1RPEL

The phage 434 or2/r1-69 complex at 2.5 angstroms resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
63
structure length
63
Chain Sequence
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The phage 434 OR2/R1-69 complex at 2.5 A resolution.
pubmed doi rcsb
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*TP*AP*TP*AP*CP*AP*AP*TP*GP*TP*AP*TP*CP*TP*TP*GP*T
total genus 22
structure length 63
sequence length 63
chains with identical sequence R
ec nomenclature
pdb deposition date 1993-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1rpeL00
1BDHA 3PXPA 1WETA 1LCDA 4X4DA 2H8RA 2XSDC 1LLIA 4X4GA 2KZ8A 3GBFA 5A7LA 2WIUB 2MEZA 1RZSA 3JXBC 3KXAA 4YARA 1WIZA 2KPJA 1ZZBA 4JQDA 4O8BA 1QP7A 1JFSA 3CROL 4J1WA 1OCTC 2O49A 4NDWA 4IVZA 4GHJA 1Y9QA 2LYPA 1RPEL 3KZ3A 2IUOA 3OP9A 2EWTA 4X4IA 2OR1L 1ZVVA 2PUDA 3OMTA 4FBIA 2EF8A 1NEQA 2LCVA 4X4HA 3HZIB 2PPXA 4X4CA 2A6CA 2ICPA 1R63A 2PIJA 3OQOA 4Y42A 3L1PA 4I6UA 2BJCA 3KJXA 2XCJA 5K98B 2KEIA 4MCXA 1UXDA 1XWRA 3JXCL 1ZUGA 3R1FA 1RZRA 1VPWA 3RZZA 1CQTA 3UFDA 2LYRA 1LMB3 1POUA 1JH9A 3O9XA 1AU7A 4GQMA 4Z58A 3QQ6A 1CJGA 3CLCA 1QQBA 1ZZ8A 1PRAA 1PERL 4X4EA 1OSLA 2PUGA 1SQ8A 1LCCA 4J1XA 4Z5CA 2GZUA 2IVGA 1BDIA 2IVBA 2O4AA 3SCFA 4IA8A 2AWIA 1ZZ9A 1WH8A 3BS3A 3QYXA 1ZZ6A 1B0NA 2EBYA 3BD1A 4OB4A 1GT0C 1WH6A 2JCGA 1IC8A 1DW9A 1QP0A 2GRLA 1O4XA 1NERA 3CECA 2AXZA 3LISA 3ZHMA 1X57A 4Z5HA 2PE5A 2IV1A 1QP4A 2LYJA 4YBAA 3IVPA 1JFTA 3F51A 2AUWA 1ZZ7A 2B5AA 1HF0A 2D5VA 4JCXA 2AW6A 1L1MA 1S7EA 1YSEA 1PNRA 3U3WA 1PRVA 2MQKA 2KEJA 2BNMA 4YG1A 1ZS4A 3G7DA 2HINA 1R69A 2PUEA 1RIOA 2LYQA 2AXUA 3FMYA 2ICTA 3F6WA 1DWKA 4I8TA 1Y7YA 1X2LA 2BNNA 3GN5B 2XI8A 4Z59A 4I6TA 3BDNA 4IWRA 3D1NI 3FYAA 3SCGA 3VK0A 1ZAYA 1QQAA 1PRUA 2OFYA 2CSFA 3OQMA 4PU3C 2FJRA 2R1JL 4YG7B 4X4FA 2IVQA 1QPZA 2GRMA 3FYMA 3ZHIA 2BNOA 3SCHA 3LFPA 2CROA 4I6RA 1EFAA 1UTXA 2L8NA 4Z5DA 2XIUA 3TRBA 3GN5A 3H5TA 4PU7A 4F8DA 3DNVB 3F52A 2R63A 3OQNA 2LYKA 4FN3A 3S8QA 1RZRD 1E3OC 2LYLA 2IU7A 4YG4A 1JWLA 2PUBA 1ADRA 3EUSA 2XJ3A 3QWGA 2WUSR 3MLFA 2PUAA 3JXDL 3G5GA 2PUCA 4JCYA 4PU4C 2LYSA 3QF3A 2KEKA 2PUFA 2HSGA 2L49A 2O38A 3B7HA 4PU8A 2AXVA 1ZPQA 3ZKCA 4X4BA 1UXCA 1ZZCA 4MCTA 1LQCA 2JVLA
