1VPWA

Structure of the purr mutant, l54m, bound to hypoxanthine and purf operator dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSMKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of PurR mutant L54M shows an alternative route to DNA kinking.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 119
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1998-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1vpwA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpwA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpwA02
2LYSA 3N8IA 3QLVA 3LTEA 2HPHA 2GZUA 3SM9A 3S8QA 4ZYLA 3ZHIA 4MS3A 3DLBA 1PNTA 1VRVA 3A0RB 3EDCA 1P8AA 2FMIA 4DQDA 3P9YA 3HSYA 4MR9B 5KC8A 8ABPA 4J1WA 2RGYA 1QP4A 3OLXA 1SXIA 1GUDA 4O5AA 4Q6WA 3A0UA 4WWHA 3UK0A 3RH0A 2PL1A 4EYKA 4F8DA 5JNWA 4RWEA 4CBVA 3BRQA 1BDHA 2RJNA 1K66A 1L5YA 3O1HB 2MYNA 2KZ8A 4GHJA 3CG4A 4XFKA 4NV3A 1XHFA 2H3HA 1Y1LA 4ETIA 4B09A 1UDRA 3RVSA 4E7OA 3PXPA 3EUSA 3HM9A 2IVBA 2E4UA 1XWWA 2IVQA 2NZUG 1FFWA 2FLWA 4NICA 4H3KB 2CHFA 3GA5A 3I5AA 3QEMB 2PJUA 5FWYB 1NATA 4YCSA 2JVJA 1VPWA 2LYKA 4S05A 2A6CA 1MB0A 4FBIA 1NXVA 2E4WA 2HQRA 2NT4A 5TPZA 3CNBA 1QQAA 2GBPA 3QYXA 3R0JA 2B5AA 5DKFA 1JL3A 2JVLA 2NUBA 4RS3A 1RZSA 3QLTA 1ZY2A 4RXMA 3JY6A 4RK7A 3SAJA 5KWSA 5T3YA 1KRWA 2FMHA 4KV7A 3EAFA 4YARA 2FXIA 4PE5B 4NCAA 3DGEC 1KGSA 3GN5A 2QU7A 3NNNA 2LUOA 4MS1A 3M6MD 3C3MA 1VKRA 1T34A 1Y9QA 5A7LA 3K4HA 4Z4GA 2IDMA 1P2FA 3UUGA 3LMKA 3G1WA 4Z58A 1USGA 3D02A 3DGFC 2L2QA 3N0WA 4W5QA 3KLNA 3F6WA 3VK0A 2F8TA 2J48A 3HZIB 3G5GA 4JB0A 2KYRA 2PAFA 4XXHA 1URPA 1VLZA 2R63A 2PUEA 1PEYA 3B2NA 2VUHB 2GWRA 3DNVB 4YGXB 2R47A 1ZDMA 4E7PA 3IPAA 4MAAA 6ABPA 2WJAA 1HEYA 2IVGA 3JVIA 2E4VA 1JYEA 5EWJA 1OXKB 2OQRA 9ABPA 2XSDC 5JNVA 2R4QA 3CG0A 1AU7A 4EYOA 3KS9A 2KEKA 1NXPA 3H6GA 4RY0A 4RDCA 3RQIA 4N41A 1E6KA 3A10A 2ICTA 4NDWA 4Z5DA 3HV2A 1GLGA 3HDVA 1Z2DA 2AW6A 1JFVA 1GCGA 4Z9AA 5GOTA 3GN5B 5IUKC 1RZRA 2XJ3A 4IA8A 2MYTA 3E3MA 3E61A 2GRMA 2WMYA 1JLKA 3NHMA 5GQSA 3FFWA 3RVPA 1NXWA 3H1EA 3RVMA 4N76A 2E4ZA 1KMIY 4N0PA 1MVOA 1YS6A 2RJOA 3MF4A 2AYXA 1ZGGA 3O2SB 1BDJA 4KVFA 1LCCA 4XARA 1ZESA 1Y7YA 2A9RA 4L85A 1F4VA 1TMYA 2MYPA 3H5OA 2R48A 3MMNA 1RXIA 3LFPA 2QVCA 5TQ2A 3QWGA 4DADA 3O75A 4LX8A 4ZMSA 3R1FA 2O49A 4YWHA 2NZVG 4Z4IA 1FFGA 3TMYA 1ADRA 2A9OA 4IILA 5C5EA 3Q41A 5TE9A 1DG9A 3SCFA 2PMCA 4MS3B 3F73A 3QLVC 4RU1A 1ZPQA 1GUBA 2ZWMA 2IOYA 2A9PA 4X4IA 3F7NA 3KXAA 3BREA 1Z12A 1PNRA 3KLOA 1PHRA 1XHEA 3GL9A 1Z25A 3SCGA 3H5LA 4FE7A 4G97A 4LE1A 3OP9A 1ABEA 5KC9A 3CFYA 1YK1A 1D1PA 5K98B 4M88A 3OM1A 5TQ0B 2PUAA 3RVJA 1UXCA 1SD5A 3BD1A 3N75A 3QELB 4PICA 4YLEA 3FYMA 1BVHA 3DBIA 1QQBA 1ZUGA 2AWIA 1FSPA 3Q15C 1AB6A 2GKGA 2QZJA 3C6QA 2O38A 4F12A 2JK1A 3MLFA 1CQTA 4H3HB 5EWMB 1PEAA 4RKRA 3JXCL 5DGCA 5JS2A 4YV7A 1XWRA 3ROFA 6CHYA 1DJMA 3N0XA 3LKVA 4LE2A 2BJCA 2FLKA 2EWTA 2LYJA 2BNNA 3OO1A 3T38A 3OMWA 4N47A 3QF3A 3LUCA 4HNSA 5EWLB 4G0PA 3RVRA 1PRVA 2OENG 4OLBA 1PRUA 3HS3A 3I42A 1EWVA 3MYYA 5KI6A 1QP0A 1JF8A 5IUNC 1YTUA 1ZITA 1L1MA 4Z0NA 1ZH4A 4EYGA 3JS5A 3I09A 4RXUA 1DBWA 5TPZD 1JH9A 3FFXA 4PU7A 4KZKA 1H9CA 3LUHA 4G0ZA 2ID7A 3ZKCA 1JWLA 2IYNA 1M5UA 3FMYA 4X4BA 1ZZCA 4WZZA 4O1HA 2JRLA 2QXYA 1YSEA 3BBLA 3KTOA 4EVRA 2F8SA 3SNKA 1ZZ6A 1YS7A 1RZRD 1LMB3 3LUFA 4Z99A 1JDPA 7ABPA 4G0OA 2CHEA 4W5RA 1JFTA 1A2OA 2RDMA 3EULA 3URMA 3EGCA 2PIJA 4Z4CA 5KQLA 4JQDA 1MIHA 2QR3A 5EWJB 3H1GA 2JVKA 3CU5A 1U2PA 5DCLA 3B7HA 3T95A 1L5ZA 3C3WA 4KREA 3CLKA 2MEZA 2XDYA 2W42A 4PU8A 2GI4A 4D6XA 5EWLA 3LISA 3CTPA 1IC8A 2MYUA 3DLHA 3Q9SA 1SXGA 1Z26A 2PE5A 3RVQA 1YIOA 4QYMA 1NERA 2KEJA 1U2QA 3O1JC 4WXEA 2KEIA 4MS4B 4IWRA 3F51A 3H6HA 4LDAA 1YMVA 3T8YA 4OLAA 3M9XA 4Q7EA 3HXMA 1ZN2A 5HKOA 1TJYA 1IIBA 3GBVA 3GBFA 4ZPJA 2FEWB 2FJRA 2QVGA 3BDNA 4MLDA 2IUOA 2P9HA 3UKJA 4Y42A 4JOQA 1Z13A 3O9XA 1S7EA 4G0YA 3F52A 1WH8A 4I6RA 1GT0C 3OM0A 3CECA 3GYBA 3O1IC 4IRXA 1SQ8A 1EHCA 2JVIA 4RK5A 1POUA 3CZCA 4MQEB 2YHBA 1J56A 4GQMA 3U3WA 5IULC 2WRZA 3HEBA 4EVQA 5IX8A 3I45A 5JNTA 1FQWA 1HF0A 4MR9A 3TD9A 3SG0A 5JS1A 3NNDA 3KZ3A 4Z5CA 4YG7B 3JPYA 4IMJB 2WUSR 4YG1A 1CJGA 1LQCA 1PUXA 1ZVVA 2E4YA 4MYRA 4Z4EA 4EUKA 1ZZBA 3FMVA 4MPTA 2PUCA 3OLZA 1B00A 4JCXA 4W5OA 3DZDA 1B0NA 4MR8A 1MB3A 4EYQA 3LUGA 4JP1A 5ED4A 4LZLA 1ZHHA 2QV0A 4D74A 2XIUA 1W9HA 3JPWA 1TLFA 3KKEA 4W5NA 3D8UA 1JYFA 3RVLA 3QX8A 1U04A 4G0XA 4MQFA 4H60A 2IPMA 4YG4A 2N9UA 4UHKA 3C97A 4RZSA 3H5IA 5CNKA 2KPJA 3MQ4A 3BRSA 3KYJB 4YS6A 5IUJC 3MA0A 3KG2A 2CD7A 1P6QA 4OB4A 1USKA 3IPCA 3KJXA 2IV1A 3KYIB 4TMYA 5IEBA 4FB4A 2QSJA 5B3JC 3D1NI 1DC8A 3GWGA 2LP4Y 3HK2A 2JBAB 2L19A 3LUDA 2WWVD 5BR1A 4F8JA 3HO1A 3HDGA 3OMXA 3GV0A 3JVDA 5BRAA 3IVPA 5FBKA 2VYCA 3OLVA 2WIUB 4KPYA 2AUWA 4EY3A 2FQXA 1CEYA 2LYLA 2IPLA 1RPEL 2JCGA 1BA2A 4RSMA 1FFSA 3EQ2A 2L17A 3NHZA 4MR8B 1EFAA 3F6CA 3RVOA 3CROL 1KRXA 4MRMB 3HUTA 3GRCA 2ID9A 2FN9A 3OLYA 5IC5A 1ISSA 3OMTA 2OFYA 4ETNA 1E2BA 4W5TA 1O4XA 2LYQA 4YRZA 2PL9A 1NXOA 3MIZA 4RY9A 4DN6A 1M5TA 5JNSA 4HYEA 4MQFB 2PLNA 1QPZA 3TO5A 1USIA 4Q6BA 5FWXB 1GCAA 1I3CA 3M9WA 4LE0A 1ZZ7A 3KCNA 3RVKA 2LPMA 2BNOA 2OR1L 2HQOA 4YO7A 