3F52A

Crystal structure of the clp gene regulator clgr from c. glutamicum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
77
structure length
77
Chain Sequence
EPLLREALGAALRSFRADKGVTLRELAEASRVSPGYLSELERGRKEVSSELLASVCHALGASVADVLIEAAGSMALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the caseinolytic protease gene regulator, a transcriptional activator in actinomycetes
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription activator
molecule keywords clp gene regulator (ClgR)
total genus 27
structure length 77
sequence length 77
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3f52A00
1L1MA 3OQMA 1ZS4A 3VK0A 4X4DA 2WIUB 3SCFA 2BNNA 3JXBC 1IC8A 1E3OC 2O4AA 2XI8A 2WUSR 4I6UA 4I8TA 4Z59A 3JXDL 2XSDC 1WH8A 4YARA 3B7HA 4JQDA 3LISA 3ZKCA 1LCDA 4FBIA 3D1NI 1QP0A 2JCGA 4X4IA 3DNVB 3O9XA 4F8DA 1RIOA 3SCGA 2O49A 4Z5CA 3ZHMA 2KEIA 4Z58A 2IV1A 1RZSA 2D5VA 2AXVA 1LQCA 1OSLA 2PUDA 1SQ8A 2B5AA 4J1WA 2AXZA 1PERL 3L1PA 3U3WA 2PUFA 1LCCA 4PU8A 2LYLA 2XCJA 1ZZ9A 1ZUGA 2AUWA 3BD1A 3QYXA 1JH9A 2PUCA 1UXCA 5K98B 3GN5B 2PUEA 1DWKA 4X4BA 3GN5A 2PE5A 2PUGA 3OQOA 3QF3A 4Y42A 4MCXA 4X4GA 1PRAA 3KJXA 3G7DA 1RPEL 1UXDA 3UFDA 1ZZCA 1Y7YA 4MCTA 2R63A 3ZHIA 3JXCL 2PPXA 1QQAA 2EWTA 3F6WA 4IA8A 4PU3C 3CROL 3R1FA 3OMTA 3QWGA 1CQTA 4FN3A 2L49A 1R69A 4YG7B 4NDWA 4OB4A 1JWLA 4I6RA 3QQ6A 4I6TA 1PNRA 1QPZA 2PUAA 2ICTA 2EF8A 3IVPA 3LFPA 1YSEA 1S7EA 1UTXA 3S8QA 2KEKA 1JFSA 1QP4A 2FJRA 1RZRD 2LCVA 2LYJA 3KXAA 3SCHA 1NEQA 4X4FA 2BNOA 2CROA 2GRMA 2XIUA 2KPJA 2L8NA 1CJGA 1EFAA 2JVLA 2LYKA 1ZZ7A 1POUA 3BDNA 2OFYA 1VPWA 2GRLA 2BNMA 2IU7A 4YG4A 1AU7A 1ZZ8A 2R1JL 4JCYA 1WIZA 2EBYA 3FMYA 1RZRA 1ZVVA 1XWRA 3OP9A 4Z5DA 3OQNA 1WETA 4O8BA 1R63A 2LYPA 1O4XA 3MLFA 2LYRA 2AWIA 5A7LA 3RZZA 2LYSA 2AW6A 3PXPA 3FYAA 4GQMA 4PU7A 3BS3A 1BDIA 1BDHA 2PUBA 2H8RA 3F51A 1NERA 2ICPA 2IVQA 2AXUA 1X2LA 2CSFA 2IVBA 4PU4C 3TRBA 2MEZA 2HINA 3CECA 2XJ3A 2MQKA 3F52A 3G5GA 4IVZA 1QQBA 3EUSA 2OR1L 2HSGA 2PIJA 3GBFA 1ZAYA 1DW9A 1QP7A 2KEJA 1OCTC 2IUOA 4GHJA 1LMB3 2A6CA 4IWRA 1ZZBA 1HF0A 2GZUA 3FYMA 3H5TA 4J1XA 1X57A 1ZPQA 1ZZ6A 4X4HA 1JFTA 4YG1A 1B0NA 1PRVA 1Y9QA 4YBAA 2BJCA 1LLIA 3KZ3A 4JCXA 1ADRA 2O38A 1WH6A 1GT0C 2KZ8A 1PRUA 4X4EA 4Z5HA 4X4CA 3CLCA 2LYQA 2IVGA 3HZIB