chains in the Genus database with same CATH superfamily
1LCDA 2XSDC 1LLIA 2PXLA 5A7LA 4YARA 4JQDA 3TELA 4J1WA 1OCTC 4GHJA 2LYPA 3KZ3A 1QB2A 3OP9A 1ZVVA 4FBIA 2PXBA 3VWSA 2PXQA 4X4HA 2FFHA 2HCSA 3OQOA 4Y42A 3KJXA 5K98B 2KEIA 1UXDA 1XWRA 3JXCL 4ER7A 3RZZA 1LMB3 3CLCA 3QQ6A 4X4EA 1SQ8A 4J1XA 2GZUA 2IVGA 1BDIA 4IA8A 1ZZ9A 3KL4A 3BS3A 1GT0C 1ZZ6A 1QP0A 1B0NA 3BD1A 3GUUA 3NXHA 1WH6A 5DT2A 2PXUA 1X57A 1QP4A 2LYJA 1JFTA 3IVPA 2AUWA 1HF0A 4JCXA 1YSEA 3SR4A 1PNRA 2MQKA 2KEJA 1ZS4A 3FMYA 3QOXA 3GZDC 3F6WA 1DWKA 4I8TA 1Y7YA 3GN5B 4Z59A 2PXEA 4I6TA 3BDNA 2R1JL 2FJRA 1QPZA 2PXTA 2IVQA 3DM5A 2GRMA 3ZHIA 2XXPA 2MXDA 3A9XA 2BNOA 2CROA 5GAGi 3DNVB 3GN5A 2XXAA 3F52A 4ER5A 2LYKA 1ADRA 3EUSA 2XJ3A 5DSXA 3JXDL 3G5GA 4JCYA 4PU4C 2LYSA 2KEKA 2O38A 1UXCA 5DRTA 5DRYA 3JXBC 2MEZA 1RZSA 2O49A 3ME5A 4IVZA 4ER3A 2EWTA 4X4CA 2ICPA 2BJCA 2HCNA 1RZRA 1DULA 1ZUGA 1VPWA 3UFDA 3SX0A 1ZZ8A 1PRAA 2V3CC 2PUGA 4OBMA 2PXDA 4Z5CA 3SCFA 2VEOA 2EBYA 2XXQA 2JCGA 2AXZA 4Z5HA 2IV1A 1L1MA 3A9ZA 3MEJA 4YG1A 2ODRD 2PUEA 3NZLA 5DTRA 1X2LA 1HQ1A 4IWRA 3SCGA 2OFYA 2L1PA 4PU3C 4X4FA 3FYMA 3LFPA 2XIUA 3H5TA 2JQEA 3NROA 3G0TA 3OQNA 4FN3A 3S8QA 2PUBA 1E3OC 2IU7A 4YG4A 5DTQA 2WUSR 2PUAA 1MFQC 2PUFA 2L49A 3B7HA 1ZPQA 3LQXA 4MCTA 1LQCA 3NDBB 2JVLA 4WVLA 3PXPA 4EKIA 1WETA 4X4DA 2H8RA 3GBFA 1WIZA 4O8BA 3A9YA 1QP7A 1JFSA 1RPEL 2IUOA 2OR1L 3GZDA 2PUDA 3OMTA 4EQZA 1QZXA 2A6CA 3M9LA 2PXVA 3L1PA 3R1FA 2LYRA 1JH9A 1CJGA 4EZIA 1OSLA 2O4AA 2AWIA 3QYXA 5DTMA 1DW9A 1O4XA 1NERA 3LISA 3ZHMA 2PE5A 3CROL 2M4HA 2D5VA 4YBAA 3F51A 1ZZ7A 4Q2JA 3QFIA 2HINA 1R69A 2LYQA 2AXUA 1NW3A 2BNNA 3R09A 3VK0A 5GAHi 1QQAA 1PRUA 2CSFA 3OQMA 4YG7B 3SCHA 1UTXA 4Z5DA 4PU7A 4F8DA 3PE5A 1RZRD 3QWGA 3MLFA 4PU8A 2AXVA 3ZKCA 4X4BA 2LLVA 1BDHA 4X4GA 2KZ8A 2WIUB 3KXAA 3OKZA 2KPJA 2J7UA 1ZZBA 4EK9A 5JUWA 2PXPA 4NDWA 1Y9QA 4X4IA 1U2ZA 2EF8A 1NEQA 2LCVA 3HZIB 2PPXA 3GZCA 1R63A 2PIJA 4I6UA 2XCJA 4MCXA 1CQTA 1POUA 3O9XA 1AU7A 4GQMA 