1VPWA

Structure of the purr mutant, l54m, bound to hypoxanthine and purf operator dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSMKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of PurR mutant L54M shows an alternative route to DNA kinking.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 119
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1998-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1vpwA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpwA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpwA02
4KK4A 4M88A 2WJAA 1CJGA 1EFAA 1QQAA 2GKGA 4F8JA 2GX6A 1ZGZA 2MSKA 2F8TA 4X4EA 1YTUA 5DLEA 4NCAA 2N9UA 3QWGA 4J1WA 1EWVA 1NXSA 4RY8A 4G0QA 4YV7A 3HJFA 4PU7A 1VPWA 2L19A 3A3KA 4LE0A 4DADA 1USIA 3OLZA 1P6UA 1FSPA 1GCAA 5EWLA 5FBKA 4N47A 3LUJA 1ABEA 4IF4A 3H5TA 1NXTA 1E6LA 2GI4A 3MF4A 5TQ0A 2XIUA 3F6CA 5HQJA 1A04A 1A2OA 3F7NA 4TMYA 4Z4EA 3EQZA 3KJXA 2L17A 4KRFA 1SXHA 4Z4GA 1O4XA 4ETIA 2AYZA 4RWEA 1S7EA 1FFSA 2CROA 1IIBA 2WUSR 3Q9SA 3OP9A 1B00A 3OLVA 3I5AA 4HNQA 1EWTA 1JHZA 1USGA 3LUDA 2PUGA 4MQFA 2FMIA 2WRZA 1GT0C 2V0NA 2YHAA 4H60A 2QSJA 2WB4A 1H9CA 3DBIA 4DN6A 1PNRA 1ZAYA 3BBLA 2FN9A 2LYSA 1HEYA 1F51E 1DC7A 1P8AA 2KEJA 2VYCA 2WY2D 4Q7EA 4RV5A 4EGSA 2VUHB 3HM9A 1LQCA 3O75A 5B3JC 4NICA 2GBPA 2GRMA 2OR1L 3GBPA 4MLCA 4FE7A 4RS3A 3DLBA 3EGCA 1RPEL 1YMVA 3IP6A 2CSFA 4Z4IA 4YBAA 4I6RA 2LYPA 3VK0A 1M2EA 3LUKA 3OLXA 4OB4A 1ZUGA 3F6WA 4G0YA 4GQMA 2ZWMA 1JYEA 3TRBA 4RZSA 4B09A 4GHJA 4GNRA 2IPLA 4Y9TA 2FSPA 4F3TA 2H0AA 2R1JL 1L5ZA 2IUOA 4Z5DA 4YG4A 1JBEA 1ZITA 3N6VA 3O1JC 5IBQA 3F51A 5TQ2A 4EYKA 4JCXA 3EDCA 3URMA 4X4FA 1RZSA 3ILHA 3QX8A 2GRLA 2WIUB 1P6QA 5CNMA 5EWJA 5JNSA 3P9YA 1YVUA 2JVIA 5FBHA 4F8DA 4OATA 1M5UA 3IPAA 1NXPA 2QVGA 2BJCA 4N76A 3BRQA 3IPCA 3OO1A 3OLWA 2FLWA 3BRSA 3QELA 3R0JA 1NEQA 3JTEA 2NT3A 5ED4A 1ZH2A 2PUDA 1Z13A 3OMWA 3A10A 2HSGA 3EULA 4O1IA 4YCSA 3TD9A 1PRUA 1E6MA 2E4XA 3OQMA 3QEMA 4RK4A 5A7LA 2IVGA 2O49A 5T3YA 3RQIA 3RVLA 4I8TA 3KG2A 3RVRA 2O4AA 1XWRA 2BGGA 3EODA 4Z5CA 1ZS4A 2R25B 1RIOA 1C4WA 4YG7B 1TM2A 2PUFA 3GBVA 4NV3A 1NXXA 3RVPA 3VNAA 1DJMA 2JBAB 4TLMB 3EUSA 3SCHA 1KRWA 3Q7RA 2AXVA 2EWTA 1S8NA 2W42A 5TQJA 1R63A 4RKRA 3N8IA 5JNWA 3RZZA 4MRMB 1FFWA 4ETMA 1KRXA 4IMJB 3QLTA 1NY5A 4EY3A 4KVFA 4MCTA 4JB0A 1APBA 3KCNA 3JXCL 4UHKA 2M98A 4EVQA 1UDRA 2A9QA 3TB6A 4QICA 4EYGA 4IILA 4MCXA 4OBBA 1AU7A 2D5VA 1ISSA 3D02A 3H5IA 1PERL 3W9SA 2A9RA 1ABFA 4MS1A 4Z99A 3QLVA 3JXDL 2RDMA 3GBFA 3EQ2A 4RDCA 4ZMRA 3OQOA 5C5EA 5IX8A 4W5TA 3NNNA 4QYMA 3RH0A 2LP4Y 4YP9A 5JS2A 1LJUA 4OG2A 4OLBA 2JCGA 1E3OC 3CFYA 1E2BA 1BAPA 2WJWA 3D8UA 3OMTA 3BS3A 2IVBA 3CROL 4RY0A 3HDVA 1NXWA 2KPJA 4MAAA 3Q7TA 2HPHA 4ZMSA 1ZPQA 4JCYA 1JF8A 1KGSA 3GT7A 4EVSA 2B5AA 2CD7A 3O9XA 1Y1LA 3N0XA 2OQRA 2JVLA 2P4UA 3DLHA 3LUCA 3FYAA 3NNSA 1ZN2A 3MYYA 2RJNA 1Z16A 1R69A 2R48A 4KMRA 4O1HA 3DGEC 1U8TA 3O2SB 1FQWA 2VUIB 4ETNA 4Z58A 2E4ZA 4TLLB 1YK1A 1JL3A 1T34A 2B1JA 3HV2A 4CBVA 3CS3A 3GYBA 4ZPJA 4EYOA 1EWKA 2IDMA 4MS4B 1SXGA 2PL1A 5KQMA 3I42A 1NERA 3KYIB 1Y9QA 3LTEA 4D6YA 5DTEA 3M6MD 3N0WA 2A6CA 3GL9A 4HNRA 2IU7A 2B4AA 2PLNA 3FFWA 3PXPA 2L8NA 4IA8A 4X4CA 1F4VA 3O1IC 5T7BA 1GCGA 4OLAA 4YR7A 3RVSA 1Y7YA 3FGZA 1P2FA 3HZHA 2IPAB 2LIVA 3OLYA 5FWYA 4MR8A 4YLEA 4FB4A 4MYRA 3H5LA 4P1ZA 2QR3A 1XHEA 3S99A 3T95A 3LKVA 3QEKA 4MRMA 3H1EA 3KKEA 7ABPA 2JK1A 2KYRA 5K98B 5KQGA 1ZZBA 1W9HA 1RPJA 3GN5B 1U0SY 4YO7A 1RZRD 4Z4CA 3LUGA 4PYRA 5PNTA 2JBAA 2FMHA 4Z4FA 2IYNA 4ZYLA 1AB6A 2FW0A 