3F52A

Crystal structure of the clp gene regulator clgr from c. glutamicum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
77
structure length
77
Chain Sequence
EPLLREALGAALRSFRADKGVTLRELAEASRVSPGYLSELERGRKEVSSELLASVCHALGASVADVLIEAAGSMALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the caseinolytic protease gene regulator, a transcriptional activator in actinomycetes
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription activator
molecule keywords clp gene regulator (ClgR)
total genus 27
structure length 77
sequence length 77
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3f52A00
3VK0A 3R1FA 4J1WA 2MQKA 4YG7B 4X4IA 1QQAA 4Z5HA 4FN3A 4O8BA 3OQNA 1LCCA 1LLIA 2PUBA 3CLCA 2WUSR 1DWKA 1PRAA 3BD1A 2O4AA 4MCTA 1ZS4A 2PUFA 2O49A 3CROL 1WH6A 2HINA 1RIOA 2GRLA 1SQ8A 3HZIB 3O9XA 3FYAA 2GRMA 2BNNA 3ZKCA 2EBYA 4YBAA 3DNVB 1BDHA 2XCJA 2AUWA 2KZ8A 4PU7A 3ZHIA 4X4DA 3U3WA 1ZVVA 2A6CA 4J1XA 4PU8A 1JH9A 1OCTC 1DW9A 2D5VA 4GHJA 2PUGA 2WIUB 2AXZA 4FBIA 2BNOA 3JXBC 3QQ6A 2B5AA 3RZZA 1NEQA 2LYRA 1LMB3 3OQOA 3F51A 3LFPA 3PXPA 2R63A 3BS3A 3GN5B 1XWRA 3F6WA 3LISA 4X4CA 1S7EA 2XSDC 2KEKA 1E3OC 3ZHMA 1O4XA 2BNMA 1BDIA 2AXVA 2IVGA 2MEZA 2PUCA 2L8NA 1RZRD 1RZRA 1ZZ9A 1PRUA 1ZUGA 3FYMA 3KZ3A 3OMTA 1VPWA 1GT0C 1RPEL 1ZZ8A 2LYSA 1LCDA 2JVLA 3JXDL 3B7HA 2PPXA 4Z59A 4YG1A 2IV1A 2KEJA 1B0NA 2ICPA 2IVQA 4GQMA 1X2LA 4IA8A 2LYJA 2BJCA 2AW6A 4X4HA 2R1JL 4Z5DA 1X57A 1L1MA 1POUA 1WIZA 2KPJA 2OR1L 4X4BA 1PNRA 2XI8A 3EUSA 2FJRA 3BDNA 4I8TA 2KEIA 4YARA 4F8DA 4Z5CA 4YG4A 3IVPA 3KJXA 3S8QA 4MCXA 1RZSA 3QYXA 4Z58A 3GN5A 1ZZCA 2PUAA 1ZZ7A 1ZZBA 3UFDA 2IU7A 2PIJA 1UXCA 3L1PA 2AXUA 2HSGA 4IWRA 3D1NI 3KXAA 3MLFA 2AWIA 4I6TA 2JCGA 4NDWA 1PERL 1QPZA 1WH8A 2XJ3A 4PU4C 1ZZ6A 2CROA 4IVZA 4X4GA 4PU3C 2PUEA 1ADRA 4X4EA 5A7LA 4I6RA 5K98B 1NERA 1UTXA 2O38A 1CQTA 1EFAA 2ICTA 2LYLA 2XIUA 2CSFA 3QWGA 1Y9QA 2LYQA 4I6UA 3SCGA 4JCYA 1UXDA 1QP0A 2PE5A 1WETA 1QP7A 3TRBA 1R63A 2IUOA 4OB4A 2PUDA 2OFYA 4Y42A 1QQBA 1R69A 1ZAYA 1JFTA 3SCFA 1YSEA 3JXCL 2L49A 2EF8A 1AU7A 1ZPQA 3CECA 4X4FA 1JFSA 3SCHA 4JQDA 3OQMA 3QF3A 3OP9A 1PRVA 3H5TA 1OSLA 1Y7YA 2LYKA 1JWLA 3FMYA 3G5GA 1HF0A 1CJGA 2LCVA 3F52A 1QP4A 2H8RA 4JCXA 1LQCA 2GZUA 3G7DA 1IC8A 3GBFA 2EWTA 2IVBA 2LYPA
