1RPEL

The phage 434 or2/r1-69 complex at 2.5 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
63
structure length
63
Chain Sequence
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The phage 434 OR2/R1-69 complex at 2.5 A resolution.
pubmed doi rcsb
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*TP*AP*TP*AP*CP*AP*AP*TP*GP*TP*AP*TP*CP*TP*TP*GP*T
total genus 22
structure length 63
sequence length 63
chains with identical sequence R
ec nomenclature
pdb deposition date 1993-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1rpeL00
3F6WA 3G7DA 2L49A 3SCFA 3FMYA 2LCVA 4X4EA 3U3WA 2EWTA 3QF3A 2D5VA 1PRUA 2IVQA 1UXCA 1ZZCA 2CSFA 4IVZA 1LQCA 2FJRA 2XIUA 4MCXA 1RIOA 4X4FA 3ZHIA 4I6UA 4GQMA 2MEZA 1LCDA 2KEJA 4I6TA 1LMB3 3F51A 1QQBA 4Z5HA 2KEIA 4NDWA 2LYJA 2ICTA 3KZ3A 3OP9A 2LYRA 3QQ6A 4Y42A 4X4DA 1QP4A 2PUFA 3JXCL 1R63A 1L1MA 1LCCA 3L1PA 2EBYA 2LYQA 1ZAYA 1JH9A 2XJ3A 3KJXA 4Z5DA 2BNNA 4FN3A 4YG7B 2O38A 4Z58A 3BS3A 3F52A 3HZIB 1ZUGA 4YG4A 2OR1L 4X4HA 1OSLA 2IVBA 2KEKA 2PUBA 3JXDL 1ZZ8A 1JFSA 2JCGA 1PRVA 1QP0A 1GT0C 4I6RA 2IU7A 4JCXA 2JVLA 1Y7YA 3S8QA 2AXVA 3R1FA 3BDNA 3CROL 1AU7A 1XWRA 1QPZA 2LYSA 1WIZA 3BD1A 4PU8A 2IUOA 1WH8A 4X4GA 1O4XA 2PUCA 2H8RA 1PNRA 2IV1A 3OQNA 3GBFA 2A6CA 1CJGA 1X57A 2R1JL 3GN5A 3PXPA 2MQKA 3QYXA 5K98B 1S7EA 2GZUA 1ZZ6A 2PUEA 1JFTA 4PU7A 5A7LA 2PUGA 2BNOA 2BJCA 1LLIA 1E3OC 2LYLA 2B5AA 3ZKCA 3D1NI 4YG1A 2XSDC 1NERA 2LYKA 3KXAA 2AXZA 2PIJA 1ZPQA 2IVGA 3IVPA 2PPXA 2HSGA 4X4BA 1B0NA 1SQ8A 2PUDA 2O4AA 4J1WA 4YBAA 2ICPA 1WETA 3FYAA 3OMTA 3RZZA 1RPEL 1ZVVA 1UTXA 2GRLA 2R63A 2BNMA 1ZZBA 1RZRD 1BDHA 1ZZ9A 3ZHMA 2AUWA 4PU4C 4I8TA 4YARA 1JWLA 4Z5CA 2O49A 2AXUA 3FYMA 1WH6A 4O8BA 1RZRA 1UXDA 3VK0A 1QQAA 1DWKA 3SCGA 1HF0A 3SCHA 3JXBC 3LFPA 1DW9A 3EUSA 2PE5A 3CLCA 2CROA 3DNVB 1OCTC 3UFDA 1NEQA 4GHJA 2OFYA 1YSEA 2HINA 2AWIA 4PU3C 1ZZ7A 4Z59A 2WUSR 3B7HA 1ADRA 3CECA 3GN5B 3TRBA 4JQDA 1Y9QA 1PERL 2GRMA 2KZ8A 4IA8A 4OB4A 1IC8A 4IWRA 1BDIA 3OQOA 2WIUB 4J1XA 1VPWA 4JCYA 3O9XA 1EFAA 4X4IA 1QP7A 3H5TA 4X4CA 3G5GA 2AW6A 2XI8A 1PRAA 1R69A 2PUAA 2L8NA 1X2LA 2KPJA 2EF8A 2LYPA 4FBIA 3OQMA 4F8DA 2XCJA 1RZSA 1CQTA 1POUA 3MLFA 3QWGA 3LISA 4MCTA 1ZS4A