4I6TA 5TPWA 2MSLA 2NT3A 3QQ6A 1ZZ8A 2FMFA 2FEPA 4JB2A 3N53A 1C0EA 1D4ZA 3CRNA 3Q7TA 4G86A 2L8NA 4P1ZA 3CLCA 3SCHA 4RY8A 4TN5A 2CSFA 1R8JA 3CS3A 2FQWA 4MS1B 4OTZA 3MM4A 1BAPA 1DBQA 3LOPA 3EQZA 3RVNA 1DRKA 3BS3A 4D6YA 1X2LA 3OO0A 4XLTA 4YR7A 1NTRA 2VUIB 3LKBA 2HQBA 2FTKE 5CHYA 1EWTA 3RZZA 3TB6A 1NY5A 3IP5A 4EVSA 3LFTA 2Q5CA 1R63A 1LJUA 3FGZA 3N6VA 1U0SY 3SQNA 1RNLA 1PRAA 3NBMA 3HUUA 1RIOA 1ABFA 2FMKA 3A3KA 3BILA 4PEVA 1JDNA 5DTEA 4EGSA 1R69A 2PKXA 5E3JA 2X7XA 3FFTA 1DBPA 4RK0A 5KQMA 4KFCA 2AYZA 1CYEA 1A0OA 3JTEA 2D5VA 1RXEA 4NCBA 3ROTA 2EF8A 4X4FA 3G85A 2FSPA 4JAVC 3H1FA 1MAVA 3LUKA 2PUFA 4Z9BA 2GX6A 2I6FA 2LYRA 2WY2D 4FE4A 1E6MA 3H5TA 3H5VA 4QICA 5B3JA 1JBEA 2ZAYA 1NEQA 2AXUA 1E3OC 1LBIA 2YHAA 1QKKA 4IF4A 1U8TA 3GBPA 2IPAB 2H8RA 5DLEA 3Q7SA 4RK6A 4X4CA 3TX6A 2B1JA 3W9SA 4FN3A 4TLLB 2FEKA 2BNMA 1YVUA 1F51E 4KMRA 4MR7B 2L49A 1OCTC 2HSGA 2LIVA 2VK2A 3LUJA 5HSGA 4ZJPA 2MSWA 4X4GA 4LRQA 3L1PA 4L4UA 1ZGZA 1OXBB 4ML3A 4RK4A 3SY8A 1D2AA 1NXSA 4RKQA 4Z4HA 4XASA 4OG2A 3ZHMA 4YP9A 4KQCA 5CNIA 1Z2EA 3FDFA 1DRJA 4MGEA 1RPJA 2R1JL 2O20A 5IEJA 1M2FA 1ZAYA 4X4DA 2FKAA 1TM2A 5EWMA 1NXTA 1W25A 3L49A 2PPXA 1DW9A 4O8BA 1CHNA 2A9QA 2MSKA 4GNRA 3VNAA 2QW1A 1QO0D 3CZ5A 3LUAA 1ZH2A 3N0RA 5HM6A 2O4AA 3L6UA 4PU4C 1DC7A 3CKMA 4X4EA 3IDOA 3ILHA 4OATA 1LCDA 1C4WA 4G0QA 3ILYA 2JBAA 5PNTA 2P4UA 3O2QB 3G7DA 3KSMA 3VNBA 4QYWA 1JX6A 1YMUA 3HCWA 4HNRA 4KQ9A 1JHZA 1PERL 3S99A 4J1XA 3K9CA 4LDZA 1DZ3A 3CHYA 3HZHA 4JA2A 5BQ3A 1WH6A 2XI8A 1YK0A 3QELA 1WETA 2GRLA 2MQKA 1NXXA 1E6LA 4IMIB 5FWYA 2ICPA 1X57A 4MRMA 1LBHA 4WXMA 5CNJA 3QLUA 4Z5HA 1DWKA 3OQOA 4I6UA 4JCYA 1QO0A 2V0NA 1D5WA 3EODA 4RV5A 3F6PA 4MLCA 5FBHA 5JNUA 3QK7A 3IP7A 4O1IA 5T7BA 2PUGA 3HVRA 1S8NA 5FWXA 4Z4FA 2BGGA 2M1ZA 1UTXA 3T6KA 2M98A 2AXVA 4Z59A 3OQNA 1DCMA 4I8TA 3JXDL 4MCXA 5JNRA 2AXZA 2LCVA 4P98A 5BRJA 4QPJC 4PZ0A 3O21A 4RK1A 4N0QA 1QP7A 3H75A 1Z15A 2R25B 2PUDA 2WJWA 3IP6A 3Q7RA 4XAQA 3H5WA 2CROA 1P6UA 1D1QA 4ETMA 1LJLA 2CWDA 1UXDA 3IP9A 2E4XA 4N03A 1EWKA 4F3TA 1DP4A 2LBPA 4KK4A 4X4HA 1Z17A 2LYPA 1Z18A 1WIZA 4OBBA 1A04A 2L18A 1OSLA 2PUBA 1LK0A 4MCTA 3OLWA 1EAYA 1LLIA 5HQJA 1ZS4A 4UHJA 3TRBA 1DCKA 3KHTA 4GPAA 2HJ9A 2IKSA 3C3KA 5D2CA 1TVMA 5I4CA 5TPWB 2IU7A 1JFSA 1ISRA 4MQEA 2FQYA 4F11A 3UFDA 2FVYA 2WB4A 5KQPA 1ZZ9A 4WUTA 2H0AA 5F64A 4HNQA 2IPNA 3NNSA 4S04A 4KRFA 2TMYA 3FYAA 4MS4A 4RXTA 2HINA 3OQMA 2DRIA 2JB9A 4PU3C 5KQGA 4G0MA 1K68A 1QMPA 4ZMRA 4MR7A 1APBA 2B4AA 3QEKA 1Z16A 4IGAA 4NQRA 2FW0A 3O2JA 4F06A 5ABPA 5TQ0A 3HJFA 1BDIA 4PYRA 4KNYA 3GT7A 1SRRA 5TQJA 1SXHA 5CNMA 3QEMA 4YBAA 5IBQA 4TLMB 4IVZA 1DCFA 4KK3A 3QLUC 4WT7A 4Y9TA 2XCJA 4JASB 5C5CA 3QX9A 1M2EA 2EBYA 5TQ2B 3JXBC 1AB5A 3EJWA 2FN8A 3O74A 1QNLA
chains in the Genus database with same CATH superfamily
4B9AA 2GZUA 1V2GA 4LZNA 2YFKA 1RKUA 3ZDAA 1IN8A 2XZOA 1XCOA 1JAYA 4Z6KA 2EJCA 1FL9A 4WVFA 4P9NA 4X3PA 4EATA 3TUZC 1V48A 2GLTA 3GFPA 3TW4A 3OLXA 1SXIA 1IXZA 2PX5A 3EVEA 4NU8X 4RLQA 3IUYA 5H70A 3IQXA 3KT3A 1AKTA 2ZRBA 4LXHA 3RNLA 4BBJA 2Z8XA 2HK9A 4QQNA 1V8BA 4PHTA 4RHUA 4CM9A 3C15C 3MWDA 4W1RA 3LW7A 1NBAA 4D46A 4J2TA 4A82A 2GYYA 3ABSB 1KFCB 3FH0A 4M7RA 2AFHE 4EUHA 4MX8A 4EW1A 3WHLA 2VYFA 1A4UA 4RD2A 4NICA 3WBFA 1LB1B 4FFPA 3B52X 2HQRA 3AERB 5G0WA 1HE2A 3VM6A 3AF5A 3LCRA 3R0JA 1QH9A 4C9BA 1AV7A 5DULA 2BDEA 2NGRA 1F6WA 2WKQA 3QQPA 1VYVA 4QULA 4QELA 4MVJA 2XA2A 2VDWB 4R69A 2RGBA 4P53A 2GPYA 3GN5A 1TEVA 1DOAA 2Z58A 1K06A 4KAJA 2LUOA 1JDSA 2HCFA 4MS1A 4C2AA 3ZS8A 4ND8B 1E7QA 4QBKA 1CQIB 2CZGA 1F4LA 1EGAA 1SKMA 1Q7RA 1C4XA 3R3XA 3VK0A 4HDNA 2X1HA 2E6UX 4PSVA 3HZIB 3DTVD 1KETA 2W11A 3PVZA 4TSFA 1T6BY 2NZJA 1FW8A 1UKEA 5FA8A 4DMLA 2QUIA 2J32A 2V0GA 1LEHA 4PQFA 2V4ZA 4RMNA 1IZ8A 2ZBEA 3ITEA 3L9WA 3ME5A 4J0FA 4P08A 3ZDXB 3LQRA 1A76A 4HLQB 2WJAA 4MB2A 5I4KA 3UT6A 3S1SA 1DVRA 4PSKA 4MROA 5E9JA 1Q1AA 2PRYA 4W5WA 4IDGA 4JJEA 2NVBA 3FKSD 3ICCA 4YROA 5LDDC 5F9FA 5DBHX 2ADOA 3RROA 1XJQA 4MEBA 4JOBA 5IW8A 4BMNA 1STOA 4EAAA 5IMSA 1PTKA 5IBCA 1QF6A 1RABA 2GWHA 3FI9A 3L0YA 3S0JA 1OB5A 5JJKA 4OQDA 1UUFA 3DZ8A 5LB2A 1Y37A 2IKQA 3HKCB 4H0FA 2I99A 3HXLA 3OQBA 4G63A 1UDBA 5IWAB 4FX5A 2PXLA 1H2AS 1N6LA 2WTXA 1RRKA 4MVJM 1UM9A 3W6UA 2ZJ6A 2WMYA 4DMMA 3FX2A 1BHQ1 3NHMA 4XJTA 2JW5A 3H1EA 4GWLA 2Q1WA 1M34A 1FU7A 4QYIA 5ALHA 1YOVA 2IHYA 2RHLA 1U2TA 1XZMA 5ALYA 2HYIC 1Y3BE 4AJ1A 2BD0A 5BSWA 3NS7A 4TVOA 3UPUA 4QM6A 5KHLB 2P3SA 3VHLB 3CY6A 1UXHA 2XB8A 3GOQA 3RASA 3TBHA 4N8DA 4DZZA 1DT3A 1OI7A 4G4IA 1AN9A 4CT0A 1PR3A 1ZW1A 3ONEA 3HXKA 4YAEA 3EIWA 4X64B 4Z4IA 3TMYA 2HCRA 1P0PA 3GDHA 1HX7A 3R40A 3IEPA 2GZAA 4L8FA 1NVGA 1QGUA 1CJCA 3E9ZA 3H9CA 3S1AB 3F73A 1E3WB 1QS0A 3CNHA 5JQGF 1KSFX 1WZIA 4FBMA 1N2HA 3EMVA 2O8NA 3BREA 1U7XA 1PNRA 2HWYA 1PHRA 4CHTA 5K0FA 3DE0X 3ZLTA 1DEHA 5B1SA 4N39A 4LE1A 5I9BA 4G97A 1FNSA 3E9CA 3ZKWB 2M6SA 1P1JA 1YK1A 5EMLA 3EIXA 1X7YA 2ZRAA 1PS8A 1SD5A 1XWIA 5P21A 5BUCA 3LXMA 1IXSB 1EEXB 1QYXA 2C42A 2IXGA 2ECPA 2ZDGA 3PNSA 3DBIA 4TTJA 3WBJA 2AWIA 3WGVA 1DE0A 3ZY3A 3Q15C 9GPBA 3NTUA 4U6SA 3RYIB 3M6VA 1ADBA 2Y0BA 3FB4A 1PEAA 5KTSA 1I2CA 1T5DX 1JB9A 2FXVA 4BFZA 2Q4RA 