2H8RA

Hepatocyte nuclear factor 1b bound to dna: mody5 gene product
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
219
structure length
176
Chain Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of disease-causing mutations in hepatocyte nuclear factor 1beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
molecule keywords 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*
total genus 56
structure length 176
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2h8rA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2h8rA01
1RESA 3QPLA 1B8IB 4GQMA 2HXIA 2VI6A 2DA7A 3MVPA 2K9QA 1R9TJ 3S1MJ 4CYCA 2R93J 3U3WA 4PU8A 4M3EA 2X9DA 2EZIA 3TW7A 1ZVVA 2G0EA 2YUSA 4C2MJ 1ZGWA 4IA8A 3CMYA 1QQBA 4GFBA 3CECA 1UMQA 1Y1WJ 2WV1A 3HEFA 3LISA 3PM1A 4MFDA 4I6UA 3MLFA 3C2BA 1O4XA 1YRNB 4IHXA 3F6WA 4IVZA 1ZZ9A 2LR8A 3LSJA 1RR7A 1QVTA 1PUFA 1NK3P 1WETA 4JCXA 1ZK8A 3DCFA 3GTLJ 4X1EA 3GBGA 3JRIA 3HOWJ 4I8TA 2IVQA 2LYPA 4IEJA 4X4HA 2VKEA 1JUSA 1ZZ6A 2AXUA 3PO3J 4FTHA 5JLWA 4A3DJ 1ETWA 4XICA 2FJRA 1GDTA 1ZZ8A 3S1NJ 4J1WA 3VK0A 2AHQA 1ETYA 2DMUA 4A3LJ 2FQ4A 1UG2A 3JRFA 1UTXA 2M9HA 5EF6A 3BQYA 2AWIA 5F0FA 2VUMJ 1U78A 2DA3A 1ZTRA 1ETQA 2A6CA 2XSDC 2CQXA 2E1OA 1LCCA 2ID6A 1GVDA 4C3IJ 1Y7YA 2EBYA 3RZZA 4M3GA 2JVLA 2XB5A 2DA6A 2K40A 5HODA 3TW6A 4BKXA 2E2JJ 5C44J 1MSEC 2LYLA 1NTCA 2HYJA 5E3LA 1JFTA 4Z59A 5C3EJ 4S0HB 4EEFG 3LSRA 2DA2A 4BBRJ 5GP9A 2PUDA 2IVBA 3CROL 3B6AA 3OQNA 3FIWA 3OQMA 2KEKA 3FYAA 4W97A 4PU7A 1ETVA 4A69C 3K7AJ 1NERA 2E19A 1VF9A 3TEDA 4QTRA 3JREA 4IHYA 1CQTA 3VPRA 1U9NA 3HOZJ 5EGOA 1PRVA 3JRCA 2DA1A 3Q0VA 5EG0A 2HQ5A 2ZB9A 4A3KJ 2CROA 3FMYA 1BJZA 3G5GA 1HDPA 5FLMJ 2E2HJ 2AW6A 2HINA 1UXDA 4A3FJ 3SFIA 2JK3A 3BTJA 2OPTA 3CQZJ 3O8GA 1JJ6C 1JTYA 3HBLA 3ZHIA 3BG3A 4Y7NJ 3BG5A 1ETKA 2Y30A 4X4FA 3GN5A 3QF3A 1HOMA 3BTLA 5E3MA 2NOGA 1L1MA 1ZZBA 2M0CA 2RAEA 4YG7B 2ECBA 5EGOB 3IVPA 4UUSA 2LYKA 1Q1VA 3WHBA 2HSGA 2L8NA 1GT0C 4A93J 5IYDJ 3B7HA 2R63A 2EZLA 3F52A 2KT0A 5IP6A 1WI3A 1VNDA 3RQIA 2PUGA 1TWGJ 1LMB3 1JGGA 2DMPA 1H89C 1MBHA 5K7ZA 4X4BA 3A01B 4Y52J 1ZQ3P 5C4JJ 3FKIJ 3R1FA 1QPZA 2B63J 1LFBA 2H8RA 4M3BA 2NVQJ 5J3LA 2YU9J 3S17J 4NDLA 1ETXA 2M34A 4AYBN 3KJXA 3O8HA 2LKXA 5M5WJ 2GM4A 3HOVJ 3S2HJ 4QIWN 2XGEA 1DW9A 1JT6A 1B8IA 2LYRA 1TWHJ 2WUSR 1GV2A 4FISA 1W0TA 1CJGA 2JN6A 4MCXA 4YARA 2FX0A 5GPCA 5K7HA 4FE7A 5F0HA 3JRAA 1WGXA 1ZUGA 3IH2A 2LY9A 1Z0XA 5GPAA 3G1LA 2XCJA 2CJJA 2MW8A 5F0CA 3BD1A 3QPSA 1XS9A 3G1OA 1TWFJ 2XPVA 2Y2ZA 3FK6A 3UFDA 2BJCA 2L7MP 3GN5B 1MBKA 2EWTA 2LTPA 3EUSA 1IDYA 1F43A 3KZ3A 1LFUP 2NVXJ 2O49A 1ADRA 2EF8A 4X6AJ 3S14J 3JRDA 1OCTC 1RZRA 2M8GX 1JT0A 3HZIB 2X6OA 4A3JJ 1LE8B 1R69A 1UHSA 3G1MA 1X2NA 2IAIA 4D5CA 3LSGA 2VKVA 5FKOA 5K7FA 2OF7A 2JA5J 3M4OJ 3GBFA 3ZQFA 2DMTA 3BTCA 1RZSA 3OP9A 1ZAYA 2LK2A 3ZQGA 1U8BA 1A5JA 1BA5A 1K83J 2EQRA 2FD5A 2R5YB 1HLVA 1TC3C 4PU4C 2NS8A 4RDUA 2PIJA 1XWRA 3SCHA 1R63A 3GTGJ 2PMZN 1JH9A 5FJ8J 5EZHA 2LP0A 2B5AA 3TP3A 3S16J 3S15J 2XRLA 2H1KA 4A3GJ 3JRBA 2MG4A 5IYBJ 1ENHA 3MN2A 2L49A 4JX6A 4L5EA 2ME6A 4B4CA 1ITYA 2Y0SN 2PUAA 1RPWA 1I50J 1RZRD 4IWRA 2JJ7A 2R7ZJ 3IV5A 3PXPA 4A3IJ 3BTIA 3CDLA 4XIDA 2HXOA 3DNVB 1X2MA 2MEZA 4MIMA 1AU7A 4O8BA 2IVGA 2E2IJ 2R5ZA 4DYQA 3HB9A 1OSLA 1ZS4A 1IV6A 3SDGA 4A3CJ 1PRUA 4X4EA 5FKMA 4I76A 3H0GJ 2PPXA 4V2GA 2L7FP 4I6ZA 4X4IA 1RPEL 4YG1A 2JA8J 1APLC 5E3OA 3QQAA 4G12A 2ICPA 2R5ZB 1HF0A 5M5YJ 4J1XA 2W48A 5FKLA 4GHJA 4V2FA 3GTJJ 2JA6J 3BG9A 2O38A 5FKNA 1ZR2A 2DA4A 5FLVA 2HI3A 3LNQA 3OSGA 4M3DA 1PNRA 2R1JL 2AO9A 3ZKCA 3SCGA 1ZKGA 1WH7A 3GTKJ 1QQAA 1JUPA 5A7LA 1QPIA 1F36A 4ABZA 3GTMJ 3JXDL 4MLOA 3BT9A 3GTQJ 2PUCA 1JTXA 1OCPA 1IG7A 3O9XA 2CUEA 3ZQLA 1VPWA 4I6RA 1LE8A 3A02A 4B3AA 3HOXJ 1BDHA 3ZOBA 1I3QJ 4JX5A 2R5YA 2COBA 3OQOA 1T33A 1B0NA 3S1QJ 2CUFA 2O9LA 2JWTA 1XG1A 2X48A 2JCGA 1WPKA 2EZKA 2MSYA 2ECCA 5IP7J 1Y1VJ 2DN0A 3HDDA 1NK2P 2GBYA 5E3NA 4JYKA 2KDZA 2GRMA 1H8AC 4DW6A 1X57A 1RKWA 3ZQHA 3GTOJ 2PUFA 1B72B 1LQCA 3Q0WA 1WH8A 2AXVA 2BNNA 2XI8A 2MQKA 4X4CA 3S1RJ 2KEIA 2WB1N 2NVTJ 3B6CA 4BY1J 1XC5A 3OOUA 1TWCJ 2KEJA 1WIZA 3S8QA 1LLIA 2AUWA 2ID3A 4X4GA 1TWAJ 3GTPJ 2WAQN 4C3JJ 5BNGA 1EFAA 1ZR4A 3RZOJ 3QQ6A 3SCFA 4D7NA 1ETOA 3TRBA 5IOYA 1H88C 2PUBA 2QCOA 5EEAA 4AUXA 4BXXJ 4IHVA 2EZHA 4PU3C 1Z77A 4AC0A 3IH3A 2R0QC 1SFOJ 1WH5A 1LCDA 2CRGA 3A01A 5IYCJ 5FKKA 2Y31A 1MNMC 4B1RA 2L7ZA 2BNMA 1OFCX 5DS9A 2LLKA 4JP0A 2FJ1A 1I6HJ 3HGGA 4W1UA 3NAUA 4DZJA 5EZGA 5EDNA 2L9RA 2R92J 1JUMA 1X58A 2LYSA 2WIUB 4I6TA 1SANA 2HOTA 3FK7A 4YBAA 3TP0A 1AKHB 1VI0A 1D5YA 1HDDC 1IJWC 3H5TA 2ELKA 5DTDA 3F0CA 4X4DA 2K9NA 9ANTA 3HOUJ 2IU7A 3JR9A 4UUSB 1MBFA 3L1PA 3BR5A 3G7DA 2IBDA 2GZUA 1OJLA 2XGDA 2IV1A 3JXBC 1IUFA 1QP0A 4JQDA 4IHWA 3MKLA 1X2LA 5M5XJ 3JRGA 3K2AA 3RKQA 3BR1A 2AXZA 2CU7A 1FEXA 3JXCL 3OIOA 2MGQA 1MBEA 3BR0A 3NARA 3A03A 4XRSG 1W0UA 2TRTA 2HOSA 3BQZA 4MO7A 1FJLA 4A3EJ 2EH3A 2ME0A 2HOAA 4DZPA 2CSFA 1ORKA 1FTZA 4A3MJ 2LVSA 3BR6A 1SQ8A 2CQQA 5JLXA 2OFYA 1IGNA 5EG0B 3OSFA 1IDZA 2XIUA 3QYXA 3CLCA 3ZQCA 1POUA 5IOZA 1WCMJ 4C3HJ 2DMQA 1ZZCA 2BNOA 3HOYJ 1BW5A 2JA7J 4J19A 2XGCA 3CCYA 1A6IA 1MH4A 3LOCA 4OB4A 1YSEA 1EF4A 5K98B 1GV5A 3UKGA 4XK4A 1DU6A 3F51A 4FBIA 4Z5DA 1HCRA 3BDNA 2QF7A 2DMNA 1PUFB 1DU0A 3I4NJ 1MH3A 5F04A 2LD5A 1AHDP 4BBSJ 5J1YA 1WH6A 5J1RA 2XJ3A 3DEWA 4D5FA 2KPJA 1QP4A 2OR1L 1JKQC 2L0KA 2Y9YA 4QSHA 1QRYA 4MCTA 1Y9QA 1JKRC 4M3FA 3SJMA 2NS7A 2PE5A 3BR3A 2O8KA 1AKHA 1IRZA 2LFBA 2LYQA 5M3FJ 1MBGA 1G2HA 3W6VA 1NEQA 1QVUA 2DJNA 1DWKA 4FCYA 3HM5A 2DTZA 2ICTA 4UUTA 3WHCA 1JWLA 1VFCA 1PERL 3D1NI 4Y42A 2XPWA 2IUOA 1FIAA 2LYJA 3H3VK 4Z58A 5IP9J 4DYCA 3Q3SA 1U9OA 1YRNA 2M2EA 2Y9ZA 4Z5CA 2YS9A 2XPUA 4A3BJ 1MSFC 1FIPA 2EBIA 4YG4A 5IPAA 4MFEA 4HNVA 3HGYA 1MBJA 3HKZN 3I4MJ 1JKOC 4LOCA 1E3OC 3KXAA 5F08A 4XRSA 2O7OA 1BW6A 3M3YJ 1P7JA 1RETA 1S7EA 3ZHMA 2I10A 5F1JA 2N8GA 3FISA 4CYCB 2NVYJ 4RBOA 4JCYA 3BR2A 3BS3A 2O4AA 1K61A 3E7LA 2IEKA 2VPRA 5EYRA 5M3MJ 2D5VA 1ZPQA 4F8DA 1JJ8C 4NDWA 4M6VA 1T56A 3LSPA 1JKPC 1PRAA 3ZQIA 4D7MA 1POGA 3QWGA 4JX4A 1BDIA 1BL0A 3IH4A 2DA5A 3LFPA 1UXCA 2LCVA 1GUUA 2PUEA 3PO2J 3Q0UA 2XB0X 2TCTA 4FN3A 4DYRA 5F27A 3FYMA 2P81A 1RIOA 3JRHA 1B72A 1ZZ7A 1JFSA 4BY7J 3OMTA 1RKTA 4Z5HA 3RZDJ 4XRMA 2HDDA 2JMWA 2K9SA 3S2DJ 2GRLA 1IC8A 5C4XJ 2KZ8A 2GLOA 4FE4A 5J1UA 1QP7A 1P7IA 1FTTA
chains in the Genus database with same CATH superfamily
1RESA 4Y13A 3MFKA 3L2QA 4GQMA 2HXIA 2VI6A 4XLNF 1MKMA 3TFLA 4G9YA 5D5XB 2HQAA 4OU0A 3M9LA 5JHFA 1ZVVA 2EZIA 2G0EA 2GOMA 2H09A 2RGVA 4IA8A 1QB2A 3I9V2 2VL8A 1QQBA 1X3ZB 3VDXA 2VBWA 3CECA 3QODA 4EK9A 1Y1WJ 4KUMA 4I0BA 4EM0B 4MQ9F 4I6UA 1TQIA 3C2BA 3MLFA 2G7HA 3LSIA 2HTSA 1RR7A 2P8TA 2QUFA 3K70C 3QPHA 4X1EA 4KIFA 1BI2A 1K6YA 2XF6A 5E8GA 4I8TA 4YIIA 2P7CB 1JUSA 4L9TA 2AXUA 3ULQB 4A3DJ 5JLWA 3U1DA 4A6DA 4XKWA 3VYRB 4MEXF 2IA2A 4Y33A 2FQ4A 6PAXA 3QOEA 2ZSIB 3R60A 2QBYB 1W7PB 2HOEA 1R1UA 2CQXA 4CCLA 3GZDA 1GVDA 3C2HA 2XASA 1S9HA 1X1DA 2XB5A 1ZLJA 4XQFA 4X0GA 2E2JJ 5C44J 3MKYB 2E7WA 4BHBA 1OKRA 3N4MA 2NYXA 3ZGKA 4IRGA 2PXTA 3GO5A 1J7KA 3T0YA 2Y0MA 1R5HA 2LRDA 1TLHB 3QOWA 3B6AA 1OR7C 4HF0A 3PIPF 3OQNA 3TDUC 3OQMA 1K78A 1YJNI 2DT6A 4ZYGA 1QA6A 3DPTA 4PU7A 2DXIA 1G59A 1A35A 4F3QA 3OYCA 3JREA 4IHYA 2Y69H 5KK1A 1W5TA 1L3LA 1RR8C 3KYCB 3VPRA 1RC9A 2R7VA 4C2TA 3Q0VA 1FLIA 3DKYA 4A3KJ 1X4OA 3FMYA 1BJZA 1LDDA 3VYUB 2ZC2A 5IT3A 1PP7U 4BXUA 2IS1A 4NQWA 3RDIA 3IKTA 1UXDA 1MNDA 4C9YA 3HC7A 2QEXI 1UELB 1JE8A 4F92B 4DQ2A 2GZWA 4CCNA 3DLLF 1SEUA 1T38A 3QYEA 5ILVA 1XCBA 3HBLA 3WTTC 3BG3A 3BG5A 1ETKA 4PJLA 1ZAOA 2Y30A 2MA3A 4X4FA 1O3QA 2A6EF 4LITA 3BTLA 5K5RA 4BE2A 5E3MA 2J5PA 2K27A 2L1PA 3K10A 2KISA 3FMSA 2M0CA 3AG1H 2ECBA 4GO1A 5EGOB 2LBFB 1M1EB 2E1NA 2W85A 1FOYA 2L4AA 2QZ8A 2L8NA 1GT0C 3RSNA 4RB3C 5DDGA 2OQRA 2R63A 3DTIA 3LQRA 3KP6A 3KP5A 4F55A 2HTJA 2PUGA 1VNDA 2A5WA 2GAUA 3K4JA 3IKVA 4NC8A 2K4BA 1T8IA 2LMDA 3SEZA 1L0OC 1P2FA 2VQGA 3I64A 3NZLA 2H8RA 3DM5A 2DFIA 2YU9J 2ZMEB 4EM2A 4MTEA 1ETXA 3CJTB 4AYBN 3KJXA 3D0SA 2LKXA 2V1DA 1WJCA 4XONA 1XX5A 1Q1HA 3HOVJ 1JT6A 1YW7A 1B8IA 1EJ9A 5DUIA 1YITI 2DI3A 4OAYA 4RGRA 4MCXA 2DAOA 5K7HA 1E3HA 1WGXA 2CS3A 3EUHA 3A9YA 2LY9A 3MWMA 1JHFA 5L3GA 1H9TA 5K1YA 4EKIA 3BD1A 3ME5A 2HPIA 2KLOA 3EUAA 1MMGA 2COMA 3G1OA 4B48A 3UFDA 1XSVA 3C2GA 2EFQA 1MBKA 3HOTA 3RPQA 2EWTA 1YX5A 4ENKA 3EUSA 3ZN1A 2R7DA 2DOEA 1EKEA 2PQ8A 1SVLA 5ED4A 1VQ7I 5FLXZ 4BDYA 3JRDA 3OYGA 4RAYA 2M8GX 4E70A 2X6OA 3CC7I 3QU6A 3CF5F 3G1MA 3LSGA 2VKVA 2EV6A 4P9FA 4PZJA 5K7FA 3L2RA 4M72A 2PFBA 3AG2H 3WG7H 4AIKA 5L3DA 4WVLA 1RZSA 3K4BA 5BMZA 2STWA 2M4HA 4OBMA 1TTYA 1ZAYA 1GLNA 3ZQ7A 2CV2A 5HVQC 1A5JA 1BA5A 2F5VA 4PCQA 5D4SA 3FF5A 1KA8A 1B6AA 2EQRA 2FD5A 3FBNB 1T08B 2R5YB 1TC3C 4BHPA 2GIVA 2R7WA 3KZZA 1C0WA 3HUGA 5J8CA 3SCHA 3VWSA 4E7ZA 3PSFA 3D5RC 5EZHA 2LP0A 2X0LA 3TP3A 1X3UA 4A3GJ 2EJRA 1F5TA 4QWQA 5FD5A 2HU9A 2KMUA 2MBFA 4IXAA 3TGNA 1OCCH 2WAFA 2V9VA 2PUAA 5FFXA 4E4HA 4RM2A 3S8PA 4A3IJ 3L2CA 2XC7A 3I59B 4KFCA 1TQMA 4NBQA 5DCMA 2F4OB 3KP7A 2R5ZA 2XRNA 2ZBKA 3HB9A 3A4CA 3R09A 3H0DA 3CUQC 3PQJA 1ERDA 3LQXA 3H9QA 1W36D 1VQ8I 1V5FA 2PPXA 3EETA 2Q2EA 3RKWA 4YG1A 2CH0A 1W7PD 3NQOA 5HNHA 3HPGA 2HPMA 1BC8C 2ICPA 2R7RA 5M5YJ 1Z3YA 3KEOA 2E34A 2NVUB 2W48A 4RB2C 3ZMVA 4GHJA 2YR2A 5DTMA 5FKNA 1ZR2A 5FLVA 2HI3A 3LNQA 3G6EI 3OSGA 4M6XA 4ZH4F 3C3WA 3ABTA 1XN7A 3KFWX 1KQ0A 1PP8F 1ZRDA 3IP4B 2LLWA 3ZR8X 4IZZA 3O6BB 1F9NA 3JXDL 4MLOA 2PUCA 5ILSA 1OCPA 4YIRX 1IG7A 3O9XA 2CUEA 5E1XA 3ZQLA 1VPWA 2XAJA 1LE8A 1R4NB 3A02A 3KP3A 4B3AA 3HOXJ 1BDHA 1IZ1A 3ZOBA 2MD0A 3FXUA 2COBA 3KLOA 1OMIA 4WXCA 2O9LA 2F4IA 4RGUA 5DV5A 2Z9OA 3CCRI 4UUVA 4AD9A 1Y1VJ 2D1VA 2DN0A 3HDDA 1ZG1A 1KONA 1Z3XA 4R8HA 1USSA 2KRCA 2R7FA 4JYKA 2GRMA 1XTAA 2IGMA 4D9JA 1X57A 2FXAA 2QENA 1WH8A 3Q0WA 4EJWA 1BIBA 1XC5A 3TKYA 3WE2A 2OAZA 5GADJ 3BG7A 1DQUA 2WAQN 2ZKZA 4C3JJ 1YS6A 3K4LA 3MEXA 4OMZA 5BNGA 2CGPA 3CCLI 2GXBA 1STZA 4HF1A 3O3KA 4D7NA 1ETOA 5IOYA 4AUXA 4BXXJ 3OR2C 4Q48A 4BH9A 3OYDA 4PU3C 2F6CA 4BE1A 3A01A 3K70D 3H5AA 1MFQC 5IYCJ 3BWGA 5FKKA 5FO5A 4GDFA 3JTHA 2CW0F 2L7ZA 1XSDA 2W00A 2BNMA 2LLKA 4WXDA 3GCMA 4XLHA 4ZTFA 3HGGA 3IRRA 1H9GA 3F6VA 3SQNA 2EK5A 3WTZA 1FYKA 1UG0A 2CUJA 2CW8A 3V7RA 3S3MA 2LYSA 5TGTA 4ENJA 3DV8A 3W2WA 4N9IA 2MH9A 2HEOA 3DBLB 2QKMB 2ISZA 4YBAA 1HDDC 3H5TA 4BU2A 5BQTA 2XHKA 5CKTA 3H92A 4WCGA 9ANTA 2DDBA 4GCVA 4UUSB 1MBFA 1KU9A 3L1PA 1YQAA 2K3PA 3ZMTA 4FX0A 4DBRA 