2H8RA

Hepatocyte nuclear factor 1b bound to dna: mody5 gene product
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
219
structure length
176
Chain Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator/dna
molecule keywords 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*
publication title Structural basis of disease-causing mutations in hepatocyte nuclear factor 1beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 176
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2h8rA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2h8rA01
1R63A 2EZKA 4S0HB 4CYCB 5FLVA 2L49A 1B72A 2AXUA 1QRYA 3TW7A 2MG4A 3LOCA 1ZR2A 1MNMC 1ETXA 4JQDA 1UHSA 2L0KA 4MO7A 1ZS4A 4JCYA 2CROA 4Z5DA 2NVXJ 3UKGA 1FJLA 3HOUJ 1B8IA 4I6TA 1RZSA 1X2NA 1AHDP 2GLOA 2P81A 2DMNA 4F8DA 4IWRA 2W48A 2XGDA 4IHWA 2JA7J 2GRLA 2CRGA 4Z5HA 5M3FJ 3BR0A 3RZZA 1ZK8A 1ORKA 4G12A 5EEAA 5M5WJ 3IVPA 3BTJA 3B7HA 1ZGWA 3GTOJ 4OB4A 2PUAA 2DJNA 3CDLA 2KPJA 5J1UA 3ZQHA 3G7DA 3D1NI 1MBEA 1RETA 2XPUA 4YG7B 2JA5J 2R7ZJ 4C3IJ 3U3WA 2DA4A 1G2HA 1JUMA 2LR8A 1AU7A 1RR7A 1Z77A 2BNOA 3FISA 2CJJA 2G0EA 3QQAA 1ZTRA 2Y9YA 5FKKA 3TP3A 2PUCA 4UUSA 1MSFC 1QPIA 2AW6A 1B8IB 1JJ8C 1RKTA 5J1YA 1JFTA 3BD1A 2BJCA 5E3NA 1U9NA 1NTCA 2HI3A 3S14J 1H8AC 4IHXA 2K9QA 1GUUA 1JTYA 3GTKJ 2B5AA 1MBGA 2KZ8A 3SFIA 1TWFJ 5EG0B 4M3GA 4YG4A 2NVYJ 2XIUA 3FMYA 1MBJA 4JX4A 2R5YB 1QQBA 2M34A 2XB5A 1PRVA 3O8HA 4D7NA 1UTXA 2M2EA 5IOZA 4A3MJ 1LQCA 2JWTA 1PUFA 1ETWA 1MBKA 1ZUGA 1PRAA 4XK4A 3KZ3A 5C4JJ 1X2MA 2IEKA 4UUSB 5M5YJ 1RESA 2AWIA 3ZQGA 2VPRA 5J3LA 1BW5A 3BQYA 4B1RA 4JX5A 1POGA 2H8RA 4A3DJ 2Y9ZA 2H1KA 4I6ZA 4BXXJ 1JKOC 1JT6A 1QVUA 3DCFA 5C3EJ 3JRFA 3ZQCA 3EUSA 4QTRA 1P7JA 3BDNA 4JX6A 1RPEL 1GT0C 3OQOA 1JJ6C 4O8BA 5EDNA 4V2FA 1FIPA 4XRSA 1UG2A 1W0TA 1A6IA 2PUGA 1ETOA 2DA2A 1D5YA 4GHJA 1T33A 5EF6A 2K40A 3S1MJ 1LFBA 4B4CA 2K9SA 4QIWN 3M3YJ 2CUFA 1S7EA 2R5ZA 2M8GX 3JRHA 3LSGA 2E1OA 3GTMJ 1HDPA 1TWHJ 5A7LA 2PUBA 2LYJA 1ZR4A 1WCMJ 2LYSA 2FX0A 5E3MA 3JR9A 2DMTA 4A69C 4A3FJ 4GQMA 4X4BA 2HXOA 2AXVA 4DZPA 3ZHIA 2EWTA 1EFAA 2FD5A 1O4XA 3KJXA 2E2IJ 3W6VA 1Y1VJ 3MLFA 3HBLA 1TC3C 2IVQA 2HOSA 4I6RA 3HOZJ 3S16J 2LYKA 1ZZ8A 3Q0VA 2BNNA 3MKLA 5E3LA 3HZIB 2VKEA 4QSHA 3BR2A 3HGYA 2LY9A 3SCFA 4A3LJ 3L1PA 1U8BA 4FCYA 3IH3A 4X4CA 2AUWA 1AKHA 2A6CA 1ZZ7A 2O38A 3Q0WA 4A3KJ 1BL0A 4FTHA 1LMB3 5GPAA 2O9LA 1CJGA 1HLVA 2LLKA 1OCTC 1SANA 4Z59A 2MQKA 5FKLA 4V2GA 2NVTJ 5IP6A 2Y0SN 1TWAJ 3GTQJ 4X4HA 1JTXA 3HOVJ 4Y42A 4X4FA 2IAIA 2FQ4A 2LCVA 2XCJA 1OCPA 2DA3A 1SFOJ 1Z0XA 4MIMA 2M0CA 1MH4A 3VK0A 2X9DA 3RZOJ 3RKQA 3SDGA 4M3BA 1GV5A 4X4IA 1ENHA 3F0CA 1ZPQA 1IV6A 5GPCA 2QCOA 5FJ8J 2XPVA 3F52A 5DTDA 4YARA 2R1JL 3JRIA 2PIJA 4ABZA 1IUFA 2NOGA 4UUTA 1ETVA 3QF3A 4BY1J 1CQTA 1X2LA 2DMUA 1OJLA 3LISA 3Q3SA 1LCDA 3PO2J 2HINA 2GRMA 1ETQA 1X58A 1BDHA 1JKQC 2N8GA 3BR5A 3OSFA 3HEFA 5F1JA 2LKXA 3C2BA 1B72B 2XJ3A 3BR3A 4BBRJ 2YU9J 3HB9A 4BY7J 4AYBN 2HOTA 3G1MA 5EZHA 4DYRA 1HOMA 3LFPA 3FIWA 1GDTA 5IYDJ 2DA6A 4RBOA 1YRNA 1H88C 1JKRC 4DYQA 4PU4C 2HYJA 4J1XA 1MSEC 1RIOA 3BG9A 2MSYA 4RDUA 4AUXA 2O49A 3R1FA 3IV5A 2Y2ZA 2LYRA 5F27A 1IRZA 5EGOA 2KT0A 3G5GA 2I10A 1I6HJ 4EEFG 3M4OJ 1IDZA 1IC8A 4W97A 1NEQA 2XGCA 1PNRA 3NAUA 1L1MA 2KDZA 1ZZ9A 2DA1A 1MBHA 4A3JJ 1NK3P 2R63A 1PERL 2DMPA 2FJ1A 5FKNA 1F43A 1BDIA 3S2DJ 1ZZBA 4D7MA 1UXCA 2O4AA 3JRDA 2KEIA 2ME0A 2BNMA 1H89C 2TRTA 2TCTA 3I4MJ 2MEZA 1ZQ3P 3HOWJ 4C3HJ 3O9XA 1DU0A 2WIUB 1Q1VA 3DEWA 2L8NA 1HCRA 3DNVB 5FKOA 2KEKA 5IP7J 2R93J 4XICA 5EGOB 4A3EJ 4M6VA 3BR6A 3NARA 2E2HJ 1QPZA 4MLOA 2DA5A 3HM5A 4FE7A 1WIZA 1IG7A 2LD5A 2R0QC 2L7ZA 1DWKA 3GN5A 4X4EA 4D5CA 3JRBA 1VFCA 1PUFB 1ZZCA 2VKVA 2PUFA 3S17J 3ZHMA 3A02A 2EZHA 1HF0A 3JXBC 3CQZJ 4X1EA 1APLC 2JN6A 4A3CJ 1T56A 4XIDA 2EQRA 1MH3A 2WB1N 2XB0X 3A03A 3O8GA 3QPSA 3S2HJ 3GTPJ 3B6CA 3A01A 4J1WA 4PU3C 2IVGA 2AXZA 4MCXA 1ITYA 1DU6A 4FN3A 5JLWA 4J19A 2WUSR 1BA5A 1MBFA 2VI6A 2ID3A 1XS9A 1VI0A 1GV2A 1WH7A 3IH2A 4X4DA 3JXCL 1XWRA 2E19A 1FTZA 2JJ7A 2HOAA 3CCYA 3QPLA 5K7HA 1VNDA 1WH6A 2IU7A 1LFUP 2IBDA 2COBA 2R92J 1VF9A 4IHVA 1QVTA 3K2AA 2R5ZB 5F04A 1SQ8A 1ZZ6A 4GFBA 3HGGA 1E3OC 3A01B 1R69A 1NERA 3OQNA 2JK3A 1GVDA 4A3IJ 1NK2P 1OSLA 3TP0A 1WETA 2IVBA 3BTIA 3GBGA 4M3FA 3H3VK 1POUA 2FJRA 1YSEA 4CYCA 3S1RJ 2LYLA 2EF8A 5C4XJ 4YG1A 3IH4A 4LOCA 2KEJA 1JT0A 4FISA 1WH8A 2XI8A 3HOXJ 2ECBA 3ZQLA 2CUEA 3HKZN 3OSGA 3I4NJ 4PU7A 5FKMA 2Y30A 3GBFA 1FIAA 2L7MP 1ETYA 3WHCA 1TWGJ 3JRAA 2JVLA 2LYPA 3ZQFA 1W0UA 2WAQN 2EBYA 4PU8A 3PM1A 2GM4A 3GTLJ 1AKHB 1JFSA 3CECA 2X6OA 1JH9A 2D5VA 3H5TA 1ADRA 3LSRA 3S1QJ 2AHQA 5K7FA 1P7IA 4D5FA 1U9OA 1IDYA 4C2MJ 3BS3A 2LFBA 4C3JJ 2NS8A 1RPWA 2CQXA 2PE5A 2YS9A 5IYCJ 2HSGA 2WV1A 2DA7A 4M3EA 3LNQA 1ZAYA 3UFDA 4YBAA 3MVPA 3HOYJ 3LSJA 5E3OA 1EF4A 2VUMJ 4B3AA 2LYQA 1PRUA 3Q0UA 3OQMA 3F6WA 5IOYA 1VPWA 4JYKA 1WPKA 3RZDJ 1QQAA 1IGNA 2X48A 3TEDA 2ICTA 3FK6A 2OPTA 1LLIA 5EG0A 2HDDA 3ZOBA 2AO9A 1QP4A 3ZKCA 2R5YA 2ICPA 9ANTA 1IJWC 2XGEA 1JUPA 3FK7A 3ZQIA 4FE4A 4IA8A 4MFEA 4Z58A 5J1RA 2JA8J 2EBIA 3BR1A 1JKPC 1F36A 5IYBJ 1A5JA 4MCTA 3MN2A 5F0FA 2OF7A 4JP0A 2EZIA 1YRNB 4Y52J 1K83J 1RKWA 3TW6A 3CMYA 4IEJA 5HODA 2GZUA 1JUSA 2JMWA 4W1UA 3F51A 4JCXA 3S1NJ 2PPXA 2O8KA 2OR1L 5DS9A 1DW9A 1X57A 3BTLA 1OFCX 2HQ5A 4BKXA 3PXPA 3SCHA 3BTCA 2ECCA 1HDDC 1UMQA 2EH3A 3B6AA 1Y9QA 4I6UA 4Z5CA 2LVSA 2LTPA 3BQZA 4I8TA 2Y31A 3OMTA 4IVZA 4X6AJ 3QWGA 1I50J 3BT9A 4DYCA 1BJZA 2LP0A 4DW6A 2NVQJ 2XRLA 1WH5A 3JRCA 1UXDA 5EZGA 1WI3A 2EZLA 2XPWA 4XRMA 5EYRA 2ME6A 2CU7A 2YUSA 1B0NA 1LE8A 3JREA 2IV1A 2QF7A 2PUDA 5M3MJ 2LK2A 4DZJA 3BG3A 1I3QJ 2CQQA 2PUEA 1XC5A 3S15J 3S8QA 2DTZA 2NS7A 1XG1A 2MW8A 3BG5A 4I76A 1JGGA 1Y7YA 2OFYA 3KXAA 1RZRA 3GN5B 1U78A 2B63J 4FBIA 5C44J 2CSFA 4A3BJ 2IUOA 3QYXA 3VPRA 4AC0A 3CROL 3H0GJ 3FYAA 3WHBA 3PO3J 4HNVA 5K98B 4NDLA 3JRGA 5F0CA 5M5XJ 2JCGA 3OP9A 1Y1WJ 2JA6J 1LE8B 5F08A 3GTGJ 4NDWA 5K7ZA 5IPAA 2E2JJ 2DMQA 2DN0A 1QP7A 3HDDA 5IP9J 5FLMJ 1ETKA 2ZB9A 3FKIJ 4XRSG 1FTTA 3JXDL 4BBSJ 5JLXA 2MGQA 3QQ6A 4L5EA 2HXIA 1ZKGA 2L7FP 4Y7NJ 2GBYA 3RQIA 2ID6A 4X4GA 3GTJJ 4IHYA 3LSPA 3K7AJ 1K61A 4A3GJ 1R9TJ 4A93J 1FEXA 1TWCJ 3CLCA 2XSDC 1RZRD 1LCCA 2ELKA 4M3DA 3SCGA 1QP0A 5BNGA 3OIOA 1BW6A 3SJMA 2L9RA 3G1OA 1JWLA 2O7OA 3E7LA 2K9NA 2M9HA 3OOUA 1WGXA 4MFDA 5F0HA 3G1LA 3FYMA 5GP9A 3TRBA 1ZVVA 2PMZN 2RAEA
chains in the Genus database with same CATH superfamily
3CJQB 1XDUA 4KIFA 4S0HB 4CYCB 2EIKH 3FX3A 3KP7A 4Q4ZF 3OS1A 4PDKA 2E5NA 1ZR2A 1D3YA 3U1KA 4UB8C 1X4PA 3KYLA 2L0KA 3GLLA 4ITVA 4LLLA 4JQDA 1KYZA 2MC3A 1B8IA 4PJLA 3QPTA 4F8DA 4EJTA 1IRFA 5DCMA 1ZK8A 3BZKA 2PUAA 2DJNA 1K6YA 3DBLB 3I71A 6PAXA 3J80K 2MD5A 3K6GA 1EH6A 1RETA 4XRFA 4YG7B 4L5JA 2JA5J 1G2HA 4I2OA 2LR8A 2XGXA 4ZTFA 1RR7A 1V3FA 2NYXA 2Y9YA 3QQAA 3IAM2 5LGTA 1MFQC 2LC2A 2OZ6A 5LEKA 4UUSA 2VL8A 1B8IB 4XL9A 1QO0D 2JRTA 2DDAA 4HG2A 5GAGJ 1H8AC 1JTYA 2K5CA 5DCMB 5E1ZB 4A0YA 1BC8C 4PSXA 3GUDA 2KZ8A 3WG9A 3QYFA 3FMYA 2V6CA 1IAWA 3N4MA 3PFYA 3T8RA 3M9AA 1PRVA 1LVAA 3O8HA 4EKGA 1I5ZA 4D7NA 1J9IA 2JWTA 1PUFA 2LNMA 2VE8A 2ZXWH 2OJED 4OAYA 1BC7C 4L9TA 1X2MA 2IEKA 4UUSB 5M5YJ 1U8RA 2E34A 1UELB 2NOJB 2PXFA 3ZR8X 1R1UA 2VN2A 5TGTA 2F2EA 4B1RA 1HC8A 1R49A 2DJIA 4B44A 4A3DJ 1BIAA 1XMXA 3QAHA 4UB6C 4ESFA 1JT6A 3DCFA 3CP2A 2L4MA 1FBQA 2YR2A 5B1AH 3PUFA 1GT0C 1RPEL 4EJVA 4O8BA 4BDZA 5FO5A 3L00A 2L5QA 3CCUI 1IN7A 1E3HA 5EF6A 3QOEA 1LFBA 3P9KA 2DK5A 2BZTA 2K9SA 3P7NA 2CUFA 2K3FA 2VBXA 4QIWN 5KHDA 3BC8A 4ESJA 2ZSIB 3J81Z 2VC0A 3LSGA 4NQWB 2QQ9A 2RQPA 1TWHJ 4B8XA 2GXBA 2O0YA 2M5WA 4A69C 4KYWA 4Y33A 3BCBA 2LYCA 4UXNA 4XN0A 4DJAA 3ZHIA 1EFAA 3IAS2 1O4XA 2PBIA 2HOSA 2XIGA 2HZDA 2A68F 4CCLA 3S16J 4ON0A 1ZZ8A 4UVBA 3Q0VA 4BUPA 2GA1A 5KAFC 1P92A 2LY9A 3SCFA 2BY0A 4IL6C 2DDBA 5JFRA 4FCYA 1QPMA 3LQQA 3K1PA 5D6EA 3GZDC 1TT0A 2DTRA 5E79C 3BLYA 3HRTA 3I53A 1BL0A 1YX3A 1T39A 1OCZH 2O9LA 1LFPA 2DT7B 2LLKA 1OCTC 2KDOA 2VJJA 4HEA2 5ERIA 5FKLA 2VJ5A 5IY5H 4PJNA 4LMYA 3K69A 1U5TB 5D5VB 3WE3A 2VJIA 4JQFA 2W84A 3AG2H 2M1BA 5DV5A 2DA3A 3B02A 3LSKA 3DBHB 3DTIA 1N25A 3RZOJ 3SDGA 3VFZA 1IV6A 4KNYA 4KUMA 1FZPB 2IS4A 4XOPA 2XPVA 1WJBA 4Y3OA 4C9YA 2R1JL 3JRIA 4ABZA 1IUFA 1S8NA 2GWRA 4UUTA 1JE8A 5TJJA 3HOTA 4IHSA 2DBBA 4BY1J 3KPHA 4AIJA 4A12A 2DMUA 3WTVC 3FXMA 2MLKA 5JVTA 3VODA 2P7VB 5JHFA 4A0ZA 4ER6A 3V7SA 2VC1A 2EV0A 1FYLA 5HS7A 1ZG3A 2XC7A 4BBRJ 2YU9J 2PXPA 2MA3A 1P9QC 3HB9A 2XF7A 1YQAA 3G1MA 5DCFA 2HPIA 2WBMA 4OMZA 2F5FA 4WXHA 3LFPA 2EJRA 2DA6A 4Y13A 3RCOA 1YRNA 3DTEA 2WAEA 1L3LA 2HYJA 3CCVI 3D5LA 4N9IA 4HRAA 4EGZA 4E70A 4RDUA 1LDJA 1EA3A 1YJNI 5BQTA 3IV5A 3SQNA 4G6DA 3T8TA 4YELA 3E97A 5JHUA 1FOXA 2CV1A 1F5TA 1BI2A 4CXFA 3M4OJ 3QOWA 1ZELA 4W97A 2J5OA 1P6RA 4OMYA 1KU7A 1IO2A 4M6XA 1ZZ9A 1LVKA 4L9NA 2FJ1A 1BI3A 2F4IA 2X4HA 3S2DJ 4LLGF 4P1WA 2RNJA 4CHUA 2HDWA 1UXCA 2O4AA 3NXHA 3RPUA 2KEIA 2BNMA 2JA2A 1SD4A 1YLFA 5ICEA 1YW7A 2M8EA 3TKYA 4ZYDA 1ZQ3P 3E6CC 3I4MJ 1TNSA 1Q1VA 4P9FA 5L3GA 1J7KA 3NRVA 2ISZA 1V5GA 2L3DA 3DNVB 1G3YA 4ANJA 2EIMH 2R93J 1W36D 4XKWA 4R8HA 4WCGA 1T2KA 4GYGA 2DQLA 1HW1A 3TO6A 4YFXF 2E2HJ 1NHAA 2IT0A 3M7GA 2EA2A 2L7ZA 4R79A 1ZZCA 4AIDA 1RUNA 2VKVA 3ZHMA 2MC4A 3F72A 5GAGi 1TNTA 4LK0F 1HF0A 4RAFA 3DU5A 1U2WA 3B73A 3PJRA 4XIDA 2XB0X 4Q48A 3QPSA 1J59A 4PK4A 2MABA 3B6CA 3TDZC 3EYYA 4N0BA 1S7AA 1E2XA 3QU6A 2IVGA 4EJOA 4UNOA 2EFNA 2LOOA 3I56I 1I3AA 2KRFA 1J75A 5JLWA 4ETSA 1MBFA 3RIRA 1USSA 1VI0A 1WH7A 2AQFA 4I0BA 3RSNA 4XLPF 2HOAA 4LIUA 3L2UA 1WJCA 4KJZA 4CSWA 3QYBA 2IS1A 4HZFA 1PJRA 2YU3A 1MNDA 1Y6IA 2NNNA 3HJEA 1SQ8A 1ZZ6A 4B3XA 3HKZA 4M72A 4O6JA 2CUZA 1E3OC 1Y0NA 2QGUA 2LH9A 2VIXA 1R69A 1NERA 2JK3A 4F55A 1G3WA 4V19K 2IVBA 1X1BA 1VQKI 4M3FA 1QZYA 4PJ0C 3H3VK 2K86A 3ULQB 1YJWI 2M7BA 2LYLA 1L0OC 4LOCA 4FISA 3SDBA 3A0HC 4OIQF 3I4NJ 5FKMA 1GHCA 4F92B 4OIOF 3DLAA 2M30A 3LSIA 1ETYA 5TRDA 2R7DA 3H1CA 3ZQFA 1BR1A 5CQEA 2GIZA 1I1SA 4PU8A 3PM1A 4EM0B 1U3EM 2GM4A 1JFSA 3CECA 5HNHA 3ABMH 2X6OA 2KIQA 5EEGA 1B59A 1LPQA 3H5TA 4M9XA 2NRAC 1X3UA 3VYRB 3CTAA 3S1QJ 2KMUA 4L18B 1P7IA 1OCOH 2DQRA 3VYSB 4D5FA 5DM6F 3EQLF 4CCKA 5DSXA 3KE2A 3BS3A 2LFBA 4C3JJ 2W25A 2QQ8A 5EJCA 1R58A 2CQXA 3SZTA 2L1PA 2HSGA 4M3EA 4EM2A 4LB6B 4XQFA 4ZDOA 2FMLA 3DU6A 4YBAA 1X3ZB 1QZZA 1A35A 4B3AA 1OCCH 2H8WA 1RR8C 2ZJ2A 3L2CA 1A36A 3OOPA 1AOYA 2YBDA 3F6WA 5FD5A 5HLGA 3ZPXA 3HOSA 2FNAA 1IGNA 3OR1C 3LAJA 3V4GA 4BHPA 2R7OA 5GAHi 4EVIA 1SMYF 2HDDA 4PCQA 3K4JA 3ZKCA 