5CXSA 4YUAA 2FLKA 2LYJA 2C9ZA 4XVRA 4LC9A 2BOVA 5T67A 1OASA 5GJCA 2MCFA 1VE5A 4ALIA 3H18A 3BXFA 4NMXB 1GNQA 2H18A 4BZQA 2G9UA 1K27A 2FUKA 4RMIA 3RIHA 2CLDX 4MW6A 2QTNA 1L1MA 3UMMA 4Z0NA 1TUEA 1EBFA 5C8YA 4FOPA 3V2GA 4DDMA 4JJAA 3JAKA 1KIAA 3SZLA 1NJ6A 4R1SA 5BVGB 1FJ2A 3QY9A 5KSZA 1Y5LA 1IQUA 4PS1A 5IM4F 3TUIC 3LX8A 4P92A 5JWHA 4OHOA 2QL9A 3LHFA 3AQIA 2XKBA 4QXQA 1X42A 2IDZA 1HV8A 1Z22A 2C78A 3HR8A 1C7JA 4GS5A 2VG8A 3Q4GA 4EM6A 4YMWA 1JFTA 1KO5A 3WGQA 5EJ6A 1LS1A 3T1HB 3QG1A 2IY9A 2P68A 1J1ZA 1UQRA 1P2SA 3K05A 1UXJA 3HNRA 4IX1A 4P82A 1ZMTA 4IHKA 4P3OA 4DYHA 3LVQE 1CLUA 4YRDA 4EEZA 5BNTA 2YINC 3W5VA 3H1GA 3JYLA 1N1GA 1CY8A 3OA0A 4U0JA 3UJDA 5CGQB 3K2BA 2BJVA 5FOTA 4EDHA 4EBBA 3BHNA 4UTPA 2MEZA 1G55A 4PNHA 4F7DA 2HBRA 1FS5A 5AW2A 2VS1A 2WTMA 2A9KA 1G66A 1VCMA 3Q9LA 3DLHA 5KYXB 1R3DA 3OCVA 1U90A 3ROPA 1RC0A 2FH5B 2QAIA 3L8FA 4ZRDA 2QMUA 5JRDS 3GNQA 5KTKA 5A3SA 4IWRA 3VKGA 4GMXA 1YMVA 3L05A 3RTEA 3UJ9A 3VPHA 3QPBA 1W0KA 3BM5A 3BWMA 3IKJA 4MWBA 5AHOA 4AY4A 4CTJA 3CR8A 1QO9A 3KOWA 1R6TA 4MMYB 4PC3A 5GV7A 2HQ1A 5BMOA 4WZAB 1Q1NA 1ULUA 1F2DA 1PV2A 3EIHA 4L5BA 2FFQA 4AN4A 1Q0TA 2ZBRA 3SSNA 1U2RA 3D2LA 2Y2VA 3CCFA 3MJSA 4JLNA 4QYIB 5IK2A 4ENQA 5BPHA 1L6IA 3FSRA 1YL6A 2GA8A 4DQVA 4E5NA 4AWBA 3K16A 1I94B 3OIDA 5CVUA 1QC5A 3DZKA 2Y1OA 3GYBA 3HJTA 1EHCA 2P40A 4LSMA 3MRTA 2RARA 3VZRA 5E6UB 4MTLA 1M7HA 5H16A 2DUWA 1ZYUA 2CFRA 3L07A 1ZU5A 1C9JA 1ILEA 2YWRA 1I4WA 1JPJA 4DUPA 4AY6A 3LV8A 4RHXA 1OXUA 1AGPA 2BGKA 4C6TA 3O8QA 4R6WA 3E0XA 2J7PD 1EQ2A 3CINA 3O3MB 1PSDA 1PK9A 4CTNA 4V1CI 4OUDA 2W2NA 3JPWA 3WHKA 1JB1A 5F3DA 2UYQA 1HE3A 4XZ3A 1OYYA 4MW2A 5JARA 3L7MA 1REQB 1JHDA 3WGIA 3J7AC 4J4HA 5HS6A 2QK4A 2ALJA 3I6QA 2HRBA 2BUBA 3F9CA 4Q3EA 1ESCA 5HNKA 1CZNA 2K6GA 2FN4A 3PHLA 2V7GA 1A9SA 1K8ZB 1QIEA 1MUUA 3BIWA 2Q5HA 3QKSA 5BXYA 2OK7A 3KJXA 1XQ6A 1EUDA 4ETWA 4TRMA 3DAHA 3ORRA 3T0IA 3GJZA 5TV2A 3HK2A 1SHKA 2ZUBA 3PQ5A 4F8JA 2XQGA 1Q0ZA 4EW2A 1Z5VA 2VYCA 3A1SA 1E2FA 2RAFA 3CKKA 2FQXA 1N25A 2IPLA 3R76A 5ECYA 4EJMA 4BGUA 2C5AA 3Q1KA 4M7OA 4QJ3A 2QU8A 5KWVA 3AFOA 1OF1A 4F38A 1FBTA 3I2JA 3P0EA 4EHIA 1S2NA 1U1IA 4KYUA 3OLYA 3CEHA 1GD1O 2B0JA 3Q9UA 1Q84A 2X5OA 1GU1A 1TW3A 3OTGA 4RCYA 4TKUB 4AK9A 4C7BA 1Y1PA 5JCJD 2J3EA 5K4GA 3U2QA 3OLCX 3FR8A 3HUDA 2HCTA 1EG2A 4UHBA 4K9LA 1ZNQO 4DDHA 2WD7B 2Y0PA 3NO4A 1ZKDA 4I6TA 5TPWA 4DJEC 1K7CA 2PX8A 2PY6A 1D8AA 1OMOA 5KNCA 3N53A 2EDAA 4ZAXA 2V8OA 1NR5A 2GERA 1XJ0A 4BEWA 4PGHA 3PNYA 3RVNA 1JWBB 2VPIA 2ADMA 5CA1F 2Q07A 2YYSA 3MAGA 3TS1A 1T1RA 1U8CB 2EHDA 3VNRA 2ZRQA 3I9V1 3EIEA 3TB6A 5KVCA 1AZTA 3VTKA 3GP8A 2XUFA 2J5RA 1R63A 1LJUA 4HQLA 3SQNA 4BVGA 3WA6A 4IQGA 3IEKA 3SLKA 5C8ZA 4AMYA 3LC0A 3SE7A 3TOZA 1PJRA 4GKJB 4PEVA 5GWXA 4ACBA 2PKXA 4BP9A 4XX0B 3ZDYB 2WINI 2F8LA 2LW7A 2VHWA 2R6FA 4DNOA 4J29A 4ZVKA 1TM1E 2QG9A 4Q01A 3L3BA 3T99A 1FFYA 1DPGA 1JQDA 2E37A 3BOSA 3I37X 2YRFA 4OXKA 3KB8A 2QJTA 1RJFA 1MABB 3JD4A 3WK4A 1KZHA 4BC0A 1P7PA 1ZNZA 3GEIA 3PKZA 2QZZA 5B3JA 2ZAYA 2A94A 4GU5A 4H2DA 3ZOKA 4Z3OA 2ZPTX 2AXUA 1LSSA 4IF4A 4CIVA 1CF2O 2C98A 1A2BA 3TX6A 1FNBA 1BMTA 2JJ2D 5ALLA 4UCWA 2K2WA 3COVA 5FPQA 4DHWA 1ZD4A 1Q1EA 2P79A 3B6JA 2VRBA 3HV0A 4ZK6A 1XMQB 3TGLA 4RLHA 4D8WA 3O8DA 2X6TA 4GVLA 1YNSA 2WW8A 1QHFA 4OYHA 3UWSA 1ZGZA 3PSAA 1B7GO 4ZA2A 3QWAA 3D6HA 2PKYX 3KPWA 3KKLA 2AMVA 3OZAA 4CKBA 3MBKA 3D43A 1HURA 4YASA 4L7QA 1HEUA 4MEJA 1VB5A 1Z2EA 7MDHA 4IQFA 4JYPA 1A8QA 1HL7A 4XQ9A 4FFBB 4D4IA 1EYZA 3BHJA 1ICIA 3CLUC 1DBRA 3N2NA 2QN8A 3NT2A 5B2FA 3FLBA 5FHRA 2X40A 5IKEA 2RHHA 1UOEA 1GPBA 5HS4A 4DRYA 3U7QA 3C7KA 4B8ZA 3AB3A 4OATA 1QE3A 2NP6A 3QEOA 5AKIA 4AZSA 3UMJA 1LSOA 4GM0A 5LJIA 3A1CA 4TTVA 5FNVF 3F7MA 3MT0A 1H3FA 4MUFA 4YR9A 3TF5A 4MDEA 1PJQA 3S5UA 1CFZA 5LD2B 1OTHA 3L7AA 4EKGA 1LSJA 2FUCA 3CHYA 4YRIA 1GZSA 4CHGA 1YS2X 4G6ZA 4BN5A 3FCSB 4E70A 2EQ5A 1CVLA 3DWGA 2CLSA 4UREA 4GAEA 3BG5A 3RIYA 3BWYA 2C1ZA 5FWYA 4KIUA 3KQHA 3SJAA 5JVDF 1N2IA 2CXOA 2GO1A 2ZIFA 4YYZA 1WUYA 1RP1A 5LOVF 3R7NA 2ZUFA 4BY9E 3GUHA 1T3LA 5G2OA 3ZGYA 3FNFA 2YWXA 4WW0A 3H7IA 3ZV5A 2Q1SA 4A8JB 1R5NA 2VC2B 3ZD8A 2PUGA 2CHUA 4RVSA 5CM9C 5HRUA 3A70A 3MGAA 3F1LA 2VP5A 1AS2A 2F3PA 5A3JA 3RBXA 2OWDA 5JNRA 3AR8A 5DYYA 4UARA 4S1OA 4KUHA 2YIDA 3REOA 2IITA 1H6CA 4J0IA 2Q6OA 2D54A 4PFJA 3SHWA 4AQDA 1A9XA 4ASUA 4W9MC 3RC8A 1ONBA 1QCCA 2WHPA 2G07A 2IVZA 3EFOA 5U4QA 1D1QA 1K5PA 1FRNA 3OJ0A 1WXQA 3R4CA 1H05A 1XNGA 2FOIA 4Y9DA 1TA4A 2A78A 2GM9A 4HLNA 1OIXA 2X9VA 4FHZA 1XRRA 3HLTA 4FN4A 4DDUA 4R7GA 1DP4A 4AC9A 3F74A 2DWOA 5F52A 1AA9A 4NENA 1C3OA 1OX5A 1JJAA 4OF4A 5E2AA 4QXPA 1Q3HA 1CX9B 5BSRA 3OEWA 3V4ZA 16PKA 4ER3A 4OUKX 4B5LA 4C06A 1EAYA 1FXWF 3RK0A 4JU8A 1DCKA 3MS2A 1E2QA 8MHTA 3QU7A 3RAJA 5JDCC 4F5EA 1ZD8A 3KZ1E 4I4CA 4MI9A 4LDNA 1DIRA 2PPVA 4DJ5X 2WB4A 1ZZGA 2FSVC 1P18A 1VCOA 4B6JA 2JLZA 5F64A 3R5KA 4AQ7A 4JXZA 1B8NA 3M1IA 3N2KB 1GSOA 3DOEA 1O96B 4JI7B 3NKVA 1D2HA 2WWTA 4JUCA 1RBMA 1Y7PA 2PVCA 1E6WA 5AOVA 3O2JA 1NP7A 1QQ7A 4P2GA 5GIPE 3UWMA 4Q82A 1XF9A 3F5SA 3FJOA 5K03A 5DI3B 3VGJA 4QTYA 4IVZA 2GBGA 1TI7A 3JCZA 1YRBA 1KBOA 3UUEA 5CBPA 3TECE 3KSDO 2ONYA 1U3TA 2GBLA 4JASB 