1RPEL

The phage 434 or2/r1-69 complex at 2.5 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
63
structure length
63
Chain Sequence
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*TP*AP*TP*AP*CP*AP*AP*TP*GP*TP*AP*TP*CP*TP*TP*GP*T
publication title The phage 434 OR2/R1-69 complex at 2.5 A resolution.
pubmed doi rcsb
total genus 22
structure length 63
sequence length 63
chains with identical sequence R
ec nomenclature
pdb deposition date 1993-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1rpeL00
1NEQA 2O38A 2KPJA 1UTXA 3GN5B 2HSGA 2LYSA 3FYMA 1Y9QA 4X4IA 2OR1L 2L8NA 4Z5HA 1X2LA 2BNMA 2AXZA 4MCTA 4YBAA 1LLIA 3BS3A 1XWRA 1ZZCA 1WH6A 2IV1A 1IC8A 3GN5A 3KXAA 2GRLA 2GRMA 2LYPA 3QF3A 2IU7A 2AXUA 2H8RA 4X4FA 3CLCA 2KZ8A 3U3WA 2HINA 2KEJA 1NERA 4O8BA 3FMYA 1R69A 3ZKCA 3GBFA 2CSFA 2IVBA 3JXBC 1ZAYA 2XSDC 2AW6A 1L1MA 3OQOA 4I6RA 1PRUA 3FYAA 4IVZA 3QWGA 1ZZ7A 2KEIA 2LYLA 4X4HA 3HZIB 1JFTA 3F51A 1QP4A 4JQDA 1UXCA 2XI8A 2XJ3A 3RZZA 2D5VA 4YARA 3D1NI 1RZSA 2LYRA 4J1WA 3G5GA 3B7HA 3UFDA 1LCDA 2LCVA 1DW9A 3QYXA 1BDIA 2PUBA 2JCGA 3OMTA 2ICPA 1B0NA 2EBYA 4X4EA 3DNVB 1RZRA 1RIOA 1GT0C 3OQMA 1WETA 1AU7A 1ADRA 1WIZA 2L49A 4Y42A 2PUEA 3QQ6A 4PU4C 1YSEA 4PU7A 1PRAA 3O9XA 1X57A 3F52A 1QQBA 3F6WA 3MLFA 1DWKA 3R1FA 4J1XA 3L1PA 3ZHMA 4JCYA 3IVPA 3LISA 4Z58A 1POUA 2MEZA 2LYJA 1LCCA 3BDNA 1JWLA 2PPXA 2PUDA 2AXVA 1LMB3 4Z59A 1RPEL 4YG1A 1PRVA 2IVGA 1PERL 1OCTC 1R63A 2AWIA 2LYQA 2JVLA 3BD1A 2B5AA 3KZ3A 3OP9A 4IWRA 4FBIA 2PUAA 2ICTA 1O4XA 1BDHA 4JCXA 2PUCA 4Z5DA 2MQKA 4I6UA 2PIJA 3JXDL 4PU3C 2XCJA 2EF8A 2LYKA 4FN3A 2WUSR 4X4GA 2A6CA 4NDWA 1QPZA 1ZVVA 2PUFA 1ZUGA 3SCHA 4X4DA 3CECA 2CROA 4OB4A 2EWTA 2PE5A 1CQTA 4X4BA 1ZZBA 2XIUA 1SQ8A 1ZZ9A 3VK0A 3G7DA 1QQAA 4IA8A 1UXDA 2IVQA 3SCGA 1ZS4A 1ZZ8A 4PU8A 2KEKA 2R1JL 2O4AA 1CJGA 1Y7YA 1LQCA 2GZUA 3OQNA 2PUGA 4I6TA 2AUWA 4MCXA 3EUSA 1JFSA 1JH9A 3PXPA 1HF0A 4F8DA 2O49A 1S7EA 1ZPQA 4YG4A 1E3OC 3KJXA 2OFYA 3SCFA 3LFPA 2WIUB 2FJRA 2BNNA 3TRBA 4I8TA 4X4CA 1WH8A 2BNOA 1QP0A 4Z5CA 3S8QA 5A7LA 1PNRA 1EFAA 4GQMA 1OSLA 2BJCA 3ZHIA 1VPWA 1QP7A 1RZRD 3CROL 3JXCL 5K98B 1ZZ6A 4YG7B 2IUOA 3H5TA 4GHJA 2R63A
