A 2KT0A 2EF8A 2AW6A 1FEXA 3S1QJ 1I6HJ 2JA6J 1U8BA 2JK3A 4W1UA 4A3GJ 3ZQFA 4IA8A 3TP3A 4MFDA 5M3MJ 3F52A 1QQBA 2JJ7A 4PU7A 3DNVB 3ZKCA 1ZZ6A 2X9DA 2GLOA 1POUA 1A5JA 2M0CA 2XGEA 4FBIA 4MLOA 4PU8A 3JXBC 4V2GA 2MG4A 2X6OA 5DTDA 1OCTC 3BR0A 4B1RA 2R92J 1ZAYA 1X2NA 4M3BA 2Y9ZA 5FKMA 3JRFA 3IH4A 3BS3A 2EQRA 4M3FA 3OMTA 1LMB3 4Y7NJ 4X4DA 4J19A 4OB4A 3ZQIA 3SCFA 3R1FA 3HOXJ 1EFAA 2BNOA 1ETYA 2XPUA 1ETQA 2EZKA 3BG5A 4AYBN 3LSGA 5EG0B 5C4XJ 4FE4A 3LSRA 2DMTA 4A3KJ 4S0HB 5J1UA 4DZPA 4DW6A 1WH6A 3JRAA 2LFBA 5F27A 3JRCA 4X4EA 1TWCJ 2EBYA 2OR1L 5IP7J 3CLCA 3S1RJ 1HDDC 1B8IB 1ETVA 2FQ4A 3Q0UA 4YG4A 3HGYA 4V2FA 3BTJA 2H1KA 1BJZA 1ETOA 3FMYA 2ICTA 4YG7B 5IPAA 1W0TA 3S2HJ 4DZJA 1JH9A 1ORKA 1HCRA 1POGA 4DYCA 3DCFA 1RPEL 2L0KA 3G1LA 2NS7A 2FX0A 2DA2A 2EH3A 2JMWA 2L7MP 5IYDJ 2IEKA 1LQCA 3HGGA 3Q0WA 3WHCA 3M3YJ 1F43A 1ZGWA 2XSDC 2K9NA 3W6VA 4M3GA 2LCVA 1PNRA 5JLXA 5HODA 3JREA 2JA7J 1IRZA 1HDPA 2GRMA 1QP4A 1Y1WJ 2EBIA 1JJ6C 5EG0A 4YARA 2DA5A 2AXVA 1LLIA 5BNGA 5IOYA 1PUFA 1UTXA 1FIPA 1S7EA 2L7FP 2R0QC 2B63J 2DA3A 5J1YA 2GM4A 2YU9J 2PPXA 5FLMJ 1DWKA 2WV1A 3OP9A 3JRDA 1IDYA 4C3HJ 4UUSB 3BTLA 4D7NA 1MH3A 1Y1VJ 2M8GX 4XIDA 2AUWA 1TWFJ 4PU4C 1RZRD 2YUSA 1QQAA 1Z0XA 4JX4A 2E2JJ 4AC0A 1RESA 1JT0A 1B8IA 2DN0A 2ZB9A 3SCHA 4X4BA 5FLVA 1WIZA 5IYBJ 4LOCA 1VNDA 3S17J 4Y52J 4YG1A 4X4GA 4FISA 1MBEA 5IP9J 1T56A 3JRBA 2JCGA 5C44J 2MEZA 5FKKA 1WH7A 2R93J 2K40A 1JJ8C 1MBJA 5FKNA 1MBFA 2XB5A 3GTMJ 2O49A 2XGDA 2R5YA 3PXPA 1OJLA 5F0HA 2VI6A 4FCYA 5IP6A 1ZPQA 3O8HA 5GPCA 1LE8B 3A01A 5M5WJ 3HOWJ 5EF6A 1PERL 1UXDA 4GFBA 3Q3SA 4MO7A 2K9QA 4M3DA 3S2DJ 1DW9A 3CECA 1W0UA 3JXCL 4A3EJ 5IOZA 3S1NJ 4XRMA 2IV1A 3IH2A 4L5EA 4Z58A 2PMZN 2FD5A 4A3MJ 3OSFA 4XICA 2PUEA 3ZHMA 1VF9A 3ZOBA 4FTHA 3A03A 2HDDA 3QWGA 1LFUP 3S8QA 1QPZA 2IVQA 4QTRA 1BW6A 4NDWA 5M5YJ 3JXDL 2HI3A 9ANTA 1CQTA 1X2LA 2XI8A 4Y42A 1G2HA 1IJWC 2HSGA 2AXUA 1QVTA 3A02A 4AUXA 2CJJA 1MSFC 3FK6A 1RZRA 4BY7J 1JT6A 1QRYA 3QF3A 3G1OA 2R5ZA 5F08A 3PO2J 3Q0VA 5EZHA 1FTZA 3QPSA 5GP9A 1LE8A 3K7AJ 2Y30A 2COBA 1R9TJ 4F8DA 4GQMA 1GV5A 2DMQA 1IDZA 2XJ3A 2XIUA 1WI3A 2MSYA 1FJLA 2B5AA 1MH4A 1XG1A 1JKRC 2R7ZJ 1JKQC 2M9HA 5K7HA 1IV6A 1B72A 1ZR2A 4BXXJ 2FJRA 2AO9A 1HOMA 3QQAA 3JRGA 4IVZA 3ZQLA 1ZK8A 3G5GA 4MCTA 2KEJA 3FYMA 2VKEA 3FIWA 4M6VA 5GPAA 3G1MA 5EZGA 2DA6A 4D5CA 5F1JA 1GT0C 3MVPA 1IC8A 2KZ8A 1Y9QA 3WHBA 3S16J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N J;  2BJC A;  2IU7 A;  3H5T A;  3GTL J;  4JX5 A;  1BW5 A;  1MBG A;  4X4F A;  4JYK A;  5FJ8 J;  1Z77 A;  2ECC A;  3E7L A;  2PUB A;  1WGX A;  1SFO J;  2IVB A;  3FKI J;  3BDN A;  2HOT A;  2JA5 J;  2LYL A;  4JQD A;  3BR3 A;  4J1X A;  5EEA A;  1HF0 A;  3MKL A;  3IH3 A;  3SFI A;  5EDN A;  4FN3 A;  3DEW A;  3LFP A;  1BL0 A;  4ABZ A;  3SJM A;  1EF4 A;  3OIO A;  2Y31 A;  2ECB A;  3HB9 A;  2BNN A;  5JLW A;  2PUA A;  2XRL A;  2JA8 J;  2OFY A;  1WCM J;  1RR7 A;  1VI0 A;  3HKZ N;  5J1R A;  5K98 B;  2D5V A;  4M3E A;  3BD1 A;  3KZ3 A;  3GTP J;  4JP0 A;  4JX6 A;  3L1P A;  2PUC A;  2NOG A;  2VPR A;  1ETK A;  2LVS A;  4QSH A;  4IWR A;  2P81 A;  4YBA A;  1U78 A;  1DU6 A;  1YSE A;  1ETW A;  4A3I J;  3SDG A;  1CJG A;  1ZVV A;  2R5Y B;  1K61 A;  1ADR A;  3U3W A;  1DU0 A;  1YRN B;  1U9O A;  2M34 A;  4EEF G;  1D5Y A;  3I4M J;  1XWR A;  3BQY A;  2CUF A;  4A3B J;  2E2H J;  1Y7Y A;  5M3F J;  3F6W A;  1Q1V A;  4C2M J;  2RAE A;  4IEJ A;  2L8N A;  2PIJ A;  2OF7 A;  2ELK A;  4IHY A;  2LLK A;  4JCY A;  4DYQ A;  3QYX A;  1H8A C;  2R1J L;  1WH5 A;  1TWA J;  3HDD A;  3FYA A;  5DS9 A;  2WB1 N;  3M4O J;  1JWL A;  1BDI A;  4FE7 A;  4I6Z A;  1XC5 A;  2M2E A;  1ENH A;  3S1M J;  1BA5 A;  3IVP A;  1QP0 A;  5EYR A;  3IV5 A;  4XK4 A;  5IYC J;  3SCG A;  2VKV A;  3LSJ A;  2I10 A;  3BTI A;  1ZTR A;  2HOS A;  4X6A J;  3GTQ J;  4B3A A;  2JN6 A;  4DYR A;  2O38 A;  2L49 A;  1FTT A;  2E1O A;  2XGC A;  1T33 A;  2R63 A;  4Z5D A;  1ETX A;  1K83 J;  1VFC A;  4IHX A;  2N8G A;  3MLF A;  3BTC A;  2R5Z B;  2JWT A;  1MNM C;  1MBK A;  3OQO A;  4Z5H A;  4MFE A;  4D7M A;  1IGN A;  1BDH A;  3S15 J;  3TED A;  2GZU A;  5E3N A;  3JR9 A;  4X4I A;  1R63 A;  3HZI B;  2LY9 A;  3H0G J;  1NK3 P;  2LYQ A;  1A6I A;  2E19 A;  4BKX A;  1GV2 A;  3HM5 A;  2EZL A;  4MIM A;  1U9N A;  2XPV A;  4Z59 A;  1RKW A;  3TW7 A;  1QP7 A;  3ZHI A;  2K9S A;  3BQZ A;  3TP0 A;  3RZD J;  4Z5C A;  2GBY A;  3BT9 A;  1ZR4 A;  5K7Z A;  5FKO A;  3LSP A;  1JTX A;  4MCX A;  4PU3 C;  4JCX A;  4GHJ A;  1ITY A;  3OOU A;  1AHD P;  4J1W A;  3S14 J;  4X4H A;  2ID6 A;  1ZKG A;  1WPK A;  3NAU A;  2AWI A;  2MW8 A;  2Y2Z A;  1MSE C;  2MQK A;  4O8B A;  2Y9Y A;  4A3J J;  2NVQ J;  5F0C A;  4B4C A;  3GTG J;  3BR6 A;  3UFD A;  3OQM A;  2LYR A;  2LTP A;  2PUD A;  3HOY J;  3B7H A;  3OQN A;  1AKH A;  1XS9 A;  2DA7 A;  2OPT A;  5J3L A;  2LR8 A;  4RDU A;  2Y0S N;  3CRO L;  4A69 C;  4I6U A;  2DMP A;  1LFB A;  4I6T A;  1ZZ8 A;  3K2A A;  2YS9 A;  1TWG J;  2TRT A;  1GUU A;  1ZS4 A;  3GTO J;  1JGG A;  1X57 A;  4I8T A;  3NAR A;  3EUS A;  1B0N A;  2LP0 A;  2BNM A;  1TWH J;  1P7I A;  1F36 A;  1OCP A;  3O8G A;  1NEQ A;  3F51 A;  1JUS A;  2HXI A;  3CMY A;  4XRS G;  2KEI A;  5M5X J;  1WET A;  1RPW A;  1L1M A;  4UUS A;  1ZZC A;  3TRB A;  2DA1 A;  2DMU A;  2CQX A;  2XPW A;  1OSL A;  1PRV A;  3HEF A;  4I6R A;  4QIW N;  3ZQC A;  2VUM J;  3PO3 J;  2O7O A;  3FIS A;  5K7F A;  1SAN A;  1PUF B;  2LD5 A;  3GN5 A;  1I3Q J;  3PM1 A;  4CYC B;  2PE5 A;  2EZI A;  1ZZ9 A;  3BG3 A;  1NTC A;  4IHW A;  2HOA A;  5E3M A;  4RBO A;  2FJ1 A;  4HNV A;  2CRG A;  4X1E A;  2GRL A;  2WIU B;  2HYJ A;  4C3J J;  5C3E J;  2CSF A;  5F0F A;  1X2M A;  1GDT A;  4G12 A;  1UHS A;  1HLV A;  3CDL A;  1JKP C;  1IUF A;  2ME0 A;  3H3V K;  2HQ5 A;  1RZS A;  3GN5 B;  1RIO A;  1JUM A;  1YRN A;  5C4J J;  3JRI A;  1JFT A;  2O4A A;  5F04 A;  1E3O C;  2X48 A;  2DA4 A;  1NK2 P;  3LNQ A;  4NDL A;  3KXA A;  3GTK J;  3ZQH A;  2LKX A;  4I76 A;  1TC3 C;  2KEK A;  2NS8 A;  1R69 A;  3QQ6 A;  1JFS A;  1LCD A;  3BR2 A;  5A7L A;  1ZQ3 P;  2O8K A;  3RKQ A;  1AKH B;  1SQ8 A;  1B72 B;  2HIN A;  3TW6 A;  3BR1 A;  5FKL A;  3FK7 A;  3OSG A;  2PUF A;  4UUT A;  1JUP A;  1PRA A;  2CU7 A;  1QVU A;  3JRH A;  3CQZ J;  1O4X A;  1OFC X;  2AXZ A;  2ID3 A;  1UG2 A;  2QF7 A;  3HOZ J;  3QPL A;  2E2I J;  4C3I J;  1I50 J;  3D1N I;  3HBL A;  2LYK A;  3B6C A;  3HOU J;  4BBS J;  1JTY A;  1P7J A;  4W97 A;  3CCY A;  2L7Z A;  3UKG A;  1GVD A;  