2BNMA 4JASB 2PPXA 1Z2DA 1Z25A 4L4UA 4MQEB 3TMYA 1LCDA 1VRVA 1NXVA 2H8RA 3SY8A 4MQEA 5IUKC 4Y42A 5TPWB 5BRJA 2WWVD 5ABPA 1WH6A 3G85A 4MLDA 4I6UA 1AB5A 3ZHMA 4PEVA 1FFGA 4FE4A 3QLVC 3CRNA 4LDAA 3RVNA 5DCLA 4XLTA 3OM0A 4TN5A 2LYRA 1OCTC 3HUTA 2LCVA 1ZDMA 1BDHA 2FEPA 4W5RA 4PZ0A 3BDNA 1RNLA 1D1QA 3O1HB 1DCMA 4PICA 3ROTA 1WIZA 4W5NA 3LMKA 3HDGA 4KFCA 4RK0A 2H3HA 1CHNA 1DCFA 4YS6A 4E7OA 5JS1A 1LBHA 3HEBA 3GV0A 1DZ3A 5BR1A 5TQ2B 1Z12A 3N53A 4JQDA 1CYEA 3B7HA 4RKQA 3SQNA 2A9OA 2KZ8A 2MSLA 1QO0A 1DBQA 1YMUA 4MS3A 5CNKA 4NDWA 4IMIB 1LMB3 2KEIA 1UTXA 1ADRA 3I09A 3CZ5A 4KQCA 3H5OA 4YG1A 2MYTA 4RK1A 2ICPA 3H75A 1URPA 3DNVB 2IPMA 3NBMA 4X4BA 3RVQA 1DRKA 3G7DA 2PUAA 3QF3A 4G0XA 4W5QA 3E61A 1K66A 5CHYA 4FBIA 4IWRA 1QPZA 2AXZA 2LYLA 2PIJA 1QKKA 5IUNC 2JRLA 1W25A 5BRAA 1JX6A 1PRVA 2JVJA 1Z2EA 1LK0A 1U2QA 1ZESA 3MIZA 5B3JA 2GWRA 4RY9A 5EWMB 1U2PA 1YK0A 3L6UA 3NNDA 2AYXA 3QQ6A 3N75A 3T8YA 4PU4C 3M9WA 3CZCA 4X4GA 2MYPA 1DP4A 3A0RB 3D1NI 4Z9AA 2FJRA 2A9PA 4N0QA 1ZH4A 4G86A 1QP0A 1D4ZA 2YHBA 3CLCA 4G0MA 3H6HA 4XFKA 3G5GA 3GRCA 3FMVA 3H6GA 4WZZA 5TPZA 3HUUA 3KYJB 2XCJA 4H3KB 5F64A 1A0OA 1LBIA 1WH8A 2FEWB 2LUOA 3BD1A 3CLKA 4D6XA 2VK2A 1QP7A 3HS3A 1QQBA 3L49A 3LUHA 1Z18A 2FEKA 2NT4A 4I6TA 1JLKA 2PJUA 3UK0A 4RXUA 2CHFA 4H3HB 3FFXA 4LRQA 2O20A 3LFTA 4NCBA 4JA2A 4KV7A 5KQPA 2QU7A 4RK7A 5IC5A 4KNYA 3SM9A 1CQTA 4QPJC 4KREA 3B2NA 3G1WA 3RVJA 3QEMB 4E7PA 2FXIA 2BNNA 1MB0A 1DC8A 1TMYA 1ZGGA 2ICTA 2FQYA 4ML3A 1POUA 4XASA 5JNTA 3HO1A 1SXIA 1B0NA 4UHJA 5EWJB 4KK3A 4Z5HA 3JPYA 2AUWA 1QMPA 4G0PA 4W5OA 2FTKE 3CG0A 2QW1A 3MMNA 4LX8A 3IP5A 2NZUG 2JVKA 2ID9A 2RGYA 4LZLA 5TE9A 4RU1A 3O74A 1XHFA 1JYFA 4KQ9A 1D2AA 1VLZA 4Q6BA 4RXTA 3RVKA 9ABPA 3LUAA 2TMYA 4OTZA 5CNIA 2KEKA 5TPWA 1SQ8A 2AW6A 2ID7A 3F6PA 5IEJA 3F73A 1D5WA 3QX9A 4F11A 1OSLA 1Z15A 5E3JA 4N41A 3T38A 2GZUA 2MQKA 3LFPA 1DRJA 2OENG 3C6QA 1JH9A 1TVMA 4Q6WA 2CHEA 2IVQA 3A0UA 4Z0NA 3HXMA 3C3KA 2FN8A 1BVHA 3ILYA 1L1MA 1ZZ9A 1ISRA 4X4DA 1E6KA 3E3MA 3Q7SA 3VNBA 2O38A 2AXUA 2I6FA 1R8JA 4X4HA 4YGXB 2XJ3A 4Z59A 2QV0A 4HYEA 2LPMA 1UXCA 4LE2A 2JB9A 3TX6A 1LLIA 4GPAA 3CNBA 2X7XA 4KZKA 1NATA 2FMFA 2Q5CA 4MPTA 4J1XA 4WUTA 6ABPA 1ZZ8A 1JDPA 1MIHA 3IVPA 1JFVA 1DW9A 5JNVA 1RZRA 1YS6A 1LCCA 3BILA 3CHYA 2LYJA 3KHTA 4MQFB 4LE1A 4RSMA 4YARA 3OM1A 1QO0D 2IV1A 2MYUA 2PL9A 2XDYA 5IULC 4Z4HA 3IP7A 4JOQA 1NXOA 4XARA 5CNJA 2PE5A 3SCFA 2LBPA 1K68A 1TJYA 2L2QA 6CHYA 4MR7A 3HZIB 4IGAA 1PHRA 1RXIA 3KSMA 1EAYA 1PEAA 4XXHA 5FWYB 5TPZD 1M2FA 1DBPA 5FWXB 3JS5A 3R1FA 4JP1A 4P98A 2BNOA 2OFYA 3HVRA 4JB2A 2HQOA 3ZHIA 3H1FA 1D1PA 3ZKCA 3JPWA 3H5VA 4IRXA 4O5AA 1ZZ6A 3S8QA 3K9CA 2EF8A 3QK7A 5HM6A 5EWMA 1PUXA 5KQLA 2AWIA 3DGFC 3KTOA 5JNUA 3SG0A 1GUDA 4F06A 3HCWA 2WMYA 2QZJA 3O2JA 5HSGA 3C3WA 3EJWA 2QVCA 1QP4A 5IUJC 3CG4A 3Q15C 2FMKA 1BDJA 3IP9A 3U3WA 4S04A 1SRRA 1ZY2A 3H5WA 4Z9BA 2FQWA 4MR9A 4YRZA 3CECA 4ZJPA 4LDZA 2R4QA 1XWWA 4MR9B 2MSWA 1JFSA 4G0ZA 1GUBA 1DWKA 1MB3A 2IPNA 3GWGA 4MR7B 4MS1B 1PNTA 1JWLA 3C3MA 3RVMA 3O21A 1U04A 3JVDA 3KXAA 3OO0A 3QLUA 3C97A 1DG9A 5GQSA 1LJLA 1J56A 1OXBB 5DGCA 3HK2A 2IKSA 3Q41A 5D2CA 1Z17A 3CU5A 1EHCA 1ZHHA 3HSYA 3RVOA 4WWHA 5FWXA 1ZZ7A 3FYMA 4JAVC 1JFTA 5JNRA 3MM4A 3K4HA 1QNLA 1I3CA 4G0OA 4XAQA 2L18A 2MYNA 2NUBA 1ZVVA 3FDFA 3KLNA 1X2LA 2PMCA 2M1ZA 1ZZCA 3LISA 1KMIY 5KC9A 1SD5A 1MAVA 2P9HA 4KPYA 1PEYA 4MGEA 4MS3B 2FQXA 4RXMA 2EBYA 3ROFA 4DQDA 2HJ9A 4EVRA 4D74A 2QXYA 4HNSA 3QYXA 3FMYA 4PE5B 4NQRA 4YWHA 3DZDA 2FKAA 2E4UA 4IVZA 1JDNA 4O8BA 3UKJA 