chains in the Genus database with same CATH superfamily
1NEQA 3GN5B 2LYSA 2XXAA 3QFIA 1Y9QA 4X4IA 1X2LA 4YBAA 3BS3A 2IV1A 3ZPXA 2LYPA 1QZXA 2CSFA 4EKGA 2PXDA 3FYAA 1ZZ7A 2LYLA 4X4HA 4JQDA 3RZZA 2PXTA 3UFDA 2LCVA 1BDIA 2PXQA 3OQMA 3OWQA 4Y42A 1X57A 1QQBA 3MLFA 3A9XA 3ZHMA 2LLVA 4Z58A 2LYJA 1JWLA 2IVGA 3NDBB 2ICTA 2HCNA 3JXDL 4PU3C 3NZLA 2WUSR 4X4GA 2PXEA 1ZUGA 3NXHA 3SCHA 2CROA 2PE5A 2XIUA 5DRYA 1ZZ9A 1QQAA 1MFQC 3SCGA 1ZZ8A 3LQXA 2GZUA 3M9LA 2PUGA 2AUWA 1JFSA 4F8DA 1E3OC 3SR4A 3SCFA 2OFYA 2XXPA 1WH8A 1QP0A 4Z5CA 5A7LA 1PNRA 1EFAA 4GQMA 2PXVA 2IUOA 2O38A 2KPJA 2OR1L 2L8NA 2YBDA 2BNMA 4MCTA 1IC8A 1WH6A 3GN5A 1U2ZA 2GRMA 2LLWA 3VWSA 4DE9A 3GBFA 3JXBC 1ZAYA 2XSDC 3UWPA 1UXCA 2D5VA 4YARA 3B7HA 1LCDA 3QYXA 2ICPA 2EBYA 3DNVB 2L1PA 1WETA 1ADRA 2L49A 2PXBA 3QQ6A 4PU4C 5DRTA 4PU7A 1PRAA 3O9XA 4JCYA 3GZDA 1POUA 2MEZA 2AXVA 4Z59A 1OCTC 1PRVA 4YG1A 3NROA 5DSXA 3BD1A 2PUAA 5GAHi 4JCXA 2MQKA 2PXKA 2XCJA 2M4HA 1ZVVA 2PUFA 4X4DA 1ZZBA 1SQ8A 1UXDA 4DE8A 1CJGA 1LQCA 5DTRA 3OKZA 4MCXA 3GUUA 3EUSA 3PXPA 4HRAA 3KL4A 3KJXA 2FJRA 3SX0A 4I8TA 1RZRD 1ZZ6A 4YG7B 4GHJA 1QP7A 2HSGA 3FYMA 4EQZA 4EK9A 2AXZA 1LLIA 3A9ZA 2GRLA 1HQ1A 2IU7A 2AXUA 2JQEA 2H8RA 4X4FA 3CLCA 2KZ8A 2ODRD 2KEJA 3FMYA 1R69A 2IVBA 4WVLA 3OQOA 1NW3A 3QWGA 2KEIA 3HZIB 2J7WA 2XJ3A 1RZSA 2LYRA 3G5GA 3DM5A 1DW9A 2PUBA 2PXFA 1RZRA 1RIOA 1AU7A 1YSEA 2HCSA 3F52A 3R1FA 3L1PA 3LISA 4ER5A 2PPXA 2PUDA 3TEPA 1R63A 4ER0A 2JVLA 3KZ3A 2VEOA 1O4XA 1BDHA 4Q2JA 2PUCA 3TFLA 2PIJA 4FN3A 4NDWA 1QPZA 3G0TA 4ER3A 2LNMA 2EWTA 1QB2A 3VK0A 3G7DA 1ZS4A 4PU8A 2O4AA 1Y7YA 3OQNA 4I6TA 2O49A 3QOXA 1HF0A 1ZPQA 4YG4A 2WIUB 2BNNA 4X4CA 1OSLA 2PXLA 2BJCA 3ZHIA 3R09A 1VPWA 3CROL 2R63A 1UTXA 3QOWA 4Z5HA 5DTQA 1XWRA 1ZZCA 3KXAA 5DTMA 4EZIA 3QF3A 3PE5A 3U3WA 2HINA 1NERA 4O8BA 3ZKCA 4ER7A 3A9YA 2AW6A 1L1MA 2PXUA 4I6RA 1PRUA 4IVZA 1DULA 1JFTA 3F51A 1QP4A 2XI8A 3GZDC 5JUWA 3D1NI 4J1WA 2J7UA 2MXDA 2JCGA 3OMTA 1B0NA 4X4EA 1GT0C 1WIZA 2PUEA 3TELA 3F6WA 5GAGi 1DWKA 4J1XA 3IVPA 1LCCA 3ME5A 3BDNA 5DT2A 1LMB3 1RPEL 2HFZA 1PERL 2AWIA 2LYQA 3MEJA 2B5AA 3OP9A 4IWRA 4FBIA 4Z5DA 4I6UA 2V3CC 2EF8A 2LYKA 2A6CA 4EKIA 2PXPA 3CECA 3GZCA 4OB4A 1CQTA 4X4BA 2XXQA 4IA8A 2IVQA 2KEKA 2R1JL 4ER6A 1JH9A 1S7EA 3LFPA 2FFHA 3TRBA 2BNOA 3S8QA 4OBMA 3JXCL 5K98B 3H5TA