chains in the Genus database with same CATH superfamily
3OQMA 2WIUB 5GAGi 2O4AA 2XI8A 3B7HA 3LISA 4EZIA 1LCDA 2KEIA 1RZSA 1OSLA 3A9ZA 1SQ8A 4J1WA 1PERL 3A9XA 2PXTA 2PUFA 1LCCA 2PXVA 1ZUGA 3BD1A 5K98B 2PE5A 3GN5A 2PUGA 1RPEL 1UXDA 4ER6A 4MCTA 2R63A 1QQAA 2EWTA 2LLVA 4YG7B 4EK9A 4ER3A 1UTXA 5DRTA 2PXKA 1CJGA 2JVLA 2PXDA 3PE5A 2OFYA 2IU7A 2R1JL 2PXLA 4O8BA 1O4XA 5A7LA 3FYAA 1BDHA 3QFIA 5DTQA 2PXEA 2IVBA 2MEZA 2OR1L 4IVZA 3EUSA 2PIJA 1ZAYA 1QP7A 1OCTC 3DM5A 2PXPA 3TEPA 2FFHA 1HF0A 1JFTA 1X57A 5DTMA 2BJCA 4YBAA 3KZ3A 5DSXA 2KZ8A 1PRUA 2IVGA 3VK0A 2BNNA 3JXBC 2WUSR 4DE9A 4I8TA 2XSDC 1WH8A 3ZKCA 3D1NI 1RIOA 3SCGA 2AXVA 2PXBA 2J7UA 1LQCA 3U3WA 2XCJA 2AUWA 3GUUA 2PUEA 4X4BA 4Y42A 4EQZA 3KJXA 1ZZCA 3ZHIA 3UWPA 2PPXA 3R1FA 3KL4A 3OMTA 3QWGA 3GZCA 1PNRA 4I6TA 2PUAA 1QPZA 2ICTA 3IVPA 3MEJA 3LFPA 2KEKA 1NW3A 2LYJA 3QOWA 3SCHA 1NEQA 2BNOA 1DULA 2L8NA 1EFAA 2LYKA 5DRYA 1POUA 1HQ1A 1AU7A 4ER5A 4OBMA 3FMYA 1XWRA 2M4HA 3TFLA 3RZZA 3BS3A 2HFZA 3F51A 2ICPA 1X2LA 2CSFA 3G0TA 3TRBA 2HINA 3CECA 2XJ3A 3G5GA 3SX0A 2HSGA 3ME5A 2IUOA 3FYMA 3H5TA 4J1XA 1ZZ6A 1ZPQA 3GZDA 2O49A 4JCXA 2O38A 2XXPA 4X4EA 4X4CA 1RZRA 1L1MA 1ZS4A 3SCFA 1E3OC 2PXFA 4I6UA 4Z59A 4YARA 3TELA 4JQDA 4FBIA 2LLWA 1QP0A 2JCGA 3DNVB 3O9XA 4Z5CA 4Z58A 2D5VA 2PUDA 2B5AA 2AXZA 4PU8A 1ZZ9A 1JH9A 1UXCA 1DWKA 5GAHi 3QF3A 3LQXA 1PRAA 4FN3A 2L49A 2VEOA 4NDWA 4I6RA 2EF8A 4EKIA 1S7EA 3S8QA 1JFSA 1RZRD 3SR4A 2LCVA 5JUWA 3KXAA 4X4FA 1ZZ7A 1VPWA 2GRLA 2BNMA 3M9LA 4HRAA 3A9YA 4JCYA 2EBYA 1ZVVA 3OP9A 4Z5DA 1R63A 3MLFA 2L1PA 2AWIA 2LYRA 4GQMA 4PU7A 2PUBA 2H8RA 2PXUA 2IVQA 2AXUA 1QQBA 2MQKA 4ER0A 1DW9A 2KEJA 2ODRD 5DTRA 4IWRA 2GZUA 4X4HA 4DE8A 4YG1A 1B0NA 1PRVA 5DT2A 1WH6A 2HCSA 1GT0C 3CLCA 4EKGA 2MXDA 2LYQA 3HZIB 4X4DA 1IC8A 3JXDL 4WVLA 4X4IA 4F8DA 3ZHMA 2IV1A 3L1PA 2LYLA 3QYXA 1MFQC 2PUCA 3GN5B 2LNMA 3R09A 3VWSA 3OQOA 4MCXA 4X4GA 3G7DA 3UFDA 1Y7YA 2HCNA 3JXCL 2PXQA 3F6WA 