chains in the Genus database with same CATH superfamily
1NW3A 3QOWA 3U3WA 1UXCA 1ZZCA 2XXAA 5DTQA 2MEZA 4ER7A 1QQBA 4NDWA 3OP9A 2LYRA 4Y42A 1R63A 3L1PA 2EBYA 2LNMA 1ZAYA 3KJXA 4Z58A 3BS3A 3HZIB 4YG4A 2PUBA 4I6RA 4JCXA 3R1FA 3CROL 2MXDA 3OKZA 2IUOA 4X4GA 2H8RA 3OQNA 1X57A 5GAGi 2HFZA 2GZUA 1ZZ6A 1JFTA 1LLIA 1E3OC 2ODRD 3D1NI 1NERA 2IVGA 3UWPA 2HSGA 1B0NA 2O4AA 4J1WA 3FYAA 3OMTA 3GZCA 4PU4C 4Z5CA 2O49A 3FYMA 1QQAA 1HF0A 3SCHA 3CLCA 2PXQA 1NEQA 2HINA 3A9XA 4ER0A 2GRMA 4IWRA 4OB4A 3VWSA 5DTMA 2WIUB 3QFIA 1QP7A 2XI8A 3LQXA 2L8NA 1X2LA 2KPJA 4FBIA 3MEJA 2XCJA 1RZSA 1CQTA 1QB2A 3G7DA 2L49A 3FMYA 3QOXA 2EWTA 2D5VA 4MCXA 3PE5A 3ZHIA 4I6UA 1LCDA 1LMB3 3F51A 2LYJA 2ICTA 3KZ3A 1QP4A 1LCCA 2PXPA 3F52A 4X4HA 3NDBB 2IVBA 3JXDL 2JCGA 1QP0A 4WVLA 2J7UA 4DE8A 2AXVA 1QPZA 2LYSA 3ZPXA 1QZXA 1O4XA 2PUCA 3TFLA 2R1JL 3PXPA 3QYXA 2PUEA 1S7EA 5A7LA 2PUGA 2LLWA 2LLVA 2LYLA 2XSDC 2LYKA 3GZDC 2AXZA 1ZPQA 2PUDA 3RZZA 2GRLA 3G0TA 3SX0A 4OBMA 1RZRA 1UXDA 1DWKA 3SCGA 3JXBC 3ME5A 3EUSA 3UFDA 2OFYA 4PU3C 1ZZ7A 1ADRA 3GN5B 4JQDA 1IC8A 4JCYA 1EFAA 3H5TA 4X4CA 2AW6A 1PRAA 1R69A 4HRAA 2PXEA 2EF8A 3OQMA 1MFQC 4F8DA 3SR4A 1POUA 3LISA 4MCTA 2PXVA 1ZS4A 3F6WA 3SCFA 4EQZA 1HQ1A 4X4EA 1DULA 5DRTA 1LQCA 2FJRA 2XIUA 4X4FA 4GQMA 2KEJA 4I6TA 2KEIA 3QQ6A 2PUFA 1L1MA 4EZIA 3NROA 2LYQA 1JH9A 2XJ3A 4ER5A 4Z5DA 2BNNA 4FN3A 2PXDA 2O38A 1OSLA 1ZZ8A 3OWQA 1GT0C 2IU7A 5DTRA 3GUUA 1XWRA 5GAHi 3BD1A 4PU8A 1WH8A 3R09A 2A6CA 3A9YA 3NZLA 5DSXA 3A9ZA 2HCNA 2BNOA 2BJCA 2B5AA 3GZDA 4ER6A 2PXFA 5DRYA 3IVPA 4X4BA 1SQ8A 3TELA 4YBAA 1RPEL 1ZVVA 1ZZBA 1BDHA 4I8TA 1JWLA 1WH6A 4O8BA 2J7WA 3TEPA 3LFPA 1DW9A 2CROA 3DNVB 2HCSA 4GHJA 1YSEA 2AWIA 5JUWA 3M9LA 4Z59A 3B7HA 2KZ8A 4IA8A 3OQOA 4J1XA 3O9XA 4X4IA 2PXLA 2LYPA 4EK9A 3MLFA 3NXHA 2LCVA 3QF3A 5DT2A 1PRUA 2YBDA 2IVQA 2CSFA 4IVZA 1RIOA 4ER3A 4Z5HA 4X4DA 2PXTA 3JXCL 2M4HA 4YG7B 1U2ZA 2OR1L 1ZUGA 4DE9A 2KEKA 1JFSA 1PRVA 2JVLA 1Y7YA 3S8QA 3BDNA 2VEOA 1AU7A 1WIZA 