2R5YA 1DUXC 2ICPA 3TL4X 3KEOA 3FKJA 1RUOA 3ZQIA 4CGZA 4Z58A 2ZJQF 2M3AA 3BR1A 4DIQA 5KVRA 2LY2A 3BPVA 5F0FA 2BOLA 1SVLA 4JP0A 2Y75A 1WZ2A 1LB2A 3I5UA 2FUG2 5FFZA 3JSPA 1TP4A 1K83J 2CUJA 3LFKA 3CMYA 5HODA 1W4MA 3FMSA 1JUSA 4BACA 2PXQA 2ZXHA 3G6EI 3V8JA 2Y48A 2ZNYA 4JCXA 4IRHA 5LBQA 3S1NJ 3HRMA 2OR1L 5DS9A 2ISYA 5FLXK 4FHTA 1DW9A 3LA7A 1VQ6I 2LG4A 1OFCX 2IGOA 4BKXA 4KDPA 3KZYA 3WTXC 1D5VA 1UMQA 2GXGA 2Q0OA 4Z5CA 2LVSA 2Y31A 3OMTA 4LJZF 3MZ8A 3BT9A 4HQEA 2V1XA 2BHYA 4ZJZA 2VEOA 2LREA 1UCRA 5EZGA 2AQEA 2E5ZA 1MNEA 1Y39A 3WU1B 2G9WA 1YG2A 2YUSA 2ZFWA 3W2WA 1B0NA 1BR2A 3RPUD 5FD6A 5LFAA 5HNFA 2GA2A 5K1YA 3JCUC 4BJTA 1S29A 3ZMDA 2MH9A 4FETA 4IKFA 2CQQA 1R36A 2PUEA 4U7DA 3G73A 4IOAF 4RB1A 2OFYA 4ZYGA 3KXAA 2L7KA 1U78A 1YOVB 2Q1ZB 2B63J 2CO5A 4AD9A 3K4MA 2UXNA 3ELKA 5E18F 1ON1A 2QUFA 5H6RA 3WHBA 4HA8A 4RM2A 3DKWA 3UR3C 2F6CA 3KZIC 1UAAA 2BXZA 2O8XA 2L54A 3NROA 4A0XA 5K7ZA 4M9SA 4E6KG 2DMQA 2X85A 2OQGA 3K4NA 1QZEA 1WJAA 2WAQA 5IP9J 1SC7A 1FTTA 3V8KA 1M1EB 3E3VA 2A05A 2E60A 3KP2A 2R7RA 2DT6A 5JLXA 3TBIA 4BBSJ 4L5EA 1R5HA 1ZKGA 2HXIA 2PXEA 2P4WA 2V3CC 4G8XA 4PFOA 1MKMA 4A3GJ 1FEXA 4OIPF 4A93J 2FA5A 1N78A 1HKSA 3BJOA 1QBJA 4M3DA 1E3PA 4OIRF 3MKWB 3SCGA 1WI9A 2ZMEB 1T0FC 4LG0A 3G1OA 2O7OA 2ADUA 3KCCA 4GYIA 2K9NA 2K9LA 3OR2C 4YEJA 4YFKF 5F0HA 1ZVVA 2NVXJ 2EZKA 4PGHA 4GCVA 5FLVA 1B72A 2AXUA 2JUCA 3TW7A 3BPXA 3R4KA 2Z99A 1ETXA 5ED4A 4MO7A 2BV6A 3CZ6A 3BROA 2HKOA 4ZYHA 1TLHB 3AL0B 4Z5DA 5AIQA 3F6OA 2CW0F 3UKGA 1X2NA 4XN3A 1P4WA 2KFDA 2PXTA 3O3KA 1IZ1A 4IWRA 3SXYA 3RYPA 2GRLA 1KQ9A 2CRGA 1PYVA 4YIIA 2RVCA 1WVRA 2V7FA 3J80Z 3CCSI 5M5WJ 1MMNA 2O61A 3CLCA 2EA4A 4OB4A 2GOXB 3CDLA 5J1UA 4IQ4A 3G7DA 1MBEA 2XPUA 3HRSA 1MMDA 1REPC 1JUMA 3BJ6A 4HW0A 2EFPA 2CQKA 2K7LA 2G0EA 4NB5A 1ZG5A 3TP3A 2HTSA 1XGNA 3ZMZA 3TELA 2W00A 4QLCU 2AW6A 3FMRA 3PSFA 5D8KB 1E17A 4GXOA 4LFUA 3ZN1A 2HVQA 5IT9K 1JFTA 3BD1A 2BJCA 4ENKA 2VE9A 3GTKJ 2B5AA 1MBGA 2OUMA 1XGOA 1Z67A 1DGWY 3L09A 5EG0B 2CG4A 1SEUA 4M73A 1QQBA 2IA0A 1OYWA 2Q2EA 4RS8A 2M2EA 1F1ZA 2V9KA 3CCEI 1ETWA 2CSOA 2KPMA 3BP8A 4YFNF 5J4YA 5GAEJ 3KZ3A 1ZREA 2WA0A 3I3LA 4RLQA 1PP7U 2DPDA 2XKPA 1MMSA 1RESA 1KU3A 4RM3A 4KMFA 3H3UA 1BW5A 3L2WA 1MIJA 4P96A 1G59A 2P7CB 5DTQA 1WWXA 2AXLA 2W57A 4I6ZA 3MQ0A 1QVUA 3JRFA 3ZQCA 1OLTA 1T6SA 3MWMA 4E4HA 1UHMA 3C18A 4X0GA 2F5VA 4AVPA 2V4JC 5DUIA 3K70D 2HR3A 1OCRH 1JJ6C 1HBXG 3OQOA 2KRCA 1FIPA 5CVVA 4XRSA 1WRJA 2XAGA 2QA4I 5A2QZ 2PUGA 3AKZA 1D5YA 3OYFA 4CZZA 2L4AA 3S1MJ 3DBRB 1OR7A 3M3YJ 2K9MA 1S7EA 5DUKA 2R5ZA 4E7JA 2M8GX 3JRHA 1WJDA 2E1OA 2XASA 3BCAA 3GTMJ 1HDPA 3C2GA 2PUBA 2E1NA 2QYOA 3WU2C 1ZR4A 1WCMJ 2LYSA 5HDKA 5AIPA 1MJAA 4AIKA 4YG2F 1G6NA 2XAQA 4X4BA 4IF4A 2I5UA 2HXOA 1YS7A 2FD5A 3KJXA 2E2IJ 3HUGB 4S05A 2UXXA 2QBYA 3ABKH 5BPDA 2CW7A 5F64A 4O3MA 3HOZJ 2LYKA 3NDBB 1UZCA 1T98A 4QSHA 3HL2A 1YJ9I 4BS9A 3K4LA 5FB2A 5LD2C 3SYTA 1EJ9A 2PMZA 3CJTB 1W5CC 3S2WA 4ESBA 1VQPI 3GFLA 1FT9A 3IH3A 5E1WA 1MGTA 2AUWA 2F5EA 3CUQB 4BHBA 3L9FA 4RA2A 1G8XA 5J47A 3REOA 2LBFA 5CPRB 3CF2A 2MQKA 4XMYA 4F7ZA 2Z33A 3EDPA 2STTA 5IP6A 1R4NB 3GTQJ 3MCZA 1JTXA 3HOVJ 4CO8A 4Y42A 4BL0B 2QBYB 5F6FA 3M8JA 2FQ4A 1SFOJ 1Z0XA 3MZYA 3RDIA 1BI1A 2IA2A 3RKQA 2BW3B 4X4IA 2LF8A 5GPCA 4WVLA 3F6VA 2PMUA 3PNTA 5L3FA 3GYHX 4CCMA 3FHZA 3F52A 3QFIA 1XSXA 4YARA 2PIJA 3S8PA 1ETVA 3DPLC 3TOAA 4BYYA 2E1MB 5LGNA 3Q3SA 3KETA 2LLVA 3PO2J 2DO7A 2X1EA 4DBRA 3BR5A 1MD0A 2ZO4A 1WQ2A 3HEFA 1JHHA 2V1DA 3KZZA 2R7SA 3C2BA 4KA4A 5BMZA 2XJ3A 2GIVA 1FC3A 1X1PA 3H92A 3TDUC 2KQRA 2IS6A 5BPIA 2KP6A 5EZHA 4DYRA 1GDTA 3H5NA 4PZJA 4RBOA 3DPUA 1NG7A 2OU2A 4DNCA 2HQRA 2EV5A 3PUBA 1KGSA 4C30A 1X4OA 4DYQA 4PU4C 1LNWA 1MSEC 2MSYA 1HQCA 2LYRA 4HAMA 1CF7A 3J7ZI 3DLLF 4L9JA 4ASNA 2KT0A 4XSZF 1IDZA 4EEFG 1IC8A 1NEQA 2RGVA 3NAUA 3LA2A 2CQ7A 1NK3P 2HS5A 3O6BB 3E6DA 4FX0A 5E8GA 2IXSA 3LSHA 2DMPA 5FKNA 1BDIA 4BEHA 1KYWA 3CMEI 4H0EA 1ZZBA 3F3XA 3ME5A 4Q47A 1O57A 4ZDLA 3JRDA 2ME0A 1H89C 2OC6A 3VEPA 2TCTA 2DFHA 1SVMA 4CCJA 1VTNC 1GXPA 4C3HJ 3JAMK 2HTJA 2RV8A 3CLOA 4HF2A 4AU7A 2L8NA 2P6TA 1V5EA 3PL8A 3TRBA 1HCRA 1W5SA 3FXJA 5L3EA 2KISA 4XICA 2PQ8A 1OYIA 3CUOA 3BR6A 3M1CA 2BY2A 3WTTC 3GCMA 3OYKA 1ACIA 4HDVA 2PMHA 4DBQA 2KZGA 2LD5A 1IG7A 1JHFA 1R1VA 5DTRA 4X4EA 3H35A 1PUFB 2PUFA 4ER3A 2EZHA 3L2VA 1XGMA 1RC9A 1A31A 2JN6A 1WKMA 3F8FA 5ILSA 3CMAI 1YIJI 3S2HJ 2CYYA 4PJMA 3GTPJ 4WXDA 3G3ZA 5FRNA 2YPRA 4MCXA 1ITYA 1P4AA 2IVMA 2FMYA 2IGKA 3GFJA 2ICWG 3F8CA 2RC4A 3S3OA 2WUSR 1YI2I 2ID3A 4OBMA 3FBIB 1XWRA 4HQMA 1V54H 2HDCA 3RKXA 4E7HA 3QPLA 2M45A 5K7HA 2H94A 4KISA 2IU7A 4LK1F 3PQJA 1VF9A 1QVTA 2O3FA 3P9CA 4XLCA 4XKVA 2DT5A 4IPAA 3GFIA 1P2FA 2EK5A 1J2XA 2OZUA 3LL7A 2XVCA 1R5ID 1OSLA 1WETA 2M4HA 3GBGA 4FQGA 1POUA 2DCEA 3BZ6A 4BJ5C 3W6JB 5FGMA 2ZMEC 2ZSHB 3M1EA 3R09A 4EM1A 3S1RJ 2OTJI 4G6TB 2KEJA 3TFLA 4YRVA 2DYRH 2VOPA 2XI8A 2FU4A 3HPGA 4P55A 2CUEA 3ZQLA 1PDNC 4XKCA 3OSGA 3OYNA 1LDKB 2PJPA 3WU0A 2BE5F 2BGCA 3BOQA 3L2QA 1V55H 1I1GA 3LMMA 1W0UA 1A04A 5DT2A 2EBYA 2JRMA 4BJ6C 5KNLA 2MLGA 4IOCF 3AL0C 3P9IA 4AYBA 1JH9A 3ECOA 2D5VA 1IN5A 1ZLJA 2HYFA 3ZMVA 3OYCA 2HNHA 1IDYA 2DOAA 1RPWA 4UHTA 3IKTA 2PE5A 2E1CA 3WTZA 4HNUA 3LNQA 1ZAYA 5EEHA 5JVGF 2JVGA 3H5AA 4BQNA 2M4KA 3UFDA 2L9SA 3J7AO 4L0ZB 3CDIA 3N05A 1FBUA 2A3SA 3C1DA 5IOYA 1QHHD 3CF5F 2R7TA 1WPKA 3H9JA 2CFOA 4LD5A 3T1BA 3M8EA 5BOXA 2J5PA 2XXPA 2ICTA 2J7UA 3FK6A 2OQRA 3FBNB 3DV8A 4FASD 3ZOBA 2AO9A 2XAUA 3ZCOA 4NC7A 4ENMA 1H9GA 4BE1A 2CW8A 2X1DA 3GFMA 9ANTA 1IJWC 5FRMA 2VT2A 1ZH5A 1ZGJA 2XGEA 4KT5C 2JT1A 1F4KA 5E8IA 4FE4A 2HCNA 4U87A 1HSJA 5J1RA 2DI3A 1DPRA 2JA8J 2ZJRF 1FPQA 5IYBJ 3NQOA 1MMAA 2CMPA 1OMIA 4WX9A 1YRNB 1RKWA 3SR4A 2IW5A 2ZBKA 1I6XA 5CJ9A 5H20A 2HQAA 2VASA 3ZMSA 3CD6I 1W7PA 1D1BA 3RI4A 1MW7A 3RKYA 1D0ZA 1LQ1A 4MNUA 2R7UA 1X57A 2HQ5A 4HSTA 3CO6C 2XF6A 1K4TA 1HDDC 1K78A 1YFHA 4OU0A 4KMUX 3I59A 3OYDA 2F48A 3C3WA 2QEXI 3DEEA 4X6AJ 2QLZA 5FFXA 1J09A 1SD6A 1T95A 3QWGA 3HXLA 1IRGA 3FM5A 1S9HA 3G0TA 3IL2A 4G7OF 1LDDA 4XRMA 1R1TA 1U6GA 2V79A 4XR6A 2VXZA 2ME6A 5LEJA 2CU7A 4D1QA 1LE8A 3JREA 3K9TA 1E0EA 3OYGA 1R00A 2X51A 4U88A 5M3MJ 2IRFG 2LK2A 1YITI 2RNGA 3BG3A 1I3QJ 2M0MA 2NNYA 1K7AA 3A0BC 3I59B 4EK9A 2O6GE 1JGGA 3GZ5A 3OYAA 2NVUB 2HWVA 4J01A 3BDDA 3M8FA 3VOEA 3BG6A 1MZBA 3EUHA 2JUGA 3GVAA 4EJUA 3WTUC 2IUOA 1QGPA 1J5YA 4ZC3A 1Y8RB 4AC0A 4MGRA 1AA7A 1G3TA 1IW7F 2MH2A 4HNVA 5M5XJ 3J81K 1ZRFA 2JCGA 3OP9A 4HYEA 1LE8B 4NDWA 1O3TA 4I7HA 2H09A 2QZ8A 2L9VA 3CUQC 1QP7A 1R71A 1CGPA 2QSGX 2LSOA 2QKMB 3FKIJ 3QQ6A 2MGQA 3IWFA 3OS0A 1O7LA 2L7FP 4RLFA 3RQIA 4IHYA 1K4SA 1WFXA 3D0SA 1XDSA 3ERMA 4QPOA 3LSPA 2AS5F 2LNBA 3K7AJ 5KCMA 1K61A 1R9TJ 4PSWA 2FE3A 1D1CA 2OTLI 1HW5A 1FY7A 3RYRA 5BNGA 3HHHA 2PEXA 2ZNZA 2CH0A 3OS2A 5E20A 1JWLA 3VB2A 3K10A 3ERED 1R23A 2KKOA 3FYMA 4YIFA 4U0WA 4O5VA 1ZARA 3SFZA 3L2RA 1SAXA 3F9KA 1IRXA 2E1MC 1KU2A 4UUVA 3H36A 3LOCA 3OYMA 2WADA 1VQLI 1N75A 1MNMC 5HDNA 1UHSA 4JCYA 2CROA 3VYTB 2JPBA 3LWFA 2ESNA 1FJLA 3HOUJ 3T5XA 1IUYA 1RZSA 1AHDP 5LHIA 4I6TA 2GLOA 2P81A 2DMNA 3E5QA 1ZRCA 2W48A 2CS3A 4WF2A 1YS6A 4Z5HA 4IHWA 2JA7J 1XMKA 3RZZA 4BDYA 1W1WE 1ORKA 4F91B 4G12A 5EEAA 3IVPA 3BTJA 2KPJA 2QM3A 3ZQHA 4U0VA 5L3BA 3OIPA 2C6YA 2NXNB 3U3WA 2DA4A 2B9SA 2CGPA 5DEQA 2BHZA 3CCLI 1AU7A 2XV4S 1Z77A 3IP4B 2CJJA 3KYDB 1ZTRA 1Z1DA 3TO7A 1O7FA 4KITB 5FKKA 3V8LA 3ZQ7A 2PUCA 1MSFC 5D4RA 4IVNA 2KHMA 4Z2YA 2AXTC 1N77A 5E3NA 1U9NA 2WC2A 3K2ZA 4S04A 3Q5FA 2DU9A 4IHXA 2K9QA 2A69F 5CYVA 2DK8A 4MQVA 3ROUA 5B66C 2ZFUA 5D8LB 2HCSA 3LA3A 4M3GA 5LHHA 4M74A 1MBJA 1BBYA 4JX4A 2R5YB 1W36C 2F4OB 5H6QA 5IOZA 4BH9A 1XMAA 1VQOI 2GXAA 1NG6A 4F3QA 3S3NA 1MBKA 1ZUGA 2ZC2A 3DQVC 3KYCB 4I99C 2H6BA 1IN6A 3S3MA 2STWA 3ECHA 2JVHA 5F1RA 3ZQGA 2VPRA 5J3LA 3E5UA 1DULA 3R0AA 2P5VA 1Z3YA 3I0TA 3NWTA 3BQYA 1ZLKA 4C2UA 1LEAA 3M07A 4BQAA 3N97A 4JX5A 2LKPA 3JSOA 1POGA 2H8RA 2Y9ZA 1JKOC 2HZTA 1UFMA 4NUBA 3S32A 3H5RA 4QTRA 4JX6A 2KIMA 3LQXA 1S3JA 1W7PD 2P5KA 4RGXA 3ZMUA 1MDMA 5EDNA 2PLYA 1W0TA 1UG2A 1D0XA 1EKEA 3HSEA 1T33A 5HVQC 2K40A 4XSXF 3DXJF 5L3DA 1XTAA 4OINF 2R7WA 4HBLA 4HV5A 1FWZA 3GZCA 5A7LA 3CC4I 2LYJA 3DTKA 4U7BA 2PX9A 2FX0A 3JR9A 2DMTA 4A3FJ 4CCOA 3MZHA 4GQMA 2K4JA 1D8KA 1QA6A 3VDXA 4DZPA 3LSMA 3GX4X 3WGHA 4UV8A 2IS2A 3H9GA 4JOMA 4Y15A 1Y1VJ 1P4XA 2CV0A 3HBLA 3W6VA 4I6RA 4IJAA 1FNNA 1JI8A 4DE8A 3GZDA 2DAOA 5CLSA 4MEYF 3MKLA 5E3LA 3HZIB 2VKEA 1SFKA 3BR2A 1VQ9I 3HGYA 2FOWA 1S7OA 1U8BA 1XSVA 2X6YA 4FT8A 4RB0A 2YX7A 1TQIA 1AKHA 3S93A 4N4OB 4XLHA 4HLYA 2O38A 1TL8A 4A3KJ 4ENNA 4XONA 4R1HA 4XORA 4WK8F 4FTHA 1LMB3 2OAZA 2MXDA 1HLVA 3I4PA 4Q2JA 3QP6A 1KU9A 4KFCA 2NVTJ 5CVIA 2KJBA 1TWAJ 2Y0SN 5KK1A 2QSHX 4X4HA 2RQQA 2TDXA 2LLWA 1IN4A 2FOKA 1HSTA 4X4FA 4ZYAA 2LCVA 2XCJA 1OCPA 4UVAA 4MIMA 2M0CA 3ZQQA 2X9DA 4M3BA 2HEOA 1ENHA 1HA8A 5FJ8J 4BXFA 1PVEA 2K27A 3AAFA 2WV0A 3IKVA 2ZXIA 3OYHA 3HRUA 1KZHA 3V7CA 1CQTA 4LG0B 1X2LA 1OJLA 3VYUB 3LISA 5IT3A 1LCDA 3AG3H 2L02A 3OMYA 4KT6A 4MHGA 1X58A 4BNCA 2GRMA 2HINA 3DM5A 1TW3A 1Z7UA 3QP5A 2EIJH 2W1OA 3OSFA 2LKXA 1RRJA 4GGGA 3E0JB 1B72B 5HLIA 3BR3A 3KLOA 3V42A 4MQ9F 4BY7J 4CH7A 4BE2A 2QQBA 1TW2A 1ZRDA 3HIFA 3DKXA 3FIWA 1QHGA 2DODA 3KIOA 1SAUA 1XX5A 2DLLA 4RB3C 4KIBA 4CA0A 4RB2C 1JKRC 3RQ4A 3J7YJ 2J7WA 4KICA 1RIOA 4J1XA 4MEXF 3A9XA 4AUXA 3R1FA 5E1XA 1I39A 3CMMA 1LUJB 3AG1H 5EGOA 5H2FC 3ESWB 3G5GA 1R4MB 2I10A 2B7EA 3F21A 1I6HJ 3KX2A 2XGCA 4DGWB 1PNRA 1F9NA 4IHTA 4B47A 4QPQA 1L1MA 2KDZA 2DA1A 1MBHA 2KIFA 1GVJA 4A3JJ 3W2AA 2VJ4A 1ZGAA 1PERL 4CYDA 1IXSB 1F43A 4NNJA 1FX7A 1XGSA 1BOBA 4D7MA 1LEBA 1TQMA 4AWXB 3JAMZ 3H0DA 4XLAA 2TRTA 2RDPA 2MEZA 2ESHA 3HOWJ 4BU2A 5J8FA 3ASOH 1DU0A 3FZVA 2GQQA 3DEWA 1H9TA 3OV8A 2H6CA 4YIRX 3J7AY 3WTYC 4PUSA 4G94A 3H9QA 5JR3A 3I64A 4RGUA 5IP7J 5EGOB 5HLHA 3OYJA 1FLIA 1FP2A 3NARA 1YTYA 2Q2EB 3HM5A 3Q9VA 1DWKA 3GN5A 3TMOA 3JRBA 1YE9A 5LHGA 3HSRA 2CFXA 4LLNA 3IHUA 3JXBC 3CQZJ 2UUZA 1APLC 4A3CJ 1T56A 2EQRA 1MH3A 2WB1N 2VBYA 2Z1DA 2BY1A 3O8GA 3TOBA 4PU3C 1NH3A 1BIBA 1GXQA 5ICFA 1ZYRF 4FX4A 2Z9OA 1BA5A 2FRHA 1HKTA 1XS9A 2WY7Q 3JXCL 2XKOA 2HU9A 4PJJA 1HQ1A 2JJ7A 3CCYA 2PXDA 1YYVA 2BVMA 2DXIA 2X0LA 1WH6A 1LFUP 2R92J 1BR4A 2R5ZB 5F04A 1MJ9A 4XBFA 5DRTA 1DP3A 5D5WB 4ER5A 3SZGA 2H27A 4A5NA 3HGGA 3WGIA 3EUHC 5ILUA 2L9NA 3RJPA 5J8CA 3TP0A 3HTSB 3GMEA 4HF0A 3BTIA 4CDGA 1MJBA 3GEZA 2FJRA 3FXUA 2L2OA 3PNYA 4LIVA 1YSEA 4CYCA 4YG1A 4IQJA 4BGDA 1VQ4I 3IH4A 3HSFA 3M9LA 2V9VA 3K4KA 