4BX9A 4XIIA 5A1JA 5J5AA 5C1DA 1JBQA 3ZXYA 3QUSA 2DH5A 2VSNA 4B85A 4QYSA 4J49A 3QLVA 1OU0A 3LTEA 4UUNA 3ROEA 2B21A 4D9EA 4YRAA 4GZMA 2FW7A 1W5AA 4IVPA 1SB8A 1YDEA 4V0OA 4DQDA 4X8HA 4Y2UA 4F1JA 1NLMA 1VSUA 2R4UA 1XB2A 4YQFA 5LSAA 4Q3NA 1T25A 2RH4A 1GUDA 4M1KA 3V7YA 4RNCA 5IS2A 2MWMA 3QE3A 5HIKA 1BWSA 2XR1A 1XD8A 4WOBA 4XFKA 4NV3A 1XHFA 1SUSA 1D3AA 1U0FA 3UXHA 5JJBA 4HZGA 4KDCA 1SHZA 1X7HA 2JGEA 3HHEA 1DKUA 1JHYA 1TCUA 3AFHA 3R7BA 1G8MA 2P9ZA 1VDMA 2WJ4A 4ND3A 2NVUB 2N47A 3NDRA 2CNLA 5CURA 1L8XA 4ASUD 1T4BA 5FWYB 2W4MA 4BKMA 3RD5A 1WHSA 3S81A 3JYOA 1ND5A 3IO5A 3K1JA 1W4RA 2WF8A 4JVSB 1ZH6A 2VSYA 5AHXA 1QYVA 3PSHA 5A6SB 1RZSA 1W59A 3CZ9A 3AF0A 3S8EA 5FOVA 4MYCA 1ODCA 2I87A 4M8SA 1SCUB 3NGLA 4OFZA 5FPYA 3H9UA 2IYSA 1XQVA 5DZSA 1KAGA 4Y2YA 5HVNA 3H9GA 4JC4A 3JAKB 1KZ9A 1EVJA 1T3GA 5A7LA 4GZLA 1JR2A 2AXPA 1W1UA 3ZI4A 4MJ7A 5SYNA 1EX9A 1YR6A 2AEFA 3O8RA 5CW1A 2Z5GA 5CXXA 3UK0A 2F8TA 1JSZA 3DOUA 1EP2B 3G5GA 3SYKA 4CQMB 3JX9A 1M6VB 1M34B 2G63A 2WIDA 3UK2A 3ET5A 3M6LA 2CSUA 5AXDA 3TB4A 3HO8A 3WL7A 4EKEA 4CU2A 3DNVB 1EEHA 3I6BA 1KI9A 1XD2A 1TU0A 2O0KA 3JWGA 1DMSA 1UZLA 2PVPA 3NGXA 5E2BA 3D5QA 1HEYA 4FFMA 4LJKA 3RYHA 3VX4A 1B6GA 4EEXA 2J9FB 3K5HA 1Y9AA 1XN1A 2HBQA 2HMYB 2WVHA 3OCXA 1ZJZA 4FYXA 4XGRA 3DOCA 1QGUB 1F5SA 3OQVA 4IIBA 4NABA 5DXAA 2GAFA 5KHOC 3NOOA 2WWYA 2Q3JA 3Q40A 4EYEA 1GLGA 1I2BA 1BDMA 2POCA 2R62A 3F97A 1EUZA 1GCGA 1OBVA 2D1RA 2YV5A 4Z9AA 5BPFA 2CV1A 3BGVA 3DZFA 2ZJZA 4IYJA 5DX0A 5L3QB 5KSYA 2ZP1A 2VKQA 1G17A 1JR6A 1WKVA 1ENZA 5HFAA 2X3UA 5TT0A 1IM5A 3UAWA 1W0JD 4CM1A 1HDRA 1HWYA 1LLUA 3IVAA 4TTRA 4AX4A 4BJ6A 4CTKA 5LDHA 2IF0A 2KBEA 2R00C 5F2KA 2BH9A 3EIFA 4Y2RA 4RKFA 4AJOA 3PE5A 1GPYA 2YDYA 4L57A 2QVCA 3KTAA 3QWGA 1ECBA 1JKIA 2DKOA 3KCQA 3NH6A 4UHFA 4NOLA 4TLAA 2G80A 4X54A 1QLWA 1R88A 3FRIA 2A9OA 4Z9YA 4F9FA 3FOCA 3WWYA 3ZIUA 3E9DA 4Y6QA 2BGWA 2HIAA 2WU4A 3ZD7A 3SEZA 1FW6A 2W6ID 4UDXX 5D87A 2CN1A 5C8YB 3FYHA 4JLVA 1YJ5A 1T2EA 4O6VA 1XHEA 3DTYA 5K20A 5JD6A 5L3SB 3EA0A 2Q6VA 4FVTA 4F3YA 3OU7A 4Y6SA 1HETA 2W6QA 2HMAA 2PXTA 2X4IA 1NX6A 2XNHA 3AHHA 3CFYA 3ZHTA 4AXXA 5EIBD 4YT4A 1OLUB 2AMYA 2VDQB 3AVOA 4FLMA 2K7FA 1IAVA 2F3QA 2X3FA 2ZE5A 4DE9A 4L27A 3UMCA 5DNWA 1N7GA 3KRTA 1LX7A 4L9SA 4LIPD 4IICA 4B3XA 1QGZA 2J9GA 3G1TA 2A7XA 2ZAGA 3DL0A 4NOKA 1K3FA 5EWMB 3KOXA 1TRKA 4LQDA 3DNPA 4FD3A 4PX3A 5AW3A 4EMUA 3FPLA 5IMBA 4DT1A 1MHTA 1KJQA 2GHIA 4N47A 1YGPA 2P9EA 1NURA 3QMWA 1YFKA 3ADKA 4PZZA 1J8FA 3LNCA 4PS0A 2ZYRA 3G6KA 4CDMA 5LYJB 3CO0S 3QITA 4BMSA 4Y3UA 2PZGA 3PGVA 4K9RA 2YNMA 2YMLA 3PI6A 3MMPA 3DOHA 3DNFA 5ALZA 5JWOA 1YJXA 1XYGA 2P67A 1E0DA 5EESA 4ZOBA 1JHOA 3FMYA 3AI3A 3ZKWA 3B9BA 1J5PA 1E1MA 4PTZA 4ZAWA 3P27A 4NPCA 5EZSA 3WOVA 1XP5A 3AWIA 4JDUA 3KPYA 3LUFA 2YKGA 4WQMA 4G0OA 2OCKA 2NZ8A 3URMA 3LGSA 1IN1A 4AUKA 2IYYA 2R1VB 2OCAA 1QKIA 1N0WA 4NBUA 3DHVA 3EB9A 4WINA 1NVKA 1HKHA 1QGYA 1TADA 1TK3A 1USVA 2FPIB 3IS3A 3KEGA 3RG2A 4UHDA 4CUZA 1P2BA 1RM0A 3WXMA 4UNRA 2CV2A 3WMWA 3IDQA 3LISA 1NQ5A 1TTQB 5EE1A 2CJWB 1X1DA 3TSOA 4DKJA 1R00A 1QIGA 3D6VA 4KBYA 4C6TB 5JS7A 3OH8A 1W0KD 1NRIA 3OIFA 1WP4A 5G1NA 2QLFA 3BAZA 4B6RA 2JH9A 3B5JA 4KAXA 1G6OA 3CX3A 1QZ3A 1Z8NA 3W1EA 4MWDA 4D4KA 5L6LB 5FWDA 1MFZA 2W6IA 4EG4A 4EHFA 5DB4A 3T9FA 4X7MA 5A9SA 1UBHS 1QQ6A 1DAPA 1QHSA 3FSGA 4F45A 3A4YA 4D82A 5TR9A 3Q0IA 4LOAA 2WFMA 1TEHA 1T9CA 3MB8A 2OCDA 4OSPA 1AJEA 1B0ZA 3DPUA 2B4YA 4MGKR 1O0SA 1UMCB 3OJWA 2NSYA 1U4NA 3CECA 1X7GA 2O7SA 2YJ6A 3M1AA 4YDRA 4IVNA 4ND4A 1SCNE 4JC0A 2V7WA 1XZLA 2EW8A 1JEAA 1QHHB 2OB2A 4BO1A 4IG9A 3ESXA 4FS3A 3ZVKA 4Q7MB 3A8TA 3UJHA 3WP0A 3WLFA 1BMFA 1UBKS 2X13A 3KZ3A 1I2AA 4I1OA 4NESA 5EUMA 4YG1A 3H2HA 1WXEA 5DYNA 5KYXA 4IWXA 2O5CA 1YAJA 4FYWA 1KDTA 5E8RA 3QTTA 3SHFA 3UMFA 1KARA 3A04A 3QYPA 4B3DA 1DAGA 2AJ8A 2GNOA 1AC5A 1GQYA 4J1QA 3VZCA 4MV9A 4RW0A 3PLNA 1PJ3A 3FGOA 2WE7A 2ZSUA 5F1YA 2O19A 5EKXA 4GMGA 3B48A 3B3GA 4YG4A 4R51A 1FLAA 2H7VA 2KBFA 3Q5DA 4DMRA 3GFBA 4ISCA 2P78A 1ZP6A 3B53X 1OFGA 3H8JA 2C96A 1RW4A 2YVAA 3PDWA 1WE2A 3L9XA 1N8SA 1P6QA 3G5MA 1WZ2A 2VDNB 1QE5A 3UMVA 1O8BA 2QSJA 1XD9A 3UBMA 5JC1A 2LP4Y 3IBTA 2F64A 1JXMA 3EH2A 3QFHA 3AYXB 4Y8VA 1Q2UA 2F3UA 2XMDA 3KXDA 4ZQBA 4H6WA 3W5DA 3BA6A 5CITA 2EQAA 2O5EA 2WIUB 2AUWA 1SU8A 3VPBA 3FYUA 3PTAA 4FR0A 2B2CA 2C7OA 1WB9A 2PO7A 3OY2A 3HJCA 4LY0A 3UWDA 1RRVA 2OBFA 5G41A 1KRXA 1X7YB 1U9YA 4JLAA 4K9PA 4ZRMA 3V5NA 1T9AA 1J0DA 1B16A 1F4PA 1TYDE 4ZALA 4A03A 1ZFNA 1L4EA 5D1HA 1KDVA 4YRZA 3ZU2A 4RY9A 1NXOA 2PGIA 1Y1QA 1AXGA 1I9CA 3KOOA 1RQPA 2OSVA 2C3UA 2PLFA 3DMNA 5I47A 4B71A 4EA9A 4F56A 1RVDA 1PBNA 4OGFA 6REQA 4C4XA 1S1CA 4GDFA 2OR1L 4YO7A 4AUNA 1QGAA 3LY5A 4UTNA 1QORA 4KE6A 5KVVA 4WCVA 1EUDB 2REXB 3SLRA 5J63A 1VSVA 5EFOA 5LWQA 3ASUA 1CR0A 2WJYA 3LY7A 4QPCA 2JLCA 2R7KA 1IRIA 1IDN1 3MM4A 1U4SA 1MDBA 4YYEA 1GAQA 1W1WA 1P62B 2OAP1 2OO7A 4YR7A 1HLDA 2WSSA 2C57A 4GPEA 4MRSA 5TB5A 2NXNA 1O03A 3ICVA 4BFCA 4ZYUA 3FKJA 2IY7A 3K8ZA 3IUMA 3S2UA 3E8MA 1ESNA 1U0SY 4YRLA 1Q7CA 1DC6A 3FDIA 3JQFA 5TMEA 1YVPA 2JL1A 4DYVA 4OI2A 5J5VA 4A0GA 1XE3A 4DLVA 2C5BA 2CW5A 3GT4A 1CEQA 1LPAB 2AYZA 1A0OA 2DCMA 2FP4A 