4IA8A 4PU3C 3CROL 1CQTA 1R69A 4OB4A 1JWLA 3QQ6A 1YSEA 1QP4A 2XXQA 3OKZA 2FJRA 3QOXA 3GZDC 2CROA 2GRMA 2XIUA 2KPJA 3BDNA 4YG4A 1ZZ8A 1WIZA 2J7WA 2JQEA 3OQNA 1WETA 2LYPA 3ZPXA 1U2ZA 4ER7A 2LYSA 2AW6A 3PXPA 1BDIA 3NZLA 1NERA 4PU4C 3F52A 2YBDA 3GBFA 1QB2A 4Q2JA 4GHJA 1LMB3 2A6CA 1ZZBA 2XXAA 1Y9QA 1LLIA 3NXHA 3NDBB 1ADRA 3NROA 2V3CC 4Z5HA 3OWQA 1QZXA
chains in the Genus database with same CATH topology
1L1MA 3OQMA 1ZS4A 3VK0A 4X4DA 2WIUB 3SCFA 2BNNA 3JXBC 1IC8A 1E3OC 2O4AA 2XI8A 2WUSR 4I6UA 4I8TA 4Z59A 3JXDL 2XSDC 1WH8A 4YARA 3B7HA 4JQDA 3LISA 3ZKCA 1LCDA 4FBIA 3D1NI 1QP0A 2JCGA 4X4IA 3DNVB 3O9XA 4F8DA 1RIOA 3SCGA 2O49A 4Z5CA 3ZHMA 2KEIA 4Z58A 2IV1A 1RZSA 2D5VA 2AXVA 1LQCA 1OSLA 2PUDA 1SQ8A 2B5AA 4J1WA 2AXZA 1PERL 3L1PA 3U3WA 2PUFA 1LCCA 4PU8A 2LYLA 2XCJA 1ZZ9A 1ZUGA 2AUWA 3BD1A 3QYXA 1JH9A 2PUCA 1UXCA 5K98B 3GN5B 2PUEA 1DWKA 4X4BA 3GN5A 2PE5A 2PUGA 3OQOA 3QF3A 4Y42A 4MCXA 4X4GA 1PRAA 3KJXA 3G7DA 1RPEL 1UXDA 3UFDA 1ZZCA 1Y7YA 4MCTA 2R63A 3ZHIA 3JXCL 2PPXA 1QQAA 2EWTA 3F6WA 4IA8A 4PU3C 3CROL 3R1FA 3OMTA 3QWGA 1CQTA 4FN3A 2L49A 1R69A 4YG7B 4NDWA 4OB4A 1JWLA 4I6RA 3QQ6A 4I6TA 1PNRA 1QPZA 2PUAA 2ICTA 2EF8A 3IVPA 3LFPA 1YSEA 1S7EA 1UTXA 3S8QA 2KEKA 1JFSA 1QP4A 2FJRA 1RZRD 2LCVA 2LYJA 3KXAA 3SCHA 1NEQA 4X4FA 2BNOA 2CROA 2GRMA 2XIUA 2KPJA 2L8NA 1CJGA 1EFAA 2JVLA 2LYKA 1ZZ7A 1POUA 3BDNA 2OFYA 1VPWA 2GRLA 2BNMA 2IU7A 4YG4A 1AU7A 1ZZ8A 2R1JL 4JCYA 1WIZA 2EBYA 3FMYA 1RZRA 1ZVVA 1XWRA 3OP9A 4Z5DA 3OQNA 1WETA 4O8BA 1R63A 2LYPA 1O4XA 3MLFA 2LYRA 2AWIA 5A7LA 3RZZA 2LYSA 2AW6A 3PXPA 3FYAA 4GQMA 4PU7A 3BS3A 1BDIA 1BDHA 2PUBA 2H8RA 3F51A 1NERA 2ICPA 2IVQA 2AXUA 1X2LA 2CSFA 2IVBA 4PU4C 3TRBA 2MEZA 2HINA 3CECA 2XJ3A 2MQKA 3F52A 3G5GA 4IVZA 1QQBA 3EUSA 2OR1L 2HSGA 2PIJA 3GBFA 1ZAYA 1DW9A 1QP7A 2KEJA 1OCTC 2IUOA 4GHJA 1LMB3 2A6CA 4IWRA 1ZZBA 1HF0A 2GZUA 3FYMA 3H5TA 4J1XA 1X57A 1ZPQA 1ZZ6A 4X4HA 1JFTA 4YG1A 1B0NA 1PRVA 1Y9QA 4YBAA 2BJCA 1LLIA 3KZ3A 4JCXA 1ADRA 2O38A 1WH6A 1GT0C 2KZ8A 1PRUA 4X4EA 4Z5HA 4X4CA 3CLCA 2LYQA 2IVGA 3HZIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1M