4Z58A 1QQBA 1PERL 1LCCA 2LNMA 2IVBA 3TFLA 4ER6A 1WH8A 1IC8A 4DE8A 4OB4A 2GRLA 3CECA 4HRAA 2B5AA 2AW6A 1S7EA 3UWPA 3U3WA 1PRVA 2BNMA 3ZPXA 3G7DA 2LLWA 1RIOA 2ICTA 2XI8A 3D1NI 3FYAA 1ZAYA 3TEPA 2J7WA 4I6RA 2PXKA 1EFAA 2L8NA 3TRBA 4DE9A 4EKGA 2R63A 3QOWA 2LYLA 1JWLA 2YBDA 2PXFA 2PUCA 3QF3A 2HFZA 2HSGA 3OWQA 4ER0A 1ZZCA
chains in the Genus database with same CATH topology
1BDHA 3PXPA 1WETA 1LCDA 4X4DA 2H8RA 2XSDC 1LLIA 4X4GA 2KZ8A 3GBFA 5A7LA 2WIUB 2MEZA 1RZSA 3JXBC 3KXAA 4YARA 1WIZA 2KPJA 1ZZBA 4JQDA 4O8BA 1QP7A 1JFSA 3CROL 4J1WA 1OCTC 2O49A 4NDWA 4IVZA 4GHJA 1Y9QA 2LYPA 1RPEL 3KZ3A 2IUOA 3OP9A 2EWTA 4X4IA 2OR1L 1ZVVA 2PUDA 3OMTA 4FBIA 2EF8A 1NEQA 2LCVA 4X4HA 3HZIB 2PPXA 4X4CA 2A6CA 2ICPA 1R63A 2PIJA 3OQOA 4Y42A 3L1PA 4I6UA 2BJCA 3KJXA 2XCJA 5K98B 2KEIA 4MCXA 1UXDA 1XWRA 3JXCL 1ZUGA 3R1FA 1RZRA 1VPWA 3RZZA 1CQTA 3UFDA 2LYRA 1LMB3 1POUA 1JH9A 3O9XA 1AU7A 4GQMA 4Z58A 3QQ6A 1CJGA 3CLCA 1QQBA 1ZZ8A 1PRAA 1PERL 4X4EA 1OSLA 2PUGA 1SQ8A 1LCCA 4J1XA 4Z5CA 2GZUA 2IVGA 1BDIA 2IVBA 2O4AA 3SCFA 4IA8A 2AWIA 1ZZ9A 1WH8A 3BS3A 3QYXA 1ZZ6A 1B0NA 2EBYA 3BD1A 4OB4A 1GT0C 1WH6A 2JCGA 1IC8A 1DW9A 1QP0A 2GRLA 1O4XA 1NERA 3CECA 2AXZA 3LISA 3ZHMA 1X57A 4Z5HA 2PE5A 2IV1A 1QP4A 2LYJA 4YBAA 3IVPA 1JFTA 3F51A 2AUWA 1ZZ7A 2B5AA 1HF0A 2D5VA 4JCXA 2AW6A 1L1MA 1S7EA 1YSEA 1PNRA 3U3WA 1PRVA 2MQKA 2KEJA 2BNMA 4YG1A 1ZS4A 3G7DA 2HINA 1R69A 2PUEA 1RIOA 2LYQA 2AXUA 3FMYA 2ICTA 3F6WA 1DWKA 4I8TA 1Y7YA 1X2LA 2BNNA 3GN5B 2XI8A 4Z59A 4I6TA 3BDNA 4IWRA 3D1NI 3FYAA 3SCGA 3VK0A 1ZAYA 1QQAA 1PRUA 2OFYA 2CSFA 3OQMA 4PU3C 2FJRA 2R1JL 4YG7B 4X4FA 2IVQA 1QPZA 2GRMA 3FYMA 3ZHIA 2BNOA 3SCHA 3LFPA 2CROA 4I6RA 1EFAA 1UTXA 2L8NA 4Z5DA 2XIUA 3TRBA 3GN5A 3H5TA 4PU7A 4F8DA 3DNVB 3F52A 2R63A 3OQNA 2LYKA 4FN3A 3S8QA 1RZRD 1E3OC 2LYLA 2IU7A 4YG4A 1JWLA 2PUBA 1ADRA 3EUSA 2XJ3A 3QWGA 2WUSR 3MLFA 2PUAA 3JXDL 3G5GA 2PUCA 4JCYA 4PU4C 2LYSA 3QF3A 2KEKA 2PUFA 2HSGA 2L49A 2O38A 3B7HA 4PU8A 2AXVA 1ZPQA 3ZKCA 4X4BA 1UXCA 1ZZCA 4MCTA 1LQCA 2JVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDH A;  3PXP A;  1WET A;  