2WU3A 4TLDA 1W35A 4QXMA 3V2UA 2EF8A 2HXSA 3HBMA 4JAVC 5EJGA 3NXHA 2P69A 5H02A 5JALA 3M4ZA 1X70A 1G20A 1NGSA 2PUFA 4CG2A 2WU8A 1SOAA 4F91B 3FOEC 4PC6A 1R0KA 3RJ9A 1QOPB 1Z6QA 3IXQA 1P2UA 5DLEA 4TYQA 5DGIA 2DLNA 2FFBA 1X7XA 4G01B 1U0JA 2W7TA 4HH1A 4QDUA 5TY0A 1U7TA 1H85A 4B4KA 5J23A 4LF9B 1G291 2OUIA 3PVSA 3WK8A 3KJHA 3HBNA 2QUHA 3PFCA 4M0DA 4RDIA 3SOZA 1HQCA 1XZEA 3WYAA 1GL6A 3SY8A 4C3OB 5C5IA 1XDUA 2ATXA 3HYSA 4JT4A 3M9LA 4WZAA 3UFBA 4NPHA 3ZHMA 1IQPA 3SQXA 1XTQA 4ZIRA 1AKRA 1YH3A 3G9ZA 5CNIA 4ZVUA 5BWCA 3R09A 4N7JA 2R1JL 2VQ6A 4B3JA 1YZVA 5IEJA 4MUKA 4FHFA 4MVWA 4BQFA 1TKRA 5A3VA 2GJAA 2UUAB 1Z82A 2PPXA 4W99A 2O3SA 4CM4A 4YFVA 2IZ0A 1XJCA 2O4AA 1NZFA 1AQ6A 4PU4C 3L6UA 3NKLA 1IN7A 4OYRA 3IYLW 2NU6A 4RVFA 1LCDA 3DMYA 1QUFA 5EZQA 5TARA 1F2VA 2PQ2A 1VECA 3A3YA 4GSKA 3EXAA 2IU3A 5PNTA 4DKXA 3A28A 4MV1A 3I1JA 4AURA 2W4IA 2BCJQ 4QYWA 3CLRD 5GZ3A 1H65A 4Q4JA 4YUYA 3HRKA 3C74A 3FVWA 5JCPA 4ZVPA 4EMTA 3C7TA 3UC5A 2PZLA 4UXJA 3ZDEA 1FUKA 4KX3A 1SCQA 5J1SB 4O59O 4I1UA 1P39A 1E6LA 1E7YA 1PZXA 1QWSA 3OPYB 1KHTA 4OFWA 1YBFA 5DGDA 4DIEA 1DKMA 3KYCA 3DZCA 1PWXA 1QO0A 3NUZA 4CIWA 3F6PA 1HQYE 2IUTA 1ZK2A 4HYTA 4IO0A 2D59A 5JAQA 1TA0A 5HKAA 3C1TA 4A6DA 3G9QA 1QX3A 3DCNA 3M1YA 1T0IA 4G26A 2M1ZA 4PPGA 2CZCA 1KEWA 1OREA 4U7WA 2RGEA 4GYYA 3ZEIA 1QTQA 1LC3A 1T5HX 4EGQA 1ECJA 1PR4A 4JBHA 4GVXA 3JWIA 1EE9A 4QTXA 3R5JA 1WPRA 2C5FA 4MHSA 3UIEA 1G0OA 2DPGA 1QO7A 4YUZA 2XIJA 1E9DA 1R0WA 3X1WA 3PPIA 3L7JA 1OV6A 5MF6A 1ZXLA 3RJ5A 8LDHA 1AHHA 4JUFA 2ZCJA 2ZULA 2I91A 2OO3A 2WDPA 5L7WA 1N5MA 3OFVA 3DHEA 3TNFA 4F3TA 2P3OA 3WYGA 3KWFA 3FFAA 4E32A 3A6PC 3DFUA 1QFXA 4LHVA 2LYPA 1LJ8A 4Q1CA 1H6DA 4JEIA 2VUTA 3P9NA 2H4FA 5SZIA 4OY3A 2Q0QA 3NHYA 4NYJQ 2DWUA 2HAEA 3IQWA 4CLOA 4M98A 1G98A 4HPXB 2CF5A 4XM2A 1U02A 2G8NA 4HWSA 4EG5A 3GN1A 4FNMA 5IT9A 1C9KA 3R7SA 4HFNA 4DLUA 3RU9A 1JZSA 1KYQA 5EPUA 4F21A 2HTEA 2CNKA 2FMTA 3R9XB 1E32A 5KYVA 2V98A 1YGYA 2CFCA 3B36A 4NARA 3PC4A 3WSWA 3VVMA 1MQAA 1C7IA 1RADA 2BFWA 1W2HA 2IXEA 4RXTA 1X7XB 2J87A 5K0LA 5K8VA 1EUYA 5MHTA 4PFQA 2HA7A 4MR7A 3P2EA 2B4AA 1ZUWA 5DF1A 3GLHE 3FNEA 2CB9A 2WPNA 1UKBA 4QWWA 5KNDA 2PXBA 3R3WA 2NADA 5C4MA 1YNOA 2XE6A 4KAAA 2BMWA 4Z53A 3H5AA 3ZE0B 3AVTA 1JA0A 2Y1LA 4LY9A 4ZO6A 5EJ2A 2IUUA 4CNQA 2G40A 4FTWA 5AHRA 2FLVA 3KB1A 1E89A 1GRQA 2PSHA 1NLFA 1R9GA 1CDEA 2HXYA 2Q1XA 3IUQA 4CM3A 4EFNA 1U0BB 2OBBA 2UZ3A 3S70A 2CLHB 3EXHB 3R7DA 4GYKA 1QG4A 2HDHA 3SZGA 1XNHA 2PBFA 4J3JA 2DR0A 2FMIA 2C29D 1S1MA 2GVDC 1U94A 2ODEA 3BIJA 2FK7A 1LWOA 3HJGA 4BNMA 3W5JA 5EUQB 4RTJA 1B8VA 2DFTA 2HGZA 2RHJA 4XW2A 3T1QA 3R9WA 1KC1A 3KIPA 2EATA 1FDTA 3R0IA 1ECFA 3E5RA 2Y4NA 4LY6A 1SUEA 1DGQA 4MGHA 4HQRA 1N5KA 2OO5C 1D7AA 2XAAA 1KYZA 2BR4A 5GZ1A 4B3TB 4L0DA 1I0IA 2A5GA 2NZUG 3B7WA 3ZXXA 3BJMA 2VJKA 2FWNA 3FA2A 4YPFA 1ISPA 1N57A 3BRWA 4H3KB 3BDIA 3K0CA 3TQOA 5CB8A 5DP1A 3PTLA 4AJ9A 3I3OA 2O2GA 3KYCB 4G4GA 5T41A 1E98A 1B4DA 2WHQA 3CUSA 3IAAA 3PNLA 2H1SA 4KPFC 1O77A 3O31A 3QYXA 3ED1A 2B5AA 1TM4E 5FUVA 5I9MA 4YCCA 4JBGA 1U9IA 3GFRA 3ML1A 4R3NA 1BIFA 1DG3A 4PLWA 1T9BA 5C8YF 1DI0A 1UXOA 5JAUA 1YONA 1GR0A 4JKIA 1DQNA 4LGVA 4YARA 3CWQA 4R0NA 3SKXA 1GNRA 2JD0A 3BIXA 3BH0A 3IEIA 1PQYA 4NU6A 3GK3A 1P8JA 2PGAA 3E7FA 3M6MD 3OJEA 3EWIA 2EX4A 4I3GA 4PQEA 4RA6A 2FDRA 1VZ2A 2FDXA 3PU6A 5CJPA 4RCZA 1KPGA 4RM3A 4ZU1X 3LLCA 1CUZA 4L76A 1HYEA 4BAGA 4Y2TA 4FDMA 1EFPA 1IJBA 1O4VA 1XZIA 2LKDA 3FWKA 5ALSA 3K0EA 3WNZA 4PBTA 1NSFA 3IMFA 1FNCA 2IDKA 2FGKA 2WIJA 1XJ5A 2X14A 4MAAA 3ZN2A 1GRRA 1MQSA 2GBLC 4MTCA 3JVIA 2IVGA 2OBXA 4ZU3A 2HEGA 5I3CA 1W36C 1RI2A 1E1DA 4L8VA 2P1ZA 3LQ2A 3PEEA 1W34A 2YV3A 3RR2A 4AKTA 4JV5B 1NG1A 1U8UA 1PU2A 3L84A 4K5QA 2OGSA 2QRMA 1SC3A 3HU2A 4CFSA 1JQKA 4IOJA 1SVUA 3A32A 4Q9KA 5GOTA 1ORHA 4L3VA 4GOOD 1YB4A 2AVDA 4IIXA 2I7XA 3CVUA 5MN5A 1IJEA 3NAQA 1CRZA 2COKA 3D7MA 2P9QA 2ZSBA 5GQSA 3RE1A 3B1YA 4GM4A 3G88A 2VWGA 3THWB 3O4IA 2PQ6A 1D5CA 1WCYA 2PK3A 3GB9A 1CUHA 4RYDA 1H2BA 3ROMA 4INJA 1ZGGA 1Y8RA 4QOFA 2BEUA 3L82B 1NW6A 4KVFA 1BJTA 2QUJA 4B9EA 2RONA 2X5XA 5B7QA 1X9GA 3R41A 2WAXA 3G2QA 3TPZA 1LZKA 2QTVB 4LYAA 5AFSA 1NUTA 1WDWB 3CIOA 2XZLA 1O9HA 2J07A 3K5WA 3L46A 1E64A 4O4HA 2O49A 3KKPA 4HB3A 4OAPA 3KDSE 2ZZKA 5AYVA 4ZMSA 4W1QA 1UQUA 1J25A 1NQVA 4R71A 2ZATA 3FB1A 1HG0A 1TUGA 3Q41A 1Q20A 2C2KA 3FNQA 3ZGZA 1Q0PA 1QV9A 3JQ9C 2DYKA 4BE4A 3I3SR 1GUBA 4ZDJA 1GYQA 3F3MA 2IP2A 4G5GA 2UDPA 521PA 3GL9A 3GGOA 4C7XA 1VMEA 2D1FA 2ID4A 3QPCA 1JXAA 2C97A 2MR5A 1MTOA 3L0OA 3LYHA 1P74A 4UPDA 2HA4A 3CN7A 3F7TA 5K98B 3FFBA 5GGYA 4RD3A 2XGMA 1CZUA 2JC3A 3OZWA 5AI6A 4OBWA 1SXJA 3NV9A 3FYMA 2WFLB 1EUCB 1AB6A 3USCS 5HIAA 3GI1A 1CE8B 2R1VA 2YS6A 1OXMA 4LMRA 3MLFA 2MOKA 3HRIA 5C4GB 4OI0A 2V6BA 3EUWA 3KQMA 1LY1A 3F6RA 1IE3A 4REQA 4M9QA 4YEDA 2O54A 3QSGA 4U63A 3HYLA 1RMQA 1SA0B 4B75A 2OFWA 3UAZA 1RZ3A 2K7ZA 4PY2A 5FBVB 5JI2E 3IT0A 1XZHA 1JSXA 4B81A 2VJDA 5C32A 4BASA 5GAGi 1VG0B 2ZYUX 3SQDA 4MRRA 1EFHA 1KH1A 3I2IA 1UMBA 4NEGA 3IXMA 3MG9A 1S96A 1L9KA 4HB0A 4HEA1 1KSHA 4JC5A 3W4JA 2FWJA 3W6PA 2AR9A 2CCGA 4C0JA 3R9XA 1JWLA 2VCHA 2V4MA 4NPAA 5GY7A 3VI3B 3HY6A 1H1LB 2R5WA 1PWEA 