chains in the Genus database with same CATH topology
1NEQA 2O38A 2KPJA 1UTXA 3GN5B 2HSGA 2LYSA 3FYMA 1Y9QA 4X4IA 2OR1L 2L8NA 4Z5HA 1X2LA 2BNMA 2AXZA 4MCTA 4YBAA 1LLIA 3BS3A 1XWRA 1ZZCA 1WH6A 2IV1A 1IC8A 3GN5A 3KXAA 2GRLA 2GRMA 2LYPA 3QF3A 2IU7A 2AXUA 2H8RA 4X4FA 3CLCA 2KZ8A 3U3WA 2HINA 2KEJA 1NERA 4O8BA 3FMYA 1R69A 3ZKCA 3GBFA 2CSFA 2IVBA 3JXBC 1ZAYA 2XSDC 2AW6A 1L1MA 3OQOA 4I6RA 1PRUA 3FYAA 4IVZA 3QWGA 1ZZ7A 2KEIA 2LYLA 4X4HA 3HZIB 1JFTA 3F51A 1QP4A 4JQDA 1UXCA 2XI8A 2XJ3A 3RZZA 2D5VA 4YARA 3D1NI 1RZSA 2LYRA 4J1WA 3G5GA 3B7HA 3UFDA 1LCDA 2LCVA 1DW9A 3QYXA 1BDIA 2PUBA 2JCGA 3OMTA 2ICPA 1B0NA 2EBYA 4X4EA 3DNVB 1RZRA 1RIOA 1GT0C 3OQMA 1WETA 1AU7A 1ADRA 1WIZA 2L49A 4Y42A 2PUEA 3QQ6A 4PU4C 1YSEA 4PU7A 1PRAA 3O9XA 1X57A 3F52A 1QQBA 3F6WA 3MLFA 1DWKA 3R1FA 4J1XA 3L1PA 3ZHMA 4JCYA 3IVPA 3LISA 4Z58A 1POUA 2MEZA 2LYJA 1LCCA 3BDNA 1JWLA 2PPXA 2PUDA 2AXVA 1LMB3 4Z59A 1RPEL 4YG1A 1PRVA 2IVGA 1PERL 1OCTC 1R63A 2AWIA 2LYQA 2JVLA 3BD1A 2B5AA 3KZ3A 3OP9A 4IWRA 4FBIA 2PUAA 2ICTA 1O4XA 1BDHA 4JCXA 2PUCA 4Z5DA 2MQKA 4I6UA 2PIJA 3JXDL 4PU3C 2XCJA 2EF8A 2LYKA 4FN3A 2WUSR 4X4GA 2A6CA 4NDWA 1QPZA 1ZVVA 2PUFA 1ZUGA 3SCHA 4X4DA 3CECA 2CROA 4OB4A 2EWTA 2PE5A 1CQTA 4X4BA 1ZZBA 2XIUA 1SQ8A 1ZZ9A 3VK0A 3G7DA 1QQAA 4IA8A 1UXDA 2IVQA 3SCGA 1ZS4A 1ZZ8A 4PU8A 2KEKA 2R1JL 2O4AA 1CJGA 1Y7YA 1LQCA 2GZUA 3OQNA 2PUGA 4I6TA 2AUWA 4MCXA 3EUSA 1JFSA 1JH9A 3PXPA 1HF0A 4F8DA 2O49A 1S7EA 1ZPQA 4YG4A 1E3OC 3KJXA 2OFYA 3SCFA 3LFPA 2WIUB 2FJRA 2BNNA 3TRBA 4I8TA 4X4CA 1WH8A 2BNOA 1QP0A 4Z5CA 3S8QA 5A7LA 1PNRA 1EFAA 4GQMA 1OSLA 2BJCA 3ZHIA 1VPWA 1QP7A 1RZRD 3CROL 3JXCL 5K98B 1ZZ6A 4YG7B 2IUOA 3H5TA 4GHJA 2R63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEQ A;  2O38 A;  2KPJ A;  1UTX A;  3GN5 B;  2HSG A;  