chains in the Genus database with same CATH superfamily
3VK0A 1QQAA 3OQNA 4O8BA 1LCCA 1DWKA 3QOXA 3CROL 3O9XA 3NROA 3NZLA 2HCNA 2LLWA 4J1XA 1OCTC 1DW9A 2PUGA 2AXZA 2LYRA 3F51A 3LFPA 2R63A 3PE5A 4OBMA 2BNMA 2IVGA 2MEZA 3A9YA 3A9ZA 2JVLA 4GQMA 4X4HA 4Z5DA 1X57A 1WIZA 1PNRA 2FJRA 2KEIA 4F8DA 3TELA 1RZSA 3QYXA 4DE9A 2PUAA 5DT2A 2J7WA 2IU7A 2PIJA 2HSGA 3GZCA 4IWRA 3D1NI 5GAGi 2PXBA 4NDWA 2XJ3A 4PU4C 4PU3C 4X4GA 4X4EA 5A7LA 2XXPA 1U2ZA 3SCGA 4Q2JA 3OWQA 2VEOA 2ODRD 1QP7A 3TRBA 2IUOA 2PUDA 2OFYA 4Y42A 1R69A 1ZAYA 2M4HA 1JFTA 3G0TA 3TFLA 2PXUA 3SCHA 3OP9A 2OR1L 3FMYA 1QZXA 2LCVA 2PXDA 3GBFA 3R1FA 4J1WA 2MQKA 1LLIA 3QOWA 1PRAA 4EQZA 3BD1A 2O49A 1WH6A 2HINA 1RIOA 3FYAA 2GRMA 2BNNA 3ZKCA 2EBYA 4YBAA 2AUWA 2KZ8A 3U3WA 3ZHIA 3MEJA 1ZVVA 2A6CA 3QQ6A 3ME5A 1LMB3 3OQOA 1NW3A 3PXPA 3GN5B 3F6WA 4EZIA 2KEKA 2PXTA 1E3OC 1BDIA 1RZRD 1RZRA 1ZZ9A 1MFQC 1GT0C 3VWSA 1B0NA 2ICPA 2LYJA 2AW6A 2R1JL 1POUA 4X4BA 4I8TA 3SR4A 3GN5A 2XXAA 1ZZ7A 1ZZBA 3L1PA 3UWPA 2HFZA 3KXAA 1QPZA 1ZZ6A 2CROA 4IVZA 2PUEA 1ADRA 2PXKA 4I6RA 5K98B 1CQTA 1EFAA 1QB2A 1UXDA 1QP0A 2PE5A 1WETA 4ER0A 4DE8A 3SCFA 1AU7A 5DSXA 1JFSA 2PXFA 3OQMA 1OSLA 1JWLA 1QP4A 4JCXA 1IC8A 5DRTA 4X4IA 4Z5HA 2WUSR 4ER3A 3GZDA 2O4AA 4WVLA 3LQXA 2MXDA 2XCJA 4PU7A 4PU8A 1JH9A 4GHJA 4FBIA 3JXBC 2B5AA 1NEQA 3ZPXA 4X4CA 1XWRA 1HQ1A 1S7EA 2XSDC 1O4XA 2AXVA 2PUCA 2L8NA 3KZ3A 1PRUA 3OMTA 1RPEL 2LYSA 3JXDL 2PPXA 3R09A 4YG1A 2IV1A 4IA8A 1L1MA 2KPJA 4EKGA 2XI8A 3BDNA 4YARA 4YG4A 3KJXA 3S8QA 4MCXA 5DTQA 1ZZCA 3UFDA 5GAHi 1UXCA 3MLFA 4I6TA 2JCGA 1PERL 1WH8A 4EK9A 5JUWA 2ICTA 2LYLA 2XIUA 3NDBB 3QWGA 1Y9QA 4I6UA 1R63A 4OB4A 1YSEA 3SX0A 3JXCL 2EF8A 4X4FA 2PXPA 4JQDA 1LCDA 3QF3A 1Y7YA 2LYKA 1HF0A 2JQEA 2J7UA 2FFHA 4YG7B 4FN3A 2PUBA 3CLCA 2PXQA 2PXLA 2LLVA 4MCTA 1ZS4A 2PUFA 3QFIA 2GRLA 1SQ8A 3HZIB 2XXQA 4ER5A 1BDHA 3DNVB 3A9XA 4X4DA 2D5VA 5DTMA 2WIUB 2BNOA 4EKIA 3RZZA 3BS3A 2V3CC 3LISA 3ZHMA 