2OU2A 2XGDA 1YIOA 2OZUA 2VJ5A 1DDNA 5E17F 2LOOA 2IS2A 3JXBC 1LVAA 3MKLA 4ZDOA 2EFWA 2ESHA 1H0MA 2FBKA 5FB2A 1X2LA 3C7JA 3CMMA 1U2WA 2IGOA 2V6CA 2FE3A 1YLFA 3NARA 3A03A 4BHCA 1W0UA 2TRTA 3BJAA 2P4WA 2HOSA 1T95A 2ME0A 2VJ4A 4DZPA 1AWCA 3KE2A 1ORKA 4ZYEA 1QZXA 1IV8A 3E5UA 3OYIA 5DSXA 4YELA 1XMXA 1IGNA 2OFYA 1Z21A 4OIOF 1POUA 3M8JA 5IOZA 4C3HJ 2DMQA 4R1HA 3K1MA 1KYWA 1TNSA 3KEQA 3GFLA 3C1DA 1YSEA 3GW2A 1EF4A 4II2A 3WU1B 3VFZA 1PUEE 2O49A 1DU0A 3I4NJ 1Y8QB 1S7AA 2DLLA 5J1RA 3QYFA 4M71A 2LLVA 3GUDA 1QRYA 3OYMA 2EFOA 2VE9A 1QZYA 2DT7B 3SJMA 2NS7A 4XORA 5HDGA 2PE5A 1G3SA 2VKHA 3T8TA 1D8JA 2LFBA 4XLPF 1P92A 3MZ8A 5M3FJ 2AXTC 1BI1A 3NRVA 2DJNA 2ICTA 1JWLA 1PERL 5FRMA 4M9XA 3OYNA 2XPWA 1MJ9A 2MD5A 2IUOA 4XBFA 1ZGJA 4Z58A 4K2EA 4HRAA 4NC6A 1Z1DA 1E17A 3VYSB 3EUHC 1BI3A 3LMMA 5KCMA 3ROUA 4WK8F 2HFHA 4PJNA 2DYRH 2OCCH 3G73A 1QZEA 3FMRA 4HNVA 3HGYA 1MBJA 4B09A 3I4MJ 3OYEA 1JKOC 4LOCA 2EB7A 1Z91A 4A0YA 3M3YJ 2NS0A 3WGGA 2O8XA 4ZTJA 3BROA 3FISA 2Z3YA 4CYCB 1X1AA 2NVYJ 3D5LA 2O4AA 2O03A 4C2UA 2KRHA 2VJJA 4HSTA 4XR6A 3OY9A 2JPBA 1VQOI 2EIJH 5FD6A 3V7CA 3KLNA 3TDZC 3V8JA 3RI4A 4IOCF 3OMYA 3IRQA 1JKPC 2GIZA 4D7MA 3U1KA 5KNLA 3HZJA 3K0LA 3R0AA 5DYMA 3QWGA 2BE5F 5FGMA 2BY2A 3F8FA 3LAJA 2QSFX 2ZFWA 1UAAA 2PUEA 1MGTA 1Y6IA 2VASA 4FN3A 1YX3A 2TCTA 3FXJA 2BVMA 4WWCA 2AXLA 4LK0F 1E2XA 4CUGA 2A6HF 3SZPA 1CF7A 3BJOA 2ZSHB 2Z1DA 2K4JA 3TO9A 1D3YA 1P4WA 2E5ZA 2KP6A 1R5GA 2HDDA 2JMWA 3S2DJ 2K85A 1TBXA 3GUUA 3F8NA 1IC8A 5C4XJ 4BE0A 2MXDA 2LDUA 2QSGX 1Y56A 4FE4A 4EM1A 1UZCA 1P7IA 2FBIA 1KZHA 2FA5A 5EJCA 4U7DA 5BPDA 4E7LA 2GA1A 3I59A 4ENMA 4DE8A 1N77A 1V5GA 3ZMDA 1R9TJ 4UVAA 2IXSA 4CCKA 4U0WA 4J01A 4PU8A 2KIMA 3TW7A 4C2MJ 1TQPA 4BYYA 2P5LC 3DFGA 4GFBA 2G7UA 4IHSA 3HEFA 5E79C 1VTNC 3PM1A 1ZYRF 2LY2A 1P6RA 4IVZA 4RGXA 1WHUA 1SFXA 3DCFA 5D6EA 3CJNA 4LLGF 3GBGA 5JHUA 4A12A 2V6EA 2LYPA 2L4MA 3CCUI 2PXBA 2MC3A 1ZZ6A 2HZTA 4DJAA 4IPAA 2FJRA 4J1WA 4CYDA 3VK0A 3T8RA 4A3LJ 1UTXA 1X3WB 3I58A 3JRFA 2L9VA 5EF6A 3E6CC 3BQYA 3CP8A 1CF7B 1S5LC 2VUMJ 1ZTRA 2HQRA 3PUFA 4HBLA 2ID6A 3L2UA 5D5UB 4OOIA 3RZZA 3DKXA 2JVLA 1CGPA 3CP2A 3MCZA 4Z2YA 1DPUA 5HODA 2Z99A 5HS9A 3TW6A 4BKXA 3SR4A 3JSPA 4IRHA 2YX7A 4A0ZA 2HYJA 5E3LA 3OYLA 1TL8A 3KEYA 4S0HB 3LQQA 2VBZA 4P1WA 3TO6A 1ZRFA 2BW3B 4I99C 1YOVB 4FQGA 2RVCA 5GP9A 4ZYAA 2J7WA 3J7ZI 2O6GE 1VQKI 3CROL 2XVCA 3J81Z 3KZYA 2LKPA 5BPIA 4KITB 1UJ8A 2ELJA 4A69C 1D8KA 2XF5A 3P9CA 1Y39A 1B4AA 2ZMEA 2L3DA 3RTRA 1CQTA 4TV7A 1U9NA 3HOZJ 4ESBA 2MYSA 3JRCA 3V7SA 2HQ5A 4IHTA 5HDNA 5LRSA 2CROA 2ACJA 3G5GA 3ML6A 1K4TA 4LB5A 1HDPA 4HYEA 1D0XA 3TL4X 1FOKA 2HINA 1VZ0A 4FHTA 4KDPA 4A3FJ 2V1UA 4CZZA 2OPTA 1UCRA 5DM7F 1ACIA 3O8GA 1JJ6C 1BJAA 4H4KC 1JTYA 3V8KA 2JPCA 4CO8A 2WBMA 3WODF 2FU4A 1QNTA 2M0MA 4RB1A 3W6KB 3L7WA 1Q1VA 3KL4A 2X6XA 1D1AA 3OOPA 4A93J 3S3OA 3JW4A 5IYDJ 3B7HA 3I71A 5L3CA 4HEA2 5GTHC 2F48A 1LJ9A 1K4SA 4B44A 4ZYDA 3DF8A 5K7ZA 4X4BA 1SD5A 2JT1A 4CDGA 4Y52J 1QPZA 3R1FA 1O3SA 1LFBA 4Q5SF 3E6DA 4M3BA 2XSJC 3S17J 1IN4A 1YJ9I 3DP7A 3O8HA 2UXNA 3OL4A 3RPUD 5M5WJ 2HVSA 1V54H 4QIWN 2XGEA 2LYRA 1K78B 2E1MC 2XXQA 4AVZA 1CJGA 2IA1A 2FX0A 2O5RA 3H5NA 3H9JA 2VOPA 2HKOA 3H36A 5F0HA 1KYZA 2PXUA 4I98B 5CVIA 3IH2A 1W7PA 1ZUGA 3CCQI 5GPAA 3G1LA 1J2XA 4IQ4A 5ICGA 2CJJA 2MW8A 4HOBA 4IL6C 4L5IA 5F0CA 3S93A 3LAPA 3QPSA 2E60A 1XS9A 1TWFJ 3FK6A 5F64A 2VIXA 3D5SC 4JQFA 3RIRA 3OL3A 2LTPA 3KZ3A 1IDYA 1KU7A 2NVXJ 1ADRA 3PNTA 3EYIA 2QBYA 3H3UA 3FXKA 3PNYA 3L09A 2UXXA 2Q0OA 5H20A 3HZIB 1JXSA 3P9IA 4BAYA 4FT8A 1UHSA 1X2NA 2IAIA 3DU6A 4D5CA 2K86A 5HDKA 2JA5J 5HS7A 1T2KA 2Y48A 3U9GA 4ZC3A 5LHHA 2OCEA 3KX2A 2ZJPF 1LQ1A 2IW5A 5DTQA 4KN7X 4LMYA 1R6RA 1U8BA 3N05A 2K9MA 4LG0A 3OS2A 3RKYA 2L9NA 3EUKL 2DW4A 1XMAA 1HLVA 2ZNZA 2ZO4A 4PGGA 5DEQA 2QA4I 4CGZA 1P4AA 4I01A 1OQYA 5DT2A 2KL4A 5TISC 2DOAA 4HZFA 3GTGJ 1JH9A 4BQNA 5FJ8J 2DOFA 5LGTA 2B5AA 4BGDA 3HRUA 3S16J 1LEBA 1SC7A 3S15J 2XRLA 2L49A 1RIOH 2VT2A 4JX6A 4L5EA 1BOBA 4IF4A 2PXEA 2NRAC 4IWRA 1I50J 2JJ7A 2R7ZJ 3IV5A 3PXPA 3CDLA 3GYHX 3DNVB 2EIMH 4O8BA 3BJ6A 5CLSA 2E2IJ 1Z6RA 4F7ZA 4DYQA 4LD5A 1FWZA 4A3CJ 3G0TA 3BPXA 3K4NA 3J7YJ 5CQEA 3EYYA 4X4IA 3UNGC 3ELKA 1APLC 1QGPA 3F72A 4RAFA 4UB6C 1G6NA 2IVMA 5FKLA 4V2FA 3GTJJ 2JA6J 2H6CA 2DA4A 4ZJZA 4WXHA 3C18A 3ZKCA 5DRYA 4LLLA 3SCGA 1J9IA 1B1BA 5EEHA 2A68F 2OA4A 1WH7A 2ZXJA 1JUPA 1NG6A 1R7JA 1KGSA 2YX4A 4F91B 1F36A 4I09A 2M7BA 3RQ4A 4EJVA 1FOWA 3GTMJ 2VB6A 2WB1A 2FFHA 3DEUA 2JVGA 3GTQJ 2HCNA 1I1SA 1JTXA 5TJJA 4L0ZB 4I6RA 2LH9A 2B9SA 1FOXA 4Z6YA 1BI0A 2CUFA 4V19K 2X48A 1XG1A 2JCGA 2MSYA 2EZKA 4KICA 2CYYA 5GTIC 1O57A 4EZIA 5FRNA 1D5VA 5D5VB 4HA8A 3GF2A 4A5NA 1SFUA 1VQ5I 2M3AA 1H8AC 4DW6A 2JUGA 2DU9A 3ZQHA 5KAFC 1B72B 1XD7A 2VQHA 3G4SI 2XI8A 2KEIA 2RV8A 2MQKA 1WQ2A 2WB1N 2VC0A 3PNVA 2J5OA 1WFXA 3WTYC 1Z7LA 4FASD 3BLYA 3OOUA 1U0JA 2P6SA 2X4HA 4QLCU 4HF2A 4LG0B 2DTRA 3WGHA 1TWAJ 3GTPJ 2A69F 1TNTA 3SHFA 4OIQF 1ZR4A 2L9SA 3RZOJ 3QQ6A 3SCFA 3IUOA 1FC3A 4XNFA 3ABKH 3SFZA 2BV6A 2IPQX 2KDOA 2V3CC 2EZHA 3LSMA 1NH3A 3TOAA 1R1VA 4AC0A 1SFOJ 1OCZH 4MHGA 1I6XA 2V9PA 2F5FA 2DPDA 3E97A 2Y31A 3GFIA 4E6KG 1OFCX 2HKXA 4UY8I 5DS9A 3NROA 4F52A 2NOJB 2E5NA 3FXOA 5DM6F 1D1CA 5EDNA 3OYKA 2Q1ZB 2L9RA 1JUMA 3H3ZA 4I6TA 1SANA 3QP5A 2HOTA 3GZDC 2QQ8A 3UR3C 2QSHX 1REPC 1AKHB 3QPTA 1WZ2A 1IJWC 1BN5A 2VQCA 3P5JA 2R7UA 2GXAA 3F0CA 2K9NA 3A0BC 2IU7A 4XOTA 3JR9A 3G7DA 2IBDA 2DFHA 1WRJA 5L3BA 4IHWA 1ZHFA 3HSEA 4HX7A 1BOAA 2M8EA 1RNLA 3K2AA 3RKQA 4KMUX 2CU7A 1FP2A 3OIOA 1BBYA 1MBEA 3WU2C 3X2QH 3BQZA 2K7LA 4PK4A 1ZREA 4F93B 2W84A 3FX3A 1S29A 1VQ6I 1LB2A 3BR6A 3AG3H 2XGXA 2CO5A 4ZZLA 1TT0A 2PXDA 5JLXA 3NDBB 5EG0B 3OSFA 1IDZA 2FBHA 3LWFA 3HL2A 4U87A 3QYXA 3ZQCA 2HS5A 4HSRA 1A36A 1WCMJ 2MC4A 3BZKA 4EKGA 2L5QA 4EJUA 1V55H 5K98B 3IC7A 1GV5A 1V3FA 3F51A 4Z5DA 2BGCA 4BBSJ 4EVIA 2W57A 2LD5A 2XJ3A 2YPRA 2W25A 4D5FA 4ON0A 3F23A 1JKQC 2L0KA 4EJTA 1QP4A 5ICFA 3ESWB 2FEZA 3JCUC 2NAZA 3CTAA 4PSXA 2V79A 1B9MA 1MZBA 3IL2A 4ESFA 4QPOA 5LBQA 4KIBA 2GA2A 1MBGA 3TMOA 4XOPA 3AKZA 3KYDB 3BCBA 1QVUA 1DWKA 5D8KB 4UUTA 3WHCA 4Y17A 1P4XA 1TT5B 2P5VA 3CCSI 4Y42A 3DEEA 3W6JB 2HWVA 2X1EA 3AFHA 2LYJA 3H3VK 3Q3SA 2AS5F 2PI0A 1YRNA 2Y9ZA 1U5TC 1MSFC 2XF7A 1FIPA 3F8BA 1SFKA 3CO7C 4UXNA 5FFZA 2QKLB 2ADUA 3VSKA 3ABUA 1OLTA 4HRIA 4MFEA 1MMSA 2PXVA 1NG7A 5LEJA 1FBSA 4KA4A 2UV1A 1E3OC 4KT6A 3BC8A 3R61A 4XRSA 1I1GA 2F5CA 3F3XA 2H8WA 5DCMB 2DPUA 2FOWA 5F1JA 5J4YA 3L2VA 2R7XA 2A61A 4XN0A 4RBOA 3BR2A 4N0BA 3OYAA 1AA7A 2IEKA 2VPRA 3CMAI 2LREA 3B73A 1ZPQA 5DD8A 3ZXSA 2Z16A 1JJ8C 3R0JA 1NHAA 3QWLA 2P0WA 1J5YA 5ICCA 1IN8A 2DT5A 4M6VA 3SZTA 4DE9A 1PRAA 3ZRGA 3ZQIA 4Q2JA 4YIFA 1POGA 4JX4A 3PL8A 5HOOA 3VSLA 3ABMH 5CJ9A 2WY8Q 3LFPA 1UB9A 4WF2A 3S32A 2EPFA 1UFMA 5JFRA 3GFMA 2L7KA 3Q0UA 3PO2J 1HQCA 5F27A 3FHNA 3AL0C 1MD0A 3BP8A 2W24A 3BPVA 2P81A 2PBIA 3JRHA 1MW7A 1ZZ7A 1IRGA 4GRIA 4BY7J 1SVMA 1SAUA 3CMEI 3FXQA 3K1PA 4XRMA 3I3LA 4RB0A 1OCOH 3CCMI 4D1QA 4PJ0C 1DGRM 3OR1C 4YG2F 3BZCA 3QPLA 2XAGA 2DA7A 3PFYA 4OWRB 2TDXA 2K9QA 2CWEA 3S1MJ 3LL7A 3K69A 3SDBA 2R93J 4HV6A 4L5JA 3U3WA 2A5YB 3COAC 4M3EA 4LLNA 2YUSA 1Z6TA 1E3PA 1QQIA 3IAS2 3KIOA 3ECHA 2WV1A 2L2OA 2CSOA 4MFDA 2JTVA 3ASNH 1YRNB 3AL0B 3CCJI 1YHQI 4IHXA 3F6WA 1ZZ9A 2LR8A 3K2ZA 3LSJA 4G6DA 3Q5FA 1QVTA 1PUFA 1R49A 2VEOA 1ZK8A 4Y3OA 1E0EA 3OS1A 1EA3A 3JRIA 2DFEA 1YI2I 4IEJA 2GQQA 4X4HA 3U2RA 2ZXHA 2V4JC 2FNPA 2RNJA 4OIRF 5A2QK 3PO3J 4LJZF 4FTHA 2FMYA 2XIGA 4XICA 1U3EM 1ZZ8A 3S1NJ 3NWSA 4UVCA 1MMDA 1UG2A 3VOEA 5F0FA 2F4MB 4GXOA 2DA3A 1U78A 2A6CA 1V4RA 2XSDC 4DGWB 1LCCA 3HHGA 4C3IJ 2EBYA 3J7AO 1SD4A 2K3FA 3ZQQA 5BS6A 1MSEC 3SEQA 1NTCA 2Z5UA 2JVHA 4E7KA 5C3EJ 4EEFG 3LSRA 3EPZA 4XM3A 2WADA 3I54A 3E1SA 2P6TA 5B5EC 4PFPA 2IVBA 4P5OA 2X6WA 3FIWA 3V4GA 2KEKA 3DTKA 3FYAA 1X1PA 2OTLI 1GXQA 1ETVA 1HW5A 2K02A 2IGNA 3K7AJ 3VB2A 2V1NA 1A31A 4CHUA 2XAQA 2VE8A 1HKTA 3P9KA 4BQOA 5DUKA 2PMHA 1R4MB 1QO0D 5KVRA 1SD7A 5EGOA 4HNTA 2I8DA 1OYYA 2A3SA 5CVVA 5EG0A 4AVPA 2OQGA 1EH7A 2ZB9A 1F4KA 1OR7A 3E0JB 4JK1X 1FPQA 3HRSA 2E2HJ 3WTWC 4UNOA 4IO9F 2NNNA 3TEPA 2P5KA 4M6YA 2CUZA 2JK3A 3BTJA 1RUNA 5DTRA 1ZN2A 3CQZJ 4YEJA 4Y15A 3G71I 3ZP5A 2OR1L 4Y7NJ 2A07F 2V1XA 2WY7Q 2ZJ2A 3TOBA 2E71A 2MLKA 2PMUA 4IOAF 3GN5A 3QF3A 3HRTA 1X1CA 2QYOA 2RAEA 5JUWA 4EV0A 3LA2A 2LYKA 4HW0A 1A6QA 3WHBA 5IT9K 2HSGA 2FMLA 4PJMA 2VT3A 5CVUA 2XROA 2M45A 3ZMZA 4L9VA 4S05A 2RREA 2JSPA 5H6RA 2BXZA 5TRDA 3J7AY 2D2WA 2IJLA 3F52A 1YG2A 1I27A 5H2FC 3RQIA 1LFPA 1TWGJ 4NHJA 3M1EA 1LMB3 1JGGA 4ER3A 1H89C 3VODA 5IY5H 2QQ9A 5E20A 1ZQ3P 4L9JA 2B63J 5F1RA 5K5QA 2HYFA 2RQQA 3OWQA 2DYSH 2ICWG 2A05A 2M34A 4ITVA 2VXZA 4IRIA 4N4NB 3OV8A 4MTDA 1FBQA 2H1LA 2WUSR 2ETHA 1GV2A 4C30A 3R4KA 2JN6A 1HXDA 3LFKA 2IRFG 3JRAA 1QPMA 3WTSC 5GAEJ 1ONVA 2PG4A 2HZDA 1V5EA 3CDIA 1WKMA 4HX4A 3CJRB 2KZGA 3RCOA 2Y2ZA 4BJ6C 2HGCA 1KQ9A 5KAIC 3GN5B 4AU7A 2FUG2 1LFUP 3I56I 1OPCA 2E1CA 1G8XA 3BDDA 3IWFA 3OIQA 4X6AJ 2BZTA 3RKXA 1RZRA 4XMYA 4BEHA 1T0FA 5CYVA 3OWTA 4A3JJ 4L0YB 3I5UA 2PEXA 1MIJA 5FKOA 3A9ZA 2K9LA 3M4OJ 2EFNA 3T5XA 3ZQFA 4IKFA 2ESNA 4S04A 2LSOA 1ODDA 3BTCA 4DBQA 3OP9A 3BCAA 4Q4ZF 3ZQGA 5LGNA 4PSWA 1YFHA 2Y75A 3OS0A 1T98A 4HV5A 2KRFA 3H9GA 2NS8A 4RGSA 5K5OA 4RDUA 3FM3A 1R63A 2PMZN 3UWPA 5LD2C 1BIAA 1I39A 5B1AH 3JRBA 3MN2A 2VPLA 4U0VA 2O0YA 2OZ6A 1W4MA 2R3SA 2DFFA 1ITYA 4R79A 1RPWA 2ZNYA 4L9NA 3BTIA 5B66C 4PFOA 1X2MA 2MEZA 4MIMA 5HLTA 1QHHD 3JTGA 2IVGA 1TW2A 3FM5A 3CC4I 2IS4A 1IF1A 3OYJA 3R6SA 2F5DA 1VQLI 1ZS4A 3SDGA 1J0RA 4X4EA 2XV4S 4I76A 3IAM2 3L2WA 3H0GJ 2JSCA 4II3A 2NNYA 3IHUA 2L7FP 4I6ZA 2JA8J 2EFPA 5H6QA 4B43A 3QQAA 2BVLA 1RRJA 2R5ZB 3F8CA 1S72I 5E18F 4J1XA 4HQMA 3BG9A 3B02A 5JI6A 1DULA 4XKVA 2AO9A 1XDSA 4N4OB 1EH6A 1AOYA 2R1JL 1PNRA 2V9KA 1ZKGA 3A9XA 5J47A 3GTKJ 1MMAA 5A7LA 3QAHA 3ABLH 1K79A 4LFUA 1WJDA 2KIUA 4HDVA 4MQVA 5DCFA 1I3QJ 1OCRH 3K4MA 2R5YA 3OQOA 1T33A 3S1QJ 4ER7A 2KPMA 5HLGA 2JWTA 4O6JA 1FT9A 4U7BA 4XN3A 5IP7J 2ZCWA 3E3VA 4MGRA 4B47A 2NXNB 5HNFA 1NK2P 4OAZA 2GXGA 2PXKA 3F8MA 2R7SA 5E3NA 2PJRA 1T6SA 3CLQA 2FSWA 3GTOJ 1W5SA 3EQLF 3H35A 5LRRA 2LNBA 1QBJA 3HSFA 2OTJI 1LQCA 2MH2A 2BNNA 3JAMZ 4X4CA 3S1RJ 1W1WE 2NVTJ 3B6CA 4U0YA 2X6YA 2WAQA 1TWCJ 2VOOA 2KEJA 2R7OA 1WIZA 3S8QA 4HLYA 1LLIA 1J09A 2AUWA 4X4GA 3TELA 4P96A 2IT0A 2R4GA 1IN5A 2XKPA 1EFAA 3FWEA 4A6EA 1X19A 2Y0SA 3J81K 2DK8A 3TRBA 4BDZA 1VQPI 2QCOA 3SZGA 4IHVA 1LCDA 2JUCA 3IH3A 2OJED 3QOPA 