1WH8A 1K6OA 3HOXJ 2ECBA 2LKSA 1XN7A 4G7HF 2G7HA 1OPCA 1FMWA 3E6BA 2K4BA 4EV0A 2Z16A 2XAHA 3K4BA 3CO7C 1O3QA 3GBFA 1TWGJ 3I55I 3JRAA 2JVLA 1OKRA 2WAQN 2EV6A 2HGCA 4BHCA 3GTLJ 2A6TA 4M6YA 5CQGA 3ZXSA 3C7JA 3PSIA 1ADRA 1S5LC 5K7FA 3MAJA 1KA8A 2LBFB 1U9OA 1KONA 1ZG1A 3MKYB 3A9ZA 2DOFA 5IYCJ 2DA7A 2O03A 3W3CA 4TV7A 3DWLE 3BY6A 5GTHC 3OYBA 4NBQA 1B6AA 3HOYJ 3LSJA 5E3OA 1EF4A 1IV8A 1ZAOA 1VQ7I 2ODRD 2VBWA 1PRUA 1I27A 3Q0UA 2IGNA 5B3SH 1KQ0A 1AWCA 2DFFA 1B4AA 1QQAA 2X48A 1UB9A 3TEDA 3IRQA 1LLIA 1HW2A 1SMTA 1BJAA 2CQNA 2QKLB 3ABTA 4JBAA 2F4MB 2DFEA 2HQNA 4CCNA 3KLNA 3KEQA 1JUPA 3FK7A 3HTUA 4XM3A 1RZ4A 4IA8A 4MFEA 2OCCH 1ZN2A 5D5XB 4EGYA 3TO9A 2PXKA 1F36A 4BQQA 4MCTA 2NAZA 3FM3A 4E7ZA 2EZIA 5B1BH 2WAFA 3TW6A 4IEJA 3A4CA 2EINH 2JQEA 1R5GA 4W1UA 3F51A 3IC7A 1Z9CA 2PPXA 2XUBA 1QB2A 1CF7B 4NHJA 4JK1X 3BTLA 4M71A 3CJRB 1XCVA 4B09A 3PIPF 3BTCA 3TQNA 3MEJA 3SCHA 2ECCA 1SFUA 2UWMA 2EH3A 1OYYA 1SFEA 3B6AA 3K70C 1Y9QA 2FNPA 4I6UA 1YW8A 3A1YA 2LTPA 4I8TA 2X6XA 3WE2A 3OYLA 4DYCA 1BJZA 4DW6A 4DE9A 1S6LA 1IXRC 2NVQJ 4NQWA 3TGNA 4II2A 2XRLA 4BEHB 1WH5A 3FWEA 1WI3A 2EZLA 1XPXA 4KN7X 1MMGA 5D5UB 3F8NA 3PQKA 2WY8Q 3CLQA 5EYRA 4ZZDA 3MKZA 3U2RA 3PFIA 3OY9A 4HX4A 2IV1A 3NZLA 2PUDA 3ISPA 1Y8QB 4HX8A 4DZJA 1XC5A 3S8QA 2NS7A 1Y7YA 1XG1A 2MW8A 3BG5A 3OWQA 2XROA 3F22A 4E7LA 4FBIA 2M4GA 3CP8A 4E7KA 2F5DA 5A2QK 2VOOA 2GOMA 3HHGA 4PGGA 3QYXA 3VPRA 3FF5A 3H0GJ 3FYAA 3PO3J 5K98B 5F0CA 3H3ZA 1TTYA 1EV7A 3CCJI 5GTIC 5F08A 3GTGJ 3E6MA 4IRIA 3D5RC 3LQRA 3OL3A 5IPAA 3ML6A 5HS8A 2LMDA 1U5TA 3HDDA 5FLMJ 4I0AA 2ZB9A 1D1AA 2FBHA 4QWQA 2DOEA 4BAYA 2Y0MA 2ID6A 1V4RA 4X4GA 2QENA 1T0FA 4I02A 3A9YA 5FROA 5J40A 1R7JA 2A5YB 3EPZA 3K1NA 4F52A 2QVOA 1EH8A 4N4NB 4EQZA 1RZRD 1B1BA 3CJNA 1LCCA 3EUKL 1X1CA 1QP0A 1PUEE 1BW6A 3U1DA 2CV2A 1DQUA 1BI0A 2KLOA 2QSFX 1FSEA 2G7UA 2DPUA 2M9HA 4MFDA 3UWPA 2HFHA 2XSJC 3G1LA 4NC6A 5GP9A 1G3SA 2PMZN 5GAHJ 2ETHA 4GO1A 1VQ8I 1R63A 4HLXA 2L49A 3GO5A 1QRYA 2MG4A 1Z21A 3DEUA 4HPQA 1FOKA 4BXUA 3OYEA 2WTEA 1ZS4A 4ZYEA 4RAZA 2VKHA 3KP3A 3LFUA 2Y69H 3FXOA 4OOIA 3QOPA 3QU3A 3WTSC 5K5RA 3GW2A 2XGDA 1RNLA 4GRIA 5M3FJ 3BR0A 1XB4A 1V5FA 2ZXJA 4HDUA 5E17F 3B7HA 2P8TA 1ZGWA 3GTOJ 2R3SA 3JTHA 2IPQX 5DD8A 2VQCA 2BYVE 2BY3A 2P6SA 3D1NI 1FYKA 4EATA 2VONA 2K02A 1FOYA 3I58A 2R7ZJ 4C3IJ 3G71I 4CICA 1HKQA 3KP5A 2VODA 2BNOA 3FISA 3LSTA 4LITA 2LDUA 2FSWA 1QPIA 5B5EC 4NC8A 2A61A 1JJ8C 1RKTA 5J1YA 3ZGKA 1NTCA 2HI3A 3S14J 1GUUA 4LB5A 2BXYA 5FLXZ 1ERDA 3SFIA 2YSRA 4A5MA 1XSDA 1TWFJ 4YG4A 1YX5A 4XNFA 2PXBA 2NVYJ 2XIUA 2M34A 2XB5A 1UTXA 1LQCA 4A3MJ 3JW4A 3W2VA 4ER0A 2VT3A 1T38A 1ODDA 4P5OA 1PRAA 3ZP5A 4XK4A 5C4JJ 1TT5B 2UV1A 2GZWA 1JXSA 1B9MA 2MFZA 3E5XA 3SZPA 4K2EA 2AWIA 2PN6A 3UNGC 5BS6A 3ZPLA 3MEXA 2VKDA 4ZH4F 3E1SA 3ONQA 3V7RA 4A6EA 4MTEA 4RMNA 1W7PB 1YW9A 4BXXJ 2H1KA 2R7VA 3ASNH 1GLNA 4XLFA 4P9UA 5C3EJ 3BDNA 1Z6TA 3EUSA 1P7JA 5K5QA 1FOWA 3BZCA 5L3CA 1STZA 1ONVA 3SEZA 1K78B 4V2FA 3ZRGA 3Q9SA 4G7ZF 1A6IA 1ETOA 1YO5C 2DA2A 3OKZA 3HC7A 4ENJA 3VWBA 4GHJA 1TZLA 4PFPA 4B4CA 3WGGA 4BQOA 3RTRA 4Y4RA 2FQ3A 4AM3A 4HX7A 1YHQI 2ZCWA 1S72I 3HPHA 2PXLA 3DFGA 5E3MA 2P0WA 2RN7A 1OR7C 3DKYA 2FFHA 3GLXA 1BOAA 3QYEA 2AXVA 3BG7A 4RGSA 2EWTA 1WJ5A 2A07F 3SEQA 3GXOA 2FBKA 3MLFA 3FHNA 1Z05A 1TC3C 2IVQA 3F8BA 2OD5A 1WJFA 4G6QA 2ELJA 2BNNA 3RPQA 1XCBA 2W4SA 4I01A 3VSKA 1QU3A 2Y0SA 1PP8F 4A3LJ 4EJWA 3L1PA 2W85A 4X4CA 2ZKZA 3SHFA 3LAPA 3GZ6A 3FMQA 2A6CA 1ZZ7A 2A6HF 4Z6YA 3Q0WA 2D45A 5GPAA 5DDGA 4A2UA 1CJGA 2JPCA 5D6FA 1SANA 4Z59A 2XF5A 5HDGA 2PFBA 3CC7I 2BEOA 2PG4A 4V2GA 4XLEA 2XAJA 4XOTA 4B48A 3WG7H 2A5WA 4DQ2A 2XXAA 2BVLA 2D1HA 2FEZA 1Z7LA 2IAIA 4IRGA 5CVUA 3IUOA 4F93B 1WJEA 1G4DA 1MH4A 3VK0A 2KIUA 1GV5A 3HYIA 3F0CA 1ZPQA 2JZYA 1EH7A 4E7SA 2QCOA 5DTDA 2W82A 4OAZA 2ACJA 1X1AA 2NOGA 3F23A 1SD5A 3QF3A 1YIOA 4G9YA 2IP2A 1QQIA 1ETQA 3W6KB 1BDHA 2VB6A 1ON2A 2MD0A 1VQMI 1JKQC 2N8GA 2V1UA 1LJ9A 1SFXA 2R7XA 3PNVA 4C2TA 2I8DA 5JI6A 5F1JA 4Q5SF 1J0RA 1D0YA 5DD4A 3QOXA 2HKXA 1WHUA 2V9PA 2IGMA 4AYBN 2HOTA 1IXCA 1UHWA 1IN8A 2RREA 3CCQI 3SX0A 4OWRB 1C0WA 5IT9Z 2OV7A 1HOMA 5IYDJ 4L9VA 4GDFA 1H88C 4A6DA 4UY8I 3MMYB 4HNTA 3BG9A 3ZMTA 2JQ7A 4KN4X 2O49A 2Y2ZA 2V26A 5F27A 5ILVA 1IRZA 3FXRA 3FDYA 2O5RA 4IXAA 3CCMI 1LKXA 5CVJA 4MTDA 4D9JA 2Z2SB 3KL4A 5LRRA 1DDNA 2R63A 3G4SI 2Z3YA 2E7WA 1QZXA 3HG9A 3X2QH 3VWSA 2KL4A 1T08B 2VQGA 1B9NA 3FXQA 2OCEA 4RAGA 2EFWA 1A6QA 1USTA 4N9HA 3O9XA 3MD2A 2WIUB 2NS0A 4HSRA 5FKOA 3ABUA 3NEUA 2KEKA 2R4GA 2LY1A 4A3EJ 3CCRI 4M6VA 2WB1A 1QPZA 4MLOA 2DA5A 3OYIA 1RIOH 4FE7A 1U0JA 2R7FA 4Y17A 1WIZA 5KAIC 4DOZA 2R0QC 2VLAA 4D5CA 3QRFF 1VFCA 1X1DA 3S17J 4XLNF 4L5IA 3U21A 3A02A 2KJCA 4AIHA 5ICCA 1T8IA 2PXVA 2GAUA 3DPTA 3OWTA 4D0PA 4X1EA 4ZTJA 3A03A 3R60A 4UV9A 3GZNB 3OL4A 3A01A 4J1WA 3KP6A 2HVSA 4ZZLA 2DW4A 2AXZA 2K3PA 2COMA 2EWNA 2VXDA 3C2HA 5HOOA 1DU6A 4FN3A 4J19A 2HFZA 1VQNI 3PE5A 2VI6A 1TBXA 4HF1A 1WSUA 1GV2A 1MDMB 3IH2A 4X4DA 2VBZA 2E19A 2L01A 1ULYA 2XHKA 2Q8KA 1FTZA 2E71A 5JUWA 4EKIA 1VNDA 2KZVA 2XAFA 2IBDA 3R61A 2COBA 3MFKA 3HZJA 4IO9F 3K2AA 4IHVA 1FMVA 2PI0A 2LF7A 1HXDA 2W24A 2ZMEA 2EILH 4GFBA 4RGRA 1D8JA 2HPMA 2KRHA 4I98B 1Z3XA 3A01B 3OQNA 4A3IJ 1GVDA 1NK2P 5CVRA 5LLQA 4IX7A 2PJRA 2EPFA 1Z91A 3DF8A 2UZKA 2EF8A 5C4XJ 4BE0A 1O3SA 5DYMA 1JT0A 4L0YB 1DPUA 2H1LA 3HKZN 2E35A 4PU7A 2EFQA 2Y30A 1U5TC 2XXQA 4HV6A 1FIAA 2MBFA 2L7MP 3WHCA 2LYPA 2R7QA 1TQPA 1X19A 3P5JA 1AKHB 2E36A 2D1VA 2Z5UA 3LSRA 2AHQA 1Q1HA 2PJRB 3PIOF 4C2MJ 3AG4H 2NS8A 4LGWA 3ZN0A 1IF1A 2X6WA 1FBSA 1UJ8A 2YS9A 4B43A 2WV1A 1R6RA 3KFWX 4E7IA 3CDHA 3BJAA 3MVPA 2MYSA 3AFHA 2VUMJ 2LYQA 3EUAA 2B0LA 1BN5A 3OQMA 3EYIA 1VQ5I 1VPWA 3KP4A 4JYKA 3RZDJ 4WXCA 4M9ZA 1OQYA 4XKBA 1OISA 3QODA 4EZIA 2OPTA 4IZZA 5EG0A 1R22A 2FBIA 3RKWA 3CC2I 1QP4A 2OBPA 3JTGA 2HYGD 3TEPA 2IJLA 3QWLA 2QQAA 5AONA 5HS9A 2V1NA 1XD7A 2M7AA 5LRSA 1H0MA 4ER7A 1SVOA 2A6EF 2EBIA 3GF2A 3IRRA 1JKPC 3A2KA 5DTMA 1A5JA 1JGSA 3BWGA 3MN2A 2OF7A 2OA4A 1VZ0A 3U9GA 2HVRA 1KQ8A 4CUGA 5HLTA 4Y52J 2XDVA 2GZUA 5J6XA 2WWYA 2JMWA 4HOBA 4U0YA 2D2WA 2O8KA 2PXUA 1UG0A 2QWWA 3GUUA 1O3RA 3PXPA 3R0JA 3K1MA 3CESA 2IA1A 3T0YA 4WWCA 3BQZA 4IVZA 1I50J 2LP0A 2W7NA 2DYSH 2XRNA 5DRYA 4J00A 1DP7P 3JRCA 3GWZA 1UXDA 1FSHA 2K85A 1DGRM 3R6SA 2XPWA 2LRDA 2E7XA 2VPLA 1NW3A 2BBYA 2YX4A 3EETA 4RAYA 2QF7A 5GADJ 5DM7F 2DFIA 3HUGA 3IWZA 2VQHA 3K4CA 3K0LA 3I9V2 2P5LC 2X1CA 3O2PE 2EB7A 3KEYA 3S15J 2ELHA 2DTZA 2HOEA 4I76A 1Y0UA 3D5SC 1BM9A 2M87A 4EMSA 3GN5B 1RZRA 4LG3A 5C44J 3WTWC 4HRIA 2CSFA 2EFOA 4A3BJ 1Z6RA 1Y56A 5J4VA 3FXLA 2JSCA 3DP7A 1W5TA 5CKTA 2VQLA 3CUQA 1K79A 3CROL 2ZJPF 4NDLA 3JRGA 4UVCA 4KIGA 4AVZA 1Y1WJ 2JA6J 2V6EA 4H4KC 2E2JJ 2DN0A 4ZDPA 1QNTA 1U2ZA 2RKHA 1SD7A 1RI7A 1ETKA 5LGUA 4XRSG 3F8MA 4CZCA 2F5CA 3JXDL 3ABLH 3G2BA 4Y7NJ 2GBYA 3GTJJ 2BW3A 1X3WB 2JTVA 3L7WA 5ICGA 1TWCJ 2XSDC 2ELKA 2FXAA 3I54A 2JSPA 3OIOA 1FP1D 5K5OA 3NWSA 4II3A 3SJMA 2L9RA 2FF4A 3OIQA 4I09A 3VSLA 4EQQA 2CWEA 3E7LA 5D4SA 3OOUA 5TISC 1WGXA 1ZHFA 3WODF 3FXKA 1FYMA 3QPHA 3COAC 2RAEA
chains in the Genus database with same CATH topology
1R63A 2EZKA 4S0HB 4CYCB 5FLVA 2L49A 1B72A 2AXUA 1QRYA 3TW7A 2MG4A 3LOCA 1ZR2A 1MNMC 1ETXA 4JQDA 1UHSA 2L0KA 4MO7A 1ZS4A 4JCYA 2CROA 4Z5DA 2NVXJ 3UKGA 1FJLA 3HOUJ 1B8IA 4I6TA 1RZSA 1X2NA 1AHDP 2GLOA 2P81A 2DMNA 4F8DA 4IWRA 2W48A 2XGDA 4IHWA 2JA7J 2GRLA 2CRGA 4Z5HA 5M3FJ 3BR0A 3RZZA 1ZK8A 1ORKA 4G12A 5EEAA 5M5WJ 3IVPA 3BTJA 3B7HA 1ZGWA 3GTOJ 4OB4A 2PUAA 2DJNA 3CDLA 2KPJA 5J1UA 3ZQHA 3G7DA 3D1NI 1MBEA 1RETA 2XPUA 4YG7B 2JA5J 2R7ZJ 4C3IJ 3U3WA 2DA4A 1G2HA 1JUMA 2LR8A 1AU7A 1RR7A 1Z77A 2BNOA 3FISA 2CJJA 2G0EA 3QQAA 1ZTRA 2Y9YA 5FKKA 3TP3A 2PUCA 4UUSA 1MSFC 1QPIA 2AW6A 1B8IB 1JJ8C 1RKTA 5J1YA 1JFTA 3BD1A 2BJCA 5E3NA 1U9NA 1NTCA 2HI3A 3S14J 1H8AC 4IHXA 2K9QA 1GUUA 1JTYA 3GTKJ 2B5AA 1MBGA 2KZ8A 3SFIA 1TWFJ 5EG0B 4M3GA 4YG4A 2NVYJ 2XIUA 3FMYA 1MBJA 4JX4A 2R5YB 1QQBA 2M34A 2XB5A 1PRVA 3O8HA 4D7NA 1UTXA 2M2EA 5IOZA 4A3MJ 1LQCA 2JWTA 1PUFA 1ETWA 1MBKA 1ZUGA 1PRAA 4XK4A 3KZ3A 5C4JJ 1X2MA 2IEKA 4UUSB 5M5YJ 1RESA 2AWIA 3ZQGA 2VPRA 5J3LA 1BW5A 3BQYA 4B1RA 4JX5A 1POGA 2H8RA 4A3DJ 2Y9ZA 2H1KA 4I6ZA 4BXXJ 1JKOC 1JT6A 1QVUA 3DCFA 5C3EJ 3JRFA 3ZQCA 3EUSA 4QTRA 1P7JA 3BDNA 4JX6A 1RPEL 1GT0C 3OQOA 1JJ6C 4O8BA 5EDNA 4V2FA 1FIPA 4XRSA 1UG2A 1W0TA 1A6IA 2PUGA 1ETOA 2DA2A 1D5YA 4GHJA 1T33A 5EF6A 2K40A 3S1MJ 1LFBA 4B4CA 2K9SA 4QIWN 3M3YJ 2CUFA 1S7EA 2R5ZA 2M8GX 3JRHA 3LSGA 2E1OA 3GTMJ 1HDPA 1TWHJ 5A7LA 2PUBA 2LYJA 1ZR4A 1WCMJ 2LYSA 2FX0A 5E3MA 3JR9A 2DMTA 4A69C 4A3FJ 4GQMA 4X4BA 2HXOA 2AXVA 4DZPA 3ZHIA 2EWTA 1EFAA 2FD5A 1O4XA 3KJXA 2E2IJ 3W6VA 1Y1VJ 3MLFA 3HBLA 1TC3C 2IVQA 2HOSA 4I6RA 3HOZJ 3S16J 2LYKA 1ZZ8A 3Q0VA 2BNNA 3MKLA 5E3LA 3HZIB 2VKEA 4QSHA 3BR2A 3HGYA 2LY9A 3SCFA 4A3LJ 3L1PA 1U8BA 4FCYA 3IH3A 4X4CA 2AUWA 1AKHA 2A6CA 1ZZ7A 2O38A 3Q0WA 4A3KJ 1BL0A 4FTHA 1LMB3 5GPAA 2O9LA 1CJGA 1HLVA 2LLKA 1OCTC 1SANA 4Z59A 2MQKA 5FKLA 4V2GA 2NVTJ 5IP6A 2Y0SN 1TWAJ 3GTQJ 4X4HA 1JTXA 3HOVJ 4Y42A 4X4FA 2IAIA 2FQ4A 2LCVA 2XCJA 1OCPA 2DA3A 1SFOJ 1Z0XA 4MIMA 2M0CA 1MH4A 3VK0A 2X9DA 3RZOJ 3RKQA 3SDGA 4M3BA 1GV5A 4X4IA 1ENHA 3F0CA 1ZPQA 1IV6A 5GPCA 2QCOA 5FJ8J 2XPVA 3F52A 5DTDA 4YARA 2R1JL 3JRIA 2PIJA 4ABZA 1IUFA 2NOGA 4UUTA 1ETVA 3QF3A 4BY1J 1CQTA 1X2LA 2DMUA 1OJLA 3LISA 3Q3SA 1LCDA 3PO2J 2HINA 2GRMA 1ETQA 1X58A 1BDHA 1JKQC 2N8GA 3BR5A 3OSFA 3HEFA 5F1JA 2LKXA 3C2BA 1B72B 2XJ3A 3BR3A 4BBRJ 2YU9J 3HB9A 4BY7J 4AYBN 2HOTA 3G1MA 5EZHA 4DYRA 1HOMA 3LFPA 3FIWA 1GDTA 5IYDJ 2DA6A 4RBOA 1YRNA 1H88C 1JKRC 4DYQA 4PU4C 2HYJA 4J1XA 1MSEC 1RIOA 3BG9A 2MSYA 4RDUA 4AUXA 2O49A 3R1FA 3IV5A 2Y2ZA 2LYRA 5F27A 1IRZA 5EGOA 2KT0A 3G5GA 2I10A 1I6HJ 4EEFG 3M4OJ 1IDZA 1IC8A 4W97A 1NEQA 2XGCA 1PNRA 3NAUA 1L1MA 2KDZA 1ZZ9A 2DA1A 1MBHA 4A3JJ 1NK3P 2R63A 1PERL 2DMPA 2FJ1A 5FKNA 1F43A 1BDIA 3S2DJ 1ZZBA 4D7MA 1UXCA 2O4AA 3JRDA 2KEIA 2ME0A 2BNMA 1H89C 2TRTA 2TCTA 3I4MJ 2MEZA 1ZQ3P 3HOWJ 4C3HJ 3O9XA 1DU0A 2WIUB 1Q1VA 3DEWA 2L8NA 1HCRA 3DNVB 5FKOA 2KEKA 5IP7J 2R93J 4XICA 5EGOB 4A3EJ 4M6VA 3BR6A 3NARA 2E2HJ 1QPZA 4MLOA 2DA5A 3HM5A 4FE7A 1WIZA 1IG7A 2LD5A 2R0QC 2L7ZA 1DWKA 3GN5A 4X4EA 4D5CA 3JRBA 1VFCA 1PUFB 1ZZCA 2VKVA 2PUFA 3S17J 3ZHMA 3A02A 2EZHA 1HF0A 3JXBC 3CQZJ 4X1EA 1APLC 2JN6A 4A3CJ 1T56A 4XIDA 2EQRA 1MH3A 2WB1N 2XB0X 3A03A 3O8GA 3QPSA 3S2HJ 3GTPJ 3B6CA 3A01A 4J1WA 4PU3C 2IVGA 2AXZA 4MCXA 1ITYA 1DU6A 4FN3A 5JLWA 4J19A 