2LYS A;  3FYM A;  1Y9Q A;  4X4I A;  2OR1 L;  2L8N A;  4Z5H A;  1X2L A;  2BNM A;  2AXZ A;  4MCT A;  4YBA A;  1LLI A;  3BS3 A;  1XWR A;  1ZZC A;  1WH6 A;  2IV1 A;  1IC8 A;  3GN5 A;  3KXA A;  2GRL A;  2GRM A;  2LYP A;  3QF3 A;  2IU7 A;  2AXU A;  2H8R A;  4X4F A;  3CLC A;  2KZ8 A;  3U3W A;  2HIN A;  2KEJ A;  1NER A;  4O8B A;  3FMY A;  1R69 A;  3ZKC A;  3GBF A;  2CSF A;  2IVB A;  3JXB C;  1ZAY A;  2XSD C;  2AW6 A;  1L1M A;  3OQO A;  4I6R A;  1PRU A;  3FYA A;  4IVZ A;  3QWG A;  1ZZ7 A;  2KEI A;  2LYL A;  4X4H A;  3HZI B;  1JFT A;  3F51 A;  1QP4 A;  4JQD A;  1UXC A;  2XI8 A;  2XJ3 A;  3RZZ A;  2D5V A;  4YAR A;  3D1N I;  1RZS A;  2LYR A;  4J1W A;  3G5G A;  3B7H A;  3UFD A;  1LCD A;  2LCV A;  1DW9 A;  3QYX A;  1BDI A;  2PUB A;  2JCG A;  3OMT A;  2ICP A;  1B0N A;  2EBY A;  4X4E A;  3DNV B;  1RZR A;  1RIO A;  1GT0 C;  3OQM A;  1WET A;  1AU7 A;  1ADR A;  1WIZ A;  2L49 A;  4Y42 A;  2PUE A;  3QQ6 A;  4PU4 C;  1YSE A;  4PU7 A;  1PRA A;  3O9X A;  1X57 A;  3F52 A;  1QQB A;  3F6W A;  3MLF A;  1DWK A;  3R1F A;  4J1X A;  3L1P A;  3ZHM A;  4JCY A;  3IVP A;  3LIS A;  4Z58 A;  1POU A;  2MEZ A;  2LYJ A;  1LCC A;  3BDN A;  1JWL A;  2PPX A;  2PUD A;  2AXV A;  1LMB 3;  4Z59 A;  1RPE L;  4YG1 A;  1PRV A;  2IVG A;  1PER L;  1OCT C;  1R63 A;  2AWI A;  2LYQ A;  2JVL A;  3BD1 A;  2B5A A;  3KZ3 A;  3OP9 A;  4IWR A;  4FBI A;  2PUA A;  2ICT A;  1O4X A;  1BDH A;  4JCX A;  2PUC A;  4Z5D A;  2MQK A;  4I6U A;  2PIJ A;  3JXD L;  4PU3 C;  2XCJ A;  2EF8 A;  2LYK A;  4FN3 A;  2WUS R;  4X4G A;  2A6C A;  4NDW A;  1QPZ A;  1ZVV A;  2PUF A;  1ZUG A;  3SCH A;  4X4D A;  3CEC A;  2CRO A;  4OB4 A;  2EWT A;  2PE5 A;  1CQT A;  4X4B A;  1ZZB A;  2XIU A;  1SQ8 A;  1ZZ9 A;  3VK0 A;  3G7D A;  1QQA A;  4IA8 A;  1UXD A;  2IVQ A;  3SCG A;  1ZS4 A;  1ZZ8 A;  4PU8 A;  2KEK A;  2R1J L;  2O4A A;  1CJG A;  1Y7Y A;  1LQC A;  2GZU A;  3OQN A;  2PUG A;  4I6T A;  2AUW A;  4MCX A;  3EUS A;  1JFS A;  1JH9 A;  3PXP A;  1HF0 A;  4F8D A;  2O49 A;  1S7E A;  1ZPQ A;  4YG4 A;  1E3O C;  3KJX A;  2OFY A;  3SCF A;  3LFP A;  2WIU B;  2FJR A;  2BNN A;  3TRB A;  4I8T A;  4X4C A;  1WH8 A;  2BNO A;  1QP0 A;  4Z5C A;  3S8Q A;  5A7L A;  1PNR A;  1EFA A;  4GQM A;  1OSL A;  2BJC A;  3ZHI A;  1VPW A;  1QP7 A;  1RZR D;  3CRO L;  3JXC L;  5K98 B;  1ZZ6 A;  4YG7 B;  2IUO A;  3H5T A;  4GHJ A;  2R63 A; 