3HYIA 4RAGA 3GZNB 1Y0UA 2PXQA 2MABA 2ZFUA 3H5RA 5F6FA 4CH7A 3DTEA 3PUBA 1MNMC 4KNYA 3I55I 3HOSA 4JP0A 3VWBA 1PYVA 2R7QA 2XAFA 1I6HJ 4W1UA 2L02A 4O5VA 3FMQA 2WTEA 5EZGA 1XCVA 3F22A 4A5MA 2B0LA 3F9KA 3WTXC 3K4CA 4JOMA 2CQKA 3TP0A 1VI0A 1D5YA 2BY1A 2ELKA 1R5ID 2F5EA 2IP2A 5DTDA 4I7HA 1ZARA 3GMEA 1VQ9I 3BR5A 2FRHA 4E7HA 2GZUA 1OJLA 2ZXIA 1IUFA 4WX9A 3GZ5A 5J40A 3PFIA 1IXRC 3BR1A 4QPQA 4AWXB 1HKSA 2LBFA 4I0AA 1FEXA 3JXCL 3TO7A 5LHGA 1HSJA 2MGQA 2JA2A 3W2VA 3BR0A 4XRSG 1HSTA 1FJLA 4A3EJ 1SMYF 2QGUA 2EH3A 2HOAA 3A0HC 2CSFA 4EJOA 1XGOA 4A3MJ 2LVSA 5D4RA 3ECOA 4B3XA 4UV8A 4HNUA 2LF8A 2CQQA 2XIUA 1FBUA 2VLAA 3CLCA 2BNOA 1ZZCA 3E6BA 4ER0A 2Z33A 1BW5A 4JBAA 2XGCA 3CCYA 1Y8RB 2XKOA 2MFZA 4OB4A 3UKGA 4CSWA 1GVJA 5LLQA 1DU6A 1HCRA 2QF7A 1YO5C 1VQMI 2Q8KA 1R00A 4IVNA 1PUFB 1AHDP 5J1YA 3DEWA 2BEOA 2FQ3A 2KJBA 2M4GA 2XAHA 1T0FC 1X4PA 2Y9YA 3MQ0A 2KPJA 1HBXG 2HYGD 4XLAA 1JI8A 4MCTA 3OYBA 1JKRC 1JHHA 3GLXA 3BR3A 2O8KA 1AKHA 5CQGA 1XGNA 3FBIB 1IRZA 4A2UA 3GLLA 1BM9A 4FCYA 3HM5A 2DTZA 5AIQA 1LDJA 1GHCA 5ICEA 1VFCA 2PJRB 1FP1D 2LF7A 1QU3A 3OYHA 3GZCA 2CFXA 1FIAA 1LDKB 5IP9J 1J75A 4M74A 2WAEA 4Z5CA 2YS9A 2XPUA 3DU5A 5AONA 4GGGA 1DPRA 3QP6A 5IPAA 3MKWB 1MDMB 1TZLA 1R22A 2DDAA 3CUOA 3HKZN 4XKCA 1MJAA 2VONA 1FMVA 3SX0A 3ERMA 2CQ7A 2PX9A 4XLFA 2LY1A 5F08A 1U6GA 3ZMUA 4CICA 1RETA 1S7EA 2VJIA 4ER6A 4G6TB 4EGZA 4HX8A 5LFAA 5EYRA 5M3MJ 4EMSA 4M73A 3ERED 2D5VA 3S2WA 3OIPA 4ETSA 1R71A 1EV7A 2QM3A 2KQRA 2VKDA 2M30A 2E35A 1N75A 3LSPA 3P7NA 1BDIA 1A04A 3DPUA 4BL0B 1BL0A 4B8XA 3RJPA 3LSTA 3IH4A 3VYTB 5AIPA 1UXCA 1GUUA 2XXAA 2XB0X 4BUPA 3CUQB 4ENNA 2LNMA 1EH8A 4M9SA 4YFXF 1B72A 4NC7A 3OMTA 3RPUA 1RKTA 4Z5HA 1FYLA 1G4DA 1HKQA 3PIOF 1KQ8A 3GEZA 1XGMA 4XSZF 2K9SA 4I02A 2OBPA 2EV0A 2GRLA 3MD2A 3JAMK 2KZ8A 1YYVA 4ZYHA 1QZZA 4HLXA 2GLOA 1XMKA 1YE9A 2FF4A 2BOLA 2PMZA 3MMYB 4J00A 1BC7C 2XUBA 4BNCA 1FTTA 2L01A 4DOZA 2AQEA 1B8IB 2CG4A 3NEUA 2V7FA 3MVPA 3K4KA 4RA2A 4CYCA 4G7ZF 2WV0A 2X9DA 3WGIA 2ZMEC 2PXFA 3M7GA 2VC1A 1ZGWA 1USTA 3CMYA 2UWMA 1U2ZA 4G94A 4XRFA 1UMQA 4LIUA 1XB4A 3LISA 2HVRA 3REOA 1O4XA 2RNGA 3DPLC 4IJAA 1NK3P 1WETA 1O3RA 4JCXA 5FROA 1O7FA 4XLEA 3U21A 5B3SH 3GTLJ 3HOWJ 1U8RA 2E36A 2IVQA 2J7UA 1RZ4A 2VKEA 3GWZA 3V8LA 4ZZDA 3FHZA 4HG2A 3CF2A 5KHDA 1HC8A 1ETWA 2YSRA 3HXLA 1GDTA 3AG4H 3S3NA 2UZKA 1U5TA 1IXSB 1ETYA 2AHQA 1LUJB 2DMUA 2CW7A 3E5XA 2M9HA 5J4VA 2AWIA 1WSUA 1DP7P 2EV5A 1ETQA 1UHWA 2E1OA 5GAHi 3CUQA 1Y7YA 2M7AA 1ON1A 1K6OA 4M3GA 4AM3A 2DA6A 2K40A 3NWTA 1G3WA 4Y4RA 4LIVA 1LPQA 1I3AA 2LYLA 5CVJA 1T39A 2ZXWH 1JFTA 2QLZA 4Z59A 2AQFA 3K6GA 2DA2A 4PDKA 3MZYA 3W3CA 4BBRJ 4KN4X 2X51A 2PUDA 3CD6I 2VQLA 4M9ZA 3CESA 4A0XA 1ZG3A 4L18B 2L54A 3LSHA 4W97A 1YJWI 4CZCA 1NERA 2E19A 2Z2SB 1VF9A 4NUBA 1FSEA 1I5ZA 3TEDA 4QTRA 4IX7A 1ZRCA 2YBDA 1UHMA 3DQVC 3DLAA 1PRVA 1DUXC 2DCEA 2DA1A 2UUZA 2JRMA 4UV9A 4UB8C 1FZPB 4ER5A 5FLMJ 2AW6A 1WJ5A 2DK5A 4PUSA 1Z7UA 3SFIA 1WI9A 5B1BH 4YFNF 2XDVA 4HPQA 3ZHIA 3JSOA 3BY6A 2O3FA 1OYIA 3KYLA 5E1WA 3DBHB 1HOMA 1N78A 2NOGA 1L1MA 3ZCOA 2VXDA 1ZZBA 2EIKH 4YG7B 2DQRA 1ZH5A 2EINH 3IVPA 4ZDPA 4UUSA 2VN2A 2QWWA 3V42A 1IXCA 4P55A 1O7LA 1PDNC 1JGSA 2V26A 1HW2A 2EA4A 2HDCA 2HDWA 1TP4A 3ZPLA 1IAWA 2M4KA 2EZLA 1G3TA 2KT0A 5IP6A 1MMNA 1WI3A 4EQQA 5E8IA 4HQEA 3MKZA 3IWZA 1R58A 1U5TB 2DMPA 2EA2A 3HTUA 2W7NA 1MBHA 3A01B 1ZELA 4OINF 5C4JJ 3CLOA 3FKIJ 2R7TA 4U88A 1S3JA 2KKOA 2NVQJ 5J3LA 4EATA 4NDLA 1WJFA 3PJRA 3WTVC 4AYBA 2DJIA 3L9FA 2GM4A 1YW9A 3S2HJ 2A6TA 1DW9A 3QU3A 1TWHJ 3O2PE 4FISA 2RQPA 1W0TA 3FXMA 4YARA 3FZVA 5GPCA 2GWRA 4FE7A 1KU2A 4YRVA 3HKZA 4BXFA 4D0PA 1Z0XA 2BYVE 2XCJA 4UVBA 1IW7F 2XPVA 1FSHA 2BJCA 2L7MP 2CV0A 3G2BA 3M9AA 2W4SA 1F43A 2BXYA 2ZJRF 2EF8A 2DODA 4KYWA 4NNJA 2KIFA 5IT9Z 5GAGi 3E6MA 5GAGJ 3S14J 1OCTC 4RMNA 1HQ1A 3WTUC 1JT0A 3FXRA 4XSXF 1LE8B 3Q9SA 1R69A 2IS6A 1XPXA 2HFZA 2OF7A 2W82A 1ON2A 3GBFA 2DMTA 2KZVA 2RN7A 2HVQA 3K1NA 1SFEA 2LK2A 4AIDA 4CXFA 1K83J 4CA0A 3MEJA 2PXLA 1IN6A 1BR1A 3WE3A 3ZMSA 4KISA 4PU4C 5D6FA 2PIJA 2PXPA 1IUYA 1XWRA 1ZG5A 5FLXK 1PVEA 2B7EA 1HA8A 2BW3A 4MNUA 2ELHA 4E7JA 3CDHA 2H1KA 2MG4A 5IYBJ 1ENHA 1S8NA 2BHZA 1J59A 3HTSB 3F6OA 2ME6A 3PSIA 4B4CA 1QHGA 2Y0SN 5HS8A 1RZRD 3QFIA 4XIDA 2Q2EB 2HXOA 3A1YA 4UHTA 1Z9CA 1FYMA 3FDYA 1AU7A 3G3ZA 5DD4A 2MLGA 2RKHA 2OC6A 1FMWA 2HR3A 1OSLA 1IV6A 1PRUA 3BG6A 5FKMA 1S7OA 5HLIA 3HUGB 1YS7A 3HG9A 4FETA 1KU3A 1MNEA 4V2GA 2KHMA 3WG9A 1RPEL 2O61A 3EDPA 1ZLKA 5E3OA 4ESJA 4G12A 4PGHA 1HF0A 2H27A 1ZGAA 4BS9A 2O38A 3MAJA 3CCVI 2VBYA 1D0YA 4G8XA 5A2QZ 4OMYA 4M3DA 1SMTA 1R36A 2CQNA 4RLQA 4XLCA 1O3TA 3RYRA 1QQAA 1N25A 2IGKA 1RUOA 1LNWA 1QPIA 4EGYA 1MDMA 4ABZA 4CCMA 3BT9A 1DGWY 3GZ6A 2KJCA 1B9NA 3M07A 1P9QC 5GAHJ 2P7VB 2VBXA 5L3FA 2OV7A 2JQ7A 1K7AA 3N97A 4JX5A 2QQAA 4XKBA 1B0NA 2IA0A 2YU3A 2BY3A 1TW3A 1S6LA 1WPKA 1WJAA 5JR3A 2ECCA 4FX4A 2QVOA 1F1ZA 2OUMA 1ULYA 2EWNA 4LGWA 2XXPA 2GBYA 5J8FA 5JVTA 2KDZA 3OKZA 2D45A 1VQ4I 3I0TA 1RKWA 3M1CA 3LA3A 2PUFA 2AXVA 3AAFA 5LEKA 4H0EA 4BY1J 3QOXA 1FY7A 3OYFA 3M8EA 2ID3A 3PQKA 1RI7A 3HPHA 1IN7A 2FOKA 4ANJA 1FNNA 2CFOA 1H88C 2PUBA 3BOQA 5EEAA 1LKXA 4KMFA 1Z77A 2R0QC 4RAZA 1WH5A 2CRGA 3BZ6A 3GVAA 5BOXA 5CPRB 4RLFA 2QQBA 5JVGF 2H6BA 3E5QA 4B1RA 2H94A 2W1OA 1XSXA 4I2OA 2FJ1A 3HJEA 2RDPA 5EEGA 3T1BA 4YFKF 1IO2A 3K9TA 4BQAA 3NAUA 3DXJF 4BQQA 4DZJA 3TQNA 3LSKA 2WWYA 3HSRA 4Q47A 2R92J 1X58A 2WIUB 1OYWA 2M1BA 5HLHA 3DBRB 4AIHA 3FK7A 5L3EA 2ZJQF 3QRFF 4X4DA 2E1MB 3HOUJ 1Z67A 4E7SA 2PLYA 2IV1A 1QP0A 5CVRA 3M8FA 4JQDA 5M5XJ 3JRGA 5J6XA 2AXZA 4MEYF 3FXLA 2DO7A 2JRTA 4G7HF 3L00A 2FNAA 3NXHA 2LG4A 4N9HA 1IRFA 2PJPA 4MO7A 4ASNA 1WWXA 3HHHA 4NQWB 4BJ5C 1W5CC 4KT5C 5ERIA 3SYTA 1FTZA 2C6YA 4CCJA 1MJBA 1VQNI 5D8LB 2X1DA 1SQ8A 2X1CA 3KP2A 2GOXB 3KP4A 3HIFA 2HCSA 4AIJA 1FX7A 1HW1A 1DP3A 3HOYJ 4RM3A 2JA7J 3I4PA 4J19A 1A6IA 1MH4A 4KIGA 4PJJA 3LOCA 1WJEA 1YIJI 4XK4A 4FBIA 2RC4A 1PJRA 4LB6B 2CV1A 3LA7A 1XGSA 2DMNA 3BDNA 1MH3A 5F04A 4BJTA 1WH6A 1D0ZA 4QSHA 3H1CA 1Y9QA 1WVRA 4M3FA 3HRMA 1G3YA 2D1HA 2LKSA 3SXYA 2LYQA 2OD5A 1G2HA 2M5WA 4XL9A 3W6VA 4GYIA 3J80K 1NEQA 4LG3A 3ISPA 3CO6C 2BBYA 3I53A 3D1NI 1SAXA 3KPHA 1R1TA 4DYCA 1U9OA 2M2EA 4HDUA 1Z05A 4DNCA 4P9UA 5DRTA 4A3BJ 3RYPA 5ILUA 3MZHA 2ODRD 1BR2A 2EBIA 4BACA 4YG4A 2EILH 5LHIA 2K5CA 1XDUA 1Y0NA 2LYCA 3GXOA 1LVKA 3LFUA 3CCEI 3GFJA 3KXAA 1NW3A 2F2EA 5E1ZB 2O7OA 1BW6A 3ZN0A 1P7JA 1YW8A 1YTYA 4IQJA 3ZHMA 3CZ6A 2I10A 2I5UA 2N8GA 3PE5A 4JCYA 3CC2I 3ZPXA 3BS3A 3KCCA 1B59A 2E7XA 4NB5A 3E7LA 4CCOA 1K61A 1R23A 2HQNA 4HAMA 4LK1F 3TBIA 4F8DA 2DQLA 2VODA 4G7OF 4EQZA 4G6QA 1SVOA 3ASOH 1IRXA 2KIQA 2G9WA 2ISYA 4NDWA 2HNHA 1T56A 2M87A 3QYBA 4OIPF 5LGUA 3GX4X 1X1BA 2JZYA 4GYGA 4ZDLA 2PN6A 3DWLE 4O3MA 2DBBA 2LC2A 4DIQA 1BR4A 2DA5A 2LCVA 1WJBA 3WU0A 2BHYA 3ONQA 1D1BA 3VEPA 2BY0A 3J80Z 2KFDA 4DYRA 2CMPA 3CJQB 3FYMA 5D5WB 1RIOA 3Q9VA 3KZIC 4RS8A 4E7IA 1JFSA 3W2AA 3F21A 3A2KA 3RZDJ 2WA0A 4KJZA 2STTA 1LEAA 4BEHB 3KETA 2XAUA 3FKJA 1GXPA 2WC2A 3DKWA 5J1UA 2JQEA 1QP7A 1OISA 1SD6A 2X85A 1W36C
chains in the Genus database with same CATH topology
1RESA 3QPLA 1B8IB 4GQMA 2HXIA 2VI6A 2DA7A 3MVPA 2K9QA 1R9TJ 3S1MJ 4CYCA 2R93J 3U3WA 4PU8A 4M3EA 2X9DA 2EZIA 3TW7A 1ZVVA 2G0EA 2YUSA 4C2MJ 1ZGWA 4IA8A 3CMYA 1QQBA 4GFBA 3CECA 1UMQA 1Y1WJ 2WV1A 3HEFA 3LISA 3PM1A 4MFDA 4I6UA 3MLFA 3C2BA 1O4XA 1YRNB 4IHXA 3F6WA 4IVZA 1ZZ9A 2LR8A 3LSJA 1RR7A 1QVTA 1PUFA 1NK3P 1WETA 4JCXA 1ZK8A 3DCFA 3GTLJ 4X1EA 3GBGA 3JRIA 3HOWJ 4I8TA 2IVQA 2LYPA 4IEJA 4X4HA 2VKEA 1JUSA 1ZZ6A 2AXUA 3PO3J 4FTHA 5JLWA 4A3DJ 1ETWA 4XICA 2FJRA 1GDTA 1ZZ8A 3S1NJ 4J1WA 3VK0A 2AHQA 1ETYA 2DMUA 4A3LJ 2FQ4A 1UG2A 3JRFA 1UTXA 2M9HA 5EF6A 3BQYA 2AWIA 5F0FA 2VUMJ 1U78A 2DA3A 1ZTRA 1ETQA 2A6CA 2XSDC 2CQXA 2E1OA 1LCCA 2ID6A 1GVDA 4C3IJ 1Y7YA 2EBYA 3RZZA 4M3GA 2JVLA 2XB5A 2DA6A 2K40A 5HODA 3TW6A 4BKXA 2E2JJ 5C44J 1MSEC 2LYLA 1NTCA 2HYJA 5E3LA 1JFTA 4Z59A 5C3EJ 4S0HB 4EEFG 3LSRA 2DA2A 4BBRJ 5GP9A 2PUDA 2IVBA 3CROL 3B6AA 3OQNA 3FIWA 3OQMA 2KEKA 3FYAA 4W97A 4PU7A 1ETVA 4A69C 3K7AJ 1NERA 2E19A 1VF9A 3TEDA 4QTRA 3JREA 4IHYA 1CQTA 3VPRA 1U9NA 3HOZJ 5EGOA 1PRVA 3JRCA 2DA1A 3Q0VA 5EG0A 2HQ5A 2ZB9A 4A3KJ 2CROA 3FMYA 1BJZA 3G5GA 1HDPA 5FLMJ 2E2HJ 2AW6A 2HINA 1UXDA 4A3FJ 3SFIA 2JK3A 3BTJA 2OPTA 3CQZJ 3O8GA 1JJ6C 1JTYA 3HBLA 3ZHIA 3BG3A 4Y7NJ 3BG5A 1ETKA 2Y30A 4X4FA 3GN5A 3QF3A 1HOMA 3BTLA 5E3MA 2NOGA 1L1MA 1ZZBA 2M0CA 2RAEA 4YG7B 2ECBA 5EGOB 3IVPA 4UUSA 2LYKA 1Q1VA 3WHBA 2HSGA 2L8NA 1GT0C 4A93J 5IYDJ 3B7HA 2R63A 2EZLA 3F52A 2KT0A 5IP6A 1WI3A 1VNDA 3RQIA 2PUGA 1TWGJ 1LMB3 1JGGA 2DMPA 1H89C 1MBHA 5K7ZA 4X4BA 3A01B 4Y52J 1ZQ3P 5C4JJ 3FKIJ 3R1FA 1QPZA 2B63J 1LFBA 2H8RA 4M3BA 2NVQJ 5J3LA 2YU9J 3S17J 4NDLA 1ETXA 2M34A 4AYBN 3KJXA 3O8HA 2LKXA 5M5WJ 2GM4A 3HOVJ 3S2HJ 4QIWN 2XGEA 1DW9A 1JT6A 1B8IA 2LYRA 1TWHJ 2WUSR 1GV2A 4FISA 1W0TA 1CJGA 2JN6A 4MCXA 4YARA 2FX0A 5GPCA 5K7HA 4FE7A 5F0HA 3JRAA 1WGXA 1ZUGA 3IH2A 2LY9A 1Z0XA 5GPAA 3G1LA 2XCJA 2CJJA 2MW8A 5F0CA 3BD1A 3QPSA 1XS9A 3G1OA 1TWFJ 2XPVA 2Y2ZA 3FK6A 3UFDA 2BJCA 2L7MP 3GN5B 1MBKA 2EWTA 2LTPA 3EUSA 1IDYA 1F43A 3KZ3A 1LFUP 2NVXJ 2O49A 1ADRA 2EF8A 4X6AJ 3S14J 3JRDA 1OCTC 1RZRA 2M8GX 1JT0A 3HZIB 2X6OA 4A3JJ 1LE8B 1R69A 1UHSA 3G1MA 1X2NA 2IAIA 4D5CA 3LSGA 2VKVA 5FKOA 5K7FA 2OF7A 2JA5J 3M4OJ 3GBFA 3ZQFA 2DMTA 3BTCA 1RZSA 3OP9A 1ZAYA 2LK2A 3ZQGA 1U8BA 1A5JA 1BA5A 1K83J 2EQRA 2FD5A 2R5YB 1HLVA 1TC3C 4PU4C 2NS8A 4RDUA 2PIJA 1XWRA 3SCHA 1R63A 3GTGJ 2PMZN 1JH9A 5FJ8J 5EZHA 2LP0A 2B5AA 3TP3A 3S16J 3S15J 2XRLA 2H1KA 4A3GJ 3JRBA 2MG4A 5IYBJ 1ENHA 3MN2A 2L49A 4JX6A 4L5EA 2ME6A 4B4CA 1ITYA 2Y0SN 2PUAA 1RPWA 1I50J 1RZRD 4IWRA 2JJ7A 2R7ZJ 3IV5A 3PXPA 4A3IJ 3BTIA 3CDLA 4XIDA 2HXOA 3DNVB 1X2MA 2MEZA 4MIMA 1AU7A 4O8BA 2IVGA 2E2IJ 2R5ZA 4DYQA 3HB9A 1OSLA 1ZS4A 1IV6A 3SDGA 4A3CJ 1PRUA 4X4EA 5FKMA 4I76A 3H0GJ 2PPXA 4V2GA 2L7FP 4I6ZA 4X4IA 1RPEL 4YG1A 2JA8J 1APLC 5E3OA 3QQAA 4G12A 2ICPA 2R5ZB 1HF0A 5M5YJ 4J1XA 2W48A 5FKLA 4GHJA 4V2FA 3GTJJ 2JA6J 3BG9A 2O38A 5FKNA 1ZR2A 2DA4A 5FLVA 2HI3A 3LNQA 3OSGA 4M3DA 1PNRA 2R1JL 2AO9A 3ZKCA 3SCGA 1ZKGA 1WH7A 3GTKJ 1QQAA 1JUPA 5A7LA 1QPIA 1F36A 4ABZA 3GTMJ 3JXDL 4MLOA 3BT9A 3GTQJ 2PUCA 1JTXA 1OCPA 1IG7A 3O9XA 2CUEA 3ZQLA 1VPWA 4I6RA 1LE8A 3A02A 4B3AA 3HOXJ 1BDHA 3ZOBA 1I3QJ 4JX5A 2R5YA 2COBA 3OQOA 1T33A 1B0NA 3S1QJ 2CUFA 2O9LA 2JWTA 1XG1A 2X48A 2JCGA 1WPKA 2EZKA 2MSYA 2ECCA 5IP7J 1Y1VJ 2DN0A 3HDDA 1NK2P 2GBYA 