1PNRA 2IV1A 2PXKA 3GBFA 1CJGA 3GN5A 2MQKA 5K98B 2XXQA 4PU7A 2PXBA 3ZKCA 4YG1A 3KXAA 2PIJA 2PXUA 2PPXA 2FFHA 4EKIA 1WETA 2ICPA 1UTXA 2R63A 2BNMA 3KL4A 1RZRD 1ZZ9A 3ZHMA 2AUWA 4YARA 2AXUA 2V3CC 3DM5A 3VK0A 2PE5A 1OCTC 2WUSR 2JQEA 3CECA 3TRBA 1Y9QA 1PERL 2XXPA 1BDIA 2L1PA 1VPWA 3G5GA 2PUAA 4Q2JA 3QWGA 4EKGA
chains in the Genus database with same CATH topology
3F6WA 3G7DA 2L49A 3SCFA 3FMYA 2LCVA 4X4EA 3U3WA 2EWTA 3QF3A 2D5VA 1PRUA 2IVQA 1UXCA 1ZZCA 2CSFA 4IVZA 1LQCA 2FJRA 2XIUA 4MCXA 1RIOA 4X4FA 3ZHIA 4I6UA 4GQMA 2MEZA 1LCDA 2KEJA 4I6TA 1LMB3 3F51A 1QQBA 4Z5HA 2KEIA 4NDWA 2LYJA 2ICTA 3KZ3A 3OP9A 2LYRA 3QQ6A 4Y42A 4X4DA 1QP4A 2PUFA 3JXCL 1R63A 1L1MA 1LCCA 3L1PA 2EBYA 2LYQA 1ZAYA 1JH9A 2XJ3A 3KJXA 4Z5DA 2BNNA 4FN3A 4YG7B 2O38A 4Z58A 3BS3A 3F52A 3HZIB 1ZUGA 4YG4A 2OR1L 4X4HA 1OSLA 2IVBA 2KEKA 2PUBA 3JXDL 1ZZ8A 1JFSA 2JCGA 1PRVA 1QP0A 1GT0C 4I6RA 2IU7A 4JCXA 2JVLA 1Y7YA 3S8QA 2AXVA 3R1FA 3BDNA 3CROL 1AU7A 1XWRA 1QPZA 2LYSA 1WIZA 3BD1A 4PU8A 2IUOA 1WH8A 4X4GA 1O4XA 2PUCA 2H8RA 1PNRA 2IV1A 3OQNA 3GBFA 2A6CA 1CJGA 1X57A 2R1JL 3GN5A 3PXPA 2MQKA 3QYXA 5K98B 1S7EA 2GZUA 1ZZ6A 2PUEA 1JFTA 4PU7A 5A7LA 2PUGA 2BNOA 2BJCA 1LLIA 1E3OC 2LYLA 2B5AA 3ZKCA 3D1NI 4YG1A 2XSDC 1NERA 2LYKA 3KXAA 2AXZA 2PIJA 1ZPQA 2IVGA 3IVPA 2PPXA 2HSGA 4X4BA 1B0NA 1SQ8A 2PUDA 2O4AA 4J1WA 4YBAA 2ICPA 1WETA 3FYAA 3OMTA 3RZZA 1RPEL 1ZVVA 1UTXA 2GRLA 2R63A 2BNMA 1ZZBA 1RZRD 1BDHA 1ZZ9A 3ZHMA 2AUWA 4PU4C 4I8TA 4YARA 1JWLA 4Z5CA 2O49A 2AXUA 3FYMA 1WH6A 4O8BA 1RZRA 1UXDA 3VK0A 1QQAA 1DWKA 3SCGA 1HF0A 3SCHA 3JXBC 3LFPA 1DW9A 3EUSA 2PE5A 3CLCA 2CROA 3DNVB 1OCTC 3UFDA 1NEQA 4GHJA 2OFYA 1YSEA 2HINA 2AWIA 4PU3C 1ZZ7A 4Z59A 2WUSR 3B7HA 1ADRA 3CECA 3GN5B 3TRBA 4JQDA 1Y9QA 1PERL 2GRMA 2KZ8A 4IA8A 4OB4A 1IC8A 4IWRA 1BDIA 3OQOA 2WIUB 4J1XA 1VPWA 4JCYA 3O9XA 1EFAA 4X4IA 1QP7A 3H5TA 4X4CA 3G5GA 2AW6A 2XI8A 1PRAA 1R69A 2PUAA 2L8NA 1X2LA 2KPJA 2EF8A 2LYPA 4FBIA 3OQMA 4F8DA 2XCJA 1RZSA 1CQTA 1POUA 3MLFA 3QWGA 3LISA 4MCTA 1ZS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6W A;  3G7D A;  2L49 A;  3SCF