#chains in the Genus database with same CATH topology
 1NEQ A;  3GN5 B;  2LYS A;  2XXA A;  3QFI A;  1Y9Q A;  4X4I A;  1X2L A;  4YBA A;  3BS3 A;  2IV1 A;  3ZPX A;  2LYP A;  1QZX A;  2CSF A;  4EKG A;  2PXD A;  3FYA A;  1ZZ7 A;  2LYL A;  4X4H A;  4JQD A;  3RZZ A;  2PXT A;  3UFD A;  2LCV A;  1BDI A;  2PXQ A;  3OQM A;  3OWQ A;  4Y42 A;  1X57 A;  1QQB A;  3MLF A;  3A9X A;  3ZHM A;  2LLV A;  4Z58 A;  2LYJ A;  1JWL A;  2IVG A;  3NDB B;  2ICT A;  2HCN A;  3JXD L;  4PU3 C;  3NZL A;  2WUS R;  4X4G A;  2PXE A;  1ZUG A;  3NXH A;  3SCH A;  2CRO A;  2PE5 A;  2XIU A;  5DRY A;  1ZZ9 A;  1QQA A;  1MFQ C;  3SCG A;  1ZZ8 A;  3LQX A;  2GZU A;  3M9L A;  2PUG A;  2AUW A;  1JFS A;  4F8D A;  1E3O C;  3SR4 A;  3SCF A;  2OFY A;  2XXP A;  1WH8 A;  1QP0 A;  4Z5C A;  5A7L A;  1PNR A;  1EFA A;  4GQM A;  2PXV A;  2IUO A;  2O38 A;  2KPJ A;  2OR1 L;  2L8N A;  2YBD A;  2BNM A;  4MCT A;  1IC8 A;  1WH6 A;  3GN5 A;  1U2Z A;  2GRM A;  2LLW A;  3VWS A;  4DE9 A;  3GBF A;  3JXB C;  1ZAY A;  2XSD C;  3UWP A;  1UXC A;  2D5V A;  4YAR A;  3B7H A;  1LCD A;  3QYX A;  2ICP A;  2EBY A;  3DNV B;  2L1P A;  1WET A;  1ADR A;  2L49 A;  2PXB A;  3QQ6 A;  4PU4 C;  5DRT A;  4PU7 A;  1PRA A;  3O9X A;  4JCY A;  3GZD A;  1POU A;  2MEZ A;  2AXV A;  4Z59 A;  1OCT C;  1PRV A;  4YG1 A;  3NRO A;  5DSX A;  3BD1 A;  2PUA A;  5GAH i;  4JCX A;  2MQK A;  2PXK A;  2XCJ A;  2M4H A;  1ZVV A;  2PUF A;  4X4D A;  1ZZB A;  1SQ8 A;  1UXD A;  4DE8 A;  1CJG A;  1LQC A;  5DTR A;  3OKZ A;  4MCX A;  3GUU A;  3EUS A;  3PXP A;  4HRA A;  3KL4 A;  3KJX A;  2FJR A;  3SX0 A;  4I8T A;  1RZR D;  1ZZ6 A;  4YG7 B;  4GHJ A;  1QP7 A;  2HSG A;  3FYM A;  4EQZ A;  4EK9 A;  2AXZ A;  1LLI A;  3A9Z A;  2GRL A;  1HQ1 A;  2IU7 A;  2AXU A;  2JQE A;  2H8R A;  4X4F A;  3CLC