5E3NA 4JYKA 2KDZA 2GRMA 1H8AC 4DW6A 1X57A 1RKWA 3ZQHA 3GTOJ 2PUFA 1B72B 1LQCA 3Q0WA 1WH8A 2AXVA 2BNNA 2XI8A 2MQKA 4X4CA 3S1RJ 2KEIA 2WB1N 2NVTJ 3B6CA 4BY1J 1XC5A 3OOUA 1TWCJ 2KEJA 1WIZA 3S8QA 1LLIA 2AUWA 2ID3A 4X4GA 1TWAJ 3GTPJ 2WAQN 4C3JJ 5BNGA 1EFAA 1ZR4A 3RZOJ 3QQ6A 3SCFA 4D7NA 1ETOA 3TRBA 5IOYA 1H88C 2PUBA 2QCOA 5EEAA 4AUXA 4BXXJ 4IHVA 2EZHA 4PU3C 1Z77A 4AC0A 3IH3A 2R0QC 1SFOJ 1WH5A 1LCDA 2CRGA 3A01A 5IYCJ 5FKKA 2Y31A 1MNMC 4B1RA 2L7ZA 2BNMA 1OFCX 5DS9A 2LLKA 4JP0A 2FJ1A 1I6HJ 3HGGA 4W1UA 3NAUA 4DZJA 5EZGA 5EDNA 2L9RA 2R92J 1JUMA 1X58A 2LYSA 2WIUB 4I6TA 1SANA 2HOTA 3FK7A 4YBAA 3TP0A 1AKHB 1VI0A 1D5YA 1HDDC 1IJWC 3H5TA 2ELKA 5DTDA 3F0CA 4X4DA 2K9NA 9ANTA 3HOUJ 2IU7A 3JR9A 4UUSB 1MBFA 3L1PA 3BR5A 3G7DA 2IBDA 2GZUA 1OJLA 2XGDA 2IV1A 3JXBC 1IUFA 1QP0A 4JQDA 4IHWA 3MKLA 1X2LA 5M5XJ 3JRGA 3K2AA 3RKQA 3BR1A 2AXZA 2CU7A 1FEXA 3JXCL 3OIOA 2MGQA 1MBEA 3BR0A 3NARA 3A03A 4XRSG 1W0UA 2TRTA 2HOSA 3BQZA 4MO7A 1FJLA 4A3EJ 2EH3A 2ME0A 2HOAA 4DZPA 2CSFA 1ORKA 1FTZA 4A3MJ 2LVSA 3BR6A 1SQ8A 2CQQA 5JLXA 2OFYA 1IGNA 5EG0B 3OSFA 1IDZA 2XIUA 3QYXA 3CLCA 3ZQCA 1POUA 5IOZA 1WCMJ 4C3HJ 2DMQA 1ZZCA 2BNOA 3HOYJ 1BW5A 2JA7J 4J19A 2XGCA 3CCYA 1A6IA 1MH4A 3LOCA 4OB4A 1YSEA 1EF4A 5K98B 1GV5A 3UKGA 4XK4A 1DU6A 3F51A 4FBIA 4Z5DA 1HCRA 3BDNA 2QF7A 2DMNA 1PUFB 1DU0A 3I4NJ 1MH3A 5F04A 2LD5A 1AHDP 4BBSJ 5J1YA 1WH6A 5J1RA 2XJ3A 3DEWA 4D5FA 2KPJA 1QP4A 2OR1L 1JKQC 2L0KA 2Y9YA 4QSHA 1QRYA 4MCTA 1Y9QA 1JKRC 4M3FA 3SJMA 2NS7A 2PE5A 3BR3A 2O8KA 1AKHA 1IRZA 2LFBA 2LYQA 5M3FJ 1MBGA 1G2HA 3W6VA 1NEQA 1QVUA 2DJNA 1DWKA 4FCYA 3HM5A 2DTZA 2ICTA 4UUTA 3WHCA 1JWLA 1VFCA 1PERL 3D1NI 4Y42A 2XPWA 2IUOA 1FIAA 2LYJA 3H3VK 4Z58A 5IP9J 4DYCA 3Q3SA 1U9OA 1YRNA 2M2EA 2Y9ZA 4Z5CA 2YS9A 2XPUA 4A3BJ 1MSFC 1FIPA 2EBIA 4YG4A 5IPAA 4MFEA 4HNVA 3HGYA 1MBJA 3HKZN 3I4MJ 1JKOC 4LOCA 1E3OC 3KXAA 5F08A 4XRSA 2O7OA 1BW6A 3M3YJ 1P7JA 1RETA 1S7EA 3ZHMA 2I10A 5F1JA 2N8GA 3FISA 4CYCB 2NVYJ 4RBOA 4JCYA 3BR2A 3BS3A 2O4AA 1K61A 3E7LA 2IEKA 2VPRA 5EYRA 5M3MJ 2D5VA 1ZPQA 4F8DA 1JJ8C 4NDWA 4M6VA 1T56A 3LSPA 1JKPC 1PRAA 3ZQIA 4D7MA 1POGA 3QWGA 4JX4A 1BDIA 1BL0A 3IH4A 2DA5A 3LFPA 1UXCA 2LCVA 1GUUA 2PUEA 3PO2J 3Q0UA 2XB0X 2TCTA 4FN3A 4DYRA 5F27A 3FYMA 2P81A 1RIOA 3JRHA 1B72A 1ZZ7A 1JFSA 4BY7J 3OMTA 1RKTA 4Z5HA 3RZDJ 4XRMA 2HDDA 2JMWA 2K9SA 3S2DJ 2GRLA 1IC8A 5C4XJ 2KZ8A 2GLOA 4FE4A 5J1UA 1QP7A 1P7IA 1FTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RES A;  3QPL A;  1B8I B;  4GQM A;  2HXI A;  2VI6 A;  2DA7 A;  3MVP A;  2K9Q A;  1R9T J;  3S1M J;  4CYC A;  2R93 J;  3U3W A;  4PU8 A;  4M3E A;  2X9D A;  2EZI A;  3TW7 A;  1ZVV A;  2G0E A;  2YUS A;  4C2M J;  1ZGW A;  4IA8 A;  3CMY A;  1QQB A;  4GFB A;  3CEC A;  1UMQ A;  1Y1W J;  2WV1 A;  3HEF A;  3LIS A;  3PM1 A;  4MFD A;  4I6U A;  3MLF A;  3C2B A;  1O4X A;  1YRN B;  4IHX A;  3F6W A;  4IVZ A;  1ZZ9 A;  2LR8 A;  3LSJ A;  1RR7 A;  1QVT A;  1PUF A;  1NK3 P;  1WET A;  4JCX A;  1ZK8 A;  3DCF A;  3GTL J;  4X1E A;  3GBG A;  3JRI A;  3HOW J;  4I8T A;  2IVQ A;  2LYP A;  4IEJ A;  4X4H A;  2VKE A;  1JUS A;  1ZZ6 A;  2AXU A;  3PO3 J;  4FTH A;  5JLW A;  4A3D J;  1ETW A;  4XIC A;  2FJR A;  1GDT A;  1ZZ8 A;  3S1N J;  4J1W A;  3VK0 A;  2AHQ A;  1ETY A;  2DMU A;  4A3L J;  2FQ4 A;  1UG2 A;  3JRF A;  1UTX A;  2M9H A;  5EF6 A;  3BQY A;  2AWI A;  5F0F A;  2VUM J;  1U78 A;  2DA3 A;  1ZTR A;  1ETQ A;  2A6C A;  2XSD C;  2CQX A;  2E1O A;  1LCC A;  2ID6 A;  1GVD A;  4C3I J;  1Y7Y A;  2EBY A;  3RZZ A;  4M3G A;  2JVL A;  2XB5 A;  2DA6 A;  2K40 A;  5HOD A;  3TW6 A;  4BKX A;  2E2J J;  5C44 J;  1MSE C;  2LYL A;  1NTC A;  2HYJ A;  5E3L A;  1JFT A;  4Z59 A;  5C3E J;  4S0H B;  4EEF G;  3LSR A;  2DA2 A;  4BBR J;  5GP9 A;  2PUD A;  2IVB A;  3CRO L;  3B6A A;  3OQN A;  3FIW A;  3OQM A;  2KEK A;  3FYA A;  4W97 A;  4PU7 A;  1ETV A;  4A69 C;  3K7A J;  1NER A;  2E19 A;  1VF9 A;  3TED A;  4QTR A;  3JRE A;  4IHY A;  1CQT A;  3VPR A;  1U9N A;  3HOZ J;  5EGO A;  1PRV A;  3JRC A;  2DA1 A;  3Q0V A;  5EG0 A;  2HQ5 A;  2ZB9 A;  4A3K J;  2CRO A;  3FMY A;  1BJZ A;  3G5G A;  1HDP A;  5FLM J;  2E2H J;  2AW6 A;  2HIN A;  1UXD A;  4A3F J;  3SFI A;  2JK3 A;  3BTJ A;  2OPT A;  3CQZ J;  3O8G A;  1JJ6 C;  1JTY A;  3HBL A;  3ZHI A;  3BG3 A;  4Y7N J;  3BG5 A;  1ETK A;  2Y30 A;  4X4F A;  3GN5 A;  3QF3 A;  1HOM A;  3BTL A;  5E3M A;  2NOG A;  1L1M A;  1ZZB A;  2M0C A;  2RAE A;  4YG7 B;  2ECB A;  5EGO B;  3IVP A;  4UUS A;  2LYK A;  1Q1V A;  3WHB A;  2HSG A;  2L8N A;  1GT0 C;  4A93 J;  5IYD J;  3B7H A;  2R63 A;  2EZL A;  3F52 A;  2KT0 A;  5IP6 A;  1WI3 A;  1VND A;  3RQI A;  2PUG A;  1TWG J;  1LMB 3;  1JGG A;  2DMP A;  1H89 C;  1MBH A;  5K7Z A;  4X4B A;  3A01 B;  4Y52 J;  1ZQ3 P;  5C4J J;  3FKI J;  3R1F A;  1QPZ A;  2B63 J;  1LFB A;  2H8R A;  4M3B A;  2NVQ J;  5J3L A;  2YU9 J;  3S17 J;  4NDL A;  1ETX A;  2M34 A;  4AYB N;  3KJX A;  3O8H A;  2LKX A;  5M5W J;  2GM4 A;  3HOV J;  3S2H J;  4QIW N;  2XGE A;  1DW9 A;  1JT6 A;  1B8I A;  2LYR A;  1TWH J;  2WUS R;  1GV2 A;  4FIS A;  1W0T A;  1CJG A;  2JN6 A;  4MCX A;  4YAR A;  2FX0 A;  5GPC A;  5K7H A;  4FE7 A;  5F0H A;  3JRA A;  1WGX A;  1ZUG A;  3IH2 A;  2LY9 A;  1Z0X A;  5GPA A;  3G1L A;  2XCJ A;  2CJJ A;  2MW8 A;  5F0C A;  3BD1 A;  3QPS A;  1XS9 A;  3G1O A;  1TWF J;  2XPV A;  2Y2Z A;  3FK6 A;  3UFD A;  2BJC A;  2L7M P;  3GN5 B;  1MBK A;  2EWT A;  2LTP A;  3EUS A;  1IDY A;  1F43 A;  3KZ3 A;  1LFU P;  2NVX J;  2O49 A;  1ADR A;  2EF8 A;  4X6A J;  3S14 J;  3JRD A;  1OCT C;  1RZR A;  2M8G X;  1JT0 A;  3HZI B;  2X6O A;  4A3J J;  1LE8 B;  1R69 A;  1UHS A;  3G1M A;  1X2N A;  2IAI A;  4D5C A;  3LSG A;  2VKV A;  5FKO A;  5K7F A;  2OF7 A;  2JA5 J;  3M4O J;  3GBF A;  3ZQF A;  2DMT A;  3BTC A;  1RZS A;  3OP9 A;  1ZAY A;  2LK2 A;  3ZQG A;  1U8B A;  1A5J A;  1BA5 A;  1K83 J;  2EQR A;  2FD5 A;  2R5Y B;  1HLV A;  1TC3 C;  4PU4 C;  2NS8 A;  4RDU A;  2PIJ A;  1XWR A;  3SCH A;  1R63 A;  3GTG J;  2PMZ N;  1JH9 A;  5FJ8 J;  5EZH A;  2LP0 A;  2B5A A;  3TP3 A;  3S16 J;  3S15 J;  2XRL A;  2H1K A;  4A3G J;  3JRB A;  2MG4 A;  5IYB J;  1ENH A;  3MN2 A;  2L49 A;  4JX6 A;  4L5E A;  2ME6 A;  4B4C A;  1ITY A;  2Y0S N;  2PUA A;  1RPW A;  1I50 J;  1RZR D;  4IWR A;  2JJ7 A;  2R7Z J;  3IV5 A;  3PXP A;  4A3I J;  3BTI A;  3CDL A;  4XID A;  2HXO A;  3DNV B;  1X2M A;  2MEZ A;  4MIM A;  1AU7 A;  4O8B A;  2IVG A;  2E2I J;  2R5Z A;  4DYQ A;  3HB9 A;  1OSL A;  1ZS4 A;  1IV6 A;  3SDG A;  4A3C J;  1PRU A;  4X4E A;  5FKM A;  4I76 A;  3H0G J;  2PPX A;  4V2G A;  2L7F P;  4I6Z A;  4X4I A;  1RPE L;  4YG1 A;  2JA8 J;  1APL C;  5E3O A;  3QQA A;  4G12 A;  2ICP A;  2R5Z B;  1HF0 A;  5M5Y J;  4J1X A;  2W48 A;  5FKL A;  4GHJ A;  4V2F A;  3GTJ J;  2JA6 J;  3BG9 A;  2O38 A;  5FKN A;  1ZR2 A;  2DA4 A;  5FLV A;  2HI3 A;  3LNQ A;  3OSG A;  4M3D A;  1PNR A;  2R1J L;  2AO9 A;  3ZKC A;  3SCG A;  1ZKG A;  1WH7 A;  3GTK J;  1QQA A;  1JUP A;  5A7L A;  1QPI A;  1F36 A;  4ABZ A;  3GTM J;  3JXD L;  4MLO A;  3BT9 A;  3GTQ J;  2PUC A;  1JTX A;  1OCP A;  1IG7 A;  3O9X A;  2CUE A;  3ZQL A;  1VPW A;  4I6R A;  1LE8 A;  3A02 A;  4B3A A;  3HOX J;  1BDH A;  3ZOB A;  1I3Q J;  4JX5 A;  2R5Y A;  2COB A;  3OQO A;  1T33 A;  1B0N A;  3S1Q J;  2CUF A;  2O9L A;  2JWT A;  1XG1 A;  2X48 A;  2JCG A;  1WPK A;  2EZK A;  2MSY A;  2ECC A;  5IP7 J;  1Y1V J;  2DN0 A;  3HDD A;  1NK2 P;  2GBY A;  5E3N A;  4JYK A;  2KDZ A;  2GRM A;  1H8A C;  4DW6 A;  1X57 A;  1RKW A;  3ZQH A;  3GTO J;  2PUF A;  1B72 B;  1LQC A;  3Q0W A;  1WH8 A;  2AXV A;  2BNN A;  2XI8 A;  2MQK A;  4X4C A;  3S1R J;  2KEI A;  2WB1 N;  2NVT J;  3B6C A;  4BY1 J;  1XC5 A;  3OOU A;  1TWC J;  2KEJ A;  1WIZ A;  3S8Q A;  1LLI A;  2AUW A;  2ID3 A;  4X4G A;  1TWA J;  3GTP J;  2WAQ N;  4C3J J;  5BNG A;  1EFA A;  1ZR4 A;  3RZO J;  3QQ6 A;  3SCF A;  4D7N A;  1ETO A;  3TRB A;  5IOY A;  1H88 C;  2PUB A;  2QCO A;  5EEA A;  4AUX A;  4BXX J;  4IHV A;  2EZH A;  4PU3 C;  1Z77 A;  4AC0 A;  3IH3 A;  2R0Q C;  1SFO J;  1WH5 A;  1LCD A;  2CRG A;  3A01 A;  5IYC J;  5FKK A;  2Y31 A;  1MNM C;  4B1R A;  2L7Z A;  2BNM A;  1OFC X;  5DS9 A;  2LLK A;  4JP0 A;  2FJ1 A;  1I6H J;  3HGG A;  4W1U A;  3NAU A;  4DZJ A;  5EZG A;  5EDN A;  2L9R A;  2R92 J;  1JUM A;  1X58 A;  2LYS A;  2WIU B;  4I6T A;  1SAN A;  2HOT A;  3FK7 A;  4YBA A;  3TP0 A;  1AKH B;  1VI0 A;  1D5Y A;  1HDD C;  1IJW C;  3H5T A;  2ELK A;  5DTD A;  3F0C A;  4X4D A;  2K9N A;  9ANT A;  3HOU J;  2IU7 A;  3JR9 A;  4UUS B;  1MBF A;  3L1P A;  3BR5 A;  3G7D A;  2IBD A;  2GZU A;  1OJL A;  2XGD A;  2IV1 A;  3JXB C;  1IUF A;  1QP0 A;  4JQD A;  4IHW A;  3MKL A;  1X2L A;  5M5X J;  3JRG A;  3K2A A;  3RKQ A;  3BR1 A;  2AXZ A;  2CU7 A;  1FEX A;  3JXC L;  3OIO A;  2MGQ A;  1MBE A;  3BR0 A;  3NAR A;  3A03 A;  4XRS G;  1W0U A;  2TRT A;  2HOS A;  3BQZ A;  4MO7 A;  1FJL A;  4A3E J;  2EH3 A;  2ME0 A;  2HOA A;  4DZP A;  2CSF A;  1ORK A;  1FTZ A;  4A3M J;  2LVS A;  3BR6 A;  1SQ8 A;  2CQQ A;  5JLX A;  2OFY A;  1IGN A;  5EG0 B;  3OSF A;  1IDZ A;  2XIU A;  3QYX A;  3CLC A;  3ZQC A;  1POU A;  5IOZ A;  1WCM J;  4C3H J;  2DMQ A;  1ZZC A;  2BNO A;  3HOY J;  1BW5 A;  2JA7 J;  4J19 A;  2XGC A;  3CCY A;  1A6I A;  1MH4 A;  3LOC A;  4OB4 A;  1YSE A;  1EF4 A;  5K98 B;  1GV5 A;  3UKG A;  4XK4 A;  1DU6 A;  3F51 A;  4FBI A;  4Z5D A;  1HCR A;  3BDN A;  2QF7 A;  2DMN A;  1PUF B;  1DU0 A;  3I4N J;  1MH3 A;  5F04 A;  2LD5 A;  1AHD P;  4BBS J;  5J1Y A;  1WH6 A;  5J1R A;  2XJ3 A;  3DEW A;  4D5F A;  2KPJ A;  1QP4 A;  2OR1 L;  1JKQ C;  2L0K A;  2Y9Y A;  4QSH A;  1QRY A;  4MCT A;  1Y9Q A;  1JKR C;  4M3F A;  3SJM A;  2NS7 A;  2PE5 A;  3BR3 A;  2O8K A;  1AKH A;  1IRZ A;  2LFB A;  2LYQ A;  5M3F J;  1MBG A;  1G2H A;  3W6V A;  1NEQ A;  1QVU A;  2DJN A;  1DWK A;  4FCY A;  3HM5 A;  2DTZ A;  2ICT A;  4UUT A;  3WHC A;  1JWL A;  1VFC A;  1PER L;  3D1N I;  4Y42 A;  2XPW A;  2IUO A;  1FIA A;  2LYJ A;  3H3V K;  4Z58 A;  5IP9 J;  4DYC A;  3Q3S A;  1U9O A;  1YRN A;  2M2E A;  2Y9Z A;  4Z5C A;  2YS9 A;  2XPU A;  4A3B J;  1MSF C;  1FIP A;  2EBI A;  4YG4 A;  5IPA A;  4MFE A;  4HNV A;  3HGY A;  1MBJ A;  3HKZ N;  3I4M J;  1JKO C;  4LOC A;  1E3O C;  3KXA A;  5F08 A;  4XRS A;  2O7O A;  1BW6 A;  3M3Y J;  1P7J A;  1RET A;  1S7E A;  3ZHM A;  2I10 A;  5F1J A;  2N8G A;  3FIS A;  4CYC B;  2NVY J;  4RBO A;  4JCY A;  3BR2 A;  3BS3 A;  2O4A A;  1K61 A;  3E7L A;  2IEK A;  2VPR A;  5EYR A;  5M3M J;  2D5V A;  1ZPQ A;  4F8D A;  1JJ8 C;  4NDW A;  4M6V A;  1T56 A;  3LSP A;  1JKP C;  1PRA A;  3ZQI A;  4D7M A;  1POG A;  3QWG A;  4JX4 A;  1BDI A;  1BL0 A;  3IH4 A;  2DA5 A;  3LFP A;  1UXC A;  2LCV A;  1GUU A;  2PUE A;  3PO2 J;  3Q0U A;  2XB0 X;  2TCT A;  4FN3 A;  4DYR A;  5F27 A;  3FYM A;  2P81 A;  1RIO A;  3JRH A;  1B72 A;  1ZZ7 A;  1JFS A;  4BY7 J;  3OMT A;  1RKT A;  4Z5H A;  3RZD J;  4XRM A;  2HDD A;  2JMW A;  2K9S A;  3S2D J;  2GRL A;  1IC8 A;  5C4X J;  2KZ8 A;  2GLO A;  4FE4 A;  5J1U A;  1QP7 A;  1P7I A;  1FTT A; 