5HKOA 1Z26A 3MA0A 3MLFA 4PU8A 4RK5A 3NHZA 2FVYA 1RXEA 4G97A 1YS7A 2LYKA 1C0EA 2E4VA 4QYWA 4FN3A 5I4CA 4WT7A 2E4YA 3SAJA 1CEYA 3GA5A 4S05A 2L49A 2LYQA 5KC8A 3SCGA 1UXDA 3GN5A 2E4WA 3JVIA 3UUGA 5C5CA 5KWSA 2IOYA 3M9XA 4WXEA 1M5TA 3H1GA 2HQRA 8ABPA 3KZ3A 4F12A 1BDIA 3EAFA 3SNKA 3T6KA 3MQ4A 4WXMA 3BREA 1USKA 2PAFA 3QELB 1YIOA 1X57A 1BA2A 2FLKA 2RJOA 1HF0A 1TLFA 2PUBA 1MVOA 2PUCA 1WETA 4EYQA 3LKBA 5BQ3A 4MS4A 1GLGA 3KLOA 1VKRA 3NHMA 2HINA 1PRAA 2MEZA 1IC8A 3UFDA 4L85A 3JXBC 3IDOA 2DRIA 2CWDA 2PUEA 3LUFA 4N0PA 5TQ0B 1DCKA 3JY6A 5KI6A 3L1PA 3QLUC 2HQBA 5EWLB 5GOTA 3LOPA 2NZVG 2XI8A 1L5YA 2ZAYA 4N03A 3FFTA 2F8SA 2R63A 3OQNA 4EUKA 1NTRA 1DBWA 2R47A 3N0RA 3O2QB 4RK6A 4MR8B 5IEBA 3CKMA 3TO5A 3I45A 3CTPA 2XSDC 3KS9A 2J48A 4X4IA 1YSEA 3OMXA 5DKFA 1OXKB 2PKXA 4PU3C 3F52A
chains in the Genus database with same CATH superfamily
2Y27A 3VR6A 4FWTA 4GZ3A 1VFPA 2W6OA 2PDAA 1DQZA 2E3JA 1X14A 4FCTA 4TTAA 1JR4A 5DLEA 5ALUA 4NCAA 4L6IA 3FPSA 1QH1A 2WUGA 2I87A 5B1IA 4RY8A 4M6WB 2ZOSA 4CDNA 3OC6A 3OUTA 4EYSA 3TLBA 3S8EA 1K6XA 2HMUA 2P0AA 4UHEA 5FULA 3STYA 1UIMA 1S5PA 1G9TA 5EWLA 3UG6A 4GR9A 1U5BB 1M2WA 2IEAA 4FILA 3KR9A 1E6LA 2NZYA 4OYRA 5EZYA 4CTMA 2A0XA 3L8FA 1O0SA 1E2NA 1QE0A 1R6BX 2FDXA 3L7NA 3NDPA 2BISA 5HQJA 3WYEA 4CGZA 3F7NA 1ZJ5A 3DE0X 3IBTA 1GSOA 1NC1A 2WF6A 2H92A 2GF2A 4PIVA 5EXTA 1Q7GA 5ES4B 1Q0QA 3A11A 3QQ5A 2XUAA 4LCJA 3W4KA 5B2FA 3X1XA 3WYCA 2RBEA 2CROA 2O3RA 2RHWA 3FMGA 4CKEA 1FIUA 3VZRA 5B53A 3LQRA 4C0JA 3SP1A 1HE5A 1Q7CA 3LUBA 4HRYA 1PVDA 3VPSA 1TYCA 2YUIA 1Z4IA 1BMFA 1FNSA 5DYWA 3SSNA 2J9GA 2H51A 1EVEA 1SQSA 2V45A 1T2DA 2C4NA 2A0UA 2XJ4A 1YI0A 3R8XA 4C7VA 2ZIXB 3ECSA 1PGPA 4YPVA 4QHYA 2I7TA 1F4PA 3FWZA 4HBGA 3ORSA 4KFTA 3TZLA 4WKPA 3VPHA 1KGDA 1W46A 1LQCA 1J70A 1G41A 1QGZA 4MYTA 2GRMA 2G80A 1Z34A 2QM0A 4G65A 5MFZA 3TE7A 4Z4IA 2CSFA 3AJ8A 4I6RA 3BYZA 3O3CA 1WQ1R 4Q24A 3F6WA 1Z4JA 2NQ8A 2Q9UA 4RZSA 3WWEA 2ZYSA 3Q6IA 1IK6A 4TZTA 2H07A 1WMEA 3INYA 1L5ZA 2BJWA 1WPXA 4MWDA 3TE6A 1U0OC 2GCIA 5HIAA 2ZI9A 3PXCX 1FLNA 4AKGA 3ILHA 2HPVA 4LY9A 1LTQA 5A71A 2JVIA 2EJUA 3BWVA 3T4PA 2HLNA 3ZU6A 5BURA 2RK6A 3IPAA 4UC0A 5IBCA 3TW8B 3IPCA 3BRSA 1JDZA 4C43A 1AF7A 2Q4OA 2KS6A 2LCFA 1MDBA 2FQQA 1TAGA 2BP7B 2RHRA 5FOWA 2FPGB 5DXAA 2JGIA 4JLNA 4O1IA 5H80A 3WICA 5L3QB 2E4XA 2JFHA 2WP0A 3COZA 2PYDA 3RQIA 3P27A 3ZWBA 1QHGA 3BMOA 4Z86A 3G0GA 2AWOA 2LTAA 5JAUA 3OJLA 1EXWA 2N46A 4FR2A 4CM6A 3S55A 2IODA 1VIMA 4K6GA 1T25A 4CQNA 2DT5A 3OCCA 4MPJA 4EI9A 1HYEA 2CXHA 4GE3A 3M1YA 1JAZA 4RKRA 3U3RA 3IBFA 4P80A 4U7GA 3JYNA 3WMRA 5KBYA 1LTHR 2EX4A 2B37A 3N2LA 5JISA 4JLUA 4FSDA 4H08A 1KI1A 3BMQB 2X8JA 3IVRA 2Q29A 4JZYA 3TINA 1NAIA 2EKQA 4N65A 4ONEA 2E49A 4EA8A 2XNSA 3GLHE 1ODSA 4KBFA 4N3BA 1WMDA 3GEPA 1WXDA 3G68A 3GHHA 3M6WA 4OBBA 4ENRA 1P77A 1XK6A 2RHDA 3DDSA 3GI1A 3N6RA 3QSGA 4NMWA 2QTTA 4Q9LA 5SV2A 4RTKA 1U0BB 4EJ6A 3QLVA 1Z74A 5BR7A 4RDCA 4FYVA 5FCDA 1IJKA 1P1RA 3EWSA 3DA8A 1MDFA 2R86A 3UMMA 1K4YA 5AESA 2V1UA 2I7VA 3PR2B 2C99A 4BS9A 4XKJA 5B7NA 1M6VA 5DK6A 2W7TA 3WY9A 1ZAKA 2M1XA 1KAHA 3GBSA 3VI3B 5HF5A 3DYBA 3GT7A 1MAUA 2Z8YA 3N0XA 3Q98A 1MXHA 4XQGA 1E2FA 4GPBA 1VXOA 4U7TB 3HU5A 4RH0A 3T3OA 5G4LA 2IIBA 4DIDA 5IZCC 3DXZA 2WSIA 1NZDA 1YZNA 2R48A 1WU7A 4JJIA 3T7IA 1U7HA 2VUIB 3AEKA 1ZD2P 4C7BA 1YK1A 1I32A 3RYTC 1JH8A 1T34A 1Y98A 3CS3A 1V25A 3UWOA 3R7WB 3O8RA 4L07A 3WB2A 1X2EA 2XYQA 1DAHA 4HH0A 3M70A 1TF2A 1SHTX 3EVCA 3MJTA 3DTVD 3GL9A 3MPOA 4HNRA 3RWBA 2PLNA 3S4YA 1A1VA 4X4CA 5A0FA 2PVCA 2FZWA 