2WUSR 1BA5A 1MBFA 2VI6A 2ID3A 1XS9A 1VI0A 1GV2A 1WH7A 3IH2A 4X4DA 3JXCL 1XWRA 2E19A 1FTZA 2JJ7A 2HOAA 3CCYA 3QPLA 5K7HA 1VNDA 1WH6A 2IU7A 1LFUP 2IBDA 2COBA 2R92J 1VF9A 4IHVA 1QVTA 3K2AA 2R5ZB 5F04A 1SQ8A 1ZZ6A 4GFBA 3HGGA 1E3OC 3A01B 1R69A 1NERA 3OQNA 2JK3A 1GVDA 4A3IJ 1NK2P 1OSLA 3TP0A 1WETA 2IVBA 3BTIA 3GBGA 4M3FA 3H3VK 1POUA 2FJRA 1YSEA 4CYCA 3S1RJ 2LYLA 2EF8A 5C4XJ 4YG1A 3IH4A 4LOCA 2KEJA 1JT0A 4FISA 1WH8A 2XI8A 3HOXJ 2ECBA 3ZQLA 2CUEA 3HKZN 3OSGA 3I4NJ 4PU7A 5FKMA 2Y30A 3GBFA 1FIAA 2L7MP 1ETYA 3WHCA 1TWGJ 3JRAA 2JVLA 2LYPA 3ZQFA 1W0UA 2WAQN 2EBYA 4PU8A 3PM1A 2GM4A 3GTLJ 1AKHB 1JFSA 3CECA 2X6OA 1JH9A 2D5VA 3H5TA 1ADRA 3LSRA 3S1QJ 2AHQA 5K7FA 1P7IA 4D5FA 1U9OA 1IDYA 4C2MJ 3BS3A 2LFBA 4C3JJ 2NS8A 1RPWA 2CQXA 2PE5A 2YS9A 5IYCJ 2HSGA 2WV1A 2DA7A 4M3EA 3LNQA 1ZAYA 3UFDA 4YBAA 3MVPA 3HOYJ 3LSJA 5E3OA 1EF4A 2VUMJ 4B3AA 2LYQA 1PRUA 3Q0UA 3OQMA 3F6WA 5IOYA 1VPWA 4JYKA 1WPKA 3RZDJ 1QQAA 1IGNA 2X48A 3TEDA 2ICTA 3FK6A 2OPTA 1LLIA 5EG0A 2HDDA 3ZOBA 2AO9A 1QP4A 3ZKCA 2R5YA 2ICPA 9ANTA 1IJWC 2XGEA 1JUPA 3FK7A 3ZQIA 4FE4A 4IA8A 4MFEA 4Z58A 5J1RA 2JA8J 2EBIA 3BR1A 1JKPC 1F36A 5IYBJ 1A5JA 4MCTA 3MN2A 5F0FA 2OF7A 4JP0A 2EZIA 1YRNB 4Y52J 1K83J 1RKWA 3TW6A 3CMYA 4IEJA 5HODA 2GZUA 1JUSA 2JMWA 4W1UA 3F51A 4JCXA 3S1NJ 2PPXA 2O8KA 2OR1L 5DS9A 1DW9A 1X57A 3BTLA 1OFCX 2HQ5A 4BKXA 3PXPA 3SCHA 3BTCA 2ECCA 1HDDC 1UMQA 2EH3A 3B6AA 1Y9QA 4I6UA 4Z5CA 2LVSA 2LTPA 3BQZA 4I8TA 2Y31A 3OMTA 4IVZA 4X6AJ 3QWGA 1I50J 3BT9A 4DYCA 1BJZA 2LP0A 4DW6A 2NVQJ 2XRLA 1WH5A 3JRCA 1UXDA 5EZGA 1WI3A 2EZLA 2XPWA 4XRMA 5EYRA 2ME6A 2CU7A 2YUSA 1B0NA 1LE8A 3JREA 2IV1A 2QF7A 2PUDA 5M3MJ 2LK2A 4DZJA 3BG3A 1I3QJ 2CQQA 2PUEA 1XC5A 3S15J 3S8QA 2DTZA 2NS7A 1XG1A 2MW8A 3BG5A 4I76A 1JGGA 1Y7YA 2OFYA 3KXAA 1RZRA 3GN5B 1U78A 2B63J 4FBIA 5C44J 2CSFA 4A3BJ 2IUOA 3QYXA 3VPRA 4AC0A 3CROL 3H0GJ 3FYAA 3WHBA 3PO3J 4HNVA 5K98B 4NDLA 3JRGA 5F0CA 5M5XJ 2JCGA 3OP9A 1Y1WJ 2JA6J 1LE8B 5F08A 3GTGJ 4NDWA 5K7ZA 5IPAA 2E2JJ 2DMQA 2DN0A 1QP7A 3HDDA 5IP9J 5FLMJ 1ETKA 2ZB9A 3FKIJ 4XRSG 1FTTA 3JXDL 4BBSJ 5JLXA 2MGQA 3QQ6A 4L5EA 2HXIA 1ZKGA 2L7FP 4Y7NJ 2GBYA 3RQIA 2ID6A 4X4GA 3GTJJ 4IHYA 3LSPA 3K7AJ 1K61A 4A3GJ 1R9TJ 4A93J 1FEXA 1TWCJ 3CLCA 2XSDC 1RZRD 1LCCA 2ELKA 4M3DA 3SCGA 1QP0A 5BNGA 3OIOA 1BW6A 3SJMA 2L9RA 3G1OA 1JWLA 2O7OA 3E7LA 2K9NA 2M9HA 3OOUA 1WGXA 4MFDA 5F0HA 3G1LA 3FYMA 5GP9A 3TRBA 1ZVVA 2PMZN 2RAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R63 A;  2EZK A;  4S0H B;  4CYC B;  5FLV A;  2L49 A;  1B72 A;  2AXU A;  1QRY A;  3TW7 A;  2MG4 A;  3LOC A;  1ZR2 A;  1MNM C;  1ETX A;  4JQD A;  1UHS A;  2L0K A;  4MO7 A;  1ZS4 A;  4JCY A;  2CRO A;  4Z5D A;  2NVX J;  3UKG A;  1FJL A;  3HOU J;  1B8I A;  4I6T A;  1RZS A;  1X2N A;  1AHD P;  2GLO A;  2P81 A;  2DMN A;  4F8D A;  4IWR A;  2W48 A;  2XGD A;  4IHW A;  2JA7 J;  2GRL A;  2CRG A;  4Z5H A;  5M3F J;  3BR0 A;  3RZZ A;  1ZK8 A;  1ORK A;  4G12 A;  5EEA A;  5M5W J;  3IVP A;  3BTJ A;  3B7H A;  1ZGW A;  3GTO J;  4OB4 A;  2PUA A;  2DJN A;  3CDL A;  2KPJ A;  5J1U A;  3ZQH A;  3G7D A;  3D1N I;  1MBE A;  1RET A;  2XPU A;  4YG7 B;  2JA5 J;  2R7Z J;  4C3I J;  3U3W A;  2DA4 A;  1G2H A;  1JUM A;  2LR8 A;  1AU7 A;  1RR7 A;  1Z77 A;  2BNO A;  3FIS A;  2CJJ A;  2G0E A;  3QQA A;  1ZTR A;  2Y9Y A;  5FKK A;  3TP3 A;  2PUC A;  4UUS A;  1MSF C;  1QPI A;  2AW6 A;  1B8I B;  1JJ8 C;  1RKT A;  5J1Y A;  1JFT A;  3BD1 A;  2BJC A;  5E3N A;  1U9N A;  1NTC A;  2HI3 A;  3S14 J;  1H8A C;  4IHX A;  2K9Q A;  1GUU A;  1JTY A;  3GTK J;  2B5A A;  1MBG A;  2KZ8 A;  3SFI A;  1TWF J;  5EG0 B;  4M3G A;  4YG4 A;  2NVY J;  2XIU A;  3FMY A;  1MBJ A;  4JX4 A;  2R5Y B;  1QQB A;  2M34 A;  2XB5 A;  1PRV A;  3O8H A;  4D7N A;  1UTX A;  2M2E A;  5IOZ A;  4A3M J;  1LQC A;  2JWT A;  1PUF A;  1ETW A;  1MBK A;  1ZUG A;  1PRA A;  4XK4 A;  3KZ3 A;  5C4J J;  1X2M A;  2IEK A;  4UUS B;  5M5Y J;  1RES A;  2AWI A;  3ZQG A;  2VPR A;  5J3L A;  1BW5 A;  3BQY A;  4B1R A;  4JX5 A;  1POG A;  2H8R A;  4A3D J;  2Y9Z A;  2H1K A;  4I6Z A;  4BXX J;  1JKO C;  1JT6 A;  1QVU A;  3DCF A;  5C3E J;  3JRF A;  3ZQC A;  3EUS A;  4QTR A;  1P7J A;  3BDN A;  4JX6 A;  1RPE L;  1GT0 C;  3OQO A;  1JJ6 C;  4O8B A;  5EDN A;  4V2F A;  1FIP A;  4XRS A;  1UG2 A;  1W0T A;  1A6I A;  2PUG A;  1ETO A;  2DA2 A;  1D5Y A;  4GHJ A;  1T33 A;  5EF6 A;  2K40 A;  3S1M J;  1LFB A;  4B4C A;  2K9S A;  4QIW N;  3M3Y J;  2CUF A;  1S7E A;  2R5Z A;  2M8G X;  3JRH A;  3LSG A;  2E1O A;  3GTM J;  1HDP A;  1TWH J;  5A7L A;  2PUB A;  2LYJ A;  1ZR4 A;  1WCM J;  2LYS A;  2FX0 A;  5E3M A;  3JR9 A;  2DMT A;  4A69 C;  4A3F J;  4GQM A;  4X4B A;  2HXO A;  2AXV A;  4DZP A;  3ZHI A;  2EWT A;  1EFA A;  2FD5 A;  1O4X A;  3KJX A;  2E2I J;  3W6V A;  1Y1V J;  3MLF A;  3HBL A;  1TC3 C;  2IVQ A;  2HOS A;  4I6R A;  3HOZ J;  3S16 J;  2LYK A;  1ZZ8 A;  3Q0V A;  2BNN A;  3MKL A;  5E3L A;  3HZI B;  2VKE A;  4QSH A;  3BR2 A;  3HGY A;  2LY9 A;  3SCF A;  4A3L J;  3L1P A;  1U8B A;  4FCY A;  3IH3 A;  4X4C A;  2AUW A;  1AKH A;  2A6C A;  1ZZ7 A;  2O38 A;  3Q0W A;  4A3K J;  1BL0 A;  4FTH A;  1LMB 3;  5GPA A;  2O9L A;  1CJG A;  1HLV A;  2LLK A;  1OCT C;  1SAN A;  4Z59 A;  2MQK A;  5FKL A;  4V2G A;  2NVT J;  5IP6 A;  2Y0S N;  1TWA J;  3GTQ J;  4X4H A;  1JTX A;  3HOV J;  4Y42 A;  4X4F A;  2IAI A;  2FQ4 A;  2LCV A;  2XCJ A;  1OCP A;  2DA3 A;  1SFO J;  1Z0X A;  4MIM A;  2M0C A;  1MH4 A;  3VK0 A;  2X9D A;  3RZO J;  3RKQ A;  3SDG A;  4M3B A;  1GV5 A;  4X4I A;  1ENH A;  3F0C A;  1ZPQ A;  1IV6 A;  5GPC A;  2QCO A;  5FJ8 J;  2XPV A;  3F52 A;  5DTD A;  4YAR A;  2R1J L;  3JRI A;  2PIJ A;  4ABZ A;  1IUF A;  2NOG A;  4UUT A;  1ETV A;  3QF3 A;  4BY1 J;  1CQT A;  1X2L A;  2DMU A;  1OJL A;  3LIS A;  3Q3S A;  1LCD A;  3PO2 J;  2HIN A;  2GRM A;  1ETQ A;  1X58 A;  1BDH A;  1JKQ C;  2N8G A;  3BR5 A;  3OSF A;  3HEF A;  5F1J A;  2LKX A;  3C2B A;  1B72 B;  2XJ3 A;  3BR3 A;  4BBR J;  2YU9 J;  3HB9 A;  4BY7 J;  4AYB N;  2HOT A;  3G1M A;  5EZH A;  4DYR A;  1HOM A;  3LFP A;  3FIW A;  1GDT A;  5IYD J;  2DA6 A;  4RBO A;  1YRN A;  1H88 C;  1JKR C;  4DYQ A;  4PU4 C;  2HYJ A;  4J1X A;  1MSE C;  1RIO A;  3BG9 A;  2MSY A;  4RDU A;  4AUX A;  2O49 A;  3R1F A;  3IV5 A;  2Y2Z A;  2LYR A;  5F27 A;  1IRZ A;  5EGO A;  2KT0 A;  3G5G A;  2I10 A;  1I6H J;  4EEF G;  3M4O J;  1IDZ A;  1IC8 A;  4W97 A;  1NEQ A;  2XGC A;  1PNR A;  3NAU A;  1L1M A;  2KDZ A;  1ZZ9 A;  2DA1 A;  1MBH A;  4A3J J;  1NK3 P;  2R63 A;  1PER L;  2DMP A;  2FJ1 A;  5FKN A;  1F43 A;  1BDI A;  3S2D J;  1ZZB A;  4D7M A;  1UXC A;  2O4A A;  3JRD A;  2KEI A;  2ME0 A;  2BNM A;  1H89 C;  2TRT A;  2TCT A;  3I4M J;  2MEZ A;  1ZQ3 P;  3HOW J;  4C3H J;  3O9X A;  1DU0 A;  2WIU B;  1Q1V A;  3DEW A;  2L8N A;  1HCR A;  3DNV B;  5FKO A;  2KEK A;  5IP7 J;  2R93 J;  4XIC A;  5EGO B;  4A3E J;  4M6V A;  3BR6 A;  3NAR A;  2E2H J;  1QPZ A;  4MLO A;  2DA5 A;  3HM5 A;  4FE7 A;  1WIZ A;  1IG7 A;  2LD5 A;  2R0Q C;  2L7Z A;  1DWK A;  3GN5 A;  4X4E A;  4D5C A;  3JRB A;  1VFC A;  1PUF B;  1ZZC A;  2VKV A;  2PUF A;  3S17 J;  3ZHM A;  3A02 A;  2EZH A;  1HF0 A;  3JXB C;  3CQZ J;  4X1E A;  1APL C;  2JN6 A;  4A3C J;  1T56 A;  4XID A;  2EQR A;  1MH3 A;  2WB1 N;  2XB0 X;  3A03 A;  3O8G A;  3QPS A;  3S2H J;  3GTP J;  3B6C A;  3A01 A;  4J1W A;  4PU3 C;  2IVG A;  2AXZ A;  4MCX A;  1ITY A;  1DU6 A;  4FN3 A;  5JLW A;  4J19 A;  2WUS R;  1BA5 A;  1MBF A;  2VI6 A;  2ID3 A;  1XS9 A;  1VI0 A;  1GV2 A;  1WH7 A;  3IH2 A;  4X4D A;  3JXC L;  1XWR A;  2E19 A;  1FTZ A;  2JJ7 A;  2HOA A;  3CCY A;  3QPL A;  5K7H A;  1VND A;  1WH6 A;  2IU7 A;  1LFU P;  2IBD A;  2COB A;  2R92 J;  1VF9 A;  4IHV A;  1QVT A;  3K2A A;  2R5Z B;  5F04 A;  1SQ8 A;  1ZZ6 A;  4GFB A;  3HGG A;  1E3O C;  3A01 B;  1R69 A;  1NER A;  3OQN A;  2JK3 A;  1GVD A;  4A3I J;  1NK2 P;  1OSL A;  3TP0 A;  1WET A;  2IVB A;  3BTI A;  3GBG A;  4M3F A;  3H3V K;  1POU A;  2FJR A;  1YSE A;  4CYC A;  3S1R J;  2LYL A;  2EF8 A;  5C4X J;  4YG1 A;  3IH4 A;  4LOC A;  2KEJ A;  1JT0 A;  4FIS A;  1WH8 A;  2XI8 A;  3HOX J;  2ECB A;  3ZQL A;  2CUE A;  3HKZ N;  3OSG A;  3I4N J;  4PU7 A;  5FKM A;  2Y30 A;  3GBF A;  1FIA A;  2L7M P;  1ETY A;  3WHC A;  1TWG J;  3JRA A;  2JVL A;  2LYP A;  3ZQF A;  1W0U A;  2WAQ N;  2EBY A;  4PU8 A;  3PM1 A;  2GM4 A;  3GTL J;  1AKH B;  1JFS A;  3CEC A;  2X6O A;  1JH9 A;  2D5V A;  3H5T A;  1ADR A;  3LSR A;  3S1Q J;  2AHQ A;  5K7F A;  1P7I A;  4D5F A;  1U9O A;  1IDY A;  4C2M J;  3BS3 A;  2LFB A;  4C3J J;  2NS8 A;  1RPW A;  2CQX A;  2PE5 A;  2YS9 A;  5IYC J;  2HSG A;  2WV1 A;  2DA7 A;  4M3E A;  3LNQ A;  1ZAY A;  3UFD A;  4YBA A;  3MVP A;  3HOY J;  3LSJ A;  5E3O A;  1EF4 A;  2VUM J;  4B3A A;  2LYQ A;  1PRU A;  3Q0U A;  3OQM A;  3F6W A;  5IOY A;  1VPW A;  4JYK A;  1WPK A;  3RZD J;  1QQA A;  1IGN A;  2X48 A;  3TED A;  2ICT A;  3FK6 A;  2OPT A;  1LLI A;  5EG0 A;  2HDD A;  3ZOB A;  2AO9 A;  1QP4 A;  3ZKC A;  2R5Y A;  2ICP A;  9ANT A;  1IJW C;  2XGE A;  1JUP A;  3FK7 A;  3ZQI A;  4FE4 A;  4IA8 A;  4MFE A;  4Z58 A;  5J1R A;  2JA8 J;  2EBI A;  3BR1 A;  1JKP C;  1F36 A;  5IYB J;  1A5J A;  4MCT A;  3MN2 A;  5F0F A;  2OF7 A;  4JP0 A;  2EZI A;  1YRN B;  4Y52 J;  1K83 J;  1RKW A;  3TW6 A;  3CMY A;  4IEJ A;  5HOD A;  2GZU A;  1JUS A;  2JMW A;  4W1U A;  3F51 A;  4JCX A;  3S1N J;  2PPX A;  2O8K A;  2OR1 L;  5DS9 A;  1DW9 A;  1X57 A;  3BTL A;  1OFC X;  2HQ5 A;  4BKX A;  3PXP A;  3SCH A;  3BTC A;  2ECC A;  1HDD C;  1UMQ A;  2EH3 A;  3B6A A;  1Y9Q A;  4I6U A;  4Z5C A;  2LVS A;  2LTP A;  3BQZ A;  4I8T A;  2Y31 A;  3OMT A;  4IVZ A;  4X6A J;  3QWG A;  1I50 J;  3BT9 A;  4DYC A;  1BJZ A;  2LP0 A;  4DW6 A;  2NVQ J;  2XRL A;  1WH5 A;  3JRC A;  1UXD A;  5EZG A;  1WI3 A;  2EZL A;  2XPW A;  4XRM A;  5EYR A;  2ME6 A;  2CU7 A;  2YUS A;  1B0N A;  1LE8 A;  3JRE A;  2IV1 A;  2QF7 A;  2PUD A;  5M3M J;  2LK2 A;  4DZJ A;  3BG3 A;  1I3Q J;  2CQQ A;  2PUE A;  1XC5 A;  3S15 J;  3S8Q A;  2DTZ A;  2NS7 A;  1XG1 A;  2MW8 A;  3BG5 A;  4I76 A;  1JGG A;  1Y7Y A;  2OFY A;  3KXA A;  1RZR A;  3GN5 B;  1U78 A;  2B63 J;  4FBI A;  5C44 J;  2CSF A;  4A3B J;  2IUO A;  3QYX A;  3VPR A;  4AC0 A;  3CRO L;  3H0G J;  3FYA A;  3WHB A;  3PO3 J;  4HNV A;  5K98 B;  4NDL A;  3JRG A;  5F0C A;  5M5X J;  2JCG A;  3OP9 A;  1Y1W J;  2JA6 J;  1LE8 B;  5F08 A;  3GTG J;  4NDW A;  5K7Z A;  5IPA A;  2E2J J;  2DMQ A;  2DN0 A;  1QP7 A;  3HDD A;  5IP9 J;  5FLM J;  1ETK A;  2ZB9 A;  3FKI J;  4XRS G;  1FTT A;  3JXD L;  4BBS J;  5JLX A;  2MGQ A;  3QQ6 A;  4L5E A;  2HXI A;  1ZKG A;  2L7F P;  4Y7N J;  2GBY A;  3RQI A;  2ID6 A;  4X4G A;  3GTJ J;  4IHY A;  3LSP A;  3K7A J;  1K61 A;  4A3G J;  1R9T J;  4A93 J;  1FEX A;  1TWC J;  3CLC A;  2XSD C;  1RZR D;  1LCC A;  2ELK A;  4M3D A;  3SCG A;  1QP0 A;  5BNG A;  3OIO A;  1BW6 A;  3SJM A;  2L9R A;  3G1O A;  1JWL A;  2O7O A;  3E7L A;  2K9N A;  2M9H A;  3OOU A;  1WGX A;  4MFD A;  5F0H A;  3G1L A;  3FYM A;  5GP9 A;  3TRB A;  1ZVV A;  2PMZ N;  2RAE A; 