2LNMA 2L1PA 1ZUGA 2YBDA 3FYMA 1VPWA 4ER6A 5DTRA 1ZZ8A 3B7HA 4Z59A 2KEJA 2BJCA 2IVQA 1X2LA 2PXVA 3EUSA 4Z5CA 3IVPA 4HRAA 4Z58A 3M9LA 3OKZA 1DULA 2AXUA 3NXHA 2AWIA 3TEPA 1NERA 1UTXA 2O38A 4JCYA 2CSFA 2LYQA 1QQBA 3GZDC 3GUUA 3DM5A 3KL4A 2L49A 2HCSA 1ZPQA 3CECA 2PXEA 1PRVA 3H5TA 1CJGA 2H8RA 3G5GA 3F52A 1LQCA 5DRYA 2GZUA 3G7DA 4ER7A 2EWTA 2IVBA 2LYPA
chains in the Genus database with same CATH topology
3VK0A 3R1FA 4J1WA 2MQKA 4YG7B 4X4IA 1QQAA 4Z5HA 4FN3A 4O8BA 3OQNA 1LCCA 1LLIA 2PUBA 3CLCA 2WUSR 1DWKA 1PRAA 3BD1A 2O4AA 4MCTA 1ZS4A 2PUFA 2O49A 3CROL 1WH6A 2HINA 1RIOA 2GRLA 1SQ8A 3HZIB 3O9XA 3FYAA 2GRMA 2BNNA 3ZKCA 2EBYA 4YBAA 3DNVB 1BDHA 2XCJA 2AUWA 2KZ8A 4PU7A 3ZHIA 4X4DA 3U3WA 1ZVVA 2A6CA 4J1XA 4PU8A 1JH9A 1OCTC 1DW9A 2D5VA 4GHJA 2PUGA 2WIUB 2AXZA 4FBIA 2BNOA 3JXBC 3QQ6A 2B5AA 3RZZA 1NEQA 2LYRA 1LMB3 3OQOA 3F51A 3LFPA 3PXPA 2R63A 3BS3A 3GN5B 1XWRA 3F6WA 3LISA 4X4CA 1S7EA 2XSDC 2KEKA 1E3OC 3ZHMA 1O4XA 2BNMA 1BDIA 2AXVA 2IVGA 2MEZA 2PUCA 2L8NA 1RZRD 1RZRA 1ZZ9A 1PRUA 1ZUGA 3FYMA 3KZ3A 3OMTA 1VPWA 1GT0C 1RPEL 1ZZ8A 2LYSA 1LCDA 2JVLA 3JXDL 3B7HA 2PPXA 4Z59A 4YG1A 2IV1A 2KEJA 1B0NA 2ICPA 2IVQA 4GQMA 1X2LA 4IA8A 2LYJA 2BJCA 2AW6A 4X4HA 2R1JL 4Z5DA 1X57A 1L1MA 1POUA 1WIZA 2KPJA 2OR1L 4X4BA 1PNRA 2XI8A 3EUSA 2FJRA 3BDNA 4I8TA 2KEIA 4YARA 4F8DA 4Z5CA 4YG4A 3IVPA 3KJXA 3S8QA 4MCXA 1RZSA 3QYXA 4Z58A 3GN5A 1ZZCA 2PUAA 1ZZ7A 1ZZBA 3UFDA 2IU7A 2PIJA 1UXCA 3L1PA 2AXUA 2HSGA 4IWRA 3D1NI 3KXAA 3MLFA 2AWIA 4I6TA 2JCGA 4NDWA 1PERL 1QPZA 1WH8A 2XJ3A 4PU4C 1ZZ6A 2CROA 4IVZA 4X4GA 4PU3C 2PUEA 1ADRA 4X4EA 5A7LA 4I6RA 5K98B 1NERA 1UTXA 2O38A 1CQTA 1EFAA 2ICTA 2LYLA 2XIUA 2CSFA 3QWGA 1Y9QA 2LYQA 4I6UA 3SCGA 4JCYA 1UXDA 1QP0A 2PE5A 1WETA 1QP7A 3TRBA 1R63A 2IUOA 4OB4A 2PUDA 2OFYA 4Y42A 1QQBA 1R69A 1ZAYA 1JFTA 3SCFA 1YSEA 3JXCL 2L49A 2EF8A 1AU7A 1ZPQA 3CECA 4X4FA 1JFSA 3SCHA 4JQDA 3OQMA 3QF3A 3OP9A 1PRVA 3H5TA 1OSLA 1Y7YA 2LYKA 1JWLA 3FMYA 3G5GA 1HF0A 1CJGA 2LCVA 3F52A 1QP4A 2H8RA 4JCXA 1LQCA 2GZUA 3G7DA 1IC8A 3GBFA 2EWTA 2IVBA 2LYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VK0 