A;  3OQM A;  1ZS4 A;  3VK0 A;  4X4D A;  2WIU B;  3SCF A;  2BNN A;  3JXB C;  1IC8 A;  1E3O C;  2O4A A;  2XI8 A;  2WUS R;  4I6U A;  4I8T A;  4Z59 A;  3JXD L;  2XSD C;  1WH8 A;  4YAR A;  3B7H A;  4JQD A;  3LIS A;  3ZKC A;  1LCD A;  4FBI A;  3D1N I;  1QP0 A;  2JCG A;  4X4I A;  3DNV B;  3O9X A;  4F8D A;  1RIO A;  3SCG A;  2O49 A;  4Z5C A;  3ZHM A;  2KEI A;  4Z58 A;  2IV1 A;  1RZS A;  2D5V A;  2AXV A;  1LQC A;  1OSL A;  2PUD A;  1SQ8 A;  2B5A A;  4J1W A;  2AXZ A;  1PER L;  3L1P A;  3U3W A;  2PUF A;  1LCC A;  4PU8 A;  2LYL A;  2XCJ A;  1ZZ9 A;  1ZUG A;  2AUW A;  3BD1 A;  3QYX A;  1JH9 A;  2PUC A;  1UXC A;  5K98 B;  3GN5 B;  2PUE A;  1DWK A;  4X4B A;  3GN5 A;  2PE5 A;  2PUG A;  3OQO A;  3QF3 A;  4Y42 A;  4MCX A;  4X4G A;  1PRA A;  3KJX A;  3G7D A;  1RPE L;  1UXD A;  3UFD A;  1ZZC A;  1Y7Y A;  4MCT A;  2R63 A;  3ZHI A;  3JXC L;  2PPX A;  1QQA A;  2EWT A;  3F6W A;  4IA8 A;  4PU3 C;  3CRO L;  3R1F A;  3OMT A;  3QWG A;  1CQT A;  4FN3 A;  2L49 A;  1R69 A;  4YG7 B;  4NDW A;  4OB4 A;  1JWL A;  4I6R A;  3QQ6 A;  4I6T A;  1PNR A;  1QPZ A;  2PUA A;  2ICT A;  2EF8 A;  3IVP A;  3LFP A;  1YSE A;  1S7E A;  1UTX A;  3S8Q A;  2KEK A;  1JFS A;  1QP4 A;  2FJR A;  1RZR D;  2LCV A;  2LYJ A;  3KXA A;  3SCH A;  1NEQ A;  4X4F A;  2BNO A;  2CRO A;  2GRM A;  2XIU A;  2KPJ A;  2L8N A;  1CJG A;  1EFA A;  2JVL A;  2LYK A;  1ZZ7 A;  1POU A;  3BDN A;  2OFY A;  1VPW A;  2GRL A;  2BNM A;  2IU7 A;  4YG4 A;  1AU7 A;  1ZZ8 A;  2R1J L;  4JCY A;  1WIZ A;  2EBY A;  3FMY A;  1RZR A;  1ZVV A;  1XWR A;  3OP9 A;  4Z5D A;  3OQN A;  1WET A;  4O8B A;  1R63 A;  2LYP A;  1O4X A;  3MLF A;  2LYR A;  2AWI A;  5A7L A;  3RZZ A;  2LYS A;  2AW6 A;  3PXP A;  3FYA A;  4GQM A;  4PU7 A;  3BS3 A;  1BDI A;  1BDH A;  2PUB A;  2H8R A;  3F51 A;  1NER A;  2ICP A;  2IVQ A;  2AXU A;  1X2L A;  2CSF A;  2IVB A;  4PU4 C;  3TRB A;  2MEZ A;  2HIN A;  3CEC A;  2XJ3 A;  2MQK A;  3F52 A;  3G5G A;  4IVZ A;  1QQB A;  3EUS A;  2OR1 L;  2HSG A;  2PIJ A;  3GBF A;  1ZAY A;  1DW9 A;  1QP7 A;  2KEJ A;  1OCT C;  2IUO A;  4GHJ A;  1LMB 