#chains in the Genus database with same CATH topology
 1RES A;  4Y13 A;  3MFK A;  3L2Q A;  4GQM A;  2HXI A;  2VI6 A;  4XLN F;  1MKM A;  3TFL A;  4G9Y A;  5D5X B;  2HQA A;  4OU0 A;  3M9L A;  5JHF A;  1ZVV A;  2EZI A;  2G0E A;  2GOM A;  2H09 A;  2RGV A;  4IA8 A;  1QB2 A;  3I9V 2;  2VL8 A;  1QQB A;  1X3Z B;  3VDX A;  2VBW A;  3CEC A;  3QOD A;  4EK9 A;  1Y1W J;  4KUM A;  4I0B A;  4EM0 B;  4MQ9 F;  4I6U A;  1TQI A;  3C2B A;  3MLF A;  2G7H A;  3LSI A;  2HTS A;  1RR7 A;  2P8T A;  2QUF A;  3K70 C;  3QPH A;  4X1E A;  4KIF A;  1BI2 A;  1K6Y A;  2XF6 A;  5E8G A;  4I8T A;  4YII A;  2P7C B;  1JUS A;  4L9T A;  2AXU A;  3ULQ B;  4A3D J;  5JLW A;  3U1D A;  4A6D A;  4XKW A;  3VYR B;  4MEX F;  2IA2 A;  4Y33 A;  2FQ4 A;  6PAX A;  3QOE A;  2ZSI B;  3R60 A;  2QBY B;  1W7P B;  2HOE A;  1R1U A;  2CQX A;  4CCL A;  3GZD A;  1GVD A;  3C2H A;  2XAS A;  1S9H A;  1X1D A;  2XB5 A;  1ZLJ A;  4XQF A;  4X0G A;  2E2J J;  5C44 J;  3MKY B;  2E7W A;  4BHB A;  1OKR A;  3N4M A;  2NYX A;  3ZGK A;  4IRG A;  2PXT A;  3GO5 A;  1J7K A;  3T0Y A;  2Y0M A;  1R5H A;  2LRD A;  1TLH B;  3QOW A;  3B6A A;  1OR7 C;  4HF0 A;  3PIP F;  3OQN A;  3TDU C;  3OQM A;  1K78 A;  1YJN I;  2DT6 A;  4ZYG A;  1QA6 A;  3DPT A;  4PU7 A;  2DXI A;  1G59 A;  1A35 A;  4F3Q A;  3OYC A;  3JRE A;  4IHY A;  2Y69 H;  5KK1 A;  1W5T A;  1L3L A;  1RR8 C;  3KYC B;  3VPR A;  1RC9 A;  2R7V A;  4C2T A;  3Q0V A;  1FLI A;  3DKY A;  4A3K J;  1X4O A;  3FMY A;  1BJZ A;  1LDD A;  3VYU B;  2ZC2 A;  5IT3 A;  1PP7 U;  4BXU A;  2IS1 A;  4NQW A;  3RDI A;  3IKT A;  1UXD A;  1MND A;  4C9Y A;  3HC7 A;  2QEX I;  1UEL B;  1JE8 A;  4F92 B;  4DQ2 A;  2GZW A;  4CCN A;  3DLL F;  1SEU A;  1T38 A;  3QYE A;  5ILV A;  1XCB A;  3HBL A;  3WTT C;  3BG3 A;  3BG5 A;  1ETK A;  4PJL A;  1ZAO A;  2Y30 A;  2MA3 A;  4X4F A;  1O3Q A;  2A6E F;  4LIT A;  3BTL A;  5K5R A;  4BE2 A;  5E3M A;  2J5P A;  2K27 A;  2L1P A;  3K10 A;  2KIS A;  3FMS A;  2M0C A;  3AG1 H;  2ECB A;  4GO1 A;  5EGO B;  2LBF B;  1M1E B;  2E1N A;  2W85 A;  1FOY A;  2L4A A;  2QZ8 A;  2L8N A;  1GT0 C;  3RSN A;  4RB3 C;  5DDG A;  2OQR A;  2R63 A;  3DTI A;  3LQR A;  3KP6 A;  3KP5 A;  4F55 A;  2HTJ A;  2PUG A;  1VND A;  2A5W A;  2GAU A;  3K4J A;  3IKV A;  4NC8 A;  2K4B A;  1T8I A;  2LMD A;  3SEZ A;  1L0O C;  1P2F A;  2VQG A;  3I64 A;  3NZL A;  2H8R A;  3DM5 A;  2DFI A;  2YU9 J;  2ZME B;  4EM2 A;  4MTE A;  1ETX A;  3CJT B;  4AYB N;  3KJX A;  3D0S A;  2LKX A;  2V1D A;  1WJC A;  4XON A;  1XX5 A;  1Q1H A;  3HOV J;  1JT6 A;  1YW7 A;  1B8I A;  1EJ9 A;  5DUI A;  1YIT I;  2DI3 A;  4OAY A;  4RGR A;  4MCX A;  2DAO A;  5K7H A;  1E3H A;  1WGX A;  2CS3 A;  3EUH A;  3A9Y A;  2LY9 A;  3MWM A;  1JHF A;  5L3G A;  1H9T A;  5K1Y A;  4EKI A;  3BD1 A;  3ME5 A;  2HPI A;  2KLO A;  3EUA A;  1MMG A;  2COM A;  3G1O A;  4B48 A;  3UFD A;  1XSV A;  3C2G A;  2EFQ A;  1MBK A;  3HOT A;  3RPQ A;  2EWT A;  1YX5 A;  4ENK A;  3EUS A;  3ZN1 A;  2R7D A;  2DOE A;  1EKE A;  2PQ8 A;  1SVL A;  5ED4 A;  1VQ7 I;  5FLX Z;  4BDY A;  3JRD A;  3OYG A;  4RAY A;  2M8G X;  4E70 A;  2X6O A;  3CC7 I;  3QU6 A;  3CF5 F;  3G1M A;  3LSG A;  2VKV A;  2EV6 A;  4P9F A;  4PZJ A;  5K7F A;  3L2R A;  4M72 A;  2PFB A;  3AG2 H;  3WG7 H;  4AIK A;  5L3D A;  4WVL A;  1RZS A;  3K4B A;  5BMZ A;  2STW A;  2M4H A;  4OBM A;  1TTY A;  1ZAY A;  1GLN A;  3ZQ7 A;  2CV2 A;  5HVQ C;  1A5J A;  1BA5 A;  2F5V A;  4PCQ A;  5D4S A;  3FF5 A;  1KA8 A;  1B6A A;  2EQR A;  2FD5 A;  3FBN B;  1T08 B;  2R5Y B;  1TC3 C;  4BHP A;  2GIV A;  2R7W A;  3KZZ A;  1C0W A;  3HUG A;  5J8C A;  3SCH A;  3VWS A;  4E7Z A;  3PSF A;  3D5R C;  5EZH A;  2LP0 A;  2X0L A;  3TP3 A;  1X3U A;  4A3G J;  2EJR A;  1F5T A;  4QWQ A;  5FD5 A;  2HU9 A;  2KMU A;  2MBF A;  4IXA A;  3TGN A;  1OCC H;  2WAF A;  2V9V A;  2PUA A;  5FFX A;  4E4H A;  4RM2 A;  3S8P A;  4A3I J;  3L2C A;  2XC7 A;  3I59 B;  4KFC A;  1TQM A;  4NBQ A;  5DCM A;  2F4O B;  3KP7 A;  2R5Z A;  2XRN A;  2ZBK A;  3HB9 A;  3A4C A;  3R09 A;  3H0D A;  3CUQ C;  3PQJ A;  1ERD A;  3LQX A;  3H9Q A;  1W36 D;  1VQ8 I;  1V5F A;  2PPX A;  3EET A;  2Q2E A;  3RKW A;  4YG1 A;  2CH0 A;  1W7P D;  3NQO A;  5HNH A;  3HPG A;  2HPM A;  1BC8 C;  2ICP A;  2R7R A;  5M5Y J;  1Z3Y A;  3KEO A;  2E34 A;  2NVU B;  2W48 A;  4RB2 C;  3ZMV A;  4GHJ A;  2YR2 A;  5DTM A;  5FKN A;  1ZR2 A;  5FLV A;  2HI3 A;  3LNQ A;  3G6E I;  3OSG A;  4M6X A;  4ZH4 F;  3C3W A;  3ABT A;  1XN7 A;  3KFW X;  1KQ0 A;  1PP8 F;  1ZRD A;  3IP4 B;  2LLW A;  3ZR8 X;  4IZZ A;  3O6B B;  1F9N A;  3JXD L;  4MLO A;  2PUC A;  5ILS A;  1OCP A;  4YIR X;  1IG7 A;  3O9X A;  2CUE A;  5E1X A;  3ZQL A;  1VPW A;  2XAJ A;  1LE8 A;  1R4N B;  3A02 A;  3KP3 A;  4B3A A;  3HOX J;  1BDH A;  1IZ1 A;  3ZOB A;  2MD0 A;  3FXU A;  2COB A;  3KLO A;  1OMI A;  4WXC A;  2O9L A;  2F4I A;  4RGU A;  5DV5 A;  2Z9O A;  3CCR I;  4UUV A;  4AD9 A;  1Y1V J;  2D1V A;  2DN0 A;  3HDD A;  1ZG1 A;  1KON A;  1Z3X A;  4R8H A;  1USS A;  2KRC A;  2R7F A;  4JYK A;  2GRM A;  1XTA A;  2IGM A;  4D9J A;  1X57 A;  2FXA A;  2QEN A;  1WH8 A;  3Q0W A;  4EJW A;  1BIB A;  1XC5 A;  3TKY A;  3WE2 A;  2OAZ A;  5GAD J;  3BG7 A;  1DQU A;  2WAQ N;  2ZKZ A;  4C3J J;  1YS6 A;  3K4L A;  3MEX A;  4OMZ A;  5BNG A;  2CGP A;  3CCL I;  2GXB A;  1STZ A;  4HF1 A;  3O3K A;  4D7N A;  1ETO A;  5IOY A;  4AUX A;  4BXX J;  3OR2 C;  4Q48 A;  4BH9 A;  3OYD A;  4PU3 C;  2F6C A;  4BE1 A;  3A01 A;  3K70 D;  3H5A A;  1MFQ C;  5IYC J;  3BWG A;  5FKK A;  5FO5 A;  4GDF A;  3JTH A;  2CW0 F;  2L7Z A;  1XSD A;  2W00 A;  2BNM A;  2LLK A;  4WXD A;  3GCM A;  4XLH A;  4ZTF A;  3HGG A;  3IRR A;  1H9G A;  3F6V A;  3SQN A;  2EK5 A;  3WTZ A;  1FYK A;  1UG0 A;  2CUJ A;  2CW8 A;  3V7R A;  3S3M A;  2LYS A;  5TGT A;  4ENJ A;  3DV8 A;  3W2W A;  4N9I A;  2MH9 A;  2HEO A;  3DBL B;  2QKM B;  2ISZ A;  4YBA A;  1HDD C;  3H5T A;  4BU2 A;  5BQT A;  2XHK A;  5CKT A;  3H92 A;  4WCG A;  9ANT A;  2DDB A;  4GCV A;  4UUS B;  1MBF A;  1KU9 A;  3L1P A;  1YQA A;  2K3P A;  3ZMT A;  4FX0 A;  4DBR A;  2OU2 A;  2XGD A;  1YIO A;  2OZU A;  2VJ5 A;  1DDN A;  5E17 F;  2LOO A;  2IS2 A;  3JXB C;  1LVA A;  3MKL A;  4ZDO A;  2EFW A;  2ESH A;  1H0M A;  2FBK A;  5FB2 A;  1X2L A;  3C7J A;  3CMM A;  1U2W A;  2IGO A;  2V6C A;  2FE3 A;  1YLF A;  3NAR A;  3A03 A;  4BHC A;  1W0U A;  2TRT A;  3BJA A;  2P4W A;  2HOS A;  1T95 A;  2ME0 A;  2VJ4 A;  4DZP A;  1AWC A;  3KE2 A;  1ORK A;  4ZYE A;  1QZX A;  1IV8 A;  3E5U A;  3OYI A;  5DSX A;  4YEL A;  1XMX A;  1IGN A;  2OFY A;  1Z21 A;  4OIO F;  1POU A;  3M8J A;  5IOZ A;  4C3H J;  2DMQ A;  4R1H A;  3K1M A;  1KYW A;  1TNS A;  3KEQ A;  3GFL A;  3C1D A;  1YSE A;  3GW2 A;  1EF4 A;  4II2 A;  3WU1 B;  3VFZ A;  1PUE E;  2O49 A;  1DU0 A;  3I4N J;  1Y8Q B;  1S7A A;  2DLL A;  5J1R A;  3QYF A;  4M71 A;  2LLV A;  3GUD A;  1QRY A;  3OYM A;  2EFO A;  2VE9 A;  1QZY A;  2DT7 B;  3SJM A;  2NS7 A;  4XOR A;  5HDG A;  2PE5 A;  1G3S A;  2VKH A;  3T8T A;  1D8J A;  2LFB A;  4XLP F;  1P92 A;  3MZ8 A;  5M3F J;  2AXT C;  1BI1 A;  3NRV A;  2DJN A;  2ICT A;  1JWL A;  1PER L;  5FRM A;  4M9X A;  3OYN A;  2XPW A;  1MJ9 A;  2MD5 A;  2IUO A;  4XBF A;  1ZGJ A;  4Z58 A;  4K2E A;  4HRA A;  4NC6 A;  1Z1D A;  1E17 A;  3VYS B;  3EUH C;  1BI3 A;  3LMM A;  5KCM A;  3ROU A;  4WK8 F;  2HFH A;  4PJN A;  2DYR H;  2OCC H;  3G73 A;  1QZE A;  3FMR A;  4HNV A;  3HGY A;  1MBJ A;  4B09 A;  3I4M J;  3OYE A;  1JKO C;  4LOC A;  2EB7 A;  1Z91 A;  4A0Y A;  3M3Y J;  2NS0 A;  3WGG A;  2O8X A;  4ZTJ A;  3BRO A;  3FIS A;  2Z3Y A;  4CYC B;  1X1A A;  2NVY J;  3D5L A;  2O4A A;  2O03 A;  4C2U A;  2KRH A;  2VJJ A;  4HST A;  4XR6 A;  3OY9 A;  2JPB A;  1VQO I;  2EIJ H;  5FD6 A;  3V7C A;  3KLN A;  3TDZ C;  3V8J A;  3RI4 A;  4IOC F;  3OMY A;  3IRQ A;  1JKP C;  2GIZ A;  4D7M A;  3U1K A;  5KNL A;  3HZJ A;  3K0L A;  3R0A A;  5DYM A;  3QWG A;  2BE5 F;  5FGM A;  2BY2 A;  3F8F A;  3LAJ A;  2QSF X;  2ZFW A;  1UAA A;  2PUE A;  1MGT A;  1Y6I A;  2VAS A;  4FN3 A;  1YX3 A;  2TCT A;  3FXJ A;  2BVM A;  4WWC A;  2AXL A;  4LK0 F;  1E2X A;  4CUG A;  2A6H F;  3SZP A;  1CF7 A;  3BJO A;  2ZSH B;  2Z1D A;  2K4J A;  3TO9 A;  1D3Y A;  1P4W A;  2E5Z A;  2KP6 A;  1R5G A;  2HDD A;  2JMW A;  3S2D J;  2K85 A;  1TBX A;  3GUU A;  3F8N A;  1IC8 A;  5C4X J;  4BE0 A;  2MXD A;  2LDU A;  2QSG X;  1Y56 A;  4FE4 A;  4EM1 A;  1UZC A;  1P7I A;  2FBI A;  1KZH A;  2FA5 A;  5EJC A;  4U7D A;  5BPD A;  4E7L A;  2GA1 A;  3I59 A;  4ENM A;  4DE8 A;  1N77 A;  1V5G A;  3ZMD A;  1R9T J;  4UVA A;  2IXS A;  4CCK A;  4U0W A;  4J01 A;  4PU8 A;  2KIM A;  3TW7 A;  4C2M J;  1TQP A;  4BYY A;  2P5L C;  3DFG A;  4GFB A;  2G7U A;  4IHS A;  3HEF A;  5E79 C;  1VTN C;  3PM1 A;  1ZYR F;  2LY2 A;  1P6R A;  4IVZ A;  4RGX A;  1WHU A;  1SFX A;  3DCF A;  5D6E A;  3CJN A;  4LLG F;  3GBG A;  5JHU A;  4A12 A;  2V6E A;  2LYP A;  2L4M A;  3CCU I;  2PXB A;  2MC3 A;  1ZZ6 A;  2HZT A;  4DJA A;  4IPA A;  2FJR A;  4J1W A;  4CYD A;  3VK0 A;  3T8R A;  4A3L J;  1UTX A;  1X3W B;  3I58 A;  3JRF A;  2L9V A;  5EF6 A;  3E6C C;  3BQY A;  3CP8 A;  1CF7 B;  1S5L C;  2VUM J;  1ZTR A;  2HQR A;  3PUF A;  4HBL A;  2ID6 A;  3L2U A;  5D5U B;  4OOI A;  3RZZ A;  3DKX A;  2JVL A;  1CGP A;  3CP2 A;  3MCZ A;  4Z2Y A;  1DPU A;  5HOD A;  2Z99 A;  5HS9 A;  3TW6 A;  4BKX A;  3SR4 A;  3JSP A;  4IRH A;  2YX7 A;  4A0Z A;  2HYJ A;  5E3L A;  3OYL A;  1TL8 A;  3KEY A;  4S0H B;  3LQQ A;  2VBZ A;  4P1W A;  3TO6 A;  1ZRF A;  2BW3 B;  4I99 C;  1YOV B;  4FQG A;  2RVC A;  5GP9 A;  4ZYA A;  2J7W A;  3J7Z I;  2O6G E;  1VQK I;  3CRO L;  2XVC A;  3J81 Z;  3KZY A;  2LKP A;  5BPI A;  4KIT B;  1UJ8 A;  2ELJ A;  4A69 