1DXYA 3PXEA 3JWGA 2SBTA 2BFEB 1Y7YA 1P2FA 3OM8A 4V0ME 5HS6A 4AZVA 1PGNA 1FJHA 4IGEA 3R9XB 1U4NA 2ZYUX 3LGAA 2J30A 4ZC1A 1KP9A 2VL7A 4B1FA 5HUQA 4X1OA 4ARUA 4AMGA 3GC6A 3KKEA 3PC2A 3I0NA 4DLUA 2QX7A 2BSAA 4FI3C 2ZVPX 3ZY4A 3EN0A 4GMFA 4AS2A 3STTA 4F2PA 1VBFA 1U1IA 1SG6A 4MRNA 2H2DA 3JQRA 3PXBA 2PPLA 4I5GA 1VRVA 3QMMA 1PR2A 3WZLA 1MAAA 3USES 4HXGA 1U9IA 3PDIA 4AZ0A 5ABPA 1RM3A 2PPVA 3O84A 1XLTA 2X2FA 4JJAA 4NE7A 5IH3A 3TL3A 2YXDA 2A67A 1ZBDA 1MEOA 4P0QB 3RREA 3NAMA 5DWQA 3BF8A 2DOKA 3GB9A 2B7BA 1Z6XA 2JH3A 4UOEA 4D4KA 2QI9F 4IXMA 2E87A 3TTTA 4YX9A 3SJZA 3EDRA 3GXBA 1I3MA 3OZDA 4PZ0A 2PMEA 3O1HB 5TV2A 4DIOA 3U1VA 2BN4A 3TKAA 5HCUA 2ZRQA 3LMKA 3RV3A 1BEUB 1PJLA 1RJWA 4WASA 4RL4A 2PV0A 1VP9A 2F3UA 3BB4A 1IK4A 2IX9A 4YS6A 4YONB 4E7OA 2O8FB 2R751 5DX8A 4C4YA 4KH0A 5EXSA 2PD4A 3C39A 3BXZA 4GW3A 4GKJB 3SR0A 1D2EA 3CC8A 4HDMB 1D1SA 1LW6E 2GN1A 3RUHA 3E1KA 1NQVA 1ZKDA 3HI6A 4B47A 2AX4A 2GRJA 3KTAA 2H1HA 1NBHA 1KS9A 2HLPA 2Z1DA 1U2RA 1NOJA 1KDPA 2RH9B 3MTGA 1ZFNA 4XQ9A 4CLRA 1E8NA 1YFLA 2DFTA 1AKEA 1URPA 1SBHA 5ALJA 4E14A 5L51A 2YQZA 1E2JA 2PSHA 1NAHA 1P5RA 3GIDA 3OIFA 1AMUA 4LNUA 4B74A 4DV5B 3PPVA 5E7MA 3SHOA 1VCMA 5DIFA 1NYTA 2I55A 5J23A 1NMSA 1FFEA 2OLJA 1SUCA 4KN5A 1K6MA 3IA2A 3A27A 3UAVA 2OG1A 4WKOA 4Q4AA 5ECGC 3S2FA 4OYLA 1YIDA 4CEHB 4NH0A 1PL7A 5B3JA 4B17A 5FV4A 1NN3A 5IKPA 3SICE 3O5AA 3Q8KA 3HNPA 4IDQA 4L57A 1U2PA 2JPDA 3IB6A 4KWTA 4P0TA 1W96A 1JN0A 1FXWF 2BV3A 3SI7A 2OD9A 1GEGA 4PGGA 4RFVA 2FZCA 3R0ZA 4PZAA 1XA4A 4ZVRA 3FAZA 3GUVA 2VG8A 2Q6OA 4X94A 2Q2OA 1CUGA 4FJ1A 4QNRA 4B3DA 1SVSA 4AIRA 1E96A 3KYJB 3KX2A 2J7PD 4ZEMA 3LGXA 5CEEA 8GPBA 2Z8XA 1WZCA 1XAHA 1US8B 1JT2A 4I2NA 5ALFA 3VOSA 4B83A 2JCSA 1MA0A 1Q1NA 1YZUA 3GH3A 3L5OA 3PD1A 1SKYE 1NN0A 2C9DA 2ZT8A 1RZ3A 3KFVA 3VH3A 4AULA 3OZCA 3WHLA 2B5WA 2BFDA 5CB8A 2XECA 2EQAA 3TW6A 4OU5A 2H0RA 3THYB 4LISA 2GM9A 3WRWA 2W6JD 3R2JA 4JELA 4JNKA 5CA0F 1ZW1A 3I53A 4G9GA 1TAUA 2IHTA 1P74A 3THWA 1MZVA 1XROA 2VYNA 3PFGA 3G1WA 1PL6A 1H22A 1UC8A 3TSZA 4YR9A 4K1XA 1HM5A 1NMQA 3FUCA 4J2OA 4LWQA 1C9YA 4AP6A 1LSOA 1YRWA 4ERXA 4YLYA 4NCNA 1ML4A 2TSYB 2B4RO 2WPDD 4ECAA 4KK3A 3BD6A 4B3XA 1JTEA 3OKAA 1B73A 2FTKE 4FK8A 3RS3A 1PCXA 4UXHA 3IP5A 1T8SA 5COBA 1IQUA 4Y3UA 2Y9PB 2K2QB 1TJ3A 3OOWA 4M54A 4PNPA 4R1OA 1EVQA 1NULA 3GEHA 4MWGA 3ABIA 3GDGA 3PNPA 1U0JA 2FOLA 1K89A 3JSAA 2GM3A 2HJVA 3NDJA 4LX0A 4RXTA 4UVDA 1YJ8A 2GQ0A 3QKRB 2JEZA 1W94A 2ORWA 3LKDA 3LYUA 4EFDA 1Y4ZA 2QP4A 2GRAA 2GYYA 1U1FA 4RFSA 5IAGA 3AERA 2NM0A 1AV7A 1P31A 3VOBA 1M67A 4NAVA 2HV9A 3A0UA 4TUYA 1P4RA 3R0QA 3ESYA 3N05A 3FOWA 4NL4H 4YTEA 4K9NA 1EJ0A 4DARA 5TMPA 4H1HA 4C0KA 2H4HA 1ZZ9A 1KZ1A 1TF5A 2Q1UA 1NMEA 2UYQA 3HNRA 4WNIA 3ZWKA 4E70A 1WHTB 5LP6C 3KXPA 4K88A 3SZRA 1GNPA 2X1VA 2CLSA 1UADA 1S2NA 3PS9A 2O06A 1CLEA 3JATA 5FBLB 5C4GB 2IBTA 3AHIA 2XI4A 2FOXA 3G02A 1LC0A 3ZTYA 4Q9JA 3ONDA 1Z2OX 3CLSD 3UJAA 1F2UA 1JJ7A 3VISA 1BC5A 2ZANA 3IVPA 1T0UA 4BMXA 4F4HA 2GSWA 1I51A 4MUIA 2FZVA 3IOEA 1SZDA 3K70C 4IVPA 3U7IA 3NIWA 4JS0A 3UUFA 4TXJA 2ZJYA 2V7XA 1NXOA 1JVSA 1UWKA 4WCVA 2LBPA 2XSZD 4F6LA 2AUTA 4MI3A 5ALIA 3GRYA 3VUEA 5HOQA 5AK4A 3EXAA 1PHRA 2NVWA 4WN3A 1ST3A 5IJ9A 3KSBC 1EDBA 1G5QA 1O3YA 1Z5NA 2XF8A 2V3VA 3L1JA 5C18A 5JECA 3UJ9A 1BDMA 1YHZA 5A7GA 1E79D 2F3QA 4BKRA 3GLSA 3ECAA 3H1FA 4AZ3A 3W9YA 1C9NA 4UZSA 2BBSA 4GBGA 1T4BA 1R10A 4JEIA 3S8QA 2GVZC 1D0VA 1FU7A 3L8ZA 4UEJA 3OA0A 4PSUA 3WL4A 4QFDA 2VT3A 5FV7A 5A3SA 2ODTX 3BRWD 4R54A 2Y8EA 3I73A 1GPNA 4CV3A 1O5IA 3GLFE 