3VPR A;  1ZZB A;  2XB0 X;  1UXC A;  3LIS A;  2QCO A;  1X58 A;  1QPI A;  4XRS A;  2W48 A;  4BBR J;  2TCT A;  2KDZ A;  2WAQ N;  3A01 B;  4A93 J;  3ZQG A;  4CYC A;  3RZZ A;  3F0C A;  3BG9 A;  3O9X A;  3B6A A;  2A6C A;  2CRO A;  2IVG A;  2HXO A;  2DJN A;  5E3O A;  4A3D J;  2PUG A;  2G0E A;  1NER A;  3BR5 A;  3LOC A;  1PRU A;  2JVL A;  3RQI A;  2CQQ A;  1JKO C;  2LYP A;  5EGO B;  2CUE A;  2WUS R;  2MGQ A;  2NVY J;  2LYJ A;  1AU7 A;  3GBF A;  2IBD A;  1H88 C;  4BY1 J;  4A3L J;  4IHV A;  2LYS A;  2H8R A;  3HOV J;  2XCJ A;  1LCC A;  3VK0 A;  2AHQ A;  3C2B A;  2EWT A;  1FIA A;  1MBH A;  3GBG A;  1RET A;  1RKT A;  5E3L A;  2IUO A;  2DMN A;  4X4C A;  2ICP A;  2ME6 A;  4D5F A;  1APL C;  2NVT J;  5EGO A;  2LK2 A;  2NVX J;  3RZO J;  1WH8 A;  2KPJ A;  1H89 C;  1VPW A;  2EZH A;  3KJX A;  2IAI A;  2DTZ A;  3G7D A;  4A3C J;  1ZUG A;  3GTJ J;  2O9L A;  1ZZ7 A;  1UMQ A;  2L9R A;  3MN2 A;  4A3F J;  1IG7 A;  2KT0 A;  2EF8 A;  2AW6 A;  1FEX A;  3S1Q J;  1I6H J;  2JA6 J;  1U8B A;  2JK3 A;  4W1U A;  4A3G J;  3ZQF A;  4IA8 A;  3TP3 A;  4MFD A;  5M3M J;  3F52 A;  1QQB A;  2JJ7 A;  4PU7 A;  3DNV B;  3ZKC A;  1ZZ6 A;  2X9D A;  2GLO A;  1POU A;  1A5J A;  2M0C A;  2XGE A;  4FBI A;  4MLO A;  4PU8 A;  3JXB C;  4V2G A;  2MG4 A;  2X6O A;  5DTD A;  1OCT C;  3BR0 A;  4B1R A;  2R92 J;  1ZAY A;  1X2N A;  4M3B A;  2Y9Z A;  5FKM A;  3JRF A;  3IH4 A;  3BS3 A;  2EQR A;  4M3F A;  3OMT A;  1LMB 3;  4Y7N J;  4X4D A;  4J19 A;  4OB4 A;  3ZQI A;  3SCF A;  3R1F A;  3HOX J;  1EFA A;  2BNO A;  1ETY A;  2XPU A;  1ETQ A;  2EZK A;  3BG5 A;  4AYB N;  3LSG A;  5EG0 B;  5C4X J;  4FE4 A;  3LSR A;  2DMT A;  4A3K J;  4S0H B;  5J1U A;  4DZP A;  4DW6 A;  1WH6 A;  3JRA A;  2LFB A;  5F27 A;  3JRC A;  4X4E A;  1TWC J;  2EBY A;  2OR1 L;  5IP7 J;  3CLC A;  3S1R J;  1HDD C;  1B8I B;  1ETV A;  2FQ4 A;  3Q0U A;  4YG4 A;  3HGY A;  4V2F A;  3BTJ A;  2H1K A;  1BJZ A;  1ETO A;  3FMY A;  2ICT A;  4YG7 B;  5IPA A;  1W0T A;  3S2H J;  4DZJ A;  1JH9 A;  1ORK A;  1HCR A;  1POG A;  4DYC A;  3DCF A;  1RPE L;  2L0K A;  3G1L A;  2NS7 A;  2FX0 A;  2DA2 A;  2EH3 A;  2JMW A;  2L7M P;  5IYD J;  2IEK A;  1LQC A;  3HGG A;  3Q0W A;  3WHC A;  3M3Y J;  1F43 A;  1ZGW A;  2XSD C;  2K9N A;  3W6V A;  4M3G A;  2LCV A;  1PNR A;  5JLX A;  5HOD A;  3JRE A;  2JA7 J;  1IRZ A;  1HDP A;  2GRM A;  1QP4 A;  1Y1W J;  2EBI A;  1JJ6 C;  5EG0 A;  4YAR A;  2DA5 A;  2AXV A;  1LLI A;  5BNG A;  5IOY A;  1PUF A;  1UTX A;  1FIP A;  1S7E A;  2L7F P;  2R0Q C;  2B63 J;  2DA3 A;  5J1Y A;  2GM4 A;  2YU9 J;  2PPX A;  5FLM J;  1DWK A;  2WV1 A;  3OP9 A;  3JRD A;  1IDY A;  4C3H J;  4UUS B;  3BTL A;  4D7N A;  1MH3 A;  1Y1V J;  2M8G X;  4XID A;  2AUW A;  1TWF J;  4PU4 C;  1RZR D;  2YUS A;  1QQA A;  1Z0X A;  4JX4 A;  2E2J J;  4AC0 A;  1RES A;  1JT0 A;  1B8I A;  2DN0 A;  2ZB9 A;  3SCH A;  4X4B A;  5FLV A;  1WIZ A;  5IYB J;  4LOC A;  1VND A;  3S17 J;  4Y52 J;  4YG1 A;  4X4G A;  4FIS A;  1MBE A;  5IP9 J;  1T56 A;  3JRB A;  2JCG A;  5C44 J;  2MEZ A;  5FKK A;  1WH7 A;  2R93 J;  2K40 A;  1JJ8 C;  1MBJ A;  5FKN A;  1MBF A;  2XB5 A;  3GTM J;  2O49 A;  2XGD A;  2R5Y A;  3PXP A;  1OJL A;  5F0H A;  2VI6 A;  4FCY A;  5IP6 A;  1ZPQ A;  3O8H A;  5GPC A;  1LE8 B;  3A01 A;  5M5W J;  3HOW J;  5EF6 A;  1PER L;  1UXD A;  4GFB A;  3Q3S A;  4MO7 A;  2K9Q A;  4M3D A;  3S2D J;  1DW9 A;  3CEC A;  1W0U A;  3JXC L;  4A3E J;  5IOZ A;  3S1N J;  4XRM A;  2IV1 A;  3IH2 A;  4L5E A;  4Z58 A;  2PMZ N;  2FD5 A;  4A3M J;  3OSF A;  4XIC A;  2PUE A;  3ZHM A;  1VF9 A;  3ZOB A;  4FTH A;  3A03 A;  2HDD A;  3QWG A;  1LFU P;  3S8Q A;  1QPZ A;  2IVQ A;  4QTR A;  1BW6 A;  4NDW A;  5M5Y J;  3JXD L;  2HI3 A;  9ANT A;  1CQT A;  1X2L A;  2XI8 A;  4Y42 A;  1G2H A;  1IJW C;  2HSG A;  2AXU A;  1QVT A;  3A02 A;  4AUX A;  2CJJ A;  1MSF C;  3FK6 A;  1RZR A;  4BY7 J;  1JT6 A;  1QRY A;  3QF3 A;  3G1O A;  2R5Z A;  5F08 A;  3PO2 J;  3Q0V A;  5EZH A;  1FTZ A;  3QPS A;  5GP9 A;  1LE8 A;  3K7A J;  2Y30 A;  2COB A;  1R9T J;  4F8D A;  4GQM A;  1GV5 A;  2DMQ A;  1IDZ A;  2XJ3 A;  2XIU A;  1WI3 A;  2MSY A;  1FJL A;  2B5A A;  1MH4 A;  1XG1 A;  1JKR C;  2R7Z J;  1JKQ C;  2M9H A;  5K7H A;  1IV6 A;  1B72 A;  1ZR2 A;  4BXX J;  2FJR A;  2AO9 A;  1HOM A;  3QQA A;  3JRG A;  4IVZ A;  3ZQL A;  1ZK8 A;  3G5G A;  4MCT A;  2KEJ A;  3FYM A;  2VKE A;  3FIW A;  4M6V A;  5GPA A;  3G1M A;  5EZG A;  2DA6 A;  4D5C A;  5F1J A;  1GT0 C;  3MVP A;  1IC8 A;  2KZ8 A;  1Y9Q A;  3WHB A;  3S16 J; 
#chains in the Genus database with same CATH topology
 4BL0 B;  4XLF A;  3H5T A;  3GTL J;  1MND A;  2D2W A;  2B7E A;  2CG4 A;  2LF7 A;  4JYK A;  2ZSH B;  3A1Y A;  2H09 A;  3QOP A;  4FX0 A;  4EM2 A;  2OQG A;  1WGX A;  2F5E A;  4IHT A;  3FKI J;  5IT9 K;  4ER0 A;  2B0L A;  1P4A A;  3BDN A;  3WTW C;  2HOT A;  2LYL A;  4A5N A;  4JQD A;  3BR3 A;  2IS6 A;  4PCQ A;  2DPD A;  3HJE A;  2R7T A;  3DEW A;  3JCU C;  1BL0 A;  1EF4 A;  4ESB A;  4YG2 F;  2R7X A;  4EV0 A;  2PXT A;  3OIO A;  3EUH C;  3CDH A;  4RGX A;  4KIS A;  1DUL A;  2G9W A;  4KIB A;  1BIB A;  1UZC A;  5JLW A;  3SYT A;  3EUH A;  5J1R A;  1UJ8 A;  4XN0 A;  2FNP A;  3EET A;  4M3E A;  4CDG A;  5DD8 A;  1IXS B;  2QYO A;  1BOB A;  2LKP A;  4OMZ A;  5KVR A;  3PIP F;  1Z3X A;  2LVS A;  4RB0 A;  4QSH A;  4IWR A;  2P81 A;  3MZY A;  3RJP A;  1YSE A;  5J4V A;  4E7K A;  1ETW A;  1AWC A;  2R5Y B;  1ADR A;  3U3W A;  3HRM A;  1DU0 A;  1RR8 C;  3OYJ A;  2MC4 A;  4ZC3 A;  1KU7 A;  4NQW A;  4EEF G;  4X0G A;  3I4M J;  3GLL A;  3BQY A;  2CUF A;  2M8E A;  1F4K A;  2A5W A;  3OR1 C;  2E2H J;  3ML6 A;  2RKH A;  4IF4 A;  3TL4 X;  1XN7 A;  4IHY A;  1O57 A;  4MNU A;  2FF4 A;  4BAC A;  1H8A C;  2K85 A;  1TNT A;  2DK8 A;  1TWA J;  2OCE A;  1YJW I;  3FYA A;  3CCL I;  2NOJ B;  4FE7 A;  3KZI C;  2X1E A;  1R58 A;  1XC5 A;  3ZMT A;  3WE3 A;  3S1M J;  1QP0 A;  4BE2 A;  3IV5 A;  1G4D A;  2E5N A;  2L4M A;  3GME A;  1MDM B;  3LSJ A;  3NQO A;  3KIO A;  4I98 B;  4RB2 C;  3FWE A;  3QAH A;  4GRI A;  4EQZ A;  1RNL A;  2P7C B;  1TQM A;  4FT8 A;  3EDP A;  3V8K A;  2E1O A;  2QUF A;  2XGC A;  2R63 A;  1FPQ A;  2Q2E B;  3P9K A;  2CUJ A;  1VFC A;  5HS9 A;  3BTC A;  3GYH X;  3PSF A;  4HDU A;  4E7J A;  4L18 B;  3OQO A;  4Z5H A;  1QHH D;  3S2W A;  3PIO F;  1IGN A;  1WJE A;  1E2X A;  2MH9 A;  1BDH A;  1OR7 A;  2PJR A;  1ONV A;  2OAZ A;  4GO1 A;  3LL7 A;  4HOB A;  3HYI A;  3KP2 A;  2DDB A;  3H3Z A;  