A;  3R1F A;  4J1W A;  2MQK A;  4YG7 B;  4X4I A;  1QQA A;  4Z5H A;  4FN3 A;  4O8B A;  3OQN A;  1LCC A;  1LLI A;  2PUB A;  3CLC A;  2WUS R;  1DWK A;  1PRA A;  3BD1 A;  2O4A A;  4MCT A;  1ZS4 A;  2PUF A;  2O49 A;  3CRO L;  1WH6 A;  2HIN A;  1RIO A;  2GRL A;  1SQ8 A;  3HZI B;  3O9X A;  3FYA A;  2GRM A;  2BNN A;  3ZKC A;  2EBY A;  4YBA A;  3DNV B;  1BDH A;  2XCJ A;  2AUW A;  2KZ8 A;  4PU7 A;  3ZHI A;  4X4D A;  3U3W A;  1ZVV A;  2A6C A;  4J1X A;  4PU8 A;  1JH9 A;  1OCT C;  1DW9 A;  2D5V A;  4GHJ A;  2PUG A;  2WIU B;  2AXZ A;  4FBI A;  2BNO A;  3JXB C;  3QQ6 A;  2B5A A;  3RZZ A;  1NEQ A;  2LYR A;  1LMB 3;  3OQO A;  3F51 A;  3LFP A;  3PXP A;  2R63 A;  3BS3 A;  3GN5 B;  1XWR A;  3F6W A;  3LIS A;  4X4C A;  1S7E A;  2XSD C;  2KEK A;  1E3O C;  3ZHM A;  1O4X A;  2BNM A;  1BDI A;  2AXV A;  2IVG A;  2MEZ A;  2PUC A;  2L8N A;  1RZR D;  1RZR A;  1ZZ9 A;  1PRU A;  1ZUG A;  3FYM A;  3KZ3 A;  3OMT A;  1VPW A;  1GT0 C;  1RPE L;  1ZZ8 A;  2LYS A;  1LCD A;  2JVL A;  3JXD L;  3B7H A;  2PPX A;  4Z59 A;  4YG1 A;  2IV1 A;  2KEJ A;  1B0N A;  2ICP A;  2IVQ A;  4GQM A;  1X2L A;  4IA8 A;  2LYJ A;  2BJC A;  2AW6 A;  4X4H A;  2R1J L;  4Z5D A;  1X57 A;  1L1M A;  1POU A;  1WIZ A;  2KPJ A;  2OR1 L;  4X4B A;  1PNR A;  2XI8 A;  3EUS A;  2FJR A;  3BDN A;  4I8T A;  2KEI A;  4YAR A;  4F8D A;  4Z5C A;  4YG4 A;  3IVP A;  3KJX A;  3S8Q A;  4MCX A;  1RZS A;  3QYX A;  4Z58 A;  3GN5 A;  1ZZC A;  2PUA A;  1ZZ7 A;  1ZZB A;  3UFD A;  2IU7 A;  2PIJ A;  1UXC A;  3L1P A;  2AXU A;  2HSG A;  4IWR A;  3D1N I;  3KXA A;  3MLF A;  2AWI A;  4I6T A;  2JCG A;  4NDW A;  1PER L;  1QPZ A;  1WH8 A;  2XJ3 A;  4PU4 C;  1ZZ6 A;  2CRO A;  4IVZ A;  4X4G A;  4PU3 C;  2PUE A;  1ADR A;  4X4E A;  5A7L A;  4I6R A;  5K98 B;  1NER A;  1UTX A;  2O38 A;  1CQT A;  1EFA A;  2ICT A;  2LYL A;  2XIU A;  2CSF A;  3QWG A;  1Y9Q A;  2LYQ A;  4I6U A;  3SCG A;  4JCY A;  1UXD A;  1QP0 A;  2PE5 A;  1WET A;  1QP7 A;  3TRB A;  1R63 A;  2IUO A;  4OB4 A;  2PUD A;  2OFY A;  4Y42 A;  1QQB A;  1R69 A;  1ZAY A;  1JFT A;  3SCF A;  1YSE A;  3JXC