A;  2KZ8 A;  2ODR D;  2KEJ A;  3FMY A;  1R69 A;  2IVB A;  4WVL A;  3OQO A;  1NW3 A;  3QWG A;  2KEI A;  3HZI B;  2J7W A;  2XJ3 A;  1RZS A;  2LYR A;  3G5G A;  3DM5 A;  1DW9 A;  2PUB A;  2PXF A;  1RZR A;  1RIO A;  1AU7 A;  1YSE A;  2HCS A;  3F52 A;  3R1F A;  3L1P A;  3LIS A;  4ER5 A;  2PPX A;  2PUD A;  3TEP A;  1R63 A;  4ER0 A;  2JVL A;  3KZ3 A;  2VEO A;  1O4X A;  1BDH A;  4Q2J A;  2PUC A;  3TFL A;  2PIJ A;  4FN3 A;  4NDW A;  1QPZ A;  3G0T A;  4ER3 A;  2LNM A;  2EWT A;  1QB2 A;  3VK0 A;  3G7D A;  1ZS4 A;  4PU8 A;  2O4A A;  1Y7Y A;  3OQN A;  4I6T A;  2O49 A;  3QOX A;  1HF0 A;  1ZPQ A;  4YG4 A;  2WIU B;  2BNN A;  4X4C A;  1OSL A;  2PXL A;  2BJC A;  3ZHI A;  3R09 A;  1VPW A;  3CRO L;  2R63 A;  1UTX A;  3QOW A;  4Z5H A;  5DTQ A;  1XWR A;  1ZZC A;  3KXA A;  5DTM A;  4EZI A;  3QF3 A;  3PE5 A;  3U3W A;  2HIN A;  1NER A;  4O8B A;  3ZKC A;  4ER7 A;  3A9Y A;  2AW6 A;  1L1M A;  2PXU A;  4I6R A;  1PRU A;  4IVZ A;  1DUL A;  1JFT A;  3F51 A;  1QP4 A;  2XI8 A;  3GZD C;  5JUW A;  3D1N I;  4J1W A;  2J7U A;  2MXD A;  2JCG A;  3OMT A;  1B0N A;  4X4E A;  1GT0 C;  1WIZ A;  2PUE A;  3TEL A;  3F6W A;  5GAG i;  1DWK A;  4J1X A;  3IVP A;  1LCC A;  3ME5 A;  3BDN A;  5DT2 A;  1LMB 3;  1RPE L;  2HFZ A;  1PER L;  2AWI A;  2LYQ A;  3MEJ A;  2B5A A;  3OP9 A;  4IWR A;  4FBI A;  4Z5D A;  4I6U A;  2V3C C;  2EF8 A;  2LYK A;  2A6C A;  4EKI A;  2PXP A;  3CEC A;  3GZC A;  4OB4 A;  1CQT A;  4X4B A;  2XXQ A;  4IA8 A;  2IVQ A;  2KEK A;  2R1J L;  4ER6 A;  1JH9 A;  1S7E A;  3LFP A;  2FFH A;  3TRB A;  2BNO A;  3S8Q A;  4OBM A;  3JXC L;  5K98 B;  3H5T A; 
#chains in the Genus database with same CATH homology
 1NEQ A;  2O38 A;  2KPJ A;  1UTX A;  3GN5 B;  2HSG A;  2LYS A;  3FYM A;  1Y9Q A;  4X4I A;  2OR1 L;  2L8N A;  4Z5H A;  1X2L A;  2BNM A;  2AXZ A;  4MCT A;  4YBA A;  1LLI A;  3BS3 A;  1XWR A;  1ZZC A;  1WH6 A;  2IV1 A;  1IC8 A;  3GN5 A;  3KXA A;  2GRL A;  2GRM A;  2LYP A;  3QF3 A;  2IU7 A;  2AXU A;  2H8R A;  4X4F A;  3CLC A;  2KZ8 A;  3U3W A;  2HIN A;  2KEJ A;  1NER A;  4O8B A;  3FMY