3;  2A6C A;  4IWR A;  1ZZB A;  1HF0 A;  2GZU A;  3FYM A;  3H5T A;  4J1X A;  1X57 A;  1ZPQ A;  1ZZ6 A;  4X4H A;  1JFT A;  4YG1 A;  1B0N A;  1PRV A;  1Y9Q A;  4YBA A;  2BJC A;  1LLI A;  3KZ3 A;  4JCX A;  1ADR A;  2O38 A;  1WH6 A;  1GT0 C;  2KZ8 A;  1PRU A;  4X4E A;  4Z5H A;  4X4C A;  3CLC A;  2LYQ A;  2IVG A;  3HZI B; 
#chains in the Genus database with same CATH topology
 3OQM A;  2WIU B;  5GAG i;  2O4A A;  2XI8 A;  3B7H A;  3LIS A;  4EZI A;  1LCD A;  2KEI A;  1RZS A;  1OSL A;  3A9Z A;  1SQ8 A;  4J1W A;  1PER L;  3A9X A;  2PXT A;  2PUF A;  1LCC A;  2PXV A;  1ZUG A;  3BD1 A;  5K98 B;  2PE5 A;  3GN5 A;  2PUG A;  1RPE L;  1UXD A;  4ER6 A;  4MCT A;  2R63 A;  1QQA A;  2EWT A;  2LLV A;  4YG7 B;  4EK9 A;  4ER3 A;  1UTX A;  5DRT A;  2PXK A;  1CJG A;  2JVL A;  2PXD A;  3PE5 A;  2OFY A;  2IU7 A;  2R1J L;  2PXL A;  4O8B A;  1O4X A;  5A7L A;  3FYA A;  1BDH A;  3QFI A;  5DTQ A;  2PXE A;  2IVB A;  2MEZ A;  2OR1 L;  4IVZ A;  3EUS A;  2PIJ A;  1ZAY A;  1QP7 A;  1OCT C;  3DM5 A;  2PXP A;  3TEP A;  2FFH A;  1HF0 A;  1JFT A;  1X57 A;  5DTM A;  2BJC A;  4YBA A;  3KZ3 A;  5DSX A;  2KZ8 A;  1PRU A;  2IVG A;  3VK0 A;  2BNN A;  3JXB C;  2WUS R;  4DE9 A;  4I8T A;  2XSD C;  1WH8 A;  3ZKC A;  3D1N I;  1RIO A;  3SCG A;  2AXV A;  2PXB A;  2J7U A;  1LQC A;  3U3W A;  2XCJ A;  2AUW A;  3GUU A;  2PUE A;  4X4B A;  4Y42 A;  4EQZ A;  3KJX A;  1ZZC A;  3ZHI A;  3UWP A;  2PPX A;  3R1F A;  3KL4 A;  3OMT A;  3QWG A;  3GZC A;  1PNR A;  4I6T A;  2PUA A;  1QPZ A;  2ICT A;  3IVP A;  3MEJ A;  3LFP A;  2KEK A;  1NW3 A;  2LYJ A;  3QOW A;  3SCH A;  1NEQ A;  2BNO A;  1DUL A;  2L8N A;  1EFA A;  2LYK A;  5DRY A;  1POU A;  1HQ1 A;  1AU7 A;  4ER5 A;  4OBM A;  3FMY A;  1XWR A;  2M4H A;  3TFL A;  3RZZ A;  3BS3 A;  2HFZ A;  3F51 A;  2ICP A;  1X2L A;  2CSF A;  3G0T A;  3TRB A;  2HIN A;  3CEC A;  2XJ3 A;  3G5G A;  3SX0 A;  2HSG A;  3ME5 A;  2IUO A;  3FYM A;  3H5T A;  4J1X A;  1ZZ6 A;  1ZPQ A;  3GZD A;  2O49 A;  4JCX A;  2O38 A;  2XXP A;  4X4E A;  4X4C A;  1RZR A;  1L1M A;  1ZS4 A;  3SCF A;  1E3O C;  2PXF A;  4I6U