#chains in the Genus database with same CATH topology
 3CJQ B;  1XDU A;  4KIF A;  4S0H B;  4CYC B;  2EIK H;  3FX3 A;  3KP7 A;  4Q4Z F;  3OS1 A;  4PDK A;  2E5N A;  1ZR2 A;  1D3Y A;  3U1K A;  4UB8 C;  1X4P A;  3KYL A;  2L0K A;  3GLL A;  4ITV A;  4LLL A;  4JQD A;  1KYZ A;  2MC3 A;  1B8I A;  4PJL A;  3QPT A;  4F8D A;  4EJT A;  1IRF A;  5DCM A;  1ZK8 A;  3BZK A;  2PUA A;  2DJN A;  1K6Y A;  3DBL B;  3I71 A;  6PAX A;  3J80 K;  2MD5 A;  3K6G A;  1EH6 A;  1RET A;  4XRF A;  4YG7 B;  4L5J A;  2JA5 J;  1G2H A;  4I2O A;  2LR8 A;  2XGX A;  4ZTF A;  1RR7 A;  1V3F A;  2NYX A;  2Y9Y A;  3QQA A;  3IAM 2;  5LGT A;  1MFQ C;  2LC2 A;  2OZ6 A;  5LEK A;  4UUS A;  2VL8 A;  1B8I B;  4XL9 A;  1QO0 D;  2JRT A;  2DDA A;  4HG2 A;  5GAG J;  1H8A C;  1JTY A;  2K5C A;  5DCM B;  5E1Z B;  4A0Y A;  1BC8 C;  4PSX A;  3GUD A;  2KZ8 A;  3WG9 A;  3QYF A;  3FMY A;  2V6C A;  1IAW A;  3N4M A;  3PFY A;  3T8R A;  3M9A A;  1PRV A;  1LVA A;  3O8H A;  4EKG A;  1I5Z A;  4D7N A;  1J9I A;  2JWT A;  1PUF A;  2LNM A;  2VE8 A;  2ZXW H;  2OJE D;  4OAY A;  1BC7 C;  4L9T A;  1X2M A;  2IEK A;  4UUS B;  5M5Y J;  1U8R A;  2E34 A;  1UEL B;  2NOJ B;  2PXF A;  3ZR8 X;  1R1U A;  2VN2 A;  5TGT A;  2F2E A;  4B1R A;  1HC8 A;  1R49 A;  2DJI A;  4B44 A;  4A3D J;  1BIA A;  1XMX A;  3QAH A;  4UB6 C;  4ESF A;  1JT6 A;  3DCF A;  3CP2 A;  2L4M A;  1FBQ A;  2YR2 A;  5B1A H;  3PUF A;  1GT0 C;  1RPE L;  4EJV A;  4O8B A;  4BDZ A;  5FO5 A;  3L00 A;  2L5Q A;  3CCU I;  1IN7 A;  1E3H A;  5EF6 A;  3QOE A;  1LFB A;  3P9K A;  2DK5 A;  2BZT A;  2K9S A;  3P7N A;  2CUF A;  2K3F A;  2VBX A;  4QIW N;  5KHD A;  3BC8 A;  4ESJ A;  2ZSI B;  3J81 Z;  2VC0 A;  3LSG A;  4NQW B;  2QQ9 A;  2RQP A;  1TWH J;  4B8X A;  2GXB A;  2O0Y A;  2M5W A;  4A69 C;  4KYW A;  4Y33 A;  3BCB A;  2LYC A;  4UXN A;  4XN0 A;  4DJA A;  3ZHI A;  1EFA A;  3IAS 2;  1O4X A;  2PBI A;  2HOS A;  2XIG A;  2HZD A;  2A68 F;  4CCL A;  3S16 J;  4ON0 A;  1ZZ8 A;  4UVB A;  3Q0V A;  4BUP A;  2GA1 A;  5KAF C;  1P92 A;  2LY9 A;  3SCF A;  2BY0 A;  4IL6 C;  2DDB A;  5JFR A;  4FCY A;  1QPM A;  3LQQ A;  3K1P A;  5D6E A;  3GZD C;  1TT0 A;  2DTR A;  5E79 C;  3BLY A;  3HRT A;  3I53 A;  1BL0 A;  1YX3 A;  1T39 A;  1OCZ H;  2O9L A;  1LFP A;  2DT7 B;  2LLK A;  1OCT C;  2KDO A;  2VJJ A;  4HEA 2;  5ERI A;  5FKL A;  2VJ5 A;  5IY5 H;  4PJN A;  4LMY A;  3K69 A;  1U5T B;  5D5V B;  3WE3 A;  2VJI A;  4JQF A;  2W84 A;  3AG2 H;  2M1B A;  5DV5 A;  2DA3 A;  3B02 A;  3LSK A;  3DBH B;  3DTI A;  1N25 A;  3RZO J;  3SDG A;  3VFZ A;  1IV6 A;  4KNY A;  4KUM A;  1FZP B;  2IS4 A;  4XOP A;  2XPV A;  1WJB A;  4Y3O A;  4C9Y A;  2R1J L;  3JRI A;  4ABZ A;  1IUF A;  1S8N A;  2GWR A;  4UUT A;  1JE8 A;  5TJJ A;  3HOT A;  4IHS A;  2DBB A;  4BY1 J;  3KPH A;  4AIJ A;  4A12 A;  2DMU A;  3WTV C;  3FXM A;  2MLK A;  5JVT A;  3VOD A;  2P7V B;  5JHF A;  4A0Z A;  4ER6 A;  3V7S A;  2VC1 A;  2EV0 A;  1FYL A;  5HS7 A;  1ZG3 A;  2XC7 A;  4BBR J;  2YU9 J;  2PXP A;  2MA3 A;  1P9Q C;  3HB9 A;  2XF7 A;  1YQA A;  3G1M A;  5DCF A;  2HPI A;  2WBM A;  4OMZ A;  2F5F A;  4WXH A;  3LFP A;  2EJR A;  2DA6 A;  4Y13 A;  3RCO A;  1YRN A;  3DTE A;  2WAE A;  1L3L A;  2HYJ A;  3CCV I;  3D5L A;  4N9I A;  4HRA A;  4EGZ A;  4E70 A;  4RDU A;  1LDJ A;  1EA3 A;  1YJN I;  5BQT A;  3IV5 A;  3SQN A;  4G6D A;  3T8T A;  4YEL A;  3E97 A;  5JHU A;  1FOX A;  2CV1 A;  1F5T A;  1BI2 A;  4CXF A;  3M4O J;  3QOW A;  1ZEL A;  4W97 A;  2J5O A;  1P6R A;  4OMY A;  1KU7 A;  1IO2 A;  4M6X A;  1ZZ9 A;  1LVK A;  4L9N A;  2FJ1 A;  1BI3 A;  2F4I A;  2X4H A;  3S2D J;  4LLG F;  4P1W A;  2RNJ A;  4CHU A;  2HDW A;  1UXC A;  2O4A A;  3NXH A;  3RPU A;  2KEI A;  2BNM A;  2JA2 A;  1SD4 A;  1YLF A;  5ICE A;  1YW7 A;  2M8E A;  3TKY A;  4ZYD A;  1ZQ3 P;  3E6C C;  3I4M J;  1TNS A;  1Q1V A;  4P9F A;  5L3G A;  1J7K A;  3NRV A;  2ISZ A;  1V5G A;  2L3D A;  3DNV B;  1G3Y A;  4ANJ A;  2EIM H;  2R93 J;  1W36 D;  4XKW A;  4R8H A;  4WCG A;  1T2K A;  4GYG A;  2DQL A;  1HW1 A;  3TO6 A;  4YFX F;  2E2H J;  1NHA A;  2IT0 A;  3M7G A;  2EA2 A;  2L7Z A;  4R79 A;  1ZZC A;  4AID A;  1RUN A;  2VKV A;  3ZHM A;  2MC4 A;  3F72 A;  5GAG i;  1TNT A;  4LK0 F;  1HF0 A;  4RAF A;  3DU5 A;  1U2W A;  3B73 A;  3PJR A;  4XID A;  2XB0 X;  4Q48 A;  3QPS A;  1J59 A;  4PK4 A;  2MAB A;  3B6C A;  3TDZ C;  3EYY A;  4N0B A;  1S7A A;  1E2X A;  3QU6 A;  2IVG A;  4EJO A;  4UNO A;  2EFN A;  2LOO A;  3I56 I;  1I3A A;  2KRF A;  1J75 A;  5JLW A;  4ETS A;  1MBF A;  3RIR A;  1USS A;  1VI0 A;  1WH7 A;  2AQF A;  4I0B A;  3RSN A;  4XLP F;  2HOA A;  4LIU A;  3L2U A;  1WJC A;  4KJZ A;  4CSW A;  3QYB A;  2IS1 A;  4HZF A;  1PJR A;  2YU3 A;  1MND A;  1Y6I A;  2NNN A;  3HJE A;  1SQ8 A;  1ZZ6 A;  4B3X A;  3HKZ A;  4M72 A;  4O6J A;  2CUZ A;  1E3O C;  1Y0N A;  2QGU A;  2LH9 A;  2VIX A;  1R69 A;  1NER A;  2JK3 A;  4F55 A;  1G3W A;  4V19 K;  2IVB A;  1X1B A;  1VQK I;  4M3F A;  1QZY A;  4PJ0 C;  3H3V K;  2K86 A;  3ULQ B;  1YJW I;  2M7B A;  2LYL A;  1L0O C;  4LOC A;  4FIS A;  3SDB A;  3A0H C;  4OIQ F;  3I4N J;  5FKM A;  1GHC A;  4F92 B;  4OIO F;  3DLA A;  2M30 A;  3LSI A;  1ETY A;  5TRD A;  2R7D A;  3H1C A;  3ZQF A;  1BR1 A;  5CQE A;  2GIZ A;  1I1S A;  4PU8 A;  3PM1 A;  4EM0 B;  1U3E M;  2GM4 A;  1JFS A;  3CEC A;  5HNH A;  3ABM H;  2X6O A;  2KIQ A;  5EEG A;  1B59 A;  1LPQ A;  3H5T A;  4M9X A;  2NRA C;  1X3U A;  3VYR B;  3CTA A;  3S1Q J;  2KMU A;  4L18 B;  1P7I A;  1OCO H;  2DQR A;  3VYS B;  4D5F A;  5DM6 F;  3EQL F;  4CCK A;  5DSX A;  3KE2 A;  3BS3 A;  2LFB A;  4C3J J;  2W25 A;  2QQ8 A;  5EJC A;  1R58 A;  2CQX A;  3SZT A;  2L1P A;  2HSG A;  4M3E A;  4EM2 A;  4LB6 B;  4XQF A;  4ZDO A;  2FML A;  3DU6 A;  4YBA A;  1X3Z B;  1QZZ A;  1A35 A;  4B3A A;  1OCC H;  2H8W A;  1RR8 C;  2ZJ2 A;  3L2C A;  1A36 A;  3OOP A;  1AOY A;  2YBD A;  3F6W A;  5FD5 A;  5HLG A;  3ZPX A;  3HOS A;  2FNA A;  1IGN A;  3OR1 C;  3LAJ A;  3V4G A;  4BHP A;  2R7O A;  5GAH i;  4EVI A;  1SMY F;  2HDD A;  4PCQ A;  3K4J A;  3ZKC A;  2R5Y A;  1DUX C;  2ICP A;  3TL4 X;  3KEO A;  3FKJ A;  1RUO A;  3ZQI A;  4CGZ A;  4Z58 A;  2ZJQ F;  2M3A A;  3BR1 A;  4DIQ A;  5KVR A;  2LY2 A;  3BPV A;  5F0F A;  2BOL A;  1SVL A;  4JP0 A;  2Y75 A;  1WZ2 A;  1LB2 A;  3I5U A;  2FUG 2;  5FFZ A;  3JSP A;  1TP4 A;  1K83 J;  2CUJ A;  3LFK A;  3CMY A;  5HOD A;  1W4M A;  3FMS A;  1JUS A;  4BAC A;  2PXQ A;  2ZXH A;  3G6E I;  3V8J A;  2Y48 A;  2ZNY A;  4JCX A;  4IRH A;  5LBQ A;  3S1N J;  3HRM A;  2OR1 L;  5DS9 A;  2ISY A;  5FLX K;  4FHT A;  1DW9 A;  3LA7 A;  1VQ6 I;  2LG4 A;  1OFC X;  2IGO A;  4BKX A;  4KDP A;  3KZY A;  3WTX C;  1D5V A;  1UMQ A;  2GXG A;  2Q0O A;  4Z5C A;  2LVS A;  2Y31 A;  3OMT A;  4LJZ F;  3MZ8 A;  3BT9 A;  4HQE A;  2V1X A;  2BHY A;  4ZJZ A;  2VEO A;  2LRE A;  1UCR A;  5EZG A;  2AQE A;  2E5Z A;  1MNE A;  1Y39 A;  3WU1 B;  2G9W A;  1YG2 A;  2YUS A;  2ZFW A;  3W2W A;  1B0N A;  1BR2 A;  3RPU D;  5FD6 A;  5LFA A;  5HNF A;  2GA2 A;  5K1Y A;  3JCU C;  4BJT A;  1S29 A;  3ZMD A;  2MH9 A;  4FET A;  4IKF A;  2CQQ A;  1R36 A;  2PUE A;  4U7D A;  3G73 A;  4IOA F;  4RB1 A;  2OFY A;  4ZYG A;  3KXA A;  2L7K A;  1U78 A;  1YOV B;  2Q1Z B;  2B63 J;  2CO5 A;  4AD9 A;  3K4M A;  2UXN A;  3ELK A;  5E18 F;  1ON1 A;  2QUF A;  5H6R A;  3WHB A;  4HA8 A;  4RM2 A;  3DKW A;  3UR3 C;  2F6C A;  3KZI C;  1UAA A;  2BXZ A;  2O8X A;  2L54 A;  3NRO A;  4A0X A;  5K7Z A;  4M9S A;  4E6K G;  2DMQ A;  2X85 A;  2OQG A;  3K4N A;  1QZE A;  1WJA A;  2WAQ A;  5IP9 J;  1SC7 A;  1FTT A;  3V8K A;  1M1E B;  3E3V A;  2A05 A;  2E60 A;  3KP2 A;  2R7R A;  2DT6 A;  5JLX A;  3TBI A;  4BBS J;  4L5E A;  1R5H A;  1ZKG A;  2HXI A;  2PXE A;  2P4W A;  2V3C C;  4G8X A;  4PFO A;  1MKM A;  4A3G J;  1FEX A;  4OIP F;  4A93 J;  2FA5 A;  1N78 A;  1HKS A;  3BJO A;  1QBJ A;  4M3D A;  1E3P A;  4OIR F;  3MKW B;  3SCG A;  1WI9 A;  2ZME B;  1T0F C;  4LG0 A;  3G1O A;  2O7O A;  2ADU A;  3KCC A;  4GYI A;  2K9N A;  2K9L A;  3OR2 C;  4YEJ A;  4YFK F;  5F0H A;  1ZVV A;  2NVX J;  2EZK A;  4PGH A;  4GCV A;  5FLV A;  1B72 A;  2AXU A;  2JUC A;  3TW7 A;  3BPX A;  3R4K A;  2Z99 A;  1ETX A;  5ED4 A;  4MO7 A;  2BV6 A;  3CZ6 A;  3BRO A;  2HKO A;  4ZYH A;  1TLH B;  3AL0 B;  4Z5D A;  5AIQ A;  3F6O A;  2CW0 F;  3UKG A;  1X2N A;  4XN3 A;  1P4W A;  2KFD A;  2PXT A;  3O3K A;  1IZ1 A;  4IWR A;  3SXY A;  3RYP A;  2GRL A;  1KQ9 A;  2CRG A;  1PYV A;  4YII A;  2RVC A;  1WVR A;  2V7F A;  3J80 Z;  3CCS I;  5M5W J;  1MMN A;  2O61 A;  3CLC A;  2EA4 A;  4OB4 A;  2GOX B;  3CDL A;  5J1U A;  4IQ4 A;  3G7D A;  1MBE A;  2XPU A;  3HRS A;  1MMD A;  1REP C;  1JUM A;  3BJ6 A;  4HW0 A;  2EFP A;  2CQK A;  2K7L A;  2G0E A;  4NB5 A;  1ZG5 A;  3TP3 A;  2HTS A;  1XGN A;  3ZMZ A;  3TEL A;  2W00 A;  4QLC U;  2AW6 A;  3FMR A;  3PSF A;  5D8K B;  1E17 A;  4GXO A;  4LFU A;  3ZN1 A;  2HVQ A;  5IT9 K;  1JFT A;  3BD1 A;  2BJC A;  4ENK A;  2VE9 A;  3GTK J;  2B5A A;  1MBG A;  2OUM A;  1XGO A;  1Z67 A;  1DGW Y;  3L09 A;  5EG0 B;  2CG4 A;  1SEU A;  4M73 A;  1QQB A;  2IA0 A;  1OYW A;  2Q2E A;  4RS8 A;  2M2E A;  1F1Z A;  2V9K A;  3CCE I;  1ETW A;  2CSO A;  2KPM A;  3BP8 A;  4YFN F;  5J4Y A;  5GAE J;  3KZ3 A;  1ZRE A;  2WA0 A;  3I3L A;  4RLQ A;  1PP7 U;  2DPD A;  2XKP A;  1MMS A;  1RES A;  1KU3 A;  4RM3 A;  4KMF A;  3H3U A;  1BW5 A;  3L2W A;  1MIJ A;  4P96 A;  1G59 A;  2P7C B;  5DTQ A;  1WWX A;  2AXL A;  2W57 A;  4I6Z A;  3MQ0 A;  1QVU A;  3JRF A;  3ZQC A;  1OLT A;  1T6S A;  3MWM A;  4E4H A;  1UHM A;  3C18 A;  4X0G A;  2F5V A;  4AVP A;  2V4J C;  5DUI A;  3K70 D;  2HR3 A;  1OCR H;  1JJ6 C;  1HBX G;  3OQO A;  2KRC A;  1FIP A;  5CVV A;  4XRS A;  