L;  2L49 A;  2EF8 A;  1AU7 A;  1ZPQ A;  3CEC A;  4X4F A;  1JFS A;  3SCH A;  4JQD A;  3OQM A;  3QF3 A;  3OP9 A;  1PRV A;  3H5T A;  1OSL A;  1Y7Y A;  2LYK A;  1JWL A;  3FMY A;  3G5G A;  1HF0 A;  1CJG A;  2LCV A;  3F52 A;  1QP4 A;  2H8R A;  4JCX A;  1LQC A;  2GZU A;  3G7D A;  1IC8 A;  3GBF A;  2EWT A;  2IVB A;  2LYP A; 
#chains in the Genus database with same CATH topology
 3VK0 A;  1QQA A;  3OQN A;  4O8B A;  1LCC A;  1DWK A;  3QOX A;  3CRO L;  3O9X A;  3NRO A;  3NZL A;  2HCN A;  2LLW A;  4J1X A;  1OCT C;  1DW9 A;  2PUG A;  2AXZ A;  2LYR A;  3F51 A;  3LFP A;  2R63 A;  3PE5 A;  4OBM A;  2BNM A;  2IVG A;  2MEZ A;  3A9Y A;  3A9Z A;  2JVL A;  4GQM A;  4X4H A;  4Z5D A;  1X57 A;  1WIZ A;  1PNR A;  2FJR A;  2KEI A;  4F8D A;  3TEL A;  1RZS A;  3QYX A;  4DE9 A;  2PUA A;  5DT2 A;  2J7W A;  2IU7 A;  2PIJ A;  2HSG A;  3GZC A;  4IWR A;  3D1N I;  5GAG i;  2PXB A;  4NDW A;  2XJ3 A;  4PU4 C;  4PU3 C;  4X4G A;  4X4E A;  5A7L A;  2XXP A;  1U2Z A;  3SCG A;  4Q2J A;  3OWQ A;  2VEO A;  2ODR D;  1QP7 A;  3TRB A;  2IUO A;  2PUD A;  2OFY A;  4Y42 A;  1R69 A;  1ZAY A;  2M4H A;  1JFT A;  3G0T A;  3TFL A;  2PXU A;  3SCH A;  3OP9 A;  2OR1 L;  3FMY A;  1QZX A;  2LCV A;  2PXD A;  3GBF A;  3R1F A;  4J1W A;  2MQK A;  1LLI A;  3QOW A;  1PRA A;  4EQZ A;  3BD1 A;  2O49 A;  1WH6 A;  2HIN A;  1RIO A;  3FYA A;  2GRM A;  2BNN A;  3ZKC A;  2EBY A;  4YBA A;  2AUW A;  2KZ8 A;  3U3W A;  3ZHI A;  3MEJ A;  1ZVV A;  2A6C A;  3QQ6 A;  3ME5 A;  1LMB 3;  3OQO A;  1NW3 A;  3PXP A;  3GN5 B;  3F6W A;  4EZI A;  2KEK A;  2PXT A;  1E3O C;  1BDI A;  1RZR D;  1RZR A;  1ZZ9 A;  1MFQ C;  1GT0 C;  3VWS A;  1B0N A;  2ICP A;  2LYJ A;  2AW6 A;  2R1J L;  1POU A;  4X4B A;  4I8T A;  3SR4 A;  3GN5 A;  2XXA A;  1ZZ7 A;  1ZZB A;  3L1P A;  3UWP A;  2HFZ A;  3KXA A;  1QPZ A;  1ZZ6 A;  2CRO A;  4IVZ A;  2PUE A;  1ADR A;  2PXK A;  4I6R A;  5K98 B;  1CQT A;  1EFA A;  1QB2 A;  1UXD A;  1QP0 A;  2PE5 A;  1WET A;  4ER0 A;  4DE8 A;  3SCF A;  1AU7 A;  5DSX A;  1JFS A;  2PXF A;  3OQM A;  1OSL A;  1JWL A;  1QP4 A;  4JCX A;  1IC8 A;  