1T1IA 2BFCB 2J46A 3E7FA 1HT1E 2WLTA 1E1NA 2XLBA 3A4TA 2VBIA 3HBJA 2P4SA 2OAQ1 2ZPTX 3GFFA 3PFNA 1SCBA 1BGWA 2WG2A 3T41A 3ZZTA 5KQRA 1DCTA 2QGNA 2R6CA 1NVGA 3QXGA 3TW0A 2ZSJA 5DTIA 4WN9B 1PGOA 2DH6A 3MGGA 2G17A 1A97A 3PGVA 3ER9A 1WUHS 3S2YA 1MB3A 4J4BA 1JWLA 3FTFA 1JE0A 1I5OA 1W5SA 1QBKC 2HPZA 1G5FA 2FZEA 4HO1X 5K99A 5K3SA 3KE8A 1HLFA 1VYHA 2W8BA 1TRKA 1JQBA 1H2HA 1I3KA 4IR7A 1KEEB 1EHCA 1SUBA 3AFNA 5C80A 4YBZA 5BN5B 4A2PA 3AHFA 3K4HA 1RRCA 1QGUA 3I2KA 1ISPA 1JXOA 1PSZA 3ZE1B 4V38A 5D5HA 2CK3D 1DJQA 4DJTA 3AF4A 2FVXA 3PXUA 4E51A 3OEHD 3LDUA 4TKUB 5FUYA 3ZS8A 4ZYXA 1G8FA 2G9RA 2ZE6A 3FMYA 3HL4A 4PSAA 3U49A 2HWUA 4HTFB 5ALDA 3VR4A 2YOGA 2YNMD 1P1CA 1RYEA 2AG6A 3D4IA 4TRNA 4C0WA 4ZDJA 3NTRA 3NRCA 2XBLA 1K86A 4O25A 3WMXA 1WDMA 4IV0A 1RYYA 1VMDA 1G20A 2XT6A 3EIFA 3QVMA 3MILA 2O7QA 3QU9A 1CZUA 3UJPA 2HR1A 1RWNA 1YBAA 3M3HA 3ND9A 4MYUA 1IN4A 3GPCA 3CKKA 3KWFA 4KTVE 3SEAA 2O8EA 5KC8A 4LMPA 2VKQA 4NCJA 2G6TA 3HVJA 1GP2A 1EKXA 3ZDZB 2FSUA 2H17A 4H7JA 1RAEA 1H3NA 4ZAGA 1YIOA 5AMXA 5KWJA 1D4OA 4EIWA 2JZOA 2AMYA 4LECA 3QE2A 1OI7A 4KYVA 5J2UB 4E09A 4EAQA 1U31A 2O8VA 2GBIA 2XQJA 4H31A 1C7FA 3WTBA 4EFMA 5CFPA 1R0CA 2PUBA 2EXXA 1G5RA 2B6NA 4R3WA 3ANMA 3IDFA 4BFCA 3NM6B 1HT0A 4P9NA 4ZV4A 2C29D 2R6JA 5K0BA 4NWIA 3RC2A 4EB0A 2CFRA 4OBXA 2EATA 4L5BA 1BXRA 4RDHA 4WW0A 5TQ0B 3W1VA 4BKQA 4DDVA 5K8TA 2JGRA 3T5DA 3LXRA 1Q7EA 4B79A 4PTYA 1JRLA 2JI9A 1L5YA 3O82A 4DT1A 2EG5A 3W0LB 1WXXA 1BVYF 3O92A 3O2QB 1TZKA 3ORFA 4JB3A 1MVLA 2UZIR 2RC6A 3HYRA 1B42A 3QOWA 4TWIA 3F67A 2B6HA 5CU7A 2W2KA 2WSSD 2IYSA 1P29A 4HGRA 1L7NA 4GOMD 6NULA 1YTUA 1BSVA 1TK3A 1WP9A 2RHLA 4FW8A 3TNDA 5IYZB 1CJGA 3NVKI 5JFOA 4R8RA 4OI1A 2MINB 2X0IA 3JAWB 4BIIA 4BQQA 4C6TB 1D2RA 1AJEA 4WY5A 5K2OA 4DLWA 3CM0A 3INGA 1QGOA 4XUCA 2AZXA 3ICWA 4Q3OA 2H48A 2IDJA 3CX7A 3EUEA 4KNVA 2FETA 4EHDA 2DPHA 1G3UA 2PA3A 2L19A 4YXWD 3PNKA 4KWCA 1NWCA 2R5WA 4IXWA 1MGPA 2QLFA 3K94A 4DDUA 2IJGX 2QY9A 3BPSA 3M4NA 3HDTA 3DOEA 4L5YA 1XRNA 4EPYA 1UBJS 2D00A 4WXPA 5LQKA 1JDBB 1A2OA 1XYVA 4FUTA 3TDNA 3KJXA 4N5NA 4QELA 2IZ0A 3K4QA 4V0OA 3PQ7A 3CBQA 5B2ZA 1S7EA 1JDTA 1NLZA 1Y4UA 4KQHA 1QVWA 1Y1TA 1RVV1 1KAGA 4ROTA 3T35A 3BJRA 5TB5A 1R4NB 3EG9A 3L7OA 4PFKA 4TSKA 2P9JA 1S02A 3GLGB 1Q91A 2QU8A 2PUGA 3NDBB 1SVLA 2QYHA 2YZ7A 2FMIA 3DOUA 4TWBA 3VBEA 1XVVA 3VFDA 2J4DA 1SOVA 1Y89A 4JEMA 4PLHA 4PLWA 3CUTA 4TQAA 4PLFA 3SQWA 2AOUA 3ESBA 1MGOA 2BP7A 4FEEA 4GPTA 4J1NA 5TX7A 1PSWA 4D9IA 3K2EA 4TOIA 2QT9A 4D41A 5IVIA 1EFRD 1QTNA 3RYHB 3OT1B 2XUIA 5BMVF 1KEEA 1XALA 1U3TA 1FSSA 2JGKA 2PQMA 2R6DA 5F3WB 3UM9A 3FBGA 2EWMA 5K5EA 4PCVA 3HWRA 3MWEB 3ONNA 3Q40A 3DLTA 4HVTA 1HYBA 4D0RA 3M49A 4BVJA 2I2CA 1VE7A 2ST1A 2WWXA 5B37A 1HSOA 3ZIUA 3F51A 1V1RA 8MHTA 4Z1MA 3I1YA 1V5IA 3P9NA 3WMGA 2C07A 3QE0A 5CNMA 2NZ8A 3ZQ6A 4YPOA 4PWYA 4AJIA 5F2OA 3WO0A 1DUVG 1F8YA 3O95A 3PWSA 1A72A 3MB5A 2QVXX 5I7EA 5EJ7A 2AKEA 2WFAA 1BD4A 2O2CA 4V0KA 3V4RA 1IEXA 4EPVA 1ESEA 1XTBA 3L1VA 5EIAA 5CB6A 2Z83A 1R4ZA 1B16A 4IOLA 4AJ1A 2YIMA 3TRJA 5HKBA 4OB7A 2FE1A 4DPLA 4LDJA 1XDDA 2NSDA 1NLUA 3LWDA 5ELMA 4DDTA 1JHMA 3CSDA 5TT1A 5CH5A 3FFBA 3H9BA 3DVAA 4NULA 3D2AA 1DX6A 2GM5A 2AXVA 2ERYA 1U8XX 1NVBA 4WSOA 5AUNB 5EN4A 3ML1A 4BMPB 4CMBA 3RZZA 3ITDA 3K0BA 4BO7A 3I12A 5DBHX 2WJYA 4BU1A 1C0LA 4MDHA 4XRRA 3NKLA 2OHOA 4M9CA 4ZWNA 4L4SA 1AKNA 2YVKA 4QEZA 1I9CA 5DBEX 4EVQA 4QUHA 1MPTA 2JFZA 5DMXA 2A1TS 1H94A 1DAFA 1BXGB 1JKFA 1HF3A 1NFQA 2Z2XA 3F96A 3OQBA 4QBGB 4MCXA 5B1HA 3H9GA 5F3RA 3D02A 3Q85A 4KAXA 1F0KA 