1WRJ A;  2XAG A;  2QA4 I;  5A2Q Z;  2PUG A;  3AKZ A;  1D5Y A;  3OYF A;  4CZZ A;  2L4A A;  3S1M J;  3DBR B;  1OR7 A;  3M3Y J;  2K9M A;  1S7E A;  5DUK A;  2R5Z A;  4E7J A;  2M8G X;  3JRH A;  1WJD A;  2E1O A;  2XAS A;  3BCA A;  3GTM J;  1HDP A;  3C2G A;  2PUB A;  2E1N A;  2QYO A;  3WU2 C;  1ZR4 A;  1WCM J;  2LYS A;  5HDK A;  5AIP A;  1MJA A;  4AIK A;  4YG2 F;  1G6N A;  2XAQ A;  4X4B A;  4IF4 A;  2I5U A;  2HXO A;  1YS7 A;  2FD5 A;  3KJX A;  2E2I J;  3HUG B;  4S05 A;  2UXX A;  2QBY A;  3ABK H;  5BPD A;  2CW7 A;  5F64 A;  4O3M A;  3HOZ J;  2LYK A;  3NDB B;  1UZC A;  1T98 A;  4QSH A;  3HL2 A;  1YJ9 I;  4BS9 A;  3K4L A;  5FB2 A;  5LD2 C;  3SYT A;  1EJ9 A;  2PMZ A;  3CJT B;  1W5C C;  3S2W A;  4ESB A;  1VQP I;  3GFL A;  1FT9 A;  3IH3 A;  5E1W A;  1MGT A;  2AUW A;  2F5E A;  3CUQ B;  4BHB A;  3L9F A;  4RA2 A;  1G8X A;  5J47 A;  3REO A;  2LBF A;  5CPR B;  3CF2 A;  2MQK A;  4XMY A;  4F7Z A;  2Z33 A;  3EDP A;  2STT A;  5IP6 A;  1R4N B;  3GTQ J;  3MCZ A;  1JTX A;  3HOV J;  4CO8 A;  4Y42 A;  4BL0 B;  2QBY B;  5F6F A;  3M8J A;  2FQ4 A;  1SFO J;  1Z0X A;  3MZY A;  3RDI A;  1BI1 A;  2IA2 A;  3RKQ A;  2BW3 B;  4X4I A;  2LF8 A;  5GPC A;  4WVL A;  3F6V A;  2PMU A;  3PNT A;  5L3F A;  3GYH X;  4CCM A;  3FHZ A;  3F52 A;  3QFI A;  1XSX A;  4YAR A;  2PIJ A;  3S8P A;  1ETV A;  3DPL C;  3TOA A;  4BYY A;  2E1M B;  5LGN A;  3Q3S A;  3KET A;  2LLV A;  3PO2 J;  2DO7 A;  2X1E A;  4DBR A;  3BR5 A;  1MD0 A;  2ZO4 A;  1WQ2 A;  3HEF A;  1JHH A;  2V1D A;  3KZZ A;  2R7S A;  3C2B A;  4KA4 A;  5BMZ A;  2XJ3 A;  2GIV A;  1FC3 A;  1X1P A;  3H92 A;  3TDU C;  2KQR A;  2IS6 A;  5BPI A;  2KP6 A;  5EZH A;  4DYR A;  1GDT A;  3H5N A;  4PZJ A;  4RBO A;  3DPU A;  1NG7 A;  2OU2 A;  4DNC A;  2HQR A;  2EV5 A;  3PUB A;  1KGS A;  4C30 A;  1X4O A;  4DYQ A;  4PU4 C;  1LNW A;  1MSE C;  2MSY A;  1HQC A;  2LYR A;  4HAM A;  1CF7 A;  3J7Z I;  3DLL F;  4L9J A;  4ASN A;  2KT0 A;  4XSZ F;  1IDZ A;  4EEF G;  1IC8 A;  1NEQ A;  2RGV A;  3NAU A;  3LA2 A;  2CQ7 A;  1NK3 P;  2HS5 A;  3O6B B;  3E6D A;  4FX0 A;  5E8G A;  2IXS A;  3LSH A;  2DMP A;  5FKN A;  1BDI A;  4BEH A;  1KYW A;  3CME I;  4H0E A;  1ZZB A;  3F3X A;  3ME5 A;  4Q47 A;  1O57 A;  4ZDL A;  3JRD A;  2ME0 A;  1H89 C;  2OC6 A;  3VEP A;  2TCT A;  2DFH A;  1SVM A;  4CCJ A;  1VTN C;  1GXP A;  4C3H J;  3JAM K;  2HTJ A;  2RV8 A;  3CLO A;  4HF2 A;  4AU7 A;  2L8N A;  2P6T A;  1V5E A;  3PL8 A;  3TRB A;  1HCR A;  1W5S A;  3FXJ A;  5L3E A;  2KIS A;  4XIC A;  2PQ8 A;  1OYI A;  3CUO A;  3BR6 A;  3M1C A;  2BY2 A;  3WTT C;  3GCM A;  3OYK A;  1ACI A;  4HDV A;  2PMH A;  4DBQ A;  2KZG A;  2LD5 A;  1IG7 A;  1JHF A;  1R1V A;  5DTR A;  4X4E A;  3H35 A;  1PUF B;  2PUF A;  4ER3 A;  2EZH A;  3L2V A;  1XGM A;  1RC9 A;  1A31 A;  2JN6 A;  1WKM A;  3F8F A;  5ILS A;  3CMA I;  1YIJ I;  3S2H J;  2CYY A;  4PJM A;  3GTP J;  4WXD A;  3G3Z A;  5FRN A;  2YPR A;  4MCX A;  1ITY A;  1P4A A;  2IVM A;  2FMY A;  2IGK A;  3GFJ A;  2ICW G;  3F8C A;  2RC4 A;  3S3O A;  2WUS R;  1YI2 I;  2ID3 A;  4OBM A;  3FBI B;  1XWR A;  4HQM A;  1V54 H;  2HDC A;  3RKX A;  4E7H A;  3QPL A;  2M45 A;  5K7H A;  2H94 A;  4KIS A;  2IU7 A;  4LK1 F;  3PQJ A;  1VF9 A;  1QVT A;  2O3F A;  3P9C A;  4XLC A;  4XKV A;  2DT5 A;  4IPA A;  3GFI A;  1P2F A;  2EK5 A;  1J2X A;  2OZU A;  3LL7 A;  2XVC A;  1R5I D;  1OSL A;  1WET A;  2M4H A;  3GBG A;  4FQG A;  1POU A;  2DCE A;  3BZ6 A;  4BJ5 C;  3W6J B;  5FGM A;  2ZME C;  2ZSH B;  3M1E A;  3R09 A;  4EM1 A;  3S1R J;  2OTJ I;  4G6T B;  2KEJ A;  3TFL A;  4YRV A;  2DYR H;  2VOP A;  2XI8 A;  2FU4 A;  3HPG A;  4P55 A;  2CUE A;  3ZQL A;  1PDN C;  4XKC A;  3OSG A;  3OYN A;  1LDK B;  2PJP A;  3WU0 A;  2BE5 F;  2BGC A;  3BOQ A;  3L2Q A;  1V55 H;  1I1G A;  3LMM A;  1W0U A;  1A04 A;  5DT2 A;  2EBY A;  2JRM A;  4BJ6 C;  5KNL A;  2MLG A;  4IOC F;  3AL0 C;  3P9I A;  4AYB A;  1JH9 A;  3ECO A;  2D5V A;  1IN5 A;  1ZLJ A;  2HYF A;  3ZMV A;  3OYC A;  2HNH A;  1IDY A;  2DOA A;  1RPW A;  4UHT A;  3IKT A;  2PE5 A;  2E1C A;  3WTZ A;  4HNU A;  3LNQ A;  1ZAY A;  5EEH A;  5JVG F;  2JVG A;  3H5A A;  4BQN A;  2M4K A;  3UFD A;  2L9S A;  3J7A O;  4L0Z B;  3CDI A;  3N05 A;  1FBU A;  2A3S A;  3C1D A;  5IOY A;  1QHH D;  3CF5 F;  2R7T A;  1WPK A;  3H9J A;  2CFO A;  4LD5 A;  3T1B A;  3M8E A;  5BOX A;  2J5P A;  2XXP A;  2ICT A;  2J7U A;  3FK6 A;  2OQR A;  3FBN B;  3DV8 A;  4FAS D;  3ZOB A;  2AO9 A;  2XAU A;  3ZCO A;  4NC7 A;  4ENM A;  1H9G A;  4BE1 A;  2CW8 A;  2X1D A;  3GFM A;  9ANT A;  1IJW C;  5FRM A;  2VT2 A;  1ZH5 A;  1ZGJ A;  2XGE A;  4KT5 C;  2JT1 A;  1F4K A;  5E8I A;  4FE4 A;  2HCN A;  4U87 A;  1HSJ A;  5J1R A;  2DI3 A;  1DPR A;  2JA8 J;  2ZJR F;  1FPQ A;  5IYB J;  3NQO A;  1MMA A;  2CMP A;  1OMI A;  4WX9 A;  1YRN B;  1RKW A;  3SR4 A;  2IW5 A;  2ZBK A;  1I6X A;  5CJ9 A;  5H20 A;  2HQA A;  2VAS A;  3ZMS A;  3CD6 I;  1W7P A;  1D1B A;  3RI4 A;  1MW7 A;  3RKY A;  1D0Z A;  1LQ1 A;  4MNU A;  2R7U A;  1X57 A;  2HQ5 A;  4HST A;  3CO6 C;  2XF6 A;  1K4T A;  1HDD C;  1K78 A;  1YFH A;  4OU0 A;  4KMU X;  3I59 A;  3OYD A;  2F48 A;  3C3W A;  2QEX I;  3DEE A;  4X6A J;  2QLZ A;  5FFX A;  1J09 A;  1SD6 A;  1T95 A;  3QWG A;  3HXL A;  1IRG A;  3FM5 A;  1S9H A;  3G0T A;  3IL2 A;  4G7O F;  1LDD A;  4XRM A;  1R1T A;  1U6G A;  2V79 A;  4XR6 A;  2VXZ A;  2ME6 A;  5LEJ A;  2CU7 A;  4D1Q A;  1LE8 A;  3JRE A;  3K9T A;  1E0E A;  3OYG A;  1R00 A;  2X51 A;  4U88 A;  5M3M J;  2IRF G;  2LK2 A;  1YIT I;  2RNG A;  3BG3 A;  1I3Q J;  2M0M A;  2NNY A;  1K7A A;  3A0B C;  3I59 B;  4EK9 A;  2O6G E;  1JGG A;  3GZ5 A;  3OYA A;  2NVU B;  2HWV A;  4J01 A;  3BDD A;  3M8F A;  3VOE A;  3BG6 A;  1MZB A;  3EUH A;  2JUG A;  3GVA A;  4EJU A;  3WTU C;  2IUO A;  1QGP A;  1J5Y A;  4ZC3 A;  1Y8R B;  4AC0 A;  4MGR A;  1AA7 A;  1G3T A;  1IW7 F;  2MH2 A;  4HNV A;  5M5X J;  3J81 K;  1ZRF A;  2JCG A;  3OP9 A;  4HYE A;  1LE8 B;  4NDW A;  1O3T A;  4I7H A;  2H09 A;  2QZ8 A;  2L9V A;  3CUQ C;  1QP7 A;  1R71 A;  1CGP A;  2QSG X;  2LSO A;  2QKM B;  3FKI J;  3QQ6 A;  2MGQ A;  3IWF A;  3OS0 A;  1O7L A;  2L7F P;  4RLF A;  3RQI A;  4IHY A;  1K4S A;  1WFX A;  3D0S A;  1XDS A;  3ERM A;  4QPO A;  3LSP A;  2AS5 F;  2LNB A;  3K7A J;  5KCM A;  1K61 A;  1R9T J;  4PSW A;  2FE3 A;  1D1C A;  2OTL I;  1HW5 A;  1FY7 A;  3RYR A;  5BNG A;  3HHH A;  2PEX A;  2ZNZ A;  2CH0 A;  3OS2 A;  5E20 A;  1JWL A;  3VB2 A;  3K10 A;  3ERE D;  1R23 A;  2KKO A;  3FYM A;  4YIF A;  4U0W A;  4O5V A;  1ZAR A;  3SFZ A;  3L2R A;  1SAX A;  3F9K A;  1IRX A;  2E1M C;  1KU2 A;  4UUV A;  3H36 A;  3LOC A;  3OYM A;  2WAD A;  1VQL I;  1N75 A;  1MNM C;  5HDN A;  1UHS A;  4JCY A;  2CRO A;  3VYT B;  2JPB A;  3LWF A;  2ESN A;  1FJL A;  3HOU J;  3T5X A;  1IUY A;  1RZS A;  1AHD P;  5LHI A;  4I6T A;  2GLO A;  2P81 A;  2DMN A;  3E5Q A;  1ZRC A;  2W48 A;  2CS3 A;  4WF2 A;  1YS6 A;  4Z5H A;  4IHW A;  2JA7 J;  1XMK A;  3RZZ A;  4BDY A;  1W1W E;  1ORK A;  4F91 B;  4G12 A;  5EEA A;  3IVP A;  3BTJ A;  2KPJ A;  2QM3 A;  3ZQH A;  4U0V A;  5L3B A;  3OIP A;  2C6Y A;  2NXN B;  3U3W A;  2DA4 A;  2B9S A;  2CGP A;  5DEQ A;  2BHZ A;  3CCL I;  1AU7 A;  2XV4 S;  1Z77 A;  3IP4 B;  2CJJ A;  3KYD B;  1ZTR A;  1Z1D A;  3TO7 A;  1O7F A;  4KIT B;  5FKK A;  3V8L A;  3ZQ7 A;  2PUC A;  1MSF C;  5D4R A;  4IVN A;  2KHM A;  4Z2Y A;  2AXT C;  1N77 A;  5E3N A;  1U9N A;  2WC2 A;  3K2Z A;  4S04 A;  3Q5F A;  2DU9 A;  4IHX A;  2K9Q A;  2A69 F;  5CYV A;  2DK8 A;  4MQV A;  3ROU A;  5B66 C;  2ZFU A;  5D8L B;  2HCS A;  3LA3 A;  4M3G A;  5LHH A;  4M74 A;  1MBJ A;  1BBY A;  4JX4 A;  2R5Y B;  1W36 C;  2F4O B;  5H6Q A;  5IOZ A;  4BH9 A;  1XMA A;  1VQO I;  2GXA A;  1NG6 A;  4F3Q A;  3S3N A;  1MBK A;  1ZUG A;  2ZC2 A;  3DQV C;  3KYC B;  4I99 C;  2H6B A;  1IN6 A;  3S3M A;  2STW A;  3ECH A;  2JVH A;  5F1R A;  3ZQG A;  2VPR A;  5J3L A;  3E5U A;  1DUL A;  3R0A A;  2P5V A;  1Z3Y A;  3I0T A;  3NWT A;  3BQY A;  1ZLK A;  4C2U A;  1LEA A;  3M07 A;  4BQA A;  3N97 A;  4JX5 A;  2LKP A;  3JSO A;  1POG A;  2H8R A;  2Y9Z A;  1JKO C;  2HZT A;  1UFM A;  4NUB A;  3S32 A;  3H5R A;  4QTR A;  4JX6 A;  2KIM A;  3LQX A;  1S3J A;  1W7P D;  2P5K A;  4RGX A;  3ZMU A;  1MDM A;  5EDN A;  2PLY A;  1W0T A;  1UG2 A;  1D0X A;  1EKE A;  3HSE A;  1T33 A;  5HVQ C;  2K40 A;  4XSX F;  3DXJ F;  5L3D A;  1XTA A;  4OIN F;  2R7W A;  4HBL A;  4HV5 A;  1FWZ A;  3GZC A;  5A7L A;  3CC4 I;  2LYJ A;  3DTK A;  4U7B A;  2PX9 A;  2FX0 A;  3JR9 A;  2DMT A;  4A3F J;  4CCO A;  3MZH A;  4GQM A;  2K4J A;  1D8K A;  1QA6 A;  3VDX A;  4DZP A;  3LSM A;  3GX4 X;  3WGH A;  4UV8 A;  2IS2 A;  3H9G A;  4JOM A;  4Y15 A;  1Y1V J;  1P4X A;  2CV0 A;  3HBL A;  3W6V A;  4I6R A;  4IJA A;  1FNN A;  1JI8 A;  4DE8 A;  3GZD A;  2DAO A;  5CLS A;  4MEY F;  3MKL A;  5E3L A;  3HZI B;  2VKE A;  1SFK A;  3BR2 A;  1VQ9 I;  3HGY A;  2FOW A;  1S7O A;  1U8B A;  1XSV A;  2X6Y A;  4FT8 A;  4RB0 A;  2YX7 A;  1TQI A;  1AKH A;  3S93 A;  4N4O B;  4XLH A;  4HLY A;  2O38 A;  1TL8 A;  4A3K J;  4ENN A;  4XON A;  4R1H A;  4XOR A;  4WK8 F;  4FTH A;  1LMB 3;  2OAZ A;  2MXD A;  1HLV A;  3I4P A;  4Q2J A;  3QP6 A;  1KU9 A;  4KFC A;  2NVT J;  5CVI A;  2KJB A;  1TWA J;  2Y0S N;  5KK1 A;  2QSH X;  4X4H A;  2RQQ A;  2TDX A;  2LLW A;  1IN4 A;  2FOK A;  1HST A;  4X4F A;  4ZYA A;  2LCV A;  2XCJ A;  1OCP A;  4UVA A;  4MIM A;  2M0C A;  3ZQQ A;  2X9D A;  4M3B A;  2HEO A;  1ENH A;  1HA8 A;  5FJ8 J;  4BXF A;  1PVE A;  2K27 A;  3AAF A;  2WV0 A;  3IKV A;  2ZXI A;  3OYH A;  3HRU A;  1KZH A;  3V7C A;  1CQT A;  4LG0 B;  1X2L A;  1OJL A;  3VYU B;  3LIS A;  5IT3 A;  1LCD A;  3AG3 H;  2L02 A;  3OMY A;  4KT6 A;  4MHG A;  1X58 A;  4BNC A;  2GRM A;  2HIN A;  3DM5 A;  1TW3 A;  1Z7U A;  3QP5 A;  2EIJ H;  2W1O A;  3OSF A;  2LKX A;  1RRJ A;  4GGG A;  3E0J B;  1B72 B;  5HLI A;  3BR3 A;  3KLO A;  3V42 A;  4MQ9 F;  4BY7 J;  4CH7 A;  4BE2 A;  2QQB A;  1TW2 A;  1ZRD A;  3HIF A;  3DKX A;  3FIW A;  1QHG A;  2DOD A;  3KIO A;  1SAU A;  1XX5 A;  2DLL A;  4RB3 C;  4KIB A;  4CA0 A;  4RB2 C;  1JKR C;  3RQ4 A;  3J7Y J;  2J7W A;  4KIC A;  1RIO A;  4J1X A;  4MEX F;  3A9X A;  4AUX A;  3R1F A;  5E1X A;  1I39 A;  3CMM A;  1LUJ B;  3AG1 H;  5EGO A;  5H2F C;  3ESW B;  3G5G A;  1R4M B;  2I10 A;  2B7E A;  3F21 A;  1I6H J;  3KX2 A;  2XGC A;  4DGW