2F5C A;  3HZI B;  1ZAR A;  2LYQ A;  1K78 A;  3LSH A;  1GV2 A;  3NXH A;  2OC6 A;  1SAU A;  4MIM A;  3S32 A;  3DLA A;  3BG6 A;  5E18 F;  3TW7 A;  2K9S A;  2STT A;  1Z05 A;  3BQZ A;  3I4P A;  4F92 B;  2ADU A;  2GBY A;  3RZD J;  2ZSI B;  4GDF A;  3LSP A;  1JTX A;  1WJB A;  2H6C A;  1AOY A;  4UY8 I;  3TO6 A;  4X4H A;  2EFQ A;  1WPK A;  5CLS A;  2MW8 A;  2Y2Z A;  2MQK A;  2ZME B;  3ESW B;  2NVQ J;  3GTG J;  3NWT A;  3KEQ A;  2EA2 A;  2LTP A;  5LFA A;  3HOY J;  1OCZ H;  3ELK A;  1ZYR F;  4QPQ A;  1OQY A;  1LVK A;  4GXO A;  2Y0S N;  5BMZ A;  2LYC A;  2QA4 I;  4I6U A;  1ZZ8 A;  1ZS4 A;  5DD4 A;  1TWG J;  1GUU A;  2FBI A;  3DTE A;  4KDP A;  5CVJ A;  2BNM A;  1TWH J;  3O8G A;  4A6D A;  2HXI A;  3FBN B;  3LQQ A;  4XRS G;  2KEI A;  1WET A;  1RPW A;  1PP7 U;  1L1M A;  4OIN F;  1UHM A;  2M5W A;  2VIX A;  2DMU A;  2IT0 A;  2XPW A;  4P96 A;  1IUY A;  1OSL A;  3I64 A;  3GZ6 A;  4EM1 A;  2M0M A;  2V1X A;  3FXJ A;  4QIW N;  4BE0 A;  3PO3 J;  1JHH A;  2XAF A;  2O7O A;  3V42 A;  2LD5 A;  3GN5 A;  2VBW A;  1I3Q J;  2CSO A;  2PXU A;  2HOA A;  2HYF A;  2VQC A;  5E3M A;  4HG2 A;  2E1N A;  2ZME A;  2QQA A;  4C3J J;  5F0F A;  2IPQ X;  3ZMU A;  4AU7 A;  2L7K A;  1UHS A;  2KFD A;  4CSW A;  1IUF A;  5GAD J;  1ERD A;  2K4J A;  3GN5 B;  3ECO A;  1RIO A;  1YRN A;  3CUQ A;  5DDG A;  1IO2 A;  4KN7 X;  1D1A A;  1PYV A;  3CTA A;  2P0W A;  1B9N A;  5BQT A;  2LLW A;  2O4A A;  1MKM A;  2ZFU A;  5D8L B;  3KYL A;  3I5U A;  3K4C A;  4NBQ A;  3ZQH A;  2LKX A;  4DOZ A;  5KAI C;  1PJR A;  2G7H A;  3I54 A;  2KEK A;  1JFS A;  1LCD A;  5GTI C;  2D1H A;  2RGV A;  3QPT A;  3W6K B;  2JSC A;  5DM7 F;  2O8K A;  4LFU A;  2Y0S A;  1DQU A;  3FX3 A;  4RGS A;  3Q9V A;  2HIN A;  2H8W A;  3TW6 A;  3OSG A;  2PUF A;  2CU7 A;  2CV1 A;  3JRH A;  4R1H A;  2ID3 A;  4CYD A;  2QF7 A;  1UEL B;  3VDX A;  3QPL A;  4GYI A;  1FT9 A;  1ZN2 A;  4XRF A;  1WHU A;  2QWW A;  3HTU A;  2FU4 A;  2DLL A;  1Y0U A;  1EKE A;  3C3W A;  2HTJ A;  5JR3 A;  2X1C A;  2I8D A;  3C1D A;  1ACI A;  2QEX I;  1YG2 A;  3R60 A;  2WC2 A;  1KA8 A;  4BBR J;  2KDZ A;  3DKX A;  2EFW A;  3A01 B;  4A93 J;  1EH8 A;  4BAY A;  4WXC A;  1TBX A;  2R7S A;  2BY1 A;  3FM3 A;  1QGP A;  1WVR A;  1DU6 A;  2A6C A;  3CCJ I;  1Y8R B;  2CRO A;  2HXO A;  2DJN A;  4YEL A;  1QA6 A;  3K1N A;  2G0E A;  1NER A;  2DK5 A;  4G7H F;  1YYV A;  3LMM A;  1XSD A;  2A3S A;  2JVL A;  1XPX A;  1JKO C;  2PXD A;  2HVQ A;  2IGM A;  2NVY J;  5KHD A;  2LYJ A;  3MD2 A;  3GBF A;  5D5V B;  2LNB A;  4A3L J;  3KE2 A;  4PFP A;  4YIF A;  4H4K C;  4IHV A;  2W57 A;  2K4B A;  1ON2 A;  3RKW A;  4IPA A;  2AHQ A;  4CCJ A;  2EWT A;  3TFL A;  2IUO A;  1RET A;  1RKT A;  3K6G A;  4X4C A;  2DMN A;  1HBX G;  5EEH A;  4D5F A;  1WJ5 A;  3RZO J;  2NNY A;  1MDM A;  1H89 C;  1VPW A;  2EFP A;  5HLT A;  4UVA A;  1J7K A;  2O9L A;  1LDD A;  2L9R A;  1V5G A;  3SZG A;  2AW6 A;  4WXH A;  2DFE A;  4L9N A;  3AG1 H;  2Z5U A;  2KRH A;  3T5X A;  2X6W A;  4RAZ A;  5DCF A;  4IA8 A;  3TP3 A;  1R7J A;  3DWL E;  2H27 A;  3OYG A;  1BR2 A;  3F52 A;  5CYV A;  3DNV B;  1WKM A;  3F8N A;  2CW8 A;  5L3B A;  1ZZ6 A;  3TDZ C;  2GLO A;  1A5J A;  3S3O A;  2K02 A;  4PU8 A;  2L4A A;  1CF7 B;  3GZD C;  1P4W A;  3QOE A;  2R92 J;  4B1R A;  2ESN A;  4M3B A;  3IH4 A;  3BS3 A;  2EQR A;  2IA0 A;  3SHF A;  3OMT A;  5DEQ A;  4Y7N J;  1LMB 3;  3OY9 A;  3KZY A;  2FE3 A;  4OB4 A;  2X6X A;  3ZQI A;  3SCF A;  3OIP A;  3SEZ A;  1QHG A;  3DM5 A;  2HKO A;  1BI1 A;  2EZK A;  4A12 A;  5C4X J;  3KP5 A;  4IX7 A;  1HKT A;  3LSR A;  2XXP A;  5J1U A;  4HDV A;  5D4S A;  3J80 K;  1REP C;  4ZDP A;  1U6G A;  5JVT A;  3QYF A;  3JRA A;  4J00 A;  2DQR A;  2LFB A;  5D5U B;  3CCQ I;  1TWC J;  3J7Z I;  4RM2 A;  1R22 A;  3BRO A;  3CJT B;  3S1R J;  1HDD C;  2XC7 A;  1ETV A;  3H36 A;  3Q0U A;  3H9J A;  4F7Z A;  2H1K A;  3GUD A;  2DT5 A;  2HYG D;  1D0Y A;  4YG7 B;  5IPA A;  1W0T A;  3VWB A;  4DJA A;  1YW9 A;  5HOO A;  1RIO H;  4HX7 A;  5E79 C;  3M9L A;  1POG A;  4DYC A;  2GA1 A;  4DQ2 A;  4KA4 A;  2MD5 A;  4ZDL A;  4C2T A;  5FRM A;  1YIO A;  2DA2 A;  3CCU I;  1K7A A;  2EH3 A;  2L7M P;  1JXS A;  2Y48 A;  3HGG A;  1SMY F;  3GFM A;  2DOE A;  1ZGW A;  1DPU A;  2J5O A;  4DE9 A;  5JLX A;  2FEZ A;  1XX5 A;  5HOD A;  3GLX A;  1IRZ A;  1MIJ A;  1TT5 B;  1VQN I;  2JVH A;  4ZH4 F;  1Z7L A;  2IGN A;  3A9Y A;  1FWZ A;  2FXA A;  4P9F A;  2PXE A;  2PPX A;  3VYT B;  2GOM A;  2VC1 A;  3CO6 C;  1HC8 A;  3V4G A;  3L2W A;  3JRD A;  4HF1 A;  3G3Z A;  4D7N A;  1Y1V J;  2M8G X;  4OWR B;  1TZL A;  2K9M A;  5GAG J;  3G4S I;  2MXD A;  2PXQ A;  1RES A;  1ODD A;  3K10 A;  1X1B A;  1OIS A;  2DN0 A;  2GIZ A;  1KU2 A;  4EK9 A;  2XF6 A;  1ZRC A;  1OCO H;  3OYM A;  1O7L A;  2VXZ A;  2HWV A;  3F72 A;  2BW3 A;  4LOC A;  1W5T A;  4Y52 J;  2BY3 A;  4FIS A;  3JRB A;  2J7W A;  2JCG A;  1WH7 A;  2K40 A;  4LG3 A;  5JHF A;  2IGK A;  3AKZ A;  2R5Y A;  1YHQ I;  1FNN A;  3M1C A;  5IP6 A;  1ZPQ A;  3M1E A;  3A01 A;  5EF6 A;  1HW2 A;  1PER L;  3J7Y J;  2K9Q A;  4ZYG A;  3JXC L;  1T6S A;  3WU0 A;  4IQ4 A;  3IH2 A;  2YR2 A;  1IZ1 A;  4L5E A;  5CVR A;  1YI2 I;  1P92 A;  4KYW A;  2Z99 A;  3OSF A;  2HKX A;  4XIC A;  3HTS B;  3ZOB A;  1FY7 A;  2NVU B;  5D5X B;  2HDD A;  4RAY A;  1LFU P;  1QPZ A;  1IXC A;  3P9I A;  3A9Z A;  5HS7 A;  4Y42 A;  4ITV A;  3RPU A;  1QVT A;  2LRE A;  4ON0 A;  2PEX A;  4AUX A;  4BUP A;  1MSF C;  1S8N A;  1XMK A;  4DE8 A;  1QRY A;  3TGN A;  3FMR A;  4ZYA A;  2XHK A;  3EUA A;  3F3X A;  2R5Z A;  2B9S A;  2BY0 A;  3LSM A;  3PO2 J;  1PUE E;  1XGN A;  1J59 A;  4PK4 A;  3FHZ A;  5EZH A;  1BI3 A;  1FTZ A;  3QPS A;  1OPC A;  5GP9 A;  5IY5 H;  4CCO A;  4F8D A;  4M71 A;  3MEX A;  1FYM A;  2X0L A;  1GV5 A;  3ZR8 X;  2XJ3 A;  2ODR D;  2MSY A;  4RA2 A;  1FJL A;  4XMY A;  3WG9 A;  2EPF A;  2B5A A;  3OWQ A;  1OYW A;  2FML A;  2HTS A;  3EUK L;  3GZD A;  2X85 A;  2M9H A;  1B72 A;  1ZR2 A;  2FJR A;  3QQA A;  4AIJ A;  2VT2 A;  4MCT A;  1A04 A;  2VKE A;  4M6V A;  1XSX A;  5EZG A;  5GPA A;  2DA6 A;  2XRO A;  1IC8 A;  4RGR A;  1Y9Q A;  3WHB A;  2K3P A;  1DGR M;  5DCM B;  4HPQ A;  2CO5 A;  1Q1H A;  2ZNZ A;  3N05 A;  3KPH A;  4RM3 A;  4OOI A;  2VT3 A;  1KQ0 A;  4ZZD A;  3K9T A;  1IN5 A;  3ZMZ A;  2W4S A;  3E7L A;  1S5L C;  1H9G A;  1LFP A;  2A5Y B;  2PUB A;  4PSW A;  4UB8 C;  4XSZ F;  5E20 A;  2IVB A;  4HV6 A;  2W25 A;  1AA7 A;  2E71 A;  2K9L A;  2W24 A;  4LLG