A;  3FMY A;  2LCV A;  4X4E A;  3U3W A;  2EWT A;  3QF3 A;  2D5V A;  1PRU A;  2IVQ A;  1UXC A;  1ZZC A;  2CSF A;  4IVZ A;  1LQC A;  2FJR A;  2XIU A;  4MCX A;  1RIO A;  4X4F A;  3ZHI A;  4I6U A;  4GQM A;  2MEZ A;  1LCD A;  2KEJ A;  4I6T A;  1LMB 3;  3F51 A;  1QQB A;  4Z5H A;  2KEI A;  4NDW A;  2LYJ A;  2ICT A;  3KZ3 A;  3OP9 A;  2LYR A;  3QQ6 A;  4Y42 A;  4X4D A;  1QP4 A;  2PUF A;  3JXC L;  1R63 A;  1L1M A;  1LCC A;  3L1P A;  2EBY A;  2LYQ A;  1ZAY A;  1JH9 A;  2XJ3 A;  3KJX A;  4Z5D A;  2BNN A;  4FN3 A;  4YG7 B;  2O38 A;  4Z58 A;  3BS3 A;  3F52 A;  3HZI B;  1ZUG A;  4YG4 A;  2OR1 L;  4X4H A;  1OSL A;  2IVB A;  2KEK A;  2PUB A;  3JXD L;  1ZZ8 A;  1JFS A;  2JCG A;  1PRV A;  1QP0 A;  1GT0 C;  4I6R A;  2IU7 A;  4JCX A;  2JVL A;  1Y7Y A;  3S8Q A;  2AXV A;  3R1F A;  3BDN A;  3CRO L;  1AU7 A;  1XWR A;  1QPZ A;  2LYS A;  1WIZ A;  3BD1 A;  4PU8 A;  2IUO A;  1WH8 A;  4X4G A;  1O4X A;  2PUC A;  2H8R A;  1PNR A;  2IV1 A;  3OQN A;  3GBF A;  2A6C A;  1CJG A;  1X57 A;  2R1J L;  3GN5 A;  3PXP A;  2MQK A;  3QYX A;  5K98 B;  1S7E A;  2GZU A;  1ZZ6 A;  2PUE A;  1JFT A;  4PU7 A;  5A7L A;  2PUG A;  2BNO A;  2BJC A;  1LLI A;  1E3O C;  2LYL A;  2B5A A;  3ZKC A;  3D1N I;  4YG1 A;  2XSD C;  1NER A;  2LYK A;  3KXA A;  2AXZ A;  2PIJ A;  1ZPQ A;  2IVG A;  3IVP A;  2PPX A;  2HSG A;  4X4B A;  1B0N A;  1SQ8 A;  2PUD A;  2O4A A;  4J1W A;  4YBA A;  2ICP A;  1WET A;  3FYA A;  3OMT A;  3RZZ A;  1RPE L;  1ZVV A;  1UTX A;  2GRL A;  2R63 A;  2BNM A;  1ZZB A;  1RZR D;  1BDH A;  1ZZ9 A;  3ZHM A;  2AUW A;  4PU4 C;  4I8T A;  4YAR A;  1JWL A;  4Z5C A;  2O49 A;  2AXU A;  3FYM A;  1WH6 A;  4O8B A;  1RZR A;  1UXD A;  3VK0 A;  1QQA A;  1DWK A;  3SCG A;  1HF0 A;  3SCH A;  3JXB C;  3LFP A;  1DW9 A;  3EUS A;  2PE5 A;  3CLC A;  2CRO A;  3DNV B;  1OCT C;  3UFD A;  1NEQ A;  4GHJ A;  2OFY A;  1YSE A;  2HIN A;  2AWI A;  4PU3 C;  1ZZ7 A;  4Z59 A;  2WUS R;  3B7H A;  1ADR A;  3CEC A;  3GN5 B;  3TRB A;  4JQD A;  1Y9Q A;  1PER L;  2GRM A;  2KZ8 A;  4IA8 A;  4OB4 A;  1IC8 A;  4IWR A;  1BDI A;  3OQO A;  2WIU B;  4J1X A;  1VPW A;  4JCY A;  3O9X A;  1EFA A;  4X4I A;  1QP7 A;  3H5T A;  4X4C A;  3G5G A;  2AW6 A;  2XI8 A;  1PRA A;  1R69 A;  2PUA A;  2L8N A;  1X2L A;  2KPJ A;  2EF8 A;  2LYP A;  4FBI A;  3OQM A;  4F8D A;  2XCJ A;  1RZS A;  1CQT A;  1POU A;  3MLF A;  3QWG A;  3LIS A;  4MCT A;  1ZS4 A; 
#chains in the Genus database with same CATH topology
 1NW3 A;  3QOW A;  3U3W A;  1UXC A;  1ZZC A;  2XXA A;  5DTQ A;  2MEZ A;  4ER7 A;  1QQB A;  4NDW A;  3OP9 A;  2LYR A;  4Y42 A;  1R63 A;  3L1P A;  2EBY A;  2LNM A;  1ZAY A;  3KJX A;  4Z58 A;  3BS3 A;  3HZI B;  4YG4 A;  2PUB A;  4I6R A;  4JCX A;  3R1F A;  3CRO L;  2MXD A;  3OKZ A;  2IUO A;  4X4G A;  2H8R A;  3OQN A;  1X57 A;  5GAG i;  2HFZ A;  2GZU A;  1ZZ6 A;  1JFT A;  1LLI A;  1E3O C;  2ODR D;  3D1N I;  1NER A;  2IVG A;  3UWP A;  2HSG A;  1B0N A;  2O4A A;  4J1W A;  3FYA A;  3OMT A;  3GZC A;  4PU4 C;  4Z5C A;  2O49 A;  3FYM A;  1QQA A;  1HF0 A;  3SCH A;  3CLC A;  2PXQ A;  1NEQ A;  2HIN A;  3A9X A;  4ER0 A;  2GRM A;  4IWR A;  4OB4 A;  3VWS A;  5DTM A;  2WIU B;  3QFI A;  1QP7 A;  2XI8 A;  3LQX A;  2L8N A;  1X2L A;  2KPJ A;  4FBI A;  3MEJ A;  2XCJ A;  1RZS A;  1CQT A;  1QB2 A;  3G7D A;  2L49 A;  3FMY A;  3QOX A;  2EWT A;  2D5V A;  4MCX A;  3PE5 A;  3ZHI A;  4I6U A;  1LCD A;  1LMB 3;  3F51 A;  2LYJ A;  2ICT A;  3KZ3 A;  1QP4 A;  1LCC A;  2PXP A;  3F52 A;  4X4H A;  3NDB B;  2IVB A;  3JXD L;  2JCG A;  1QP0 A;  4WVL A;  2J7U A;  4DE8 A;  2AXV A;  1QPZ A;  2LYS A;  3ZPX A;  1QZX A;  1O4X A;  2PUC A;  3TFL A;  2R1J L;  3PXP A;  3QYX A;  2PUE A;  1S7E A;  5A7L A;  2PUG A;  2LLW A;  2LLV A;  2LYL A;  2XSD C;  2LYK A;  3GZD C;  2AXZ A;  1ZPQ A;  2PUD A;  3RZZ A;  2GRL A;  3G0T A;  3SX0 A;  4OBM A;  1RZR A;  1UXD A;  1DWK A;  3SCG A;  3JXB C;  3ME5 A;  3EUS A;  3UFD A;  2OFY A;  4PU3 C;  1ZZ7 A;  1ADR A;  3GN5 B;  4JQD A;  1IC8 A;  4JCY A;  1EFA A;  3H5T A;  4X4C A;  2AW6 A;  1PRA A;  1R69 A;  4HRA A;  2PXE A;  2EF8 A;  3OQM A;  1MFQ C;  4F8D A;  3SR4 A;  1POU A;  3LIS A;  4MCT A;  2PXV A;  1ZS4 A;  3F6W A;  3SCF A;  