B;  1PNR A;  1F9N A;  4IHT A;  4B47 A;  4QPQ A;  1L1M A;  2KDZ A;  2DA1 A;  1MBH A;  2KIF A;  1GVJ A;  4A3J J;  3W2A A;  2VJ4 A;  1ZGA A;  1PER L;  4CYD A;  1IXS B;  1F43 A;  4NNJ A;  1FX7 A;  1XGS A;  1BOB A;  4D7M A;  1LEB A;  1TQM A;  4AWX B;  3JAM Z;  3H0D A;  4XLA A;  2TRT A;  2RDP A;  2MEZ A;  2ESH A;  3HOW J;  4BU2 A;  5J8F A;  3ASO H;  1DU0 A;  3FZV A;  2GQQ A;  3DEW A;  1H9T A;  3OV8 A;  2H6C A;  4YIR X;  3J7A Y;  3WTY C;  4PUS A;  4G94 A;  3H9Q A;  5JR3 A;  3I64 A;  4RGU A;  5IP7 J;  5EGO B;  5HLH A;  3OYJ A;  1FLI A;  1FP2 A;  3NAR A;  1YTY A;  2Q2E B;  3HM5 A;  3Q9V A;  1DWK A;  3GN5 A;  3TMO A;  3JRB A;  1YE9 A;  5LHG A;  3HSR A;  2CFX A;  4LLN A;  3IHU A;  3JXB C;  3CQZ J;  2UUZ A;  1APL C;  4A3C J;  1T56 A;  2EQR A;  1MH3 A;  2WB1 N;  2VBY A;  2Z1D A;  2BY1 A;  3O8G A;  3TOB A;  4PU3 C;  1NH3 A;  1BIB A;  1GXQ A;  5ICF A;  1ZYR F;  4FX4 A;  2Z9O A;  1BA5 A;  2FRH A;  1HKT A;  1XS9 A;  2WY7 Q;  3JXC L;  2XKO A;  2HU9 A;  4PJJ A;  1HQ1 A;  2JJ7 A;  3CCY A;  2PXD A;  1YYV A;  2BVM A;  2DXI A;  2X0L A;  1WH6 A;  1LFU P;  2R92 J;  1BR4 A;  2R5Z B;  5F04 A;  1MJ9 A;  4XBF A;  5DRT A;  1DP3 A;  5D5W B;  4ER5 A;  3SZG A;  2H27 A;  4A5N A;  3HGG A;  3WGI A;  3EUH C;  5ILU A;  2L9N A;  3RJP A;  5J8C A;  3TP0 A;  3HTS B;  3GME A;  4HF0 A;  3BTI A;  4CDG A;  1MJB A;  3GEZ A;  2FJR A;  3FXU A;  2L2O A;  3PNY A;  4LIV A;  1YSE A;  4CYC A;  4YG1 A;  4IQJ A;  4BGD A;  1VQ4 I;  3IH4 A;  3HSF A;  3M9L A;  2V9V A;  3K4K A;  1WH8 A;  1K6O A;  3HOX J;  2ECB A;  2LKS A;  1XN7 A;  4G7H F;  2G7H A;  1OPC A;  1FMW A;  3E6B A;  2K4B A;  4EV0 A;  2Z16 A;  2XAH A;  3K4B A;  3CO7 C;  1O3Q A;  3GBF A;  1TWG J;  3I55 I;  3JRA A;  2JVL A;  1OKR A;  2WAQ N;  2EV6 A;  2HGC A;  4BHC A;  3GTL J;  2A6T A;  4M6Y A;  5CQG A;  3ZXS A;  3C7J A;  3PSI A;  1ADR A;  1S5L C;  5K7F A;  3MAJ A;  1KA8 A;  2LBF B;  1U9O A;  1KON A;  1ZG1 A;  3MKY B;  3A9Z A;  2DOF A;  5IYC J;  2DA7 A;  2O03 A;  3W3C A;  4TV7 A;  3DWL E;  3BY6 A;  5GTH C;  3OYB A;  4NBQ A;  1B6A A;  3HOY J;  3LSJ A;  5E3O A;  1EF4 A;  1IV8 A;  1ZAO A;  1VQ7 I;  2ODR D;  2VBW A;  1PRU A;  1I27 A;  3Q0U A;  2IGN A;  5B3S H;  1KQ0 A;  1AWC A;  2DFF A;  1B4A A;  1QQA A;  2X48 A;  1UB9 A;  3TED A;  3IRQ A;  1LLI A;  1HW2 A;  1SMT A;  1BJA A;  2CQN A;  2QKL B;  3ABT A;  4JBA A;  2F4M B;  2DFE A;  2HQN A;  4CCN A;  3KLN A;  3KEQ A;  1JUP A;  3FK7 A;  3HTU A;  4XM3 A;  1RZ4 A;  4IA8 A;  4MFE A;  2OCC H;  1ZN2 A;  5D5X B;  4EGY A;  3TO9 A;  2PXK A;  1F36 A;  4BQQ A;  4MCT A;  2NAZ A;  3FM3 A;  4E7Z A;  2EZI A;  5B1B H;  2WAF A;  3TW6 A;  4IEJ A;  3A4C A;  2EIN H;  2JQE A;  1R5G A;  4W1U A;  3F51 A;  3IC7 A;  1Z9C A;  2PPX A;  2XUB A;  1QB2 A;  1CF7 B;  4NHJ A;  4JK1 X;  3BTL A;  4M71 A;  3CJR B;  1XCV A;  4B09 A;  3PIP F;  3BTC A;  3TQN A;  3MEJ A;  3SCH A;  2ECC A;  1SFU A;  2UWM A;  2EH3 A;  1OYY A;  1SFE A;  3B6A A;  3K70 C;  1Y9Q A;  2FNP A;  4I6U A;  1YW8 A;  3A1Y A;  2LTP A;  4I8T A;  2X6X A;  3WE2 A;  3OYL A;  4DYC A;  1BJZ A;  4DW6 A;  4DE9 A;  1S6L A;  1IXR C;  2NVQ J;  4NQW A;  3TGN A;  4II2 A;  2XRL A;  4BEH B;  1WH5 A;  3FWE A;  1WI3 A;  2EZL A;  1XPX A;  4KN7 X;  1MMG A;  5D5U B;  3F8N A;  3PQK A;  2WY8 Q;  3CLQ A;  5EYR A;  4ZZD A;  3MKZ A;  3U2R A;  3PFI A;  3OY9 A;  4HX4 A;  2IV1 A;  3NZL A;  2PUD A;  3ISP A;  1Y8Q B;  4HX8 A;  4DZJ A;  1XC5 A;  3S8Q A;  2NS7 A;  1Y7Y A;  1XG1 A;  2MW8 A;  3BG5 A;  3OWQ A;  2XRO A;  3F22 A;  4E7L A;  4FBI A;  2M4G A;  3CP8 A;  4E7K A;  2F5D A;  5A2Q K;  2VOO A;  2GOM A;  3HHG A;  4PGG A;  3QYX A;  3VPR A;  3FF5 A;  3H0G J;  3FYA A;  3PO3 J;  5K98 B;  5F0C A;  3H3Z A;  1TTY A;  1EV7 A;  3CCJ I;  5GTI C;  5F08 A;  3GTG J;  3E6M A;  4IRI A;  3D5R C;  3LQR A;  3OL3 A;  5IPA A;  3ML6 A;  5HS8 A;  2LMD A;  1U5T A;  3HDD A;  5FLM J;  4I0A A;  2ZB9 A;  1D1A A;  2FBH A;  4QWQ A;  2DOE A;  4BAY A;  2Y0M A;  2ID6 A;  1V4R A;  4X4G A;  2QEN A;  1T0F A;  4I02 A;  3A9Y A;  5FRO A;  5J40 A;  1R7J A;  2A5Y B;  3EPZ A;  3K1N A;  4F52 A;  2QVO A;  1EH8 A;  4N4N B;  4EQZ A;  1RZR D;  1B1B A;  3CJN A;  1LCC A;  3EUK L;  1X1C A;  1QP0 A;  1PUE E;  1BW6 A;  3U1D A;  2CV2 A;  1DQU A;  1BI0 A;  2KLO A;  2QSF X;  1FSE A;  2G7U A;  2DPU A;  2M9H A;  4MFD A;  3UWP A;  2HFH A;  2XSJ C;  3G1L A;  4NC6 A;  5GP9 A;  1G3S A;  2PMZ N;  5GAH J;  2ETH A;  4GO1 A;  1VQ8 I;  1R63 A;  4HLX A;  2L49 A;  3GO5 A;  1QRY A;  2MG4 A;  1Z21 A;  3DEU A;  4HPQ A;  1FOK A;  4BXU A;  3OYE A;  2WTE A;  1ZS4 A;  4ZYE A;  4RAZ A;  2VKH A;  3KP3 A;  3LFU A;  2Y69 H;  3FXO A;  4OOI A;  3QOP A;  3QU3 A;  3WTS C;  5K5R A;  3GW2 A;  2XGD A;  1RNL A;  4GRI A;  5M3F J;  3BR0 A;  1XB4 A;  1V5F A;  2ZXJ A;  4HDU A;  5E17 F;  3B7H A;  2P8T A;  1ZGW A;  3GTO J;  2R3S A;  3JTH A;  2IPQ X;  5DD8 A;  2VQC A;  2BYV E;  2BY3 A;  2P6S A;  3D1N I;  1FYK A;  4EAT A;  2VON A;  2K02 A;  1FOY A;  3I58 A;  2R7Z J;  4C3I J;  3G71 I;  4CIC A;  1HKQ A;  3KP5 A;  2VOD A;  2BNO A;  3FIS A;  3LST A;  4LIT A;  2LDU A;  2FSW A;  1QPI A;  5B5E C;  4NC8 A;  2A61 A;  1JJ8 C;  1RKT A;  5J1Y A;  3ZGK A;  1NTC A;  2HI3 A;  3S14 J;  1GUU A;  4LB5 A;  2BXY A;  5FLX Z;  1ERD A;  3SFI A;  2YSR A;  4A5M A;  1XSD A;  1TWF J;  4YG4 A;  1YX5 A;  4XNF A;  2PXB A;  2NVY J;  2XIU A;  2M34 A;  2XB5 A;  1UTX A;  1LQC A;  4A3M J;  3JW4 A;  3W2V A;  4ER0 A;  2VT3 A;  1T38 A;  1ODD A;  4P5O A;  1PRA A;  3ZP5 A;  4XK4 A;  5C4J J;  1TT5 B;  2UV1 A;  2GZW A;  1JXS A;  1B9M A;  2MFZ A;  3E5X A;  3SZP A;  4K2E A;  2AWI A;  2PN6 A;  3UNG C;  5BS6 A;  3ZPL A;  3MEX A;  2VKD A;  4ZH4 F;  3E1S A;  3ONQ A;  3V7R A;  4A6E A;  4MTE A;  4RMN A;  1W7P B;  1YW9 A;  4BXX J;  2H1K A;  2R7V A;  3ASN H;  1GLN A;  4XLF A;  4P9U A;  5C3E J;  3BDN A;  1Z6T A;  3EUS A;  1P7J A;  5K5Q A;  1FOW A;  3BZC A;  5L3C A;  1STZ A;  1ONV A;  3SEZ A;  1K78 B;  4V2F A;  3ZRG A;  3Q9S A;  4G7Z F;  1A6I A;  1ETO A;  1YO5 C;  2DA2 A;  3OKZ A;  3HC7 A;  4ENJ A;  3VWB A;  4GHJ A;  1TZL A;  4PFP A;  4B4C A;  3WGG A;  4BQO A;  3RTR A;  4Y4R A;  2FQ3 A;  4AM3 A;  4HX7 A;  1YHQ I;  2ZCW A;  1S72 I;  3HPH A;  2PXL A;  3DFG A;  5E3M A;  2P0W A;  2RN7 A;  1OR7 C;  3DKY A;  2FFH A;  3GLX A;  1BOA A;  3QYE A;  2AXV A;  3BG7 A;  4RGS A;  2EWT A;  1WJ5 A;  2A07 F;  3SEQ A;  3GXO A;  2FBK A;  3MLF A;  3FHN A;  1Z05 A;  1TC3 C;  2IVQ A;  3F8B A;  2OD5 A;  1WJF A;  4G6Q A;  2ELJ A;  2BNN A;  3RPQ A;  1XCB A;  2W4S A;  4I01 A;  3VSK A;  1QU3 A;  2Y0S A;  1PP8 F;  4A3L J;  4EJW A;  3L1P A;  2W85 A;  4X4C A;  2ZKZ A;  3SHF A;  3LAP A;  3GZ6 A;  3FMQ A;  2A6C A;  1ZZ7 A;  2A6H F;  4Z6Y A;  3Q0W A;  2D45 A;  5GPA A;  5DDG A;  4A2U A;  1CJG A;  2JPC A;  5D6F A;  1SAN A;  4Z59 A;  2XF5 A;  5HDG A;  2PFB A;  3CC7 I;  2BEO A;  2PG4 A;  4V2G A;  4XLE A;  2XAJ A;  4XOT A;  4B48 A;  3WG7 H;  2A5W A;  4DQ2 A;  2XXA A;  2BVL A;  2D1H A;  2FEZ A;  1Z7L A;  2IAI A;  4IRG A;  5CVU A;  3IUO A;  4F93 B;  1WJE A;  1G4D A;  1MH4 A;  3VK0 A;  2KIU A;  1GV5 A;  3HYI A;  3F0C A;  1ZPQ A;  2JZY A;  1EH7 A;  4E7S A;  2QCO A;  5DTD A;  2W82 A;  4OAZ A;  2ACJ A;  1X1A A;  2NOG A;  3F23 A;  1SD5 A;  3QF3 A;  1YIO A;  4G9Y A;  2IP2 A;  1QQI A;  1ETQ A;  3W6K B;  1BDH A;  2VB6 A;  1ON2 A;  2MD0 A;  1VQM I;  1JKQ C;  2N8G A;  2V1U A;  1LJ9 A;  1SFX A;  2R7X A;  3PNV A;  4C2T A;  2I8D A;  5JI6 A;  5F1J A;  4Q5S F;  1J0R A;  1D0Y A;  5DD4 A;  3QOX A;  2HKX A;  1WHU A;  2V9P A;  2IGM A;  4AYB N;  2HOT A;  1IXC A;  1UHW A;  1IN8 A;  2RRE A;  3CCQ I;  3SX0 A;  4OWR B;  1C0W A;  5IT9 Z;  2OV7 A;  1HOM A;  5IYD J;  4L9V A;  4GDF A;  1H88 C;  4A6D A;  4UY8 I;  3MMY B;  4HNT A;  3BG9 A;  3ZMT A;  2JQ7 A;  4KN4 X;  2O49 A;  2Y2Z A;  2V26 A;  5F27 A;  5ILV A;  1IRZ A;  3FXR A;  3FDY A;  2O5R A;  4IXA A;  3CCM I;  1LKX A;  5CVJ A;  4MTD A;  4D9J A;  2Z2S B;  3KL4 A;  5LRR A;  1DDN A;  2R63 A;  3G4S I;  2Z3Y A;  2E7W A;  1QZX A;  3HG9 A;  3X2Q H;  3VWS A;  2KL4 A;  1T08 B;  2VQG A;  1B9N A;  3FXQ A;  2OCE A;  4RAG A;  2EFW A;  1A6Q A;  1UST A;  4N9H A;  3O9X A;  3MD2 A;  2WIU B;  2NS0 A;  4HSR A;  5FKO A;  3ABU A;  3NEU A;  2KEK A;  2R4G A;  2LY1 A;  4A3E J;  3CCR I;  4M6V A;  2WB1 A;  1QPZ A;  4MLO A;  2DA5 A;  3OYI A;  1RIO H;  4FE7 A;  1U0J A;  2R7F A;  4Y17 A;  1WIZ A;  5KAI C;  4DOZ A;  2R0Q C;  2VLA A;  4D5C A;  3QRF F;  1VFC A;  1X1D A;  3S17 J;  4XLN F;  4L5I A;  3U21 A;  3A02 A;  2KJC A;  4AIH A;  5ICC A;  1T8I A;  2PXV A;  2GAU A;  3DPT A;  3OWT A;  4D0P A;  4X1E A;  4ZTJ A;  3A03 A;  3R60 A;  4UV9 A;  3GZN B;  3OL4 A;  3A01 A;  4J1W A;  3KP6 A;  2HVS A;  4ZZL A;  2DW4 A;  2AXZ A;  2K3P A;  2COM A;  2EWN A;  2VXD A;  3C2H A;  5HOO A;  1DU6 A;  4FN3 A;  4J19 A;  2HFZ A;  1VQN I;  3PE5 A;  2VI6 A;  1TBX A;  4HF1 A;  1WSU A;  1GV2 A;  1MDM B;  3IH2 A;  4X4D A;  2VBZ A;  2E19 A;  2L01 A;  1ULY A;  2XHK A;  2Q8K A;  1FTZ A;  2E71 A;  5JUW A;  4EKI A;  1VND A;  2KZV A;  2XAF A;  2IBD A;  3R61 A;  2COB A;  3MFK A;  3HZJ A;  4IO9 F;  3K2A A;  4IHV A;  1FMV A;  2PI0 A;  2LF7 A;  1HXD A;  2W24 A;  2ZME A;  2EIL H;  4GFB A;  4RGR A;  1D8J A;  2HPM A;  2KRH A;  4I98 B;  1Z3X A;  3A01 B;  3OQN A;  4A3I J;  1GVD A;  1NK2 P;  5CVR A;  5LLQ A;  4IX7 A;  2PJR A;  2EPF A;  1Z91 A;  3DF8 A;  2UZK A;  2EF8 A;  5C4X J;  4BE0 A;  1O3S A;  5DYM A;  1JT0 A;  4L0Y B;  1DPU A;  2H1L A;  3HKZ N;  2E35 A;  4PU7 A;  2EFQ A;  2Y30 A;  1U5T C;  2XXQ A;  4HV6 A;  1FIA A;  2MBF A;  2L7M P;  3WHC A;  2LYP A;  2R7Q A;  1TQP A;  1X19 A;  3P5J A;  1AKH B;  2E36 A;  2D1V A;  2Z5U A;  3LSR A;  2AHQ A;  1Q1H A;  2PJR B;  3PIO F;  4C2M J;  3AG4 H;  2NS8 A;  4LGW A;  3ZN0 A;  1IF1 A;  2X6W A;  1FBS A;  1UJ8 A;  2YS9 A;  4B43 A;  2WV1 A;  1R6R A;  3KFW X;  4E7I A;  3CDH A;  3BJA A;  3MVP A;  2MYS A;  3AFH A;  2VUM J;  2LYQ A;  3EUA A;  2B0L A;  1BN5 A;  3OQM A;  3EYI A;  1VQ5 I;  1VPW A;  3KP4 A;  4JYK A;  3RZD J;  4WXC A;  4M9Z A;  1OQY A;  4XKB A;  1OIS A;  3QOD A;  4EZI A;  2OPT A;  4IZZ A;  5EG0 A;  1R22 A;  2FBI A;  3RKW A;  3CC2 I;  1QP4 A;  2OBP A;  3JTG A;  2HYG D;  3TEP A;  2IJL A;  3QWL A;  2QQA A;  5AON A;  5HS9 A;  2V1N A;  1XD7 A;  2M7A A;  5LRS A;  1H0M A;  4ER7 A;  1SVO A;  2A6E F;  2EBI A;  3GF2 A;  