1CFJA 1TYCA 3EZ6A 3KTOA 4MV3A 1EIWA 2H1LA 3KWMA 3VR3A 1V11B 1H66A 1WVIA 3EC2A 4M1YA 4O29A 4OGKA 2BZ1A 1YA4A 3VAYA 2WPDD 3N8KA 5H68A 1DO2A 3QFFA 3V8EA 3WZLA 2I7TA 1Z3CA 4WV3A 1ES9A 4ON9A 4X6XA 3T3GA 3UUFA 2Q7XA 4DE5A 1RC8A 3RAFC 2WABA 4TM7A 4KQ2A 4C88A 4CM6A 1QJCA 5JASA 2QMHA 2YQ4A 3CX7A 1GKLA 2VUSA 5AI5A 2PFGA 3IVMA 3TINA 3B82A 3M6UA 4H31A 1F6DA 3FPBA 1XDSA 5TLSA 1XXHA 1A7UA 1VGRA 4UUMA 5EJ9A 4L8YA 3LT5A 4AIRA 4DA8A 2M32A 2X0IA 4M1EA 5AKJA 2HFJA 1G3UA 5JSYA 3F3SA 4PX2A 2A8YA 5CDHA 1T6ZA 3GJ8A 4IW3B 3DLAA 4YDQA 5K5EA 4G5XA 1GL7A 2BELA 2FPXA 4WK2B 2R3SA 5FBLB 3KJFA 1ISHA 2P9HA 4Q1EA 2XCSB 4JOQA 1UDAA 5DNVA 4IGKA 1IIRA 4JGGA 5D8DA 4FT2A 3F6SA 4E15A 1SQ8A 4MUYA 1E18A 4QOJA 1JEYB 4MQEB 3NHAA 3ANNA 2OM6A 2WRZA 4QA9A 4YO8A 2V7XA 3U3ZA 2ISSD 4UUPA 4EG6A 1W87A 1ZBDA 2CZQA 3Q5GA 4LNHA 2GT1A 4MYRA 2XWQA 3PQ4A 3JR3A 3X43A 5ADUS 3L04A 1QHEA 1MGPA 3OLZA 2OV1A 4RA9B 5BQPA 1C50A 4S2EA 1IULA 2OFOA 3I2FA 5SICE 3LUGA 3FNHA 2P0YA 4W1PA 4LZLA 2QGFA 2WZCA 4NZZA 2O14A 5KEIA 2Q49A 1H6AA 4MW7A 3TOSA 3UOGA 1G3QA 2NO0A 2C2GA 1ZQ1A 4KPUA 1SKUA 4XQGA 4G23A 5EHIA 3UJPA 4B0OA 4CKXA 5JTUA 3U44B 2A9FA 4UM7A 3AKCA 1FVFA 2P77A 4PAQA 1P4AA 3RUPA 1IBCA 1UJ6A 1VRCA 2V5UA 1G8FA 4B79A 3SZRA 1VHLA 4TV8A 5CP8A 3S2EA 4WFQA 4HH3C 1OKKD 4JR0A 2EKPA 3KG2A 3VMFA 5I7EA 4OB4A 3V55A 1UMCA 4DMGA 2A92A 4TMYA 4U00A 4XOIA 1KTVA 3DW1X 3M2TA 1NU6A 3PEFA 1IDOA 4ZZ3A 1OGJA 5AVRA 2Q0HA 4FT4A 2TS1A 5CEFA 1AT1A 4TLBA 2ZQZA 1NT4A 1BRMA 2A4MA 2UZ1B 3GV0A 1Q74A 2Z4RA 4RF4A 5BN4B 2GCPA 1Y1RA 4BWVA 4K0KB 1DULA 2IYPA 3DLIA 1QV6A 5IC6A 1BA2A 1K4YA 1MB4A 3ICOA 4RSMA 2JFFA 1Y6RA 3DHYA 1KVSA 3OE7D 3RUEA 3RBAA 2B6NA 1JI3A 1FX0A 1YA8A 3RVOA 2GJSA 3LKDA 4MRMB 3VH3A 3ZDZB 4D3FA 3VUFA 1IBKB 2ID9A 1EFKA 1RXUA 2YX1A 4MDYA 4BB0A 5DNAA 1GPJA 3BSWA 3MIZA 4DN6A 2QSZA 2WWFA 3I0NA 4GOND 1DAFA 2FWRA 3P0IA 4TKLA 4DRXB 1T2CA 3H2JA 4EB6A 4B74A 3DTVA 3I9KA 2GXUA 3Q85A 1ZINA 3KCNA 1Y1TA 3TPCA 1POWA 3VBEA 3ETLA 3ZH9B 3LTNC 3L6OO 2ZSJA 2I2FA 2LDBA 2PX0A 1SCUA 1XPJA 1CJTC 2PNFA 2WV7A 3CE9A 1S4MA 1BVRA 4KQXA 1AQUA 1TK2A 2A5LA 4G86A 4M0LA 4P1ZA 4LOLA 4RHCA 3TOXA 1O6BA 3AUKA 3SCHA 4CW7A 4E46A 5J2TB 2GFHA 4ND6A 3FKSA 5TXGA 4DREA 3VYWA 2NW6A 2W5UA 1F12A 1EB9A 3OO0A 3P1JA 4J3FA 1LFDB 4J7XA 1TTPB 3ORFA 4OMUA 1I7NA 3VHRA 4BBZA 2R85A 4PYMA 5J4YA 5L95A 1DJOA 3BA1A 2BZGA 4B8YA 1U9CA 4BBAA 2DJIA 3GEMA 2DWPA 1ID1A 2DHEA 3ESBA 3JVEA 3BXHA 1D2MA 1R69A 3H84A 3RCBA 4WBNF 1XF1A 5ALUA 1PUIA 3A6KA 1AU9A 1KPHA 2ONCA 1C4OA 3BTOA 5REQA 3ESQA 1TIBA 2WOJA 1TD9A 3K2QA 3HDYA 3NIGB 4G56A 4LHWA 5KINB 2RK4A 3WKAA 3WYEA 1VYUA 1X39A 4YLGA 4DGQA 3WLNA 3K9NA 1N9GB 4ZOLA 2BFAA 2QTHA 3OHSX 4WK6A 5FFMA 1THMA 1E3OC 3QWBA 4LCBA 4R7TA 2B1GA 5ECGC 2QRZA 3W9YA 4N8SA 4P80A 2B1JA 3ZCVA 3ANLA 3W2TA 3KTFA 4OPMA 3SDSA 2B5VA 4MGYR 4UE6A 2HSGA 4QRHA 5HG0A 1O5TA 2H9IA 2ZT5A 3JU3A 4G41A 3BJZA 1TTHA 4KXWA 4MQMA 4TLEA 5A5EA 4Z4QA 3L1PA 1Q95A 3LQQA 2JASA 5C81A 5HILA 4C4RA 1U0OC 1D4FA 5I7WA 2B0CA 2PJZA 2IFTA 4QVGA 4OX9B 5KTTA 2EZ9A 3HB1A 3PR2B 1EBUA 3KQOA 5D1NA 4UBMA 4ZZIA 1P77A 1M2FA 3QBDA 2Z0MA 2W8ZA 1GU0A 2ZLBA 4CNBA 3EARA 5HRAA 1W25A 2AC2A 3FF4A 1I2MA 1GAJA 1A3CA 2ANBA 4JT9A 1QH1B 1WMSA 3BFVA 3CZ5A 5B53A 4OO3A 5DASA 1I14A 1YB1A 5SZHB 4HX5A 4YRSA 1KEKA 3AP1A 2YJGA 4KBGA 5AHWA 2C9DA 2H8GA 3NGMA 4DWOA 4AKIA 3E8SA 4X7RA 3FCYA 3R8CA 1FFDA 3ACBA 5BMVB 4HZIA 2ZBVA 1QPBA 3KSMA 3RHSA 3L18A 4X45A 3IQEA 3MIIA 1KI2A 4DWJA 3SHOA 3D8SA 3ZUPA 3RYFB 1R64A 5DK4A 2GZ2A 4N9QA 5G4KB 1XXHE 2AHOA 3ZI7A 3UH1A 1NC3A 3MRVA 1SC1A 2Z2IA 4RJKA 2GGSA 1U1FA 1C9DB 1SAYA 2P9GA 1SUWA 3PPWA 1KVRA 4U7HA 5AOBA 1H4SA 4LA4A 2VQDA 3O91A 4B3RB 3QLUA 5JPCA 4I6UA 1WV1A 3EZ9A 2HJRA 1ZPDA 4Q93A 3T12A 3T1VA 4DIUA 4O1MA 4PW0A 3IP7A 1ULAA 1W5EA 1XOIA 4I66A 4XIYA 2Y93A 5IM5A 4LF6B 4DSUA 1IJFA 4EO9A 5FEMA 4X7BA 5A04A 3X1ZA 1I1NA 1OQAA 2ZOSA 4BFUA 3QVGA 5FI0B 1Y1SA 1ZCAA 4P98A 3AR4A 3LPMA 2H52A 3MOSA 3PVCA 3M5PA 5IYZF 4M9ZA 4GPTA 2C2OA 3GPIA 4GKVA 4QZVA 1UEJA 3DVAA 3H75A 2OXCA 1HDEA 4KN9S 2AWOA 3EMKA 3U4GA 2JKZA 1IBRA 2MMGA 3GLKA 3WIEA 4EKNB 4D26A 4TKMA 4D0LB 2O4CA 1HGXA 4KXXA 4LVCA 5E7IA 1RQ2A 4ZZ2A 3REQA 4KQJA 1DBVO 3RS9A 5DISB 4JP3A 2GPWA 2ZS8A 3ANYB 1PDWA 4OKNA 2B34A 3HY3A 4XUEA 3DO8A 4HWPA 3U1VA 4DVGA 1T3TA 2VTKA 3ZI0A 3DE4X 5A3RA 1GL9B 1ODKA 1UXGA 2ORWA 6LDHA 4P93A 2BIFA 5JHGB 1LLIA 1XTVA 3R7LA 1XN4A 3PFWO 2PSJA 4HR7A 4MOWA 3UCXA 4GOKA 1GSAA 2PT6A 4EG3A 5IZ4A 3D1VA 2FZ5A 4FKZA 5LP6A 2O8CB 2XF2A 3HSKA 1L4UA 4IKEA 1GKYA 5BYJA 2L1PA 1KMCA 3B6IA 2AK3A 3VDRA 5K0JA 4LGMA 2WMOB 4Q9IA 4WBNA 4BU1A 2QVXX 5EHXA 3U3DA 1F06A 5ALRA 4BGIA 5CDYA 2HF9A 1XU7A 2WSYB 3BK1A 3E9YA 4OI4A 2H54A 3SMVA 3UQYS 4OK5A 2WZQA 3CH5A 3VC7A 3ZUGA 1FRVA 1ZOOA 1N6KA 3GEBA 3HACA 1XI2A 2A3NA 4K1XA 4KR6A 3QEKA 4NQRA 1OLUA 4QU9A 1BDIA 1SD1A 4KNYA 1POXA 3BWVA 4HWRA 5TQJA 5IVPA 2Z4SA 4QOSA 4EOGA 4C7OA 5IJ0B 3HVUA 5FF9A 4WKPA 2J7PA 5T4FA 3UANA 4DIKA 9LDTA 5ADHA 10MHA 4L8WB 1XAIA 2EBYA 2FPMA 2P65A 4KE7A 3FPAA 3RC3A 4Z86A 1FSGA 3REGA 1DIGA 1ISJA 3MXTA 3EDOA 1GRNA 1YZQA 3L8EA 1J8VA 3ZHIA 4TL8A 2BDUA 5B4UA 1O2DA 2Q21A 3KOMA 3KXKA 3ZWNA 4KGVA 3HBAA 4WIAA 