1LCD A;  4X4D A;  2H8R A;  2XSD C;  1LLI A;  4X4G A;  2KZ8 A;  3GBF A;  5A7L A;  2WIU B;  2MEZ A;  1RZS A;  3JXB C;  3KXA A;  4YAR A;  1WIZ A;  2KPJ A;  1ZZB A;  4JQD A;  4O8B A;  1QP7 A;  1JFS A;  3CRO L;  4J1W A;  1OCT C;  2O49 A;  4NDW A;  4IVZ A;  4GHJ A;  1Y9Q A;  2LYP A;  1RPE L;  3KZ3 A;  2IUO A;  3OP9 A;  2EWT A;  4X4I A;  2OR1 L;  1ZVV A;  2PUD A;  3OMT A;  4FBI A;  2EF8 A;  1NEQ A;  2LCV A;  4X4H A;  3HZI B;  2PPX A;  4X4C A;  2A6C A;  2ICP A;  1R63 A;  2PIJ A;  3OQO A;  4Y42 A;  3L1P A;  4I6U A;  2BJC A;  3KJX A;  2XCJ A;  5K98 B;  2KEI A;  4MCX A;  1UXD A;  1XWR A;  3JXC L;  1ZUG A;  3R1F A;  1RZR A;  1VPW A;  3RZZ A;  1CQT A;  3UFD A;  2LYR A;  1LMB 3;  1POU A;  1JH9 A;  3O9X A;  1AU7 A;  4GQM A;  4Z58 A;  3QQ6 A;  1CJG A;  3CLC A;  1QQB A;  1ZZ8 A;  1PRA A;  1PER L;  4X4E A;  1OSL A;  2PUG A;  1SQ8 A;  1LCC A;  4J1X A;  4Z5C A;  2GZU A;  2IVG A;  1BDI A;  2IVB A;  2O4A A;  3SCF A;  4IA8 A;  2AWI A;  1ZZ9 A;  1WH8 A;  3BS3 A;  3QYX A;  1ZZ6 A;  1B0N A;  2EBY A;  3BD1 A;  4OB4 A;  1GT0 C;  1WH6 A;  2JCG A;  1IC8 A;  1DW9 A;  1QP0 A;  2GRL A;  1O4X A;  1NER A;  3CEC A;  2AXZ A;  3LIS A;  3ZHM A;  1X57 A;  4Z5H A;  2PE5 A;  2IV1 A;  1QP4 A;  2LYJ A;  4YBA A;  3IVP A;  1JFT A;  3F51 A;  2AUW A;  1ZZ7 A;  2B5A A;  1HF0 A;  2D5V A;  4JCX A;  2AW6 A;  1L1M A;  1S7E A;  1YSE A;  1PNR A;  3U3W A;  1PRV A;  2MQK A;  2KEJ A;  2BNM A;  4YG1 A;  1ZS4 A;  3G7D A;  2HIN A;  1R69 A;  2PUE A;  1RIO A;  2LYQ A;  2AXU A;  3FMY A;  2ICT A;  3F6W A;  1DWK A;  4I8T A;  1Y7Y A;  1X2L A;  2BNN A;  3GN5 B;  2XI8 A;  4Z59 A;  4I6T A;  3BDN A;  4IWR A;  3D1N I;  3FYA A;  3SCG A;  3VK0 A;  1ZAY A;  1QQA A;  1PRU A;  2OFY A;  2CSF A;  3OQM A;  4PU3 C;  2FJR A;  2R1J L;  4YG7 B;  4X4F A;  2IVQ A;  1QPZ A;  2GRM A;  3FYM A;  3ZHI A;  2BNO A;  3SCH A;  3LFP A;  2CRO A;  4I6R A;  1EFA A;  1UTX A;  2L8N A;  4Z5D A;  2XIU A;  3TRB A;  3GN5 A;  3H5T A;  4PU7 A;  4F8D A;  3DNV B;  3F52 A;  2R63 A;  3OQN A;  2LYK A;  4FN3 A;  3S8Q A;  1RZR D;  1E3O C;  2LYL A;  2IU7 A;  