3IRR A;  1JKP C;  3A2K A;  5DTM A;  1A5J A;  1JGS A;  3BWG A;  3MN2 A;  2OF7 A;  2OA4 A;  1VZ0 A;  3U9G A;  2HVR A;  1KQ8 A;  4CUG A;  5HLT A;  4Y52 J;  2XDV A;  2GZU A;  5J6X A;  2WWY A;  2JMW A;  4HOB A;  4U0Y A;  2D2W A;  2O8K A;  2PXU A;  1UG0 A;  2QWW A;  3GUU A;  1O3R A;  3PXP A;  3R0J A;  3K1M A;  3CES A;  2IA1 A;  3T0Y A;  4WWC A;  3BQZ A;  4IVZ A;  1I50 J;  2LP0 A;  2W7N A;  2DYS H;  2XRN A;  5DRY A;  4J00 A;  1DP7 P;  3JRC A;  3GWZ A;  1UXD A;  1FSH A;  2K85 A;  1DGR M;  3R6S A;  2XPW A;  2LRD A;  2E7X A;  2VPL A;  1NW3 A;  2BBY A;  2YX4 A;  3EET A;  4RAY A;  2QF7 A;  5GAD J;  5DM7 F;  2DFI A;  3HUG A;  3IWZ A;  2VQH A;  3K4C A;  3K0L A;  3I9V 2;  2P5L C;  2X1C A;  3O2P E;  2EB7 A;  3KEY A;  3S15 J;  2ELH A;  2DTZ A;  2HOE A;  4I76 A;  1Y0U A;  3D5S C;  1BM9 A;  2M87 A;  4EMS A;  3GN5 B;  1RZR A;  4LG3 A;  5C44 J;  3WTW C;  4HRI A;  2CSF A;  2EFO A;  4A3B J;  1Z6R A;  1Y56 A;  5J4V A;  3FXL A;  2JSC A;  3DP7 A;  1W5T A;  5CKT A;  2VQL A;  3CUQ A;  1K79 A;  3CRO L;  2ZJP F;  4NDL A;  3JRG A;  4UVC A;  4KIG A;  4AVZ A;  1Y1W J;  2JA6 J;  2V6E A;  4H4K C;  2E2J J;  2DN0 A;  4ZDP A;  1QNT A;  1U2Z A;  2RKH A;  1SD7 A;  1RI7 A;  1ETK A;  5LGU A;  4XRS G;  3F8M A;  4CZC A;  2F5C A;  3JXD L;  3ABL H;  3G2B A;  4Y7N J;  2GBY A;  3GTJ J;  2BW3 A;  1X3W B;  2JTV A;  3L7W A;  5ICG A;  1TWC J;  2XSD C;  2ELK A;  2FXA A;  3I54 A;  2JSP A;  3OIO A;  1FP1 D;  5K5O A;  3NWS A;  4II3 A;  3SJM A;  2L9R A;  2FF4 A;  3OIQ A;  4I09 A;  3VSL A;  4EQQ A;  2CWE A;  3E7L A;  5D4S A;  3OOU A;  5TIS C;  1WGX A;  1ZHF A;  3WOD F;  3FXK A;  1FYM A;  3QPH A;  3COA C;  2RAE A; 
#chains in the Genus database with same CATH homology
 1R63 A;  2EZK A;  4S0H B;  4CYC B;  5FLV A;  2L49 A;  1B72 A;  2AXU A;  1QRY A;  3TW7 A;  2MG4 A;  3LOC A;  1ZR2 A;  1MNM C;  1ETX A;  4JQD A;  1UHS A;  2L0K A;  4MO7 A;  1ZS4 A;  4JCY A;  2CRO A;  4Z5D A;  2NVX J;  3UKG A;  1FJL A;  3HOU J;  1B8I A;  4I6T A;  1RZS A;  1X2N A;  1AHD P;  2GLO A;  2P81 A;  2DMN A;  4F8D A;  4IWR A;  2W48 A;  2XGD A;  4IHW A;  2JA7 J;  2GRL A;  2CRG A;  4Z5H A;  5M3F J;  3BR0 A;  3RZZ A;  1ZK8 A;  1ORK A;  4G12 A;  5EEA A;  5M5W J;  3IVP A;  3BTJ A;  3B7H A;  1ZGW A;  3GTO J;  4OB4 A;  2PUA A;  2DJN A;  3CDL A;  2KPJ A;  5J1U A;  3ZQH A;  3G7D A;  3D1N I;  1MBE A;  1RET A;  2XPU A;  4YG7 B;  2JA5 J;  2R7Z J;  4C3I J;  3U3W A;  2DA4 A;  1G2H A;  1JUM A;  2LR8 A;  1AU7 A;  1RR7 A;  1Z77 A;  2BNO A;  3FIS A;  2CJJ A;  2G0E A;  3QQA A;  1ZTR A;  2Y9Y A;  5FKK A;  3TP3 A;  2PUC A;  4UUS A;  1MSF C;  1QPI A;  2AW6 A;  1B8I B;  1JJ8 C;  1RKT A;  5J1Y A;  1JFT A;  3BD1 A;  2BJC A;  5E3N A;  1U9N A;  1NTC A;  2HI3 A;  3S14 J;  1H8A C;  4IHX A;  2K9Q A;  1GUU A;  1JTY A;  3GTK J;  2B5A A;  1MBG A;  2KZ8 A;  3SFI A;  1TWF J;  5EG0 B;  4M3G A;  4YG4 A;  2NVY J;  2XIU A;  3FMY A;  1MBJ A;  4JX4 A;  2R5Y B;  1QQB A;  2M34 A;  2XB5 A;  1PRV A;  3O8H A;  4D7N A;  1UTX A;  2M2E A;  5IOZ A;  4A3M J;  1LQC A;  2JWT A;  1PUF A;  1ETW A;  1MBK A;  1ZUG A;  1PRA A;  4XK4 A;  3KZ3 A;  5C4J J;  1X2M A;  2IEK A;  4UUS B;  5M5Y J;  1RES A;  2AWI A;  3ZQG A;  2VPR A;  5J3L A;  1BW5 A;  3BQY A;  4B1R A;  4JX5 A;  1POG A;  2H8R A;  4A3D J;  2Y9Z A;  2H1K A;  4I6Z A;  4BXX J;  1JKO C;  1JT6 A;  1QVU A;  3DCF A;  5C3E J;  3JRF A;  3ZQC A;  3EUS A;  4QTR A;  1P7J A;  3BDN A;  4JX6 A;  1RPE L;  1GT0 C;  3OQO A;  1JJ6 C;  4O8B A;  5EDN A;  4V2F A;  1FIP A;  4XRS A;  1UG2 A;  1W0T A;  1A6I A;  2PUG A;  1ETO A;  2DA2 A;  1D5Y A;  4GHJ A;  1T33 A;  5EF6 A;  2K40 A;  3S1M J;  1LFB A;  4B4C A;  2K9S A;  4QIW N;  3M3Y J;  2CUF A;  1S7E A;  2R5Z A;  2M8G X;  3JRH A;  3LSG A;  2E1O A;  3GTM J;  1HDP A;  1TWH J;  5A7L A;  2PUB A;  2LYJ A;  1ZR4 A;  1WCM J;  2LYS A;  2FX0 A;  5E3M A;  3JR9 A;  2DMT A;  4A69 C;  4A3F J;  4GQM A;  4X4B A;  2HXO A;  2AXV A;  4DZP A;  3ZHI A;  2EWT A;  1EFA A;  2FD5 A;  1O4X A;  3KJX A;  2E2I J;  3W6V A;  1Y1V J;  3MLF A;  3HBL A;  1TC3 C;  2IVQ A;  2HOS A;  4I6R A;  3HOZ J;  3S16 J;  2LYK A;  1ZZ8 A;  3Q0V A;  2BNN A;  3MKL A;  5E3L A;  3HZI B;  2VKE A;  4QSH A;  3BR2 A;  3HGY A;  2LY9 A;  3SCF A;  4A3L J;  3L1P A;  1U8B A;  4FCY A;  3IH3 A;  4X4C A;  2AUW A;  1AKH A;  2A6C A;  1ZZ7 A;  2O38 A;  3Q0W A;  4A3K J;  1BL0 A;  4FTH A;  1LMB 3;  5GPA A;  2O9L A;  1CJG A;  1HLV A;  2LLK A;  1OCT C;  1SAN A;  4Z59 A;  2MQK A;  5FKL A;  4V2G A;  2NVT J;  5IP6 A;  2Y0S N;  1TWA J;  3GTQ J;  4X4H A;  1JTX A;  3HOV J;  4Y42 A;  4X4F A;  2IAI A;  2FQ4 A;  2LCV A;  2XCJ A;  1OCP A;  2DA3 A;  1SFO J;  1Z0X A;  4MIM A;  2M0C A;  1MH4 A;  3VK0 A;  2X9D A;  3RZO J;  3RKQ A;  3SDG A;  4M3B A;  1GV5 A;  4X4I A;  1ENH A;  3F0C A;  1ZPQ A;  1IV6 A;  5GPC A;  2QCO A;  5FJ8 J;  2XPV A;  3F52 A;  5DTD A;  4YAR A;  2R1J L;  3JRI A;  2PIJ A;  4ABZ A;  1IUF A;  2NOG A;  4UUT A;  1ETV A;  3QF3 A;  4BY1 J;  1CQT A;  1X2L A;  2DMU A;  1OJL A;  3LIS A;  3Q3S A;  1LCD A;  3PO2 J;  2HIN A;  2GRM A;  1ETQ A;  1X58 A;  1BDH A;  1JKQ C;  2N8G A;  3BR5 A;  3OSF A;  3HEF A;  5F1J A;  2LKX A;  3C2B A;  1B72 B;  2XJ3 A;  3BR3 A;  4BBR J;  2YU9 J;  3HB9 A;  4BY7 J;  4AYB N;  2HOT A;  3G1M A;  5EZH A;  4DYR A;  1HOM A;  3LFP A;  3FIW A;  1GDT A;  5IYD J;  2DA6 A;  4RBO A;  1YRN A;  1H88 C;  1JKR C;  4DYQ A;  4PU4 C;  2HYJ A;  4J1X A;  1MSE C;  1RIO A;  3BG9 A;  2MSY A;  4RDU A;  4AUX A;  2O49 A;  3R1F A;  3IV5 A;  2Y2Z A;  2LYR A;  5F27 A;  1IRZ A;  5EGO A;  2KT0 A;  3G5G A;  2I10 A;  1I6H J;  4EEF G;  3M4O J;  1IDZ A;  1IC8 A;  4W97 A;  1NEQ A;  2XGC A;  1PNR A;  3NAU A;  1L1M A;  2KDZ A;  1ZZ9 A;  2DA1 A;  1MBH A;  4A3J J;  1NK3 P;  2R63 A;  1PER L;  2DMP A;  2FJ1 A;  5FKN A;  1F43 A;  1BDI A;  3S2D J;  1ZZB A;  4D7M A;  1UXC A;  2O4A A;  3JRD A;  2KEI A;  2ME0 A;  2BNM A;  1H89 C;  2TRT A;  2TCT A;  3I4M J;  2MEZ A;  1ZQ3 P;  3HOW J;  4C3H J;  3O9X A;  1DU0 A;  2WIU B;  1Q1V A;  3DEW A;  2L8N A;  1HCR A;  3DNV B;  5FKO A;  2KEK A;  5IP7 J;  2R93 J;  4XIC A;  5EGO B;  4A3E J;  4M6V A;  3BR6 A;  3NAR A;  2E2H J;  1QPZ A;  4MLO A;  2DA5 A;  3HM5 A;  4FE7 A;  1WIZ A;  1IG7 A;  2LD5 A;  2R0Q C;  2L7Z A;  1DWK A;  3GN5 A;  4X4E A;  4D5C A;  3JRB A;  1VFC A;  1PUF B;  1ZZC A;  2VKV A;  2PUF A;  3S17 J;  3ZHM A;  3A02 A;  2EZH A;  1HF0 A;  3JXB C;  3CQZ J;  4X1E A;  1APL C;  2JN6 A;  4A3C J;  1T56 A;  4XID A;  2EQR A;  1MH3 A;  2WB1 N;  2XB0 X;  3A03 A;  3O8G A;  3QPS A;  3S2H J;  3GTP J;  3B6C A;  3A01 A;  4J1W A;  4PU3 C;  2IVG A;  2AXZ A;  4MCX A;  1ITY A;  1DU6 A;  4FN3 A;  5JLW A;  4J19 A;  2WUS R;  1BA5 A;  1MBF A;  2VI6 A;  2ID3 A;  1XS9 A;  1VI0 A;  1GV2 A;  1WH7 A;  3IH2 A;  4X4D A;  3JXC L;  1XWR A;  2E19 A;  1FTZ A;  2JJ7 A;  2HOA A;  3CCY A;  3QPL A;  5K7H A;  1VND A;  1WH6 A;  2IU7 A;  1LFU P;  2IBD A;  2COB A;  2R92 J;  1VF9 A;  4IHV A;  1QVT A;  3K2A A;  2R5Z B;  5F04 A;  1SQ8 A;  1ZZ6 A;  4GFB A;  3HGG A;  1E3O C;  3A01 B;  1R69 A;  1NER A;  3OQN A;  2JK3 A;  1GVD A;  4A3I J;  1NK2 P;  1OSL A;  3TP0 A;  1WET A;  2IVB A;  3BTI A;  3GBG A;  4M3F A;  3H3V K;  1POU A;  2FJR A;  1YSE A;  4CYC A;  3S1R J;  2LYL A;  2EF8 A;  5C4X J;  4YG1 A;  3IH4 A;  4LOC A;  2KEJ A;  1JT0 A;  4FIS A;  1WH8 A;  2XI8 A;  3HOX J;  2ECB A;  3ZQL A;  2CUE A;  3HKZ N;  3OSG A;  3I4N J;  4PU7 A;  5FKM A;  2Y30 A;  3GBF A;  1FIA A;  2L7M P;  1ETY A;  3WHC A;  1TWG J;  3JRA A;  2JVL A;  2LYP A;  3ZQF A;  1W0U A;  2WAQ N;  2EBY A;  4PU8 A;  3PM1 A;  2GM4 A;  3GTL J;  1AKH B;  1JFS A;  3CEC A;  2X6O A;  1JH9 A;  2D5V A;  3H5T A;  1ADR A;  3LSR A;  3S1Q J;  2AHQ A;  5K7F A;  1P7I A;  4D5F A;  1U9O A;  1IDY A;  4C2M J;  3BS3 A;  2LFB A;  4C3J J;  2NS8 A;  1RPW A;  2CQX A;  2PE5 A;  2YS9 A;  5IYC J;  2HSG A;  2WV1 A;  2DA7 A;  4M3E A;  3LNQ A;  1ZAY A;  3UFD A;  4YBA A;  3MVP A;  3HOY J;  3LSJ A;  5E3O A;  1EF4 A;  2VUM J;  4B3A A;  2LYQ A;  1PRU A;  3Q0U A;  3OQM A;  3F6W A;  5IOY A;  1VPW A;  4JYK A;  1WPK A;  3RZD J;  1QQA A;  1IGN A;  2X48 A;  3TED A;  2ICT A;  3FK6 A;  2OPT A;  1LLI A;  5EG0 A;  2HDD A;  3ZOB A;  2AO9 A;  1QP4 A;  3ZKC A;  2R5Y A;  2ICP A;  9ANT A;  1IJW C;  2XGE A;  1JUP A;  3FK7 A;  3ZQI A;  4FE4 A;  4IA8 A;  4MFE A;  4Z58 A;  5J1R A;  2JA8 J;  2EBI A;  3BR1 A;  1JKP C;  1F36 A;  5IYB J;  1A5J A;  4MCT A;  3MN2 A;  5F0F A;  2OF7 A;  4JP0 A;  2EZI A;  1YRN B;  4Y52 J;  1K83 J;  1RKW A;  3TW6 A;  3CMY A;  4IEJ A;  5HOD A;  2GZU A;  1JUS A;  2JMW A;  4W1U A;  3F51 A;  4JCX A;  3S1N J;  2PPX A;  2O8K A;  2OR1 L;  5DS9 A;  1DW9 A;  1X57 A;  3BTL A;  1OFC X;  2HQ5 A;  4BKX A;  3PXP A;  3SCH A;  3BTC A;  2ECC A;  1HDD C;  1UMQ A;  2EH3 A;  3B6A A;  1Y9Q A;  4I6U A;  4Z5C A;  2LVS A;  2LTP A;  3BQZ A;  4I8T A;  2Y31 A;  3OMT A;  4IVZ A;  4X6A J;  3QWG A;  1I50 J;  3BT9 A;  4DYC A;  1BJZ A;  2LP0 A;  4DW6 A;  2NVQ J;  2XRL A;  1WH5 A;  3JRC A;  1UXD A;  5EZG A;  1WI3 A;  2EZL A;  2XPW A;  4XRM A;  5EYR A;  2ME6 A;  2CU7 A;  2YUS A;  1B0N A;  1LE8 A;  3JRE A;  2IV1 A;  2QF7 A;  2PUD A;  5M3M J;  2LK2 A;  4DZJ A;  3BG3 A;  1I3Q J;  2CQQ A;  2PUE A;  1XC5 A;  3S15 J;  3S8Q A;  2DTZ A;  2NS7 A;  1XG1 A;  2MW8 A;  3BG5 A;  4I76 A;  1JGG A;  1Y7Y A;  2OFY A;  3KXA A;  1RZR A;  3GN5 B;  1U78 A;  2B63 J;  4FBI A;  5C44 J;  2CSF A;  4A3B J;  2IUO A;  3QYX A;  3VPR A;  4AC0 A;  3CRO L;  3H0G J;  3FYA A;  3WHB A;  3PO3 J;  4HNV A;  5K98 B;  4NDL A;  3JRG A;  5F0C A;  5M5X J;  2JCG A;  3OP9 A;  1Y1W J;  2JA6 J;  1LE8 B;  5F08 A;  3GTG J;  4NDW A;  5K7Z A;  5IPA A;  2E2J J;  2DMQ A;  2DN0 A;  1QP7 A;  3HDD A;  5IP9 J;  5FLM J;  1ETK A;  2ZB9 A;  3FKI J;  4XRS G;  1FTT A;  3JXD L;  4BBS J;  5JLX A;  2MGQ A;  3QQ6 A;  4L5E A;  2HXI A;  1ZKG A;  2L7F P;  4Y7N J;  2GBY A;  3RQI A;  2ID6 A;  4X4G A;  3GTJ J;  4IHY A;  3LSP A;  3K7A J;  1K61 A;  4A3G J;  1R9T J;  4A93 J;  1FEX A;  1TWC J;  3CLC A;  2XSD C;  1RZR D;  1LCC A;  2ELK A;  4M3D A;  3SCG A;  1QP0 A;  5BNG A;  3OIO A;  1BW6 A;  3SJM A;  2L9R A;  3G1O A;  1JWL A;  2O7O A;  3E7L A;  2K9N A;  2M9H A;  3OOU A;  1WGX A;  4MFD A;  5F0H A;  3G1L A;  3FYM A;  5GP9 A;  3TRB A;  1ZVV A;  2PMZ N;  2RAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...