F;  2JQE A;  2BW3 B;  5D6E A;  4ZYD A;  4J1X A;  3MKL A;  5EDN A;  3SFI A;  4PGH A;  3VSL A;  4BQN A;  1T8I A;  3LFP A;  2VKD A;  2Y69 H;  1G3Y A;  5TRD A;  2GIV A;  3DBL B;  3M9A A;  3MCZ A;  1R1T A;  3IWZ A;  1DGW Y;  2ECB A;  3JW4 A;  1R1U A;  5CVU A;  2JA8 J;  1WCM J;  1VI0 A;  3FM5 A;  3E5Q A;  3HKZ N;  5K98 B;  3BD1 A;  3RPQ A;  4BDZ A;  3GTP J;  3ZMS A;  4JX6 A;  2RNG A;  2NOG A;  2M4G A;  1D8J A;  2OTJ I;  4P5O A;  1TT0 A;  3E0J B;  3QYB A;  1J2X A;  2BHY A;  2QQ9 A;  2RDP A;  2CQK A;  1R23 A;  2W85 A;  3TQN A;  3OYD A;  1U78 A;  1DP7 P;  2CGP A;  3KLO A;  1CJG A;  1K61 A;  3QOX A;  2VJI A;  3FXL A;  5DRY A;  1U9O A;  2CFX A;  3WU1 B;  1D5Y A;  1VQL I;  2OZU A;  2A6H F;  1Q1V A;  3SQN A;  4IEJ A;  2PIJ A;  2OF7 A;  2ELK A;  3H92 A;  3HUG A;  4FET A;  2R1J L;  3K1M A;  1TW2 A;  3F23 A;  1BDI A;  1X19 A;  4IRH A;  2PBI A;  3ZQQ A;  3LFK A;  2M2E A;  2XKP A;  1BA5 A;  3IVP A;  3H3U A;  4I7H A;  4XK4 A;  2VC0 A;  2ZCW A;  2WTE A;  5IYC J;  2WA0 A;  1OMI A;  1W4M A;  2VKV A;  3K4L A;  5E17 F;  3NRV A;  2HOS A;  3GF2 A;  2BEO A;  4X6A J;  4B3A A;  2JN6 A;  4DYR A;  2O38 A;  4XLA A;  1HXD A;  4FAS D;  3F9K A;  1K83 J;  2W1O A;  1VQ4 I;  4IHX A;  2R5Z B;  2JPB A;  2JWT A;  2VOD A;  2HZT A;  5HLG A;  4MFE A;  2NNN A;  4PUS A;  1MGT A;  5DV5 A;  2CYY A;  1UB9 A;  2V7F A;  2KJC A;  2GZU A;  4BEH A;  4X4I A;  2CMP A;  3F21 A;  1R63 A;  3F8F A;  2LY9 A;  3H0G J;  1NH3 A;  4BHP A;  3HM5 A;  2HFZ A;  3M8E A;  2FRH A;  4L5J A;  1RKW A;  1WJA A;  1VQ9 I;  3ZHI A;  3QOW A;  3TP0 A;  1HW5 A;  1TP4 A;  2EIJ H;  2V79 A;  3BDD A;  3ZP5 A;  1FOX A;  3ME5 A;  4PU3 C;  4MGR A;  4EJO A;  3TOB A;  4XM3 A;  3OS0 A;  1SC7 A;  2LLV A;  2PN6 A;  1ITY A;  4AD9 A;  2P5L C;  4J1W A;  2LDU A;  4ZZL A;  3I53 A;  2KL4 A;  3CCE I;  5JHU A;  2WAE A;  4O8B A;  2VN2 A;  2HDW A;  2FOW A;  1G8X A;  3C2G A;  4M73 A;  1FLI A;  3I0T A;  2LYR A;  2PUD A;  4YFX F;  4NC8 A;  4ANJ A;  3OQN A;  2GXB A;  5JI6 A;  1XS9 A;  2LR8 A;  4RDU A;  3CRO L;  3BP8 A;  1P9Q C;  1TLH B;  3PE5 A;  2DMP A;  1LFB A;  2Z9O A;  4I6T A;  2YS9 A;  1BC7 C;  2TRT A;  3W2V A;  4EJT A;  2VPL A;  5B3S H;  1X57 A;  3EUS A;  1B0N A;  2JRT A;  1NW3 A;  1VQO I;  4EVI A;  1F36 A;  1OCP A;  3BLY A;  4YFK F;  3J7A O;  1JUS A;  3OYE A;  1F1Z A;  2PI0 A;  3OOP A;  1GVJ A;  3CMY A;  3NZL A;  2OV7 A;  1GLN A;  4PGG A;  1PRV A;  3V7C A;  3ABL H;  4I6R A;  1FBS A;  3ZQC A;  4HST A;  5L3C A;  2QSF X;  3K70 D;  4DBQ A;  3OS1 A;  4A0Y A;  3OS2 A;  4L0Y B;  3AG3 H;  2UXN A;  4KIT B;  3VFZ A;  2BZT A;  1R36 A;  1PVE A;  1VTN C;  3QYE A;  3HG9 A;  3OV8 A;  2HEO A;  3WTU C;  4RBO A;  4HNV A;  2AQF A;  1J5Y A;  2CRG A;  2GRL A;  2V1N A;  2WIU B;  3K1P A;  3DKY A;  4F52 A;  2E5Z A;  1SD7 A;  2GOX B;  1HLV A;  2PXF A;  3CDL A;  3ABM H;  2CH0 A;  2ME0 A;  1RZS A;  3R61 A;  5C4J J;  4ETS A;  1T98 A;  2VQG A;  3MMY B;  3U1K A;  5HNF A;  3OYC A;  1V55 H;  5AIP A;  3JRI A;  4IKF A;  4S04 A;  2X48 A;  4Q4Z F;  2DA4 A;  3O2P E;  3MFK A;  1LEB A;  2RQQ A;  1N78 A;  1I1S A;  1O3T A;  3DQV C;  4RLQ A;  5HDK A;  4NNJ A;  3PNV A;  2NS8 A;  3W2W A;  3BR2 A;  3QRF F;  4Y17 A;  5A7L A;  3CP2 A;  4AWX B;  3HOT A;  3RKQ A;  1AKH B;  2Z3Y A;  3UWP A;  3BR1 A;  5FKL A;  4RB3 C;  4UUT A;  1B9M A;  1QVU A;  4I02 A;  3OYI A;  2VQH A;  3U1D A;  2C6Y A;  1SD6 A;  3CQZ J;  1VQ6 I;  2HQR A;  4F91 B;  5D4R A;  2Q1Z B;  4XKV A;  1GXP A;  1D5V A;  3HOZ J;  1UCR A;  2ZXW H;  2E2I J;  4NUB A;  3TKY A;  2LYK A;  3IKV A;  3B02 A;  2CS3 A;  4W97 A;  3GO5 A;  3FXU A;  4U0V A;  5FD5 A;  2DT6 A;  3BWG A;  1TNS A;  1SVL A;  1I39 A;  1T0F A;  3G71 I;  2OCC H;  1GVD A;  4JK1 X;  2EIM H;  1ZZB A;  3RYP A;  1UXC A;  4RLF A;  2HOE A;  3L2R A;  2QCO A;  1X58 A;  1QPI A;  1VQ5 I;  2W48 A;  1XGO A;  4OAZ A;  4DBR A;  1OLT A;  2KQR A;  3OMY A;  3IWF A;  1QPM A;  5LHI A;  2ZJQ F;  3BR5 A;  3LOC A;  2RVC A;  1FBU A;  3RQI A;  5J8C A;  4BDY A;  2VL8 A;  2CQQ A;  3C7J A;  3CC2 I;  2V1U A;  1TL8 A;  1F9N A;  2LYS A;  2DOF A;  1N75 A;  1QZX A;  1LCC A;  4Z2Y A;  4CA0 A;  2VON A;  3C2B A;  3VYS B;  5FD6 A;  2WY7 Q;  2EFO A;  5E3L A;  4B3X A;  1APL C;  2NVT J;  2XAS A;  1WH8 A;  3KLN A;  4M74 A;  2FSW A;  3W6J B;  2EZH A;  3KJX A;  3G7D A;  4WWC A;  1ZZ7 A;  4HBL A;  2KT0 A;  2JQ7 A;  5ILV A;  3H5N A;  4FQG A;  2NYX A;  2Q2E A;  1X1A A;  4OIO F;  4XOR A;  2EB7 A;  5LRS A;  1ZRF A;  1IN8 A;  2ZXJ A;  4XLH A;  3ZPX A;  1SEU A;  2UUZ A;  2L1P A;  2X9D A;  4O5V A;  3BJA A;  2XGE A;  4U0W A;  4FBI A;  4MLO A;  1MMD A;  1RI7 A;  1MZB A;  2ZNY A;  3HXL A;  4EAT A;  4PJ0 C;  5DTD A;  2A68 F;  1K78 B;  2QGU A;  5DRT A;  1X2N A;  4HNU A;  1XGS A;  4A5M A;  3JRF A;  1DPR A;  4WX9 A;  4CZZ A;  1K79 A;  3CCV I;  3DU6 A;  1P4X A;  3HRU A;  4E7I A;  3GUU A;  2MFZ A;  3CCR I;  5ED4 A;  2XPU A;  2AXL A;  1ETQ A;  4AYB N;  2DYS H;  2ZJR F;  3LSG A;  3KP4 A;  2XDV A;  1WJC A;  2DMT A;  3ISP A;  3IUO A;  5GTH C;  2YX4 A;  4DW6 A;  1WH6 A;  2XAG A;  2L9N A;  3OL4 A;  4WVL A;  5F27 A;  3HPH A;  4IRG A;  2XVC A;  1YJN I;  3CLC A;  3UNG C;  1B8I B;  2BXZ A;  2P7V B;  2FNA A;  2FQ4 A;  3I58 A;  3I59 B;  1I3A A;  5FFZ A;  5K5R A;  1ZLK A;  4YG4 A;  3BTJ A;  3SDB A;  2W84 A;  3WTX C;  2VB6 A;  3S2H J;  1JH9 A;  1ORK A;  1WI9 A;  1HCR A;  1FOW A;  3KP7 A;  3G1L A;  4L5I A;  2MC3 A;  4E7S A;  4M72 A;  2FX0 A;  2XV4 S;  3P5J A;  5IYD J;  3SEQ A;  3HHH A;  3Q0W A;  3WHC A;  3M3Y J;  4ZTJ A;  1R71 A;  2LCV A;  1F5T A;  1WSU A;  3A0B C;  1ZG3 A;  3WGH A;  3JRE A;  2ETH A;  4CZC A;  3KFW X;  2A05 A;  2MBF A;  2GRM A;  3ZMD A;  1Y1W J;  1JJ6 C;  5EG0 A;  4E4H A;  5BNG A;  5IOY A;  1W5C C;  3U21 A;  3MKZ A;  1PUF A;  4I2O A;  3QP5 A;  1S7E A;  3WGG A;  2L7F P;  1UTX A;  2IA1 A;  4RS8 A;  3RTR A;  1Y56 A;  4BQO A;  4EQQ A;  1W36 C;  2Z2S B;  5FLM J;  1DWK A;  2J5P A;  1ZLJ A;  2V6C A;  2WY8 Q;  3ONQ A;  4NC7 A;  1MH3 A;  2AUW A;  4XID A;  1TWF J;  2E1M B;  4Y15 A;  1ZG1 A;  1R1V A;  2HCN A;  3EYI A;  3CJR B;  1N77 A;  1MMN A;  2CQN A;  3FMS A;  1JT0 A;  3K4M A;  3RQ4 A;  1IXR C;  1V3F A;  3E5X A;  5F1R A;  4EGY A;  5D5W B;  1LEA A;  1U0J A;  1U5T C;  2WAD A;  4KT5 C;  1YIT I;  1WIZ A;  3A9X A;  3D5S C;  3QU3 A;  1FYK A;  2VOP A;  1MBE A;  3MWM A;  4WF2 A;  2EV5 A;  5FKK A;  3OL3 A;  1MBJ A;  1MBF A;  4XN3 A;  1MFQ C;  4Q48 A;  4BH9 A;  4EJV A;  2O49 