4YG4 A;  1JWL A;  2PUB A;  1ADR A;  3EUS A;  2XJ3 A;  3QWG A;  2WUS R;  3MLF A;  2PUA A;  3JXD L;  3G5G A;  2PUC A;  4JCY A;  4PU4 C;  2LYS A;  3QF3 A;  2KEK A;  2PUF A;  2HSG A;  2L49 A;  2O38 A;  3B7H A;  4PU8 A;  2AXV A;  1ZPQ A;  3ZKC A;  4X4B A;  1UXC A;  1ZZC A;  4MCT A;  1LQC A;  2JVL A; 
#chains in the Genus database with same CATH topology
 1LCD A;  2XSD C;  1LLI A;  2PXL A;  5A7L A;  4YAR A;  4JQD A;  3TEL A;  4J1W A;  1OCT C;  4GHJ A;  2LYP A;  3KZ3 A;  1QB2 A;  3OP9 A;  1ZVV A;  4FBI A;  2PXB A;  3VWS A;  2PXQ A;  4X4H A;  2FFH A;  2HCS A;  3OQO A;  4Y42 A;  3KJX A;  5K98 B;  2KEI A;  1UXD A;  1XWR A;  3JXC L;  4ER7 A;  3RZZ A;  1LMB 3;  3CLC A;  3QQ6 A;  4X4E A;  1SQ8 A;  4J1X A;  2GZU A;  2IVG A;  1BDI A;  4IA8 A;  1ZZ9 A;  3KL4 A;  3BS3 A;  1GT0 C;  1ZZ6 A;  1QP0 A;  1B0N A;  3BD1 A;  3GUU A;  3NXH A;  1WH6 A;  5DT2 A;  2PXU A;  1X57 A;  1QP4 A;  2LYJ A;  1JFT A;  3IVP A;  2AUW A;  1HF0 A;  4JCX A;  1YSE A;  3SR4 A;  1PNR A;  2MQK A;  2KEJ A;  1ZS4 A;  3FMY A;  3QOX A;  3GZD C;  3F6W A;  1DWK A;  4I8T A;  1Y7Y A;  3GN5 B;  4Z59 A;  2PXE A;  4I6T A;  3BDN A;  2R1J L;  2FJR A;  1QPZ A;  2PXT A;  2IVQ A;  3DM5 A;  2GRM A;  3ZHI A;  2XXP A;  2MXD A;  3A9X A;  2BNO A;  2CRO A;  5GAG i;  3DNV B;  3GN5 A;  2XXA A;  3F52 A;  4ER5 A;  2LYK A;  1ADR A;  3EUS A;  2XJ3 A;  5DSX A;  3JXD L;  3G5G A;  4JCY A;  4PU4 C;  2LYS A;  2KEK A;  2O38 A;  1UXC A;  5DRT A;  5DRY A;  3JXB C;  2MEZ A;  1RZS A;  2O49 A;  3ME5 A;  4IVZ A;  4ER3 A;  2EWT A;  4X4C A;  2ICP A;  2BJC A;  2HCN A;  1RZR A;  1DUL A;  1ZUG A;  1VPW A;  3UFD A;  3SX0 A;  1ZZ8 A;  1PRA A;  2V3C C;  2PUG A;  4OBM A;  2PXD A;  4Z5C A;  3SCF A;  2VEO A;  2EBY A;  2XXQ A;  2JCG A;  2AXZ A;  4Z5H A;  2IV1 A;  1L1M A;  3A9Z A;  3MEJ A;  4YG1 A;  2ODR D;  2PUE A;  3NZL A;  5DTR A;  1X2L A;  1HQ1 A;  4IWR A;  3SCG A;  2OFY A;  2L1P A;  4PU3 C;  4X4F A;  3FYM A;  3LFP A;  2XIU A;  3H5T A;  2JQE A;  3NRO A;  3G0T A;  3OQN A;  4FN3 A;  3S8Q A;  2PUB A;  1E3O C;  2IU7 A;  4YG4 A;  5DTQ A;  2WUS