A;  4Z59 A;  4YAR A;  3TEL A;  4JQD A;  4FBI A;  2LLW A;  1QP0 A;  2JCG A;  3DNV B;  3O9X A;  4Z5C A;  4Z58 A;  2D5V A;  2PUD A;  2B5A A;  2AXZ A;  4PU8 A;  1ZZ9 A;  1JH9 A;  1UXC A;  1DWK A;  5GAH i;  3QF3 A;  3LQX A;  1PRA A;  4FN3 A;  2L49 A;  2VEO A;  4NDW A;  4I6R A;  2EF8 A;  4EKI A;  1S7E A;  3S8Q A;  1JFS A;  1RZR D;  3SR4 A;  2LCV A;  5JUW A;  3KXA A;  4X4F A;  1ZZ7 A;  1VPW A;  2GRL A;  2BNM A;  3M9L A;  4HRA A;  3A9Y A;  4JCY A;  2EBY A;  1ZVV A;  3OP9 A;  4Z5D A;  1R63 A;  3MLF A;  2L1P A;  2AWI A;  2LYR A;  4GQM A;  4PU7 A;  2PUB A;  2H8R A;  2PXU A;  2IVQ A;  2AXU A;  1QQB A;  2MQK A;  4ER0 A;  1DW9 A;  2KEJ A;  2ODR D;  5DTR A;  4IWR A;  2GZU A;  4X4H A;  4DE8 A;  4YG1 A;  1B0N A;  1PRV A;  5DT2 A;  1WH6 A;  2HCS A;  1GT0 C;  3CLC A;  4EKG A;  2MXD A;  2LYQ A;  3HZI B;  4X4D A;  1IC8 A;  3JXD L;  4WVL A;  4X4I A;  4F8D A;  3ZHM A;  2IV1 A;  3L1P A;  2LYL A;  3QYX A;  1MFQ C;  2PUC A;  3GN5 B;  2LNM A;  3R09 A;  3VWS A;  3OQO A;  4MCX A;  4X4G A;  3G7D A;  3UFD A;  1Y7Y A;  2HCN A;  3JXC L;  2PXQ A;  3F6W A;  4IA8 A;  4PU3 C;  3CRO L;  1CQT A;  1R69 A;  4OB4 A;  1JWL A;  3QQ6 A;  1YSE A;  1QP4 A;  2XXQ A;  3OKZ A;  2FJR A;  3QOX A;  3GZD C;  2CRO A;  2GRM A;  2XIU A;  2KPJ A;  3BDN A;  4YG4 A;  1ZZ8 A;  1WIZ A;  2J7W A;  2JQE A;  3OQN A;  1WET A;  2LYP A;  3ZPX A;  1U2Z A;  4ER7 A;  2LYS A;  2AW6 A;  3PXP A;  1BDI A;  3NZL A;  1NER A;  4PU4 C;  3F52 A;  2YBD A;  3GBF A;  1QB2 A;  4Q2J A;  4GHJ A;  1LMB 3;  2A6C A;  1ZZB A;  2XXA A;  1Y9Q A;  1LLI A;  3NXH A;  3NDB B;  1ADR A;  3NRO A;  2V3C C;  4Z5H A;  3OWQ A;  1QZX A; 
#chains in the Genus database with same CATH homology
 1L1M A;  3OQM A;  1ZS4 A;  3VK0 A;  4X4D A;  2WIU B;  3SCF A;  2BNN A;  3JXB C;  1IC8 A;  1E3O C;  2O4A A;  2XI8 A;  2WUS R;  4I6U A;  4I8T A;  4Z59 A;  3JXD L;  2XSD C;  1WH8 A;  4YAR A;  3B7H A;  4JQD A;  3LIS A;  3ZKC A;  1LCD A;  4FBI A;  3D1N I;  1QP0 A;  2JCG A;  4X4I A;  3DNV B;  3O9X A;  4F8D A;  1RIO A;  3SCG A;  2O49 A;  4Z5C A;  3ZHM A;  2KEI A;  4Z58 A;  