5DRT A;  4X4I A;  4Z5H A;  2WUS R;  4ER3 A;  3GZD A;  2O4A A;  4WVL A;  3LQX A;  2MXD A;  2XCJ A;  4PU7 A;  4PU8 A;  1JH9 A;  4GHJ A;  4FBI A;  3JXB C;  2B5A A;  1NEQ A;  3ZPX A;  4X4C A;  1XWR A;  1HQ1 A;  1S7E A;  2XSD C;  1O4X A;  2AXV A;  2PUC A;  2L8N A;  3KZ3 A;  1PRU A;  3OMT A;  1RPE L;  2LYS A;  3JXD L;  2PPX A;  3R09 A;  4YG1 A;  2IV1 A;  4IA8 A;  1L1M A;  2KPJ A;  4EKG A;  2XI8 A;  3BDN A;  4YAR A;  4YG4 A;  3KJX A;  3S8Q A;  4MCX A;  5DTQ A;  1ZZC A;  3UFD A;  5GAH i;  1UXC A;  3MLF A;  4I6T A;  2JCG A;  1PER L;  1WH8 A;  4EK9 A;  5JUW A;  2ICT A;  2LYL A;  2XIU A;  3NDB B;  3QWG A;  1Y9Q A;  4I6U A;  1R63 A;  4OB4 A;  1YSE A;  3SX0 A;  3JXC L;  2EF8 A;  4X4F A;  2PXP A;  4JQD A;  1LCD A;  3QF3 A;  1Y7Y A;  2LYK A;  1HF0 A;  2JQE A;  2J7U A;  2FFH A;  4YG7 B;  4FN3 A;  2PUB A;  3CLC A;  2PXQ A;  2PXL A;  2LLV A;  4MCT A;  1ZS4 A;  2PUF A;  3QFI A;  2GRL A;  1SQ8 A;  3HZI B;  2XXQ A;  4ER5 A;  1BDH A;  3DNV B;  3A9X A;  4X4D A;  2D5V A;  5DTM A;  2WIU B;  2BNO A;  4EKI A;  3RZZ A;  3BS3 A;  2V3C C;  3LIS A;  3ZHM A;  2LNM A;  2L1P A;  1ZUG A;  2YBD A;  3FYM A;  1VPW A;  4ER6 A;  5DTR A;  1ZZ8 A;  3B7H A;  4Z59 A;  2KEJ A;  2BJC A;  2IVQ A;  1X2L A;  2PXV A;  3EUS A;  4Z5C A;  3IVP A;  4HRA A;  4Z58 A;  3M9L A;  3OKZ A;  1DUL A;  2AXU A;  3NXH A;  2AWI A;  3TEP A;  1NER A;  1UTX A;  2O38 A;  4JCY A;  2CSF A;  2LYQ A;  1QQB A;  3GZD C;  3GUU A;  3DM5 A;  3KL4 A;  2L49 A;  2HCS A;  1ZPQ A;  3CEC A;  2PXE A;  1PRV A;  3H5T A;  1CJG A;  2H8R A;  3G5G A;  3F52 A;  1LQC A;  5DRY A;  2GZU A;  3G7D A;  4ER7 A;  2EWT A;  2IVB A;  2LYP A; 
#chains in the Genus database with same CATH homology
 3VK0 A;  3R1F A;  4J1W A;  2MQK A;  4YG7 B;  4X4I A;  1QQA A;  4Z5H A;  4FN3 A;  4O8B A;  3OQN A;  1LCC A;  1LLI A;  2PUB A;  3CLC A;  2WUS R;  1DWK A;  1PRA A;  3BD1 A;  2O4A A;  4MCT A;  1ZS4 A;  2PUF A;  2O49 A;  3CRO L;  1WH6 A;  2HIN A;  1RIO A;  2GRL A;  1SQ8 A;  3HZI B;  3O9X A;  3FYA A;  2GRM A;  2BNN A;  3ZKC A;  2EBY A;  4YBA A;  3DNV B;  1BDH A;  2XCJ A;  