4EQZ A;  1HQ1 A;  4X4E A;  1DUL A;  5DRT A;  1LQC A;  2FJR A;  2XIU A;  4X4F A;  4GQM A;  2KEJ A;  4I6T A;  2KEI A;  3QQ6 A;  2PUF A;  1L1M A;  4EZI A;  3NRO A;  2LYQ A;  1JH9 A;  2XJ3 A;  4ER5 A;  4Z5D A;  2BNN A;  4FN3 A;  2PXD A;  2O38 A;  1OSL A;  1ZZ8 A;  3OWQ A;  1GT0 C;  2IU7 A;  5DTR A;  3GUU A;  1XWR A;  5GAH i;  3BD1 A;  4PU8 A;  1WH8 A;  3R09 A;  2A6C A;  3A9Y A;  3NZL A;  5DSX A;  3A9Z A;  2HCN A;  2BNO A;  2BJC A;  2B5A A;  3GZD A;  4ER6 A;  2PXF A;  5DRY A;  3IVP A;  4X4B A;  1SQ8 A;  3TEL A;  4YBA A;  1RPE L;  1ZVV A;  1ZZB A;  1BDH A;  4I8T A;  1JWL A;  1WH6 A;  4O8B A;  2J7W A;  3TEP A;  3LFP A;  1DW9 A;  2CRO A;  3DNV B;  2HCS A;  4GHJ A;  1YSE A;  2AWI A;  5JUW A;  3M9L A;  4Z59 A;  3B7H A;  2KZ8 A;  4IA8 A;  3OQO A;  4J1X A;  3O9X A;  4X4I A;  2PXL A;  2LYP A;  4EK9 A;  3MLF A;  3NXH A;  2LCV A;  3QF3 A;  5DT2 A;  1PRU A;  2YBD A;  2IVQ A;  2CSF A;  4IVZ A;  1RIO A;  4ER3 A;  4Z5H A;  4X4D A;  2PXT A;  3JXC L;  2M4H A;  4YG7 B;  1U2Z A;  2OR1 L;  1ZUG A;  4DE9 A;  2KEK A;  1JFS A;  1PRV A;  2JVL A;  1Y7Y A;  3S8Q A;  3BDN A;  2VEO A;  1AU7 A;  1WIZ A;  1PNR A;  2IV1 A;  2PXK A;  3GBF A;  1CJG A;  3GN5 A;  2MQK A;  5K98 B;  2XXQ A;  4PU7 A;  2PXB A;  3ZKC A;  4YG1 A;  3KXA A;  2PIJ A;  2PXU A;  2PPX A;  2FFH A;  4EKI A;  1WET A;  2ICP A;  1UTX A;  2R63 A;  2BNM A;  3KL4 A;  1RZR D;  1ZZ9 A;  3ZHM A;  2AUW A;  4YAR A;  2AXU A;  2V3C C;  3DM5 A;  3VK0 A;  2PE5 A;  1OCT C;  2WUS R;  2JQE A;  3CEC A;  3TRB A;  1Y9Q A;  1PER L;  2XXP A;  1BDI A;  2L1P A;  1VPW A;  3G5G A;  2PUA A;  4Q2J A;  3QWG A;  4EKG A; 
#chains in the Genus database with same CATH homology
 3F6W A;  3G7D A;  2L49 A;  3SCF A;  3FMY A;  2LCV A;  4X4E A;  3U3W A;  2EWT A;  3QF3 A;  2D5V A;  1PRU A;  2IVQ A;  1UXC A;  1ZZC A;  2CSF A;  4IVZ A;  1LQC A;  2FJR A;  2XIU A;  4MCX A;  1RIO A;  4X4F A;  3ZHI A;  4I6U A;  4GQM A;  2MEZ A;  1LCD A;  2KEJ A;  4I6T A;  1LMB 3;  3F51 A;  1QQB A;  4Z5H A;  2KEI A;  4NDW A;  2LYJ A;  2ICT A;  3KZ3 A;  3OP9 A;  2LYR A;  3QQ6 A;  