2IV1 A;  1RZS A;  2D5V A;  2AXV A;  1LQC A;  1OSL A;  2PUD A;  1SQ8 A;  2B5A A;  4J1W A;  2AXZ A;  1PER L;  3L1P A;  3U3W A;  2PUF A;  1LCC A;  4PU8 A;  2LYL A;  2XCJ A;  1ZZ9 A;  1ZUG A;  2AUW A;  3BD1 A;  3QYX A;  1JH9 A;  2PUC A;  1UXC A;  5K98 B;  3GN5 B;  2PUE A;  1DWK A;  4X4B A;  3GN5 A;  2PE5 A;  2PUG A;  3OQO A;  3QF3 A;  4Y42 A;  4MCX A;  4X4G A;  1PRA A;  3KJX A;  3G7D A;  1RPE L;  1UXD A;  3UFD A;  1ZZC A;  1Y7Y A;  4MCT A;  2R63 A;  3ZHI A;  3JXC L;  2PPX A;  1QQA A;  2EWT A;  3F6W A;  4IA8 A;  4PU3 C;  3CRO L;  3R1F A;  3OMT A;  3QWG A;  1CQT A;  4FN3 A;  2L49 A;  1R69 A;  4YG7 B;  4NDW A;  4OB4 A;  1JWL A;  4I6R A;  3QQ6 A;  4I6T A;  1PNR A;  1QPZ A;  2PUA A;  2ICT A;  2EF8 A;  3IVP A;  3LFP A;  1YSE A;  1S7E A;  1UTX A;  3S8Q A;  2KEK A;  1JFS A;  1QP4 A;  2FJR A;  1RZR D;  2LCV A;  2LYJ A;  3KXA A;  3SCH A;  1NEQ A;  4X4F A;  2BNO A;  2CRO A;  2GRM A;  2XIU A;  2KPJ A;  2L8N A;  1CJG A;  1EFA A;  2JVL A;  2LYK A;  1ZZ7 A;  1POU A;  3BDN A;  2OFY A;  1VPW A;  2GRL A;  2BNM A;  2IU7 A;  4YG4 A;  1AU7 A;  1ZZ8 A;  2R1J L;  4JCY A;  1WIZ A;  2EBY A;  3FMY A;  1RZR A;  1ZVV A;  1XWR A;  3OP9 A;  4Z5D A;  3OQN A;  1WET A;  4O8B A;  1R63 A;  2LYP A;  1O4X A;  3MLF A;  2LYR A;  2AWI A;  5A7L A;  3RZZ A;  2LYS A;  2AW6 A;  3PXP A;  3FYA A;  4GQM A;  4PU7 A;  3BS3 A;  1BDI A;  1BDH A;  2PUB A;  2H8R A;  3F51 A;  1NER A;  2ICP A;  2IVQ A;  2AXU A;  1X2L A;  2CSF A;  2IVB A;  4PU4 C;  3TRB A;  2MEZ A;  2HIN A;  3CEC A;  2XJ3 A;  2MQK A;  3F52 A;  3G5G A;  4IVZ A;  1QQB A;  3EUS A;  2OR1 L;  2HSG A;  2PIJ A;  3GBF A;  1ZAY A;  1DW9 A;  1QP7 A;  2KEJ A;  1OCT C;  2IUO A;  4GHJ A;  1LMB 3;  2A6C A;  4IWR A;  1ZZB A;  1HF0 A;  2GZU A;  3FYM A;  3H5T A;  4J1X A;  1X57 A;  1ZPQ A;  1ZZ6 A;  4X4H A;  1JFT A;  4YG1 A;  1B0N A;  1PRV A;  1Y9Q A;  4YBA A;  2BJC A;  1LLI A;  3KZ3 A;  4JCX A;  1ADR A;  2O38 A;  1WH6 A;  1GT0 C;  2KZ8 A;  1PRU A;  4X4E A;  4Z5H A;  4X4C A;  3CLC A;  2LYQ A;  2IVG A;  3HZI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...