A;  1SMT A;  1OJL A;  5F0H A;  5BPI A;  1RRJ A;  3G6E I;  2E1C A;  1DUX C;  3ZMV A;  3L2Q A;  3K70 C;  1S7A A;  3ASN H;  4AM3 A;  2ESH A;  3A4C A;  4GFB A;  5ICE A;  1TW3 A;  3HSE A;  1XTA A;  2KIM A;  3LQX A;  3CEC A;  1W0U A;  2XUB A;  4CXF A;  2IV1 A;  2DW4 A;  4ER5 A;  2JUG A;  2PMZ N;  1Y39 A;  1A35 A;  2PUE A;  3ZHM A;  4FTH A;  2DAO A;  2M87 A;  4E70 A;  2LRD A;  2H94 A;  1HA8 A;  2IVQ A;  2MD0 A;  5GAH J;  1BW6 A;  4NDW A;  4ZTF A;  3GCM A;  4FX4 A;  2R7V A;  1K4S A;  1V4R A;  3JXD L;  3E5U A;  9ANT A;  2DO7 A;  2XI8 A;  2V26 A;  1SFK A;  1G2H A;  2ZME C;  1GXQ A;  1ZGA A;  3DFG A;  2DYR H;  2OBP A;  1T2K A;  1RZR A;  3FK6 A;  1KU9 A;  1IN7 A;  5E8I A;  3OYK A;  1QO0 D;  3DU5 A;  1IAW A;  1OCR H;  1QZE A;  4WXD A;  3CP8 A;  3PL8 A;  3V8L A;  2E35 A;  4HSR A;  4EM0 B;  4BYY A;  2E60 A;  1USS A;  1LE8 A;  2Y30 A;  4XL9 A;  1R9T J;  1X3Z B;  2PXL A;  2AS5 F;  4AVP A;  3V8J A;  2A07 F;  1IDZ A;  5HDN A;  3CUQ C;  1WI3 A;  4KFC A;  1FBQ A;  1Z3Y A;  2ICW G;  4LJZ F;  5ICF A;  4LD5 A;  2XF7 A;  5HVQ C;  4ZDO A;  4MEX F;  5K7H A;  1IV6 A;  1FC3 A;  4BXX J;  1R00 A;  4YIR X;  1YS7 A;  1XMX A;  4IVZ A;  1B59 A;  2VQL A;  3G5G A;  1YOV B;  3SFZ A;  5H2F C;  4YRV A;  4R8H A;  3G1M A;  3CUQ B;  5F1J A;  1I1G A;  3MVP A;  4M6Y A;  2KRC A;  5A2Q Z;  4G6D A;  3RKX A;  3S16 J;  2BY2 A;  2HU9 A;  3I4N J;  3HL2 A;  3ERM A;  3MAJ A;  1I6X A;  4B8X A;  4JX5 A;  4U87 A;  1BW5 A;  1I27 A;  3SXY A;  4KNY A;  4XLP F;  1YX3 A;  5FJ8 J;  4H0E A;  1UST A;  4QWQ A;  2OUM A;  1T38 A;  1QZY A;  2V9V A;  1LNW A;  3PUF A;  3SZT A;  2JA5 J;  1Z21 A;  2IRF G;  1HF0 A;  2KZV A;  2E36 A;  1IRG A;  2HPI A;  2XAJ A;  2K3F A;  3SJM A;  4OAY A;  3RYR A;  5L3E A;  4Q5S F;  5ERI A;  1X3W B;  3FXO A;  2Y31 A;  3KP3 A;  3HB9 A;  5F64 A;  2BNN A;  3ZCO A;  4BXF A;  2XRL A;  2OFY A;  2QSH X;  1MMA A;  1RR7 A;  4M6X A;  4IQJ A;  1U2Z A;  3DTI A;  2PX9 A;  2K27 A;  3LSI A;  3VWS A;  2PXB A;  4N4O B;  2PLY A;  1TQI A;  3L9F A;  1T0F C;  4HEA 2;  3DPU A;  1HQ1 A;  3L1P A;  1XMA A;  2VPR A;  5F6F A;  5JVG F;  2PUC A;  2YX7 A;  5L3D A;  2COM A;  2OJE D;  4MTE A;  4LLN A;  4QPO A;  2F4O B;  2RRE A;  3SDG A;  3CDI A;  1U5T A;  4PFO A;  5KNL A;  3JSP A;  2M34 A;  2KLO A;  3S8P A;  4A3B J;  3T0Y A;  1SVO A;  5M3F J;  3S3N A;  2RAE A;  3MKW B;  3QP6 A;  2L8N A;  1JGS A;  4HYE A;  4JCY A;  4P1W A;  2IW5 A;  2WB1 A;  3QYX A;  1GHC A;  4PJN A;  2P4W A;  2HVR A;  4LG0 A;  5A2Q K;  4P9U A;  1XCB A;  2KMU A;  5B66 C;  5HLH A;  1JWL A;  1U5T B;  3GXO A;  1FZP B;  1V5E A;  5EYR A;  3JAM K;  5DTM A;  3BPX A;  1FX7 A;  3F22 A;  3MKY B;  2EA4 A;  2XRN A;  4ESJ A;  1EH7 A;  5D8K B;  3NWS A;  2I10 A;  3BTI A;  1ZTR A;  2QVO A;  3GTQ J;  3D5R C;  3FDY A;  1FTT A;  1T33 A;  1ETX A;  4IXA A;  3MLF A;  4XR6 A;  3OYH A;  3RKY A;  2XAU A;  1MBK A;  3E97 A;  2LNM A;  2ELH A;  4D7M A;  4UV9 A;  2ELJ A;  3EYY A;  2V4J C;  3KCC A;  4I99 C;  3ZXS A;  2EFN A;  3S15 J;  2CW0 F;  1FMW A;  2PQ8 A;  3JR9 A;  4OIQ F;  2AXT C;  3DTK A;  4N0B A;  5AON A;  1MJB A;  3I9V 2;  1O3S A;  5BPD A;  1NK3 P;  4U88 A;  4P55 A;  1U9N A;  2XPV A;  2A61 A;  4GCV A;  1LDJ A;  1Z91 A;  2A6T A;  2DOD A;  3B73 A;  3MQ0 A;  4G9Y A;  1BM9 A;  4LMY A;  1PDN C;  1WJF A;  4Z59 A;  5IT9 Z;  2VBY A;  3L2C A;  3J80 Z;  3BT9 A;  1BOA A;  3R09 A;  1JHF A;  5K7Z A;  1C0W A;  4MCX A;  2Q8K A;  4GHJ A;  4E6K G;  3IKT A;  1G59 A;  3ROU A;  3S14 J;  2EWN A;  1K6O A;  2ID6 A;  3KX2 A;  2AWI A;  2DI3 A;  3DF8 A;  2Z16 A;  2X1D A;  1D8K A;  3OYA A;  1LVA A;  1SD4 A;  3TBI A;  3HIF A;  4II2 A;  4ASN A;  2P6S A;  1W36 D;  3QFI A;  2LBF A;  3CCM I;  1IRF A;  1AKH A;  3P9C A;  2DA7 A;  2OPT A;  3HHG A;  2QKL B;  2QM3 A;  5J3L A;  3TO7 A;  3QU6 A;  4A69 C;  1YJ9 I;  3PNY A;  1D3Y A;  4PDK A;  2Y75 A;  2HZD A;  5LGN A;  3RSN A;  4WCG A;  2DPU A;  3RI4 A;  1ZH5 A;  4IZZ A;  4ENM A;  4E7Z A;  2KRF A;  2EV0 A;  2LG4 A;  1W7P D;  3J7A Y;  4LK0 F;  3K4J A;  2HR3 A;  2ZJP F;  3MZ8 A;  1SFU A;  1A36 A;  1WZ2 A;  4UUS A;  2A69 F;  3RPU D;  2CQX A;  4MHG A;  4YII A;  2EK5 A;  2QLZ A;  1EJ9 A;  2P6T A;  1J09 A;  3CF2 A;  2ZXI A;  3PQJ A;  4BGD A;  1SAN A;  5FB2 A;  1KON A;  1EA3 A;  1ZZ9 A;  3BG3 A;  4HV5 A;  4IHW A;  2M45 A;  3M7G A;  2EJR A;  4X1E A;  4RMN A;  3CLQ A;  2DFH A;  3BZK A;  5C3E J;  2CSF A;  3PSI A;  4OU0 A;  4G12 A;  1OYY A;  2HCS A;  1XB4 A;  5LD2 C;  1JKP C;  3H3V K;  3FXK A;  3WGI A;  2NS0 A;  1JUM A;  3CME I;  1O3R A;  2W82 A;  1MJA A;  2MLK A;  1JFT A;  1Y6I A;  4XOP A;  2FBK A;  3OWT A;  2JA2 A;  5LRR A;  5L3F A;  1D1B A;  2JPC A;  2V3C C;  3LAP A;  4DNC A;  1NK2 P;  5K5Q A;  2KIS A;  3KXA A;  3GTK J;  1FSH A;  4CCN A;  2IGO A;  4AYB A;  2P5K A;  3GZN B;  2PXP A;  2F5D A;  4ZJZ A;  2RN7 A;  2YBD A;  2DFI A;  4RGU A;  2XGX A;  4CHU A;  4E7L A;  2CQ7 A;  3QWL A;  5KAF C;  2CWE A;  3HC7 A;  2QEN A;  2WAF A;  3DV8 A;  1PRA A;  5ICC A;  5HS8 A;  1J75 A;  1OFC X;  3CUO A;  1UG2 A;  3F6V A;  4Q2J A;  4HF0 A;  1IW7 F;  1UAA A;  2IXS A;  4AIK A;  3CCY A;  2FBH A;  2O0Y A;  2L2O A;  4XLE A;  2NRA C;  4KIG A;  4XON A;  1FP1 D;  1ULY A;  1Z6R A;  3HSF A;  3VPR A;  1MMS A;  2LSO A;  2DTR A;  2TCT A;  2KZG A;  2WAQ N;  3G0T A;  3ZQG A;  4CYC A;  2L9S A;  2M7B A;  3B6A A;  2Z1D A;  3OYF A;  3OYN A;  2F4I A;  1OKR A;  2IVG A;  2PUG A;  3TEL A;  2EIN H;  4F3Q A;  4I09 A;  2LYP A;  5EGO B;  2WUS R;  3GVA A;  5FGM A;  1BIA A;  1YTY A;  1AU7 A;  2IBD A;  1H88 C;  4BY1 J;  1YS6 A;  3M8J A;  2H8R A;  2ZBK A;  1XGM A;  2M4K A;  4HQM A;  1K6Y A;  2R7R A;  3VK0 A;  3SR4 A;  1FIA A;  1S9H A;  1IF1 A;  1R4M B;  2VE8 A;  2ME6 A;  2NVX J;  2KPJ A;  2R7W A;  2WV0 A;  3ZQ7 A;  2V1D A;  1ZUG A;  2L02 A;  3GTJ J;  3COA C;  1UMQ A;  3MN2 A;  3GZ5 A;  4DGW B;  1VQM I;  2JSP A;  5CPR B;  3JTH A;  5DUK A;  5E1W A;  1IG7 A;  3FBI B;  4IRI A;  1FEX A;  5DSX A;  1ZRE A;  3S1Q J;  1I6H J;  4IL6 C;  1S3J A;  2JK3 A;  4JCX A;  4LLL A;  3KEO A;  3ZQF A;  1IV8 A;  3M07 A;  2HQN A;  5LLQ A;  3WU2 C;  1KQ8 A;  1ZRD A;  3OR2 C;  2UXX A;  3CMA I;  1WJD A;  1QQB A;  4M9X A;  2JJ7 A;  4PU7 A;  3CF5 F;  3ZKC A;  2RV8 A;  3HZJ A;  1POU A;  4UB6 C;  2O5R A;  3JXB C;  3H1C A;  2MG4 A;  4I0A A;  3NEU A;  2X6O A;  1G3W A;  1R6R A;  2MH2 A;  3ZPL A;  1WRJ A;  3AG4 H;  1OCT C;  3BR0 A;  2Y9Z A;  5FKM A;  4HA8 A;  3J81 Z;  1S72 I;  1BR1 A;  