1AZSC 3HXTA 5TEWA 1E58A 4C4TA 3EG5A 1G8YA 3A0UA 3AB7A 2O8BB 1JR4A 2FJUA 3UGQA 1KXJA 4DVJA 4EKIA 2NU9A 3NATA 3IOCA 5AVXA 2Y0CA 3ANMA 2PV7A 2ZWOA 1T8RA 3VYVA 5B30A 1DAKA 4DLAA 2PXUA 1AGRA 1Y5RA 3C2QA 1O9GA 1RM5A 4OQZA 5KKNB 5AMXA 5SV2A 4BO5A 3R5FA 2CLMB 3PUYA 1PK7A 1R0ZA 3LW8A 3GA5A 5KKCA 3BB4A 2HCNA 5AKZA 5AM4A 3UV6A 3AUXA 4GECA 4NCKA 1IZ0A 2P1RA 2QLTA 1ZK0A 3OC0A 4FEGA 4L78A 1PVVA 2HLNA 1HMYA 1UL1X 2IY8A 4FYVA 1V1JA 3MT7A 5KOIA 1XEWY 4NYIR 3H87A 4A2WA 3RC7A 1A4RA 4LSGA 3HGTA 4WLEA 4DR2B 4ZODA 1KRWA 3U3MA 2FSUA 4CMBA 1M3SA 2F1KA 5K0EA 3KPVA 3IE2A 1T8YA 1WBBA 3EOZA 4HWGA 4N5DA 1E77A 3DUFA 2X0RA 2C4TA 3NNNA 1TQDA 3K5IA 3FDJA 3C7CB 3DQZA 4G2NA 5DGXA 3UTCA 1Z7EA 2XLCA 5LA6B 2Q29A 1FDUA 2O0MA 1UXKA 5DCUA 1OT5A 1QG2A 2IXAA 4C6SA 1Y4AE 4O3FA 4QPNA 3R8FA 1TAUA 1M10A 1J42A 2J09A 4BLUA 3CSDA 1VLZA 1N6PA 2VT7A 1KFEB 3REQB 1Z88A 3L6RA 1J0CA 3MTBA 4QUBA 5DSXA 5DNDA 1E7MA 2PR2A 1DAHA 2KLHA 3BQNB 3DE3X 1X7DA 5EYPB 4A0RA 1SBQA 2D1SA 3JWEA 1J7JA 1Z6ZA 4FYIA 3BXOA 2W2VA 3B2QA 3Q2IA 5H83A 1F8UA 2R44A 2RGWA 1LCIA 2DMRA 2VF5X 3TGPA 2R751 4CL2A 1U2ZA 4RDCA 4BJ5A 1K8XB 3I04M 2JQEA 2HREA 2VTVA 3L7YA 5C7YA 3AP3A 3S2FA 3Q8XB 1QRRA 2XYVA 4TV9A 4CPDA 3LG2A 2NO9A 4XWOA 2EP7A 5KPJA 3V8QA 5DU2A 1NMYA 4I2VA 1RZRA 3AUFA 5DWQA 3DZHA 4IXMA 4WTOA 4RGQA 3IKTA 2XF8A 3G3EA 1AY0A 4GH5A 3ORQA 2RCYA 1EVIA 3AY6A 4ZVTA 4R41A 5KSWB 1OFUA 3EC7A 1CW2B 1BDBA 3V4FA 2IS6A 1YKFA 1SXJB 3RVMA 2ZU6A 3AZOA 4PRZA 4C21A 3WAJA 1X1EA 3DFMA 3EZNA 4KMSA 3RFCA 1A9YA 1DCTA 4YALA 3L8MA 3LJKA 1YQUA 3EYWA 4OREX 1I7LA 3KVRA 3OU6A 4NNOA 4RNDB 2A9RA 4Q7QA 4KNWA 1H4QA 1X6VA 1Z2OX 4ARVA 1CY7A 2NPFA 2MMCA 2GBCA 1DXYA 1GPWB 1Q0LA 4DADA 3U4QB 3HCBA 4YXFA 2AOTA 4YCMA 2EIHA 1PR0A 3N0VA 1FFGA 4GOLD 3OQHA 3RJTA 2DQSA 5G02A 3WL3A 5A1TA 1PFYA 5CFRA 1DG9A 1A8UA 1LW7A 1SO8A 1WX1A 1V16A 1WZEA 2OKGA 2XADA 3GA7A 3QU9A 4G1CA 1OI2A 4X7PA 2ZWMA 1F7VA 3M33A 3G17A 5KCMA 4INAA 3B1WA 4BNHA 4MQ4A 1Z75A 3KPJA 2OPBA 4P4GA 2M1XA 1JLRA 5TEVA 4MKXA 5AHKA 5IZCA 4RF5A 1J97A 3KKKA 5CFOA 4DQXA 2ZJ8A 4H3VA 3NU1A 3MWYW 3ZCRA 2ZWVA 4BNDA 1Z47A 1V8DA 4B3GA 2X5KO 2ZJFA 3W8RA 1RXCA 5EZ6B 5CCXA 3FGNA 5HQTA 1Z0UA 1NF3A 2GK3A 1WHTB 1NMEA 3LYUA 4Z8XA 3RLFA 5H8WA 4LF4B 1G5IA 3P7MA 4HEHA 1X9HA 3K53A 2AFIB 1XMOB 1KO8A 2JK1A 3MTIA 4AJNA 2C7VA 1RJ9B 1KK0A 1VKOA 1VL1A 5CIQA 1EK0A 2B8EA 2YZ2A 1C1YA 2VZ0A 2PTHA 1ZIPA 1F2UB 5LQNA 1I3LA 2BI8A 3DO5A 5EPOA 4ZHSA 2YJTD 1JLSA 1SOUA 2RIPA 3CLRC 2WF7A 3DV0A 4ABTA 3KP1A 1JA1A 1XA0A 1QP0A 4IFEA 1JEJA 4BKPA 3LK7A 4YREA 3NLLA 4ALLA 2J4FA 3FOAA 1GKIA 3PHGA 2G4CA 3QKTA 1JDVA 3UY4A 2NQ8A 2C8LA 3CONA 2X1VA 3EOBI 1P4SA 3QIAA 4OOFA 3ZXUB 2WHPB 1DV2A 2N0SA 2ID7A 4K88A 1M5UA 1OZGA 3DBRB 2GM3A 4OGGA 3KAPA 3TVTA 1BQ3A 1DPFA 3PQCA 3NASA 3V48A 5CA1A 2RHTA 5K6TA 3QOXA 3SNKA 3A7DA 5EIHA 2FPGB 1RZRD 1UK8A 5TT1A 4WXPA 4CMEC 2DEUA 5LPNA 4G89A 2YHIB 3PWTA 4KB5A 3ONFA 4XWTA 4ESVA 2IYLD 2PRKA 3LZDA 1ZHFA 5K8CA 3T35A 4FZVA 1A9TA 1HYHA 1JJ7A 4P4SA 5F3RA 3A6DA 4XYBA 1PKXA 1U7DA 3SX4A 1UBFA 4GP7A 4LHYA 4B7AA 2AA3A 1SUAA 3C6XA 3T5DA 1N6OA 3WTCA 1MA3A 5EP2A 2QP4A 1NPDA 2A59A 1PJ4A 1Z07A 2XDYA 3V1TC 2I33A 2O23A 1GGMA 4NXMB 2COUA 2EV9A 2VCEA 4Q16A 4A16A 2UUCB 1ZISA 2O1WA 5AVKA 3I39X 5FRDA 3VJMA 2DG2A 2P1DA 3LYLA 3IHLA 4QYMA 1M76A 5TGZA 3TTWA 5KU1A 1YDHA 1R0XA 4BB5A 4CG0A 3M5DA 2PG3A 1C9EA 3M9XA 2XX3A 3IIKA 3S27A 2IPOA 1C3VA 1PTJA 1TJYA 2EC5A 5JCOA 1GHTA 5KOJB 1N6IA 1VE7A 1WVMA 1Z2PX 1UKVY 3O38A 1BTOA 1XDGA 3DV2A 3G2PA 3K2IA 1XU4A 5AW4A 4I50A 4RZUA 1GY8A 2E7ZA 3BQ9A 2Y67A 3HO6A 3N8NA 1H23A 5JD3A 3AF3A 1Y7TA 2WWRA 1USUA 2X15A 3JQQA 2CL6X 1YJQA 1V9CA 4LOIA 4X41A 3MUFA 4DNQA 4F06A 1DLJA 3ZBQA 3NXKA 1Z8DA 1W9MA 1Z56C 1W0JA 1YHZA 2QQEA 1X1CA 1G8GA 2A67A 3EDQA 3FYUC 3DEKA 3QPUA 3R0VA 4WFKA 2Z1DA 2OC9A 4CIXA 2P2SA 4K9OA 3DCYA 3DM9B 4FGUA 2IXTA 1UP4A 4GI7A 3KAKA 4RH1A 1P73A 3KUKA 2WM9B 2VXBA 2EDCA 1ZD2P 1OWOA 4OKSA 1KEPA 3DDUA 4JCXA 3NT4A 3DZDA 4M9CA 3V1MA 3VR3D 1C41A 3OZUA 4MYTA 4EYQA 2O2HA 3LU1A 4IIHA 5HEKA 1T9DA 4F4HA 4GW3A 4HLUA 5KYTA 4HLUC 4NH0A 3TNDA 3MUNA 1O57A 2BJWA 3W6NA 3L1HA 2P8SA 3HKBB 1TLFA 3C39A 1UOPA 2B5OA 2YTZA 4I5FA 4NBRA 4Y6LA 2C83A 2OV2A 3PGLA 3V4OA 5KNBD 2NQ2C 3P20A 1OYWA 5EJAA 1IPEA 2WJVA 1NX9A 3I9MA 4B0PA 3AKDA 5T6BA 3SYLA 1RHJA 3TLMA 1N8TA 5CH5A 3WRYA 3WBBA 5FLXA 2HHAA 4IDAA 5HW0A 3MWFA 5AXCA 1CWUA 1VG9B 4C6HA 1PFKA 3KVOA 1D0VA 2WWVD 2I4RA 4NCXA 4BTLA 1DDGA 1BA3A 5F1KA 5AVSA 3ILXA 3EVAA 4UTRA 5BRAA 3IVPA 2J5XA 1MEEA 2P75A 3QE0A 2H1CA 1S9DA 4PLYA 1VA4A 4KPYA 3WGGA 4DLLA 4JQCA 5L4LA 2B3TA 2QKYA 3Q6NA 3V1YA 3ZW9A 3V33A 2FPOA 2H2WA 1F3OA 4U2FA 1MO3A 2HMWA 1KY3A 2BM0A 3L4BA 4MYHA 1AS0A 1VIMA 4UPEA 5JH7F 2FHPA 4NV0A 4D79A 3MTEA 2ZSAA 4DPMA 1DQZA 3WYNA 2Z95A 2NSDA 2J5BA 3DD1A 4FXPA 2WUDA 3ABIA 3NTRA 3ELUA 4CODB 1M5TA 3ZHUA 4KXMA 1CQXA 1UIRA 3AERA 3O4JA 3A4LA 1KORA 4UASA 2HBYA 5E4YA 1J8QA 4FCTA 3ZJYA 1A5ZA 4EA8A 3M9WA 4US2R 2ZUUA 2VHCA 3LZCA 4LE0A 4MRAA 2P4QA 1FFBA 4C2TA 4B3CA 3AJDA 4KNVA 2BGTA 1NVFA 3IUNA 3IR6A 3P19A 4RTSA 5EIFA 1RFGE 1FYDA 2JHFA 3BSSA 3CRNA 3GZJA 1TYEB 1U98A 3L02A 4G36A 4LW8A 4TN5A 4U6QA 2C0CA 3FTDA 2BFCA 