R;  2PUA A;  1MFQ C;  2PUF A;  2L49 A;  3B7H A;  1ZPQ A;  3LQX A;  4MCT A;  1LQC A;  3NDB B;  2JVL A;  4WVL A;  3PXP A;  4EKI A;  1WET A;  4X4D A;  2H8R A;  3GBF A;  1WIZ A;  4O8B A;  3A9Y A;  1QP7 A;  1JFS A;  1RPE L;  2IUO A;  2OR1 L;  3GZD A;  2PUD A;  3OMT A;  4EQZ A;  1QZX A;  2A6C A;  3M9L A;  2PXV A;  3L1P A;  3R1F A;  2LYR A;  1JH9 A;  1CJG A;  4EZI A;  1OSL A;  2O4A A;  2AWI A;  3QYX A;  5DTM A;  1DW9 A;  1O4X A;  1NER A;  3LIS A;  3ZHM A;  2PE5 A;  3CRO L;  2M4H A;  2D5V A;  4YBA A;  3F51 A;  1ZZ7 A;  4Q2J A;  3QFI A;  2HIN A;  1R69 A;  2LYQ A;  2AXU A;  1NW3 A;  2BNN A;  3R09 A;  3VK0 A;  5GAH i;  1QQA A;  1PRU A;  2CSF A;  3OQM A;  4YG7 B;  3SCH A;  1UTX A;  4Z5D A;  4PU7 A;  4F8D A;  3PE5 A;  1RZR D;  3QWG A;  3MLF A;  4PU8 A;  2AXV A;  3ZKC A;  4X4B A;  2LLV A;  1BDH A;  4X4G A;  2KZ8 A;  2WIU B;  3KXA A;  3OKZ A;  2KPJ A;  2J7U A;  1ZZB A;  4EK9 A;  5JUW A;  2PXP A;  4NDW A;  1Y9Q A;  4X4I A;  1U2Z A;  2EF8 A;  1NEQ A;  2LCV A;  3HZI B;  2PPX A;  3GZC A;  1R63 A;  2PIJ A;  4I6U A;  2XCJ A;  4MCX A;  1CQT A;  1POU A;  3O9X A;  1AU7 A;  4GQM A;  4Z58 A;  1QQB A;  1PER L;  1LCC A;  2LNM A;  2IVB A;  3TFL A;  4ER6 A;  1WH8 A;  1IC8 A;  4DE8 A;  4OB4 A;  2GRL A;  3CEC A;  4HRA A;  2B5A A;  2AW6 A;  1S7E A;  3UWP A;  3U3W A;  1PRV A;  2BNM A;  3ZPX A;  3G7D A;  2LLW A;  1RIO A;  2ICT A;  2XI8 A;  3D1N I;  3FYA A;  1ZAY A;  3TEP A;  2J7W A;  4I6R A;  2PXK A;  1EFA A;  2L8N A;  3TRB A;  4DE9 A;  4EKG A;  2R63 A;  3QOW A;  2LYL A;  1JWL A;  2YBD A;  2PXF A;  2PUC A;  3QF3 A;  2HFZ A;  2HSG A;  3OWQ A;  4ER0 A;  1ZZC A; 
#chains in the Genus database with same CATH homology
 1BDH A;  3PXP A;  1WET A;  1LCD A;  4X4D A;  2H8R A;  2XSD C;  1LLI A;  4X4G A;  2KZ8 A;  3GBF A;  5A7L A;  2WIU B;  2MEZ A;  1RZS A;  3JXB C;  3KXA A;  4YAR A;  1WIZ A;  2KPJ A;  1ZZB A;  4JQD A;  4O8B A;  1QP7 A;  1JFS A;  3CRO L;  4J1W A;  1OCT C;  2O49 A;  4NDW A;  4IVZ A;  4GHJ A;  1Y9Q A;  2LYP A;  1RPE L;  3KZ3 A;  2IUO A;  3OP9 A;  2EWT A;  4X4I A;  2OR1 L;  1ZVV