C;  1D8K A;  2XF5 A;  3P9C A;  1Y39 A;  1B4A A;  2ZME A;  2L3D A;  3RTR A;  1CQT A;  4TV7 A;  1U9N A;  3HOZ J;  4ESB A;  2MYS A;  3JRC A;  3V7S A;  2HQ5 A;  4IHT A;  5HDN A;  5LRS A;  2CRO A;  2ACJ A;  3G5G A;  3ML6 A;  1K4T A;  4LB5 A;  1HDP A;  4HYE A;  1D0X A;  3TL4 X;  1FOK A;  2HIN A;  1VZ0 A;  4FHT A;  4KDP A;  4A3F J;  2V1U A;  4CZZ A;  2OPT A;  1UCR A;  5DM7 F;  1ACI A;  3O8G A;  1JJ6 C;  1BJA A;  4H4K C;  1JTY A;  3V8K A;  2JPC A;  4CO8 A;  2WBM A;  3WOD F;  2FU4 A;  1QNT A;  2M0M A;  4RB1 A;  3W6K B;  3L7W A;  1Q1V A;  3KL4 A;  2X6X A;  1D1A A;  3OOP A;  4A93 J;  3S3O A;  3JW4 A;  5IYD J;  3B7H A;  3I71 A;  5L3C A;  4HEA 2;  5GTH C;  2F48 A;  1LJ9 A;  1K4S A;  4B44 A;  4ZYD A;  3DF8 A;  5K7Z A;  4X4B A;  1SD5 A;  2JT1 A;  4CDG A;  4Y52 J;  1QPZ A;  3R1F A;  1O3S A;  1LFB A;  4Q5S F;  3E6D A;  4M3B A;  2XSJ C;  3S17 J;  1IN4 A;  1YJ9 I;  3DP7 A;  3O8H A;  2UXN A;  3OL4 A;  3RPU D;  5M5W J;  2HVS A;  1V54 H;  4QIW N;  2XGE A;  2LYR A;  1K78 B;  2E1M C;  2XXQ A;  4AVZ A;  1CJG A;  2IA1 A;  2FX0 A;  2O5R A;  3H5N A;  3H9J A;  2VOP A;  2HKO A;  3H36 A;  5F0H A;  1KYZ A;  2PXU A;  4I98 B;  5CVI A;  3IH2 A;  1W7P A;  1ZUG A;  3CCQ I;  5GPA A;  3G1L A;  1J2X A;  4IQ4 A;  5ICG A;  2CJJ A;  2MW8 A;  4HOB A;  4IL6 C;  4L5I A;  5F0C A;  3S93 A;  3LAP A;  3QPS A;  2E60 A;  1XS9 A;  1TWF J;  3FK6 A;  5F64 A;  2VIX A;  3D5S C;  4JQF A;  3RIR A;  3OL3 A;  2LTP A;  3KZ3 A;  1IDY A;  1KU7 A;  2NVX J;  1ADR A;  3PNT A;  3EYI A;  2QBY A;  3H3U A;  3FXK A;  3PNY A;  3L09 A;  2UXX A;  2Q0O A;  5H20 A;  3HZI B;  1JXS A;  3P9I A;  4BAY A;  4FT8 A;  1UHS A;  1X2N A;  2IAI A;  3DU6 A;  4D5C A;  2K86 A;  5HDK A;  2JA5 J;  5HS7 A;  1T2K A;  2Y48 A;  3U9G A;  4ZC3 A;  5LHH A;  2OCE A;  3KX2 A;  2ZJP F;  1LQ1 A;  2IW5 A;  5DTQ A;  4KN7 X;  4LMY A;  1R6R A;  1U8B A;  3N05 A;  2K9M A;  4LG0 A;  3OS2 A;  3RKY A;  2L9N A;  3EUK L;  2DW4 A;  1XMA A;  1HLV A;  2ZNZ A;  2ZO4 A;  4PGG A;  5DEQ A;  2QA4 I;  4CGZ A;  1P4A A;  4I01 A;  1OQY A;  5DT2 A;  2KL4 A;  5TIS C;  2DOA A;  4HZF A;  3GTG J;  1JH9 A;  4BQN A;  5FJ8 J;  2DOF A;  5LGT A;  2B5A A;  4BGD A;  3HRU A;  3S16 J;  1LEB A;  1SC7 A;  3S15 J;  2XRL A;  2L49 A;  1RIO H;  2VT2 A;  4JX6 A;  4L5E A;  1BOB A;  4IF4 A;  2PXE A;  2NRA C;  4IWR A;  1I50 J;  2JJ7 A;  2R7Z J;  3IV5 A;  3PXP A;  3CDL A;  3GYH X;  3DNV B;  2EIM H;  4O8B A;  3BJ6 A;  5CLS A;  2E2I J;  1Z6R A;  4F7Z A;  4DYQ A;  4LD5 A;  1FWZ A;  4A3C J;  3G0T A;  3BPX A;  3K4N A;  3J7Y J;  5CQE A;  3EYY A;  4X4I A;  3UNG C;  3ELK A;  1APL C;  1QGP A;  3F72 A;  4RAF A;  4UB6 C;  1G6N A;  2IVM A;  5FKL A;  4V2F A;  3GTJ J;  2JA6 J;  2H6C A;  2DA4 A;  4ZJZ A;  4WXH A;  3C18 A;  3ZKC A;  5DRY A;  4LLL A;  3SCG A;  1J9I A;  1B1B A;  5EEH A;  2A68 F;  2OA4 A;  1WH7 A;  2ZXJ A;  1JUP A;  1NG6 A;  1R7J A;  1KGS A;  2YX4 A;  4F91 B;  1F36 A;  4I09 A;  2M7B A;  3RQ4 A;  4EJV A;  1FOW A;  3GTM J;  2VB6 A;  2WB1 A;  2FFH A;  3DEU A;  2JVG A;  3GTQ J;  2HCN A;  1I1S A;  1JTX A;  5TJJ A;  4L0Z B;  4I6R A;  2LH9 A;  2B9S A;  1FOX A;  4Z6Y A;  1BI0 A;  2CUF A;  4V19 K;  2X48 A;  1XG1 A;  2JCG A;  2MSY A;  2EZK A;  4KIC A;  2CYY A;  5GTI C;  1O57 A;  4EZI A;  5FRN A;  1D5V A;  5D5V B;  4HA8 A;  3GF2 A;  4A5N A;  1SFU A;  1VQ5 I;  2M3A A;  1H8A C;  4DW6 A;  2JUG A;  2DU9 A;  3ZQH A;  5KAF C;  1B72 B;  1XD7 A;  2VQH A;  3G4S I;  2XI8 A;  2KEI A;  2RV8 A;  2MQK A;  1WQ2 A;  2WB1 N;  2VC0 A;  3PNV A;  2J5O A;  1WFX A;  3WTY C;  1Z7L A;  4FAS D;  3BLY A;  3OOU A;  1U0J A;  2P6S A;  2X4H A;  4QLC U;  4HF2 A;  4LG0 B;  2DTR A;  3WGH A;  1TWA J;  3GTP J;  2A69 F;  1TNT A;  3SHF A;  4OIQ F;  1ZR4 A;  2L9S A;  3RZO J;  3QQ6 A;  3SCF A;  3IUO A;  1FC3 A;  4XNF A;  3ABK H;  3SFZ A;  2BV6 A;  2IPQ X;  2KDO A;  2V3C C;  2EZH A;  3LSM A;  1NH3 A;  3TOA A;  1R1V A;  4AC0 A;  1SFO J;  1OCZ H;  4MHG A;  1I6X A;  2V9P A;  2F5F A;  2DPD A;  3E97 A;  2Y31 A;  3GFI A;  4E6K G;  1OFC X;  2HKX A;  4UY8 I;  5DS9 A;  3NRO A;  4F52 A;  2NOJ B;  2E5N A;  3FXO A;  5DM6 F;  1D1C A;  5EDN A;  3OYK A;  2Q1Z B;  2L9R A;  1JUM A;  3H3Z A;  4I6T A;  1SAN A;  3QP5 A;  2HOT A;  3GZD C;  2QQ8 A;  3UR3 C;  2QSH X;  1REP C;  1AKH B;  3QPT A;  1WZ2 A;  1IJW C;  1BN5 A;  2VQC A;  3P5J A;  2R7U A;  2GXA A;  3F0C A;  2K9N A;  3A0B C;  2IU7 A;  4XOT A;  3JR9 A;  3G7D A;  2IBD A;  2DFH A;  1WRJ A;  5L3B A;  4IHW A;  1ZHF A;  3HSE A;  4HX7 A;  1BOA A;  2M8E A;  1RNL A;  3K2A A;  3RKQ A;  4KMU X;  2CU7 A;  1FP2 A;  3OIO A;  1BBY A;  1MBE A;  3WU2 C;  3X2Q H;  3BQZ A;  2K7L A;  4PK4 A;  1ZRE A;  4F93 B;  2W84 A;  3FX3 A;  1S29 A;  1VQ6 I;  1LB2 A;  3BR6 A;  3AG3 H;  2XGX A;  2CO5 A;  4ZZL A;  1TT0 A;  2PXD A;  5JLX A;  3NDB B;  5EG0 B;  3OSF A;  1IDZ A;  2FBH A;  3LWF A;  3HL2 A;  4U87 A;  3QYX A;  3ZQC A;  2HS5 A;  4HSR A;  1A36 A;  1WCM J;  2MC4 A;  3BZK A;  4EKG A;  2L5Q A;  4EJU A;  1V55 H;  5K98 B;  3IC7 A;  1GV5 A;  1V3F A;  3F51 A;  4Z5D A;  2BGC A;  4BBS J;  4EVI A;  2W57 A;  2LD5 A;  2XJ3 A;  2YPR A;  2W25 A;  4D5F A;  4ON0 A;  3F23 A;  1JKQ C;  2L0K A;  4EJT A;  1QP4 A;  5ICF A;  3ESW B;  2FEZ A;  3JCU C;  2NAZ A;  3CTA A;  4PSX A;  2V79 A;  1B9M A;  1MZB A;  3IL2 A;  4ESF A;  4QPO A;  5LBQ A;  4KIB A;  2GA2 A;  1MBG A;  3TMO A;  4XOP A;  3AKZ A;  3KYD B;  3BCB A;  1QVU A;  1DWK A;  5D8K B;  4UUT A;  3WHC A;  4Y17 A;  1P4X A;  1TT5 B;  2P5V A;  3CCS I;  4Y42 A;  3DEE A;  3W6J B;  2HWV A;  2X1E A;  3AFH A;  2LYJ A;  3H3V K;  3Q3S A;  2AS5 F;  2PI0 A;  1YRN A;  2Y9Z A;  1U5T C;  1MSF C;  2XF7 A;  1FIP A;  3F8B A;  1SFK A;  3CO7 C;  4UXN A;  5FFZ A;  2QKL B;  2ADU A;  3VSK A;  3ABU A;  1OLT A;  4HRI A;  4MFE A;  1MMS A;  2PXV A;  1NG7 A;  5LEJ A;  1FBS A;  4KA4 A;  2UV1 A;  1E3O C;  4KT6 A;  3BC8 A;  3R61 A;  4XRS A;  1I1G A;  2F5C A;  3F3X A;  2H8W A;  5DCM B;  2DPU A;  2FOW A;  5F1J A;  5J4Y A;  3L2V A;  2R7X A;  2A61 A;  4XN0 A;  4RBO A;  3BR2 A;  4N0B A;  3OYA A;  1AA7 A;  2IEK A;  2VPR A;  3CMA I;  2LRE A;  3B73 A;  1ZPQ A;  5DD8 A;  3ZXS A;  2Z16 A;  1JJ8 C;  3R0J A;  1NHA A;  3QWL A;  2P0W A;  1J5Y A;  5ICC A;  1IN8 A;  2DT5 A;  4M6V A;  3SZT A;  4DE9 A;  1PRA A;  3ZRG A;  3ZQI A;  4Q2J A;  4YIF A;  1POG A;  4JX4 A;  3PL8 A;  5HOO A;  3VSL A;  3ABM H;  5CJ9 A;  2WY8 Q;  3LFP A;  1UB9 A;  4WF2 A;  3S32 A;  2EPF A;  1UFM A;  5JFR A;  3GFM A;  2L7K A;  3Q0U A;  3PO2 J;  1HQC A;  5F27 A;  3FHN A;  3AL0 C;  1MD0 A;  3BP8 A;  2W24 A;  3BPV A;  2P81 A;  2PBI A;  3JRH A;  1MW7 A;  1ZZ7 A;  1IRG A;  4GRI A;  4BY7 J;  1SVM A;  1SAU A;  3CME I;  3FXQ A;  3K1P A;  4XRM A;  3I3L A;  4RB0 A;  1OCO H;  3CCM I;  4D1Q A;  4PJ0 C;  1DGR M;  3OR1 C;  4YG2 F;  3BZC A;  3QPL A;  2XAG A;  2DA7 A;  3PFY A;  4OWR B;  2TDX A;  2K9Q A;  2CWE A;  3S1M J;  3LL7 A;  3K69 A;  3SDB A;  2R93 J;  4HV6 A;  4L5J A;  3U3W A;  2A5Y B;  3COA C;  4M3E A;  4LLN A;  2YUS A;  1Z6T A;  1E3P A;  1QQI A;  3IAS 2;  3KIO A;  3ECH A;  2WV1 A;  2L2O A;  2CSO A;  4MFD A;  2JTV A;  3ASN H;  1YRN B;  3AL0 B;  3CCJ I;  1YHQ I;  4IHX A;  3F6W A;  1ZZ9 A;  2LR8 A;  3K2Z A;  3LSJ A;  4G6D A;  3Q5F A;  1QVT A;  1PUF A;  1R49 A;  2VEO A;  1ZK8 A;  4Y3O A;  1E0E A;  3OS1 A;  1EA3 A;  3JRI A;  2DFE A;  1YI2 I;  4IEJ A;  2GQQ A;  4X4H A;  3U2R A;  2ZXH A;  2V4J C;  2FNP A;  2RNJ A;  4OIR F;  5A2Q K;  3PO3 J;  4LJZ F;  4FTH A;  2FMY A;  2XIG A;  4XIC A;  1U3E M;  1ZZ8 A;  3S1N J;  3NWS A;  4UVC A;  1MMD A;  1UG2 A;  3VOE A;  5F0F A;  2F4M B;  4GXO A;  2DA3 A;  1U78 A;  2A6C A;  1V4R A;  2XSD C;  4DGW B;  1LCC A;  3HHG A;  4C3I J;  2EBY A;  3J7A O;  1SD4 A;  2K3F A;  3ZQQ A;  5BS6 A;  1MSE C;  3SEQ A;  1NTC A;  2Z5U A;  2JVH A;  4E7K A;  5C3E J;  4EEF G;  3LSR A;  3EPZ A;  4XM3 A;  2WAD A;  3I54 A;  3E1S A;  2P6T A;  5B5E C;  4PFP A;  2IVB A;  4P5O A;  2X6W A;  3FIW A;  3V4G A;  2KEK A;  3DTK A;  3FYA A;  1X1P A;  2OTL I;  1GXQ A;  1ETV A;  1HW5 A;  2K02 A;  2IGN A;  3K7A J;  3VB2 A;  2V1N A;  1A31 A;  4CHU A;  2XAQ A;  2VE8 A;  1HKT A;  3P9K A;  4BQO A;  5DUK A;  2PMH A;  1R4M B;  1QO0 D;  5KVR A;  1SD7 A;  5EGO A;  4HNT A;  2I8D A;  1OYY A;  2A3S A;  5CVV A;  5EG0 A;  4AVP A;  2OQG A;  1EH7 A;  2ZB9 A;  1F4K A;  1OR7 A;  3E0J B;  4JK1 X;  1FPQ A;  3HRS A;  2E2H J;  3WTW C;  4UNO A;  4IO9 F;  2NNN A;  3TEP A;  2P5K A;  4M6Y A;  2CUZ A;  2JK3 A;  3BTJ A;  1RUN A;  5DTR A;  1ZN2 A;  3CQZ J;  4YEJ A;  4Y15 A;  3G71 I;  3ZP5 A;  2OR1 L;  4Y7N J;  2A07 F;  2V1X A;  2WY7 Q;  2ZJ2 A;  3TOB A;  2E71 A;  2MLK A;  2PMU A;  4IOA F;  3GN5 A;  3QF3 A;  3HRT A;  1X1C A;  2QYO A;  2RAE A;  5JUW A;  4EV0 A;  3LA2 A;  2LYK A;  4HW0 A;  1A6Q A;  3WHB A;  5IT9 K;  2HSG A;  2FML A;  4PJM A;  2VT3 A;  5CVU A;  2XRO A;  2M45 A;  3ZMZ A;  4L9V A;  4S05 A;  2RRE A;  2JSP A;  5H6R A;  2BXZ A;  5TRD A;  3J7A Y;  2D2W A;  2IJL A;  3F52 A;  1YG2 A;  1I27 A;  5H2F C;  3RQI A;  1LFP A;  1TWG J;  4NHJ A;  3M1E A;  1LMB 3;  1JGG A;  4ER3 A;  1H89 C;  3VOD A;  5IY5 H;  2QQ9 A;  5E20 A;  1ZQ3 P;  4L9J A;  2B63 J;  5F1R A;  5K5Q A;  2HYF A;  2RQQ A;  3OWQ A;  2DYS H;  2ICW G;  2A05 A;  2M34 A;  4ITV A;  2VXZ A;  4IRI A;  4N4N B;  3OV8 A;  4MTD A;  1FBQ A;  2H1L A;  2WUS R;  2ETH A;  1GV2 A;  4C30 A;  3R4K A;  2JN6 A;  1HXD A;  3LFK A;  2IRF G;  3JRA A;  1QPM A;  3WTS C;  5GAE J;  1ONV A;  2PG4 A;  2HZD A;  1V5E A;  3CDI A;  1WKM A;  4HX4 A;  3CJR B;  2KZG A;  3RCO A;  2Y2Z A;  4BJ6 C;  2HGC A;  1KQ9 A;  5KAI C;  3GN5 B;  4AU7 A;  2FUG 2;  1LFU P;  3I56 I;  1OPC A;  2E1C A;  1G8X A;  3BDD A;  3IWF A;  3OIQ A;  4X6A J;  2BZT A;  3RKX A;  1RZR A;  4XMY A;  4BEH A;  1T0F A;  5CYV A;  3OWT A;  4A3J J;  4L0Y B;  3I5U A;  2PEX A;  1MIJ A;  5FKO A;  3A9Z A;  2K9L A;  3M4O J;  2EFN A;  3T5X A;  3ZQF A;  4IKF A;  2ESN A;  4S04 A;  2LSO A;  1ODD A;  3BTC A;  4DBQ A;  3OP9 A;  3BCA A;  4Q4Z F;  3ZQG A;  5LGN A;  4PSW A;  1YFH A;  2Y75 A;  3OS0 A;  1T98 A;  4HV5 A;  2KRF A;  3H9G A;  2NS8 A;  4RGS A;  5K5O A;  4RDU A;  3FM3 A;  1R63 A;  2PMZ N;  3UWP A;  5LD2 C;  1BIA A;  1I39 A;  5B1A H;  3JRB A;  3MN2 A;  2VPL A;  4U0V A;  2O0Y A;  2OZ6 A;  1W4M A;  2R3S A;  2DFF A;  1ITY A;  4R79 A;  1RPW A;  2ZNY A;  4L9N A;  3BTI A;  5B66 