4IOA F;  2O3F A;  4G7O F;  1EFA A;  1JE8 A;  3BG5 A;  5EG0 B;  1IN4 A;  4FE4 A;  4U7D A;  4A3K J;  2P8T A;  3IRQ A;  4DZP A;  2DFF A;  2BXY A;  1OCC H;  1XCV A;  3JRC A;  3WE2 A;  3NDB B;  1MW7 A;  3DLL F;  2HFH A;  2EBY A;  1NG6 A;  4CGZ A;  1YO5 C;  2NXN B;  2ZJ2 A;  3VSK A;  5JUW A;  1BJZ A;  5H20 A;  1D0Z A;  2YU3 A;  3FMY A;  3E6D A;  2KKO A;  3BY6 A;  1W5S A;  2QQ8 A;  4DZJ A;  5E1Z B;  3WOD F;  1KGS A;  3WTS C;  4ZYE A;  3ABT A;  2L0K A;  2NS7 A;  1N25 A;  2MA3 A;  4K2E A;  4B43 A;  3PJR A;  3FHN A;  4KMF A;  2JMW A;  2R7U A;  2IEK A;  4LG0 B;  1FOY A;  1F43 A;  2XSD C;  2K9N A;  4A6E A;  4B47 A;  4M3G A;  3W6V A;  4A0Z A;  5DYM A;  1PNR A;  2R7F A;  5D6F A;  5TGT A;  4AID A;  2R4G A;  1QP4 A;  1HW1 A;  5B1B H;  5LHG A;  1MD0 A;  1X1C A;  1ZGJ A;  4C9Y A;  2DA5 A;  3GEZ A;  2AXV A;  1LLI A;  3E6M A;  4KMU X;  2F2E A;  1FIP A;  2BHZ A;  3LA3 A;  3IC7 A;  2B63 J;  4KIC A;  3AL0 B;  2E7X A;  2GM4 A;  5GAE J;  4BQA A;  5LEK A;  4L9J A;  2IJL A;  2KP6 A;  2JTV A;  1KZH A;  2WV1 A;  3BJO A;  4Y3O A;  4G6T B;  4BE1 A;  3DEE A;  5ILS A;  2WAQ A;  1RZR D;  4PU4 C;  3R4K A;  2YUS A;  4XOT A;  1Z0X A;  1W1W E;  2DCE A;  4JX4 A;  3KZZ A;  5LHH A;  4AC0 A;  2E2J J;  2CUZ A;  3TDU C;  3BZ6 A;  2JT1 A;  5IT3 A;  1R4N B;  1V5F A;  1B8I A;  2UV1 A;  3SCH A;  2MAB A;  3WG7 H;  4X4B A;  5FLV A;  3CLO A;  1MMG A;  4BU2 A;  2V9P A;  2KPM A;  1VND A;  3S17 J;  4YG1 A;  4X4G A;  2H6B A;  2K5C A;  1CGP A;  3F6O A;  1UHW A;  3ULQ B;  5C44 J;  2MEZ A;  4HLX A;  4BJ6 C;  4BHC A;  1JJ8 C;  5FKN A;  3VYR B;  2JUC A;  2XB5 A;  2ZKZ A;  3GTM J;  5K1Y A;  2VI6 A;  1E3H A;  5FRO A;  3E1S A;  4XQF A;  4F93 B;  3KYD B;  4FCY A;  3O8H A;  2QQB A;  3P7N A;  3GFI A;  3JSO A;  3CZ6 A;  3KL4 A;  1UXD A;  3S2D J;  1DW9 A;  4M3D A;  3W3C A;  1RC9 A;  4UXN A;  3ERE D;  4A3E J;  1X1P A;  1T08 B;  2PMU A;  4XKB A;  1VF9 A;  1KYZ A;  3QWG A;  3A03 A;  3RDI A;  4BJT A;  4XNF A;  1HKQ A;  4ESF A;  2LBF B;  2HI3 A;  4JBA A;  1X2L A;  1D0X A;  1B1B A;  2RNJ A;  4G6Q A;  2FA5 A;  2KIU A;  2WBM A;  4XKW A;  1YX5 A;  4BY7 J;  5LGT A;  1JT6 A;  3L09 A;  3QF3 A;  3I3L A;  2BBY A;  2FFH A;  2OU2 A;  4N4N B;  4XLC A;  5H6Q A;  3Q0V A;  1S29 A;  3O3K A;  3U9G A;  3K7A J;  4G7Z F;  2COB A;  3DXJ F;  5BS6 A;  3F8B A;  4ER3 A;  2EIL H;  4LIT A;  4LB6 B;  3CC7 I;  2DMQ A;  4U7B A;  3LAJ A;  1B4A A;  4NC6 A;  3N97 A;  1YW8 A;  4XKC A;  1R5I D;  1XG1 A;  4G94 A;  2JZY A;  4AIH A;  1MNE A;  1JKQ C;  2JRM A;  4IOC F;  3TO9 A;  3H5A A;  1HOM A;  4LIU A;  3JRG A;  4XLN F;  2DBB A;  3ZQL A;  2VOO A;  2E34 A;  2KEJ A;  3HPG A;  4N9H A;  2TDX A;  4FHT A;  2VJ4 A;  4D5C A;  2KZ8 A;  3AL0 C;  2DDA A;  1LPQ A;  2VUM J;  2VJJ A;  3HSR A;  1LDK B;  1FYL A;  3WTZ A;  2BJC A;  2IU7 A;  1WWX A;  3QPH A;  4X4F A;  1MBG A;  3E6C C;  4DIQ A;  1X1D A;  1JI8 A;  1Z77 A;  2ECC A;  6PAX A;  2P5V A;  2PJP A;  1SFO J;  2O61 A;  1Y8Q B;  2VLA A;  4L9V A;  4EJU A;  3PNT A;  1EH6 A;  3GX4 X;  2OQR A;  2DU9 A;  5EEA A;  3IH3 A;  4IVN A;  4LB5 A;  3HRS A;  4FN3 A;  2L01 A;  2BVM A;  1VQ8 I;  4ABZ A;  3KP6 A;  2LC2 A;  3S93 A;  2J7U A;  3VB2 A;  3K4K A;  2QKM B;  2AQE A;  1BN5 A;  4OBM A;  5CJ9 A;  2VEO A;  2PUA A;  3VOD A;  3GZC A;  1UG0 A;  3ECH A;  1R5G A;  3K69 A;  3LFU A;  1J9I A;  4C30 A;  2X4H A;  2D5V A;  1XDU A;  3KZ3 A;  2VBX A;  1X3U A;  1LB2 A;  1KYW A;  2IA2 A;  4JP0 A;  4PJJ A;  4IHS A;  1ETK A;  2IS2 A;  2H1L A;  2DOA A;  4J01 A;  5EJC A;  4YBA A;  4UVB A;  2DXI A;  2F5V A;  4A3I J;  1R49 A;  1ZVV A;  3TMO A;  3BJ6 A;  1XDS A;  1YRN B;  1ZHF A;  4OIP F;  3J81 K;  2BV6 A;  1XWR A;  4PZJ A;  4HLY A;  1Y7Y A;  3F6W A;  4XBF A;  4C2M J;  4KUM A;  3CMM A;  4U0Y A;  2RQP A;  3CES A;  2LLK A;  4DYQ A;  4NB5 A;  4CIC A;  3PQK A;  1WH5 A;  3R0J A;  3HDD A;  3FXR A;  2WB1 N;  5DS9 A;  3M4O J;  4GYG A;  3K4B A;  4I6Z A;  2K86 A;  1ENH A;  3Q9S A;  3OYB A;  2R7D A;  1D1C A;  2Y0M A;  3SCG A;  4ZYH A;  3ZRG A;  3F8C A;  4XSX F;  2R3S A;  1XD7 A;  1OYI A;  3VEP A;  1O7F A;  4N9I A;  2L49 A;  1SFE A;  2XF5 A;  4UV8 A;  1QQI A;  4Z5D A;  3DPL C;  3ASO H;  1ON1 A;  5CVV A;  2N8G A;  3TOA A;  1IRX A;  1MNM C;  3L7W A;  4WK8 F;  4HF2 A;  3SX0 A;  1U2W A;  2GZW A;  4ENJ A;  3FMQ A;  1TTY A;  3A2K A;  2ZFW A;  1HST A;  3DBR B;  4KN4 X;  4S05 A;  3TED A;  5E3N A;  4JQF A;  2CV2 A;  4LK1 F;  1A6I A;  2E19 A;  3ZGK A;  4BKX A;  1RUO A;  5BOX A;  2EZL A;  3IHU A;  3TEP A;  3KYC B;  1KQ9 A;  2E1M C;  3K4N A;  4BHB A;  4UUV A;  4OMY A;  1QP7 A;  2MYS A;  3AFH A;  1QU3 A;  5DM6 F;  3MZH A;  2K7L A;  4Z5C A;  1ZR4 A;  1TQP A;  3V7R A;  3T1B A;  5FKO A;  2ISY A;  1FMV A;  3OOU A;  1Z9C A;  1AHD P;  3O6B B;  4L9T A;  1ZKG A;  5LEJ A;  3G73 A;  3NAU A;  3AAF A;  5FLX Z;  1MSE C;  2XAQ A;  2Y9Y A;  4A3J J;  5F0C A;  4B4C A;  3IAM 2;  2OD5 A;  3BR6 A;  3H35 A;  3UFD A;  2QBY B;  3OQM A;  3B7H A;  3D0S A;  4BNC A;  4O6J A;  5B1A H;  3HUG B;  1YQA A;  2XSJ C;  4B44 A;  1H9T A;  3CJQ B;  1A31 A;  2IP2 A;  3K2A A;  1E3P A;  1BI0 A;  3GTO J;  1JGG A;  1QNT A;  4MQ9 F;  4I8T A;  3NAR A;  2LP0 A;  3FXQ A;  1P7I A;  3F51 A;  1NEQ A;  3C2H A;  1ZAO A;  3WTV C;  4Z6Y A;  5CQG A;  5M5X J;  1ZZC A;  3TRB A;  1H0M A;  3GW2 A;  2DA1 A;  2F5F A;  2OTL I;  3HEF A;  4QLC U;  1U3E M;  4HX8 A;  2O8X A;  5FO5 A;  1T95 A;  3S3M A;  4CH7 A;  3FIS A;  4GGG A;  1T39 A;  4NHJ A;  5K7F A;  1PUF B;  4CCL A;  3EPZ A;  3CD6 I;  3AG2 H;  3PM1 A;  4CYC B;  2PE5 A;  2EZI A;  1KU3 A;  3OIQ A;  1NTC A;  2FJ1 A;  3E6B A;  4RAG A;  3ABU A;  2HYJ A;  1BBY A;  3DP7 A;  3LA7 A;  3NRO A;  2DT7 B;  4BXU A;  1X2M A;  1GDT A;  1LQ1 A;  1SAX A;  4D0P A;  3N4M A;  3L00 A;  1Y0N A;  2HQ5 A;  1ZG5 A;  4YFN F;  5FLX K;  4HX4 A;  5F04 A;  1E3O C;  5CQE A;  1WFX A;  2KHM A;  3KEY A;  5AIQ A;  3LNQ A;  4LIV A;  3RCO A;  4NDL A;  3CJN A;  5HNH A;  2VBZ A;  4PSX A;  2GAU A;  4I76 A;  4E7H A;  1TC3 C;  1V54 H;  4MTD A;  1R69 A;  1NHA A;  3QQ6 A;  3PUB A;  2W00 A;  1M1E B;  3K2Z A;  1DDN A;  1XSV A;  2ZO4 A;  1ZQ3 P;  3MEJ A;  4UHT A;  1RZ4 A;  4BBS J;  3DEU A;  1SQ8 A;  3HRT A;  3VOE A;  1B72 B;  2KIF A;  3FK7 A;  5H6R A;  2M1B A;  4RAF A;  1JUP A;  3D5L A;  2I5U A;  3FXM A;  5E8G A;  1VQP I;  1O4X A;  2AXZ A;  5ILU A;  3OKZ A;  1I5Z A;  1Z6T A;  1X4P A;  3ZN1 A;  4C3I J;  1I50 J;  3GWZ A;  3D1N I;  1O3Q A;  4UNO A;  3HBL A;  2KIQ A;  2PFB A;  3B6C A;  4HW0 A;  4ENK A;  1JTY A;  1P7J A;  3IL2 A;  4HRI A;  3HOU J;  5K5O A;  2QSG X;  3REO A;  2XAH A;  2M4H A;  2L7Z A;  1ZEL A;  5J4Y A;  2VXD A;  3UKG A;  1YFH A;  3FKJ A;  2PMZ A;  2XB0 X;  3LIS A;  5J6X A;  2ZC2 A;  3C18 A;  4KIF A;  4XRS A;  3L2U A;  5TIS C;  1FOK A;  3RZZ A;  3F0C A;  3BG9 A;  2NAZ A;  3O9X A;  1SFX A;  1QB2 A;  5CKT A;  2Z33 A;  1BR4 A;  5E3O A;  4A3D J;  1X4O A;  3CCS I;  1PRU A;  3KET A;  3IRR A;  2HPM A;  1RUN A;  4Q47 A;  4CUG A;  2ACJ A;  2LMD A;  2OA4 A;  4KT6 A;  2UZK A;  2CUE A;  2MGQ A;  4I0B A;  3V7S A;  2VE9 A;  3HOV J;  2XCJ A;  2XXA A;  5DTR A;  1PP8 F;  1HKS A;  2GXG A;  3BG7 A;  1L0O C;  5DUI A;  3JTG A;  2F4M B;  2M30 A;  1MBH A;  3GBG A;  1S7O A;  2ICP A;  4ER6 A;  5EGO A;  1UFM A;  2LK2 A;  3BZC A;  3I56 I;  1K4T A;  4B48 A;  1WQ2 A;  3BOQ A;  2GWR A;  4KJZ A;  2IAI A;  2DTZ A;  2HGC A;  4A3C J;  2D1V A;  4Y4R A;  2PMH A;  4A3F J;  4HQE A;  2EF8 A;  2XIG A;  4IJA A;  1HQC A;  1LJ9 A;  5FFX A;  2WWY A;  2JA6 J;  1U8B A;  2VKH A;  4W1U A;  4A3G J;  1EV7 A;  2DQL A;  4MFD A;  5M3M J;  2E7W A;  4LGW A;  2QZ8 A;  3UR3 C;  5J40 A;  2M0C A;  5HDG A;  2FUG 2;  1Z7U A;  2GA2 A;  4V2G A;  2L3D A;  3GFL A;  2Q0O A;  1R5H A;  5B5E C;  3H0D A;  2IS4 A;  1ZAY A;  2XXQ A;  1BI2 A;  2W7N A;  2L54 A;  3HKZ A;  4M3F A;  3T8R A;  5J47 A;  3I71 A;  2V9K A;  4PJM A;  4J19 A;  3FZV A;  4X4D A;  3BCB A;  3K0L A;  3I59 A;  3R1F A;  2VAS A;  3HOX J;  3WTY C;  3DBH B;  2BNO A;  2HDC A;  1ETY A;  1G3T A;  3EQL F;  4BEH B;  2FOK A;  5L3G A;  2OZ6 A;  5TJJ A;  4EKI A;  4S0H B;  4B09 A;  4A0X A;  2O03 A;  5GAH i;  2F6C A;  2L9V A;  1Z1D A;  2ISZ A;  4X4E A;  4G8X A;  3ZN0 A;  2OR1 L;  5IP7 J;  1DP3 A;  4Y13 A;  5KCM A;  1A6Q A;  4Y33 A;  3HGY A;  4V2F A;  5DTQ A;  2HVS A;  2XKO A;  3G2B A;  1ETO A;  1VQ7 I;  5HLI A;  4HRA A;  2ICT A;  2CV0 A;  2CFO A;  3W2A A;  2HNH A;  4EMS A;  4EGZ A;  1YE9 A;  4OIR F;  3CO7 C;  3QOD A;  4M9Z A;  2GQQ A;  3DCF A;  1RPE L;  4CO8 A;  2JVG A;  4II3 A;  3PFY A;  1VQK I;  5LGU A;  1U8R A;  3VYU B;  1LQC A;  5DCM A;  4IO9 F;  2EV6 A;  4D1Q A;  2UWM A;  2JA7 J;  2VJ5 A;  4JOM A;  2RC4 A;  1HDP A;  1G6N A;  3HOS A;  2EBI A;  4ENN A;  4YAR A;  2X6Y A;  4BJ5 C;  4HZF A;  1QBJ A;  4AVZ A;  2STW A;  2R0Q C;  2DA3 A;  5J1Y A;  2YU9 J;  4PJL A;  3WTT C;  1VZ0 A;  3OP9 A;  5EEG A;  1IDY A;  4C3H J;  4UUS B;  5DT2 A;  3BTL A;  1BJA A;  2LY2 A;  2IVM A;  2LF8 A;  3H5R A;  4RB1 A;  1QQA A;  1LUJ B;  3LQR A;  3H9G A;  2ZB9 A;  2LOO A;  1G3S A;  2R7Q A;  1E17 A;  2PJR B;  5IYB J;  2F48 A;  5ICG A;  4HAM A;  3Q5F A;  4EZI A;  3LA2 A;  5IP9 J;  3T8T A;  1T56 A;  1STZ A;  5KK1 A;  3BCA A;  2R93 J;  2M3A A;  3H9Q A;  2X51 A;  2XGD A;  3PXP A;  2PXK A;  1W7P B;  5FRN A;  2DJI A;  2BE5 F;  2FQ3 A;  5GPC A;  1LE8 B;  3F8M A;  5M5W J;  3HOW J;  1L3L A;  2G7U A;  3Q3S A;  4MO7 A;  3JAM Z;  2A6E F;  1CF7 A;  4CCK A;  5IOZ A;  4BS9 A;  4XRM A;  3S1N J;  4F55 A;  5CVI A;  2PXV A;  5LBQ A;  5E1X A;  4Z58 A;  2FD5 A;  3R6S A;  4A3M J;  2R7O A;  2PG4 A;  3FF5 A;  2O6G E;  1YW7 A;  3S8Q A;  2ZXH A;  1W7P A;  4QTR A;  4HNT A;  4TV7 A;  5GAG i;  2YSR A;  5M5Y J;  3L2V A;  2LY1 A;  4R79 A;  1LKX A;  2HS5 A;  3BPV A;  4MQV A;  1CQT A;  2HQA A;  1P2F A;  4NQW B;  4UVC A;  1OR7 C;  1IJW C;  2HSG A;  3DPT A;  2AXU A;  2LKS A;  2BVL A;  4YEJ A;  1SVM A;  3A02 A;  3I55 I;  4L0Z B;  2CJJ A;  2BYV E;  3LSK A;  4A2U A;  1P6R A;  3E3V A;  4ER7 A;  3A0H C;  2LH9 A;  3G1O A;  2L5Q A;  2FMY A;  3U2R A;  5F08 A;  4C2U A;  2KJB A;  3SZP A;  3OYL A;  4D9J A;  1NG7 A;  1S6L A;  3BC8 A;  1IN6 A;  3IP4 B;  3LWF A;  1HSJ A;  5JFR A;  4GQM A;  4CCM A;  3RIR A;  1BC8 C;  3R0A A;  2BGC A;  2XIU A;  2GXA A;  2EIK H;  4BQQ A;  5J8F A;  3M8F A;  3CC4 I;  1E0E A;  1Z67 A;  3X2Q H;  1MH4 A;  3DKW A;  1YIJ I;  1JKR C;  2R7Z J;  2KDO A;  2D45 A;  3GFJ A;  4M9S A;  3PFI A;  2YPR A;  1J0R A;  1QZZ A;  2AO9 A;  1FSE A;  2V6E A;  2IS1 A;  2MLG A;  4V19 K;  2CW7 A;  1SD5 A;  4I01 A;  2M7A A;  1FP2 A;  3IAS 2;  1ZK8 A;  4EKG A;  2BOL A;  3LST A;  2QBY A;  4O3M A;  3FYM A;  3FIW A;  3ABK H;  1B6A A;  4MEY F;  1GT0 C;  1MJ9 A;  1YLF A;  4EJW A; 
#chains in the Genus database with same CATH homology
 3I4N J;  2BJC A;  2IU7 A;  3H5T A;  3GTL J;  4JX5 A;  1BW5 A;  1MBG A;  4X4F A;  4JYK A;  5FJ8 J;  1Z77 A;  2ECC A;  3E7L A;  2PUB A;  1WGX A;  1SFO J;  2IVB A;  3FKI J;  3BDN A;  2HOT A;  2JA5 J;  2LYL A;  4JQD A;  3BR3 A;  4J1X A;  5EEA A;  1HF0 A;  3MKL A;  3IH3 A;  3SFI A;  5EDN A;  4FN3 A;  3DEW A;  3LFP A;  1BL0 A;  4ABZ A;  3SJM A;  1EF4 A;  3OIO A;  2Y31 A;  2ECB A;  3HB9 A;  2BNN A;  5JLW A;  2PUA A;  2XRL A;  2JA8 J;  2OFY A;  1WCM J;  1RR7 A;  1VI0 A;  3HKZ N;  5J1R A;  5K98 B;  2D5V A;  4M3E A;  3BD1 A;  3KZ3 A;  3GTP J;  4JP0 A;  4JX6 A;  3L1P A;  2PUC A;  2NOG A;  2VPR A;  1ETK A;  2LVS A;  4QSH A;  4IWR A;  2P81 A;  4YBA A;  1U78 A;  1DU6 A;  1YSE A;  1ETW A;  4A3I J;  3SDG A;  1CJG A;  1ZVV A;  2R5Y B;  1K61 A;  1ADR A;  3U3W A;  1DU0 A;  1YRN B;  1U9O A;  2M34 A;  4EEF G;  1D5Y A;  3I4M J;  1XWR A;  3BQY A;  2CUF A;  4A3B J;  2E2H J;  1Y7Y A;  5M3F J;  3F6W A;  1Q1V A;  4C2M J;  2RAE A;  4IEJ A;  2L8N A;  2PIJ A;  2OF7 A;  2ELK A;  4IHY A;  2LLK A;  4JCY A;  4DYQ A;  3QYX A;  1H8A C;  2R1J L;  1WH5 A;  1TWA J;  3HDD A;  3FYA A;  5DS9 A;  2WB1 N;  3M4O J;  1JWL A;  1BDI A;  4FE7 A;  4I6Z A;  1XC5 A;  2M2E A;  1ENH A;  3S1M J;  1BA5 A;  3IVP A;  1QP0 A;  5EYR A;  3IV5 A;  4XK4 A;  5IYC J;  3SCG A;  2VKV A;  3LSJ A;  2I10 A;  3BTI A;  1ZTR A;  2HOS A;  4X6A J;  3GTQ J;  4B3A A;  2JN6 A;  4DYR A;  2O38 A;  2L49 A;  1FTT A;  2E1O A;  2XGC A;  1T33 A;  2R63 A;  4Z5D A;  1ETX A;  1K83 J;  1VFC A;  4IHX A;  2N8G A;  3MLF A;  3BTC A;  2R5Z B;  2JWT A;  1MNM C;  1MBK A;  3OQO A;  4Z5H A;  4MFE A;  4D7M A;  1IGN A;  1BDH A;  3S15 J;  3TED A;  2GZU A;  5E3N A;  3JR9 A;  4X4I A;  1R63 A;  3HZI B;  2LY9 A;  3H0G J;  1NK3 P;  2LYQ A;  1A6I A;  2E19 A;  4BKX A;  1GV2 A;  3HM5 A;  2EZL A;  4MIM A;  1U9N A;  2XPV A;  4Z59 A;  1RKW A;  3TW7 A;  1QP7 A;  3ZHI A;  2K9S A;  3BQZ A;  3TP0 A;  3RZD J;  4Z5C A;  2GBY A;  3BT9 A;  1ZR4 A;  5K7Z A;  5FKO A;  3LSP A;  1JTX A;  4MCX A;  4PU3 C;  4JCX A;  4GHJ A;  1ITY A;  3OOU A;  1AHD P;  4J1W A;  3S14 J;  4X4H A;  2ID6 A;  1ZKG A;  1WPK A;  3NAU