A;  1R69 A;  3ZKC A;  3GBF A;  2CSF A;  2IVB A;  3JXB C;  1ZAY A;  2XSD C;  2AW6 A;  1L1M A;  3OQO A;  4I6R A;  1PRU A;  3FYA A;  4IVZ A;  3QWG A;  1ZZ7 A;  2KEI A;  2LYL A;  4X4H A;  3HZI B;  1JFT A;  3F51 A;  1QP4 A;  4JQD A;  1UXC A;  2XI8 A;  2XJ3 A;  3RZZ A;  2D5V A;  4YAR A;  3D1N I;  1RZS A;  2LYR A;  4J1W A;  3G5G A;  3B7H A;  3UFD A;  1LCD A;  2LCV A;  1DW9 A;  3QYX A;  1BDI A;  2PUB A;  2JCG A;  3OMT A;  2ICP A;  1B0N A;  2EBY A;  4X4E A;  3DNV B;  1RZR A;  1RIO A;  1GT0 C;  3OQM A;  1WET A;  1AU7 A;  1ADR A;  1WIZ A;  2L49 A;  4Y42 A;  2PUE A;  3QQ6 A;  4PU4 C;  1YSE A;  4PU7 A;  1PRA A;  3O9X A;  1X57 A;  3F52 A;  1QQB A;  3F6W A;  3MLF A;  1DWK A;  3R1F A;  4J1X A;  3L1P A;  3ZHM A;  4JCY A;  3IVP A;  3LIS A;  4Z58 A;  1POU A;  2MEZ A;  2LYJ A;  1LCC A;  3BDN A;  1JWL A;  2PPX A;  2PUD A;  2AXV A;  1LMB 3;  4Z59 A;  1RPE L;  4YG1 A;  1PRV A;  2IVG A;  1PER L;  1OCT C;  1R63 A;  2AWI A;  2LYQ A;  2JVL A;  3BD1 A;  2B5A A;  3KZ3 A;  3OP9 A;  4IWR A;  4FBI A;  2PUA A;  2ICT A;  1O4X A;  1BDH A;  4JCX A;  2PUC A;  4Z5D A;  2MQK A;  4I6U A;  2PIJ A;  3JXD L;  4PU3 C;  2XCJ A;  2EF8 A;  2LYK A;  4FN3 A;  2WUS R;  4X4G A;  2A6C A;  4NDW A;  1QPZ A;  1ZVV A;  2PUF A;  1ZUG A;  3SCH A;  4X4D A;  3CEC A;  2CRO A;  4OB4 A;  2EWT A;  2PE5 A;  1CQT A;  4X4B A;  1ZZB A;  2XIU A;  1SQ8 A;  1ZZ9 A;  3VK0 A;  3G7D A;  1QQA A;  4IA8 A;  1UXD A;  2IVQ A;  3SCG A;  1ZS4 A;  1ZZ8 A;  4PU8 A;  2KEK A;  2R1J L;  2O4A A;  1CJG A;  1Y7Y A;  1LQC A;  2GZU A;  3OQN A;  2PUG A;  4I6T A;  2AUW A;  4MCX A;  3EUS A;  1JFS A;  1JH9 A;  3PXP A;  1HF0 A;  4F8D A;  2O49 A;  1S7E A;  1ZPQ A;  4YG4 A;  1E3O C;  3KJX A;  2OFY A;  3SCF A;  3LFP A;  2WIU B;  2FJR A;  2BNN A;  3TRB A;  4I8T A;  4X4C A;  1WH8 A;  2BNO A;  1QP0 A;  4Z5C A;  3S8Q A;  5A7L A;  1PNR A;  1EFA A;  4GQM A;  1OSL A;  2BJC A;  3ZHI A;  1VPW A;  1QP7 A;  1RZR D;  3CRO L;  3JXC L;  5K98 B;  1ZZ6 A;  4YG7 B;  2IUO A;  3H5T A;  4GHJ A;  2R63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...