2AUW A;  2KZ8 A;  4PU7 A;  3ZHI A;  4X4D A;  3U3W A;  1ZVV A;  2A6C A;  4J1X A;  4PU8 A;  1JH9 A;  1OCT C;  1DW9 A;  2D5V A;  4GHJ A;  2PUG A;  2WIU B;  2AXZ A;  4FBI A;  2BNO A;  3JXB C;  3QQ6 A;  2B5A A;  3RZZ A;  1NEQ A;  2LYR A;  1LMB 3;  3OQO A;  3F51 A;  3LFP A;  3PXP A;  2R63 A;  3BS3 A;  3GN5 B;  1XWR A;  3F6W A;  3LIS A;  4X4C A;  1S7E A;  2XSD C;  2KEK A;  1E3O C;  3ZHM A;  1O4X A;  2BNM A;  1BDI A;  2AXV A;  2IVG A;  2MEZ A;  2PUC A;  2L8N A;  1RZR D;  1RZR A;  1ZZ9 A;  1PRU A;  1ZUG A;  3FYM A;  3KZ3 A;  3OMT A;  1VPW A;  1GT0 C;  1RPE L;  1ZZ8 A;  2LYS A;  1LCD A;  2JVL A;  3JXD L;  3B7H A;  2PPX A;  4Z59 A;  4YG1 A;  2IV1 A;  2KEJ A;  1B0N A;  2ICP A;  2IVQ A;  4GQM A;  1X2L A;  4IA8 A;  2LYJ A;  2BJC A;  2AW6 A;  4X4H A;  2R1J L;  4Z5D A;  1X57 A;  1L1M A;  1POU A;  1WIZ A;  2KPJ A;  2OR1 L;  4X4B A;  1PNR A;  2XI8 A;  3EUS A;  2FJR A;  3BDN A;  4I8T A;  2KEI A;  4YAR A;  4F8D A;  4Z5C A;  4YG4 A;  3IVP A;  3KJX A;  3S8Q A;  4MCX A;  1RZS A;  3QYX A;  4Z58 A;  3GN5 A;  1ZZC A;  2PUA A;  1ZZ7 A;  1ZZB A;  3UFD A;  2IU7 A;  2PIJ A;  1UXC A;  3L1P A;  2AXU A;  2HSG A;  4IWR A;  3D1N I;  3KXA A;  3MLF A;  2AWI A;  4I6T A;  2JCG A;  4NDW A;  1PER L;  1QPZ A;  1WH8 A;  2XJ3 A;  4PU4 C;  1ZZ6 A;  2CRO A;  4IVZ A;  4X4G A;  4PU3 C;  2PUE A;  1ADR A;  4X4E A;  5A7L A;  4I6R A;  5K98 B;  1NER A;  1UTX A;  2O38 A;  1CQT A;  1EFA A;  2ICT A;  2LYL A;  2XIU A;  2CSF A;  3QWG A;  1Y9Q A;  2LYQ A;  4I6U A;  3SCG A;  4JCY A;  1UXD A;  1QP0 A;  2PE5 A;  1WET A;  1QP7 A;  3TRB A;  1R63 A;  2IUO A;  4OB4 A;  2PUD A;  2OFY A;  4Y42 A;  1QQB A;  1R69 A;  1ZAY A;  1JFT A;  3SCF A;  1YSE A;  3JXC L;  2L49 A;  2EF8 A;  1AU7 A;  1ZPQ A;  3CEC A;  4X4F A;  1JFS A;  3SCH A;  4JQD A;  3OQM A;  3QF3 A;  3OP9 A;  1PRV A;  3H5T A;  1OSL A;  1Y7Y A;  2LYK A;  1JWL A;  3FMY A;  3G5G A;  1HF0 A;  1CJG A;  2LCV A;  3F52 A;  1QP4 A;  2H8R A;  4JCX A;  1LQC A;  2GZU A;  3G7D A;  1IC8 A;  3GBF A;  2EWT A;  2IVB A;  2LYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...