A;  2AWI A;  2MW8 A;  2Y2Z A;  1MSE C;  2MQK A;  4O8B A;  2Y9Y A;  4A3J J;  2NVQ J;  5F0C A;  4B4C A;  3GTG J;  3BR6 A;  3UFD A;  3OQM A;  2LYR A;  2LTP A;  2PUD A;  3HOY J;  3B7H A;  3OQN A;  1AKH A;  1XS9 A;  2DA7 A;  2OPT A;  5J3L A;  2LR8 A;  4RDU A;  2Y0S N;  3CRO L;  4A69 C;  4I6U A;  2DMP A;  1LFB A;  4I6T A;  1ZZ8 A;  3K2A A;  2YS9 A;  1TWG J;  2TRT A;  1GUU A;  1ZS4 A;  3GTO J;  1JGG A;  1X57 A;  4I8T A;  3NAR A;  3EUS A;  1B0N A;  2LP0 A;  2BNM A;  1TWH J;  1P7I A;  1F36 A;  1OCP A;  3O8G A;  1NEQ A;  3F51 A;  1JUS A;  2HXI A;  3CMY A;  4XRS G;  2KEI A;  5M5X J;  1WET A;  1RPW A;  1L1M A;  4UUS A;  1ZZC A;  3TRB A;  2DA1 A;  2DMU A;  2CQX A;  2XPW A;  1OSL A;  1PRV A;  3HEF A;  4I6R A;  4QIW N;  3ZQC A;  2VUM J;  3PO3 J;  2O7O A;  3FIS A;  5K7F A;  1SAN A;  1PUF B;  2LD5 A;  3GN5 A;  1I3Q J;  3PM1 A;  4CYC B;  2PE5 A;  2EZI A;  1ZZ9 A;  3BG3 A;  1NTC A;  4IHW A;  2HOA A;  5E3M A;  4RBO A;  2FJ1 A;  4HNV A;  2CRG A;  4X1E A;  2GRL A;  2WIU B;  2HYJ A;  4C3J J;  5C3E J;  2CSF A;  5F0F A;  1X2M A;  1GDT A;  4G12 A;  1UHS A;  1HLV A;  3CDL A;  1JKP C;  1IUF A;  2ME0 A;  3H3V K;  2HQ5 A;  1RZS A;  3GN5 B;  1RIO A;  1JUM A;  1YRN A;  5C4J J;  3JRI A;  1JFT A;  2O4A A;  5F04 A;  1E3O C;  2X48 A;  2DA4 A;  1NK2 P;  3LNQ A;  4NDL A;  3KXA A;  3GTK J;  3ZQH A;  2LKX A;  4I76 A;  1TC3 C;  2KEK A;  2NS8 A;  1R69 A;  3QQ6 A;  1JFS A;  1LCD A;  3BR2 A;  5A7L A;  1ZQ3 P;  2O8K A;  3RKQ A;  1AKH B;  1SQ8 A;  1B72 B;  2HIN A;  3TW6 A;  3BR1 A;  5FKL A;  3FK7 A;  3OSG A;  2PUF A;  4UUT A;  1JUP A;  1PRA A;  2CU7 A;  1QVU A;  3JRH A;  3CQZ J;  1O4X A;  1OFC X;  2AXZ A;  2ID3 A;  1UG2 A;  2QF7 A;  3HOZ J;  3QPL A;  2E2I J;  4C3I J;  1I50 J;  3D1N I;  3HBL A;  2LYK A;  3B6C A;  3HOU J;  4BBS J;  1JTY A;  1P7J A;  4W97 A;  3CCY A;  2L7Z A;  3UKG A;  1GVD A;  3VPR A;  1ZZB A;  2XB0 X;  1UXC A;  3LIS A;  2QCO A;  1X58 A;  1QPI A;  4XRS A;  2W48 A;  4BBR J;  2TCT A;  2KDZ A;  2WAQ N;  3A01 B;  4A93 J;  3ZQG A;  4CYC A;  3RZZ A;  3F0C A;  3BG9 A;  3O9X A;  3B6A A;  2A6C A;  2CRO A;  2IVG A;  2HXO A;  2DJN A;  5E3O A;  4A3D J;  2PUG A;  2G0E A;  1NER A;  3BR5 A;  3LOC A;  1PRU A;  2JVL A;  3RQI A;  2CQQ A;  1JKO C;  2LYP A;  5EGO B;  2CUE A;  2WUS R;  2MGQ A;  2NVY J;  2LYJ A;  1AU7 A;  3GBF A;  2IBD A;  1H88 C;  4BY1 J;  4A3L J;  4IHV A;  2LYS A;  2H8R A;  3HOV J;  2XCJ A;  1LCC A;  3VK0 A;  2AHQ A;  3C2B A;  2EWT A;  1FIA A;  1MBH A;  3GBG A;  1RET A;  1RKT A;  5E3L A;  2IUO A;  2DMN A;  4X4C A;  2ICP A;  2ME6 A;  4D5F A;  1APL C;  2NVT J;  5EGO A;  2LK2 A;  2NVX J;  3RZO J;  1WH8 A;  2KPJ A;  1H89 C;  1VPW A;  2EZH A;  3KJX A;  2IAI A;  2DTZ A;  3G7D A;  4A3C J;  1ZUG A;  3GTJ J;  2O9L A;  1ZZ7 A;  1UMQ A;  2L9R A;  3MN2 A;  4A3F J;  1IG7 A;  2KT0 A;  2EF8 A;  2AW6 A;  1FEX A;  3S1Q J;  1I6H J;  2JA6 J;  1U8B A;  2JK3 A;  4W1U A;  4A3G J;  3ZQF A;  4IA8 A;  3TP3 A;  4MFD A;  5M3M J;  3F52 A;  1QQB A;  2JJ7 A;  4PU7 A;  3DNV B;  3ZKC A;  1ZZ6 A;  2X9D A;  2GLO A;  1POU A;  1A5J A;  2M0C A;  2XGE A;  4FBI A;  4MLO A;  4PU8 A;  3JXB C;  4V2G A;  2MG4 A;  2X6O A;  5DTD A;  1OCT C;  3BR0 A;  4B1R A;  2R92 J;  1ZAY A;  1X2N A;  4M3B A;  2Y9Z A;  5FKM A;  3JRF A;  3IH4 A;  3BS3 A;  2EQR A;  4M3F A;  3OMT A;  1LMB 3;  4Y7N J;  4X4D A;  4J19 A;  4OB4 A;  3ZQI A;  3SCF A;  3R1F A;  3HOX J;  1EFA A;  2BNO A;  1ETY A;  2XPU A;  1ETQ A;  2EZK A;  3BG5 A;  4AYB N;  3LSG A;  5EG0 B;  5C4X J;  4FE4 A;  3LSR A;  2DMT A;  4A3K J;  4S0H B;  5J1U A;  4DZP A;  4DW6 A;  1WH6 A;  3JRA A;  2LFB A;  5F27 A;  3JRC A;  4X4E A;  1TWC J;  2EBY A;  2OR1 L;  5IP7 J;  3CLC A;  3S1R J;  1HDD C;  1B8I B;  1ETV A;  2FQ4 A;  3Q0U A;  4YG4 A;  3HGY A;  4V2F A;  3BTJ A;  2H1K A;  1BJZ A;  1ETO A;  3FMY A;  2ICT A;  4YG7 B;  5IPA A;  1W0T A;  3S2H J;  4DZJ A;  1JH9 A;  1ORK A;  1HCR A;  1POG A;  4DYC A;  3DCF A;  1RPE L;  2L0K A;  3G1L A;  2NS7 A;  2FX0 A;  2DA2 A;  2EH3 A;  2JMW A;  2L7M P;  5IYD J;  2IEK A;  1LQC A;  3HGG A;  3Q0W A;  3WHC A;  3M3Y J;  1F43 A;  1ZGW A;  2XSD C;  2K9N A;  3W6V A;  4M3G A;  2LCV A;  1PNR A;  5JLX A;  5HOD A;  3JRE A;  2JA7 J;  1IRZ A;  1HDP A;  2GRM A;  1QP4 A;  1Y1W J;  2EBI A;  1JJ6 C;  5EG0 A;  4YAR A;  2DA5 A;  2AXV A;  1LLI A;  5BNG A;  5IOY A;  1PUF A;  1UTX A;  1FIP A;  1S7E A;  2L7F P;  2R0Q C;  2B63 J;  2DA3 A;  5J1Y A;  2GM4 A;  2YU9 J;  2PPX A;  5FLM J;  1DWK A;  2WV1 A;  3OP9 A;  3JRD A;  1IDY A;  4C3H J;  4UUS B;  3BTL A;  4D7N A;  1MH3 A;  1Y1V J;  2M8G X;  4XID A;  2AUW A;  1TWF J;  4PU4 C;  1RZR D;  2YUS A;  1QQA A;  1Z0X A;  4JX4 A;  2E2J J;  4AC0 A;  1RES A;  1JT0 A;  1B8I A;  2DN0 A;  2ZB9 A;  3SCH A;  4X4B A;  5FLV A;  1WIZ A;  5IYB J;  4LOC A;  1VND A;  3S17 J;  4Y52 J;  4YG1 A;  4X4G A;  4FIS A;  1MBE A;  5IP9 J;  1T56 A;  3JRB A;  2JCG A;  5C44 J;  2MEZ A;  5FKK A;  1WH7 A;  2R93 J;  2K40 A;  1JJ8 C;  1MBJ A;  5FKN A;  1MBF A;  2XB5 A;  3GTM J;  2O49 A;  2XGD A;  2R5Y A;  3PXP A;  1OJL A;  5F0H A;  2VI6 A;  4FCY A;  5IP6 A;  1ZPQ A;  3O8H A;  5GPC A;  1LE8 B;  3A01 A;  5M5W J;  3HOW J;  5EF6 A;  1PER L;  1UXD A;  4GFB A;  3Q3S A;  4MO7 A;  2K9Q A;  4M3D A;  3S2D J;  1DW9 A;  3CEC A;  1W0U A;  3JXC L;  4A3E J;  5IOZ A;  3S1N J;  4XRM A;  2IV1 A;  3IH2 A;  4L5E A;  4Z58 A;  2PMZ N;  2FD5 A;  4A3M J;  3OSF A;  4XIC A;  2PUE A;  3ZHM A;  1VF9 A;  3ZOB A;  4FTH A;  3A03 A;  2HDD A;  3QWG A;  1LFU P;  3S8Q A;  1QPZ A;  2IVQ A;  4QTR A;  1BW6 A;  4NDW A;  5M5Y J;  3JXD L;  2HI3 A;  9ANT A;  1CQT A;  1X2L A;  2XI8 A;  4Y42 A;  1G2H A;  1IJW C;  2HSG A;  2AXU A;  1QVT A;  3A02 A;  4AUX A;  2CJJ A;  1MSF C;  3FK6 A;  1RZR A;  4BY7 J;  1JT6 A;  1QRY A;  3QF3 A;  3G1O A;  2R5Z A;  5F08 A;  3PO2 J;  3Q0V A;  5EZH A;  1FTZ A;  3QPS A;  5GP9 A;  1LE8 A;  3K7A J;  2Y30 A;  2COB A;  1R9T J;  4F8D A;  4GQM A;  1GV5 A;  2DMQ A;  1IDZ A;  2XJ3 A;  2XIU A;  1WI3 A;  2MSY A;  1FJL A;  2B5A A;  1MH4 A;  1XG1 A;  1JKR C;  2R7Z J;  1JKQ C;  2M9H A;  5K7H A;  1IV6 A;  1B72 A;  1ZR2 A;  4BXX J;  2FJR A;  2AO9 A;  1HOM A;  3QQA A;  3JRG A;  4IVZ A;  3ZQL A;  1ZK8 A;  3G5G A;  4MCT A;  2KEJ A;  3FYM A;  2VKE A;  3FIW A;  4M6V A;  5GPA A;  3G1M A;  5EZG A;  2DA6 A;  4D5C A;  5F1J A;  1GT0 C;  3MVP A;  1IC8 A;  2KZ8 A;  1Y9Q A;  3WHB A;  3S16 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...