2MR6A 4Z99A 1CULC 2XZTA 3EQ2A 2IK8A 4OJQA 4ZU1X 2DCUA 3H11A 3C5CA 5AQEA 5D87A 1L1RA 2ECOA 4TXHA 3P2OA 5JZMA 3QYPA 1G5HA 4D9KA 3GLFB 2IVBA 1Z4QA 4M98A 2CLFB 4EF4A 3ZDXB 3B1XA 3GJTA 3PL1A 1P1BA 1MU0A 1J0DA 1I3LA 1ORIA 2CFOA 4NU6A 1L5GB 1Y34E 3VHXA 3O9XA 5F5LA 3ZBPA 1NP7A 1U6KA 3G7SA 3MCWA 4OJKA 4GPEA 2PSFA 2OSVA 4LOJA 1STOA 1PX0A 3AHGA 4OH1A 1AKMA 3GJ8A 4KMRA 4PLPA 3DGEC 2P35A 3B1JA 4FGUA 5SY9A 3U26A 3K5IA 1T4DA 2EZUA 2G1AA 1GWNA 2HCFA 2QMOA 2DPYA 2UVPA 3C7KA 3FFAA 3I28A 3JAKB 4IL5A 4IVNA 5DO9A 2XVAA 3W5VA 3CLTC 2Q8NA 2DF8A 3DXYA 1C1XB 2H18A 2CNLA 4FBLA 1L7VC 4BGEA 4R69A 4CXMA 4Q7LA 5A5VA 2EJBA 4OA5A 1S9HA 2FX5A 3BAFA 4MX8A 1IUOA 4MGIR 4IH1A 3WQRA 3O1IC 4MUHA 2F1KA 1KOJA 1EHIA 4ALKA 4JWKA 4L7QA 2BF4A 3FGZA 3WWCA 2NU8A 4LJ4A 5A9SA 1KEPA 4ZHQF 1TLLA 3I6BA 3WV5A 4HDMA 1T8UA 3P52A 4D9HA 5CGZA 1F6WA 2QR3A 1TD9A 2ZSKA 1KSJA 3N2ZB 3NCHA 3CE6A 3H1EA 1VMAA 4FZRA 3U31A 1PQ4A 1M6YA 3OTIA 4C2TA 1MV8A 2YWHA 4C6RA 4X54A 5J47A 4Z4FA 4B7XA 1J39A 5FL7D 5LXTB 3HUDA 3IUJA 1DRVA 1IM5A 1Z0SA 4MQEA 3T7RA 4IIUA 4WINA 1X80A 1KI9A 2ZB3A 1KTVA 4GAEA 4MLDA 3A1CA 1MVNA 5REQB 3LY8A 1X19A 3K9WA 1H2AS 1FJGB 3MXOA 2PXAA 2PZKA 4CKCB 3R3JA 4P22A 3FNHA 3MELA 4XUDA 4B81A 3LCMA 5KS2A 1AC5A 1IAQA 3OZWA 5IAOA 4OV6B 4AJEA 2E4AA 2X1HA 3AVWA 2ECQA 5DYGA 2BFFB 1CRWG 2O57A 3E05A 3UMBA 3TWOA 3SJUA 4PPYA 1UAGA 4QBFA 3ZNPA 4EHKA 1OH6A 1MO5A 4J76A 2O3TA 1RACA 4LY3A 4O2AA 2LLVA 3E9NA 3KVRA 5TQ2B 2CHUA 2BCGY 2D5AA 1H42A 4UVIA 1P80A 2FEXA 1DBQA 1ZSNA 4MV1A 1Q22A 4D0LB 3KBBA 1QDUA 3DVQX 2ACVA 3B70A 3HCDA 4HGNA 1JLHA 4KQCA 3AKDA 3HDQA 2P6OA 1UBCA 1UJ5A 1ZD1A 2OR3A 2RG1A 1U5CA 3DE4X 1FNMA 3HACA 4WXRA 4ZRMA 3VR2A 4A2CA 1RIFA 3L8GA 1DADA 4W1QA 1XP5A 3N7AA 1YKFA 5KOJB 3GZNB 2GPNA 3UGKA 1YAJA 4HDAA 4X64B 2AXZA 3Q8MA 4OB6A 3BXGA 1WABA 2D0IA 3PPYA 3A31A 1UBNA 4Z51A 4Z0TA 1OGJA 3FVRA 3PQ6A 2JASA 2ZKLA 3TMKA 3BGDA 4RY9A 3ZLVA 1EFUA 3P20A 4QUEA 5BSVA 1DKOA 1BTOA 2LWIA 3RCBA 4CDMA 1JIUA 2JGAA 4RTPA 3NM4A 4PPGA 3T8YA 4ZAFA 4UNRA 2AFIE 3AB8A 3A0RB 5DGDA 3IRVA 4O4JB 4F3NA 4CR8A 3NUQA 2OV6A 1EGHA 2PXHA 1U28A 1ZIDA 5KJCA 3CZMA 3A6KA 1MENA 4CLRB 3D7KA 2OXIA 5AM1A 1AKWA 2GHQA 5EJ4A 4AY4A 4OSOA 1AVTA 5FR2A 4FN4A 2YWCA 5FBZA 3D6TB 5IAAA 1T4CB 4UKDA 4JBHA 4IIJB 1WCYA 2WG0A 4N7MA 3RIYA 2OFXA 3A6GA 3A58B 4DXHA 3MJDA 2RG7A 1Q7TA 3JATB 2YYYA 3L0CA 4RS4A 4TL6A 4BEJA 5ALLA 4ZJUA 3B2NA 1XZKA 5BSMA 2C2ZA 3JASA 4M87A 3RSFA 4YCMA 2ICTA 3K8QA 2IYXA 1CC1S 3DE3X 4NS1A 3EVDA 4IDHA 5E6RB 3D31A 2H9YA 2HT6A 2IXEA 1M34B 4TKMA 4EG3A 4MCAA 1GUZA 4J91A 1U98A 4I1IA 1QGYA 4X6YA 3DMFA 1G55A 4G8JA 3ZC3A 4ODIA 1JYFA 1Y8QA 1TKCA 1GTRA 2MXDA 1ILEA 4AICA 4AG5A 5FQOA 3D0KA 1UJNA 1OSLA 4ZIRA 1ZN7A 4AP9A 3WK9A 3A9CA 1SKUA 4HB2A 4KYIB 5IX8A 4BTLA 3QHAA 1S8OA 5J4KA 4MLZA 2XTMA 3WBFA 2O2JA 3FZYA 1EX9A 4BLWA 2EJCA 4II3A 4E1BA 5TSDA 1NNEA 2BGJA 2FFBA 1IY8A 3CA8A 3Q3IA 1A5ZA 3HR4A 3DOFA 4WRRA 1PZNA 5BOVA 5C1BA 1VCNA 4GT1A 4EG7A 2HV8A 3L7LA 1UXCA 1UWVA 3KYCA 2PKQO 1EGQA 2WU4A 4E5MA 2O0KA 2CJXA 3UJCA 5HE8A 5IDWA 1U1EA 2IS2A 1Y1SA 2JJ2A 1GM5A 3JQBA 4GSYA 5KNDD 4QVKA 5EG5A 2OKGA 3ZZUA 2VDPB 4WTOA 3ETJA 2ZBQA 3H19A 1G5TA 4G5YA 4AZTA 4YAEA 3GDWA 3H8WA 2ZITA 3FTPA 3OZBA 2LCQA 3IIJA 1O94A 1WKBA 5HG0A 1QHYA 2REOA 2X2PA 4HLDA 4WN9A 2C31A 4UVEA 2ORED 3TD6A 3OTWA 5A2GA 5E6SB 1H6AA 1AXGA 4H18A 3ZEIA 4CHTA 3OKFA 2VLIA 4G8BA 3T3HA 5EVCA 4M53A 4LXTA 2UZAA 3NIDB 2HUNA 4V1CI 3NT2A 3QU4A 1UDBA 1YUMA 5T3UA 4LVUA 2I8CA 1U1DA 3DH0A 4DIUA 4KO8A 4YCAA 2OSBA 3WL7A 4BFVA 4FS8A 3H5VA 