4Y42 A;  4X4D A;  1QP4 A;  2PUF A;  3JXC L;  1R63 A;  1L1M A;  1LCC A;  3L1P A;  2EBY A;  2LYQ A;  1ZAY A;  1JH9 A;  2XJ3 A;  3KJX A;  4Z5D A;  2BNN A;  4FN3 A;  4YG7 B;  2O38 A;  4Z58 A;  3BS3 A;  3F52 A;  3HZI B;  1ZUG A;  4YG4 A;  2OR1 L;  4X4H A;  1OSL A;  2IVB A;  2KEK A;  2PUB A;  3JXD L;  1ZZ8 A;  1JFS A;  2JCG A;  1PRV A;  1QP0 A;  1GT0 C;  4I6R A;  2IU7 A;  4JCX A;  2JVL A;  1Y7Y A;  3S8Q A;  2AXV A;  3R1F A;  3BDN A;  3CRO L;  1AU7 A;  1XWR A;  1QPZ A;  2LYS A;  1WIZ A;  3BD1 A;  4PU8 A;  2IUO A;  1WH8 A;  4X4G A;  1O4X A;  2PUC A;  2H8R A;  1PNR A;  2IV1 A;  3OQN A;  3GBF A;  2A6C A;  1CJG A;  1X57 A;  2R1J L;  3GN5 A;  3PXP A;  2MQK A;  3QYX A;  5K98 B;  1S7E A;  2GZU A;  1ZZ6 A;  2PUE A;  1JFT A;  4PU7 A;  5A7L A;  2PUG A;  2BNO A;  2BJC A;  1LLI A;  1E3O C;  2LYL A;  2B5A A;  3ZKC A;  3D1N I;  4YG1 A;  2XSD C;  1NER A;  2LYK A;  3KXA A;  2AXZ A;  2PIJ A;  1ZPQ A;  2IVG A;  3IVP A;  2PPX A;  2HSG A;  4X4B A;  1B0N A;  1SQ8 A;  2PUD A;  2O4A A;  4J1W A;  4YBA A;  2ICP A;  1WET A;  3FYA A;  3OMT A;  3RZZ A;  1RPE L;  1ZVV A;  1UTX A;  2GRL A;  2R63 A;  2BNM A;  1ZZB A;  1RZR D;  1BDH A;  1ZZ9 A;  3ZHM A;  2AUW A;  4PU4 C;  4I8T A;  4YAR A;  1JWL A;  4Z5C A;  2O49 A;  2AXU A;  3FYM A;  1WH6 A;  4O8B A;  1RZR A;  1UXD A;  3VK0 A;  1QQA A;  1DWK A;  3SCG A;  1HF0 A;  3SCH A;  3JXB C;  3LFP A;  1DW9 A;  3EUS A;  2PE5 A;  3CLC A;  2CRO A;  3DNV B;  1OCT C;  3UFD A;  1NEQ A;  4GHJ A;  2OFY A;  1YSE A;  2HIN A;  2AWI A;  4PU3 C;  1ZZ7 A;  4Z59 A;  2WUS R;  3B7H A;  1ADR A;  3CEC A;  3GN5 B;  3TRB A;  4JQD A;  1Y9Q A;  1PER L;  2GRM A;  2KZ8 A;  4IA8 A;  4OB4 A;  1IC8 A;  4IWR A;  1BDI A;  3OQO A;  2WIU B;  4J1X A;  1VPW A;  4JCY A;  3O9X A;  1EFA A;  4X4I A;  1QP7 A;  3H5T A;  4X4C A;  3G5G A;  2AW6 A;  2XI8 A;  1PRA A;  1R69 A;  2PUA A;  2L8N A;  1X2L A;  2KPJ A;  2EF8 A;  2LYP A;  4FBI A;  3OQM A;  4F8D A;  2XCJ A;  1RZS A;  1CQT A;  1POU A;  3MLF A;  3QWG A;  3LIS A;  4MCT A;  1ZS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...