1BAPA 3LOPA 1MVNA 2QMEA 2HZ7A 5EMJA 4WPGA 1E6CA 1VIYA 3ZU3A 2HQBA 3F8TA 4J6FA 4Z0PA 3WQQA 5CHYA 1EI9A 4CM8A 1FMFA 2XXAB 1ORRA 2OP1A 1WOYA 1RWXA 3DJFA 1Z45A 1E3IA 2G5GX 1EFPB 2VJMB 2BR5A 1H6BA 2XEXA 1VP9A 4AF8A 4F2DA 1G59A 2BFOA 4HK4A 2ZPAA 3VTAA 2QVLA 3NOVA 1G4UR 4CCSA 3A9RA 3PIRA 2BBTA 1P1IA 3SS7X 3S29A 4BFLA 1DBPA 2YJ5A 2XMRA 3D3WB 2IIVA 3IRVA 2Q5QA 3MT8A 4GZ6A 4RVGA 3ZE8A 2D5VA 2UYOA 3PR3A 3JALB 4D5GA 2OBMA 4KMMA 1ZW6A 3TD6A 4F85A 4TKVB 1MFPA 4FFRA 5HGXA 2Q4BA 1GEGA 1V6AA 2OFFA 2H5JA 3IMCA 4BQNA 3O0DA 3WAGA 1LBIA 3WADA 3FZNA 3I5XA 3GBPA 4B31A 2Y1CA 5L7TA 5IVHA 2EWMA 5DHTA 2RHWA 5ALQA 2O06A 2OHJA 3I9NA 2PXXA 3FCOA 4R8RA 1Y7LA 5FWAA 4R0MA 1GG8A 2X2OA 1M9NA 3WBKA 2BEKA 1A88A 4C5CA 5HSGA 3ELWA 4ZJPA 3DMTC 1R4AA 4HN4B 5IN4A 2ZTMA 4ZAFA 3OPYA 4FHGA 4RKQA 4KUEA 3ZDRA 1QB7A 2HBZA 1NW5A 3PGKA 3FTCA 2YJ4A 1Z4OA 4XTCS 3Q0TA 5CLHA 3T7AA 4PNEA 1RQXA 4UOEA 1M2GA 5JVDB 4ZC1A 3LPLA 3BH6A 3BMOA 1Z4PX 2ZBQA 1NW3A 1ECCA 3MSCA 4YQZA 2W98A 4B1FA 4EH1A 2OZKA 4ES6A 4XJVA 1X7WA 2AZXA 1FSFA 1M8JA 1KZGB 4UQPA 3ZWVA 1QZUA 2OTCA 3HP4A 4A6XA 1J9GA 1THGA 1V5GA 3BBPA 3ISJA 1PGOA 3K73O 5JATA 5FOXA 1BOOA 2A1TR 2TMKA 3T61A 3A6GA 1XV5A 1CS4C 1RQRA 1Z83A 4NU0A 4Y2VA 2PMDA 3L8CA 1XEXA 2AJBA 3SX0A 3GFGA 5LJLA 2C0QA 3G7DA 2ZRFA 4F46A 1JX6A 3UCEA 3AINA 2IYUA 2IT1A 1DKNA 4Q7KA 4FQ7A 4KLCA 2QTBA 5EZ5A 3ON5A 4NH4A 1BHJA 1W88A 3C7DB 2BCGY 2XMCA 4X1IA 2EX0A 1SRQA 1XROA 1WSWA 2PT5A 4HDCA 3WSVA 2PGLA 2I8CA 3ABZA 5DHSA 1BH6A 2BKAA 3F47A 1E69A 4IMIB 2HPVA 4B48A 2ICPA 1C2TA 1QHYA 3K1TA 3QKRA 4KKVA 1ZMOA 5HM8A 1DWKA 2DE0X 1ATZA 2VBCA 1CIVA 3TCKA 3WNVA 1YDFA 4XR4A 3JYQA 3R20A 1JVBA 4F2GA 2BEWB 3EVBA 3ND5A 4HSGA 1LZLA 4ZOQI 1HA3A 3T6KA 3OTWA 3KO8A 4I8TA 5KNLA 1GPKA 4HC4A 1TECE 4BVEA 4I1RA 4M9RA 3ZW7A 3KQUA 4YP7A 2JFPA 3ES9A 4KGXA 5K6AA 4HDRB 1Z5NA 3HA5A 3HN2A 4TPKA 3UJCA 2R25B 1IVNA 1YFZA 5K3EA 3IP6A 2ZWAA 4ZYWA 1EZZA 1P6UA 4WJKB 3L4KA 2GILA 2ETXA 1JQEA 1R74A 5ICSA 1EWKA 1C0IA 3RUHA 4M9SA 4I8DA 2KSQA 1SUIA 2BL4A 4BIIA 2EKQA 3UA3A 2SBTA 5AW9A 4U3JB 5FFFA 4KE8A 3D4IA 1RC1A 4BE7B 2EL7A 3QUCA 4IH1A 4Q39A 3RRFA 4BUZA 1CB7A 3VRHA 4OYYA 3X2EA 1H2RS 4KX5A 1V9SA 3IQZA 1ZS4A 3ZDCA 4DCPA 2DFVA 3I92A 1TIKA 1Z5ZA 2IQIA 3P4UA 3DFFA 2A0FA 1SN7A 2VH2A 1UC8A 3LFHA 1KS2A 1Z36A 3D7RA 3IQDB 1BCRB 4TS1A 4C04A 4FIDA 6PFKA 3U09A 5AI8A 4OB7A 1UWCA 1ZZ9A 1XVUA 3K09A 4OP1A 4DEYA 4RJTA 4QE3A 1CZHA 2F1IA 2OKCA 3KOUA 1GYPA 3PF9A 4UNQA 1PFWA 3MD0A 2PZAA 1AS3A 3OESA 1ISMA 1R37A 2V59A 3RUIA 2JHPA 3GCZA 2I3GA 2QROA 4ZMRA 1N8KA 4UFNA 4JJ8A 4BV9A 4M99A 4CDNA 2BGNA 3OOHA 2FW0A 1SXJD 1V6SA 1H93A 2O2ZA 2I66A 1UWLA 2D2IA 2DWQA 2PWYA 3A1FA 3CR3C 5G3YA 4F8EA 2G67A 1YZKA 1EH5A 1V4VA 2FZGA 4S1TA 1EG7A 1XMJA 1Z0JA 3GZ4A 4LJ8A 1I24A 2ISCA 3PZBA 4GI1A 4I7EA 3GLVA 5L53A 1AUPA 3GJ4A 1S2DA 1RHKA 1WV0A 2RHGB 2EKDA 1PZNA 3UENA 3GZNB 3LF2A 1KPIA 3PGA1 1X7WB 2QA5A 4WXYB 1B0UA 1HG1A 3QX7A 4OJKA 4MS3A 4YAWA 3U4CA 1Z6XA 3GLIA 2Z2KA 3KJIA 1EWYA 1IXYA 1O6CA 1P8AA 3EDCA 3MOIA 3CRMA 1ZM2A 3ESAA 2CUNA 5I5EA 4O5AA 4Q6WA 1WUKS 1YHNA 4WWHA 2O3UA 3ZWOA 4BMVA 2CNWD 4EJSC 4EYKA 5JNWA 2XUJA 4LYEA 2I0FA 5FNVA 1KWGA 2H92A 1GZVA 4H15A 3UV3A 4BNDB 1I2DA 4OAQA 2J8ZA 4V2UA 4DLNA 4ETIA 5GADl 4UNIA 3HM9A 2A86A 4BMCA 1KR5A 4Y6GB 5JZVA 4AAYA 1NBWB 1COWA 1FFWA 4A1OA 1ZEMA 3B89A 4L51A 4KWHA 1ZNWA 1KKLA 1GTG1 1M1UA 3PLRA 5CAEB 5C1PA 4OFXA 2WB2A 2HI0A 2JGDB 3AIOA 3E27A 4HG2A 5KDLA 5B1DA 2D2EA 1U28C 1O94D 3IRUA 2VHQA 1QQAA 2BEJA 1JNXX 4PPNA 4ZO8A 5DKFA 3T5TA 4BZPA 1FTGA 3L0SA 3M2PA 2NUBA 3ZWAA 2YXNA 2JCYA 3QLTA 2BM9A 3JY6A 4YP5A 1G7SA 1ADYA 3MTAA 4KE9A 4X85A 2YYAA 3PD1A 4PU0A 2FMHA 4TKZA 1JE0A 1TMOA 2EIXA 4D6PA 2PEZA 2H31A 2P6UA 3AP2A 3BDAA 3G0DA 4IXTA 5I7OA 5ENVA 1LLQA 1NVVR 3NWBA 4TMKA 3WICA 5FP0A 5JANA 1JG6A 1TPYA 3HB7A 2Y6UA 4MGIR 4UBIA 2ASEA 2R5FA 3K4HA 5FB3A 1FZQA 1U6IA 2IDMA 4AMVA 1GPLA 2A9JA 1SJ9A 2N42A 1YKGA 3X1JA 5CB4B 3MEJA 4KXFB 1BEZA 1EJ6A 2B20A 1XZAA 2C1XA 2FUNB 1FXWA 4AFNA 2PGOA 5LZ4A 2GWRA 2VHUA 1L1EA 1ZICA 1TYAE 4B87A 2QVBA 1CEEA 1OXKB 4JK3A 1CQJA 3VU1A 3IDZA 5ALTA 3HXPA 4KLNA 4LUCA 3ZHXA 5TMBA 3PS9A 4IQ0A 2ON6A 2IW3A 3PD0A 1H2EA 3VJRA 4BEJA 3C3JA 4DG5A 4YPVA 4Z5DA 2H06A 2EWVA 2KS6A 3DBLB 3HV2A 2HV9A 2VPWA 3QNWA 1WSAA 3TJMA 2GZDA 4B45A 4BLTA 1V1RA 3SJUA 2AW6A 4Q3AA 2P2ZA 3MTQA 4FFVA 2CL5A 2H1FA 4QNNA 1ZCBA 1E5TA 1HDYA 2I6GA 4KO4S 2PUWA 4ZO9A 3A6ZA 3I6YA 3CZMA 1CUGA 3KBOA 5JCJA 4LK2A 1NI3A 1P5FA 1QE0A 1E9SA 2JLRA 3B38A 4JXKA 4MP6A 3JR7A 2BKEA 4Z2AA 3A06A 1G5TA 2HU8A 4IF6A 3DA8A 1J8YF 1XCJA 1KSJA 2PYZA 4K6MA 1RM3A 2ZTHA 1NHWA 2MJLA 1BDJA 1NE7A 3MPOA 4LBYA 3BMXA 2QRQA 4OB8A 3ORHA 1UJCA 4J1SA 4UTZA 4RJJA 2QRJA 3WK9A 4X5OA 5IVKA 5ITZB 3NVDA 2R4TA 4Q3LA 1UBRS 4ND5A 1AUVA 1MW9X 3ZWCA 4PXYA 2Q4DA 5FV7A 5EKTA 4Z0HO 2Y76A 3KQTA 2VNIA 2QTCA 5DJ5A 3GJTA 5DW0A 3WL6A 3ZOZA 2HHJA 1Z7YA 2IOYA 1FP7A 3MGKA 4FSXA 1Z12A 3KQSA 5HUHA 2M6LA 4HDKA 4J2OA 4U2DA 1JALA 1Z25A 2XCQA 4UD6A 1CT9A 5FNVB 4CF3A 2H7YA 3GEPA 2IV7A 4B6PA 2QGZA 1UXCA 2OGUA 2WSSD 1U9ZA 4UOZA 1QK4A 4NOJA 4FZJA 4ER0A 1BMDA 3LC7O 1FSPA 4R05A 5KIAA 4JA0A 1OBFO 1R27A 1XVIA 4M1SA 4OIFA 1E96A 1PJ8A