1SQ6A 4B87A 1HG0A 1L4KA 2PTHA 5DWDA 4OHZA 4ZYWA 5JS6A 5TS2A 2ZAIA 3K9CA 1GKYA 2EFEB 4UNQA 3I83A 2CLHB 3PP8A 4K0KB 1OLXA 1RWVA 1HUQA 1P7PA 4HP8A 3DV0A 1DAKA 5I8ZA 2O6HA 4HFRA 2WMYA 2QV7A 4FMCF 4PC6A 3EJWA 1E2LA 2PQ2A 2QVCA 4Z9FA 5ENVA 5JZOA 4MI6A 1CS4C 2I3ZA 2RIRA 3JZDA 2HFZA 3OU2A 2FQWA 2PCLA 1IBRA 1SHLA 1HBJA 4FUQA 2QW8A 4A6XA 3R6WA 3KL4A 1XWWA 4N5IX 1D5CA 3JQGB 3L7AA 4GDMA 3EZGA 2OB2A 1PNTA 3BXHA 2HD4A 3HWSA 2HA5A 3KYDA 2GT1A 3HBMA 4UD6A 1OXSC 4UW9A 4RPLA 3C97A 4MUYA 2GHIA 2P5YA 1C3OB 3KT0A 5ILGA 1VI5A 3KEQA 3V8QA 2QJOA 4MA0A 4KIGA 5FWXA 1JG2A 4O2BB 2BKAA 3FI9A 5B6JA 1S7GA 1T1JA 3UOGA 2C7QA 2NUBA 5IZ4A 1VJCA 1KBZA 2WC1A 2WFLA 1CQJB 2OLKA 3I6ZA 2PMCA 1SC4A 2NAPA 3AEZA 1C9KA 1PIWA 1O7JA 3D6VA 3MVEA 1DE0A 4PLZA 3UPTA 1B23P 3E53A 3DTNA 5JYEA 3GPBA 4RHXA 4XVCA 5G41A 5KJ6A 3F8SA 1XRLA 1WPRA 1J2RA 1AHIA 2HHHB 1CB0A 1IZ9A 1QG2A 1XWFA 2FXVA 2VK8A 2YVQA 4QTUB 4BRZA 3H9JA 3MA0A 5DM60 2R7LA 1YC2A 1M66A 2PD6A 1HDGO 5FUXA 3WYGA 5A3QA 3NC1C 3AOEA 3FY4A 4LBYA 2WYVA 4ZO6A 1Z5ZA 4HMOA 5I8PA 3CVVA 3PCTA 4TS9A 4MYHA 3T5BA 4DA9A 2E4YA 2I7XA 4RZXA 3QPWA 3QXSA 1QUFA 2ATCA 4RQUA 4AO6A 5EJFA 4D97A 4E31A 1E0AA 4AY5A 1EK0A 1ZMXA 1W29A 1BE8A 3M9XA 1W2GA 2L69A 3KIPA 1ZNYA 2YYSA 2FPWA 4UE2A 1RYNA 2JIPA 3HHPA 4Q01A 1KFKB 1J8YF 3PT5A 4CEIA 2RFLA 3PUKA 4EKYA 2BR5A 1T1EA 1V8PA 4DA8A 3SK0A 1ZW6A 1N77A 3EMKA 2OD7A 3UC5A 1EUZA 2CXQA 5JVDA 3ZUGA 3O4RA 2LV8A 3ZPXA 2R6FA 3OE7D 2P6UA 3MBKA 4X97A 1DXQA 1X3SA 4IDOA 4N9WA 3AZQA 4X60A 2ZQ5A 1E2EA 4MRVA 1G8GA 1J1IA 1MX3A 4TQ9A 2ZIFA 2HINA 2RKOA 1ZCFA 5DHQA 2B0CA 2WE8A 1KU6A 2DRIA 1SM4A 3UA3A 4FFWA 4A91A 1GNRA 1G7SA 5TNXA 3QLUC 1DKQA 2OFPA 4UBIA 4LA4A 2ZBRA 3ZDRA 1N78A 1TD1A 2HDNB 4FLEA 2WMDA 4EG8A 4YRDA 3QU7A 4DPMA 2XHZA 3DT6A 3QVJA 5J2TB 1IB6A 1WV0A 2GCEA 3LDFA 4U2KA 1AU9A 2DQYA 2Q2VA 4P4UA 1OBFO 1UFRA 2VF8A 4II2A 5FPQA 2NQTA 2I0FA 1XZCA 2YJGA 1F3OA 4N18A 1ZLYA 5J1TB 3T5MA 1YFZA 1ZN9A 5B3LA 3EZFA 1IMOA 1QQAA 3NAQA 3MS2A 4PS0A 1E9AA 3K05A 5H16A 3O1LA 5TEVA 1W75A 5KYWB 1R7RA 1JSLA 3QWGA 1EWVA 2YHSA 3DCYA 4GKVA 1LBSA 2FFQA 1OBVA 3F98A 1J8FA 4RIFA 2QXUA 4Q93A 5BY2A 4P58A 1HI9A 4RZUA 2IP4A 1JLLB 2WDPA 3PF8A 5EHGA 3B5EA 4QXAA 4YAUA 5IT9A 3UOAB 5SZIA 1P0CA 2FP4B 1PR6A 2QNRA 4EELA 2VXBA 3FPLA 4P4SA 3ASVA 1ZK2A 1YI1A 2A7XA 2R2AA 4I36A 4AWAA 5LSAA 2PX0A 3AESB 3FR8A 1VDMA 2W2OA 2DT8A 1FFSA 1GXSA 3BMNA 1OXUA 2X3UA 2XRMA 2G7MC 3L1HA 1XZEA 1NM5C 2G5CA 3U3MA 1PAUA 3NXKA 5DNDA 5BWCA 1N36B 3JAWA 2YMQA 3IEMA 2GBLC 4P5EA 3UJBA 2HADA 4DV6B 1I4TD 1GNTA 2Y1CA 1I1OA 1YR2A 3QVKA 3SBDA 1EK5A 1YR7A 3CLUC 3I1FA 5EUQB 3UAZA 1KQ3A 3BIFA 5CCXA 4YY3B 3FMPB 4ESVA 2H5EA 2W6ZA 2UVQA 2AOTB 3U5TA 4GZMA 3IBSA 2IEZA 4KSYA 1JA1A 1VYTA 4XIYA 4P4LA 1T9GR 4D3ZA 3MTIA 2OC4A 3N0VA 3EGCA 3WRVA 2ECFA 2HU8A 3OZRA 3X2EA 4AS1A 2CMGA 4YREA 3QF4A 4XGNA 6GPBA 3WRYA 3BCHA 1OREA 2D0OB 4AW9A 3K70D 3GEIA 5C37A 4P32A 5JROA 3UFXA 1A5AB 2G70A 3AK4A 1VLHA 3SFTA 1W1IA 4X4FA 3REQA 3WKEA 4B6GA 4PRYA 1ENYA 3P9YA 2WJZB 2RGAA 2PQ6A 1D7OA 1M5UA 2PUHA 4LNHA 5HZHA 1Z4MA 3Q0IA 3L46A 1NPTO 1SIWA 3JWJA 1M2NA 3OLWA 1E5XA 2I29A 3DWFA 3MJ4A 2W2NA 4QVIA 1W0JD 4I9HA 2NT3A 2F62A 1FMCA 4FFDA 3AEQA 1RJFA 2J1LA 4BB0A 2PZEA 5EJ8A 2IVGA 3V1YA 4MICA 3BCUA 4IIXA 3DWGA 4E21A 1UC5B 1LLCA 1GEEA 2PUTA 3EXEA 2BGGA 4AJ9A 4DCCA 3MLBA 4UNPA 5EE1A 1NXXA 2K4MA 2OAGA 2WUFA 1LV7A 2BH2A 1MOZA 1OYOA 1OX4B 1Y5NA 4H3VA 1M1NA 1UMBB 3COVA 5FLEX 1G8YA 1MO3A 4DWOA 4BYGA 1XZPA 2FZGA 4OFZA 2BHLA 1TKRA 1RI5A 2QG4A 1KETA 1UBTS 2V54A 2LE0A 2OXRA 