C;  4PFO A;  1X2M A;  2MEZ A;  4MIM A;  5HLT A;  1QHH D;  3JTG A;  2IVG A;  1TW2 A;  3FM5 A;  3CC4 I;  2IS4 A;  1IF1 A;  3OYJ A;  3R6S A;  2F5D A;  1VQL I;  1ZS4 A;  3SDG A;  1J0R A;  4X4E A;  2XV4 S;  4I76 A;  3IAM 2;  3L2W A;  3H0G J;  2JSC A;  4II3 A;  2NNY A;  3IHU A;  2L7F P;  4I6Z A;  2JA8 J;  2EFP A;  5H6Q A;  4B43 A;  3QQA A;  2BVL A;  1RRJ A;  2R5Z B;  3F8C A;  1S72 I;  5E18 F;  4J1X A;  4HQM A;  3BG9 A;  3B02 A;  5JI6 A;  1DUL A;  4XKV A;  2AO9 A;  1XDS A;  4N4O B;  1EH6 A;  1AOY A;  2R1J L;  1PNR A;  2V9K A;  1ZKG A;  3A9X A;  5J47 A;  3GTK J;  1MMA A;  5A7L A;  3QAH A;  3ABL H;  1K79 A;  4LFU A;  1WJD A;  2KIU A;  4HDV A;  4MQV A;  5DCF A;  1I3Q J;  1OCR H;  3K4M A;  2R5Y A;  3OQO A;  1T33 A;  3S1Q J;  4ER7 A;  2KPM A;  5HLG A;  2JWT A;  4O6J A;  1FT9 A;  4U7B A;  4XN3 A;  5IP7 J;  2ZCW A;  3E3V A;  4MGR A;  4B47 A;  2NXN B;  5HNF A;  1NK2 P;  4OAZ A;  2GXG A;  2PXK A;  3F8M A;  2R7S A;  5E3N A;  2PJR A;  1T6S A;  3CLQ A;  2FSW A;  3GTO J;  1W5S A;  3EQL F;  3H35 A;  5LRR A;  2LNB A;  1QBJ A;  3HSF A;  2OTJ I;  1LQC A;  2MH2 A;  2BNN A;  3JAM Z;  4X4C A;  3S1R J;  1W1W E;  2NVT J;  3B6C A;  4U0Y A;  2X6Y A;  2WAQ A;  1TWC J;  2VOO A;  2KEJ A;  2R7O A;  1WIZ A;  3S8Q A;  4HLY A;  1LLI A;  1J09 A;  2AUW A;  4X4G A;  3TEL A;  4P96 A;  2IT0 A;  2R4G A;  1IN5 A;  2XKP A;  1EFA A;  3FWE A;  4A6E A;  1X19 A;  2Y0S A;  3J81 K;  2DK8 A;  3TRB A;  4BDZ A;  1VQP I;  2QCO A;  3SZG A;  4IHV A;  1LCD A;  2JUC A;  3IH3 A;  2OJE D;  3QOP A;  3HYI A;  4RAG A;  3GZN B;  1Y0U A;  2PXQ A;  2MAB A;  2ZFU A;  3H5R A;  5F6F A;  4CH7 A;  3DTE A;  3PUB A;  1MNM C;  4KNY A;  3I55 I;  3HOS A;  4JP0 A;  3VWB A;  1PYV A;  2R7Q A;  2XAF A;  1I6H J;  4W1U A;  2L02 A;  4O5V A;  3FMQ A;  2WTE A;  5EZG A;  1XCV A;  3F22 A;  4A5M A;  2B0L A;  3F9K A;  3WTX C;  3K4C A;  4JOM A;  2CQK A;  3TP0 A;  1VI0 A;  1D5Y A;  2BY1 A;  2ELK A;  1R5I D;  2F5E A;  2IP2 A;  5DTD A;  4I7H A;  1ZAR A;  3GME A;  1VQ9 I;  3BR5 A;  2FRH A;  4E7H A;  2GZU A;  1OJL A;  2ZXI A;  1IUF A;  4WX9 A;  3GZ5 A;  5J40 A;  3PFI A;  1IXR C;  3BR1 A;  4QPQ A;  4AWX B;  1HKS A;  2LBF A;  4I0A A;  1FEX A;  3JXC L;  3TO7 A;  5LHG A;  1HSJ A;  2MGQ A;  2JA2 A;  3W2V A;  3BR0 A;  4XRS G;  1HST A;  1FJL A;  4A3E J;  1SMY F;  2QGU A;  2EH3 A;  2HOA A;  3A0H C;  2CSF A;  4EJO A;  1XGO A;  4A3M J;  2LVS A;  5D4R A;  3ECO A;  4B3X A;  4UV8 A;  4HNU A;  2LF8 A;  2CQQ A;  2XIU A;  1FBU A;  2VLA A;  3CLC A;  2BNO A;  1ZZC A;  3E6B A;  4ER0 A;  2Z33 A;  1BW5 A;  4JBA A;  2XGC A;  3CCY A;  1Y8R B;  2XKO A;  2MFZ A;  4OB4 A;  3UKG A;  4CSW A;  1GVJ A;  5LLQ A;  1DU6 A;  1HCR A;  2QF7 A;  1YO5 C;  1VQM I;  2Q8K A;  1R00 A;  4IVN A;  1PUF B;  1AHD P;  5J1Y A;  3DEW A;  2BEO A;  2FQ3 A;  2KJB A;  2M4G A;  2XAH A;  1T0F C;  1X4P A;  2Y9Y A;  3MQ0 A;  2KPJ A;  1HBX G;  2HYG D;  4XLA A;  1JI8 A;  4MCT A;  3OYB A;  1JKR C;  1JHH A;  3GLX A;  3BR3 A;  2O8K A;  1AKH A;  5CQG A;  1XGN A;  3FBI B;  1IRZ A;  4A2U A;  3GLL A;  1BM9 A;  4FCY A;  3HM5 A;  2DTZ A;  5AIQ A;  1LDJ A;  1GHC A;  5ICE A;  1VFC A;  2PJR B;  1FP1 D;  2LF7 A;  1QU3 A;  3OYH A;  3GZC A;  2CFX A;  1FIA A;  1LDK B;  5IP9 J;  1J75 A;  4M74 A;  2WAE A;  4Z5C A;  2YS9 A;  2XPU A;  3DU5 A;  5AON A;  4GGG A;  1DPR A;  3QP6 A;  5IPA A;  3MKW B;  1MDM B;  1TZL A;  1R22 A;  2DDA A;  3CUO A;  3HKZ N;  4XKC A;  1MJA A;  2VON A;  1FMV A;  3SX0 A;  3ERM A;  2CQ7 A;  2PX9 A;  4XLF A;  2LY1 A;  5F08 A;  1U6G A;  3ZMU A;  4CIC A;  1RET A;  1S7E A;  2VJI A;  4ER6 A;  4G6T B;  4EGZ A;  4HX8 A;  5LFA A;  5EYR A;  5M3M J;  4EMS A;  4M73 A;  3ERE D;  2D5V A;  3S2W A;  3OIP A;  4ETS A;  1R71 A;  1EV7 A;  2QM3 A;  2KQR A;  2VKD A;  2M30 A;  2E35 A;  1N75 A;  3LSP A;  3P7N A;  1BDI A;  1A04 A;  3DPU A;  4BL0 B;  1BL0 A;  4B8X A;  3RJP A;  3LST A;  3IH4 A;  3VYT B;  5AIP A;  1UXC A;  1GUU A;  2XXA A;  2XB0 X;  4BUP A;  3CUQ B;  4ENN A;  2LNM A;  1EH8 A;  4M9S A;  4YFX F;  1B72 A;  4NC7 A;  3OMT A;  3RPU A;  1RKT A;  4Z5H A;  1FYL A;  1G4D A;  1HKQ A;  3PIO F;  1KQ8 A;  3GEZ A;  1XGM A;  4XSZ F;  2K9S A;  4I02 A;  2OBP A;  2EV0 A;  2GRL A;  3MD2 A;  3JAM K;  2KZ8 A;  1YYV A;  4ZYH A;  1QZZ A;  4HLX A;  2GLO A;  1XMK A;  1YE9 A;  2FF4 A;  2BOL A;  2PMZ A;  3MMY B;  4J00 A;  1BC7 C;  2XUB A;  4BNC A;  1FTT A;  2L01 A;  4DOZ A;  2AQE A;  1B8I B;  2CG4 A;  3NEU A;  2V7F A;  3MVP A;  3K4K A;  4RA2 A;  4CYC A;  4G7Z F;  2WV0 A;  2X9D A;  3WGI A;  2ZME C;  2PXF A;  3M7G A;  2VC1 A;  1ZGW A;  1UST A;  3CMY A;  2UWM A;  1U2Z A;  4G94 A;  4XRF A;  1UMQ A;  4LIU A;  1XB4 A;  3LIS A;  2HVR A;  3REO A;  1O4X A;  2RNG A;  3DPL C;  4IJA A;  1NK3 P;  1WET A;  1O3R A;  4JCX A;  5FRO A;  1O7F A;  4XLE A;  3U21 A;  5B3S H;  3GTL J;  3HOW J;  1U8R A;  2E36 A;  2IVQ A;  2J7U A;  1RZ4 A;  2VKE A;  3GWZ A;  3V8L A;  4ZZD A;  3FHZ A;  4HG2 A;  3CF2 A;  5KHD A;  1HC8 A;  1ETW A;  2YSR A;  3HXL A;  1GDT A;  3AG4 H;  3S3N A;  2UZK A;  1U5T A;  1IXS B;  1ETY A;  2AHQ A;  1LUJ B;  2DMU A;  2CW7 A;  3E5X A;  2M9H A;  5J4V A;  2AWI A;  1WSU A;  1DP7 P;  2EV5 A;  1ETQ A;  1UHW A;  2E1O A;  5GAH i;  3CUQ A;  1Y7Y A;  2M7A A;  1ON1 A;  1K6O A;  4M3G A;  4AM3 A;  2DA6 A;  2K40 A;  3NWT A;  1G3W A;  4Y4R A;  4LIV A;  1LPQ A;  1I3A A;  2LYL A;  5CVJ A;  1T39 A;  2ZXW H;  1JFT A;  2QLZ A;  4Z59 A;  2AQF A;  3K6G A;  2DA2 A;  4PDK A;  3MZY A;  3W3C A;  4BBR J;  4KN4 X;  2X51 A;  2PUD A;  3CD6 I;  2VQL A;  4M9Z A;  3CES A;  4A0X A;  1ZG3 A;  4L18 B;  2L54 A;  3LSH A;  4W97 A;  1YJW I;  4CZC A;  1NER A;  2E19 A;  2Z2S B;  1VF9 A;  4NUB A;  1FSE A;  1I5Z A;  3TED A;  4QTR A;  4IX7 A;  1ZRC A;  2YBD A;  1UHM A;  3DQV C;  3DLA A;  1PRV A;  1DUX C;  2DCE A;  2DA1 A;  2UUZ A;  2JRM A;  4UV9 A;  4UB8 C;  1FZP B;  4ER5 A;  5FLM J;  2AW6 A;  1WJ5 A;  2DK5 A;  4PUS A;  1Z7U A;  3SFI A;  1WI9 A;  5B1B H;  4YFN F;  2XDV A;  4HPQ A;  3ZHI A;  3JSO A;  3BY6 A;  2O3F A;  1OYI A;  3KYL A;  5E1W A;  3DBH B;  1HOM A;  1N78 A;  2NOG A;  1L1M A;  3ZCO A;  2VXD A;  1ZZB A;  2EIK H;  4YG7 B;  2DQR A;  1ZH5 A;  2EIN H;  3IVP A;  4ZDP A;  4UUS A;  2VN2 A;  2QWW A;  3V42 A;  1IXC A;  4P55 A;  1O7L A;  1PDN C;  1JGS A;  2V26 A;  1HW2 A;  2EA4 A;  2HDC A;  2HDW A;  1TP4 A;  3ZPL A;  1IAW A;  2M4K A;  2EZL A;  1G3T A;  2KT0 A;  5IP6 A;  1MMN A;  1WI3 A;  4EQQ A;  5E8I A;  4HQE A;  3MKZ A;  3IWZ A;  1R58 A;  1U5T B;  2DMP A;  2EA2 A;  3HTU A;  2W7N A;  1MBH A;  3A01 B;  1ZEL A;  4OIN F;  5C4J J;  3CLO A;  3FKI J;  2R7T A;  4U88 A;  1S3J A;  2KKO A;  2NVQ J;  5J3L A;  4EAT A;  4NDL A;  1WJF A;  3PJR A;  3WTV C;  4AYB A;  2DJI A;  3L9F A;  2GM4 A;  1YW9 A;  3S2H J;  2A6T A;  1DW9 A;  3QU3 A;  1TWH J;  3O2P E;  4FIS A;  2RQP A;  1W0T A;  3FXM A;  4YAR A;  3FZV A;  5GPC A;  2GWR A;  4FE7 A;  1KU2 A;  4YRV A;  3HKZ A;  4BXF A;  4D0P A;  1Z0X A;  2BYV E;  2XCJ A;  4UVB A;  1IW7 F;  2XPV A;  1FSH A;  2BJC A;  2L7M P;  2CV0 A;  3G2B A;  3M9A A;  2W4S A;  1F43 A;  2BXY A;  2ZJR F;  2EF8 A;  2DOD A;  4KYW A;  4NNJ A;  2KIF A;  5IT9 Z;  5GAG i;  3E6M A;  5GAG J;  3S14 J;  1OCT C;  4RMN A;  1HQ1 A;  3WTU C;  1JT0 A;  3FXR A;  4XSX F;  1LE8 B;  3Q9S A;  1R69 A;  2IS6 A;  1XPX A;  2HFZ A;  2OF7 A;  2W82 A;  1ON2 A;  3GBF A;  2DMT A;  2KZV A;  2RN7 A;  2HVQ A;  3K1N A;  1SFE A;  2LK2 A;  4AID A;  4CXF A;  1K83 J;  4CA0 A;  3MEJ A;  2PXL A;  1IN6 A;  1BR1 A;  3WE3 A;  3ZMS A;  4KIS A;  4PU4 C;  5D6F A;  2PIJ A;  2PXP A;  1IUY A;  1XWR A;  1ZG5 A;  5FLX K;  1PVE A;  2B7E A;  1HA8 A;  2BW3 A;  4MNU A;  2ELH A;  4E7J A;  3CDH A;  2H1K A;  2MG4 A;  5IYB J;  1ENH A;  1S8N A;  2BHZ A;  1J59 A;  3HTS B;  3F6O A;  2ME6 A;  3PSI A;  4B4C A;  1QHG A;  2Y0S N;  5HS8 A;  1RZR D;  3QFI A;  4XID A;  2Q2E B;  2HXO A;  3A1Y A;  4UHT A;  1Z9C A;  1FYM A;  3FDY A;  1AU7 A;  3G3Z A;  5DD4 A;  2MLG A;  2RKH A;  2OC6 A;  1FMW A;  2HR3 A;  1OSL A;  1IV6 A;  1PRU A;  3BG6 A;  5FKM A;  1S7O A;  5HLI A;  3HUG B;  1YS7 A;  3HG9 A;  4FET A;  1KU3 A;  1MNE A;  4V2G A;  2KHM A;  3WG9 A;  1RPE L;  2O61 A;  3EDP A;  1ZLK A;  5E3O A;  4ESJ A;  4G12 A;  4PGH A;  1HF0 A;  2H27 A;  1ZGA A;  4BS9 A;  2O38 A;  3MAJ A;  3CCV I;  2VBY A;  1D0Y A;  4G8X A;  5A2Q Z;  4OMY A;  4M3D A;  1SMT A;  1R36 A;  2CQN A;  4RLQ A;  4XLC A;  1O3T A;  3RYR A;  1QQA A;  1N25 A;  2IGK A;  1RUO A;  1LNW A;  1QPI A;  4EGY A;  1MDM A;  4ABZ A;  4CCM A;  3BT9 A;  1DGW Y;  3GZ6 A;  2KJC A;  1B9N A;  3M07 A;  1P9Q C;  5GAH J;  2P7V B;  2VBX A;  5L3F A;  2OV7 A;  2JQ7 A;  1K7A A;  3N97 A;  4JX5 A;  2QQA A;  4XKB A;  1B0N A;  2IA0 A;  2YU3 A;  2BY3 A;  1TW3 A;  1S6L A;  1WPK A;  1WJA A;  5JR3 A;  2ECC A;  4FX4 A;  2QVO A;  1F1Z A;  2OUM A;  1ULY A;  2EWN A;  4LGW A;  2XXP A;  2GBY A;  5J8F A;  5JVT A;  2KDZ A;  3OKZ A;  2D45 A;  1VQ4 I;  3I0T A;  1RKW A;  3M1C A;  3LA3 A;  2PUF A;  2AXV A;  3AAF A;  5LEK A;  4H0E A;  4BY1 J;  3QOX A;  1FY7 A;  3OYF A;  3M8E A;  2ID3 A;  3PQK A;  1RI7 A;  3HPH A;  1IN7 A;  2FOK A;  4ANJ A;  1FNN A;  2CFO A;  1H88 C;  2PUB A;  3BOQ A;  5EEA A;  1LKX A;  4KMF A;  1Z77 A;  2R0Q C;  4RAZ A;  1WH5 A;  2CRG A;  3BZ6 A;  3GVA A;  5BOX A;  5CPR B;  4RLF A;  2QQB A;  5JVG F;  2H6B A;  3E5Q A;  4B1R A;  2H94 A;  2W1O A;  1XSX A;  4I2O A;  2FJ1 A;  3HJE A;  2RDP A;  5EEG A;  3T1B A;  4YFK F;  1IO2 A;  3K9T A;  4BQA A;  3NAU A;  3DXJ F;  4BQQ A;  4DZJ A;  3TQN A;  3LSK A;  2WWY A;  3HSR A;  4Q47 A;  2R92 J;  1X58 A;  2WIU B;  1OYW A;  2M1B A;  5HLH A;  3DBR B;  4AIH A;  3FK7 A;  5L3E A;  2ZJQ F;  3QRF F;  4X4D A;  2E1M B;  3HOU J;  1Z67 A;  4E7S A;  2PLY A;  2IV1 A;  1QP0 A;  5CVR A;  3M8F A;  4JQD A;  5M5X J;  3JRG A;  5J6X A;  2AXZ A;  4MEY F;  3FXL A;  2DO7 A;  2JRT A;  4G7H F;  3L00 A;  2FNA A;  3NXH A;  2LG4 A;  4N9H A;  1IRF A;  2PJP A;  4MO7 A;  4ASN A;  1WWX A;  3HHH A;  4NQW B;  4BJ5 C;  1W5C C;  4KT5 C;  5ERI A;  3SYT A;  1FTZ A;  2C6Y A;  4CCJ A;  1MJB A;  1VQN I;  5D8L B;  2X1D A;  1SQ8 A;  2X1C A;  3KP2 A;  2GOX B;  3KP4 A;  3HIF A;  2HCS A;  4AIJ A;  1FX7 A;  1HW1 A;  1DP3 A;  3HOY J;  4RM3 A;  2JA7 J;  3I4P A;  4J19 A;  1A6I A;  1MH4 A;  4KIG A;  4PJJ A;  3LOC A;  1WJE A;  1YIJ I;  4XK4 A;  4FBI A;  2RC4 A;  