A;  2PUD A;  3OMT A;  4FBI A;  2EF8 A;  1NEQ A;  2LCV A;  4X4H A;  3HZI B;  2PPX A;  4X4C A;  2A6C A;  2ICP A;  1R63 A;  2PIJ A;  3OQO A;  4Y42 A;  3L1P A;  4I6U A;  2BJC A;  3KJX A;  2XCJ A;  5K98 B;  2KEI A;  4MCX A;  1UXD A;  1XWR A;  3JXC L;  1ZUG A;  3R1F A;  1RZR A;  1VPW A;  3RZZ A;  1CQT A;  3UFD A;  2LYR A;  1LMB 3;  1POU A;  1JH9 A;  3O9X A;  1AU7 A;  4GQM A;  4Z58 A;  3QQ6 A;  1CJG A;  3CLC A;  1QQB A;  1ZZ8 A;  1PRA A;  1PER L;  4X4E A;  1OSL A;  2PUG A;  1SQ8 A;  1LCC A;  4J1X A;  4Z5C A;  2GZU A;  2IVG A;  1BDI A;  2IVB A;  2O4A A;  3SCF A;  4IA8 A;  2AWI A;  1ZZ9 A;  1WH8 A;  3BS3 A;  3QYX A;  1ZZ6 A;  1B0N A;  2EBY A;  3BD1 A;  4OB4 A;  1GT0 C;  1WH6 A;  2JCG A;  1IC8 A;  1DW9 A;  1QP0 A;  2GRL A;  1O4X A;  1NER A;  3CEC A;  2AXZ A;  3LIS A;  3ZHM A;  1X57 A;  4Z5H A;  2PE5 A;  2IV1 A;  1QP4 A;  2LYJ A;  4YBA A;  3IVP A;  1JFT A;  3F51 A;  2AUW A;  1ZZ7 A;  2B5A A;  1HF0 A;  2D5V A;  4JCX A;  2AW6 A;  1L1M A;  1S7E A;  1YSE A;  1PNR A;  3U3W A;  1PRV A;  2MQK A;  2KEJ A;  2BNM A;  4YG1 A;  1ZS4 A;  3G7D A;  2HIN A;  1R69 A;  2PUE A;  1RIO A;  2LYQ A;  2AXU A;  3FMY A;  2ICT A;  3F6W A;  1DWK A;  4I8T A;  1Y7Y A;  1X2L A;  2BNN A;  3GN5 B;  2XI8 A;  4Z59 A;  4I6T A;  3BDN A;  4IWR A;  3D1N I;  3FYA A;  3SCG A;  3VK0 A;  1ZAY A;  1QQA A;  1PRU A;  2OFY A;  2CSF A;  3OQM A;  4PU3 C;  2FJR A;  2R1J L;  4YG7 B;  4X4F A;  2IVQ A;  1QPZ A;  2GRM A;  3FYM A;  3ZHI A;  2BNO A;  3SCH A;  3LFP A;  2CRO A;  4I6R A;  1EFA A;  1UTX A;  2L8N A;  4Z5D A;  2XIU A;  3TRB A;  3GN5 A;  3H5T A;  4PU7 A;  4F8D A;  3DNV B;  3F52 A;  2R63 A;  3OQN A;  2LYK A;  4FN3 A;  3S8Q A;  1RZR D;  1E3O C;  2LYL A;  2IU7 A;  4YG4 A;  1JWL A;  2PUB A;  1ADR A;  3EUS A;  2XJ3 A;  3QWG A;  2WUS R;  3MLF A;  2PUA A;  3JXD L;  3G5G A;  2PUC A;  4JCY A;  4PU4 C;  2LYS A;  3QF3 A;  2KEK A;  2PUF A;  2HSG A;  2L49 A;  2O38 A;  3B7H A;  4PU8 A;  2AXV A;  1ZPQ A;  3ZKC A;  4X4B A;  1UXC A;  1ZZC A;  4MCT A;  1LQC A;  2JVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...