1PJR A;  4LB6 B;  2CV1 A;  3LA7 A;  1XGS A;  2DMN A;  3BDN A;  1MH3 A;  5F04 A;  4BJT A;  1WH6 A;  1D0Z A;  4QSH A;  3H1C A;  1Y9Q A;  1WVR A;  4M3F A;  3HRM A;  1G3Y A;  2D1H A;  2LKS A;  3SXY A;  2LYQ A;  2OD5 A;  1G2H A;  2M5W A;  4XL9 A;  3W6V A;  4GYI A;  3J80 K;  1NEQ A;  4LG3 A;  3ISP A;  3CO6 C;  2BBY A;  3I53 A;  3D1N I;  1SAX A;  3KPH A;  1R1T A;  4DYC A;  1U9O A;  2M2E A;  4HDU A;  1Z05 A;  4DNC A;  4P9U A;  5DRT A;  4A3B J;  3RYP A;  5ILU A;  3MZH A;  2ODR D;  1BR2 A;  2EBI A;  4BAC A;  4YG4 A;  2EIL H;  5LHI A;  2K5C A;  1XDU A;  1Y0N A;  2LYC A;  3GXO A;  1LVK A;  3LFU A;  3CCE I;  3GFJ A;  3KXA A;  1NW3 A;  2F2E A;  5E1Z B;  2O7O A;  1BW6 A;  3ZN0 A;  1P7J A;  1YW8 A;  1YTY A;  4IQJ A;  3ZHM A;  3CZ6 A;  2I10 A;  2I5U A;  2N8G A;  3PE5 A;  4JCY A;  3CC2 I;  3ZPX A;  3BS3 A;  3KCC A;  1B59 A;  2E7X A;  4NB5 A;  3E7L A;  4CCO A;  1K61 A;  1R23 A;  2HQN A;  4HAM A;  4LK1 F;  3TBI A;  4F8D A;  2DQL A;  2VOD A;  4G7O F;  4EQZ A;  4G6Q A;  1SVO A;  3ASO H;  1IRX A;  2KIQ A;  2G9W A;  2ISY A;  4NDW A;  2HNH A;  1T56 A;  2M87 A;  3QYB A;  4OIP F;  5LGU A;  3GX4 X;  1X1B A;  2JZY A;  4GYG A;  4ZDL A;  2PN6 A;  3DWL E;  4O3M A;  2DBB A;  2LC2 A;  4DIQ A;  1BR4 A;  2DA5 A;  2LCV A;  1WJB A;  3WU0 A;  2BHY A;  3ONQ A;  1D1B A;  3VEP A;  2BY0 A;  3J80 Z;  2KFD A;  4DYR A;  2CMP A;  3CJQ B;  3FYM A;  5D5W B;  1RIO A;  3Q9V A;  3KZI C;  4RS8 A;  4E7I A;  1JFS A;  3W2A A;  3F21 A;  3A2K A;  3RZD J;  2WA0 A;  4KJZ A;  2STT A;  1LEA A;  4BEH B;  3KET A;  2XAU A;  3FKJ A;  1GXP A;  2WC2 A;  3DKW A;  5J1U A;  2JQE A;  1QP7 A;  1OIS A;  1SD6 A;  2X85 A;  1W36 C; 
#chains in the Genus database with same CATH homology
 1RES A;  3QPL A;  1B8I B;  4GQM A;  2HXI A;  2VI6 A;  2DA7 A;  3MVP A;  2K9Q A;  1R9T J;  3S1M J;  4CYC A;  2R93 J;  3U3W A;  4PU8 A;  4M3E A;  2X9D A;  2EZI A;  3TW7 A;  1ZVV A;  2G0E A;  2YUS A;  4C2M J;  1ZGW A;  4IA8 A;  3CMY A;  1QQB A;  4GFB A;  3CEC A;  1UMQ A;  1Y1W J;  2WV1 A;  3HEF A;  3LIS A;  3PM1 A;  4MFD A;  4I6U A;  3MLF A;  3C2B A;  1O4X A;  1YRN B;  4IHX A;  3F6W A;  4IVZ A;  1ZZ9 A;  2LR8 A;  3LSJ A;  1RR7 A;  1QVT A;  1PUF A;  1NK3 P;  1WET A;  4JCX A;  1ZK8 A;  3DCF A;  3GTL J;  4X1E A;  3GBG A;  3JRI A;  3HOW J;  4I8T A;  2IVQ A;  2LYP A;  4IEJ A;  4X4H A;  2VKE A;  1JUS A;  1ZZ6 A;  2AXU A;  3PO3 J;  4FTH A;  5JLW A;  4A3D J;  1ETW A;  4XIC A;  2FJR A;  1GDT A;  1ZZ8 A;  3S1N J;  4J1W A;  3VK0 A;  2AHQ A;  1ETY A;  2DMU A;  4A3L J;  2FQ4 A;  1UG2 A;  3JRF A;  1UTX A;  2M9H A;  5EF6 A;  3BQY A;  2AWI A;  5F0F A;  2VUM J;  1U78 A;  2DA3 A;  1ZTR A;  1ETQ A;  2A6C A;  2XSD C;  2CQX A;  2E1O A;  1LCC A;  2ID6 A;  1GVD A;  4C3I J;  1Y7Y A;  2EBY A;  3RZZ A;  4M3G A;  2JVL A;  2XB5 A;  2DA6 A;  2K40 A;  5HOD A;  3TW6 A;  4BKX A;  2E2J J;  5C44 J;  1MSE C;  2LYL A;  1NTC A;  2HYJ A;  5E3L A;  1JFT A;  4Z59 A;  5C3E J;  4S0H B;  4EEF G;  3LSR A;  2DA2 A;  4BBR J;  5GP9 A;  2PUD A;  2IVB A;  3CRO L;  3B6A A;  3OQN A;  3FIW A;  3OQM A;  2KEK A;  3FYA A;  4W97 A;  4PU7 A;  1ETV A;  4A69 C;  3K7A J;  1NER A;  2E19 A;  1VF9 A;  3TED A;  4QTR A;  3JRE A;  4IHY A;  1CQT A;  3VPR A;  1U9N A;  3HOZ J;  5EGO A;  1PRV A;  3JRC A;  2DA1 A;  3Q0V A;  5EG0 A;  2HQ5 A;  2ZB9 A;  4A3K J;  2CRO A;  3FMY A;  1BJZ A;  3G5G A;  1HDP A;  5FLM J;  2E2H J;  2AW6 A;  2HIN A;  1UXD A;  4A3F J;  3SFI A;  2JK3 A;  3BTJ A;  2OPT A;  3CQZ J;  3O8G A;  1JJ6 C;  1JTY A;  3HBL A;  3ZHI A;  3BG3 A;  4Y7N J;  3BG5 A;  1ETK A;  2Y30 A;  4X4F A;  3GN5 A;  3QF3 A;  1HOM A;  3BTL A;  5E3M A;  2NOG A;  1L1M A;  1ZZB A;  2M0C A;  2RAE A;  4YG7 B;  2ECB A;  5EGO B;  3IVP A;  4UUS A;  2LYK A;  1Q1V A;  3WHB A;  2HSG A;  2L8N A;  1GT0 C;  4A93 J;  5IYD J;  3B7H A;  2R63 A;  2EZL A;  3F52 A;  2KT0 A;  5IP6 A;  1WI3 A;  1VND A;  3RQI A;  2PUG A;  1TWG J;  1LMB 3;  1JGG A;  2DMP A;  1H89 C;  1MBH A;  5K7Z A;  4X4B A;  3A01 B;  4Y52 J;  1ZQ3 P;  5C4J J;  3FKI J;  3R1F A;  1QPZ A;  2B63 J;  1LFB A;  2H8R A;  4M3B A;  2NVQ J;  5J3L A;  2YU9 J;  3S17 J;  4NDL A;  1ETX A;  2M34 A;  4AYB N;  3KJX A;  3O8H A;  2LKX A;  5M5W J;  2GM4 A;  3HOV J;  3S2H J;  4QIW N;  2XGE A;  1DW9 A;  1JT6 A;  1B8I A;  2LYR A;  1TWH J;  2WUS R;  1GV2 A;  4FIS A;  1W0T A;  1CJG A;  2JN6 A;  4MCX A;  4YAR A;  2FX0 A;  5GPC A;  5K7H A;  4FE7 A;  5F0H A;  3JRA A;  1WGX A;  1ZUG A;  3IH2 A;  2LY9 A;  1Z0X A;  5GPA A;  3G1L A;  2XCJ A;  2CJJ A;  2MW8 A;  5F0C A;  3BD1 A;  3QPS A;  1XS9 A;  3G1O A;  1TWF J;  2XPV A;  2Y2Z A;  3FK6 A;  3UFD A;  2BJC A;  2L7M P;  3GN5 B;  1MBK A;  2EWT A;  2LTP A;  3EUS A;  1IDY A;  1F43 A;  3KZ3 A;  1LFU P;  2NVX J;  2O49 A;  1ADR A;  2EF8 A;  4X6A J;  3S14 J;  3JRD A;  1OCT C;  1RZR A;  2M8G X;  1JT0 A;  3HZI B;  2X6O A;  4A3J J;  1LE8 B;  1R69 A;  1UHS A;  3G1M A;  1X2N A;  2IAI A;  4D5C A;  3LSG A;  2VKV A;  5FKO A;  5K7F A;  2OF7 A;  2JA5 J;  3M4O J;  3GBF A;  3ZQF A;  2DMT A;  3BTC A;  1RZS A;  3OP9 A;  1ZAY A;  2LK2 A;  3ZQG A;  1U8B A;  1A5J A;  1BA5 A;  1K83 J;  2EQR A;  2FD5 A;  2R5Y B;  1HLV A;  1TC3 C;  4PU4 C;  2NS8 A;  4RDU A;  2PIJ A;  1XWR A;  3SCH A;  1R63 A;  3GTG J;  2PMZ N;  1JH9 A;  5FJ8 J;  5EZH A;  2LP0 A;  2B5A A;  3TP3 A;  3S16 J;  3S15 J;  2XRL A;  2H1K A;  4A3G J;  3JRB A;  2MG4 A;  5IYB J;  1ENH A;  3MN2 A;  2L49 A;  4JX6 A;  4L5E A;  2ME6 A;  4B4C A;  1ITY A;  2Y0S N;  2PUA A;  1RPW A;  1I50 J;  1RZR D;  4IWR A;  2JJ7 A;  2R7Z J;  3IV5 A;  3PXP A;  4A3I J;  3BTI A;  3CDL A;  4XID A;  2HXO A;  3DNV B;  1X2M A;  2MEZ A;  4MIM A;  1AU7 A;  4O8B A;  2IVG A;  2E2I J;  2R5Z A;  4DYQ A;  3HB9 A;  1OSL A;  1ZS4 A;  1IV6 A;  3SDG A;  4A3C J;  1PRU A;  4X4E A;  5FKM A;  4I76 A;  3H0G J;  2PPX A;  4V2G A;  2L7F P;  4I6Z A;  4X4I A;  1RPE L;  4YG1 A;  2JA8 J;  1APL C;  5E3O A;  3QQA A;  4G12 A;  2ICP A;  2R5Z B;  1HF0 A;  5M5Y J;  4J1X A;  2W48 A;  5FKL A;  4GHJ A;  4V2F A;  3GTJ J;  2JA6 J;  3BG9 A;  2O38 A;  5FKN A;  1ZR2 A;  2DA4 A;  5FLV A;  2HI3 A;  3LNQ A;  3OSG A;  4M3D A;  1PNR A;  2R1J L;  2AO9 A;  3ZKC A;  3SCG A;  1ZKG A;  1WH7 A;  3GTK J;  1QQA A;  1JUP A;  5A7L A;  1QPI A;  1F36 A;  4ABZ A;  3GTM J;  3JXD L;  4MLO A;  3BT9 A;  3GTQ J;  2PUC A;  1JTX A;  1OCP A;  1IG7 A;  3O9X A;  2CUE A;  3ZQL A;  1VPW A;  4I6R A;  1LE8 A;  3A02 A;  4B3A A;  3HOX J;  1BDH A;  3ZOB A;  1I3Q J;  4JX5 A;  2R5Y A;  2COB A;  3OQO A;  1T33 A;  1B0N A;  3S1Q J;  2CUF A;  2O9L A;  2JWT A;  1XG1 A;  2X48 A;  2JCG A;  1WPK A;  2EZK A;  2MSY A;  2ECC A;  5IP7 J;  1Y1V J;  2DN0 A;  3HDD A;  1NK2 P;  2GBY A;  5E3N A;  4JYK A;  2KDZ A;  2GRM A;  1H8A C;  4DW6 A;  1X57 A;  1RKW A;  3ZQH A;  3GTO J;  2PUF A;  1B72 B;  1LQC A;  3Q0W A;  1WH8 A;  2AXV A;  2BNN A;  2XI8 A;  2MQK A;  4X4C A;  3S1R J;  2KEI A;  2WB1 N;  2NVT J;  3B6C A;  4BY1 J;  1XC5 A;  3OOU A;  1TWC J;  2KEJ A;  1WIZ A;  3S8Q A;  1LLI A;  2AUW A;  2ID3 A;  4X4G A;  1TWA J;  3GTP J;  2WAQ N;  4C3J J;  5BNG A;  1EFA A;  1ZR4 A;  3RZO J;  3QQ6 A;  3SCF A;  4D7N A;  1ETO A;  3TRB A;  5IOY A;  1H88 C;  2PUB A;  2QCO A;  5EEA A;  4AUX A;  4BXX J;  4IHV A;  2EZH A;  4PU3 C;  1Z77 A;  4AC0 A;  3IH3 A;  2R0Q C;  1SFO J;  1WH5 A;  1LCD A;  2CRG A;  3A01 A;  5IYC J;  5FKK A;  2Y31 A;  1MNM C;  4B1R A;  2L7Z A;  2BNM A;  1OFC X;  5DS9 A;  2LLK A;  4JP0 A;  2FJ1 A;  1I6H J;  3HGG A;  4W1U A;  3NAU A;  4DZJ A;  5EZG A;  5EDN A;  2L9R A;  2R92 J;  1JUM A;  1X58 A;  2LYS A;  2WIU B;  4I6T A;  1SAN A;  2HOT A;  3FK7 A;  4YBA A;  3TP0 A;  1AKH B;  1VI0 A;  1D5Y A;  1HDD C;  1IJW C;  3H5T A;  2ELK A;  5DTD A;  3F0C A;  4X4D A;  2K9N A;  9ANT A;  3HOU J;  2IU7 A;  3JR9 A;  4UUS B;  1MBF A;  3L1P A;  3BR5 A;  3G7D A;  2IBD A;  2GZU A;  1OJL A;  2XGD A;  2IV1 A;  3JXB C;  1IUF A;  1QP0 A;  4JQD A;  4IHW A;  3MKL A;  1X2L A;  5M5X J;  3JRG A;  3K2A A;  3RKQ A;  3BR1 A;  2AXZ A;  2CU7 A;  1FEX A;  3JXC L;  3OIO A;  2MGQ A;  1MBE A;  3BR0 A;  3NAR A;  3A03 A;  4XRS G;  1W0U A;  2TRT A;  2HOS A;  3BQZ A;  4MO7 A;  1FJL A;  4A3E J;  2EH3 A;  2ME0 A;  2HOA A;  4DZP A;  2CSF A;  1ORK A;  1FTZ A;  4A3M J;  2LVS A;  3BR6 A;  1SQ8 A;  2CQQ A;  5JLX A;  2OFY A;  1IGN A;  5EG0 B;  3OSF A;  1IDZ A;  2XIU A;  3QYX A;  3CLC A;  3ZQC A;  1POU A;  5IOZ A;  1WCM J;  4C3H J;  2DMQ A;  1ZZC A;  2BNO A;  3HOY J;  1BW5 A;  2JA7 J;  4J19 A;  2XGC A;  3CCY A;  1A6I A;  1MH4 A;  3LOC A;  4OB4 A;  1YSE A;  1EF4 A;  5K98 B;  1GV5 A;  3UKG A;  4XK4 A;  1DU6 A;  3F51 A;  4FBI A;  4Z5D A;  1HCR A;  3BDN A;  2QF7 A;  2DMN A;  1PUF B;  1DU0 A;  3I4N J;  1MH3 A;  5F04 A;  2LD5 A;  1AHD P;  4BBS J;  5J1Y A;  1WH6 A;  5J1R A;  2XJ3 A;  3DEW A;  4D5F A;  2KPJ A;  1QP4 A;  2OR1 L;  1JKQ C;  2L0K A;  2Y9Y A;  4QSH A;  1QRY A;  4MCT A;  1Y9Q A;  1JKR C;  4M3F A;  3SJM A;  2NS7 A;  2PE5 A;  3BR3 A;  2O8K A;  1AKH A;  1IRZ A;  2LFB A;  2LYQ A;  5M3F J;  1MBG A;  1G2H A;  3W6V A;  1NEQ A;  1QVU A;  2DJN A;  1DWK A;  4FCY A;  3HM5 A;  2DTZ A;  2ICT A;  4UUT A;  3WHC A;  1JWL A;  1VFC A;  1PER L;  3D1N I;  4Y42 A;  2XPW A;  2IUO A;  1FIA A;  2LYJ A;  3H3V K;  4Z58 A;  5IP9 J;  4DYC A;  3Q3S A;  1U9O A;  1YRN A;  2M2E A;  2Y9Z A;  4Z5C A;  2YS9 A;  2XPU A;  4A3B J;  1MSF C;  1FIP A;  2EBI A;  4YG4 A;  5IPA A;  4MFE A;  4HNV A;  3HGY A;  1MBJ A;  3HKZ N;  3I4M J;  1JKO C;  4LOC A;  1E3O C;  3KXA A;  5F08 A;  4XRS A;  2O7O A;  1BW6 A;  3M3Y J;  1P7J A;  1RET A;  1S7E A;  3ZHM A;  2I10 A;  5F1J A;  2N8G A;  3FIS A;  4CYC B;  2NVY J;  4RBO A;  4JCY A;  3BR2 A;  3BS3 A;  2O4A A;  1K61 A;  3E7L A;  2IEK A;  2VPR A;  5EYR A;  5M3M J;  2D5V A;  1ZPQ A;  4F8D A;  1JJ8 C;  4NDW A;  4M6V A;  1T56 A;  3LSP A;  1JKP C;  1PRA A;  3ZQI A;  4D7M A;  1POG A;  3QWG A;  4JX4 A;  1BDI A;  1BL0 A;  3IH4 A;  2DA5 A;  3LFP A;  1UXC A;  2LCV A;  1GUU A;  2PUE A;  3PO2 J;  3Q0U A;  2XB0 X;  2TCT A;  4FN3 A;  4DYR A;  5F27 A;  3FYM A;  2P81 A;  1RIO A;  3JRH A;  1B72 A;  1ZZ7 A;  1JFS A;  4BY7 J;  3OMT A;  1RKT A;  4Z5H A;  3RZD J;  4XRM A;  2HDD A;  2JMW A;  2K9S A;  3S2D J;  2GRL A;  1IC8 A;  5C4X J;  2KZ8 A;  2GLO A;  4FE4 A;  5J1U A;  1QP7 A;  1P7I A;  1FTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...