3GOHA 4FONA 4JGIA 4ND4A 4DSTA 3GPLA 4DRYA 4BP1A 4C0SA 4RABA 3WDLA 1N1DA 4R31A 1PTKA 3ZH2A 2QRMA 2ZSIA 1VSBA 2WLSA 3KFXA 3KP1A 3OBBA 4H7FA 4ALJA 5K6AA 3P0IA 4RLSA 3MWFA 3FPAA 3NO4A 1ADJA 5ALXA 2X86A 2RDMA 2JAPA 3PDWA 3ZUPA 4D9GA 4C5CA 2ZKIA 4KXYA 1UL1X 5LKRA 2DVMA 1QIGA 1E32A 1WUKS 2HU7A 3IOYA 4CLHA 4FXPA 4NABA 4AXBA 2C3OA 2AZMA 1UPUA 2IEYA 3I2IA 4A1FA 1CRPA 2J9XB 1GARA 2PIDA 2Q9AA 3ILVA 1RYDA 1G3QA 2QT0A 1G66A 5B7QA 1GRRA 3S40A 1K3UB 3FRJA 4RTRA 1UKZA 3T9BA 5TQVA 3W6PA 1THTA 1KMQA 3DHWC 4QWMA 1T9HA 2PSSA 4MUMA 1M2OB 3JZFA 3INRA 2C2HA 3EGDB 1F06A 4FNAA 1R4AA 4LYAA 1CE8A 4OI2A 4OLJA 2XDQB 4RZ3A 2ZWOA 3M89A 3TDMA 1XTIA 3VHQA 4B2LA 1GRNA 3JARB 4BQFA 2QMYA 3I42A 1L5RA 3EVBA 4I4NA 2G71A 2V6JA 1UC4B 3M6MD 4G2NA 1ZHOA 3M4XA 3UYLA 4I1YA 1LD3A 2P6PA 1SPXA 3CUUA 3TRIA 2GZ2A 4DLYA 2XUDA 4RYDA 5JSQA 1LDMA 4YR7A 3RW9A 4KMSA 2OCGA 3MWYW 2IWHA 2X7JA 4FHZA 1PJAA 2VDMB 4CG0A 1SVMA 3CCCA 2R0QC 2CNWA 2VDVE 2VYFA 4KJXA 2X8BA 4DMKA 5F9HA 5A4KA 1WSDA 3ZK7A 4S05A 1VC2A 2D8AA 3IAM1 4OOEA 2G8NA 3W6ZA 3SYNA 1CCWA 4EDFA 2FSVC 5AW0A 1QK3A 1U63A 1C81A 1J9ZA 1ZOPA 4WLEA 4WKGA 2ZDHA 3A25A 5JAIA 4C2BA 1L5QA 2PU7A 2CDCA 2JJ2D 1JU3A 3HCPA 3WLEA 1X1DA 3WGOA 1QIJA 2QYSA 3CJRA 2IOFA 3UFXB 1Z8DA 4MWBA 1J1ZA 4Y42A 1J25A 2ETVA 1Y7TA 5KU1A 1WH6A 4DE5A 3LZ6A 3SSMA 3IKMB 2VTDA 4PEVA 3EASA 1RYFA 2C82A 3HUEA 1NLMA 1ZICA 4LDAA 3AYXB 4R81A 3I5UA 2E0IA 2VF4X 5DCLA 1ENPA 2IZ7A 7MHTA 3AF1A 3BEOA 3ICVA 4TM8A 1A8HA 5L8VA 2YC2C 5L53A 5LQRA 1J33A 1XAJA 3Q9LA 5EZSA 1U2DA 3ZCVA 4B2YA 2JHFA 1CWUA 4OU4A 3WGHA 2QTNA 1OW3B 2EGGA 4GYWA 2IHKA 1PE0A 4OBEA 3RD5A 4DSAA 3J80A 1RJEA 1KI3A 3H1PA 1WBJB 1A7JA 2PLAA 1P72A 3SIWA 4CFSA 1HXHA 4JKIA 1R0LA 1DKUA 1RWPA 1Z12A 1YZLA 2FR0A 2Z9CA 4RKQA 3ZQUA 3IV6A 5H82A 9ATCA 2QJFA 5CNKA 2WOOA 1LMB3 1PT6A 3OZFA 1MX9A 4M9SA 5C8YF 2KM1A 3JALB 1JKXA 1BKYA 1JG7A 4GWGA 1ADCA 3IA7A 4Q02A 3RLIA 1JR3D 2QRJA 1BVRA 4B32A 4D3XA 5I9BA 4ESHA 3GN1A 2PO5A 5E8RA 5A6SA 2AOTA 3HN6A 1CZRA 3OWHA 4G07A 3AF0A 4TMXA 5FI3A 3RSCA 4AUEA 3UT5A 3RS5A 4HRVA 4AG3A 2H59A 2YHUA 5CLHA 4GXTA 4YJ3F 1QKKA 5AXBA 4JQZA 3ZQJA 4AMUA 4BBZA 2AG5A 1YRBA 3OZGA 4YI5A 1CZHA 3CZ9A 1INLA 2PX3A 4BQRA 2WK1A 5EWMB 1XNGA 1CW2B 2WKPA 2XOKA 1GNLA 1QQ6A 4F5YA 1PT8A 2H00A 2LIPA 4HN9A 1SAYA 2VCEA 3UV6A 1N2SA 1YDMA 2O2IA 1FE8A 3GGDA 1KVSA 4P34A 3WLJA 4HFNA 2Z4RA 1VHJA 4OP2A 4WZZA 4R1PA 1YSCA 3EYAA 4L5CA 4KTTE 5F64A 3EIEA 4LV6A 4C7JA 2CB9A 3HFGA 4XIJA 5FLXA 4YAWA 3NBXX 1OZGA 4BJHB 4RBNA 1D8TA 3EB9A 4Y1RB 1AK2A 3KAQA 1MW9X 4RXUA 2RK3A 5M2QA 4DR3B 2ET6A 1ZOOA 2YYAA 5CEJA 4ARVA 5HGXA 3ZI0A 1T5DX 2O20A 1DHTA 4X91A 4LZAA 5CDSA 1KQPA 3ENZA 5J4VA 5F98A 4KHZA 5EIXA 2A6PA 2GCGA 3ID6C 13PKA 3WFZA 2ZPUA 2EL7A 2J7UA 3PTAA 1GSAA 1XL1A 3IAAA 2B4TO 1S0UA 5DNWA 1HORA 1YDFA 3I64A 3AR8A 1DC8A 1ONOA 1V48A 1M1NB 1UMBA 1ZD8A 2JZCA 2Z56A 3RS8A 1C7JA 3A4NA 1MXFA 3KYCB 4LGVA 1B7GO 4HEA6 4BNFA 3D0QA 5EMHA 4ZZ1A 4Q1AA 4CW7A 5A9RA 5IN4A 3HXTA 3MMNA 4ER3A 1KFBB 2VP3A 3GO4A 4RSHA 2O8BB 2B3TA 3GZTB 2IVZA 3HP1A 5E6UA 1EBUA 3PR3A 4MW4A 1E61A 1Z73A 4ZU3A 1E3QA 2DTEA 1DX4A 1WBDA 1VLZA 1B8PA 2I1LA 4Q6BA 2PXXA 3M34A 5IEJA 3RJ9A 1O8CA 1KMNA 2YN2A 4EATA 4F11A 3N2GB 1KJNA 2ZK7A 1X7WB 2J0VA 2PLRA 3SF8A 3ANSA 3EC1A 1OFTA 3OPYA 1AKYA 3NGLA 2IV3A 4LW8A 3OOSA 2L1PA 3R40A 4LF5B 1EESA 1FTYA 1L1MA 1NI3A 3ODGA 3SLGA 5KSOA 1SNYA 3HA2A 4OD0A 4EA7A 4I1SA 1R8JA 4YGXB 4CKBB 4NMLA 3BN3A 1OI2A 1EGAA 3H86A 1JDSA 4TQGA 3EISA 2OGUA 4DQ0A 4EJSB 1KJZA 2BGTA 2H1WA 1NI4A 4WUTA 3RHSA 1F6DA 2PKRA 1ZZ8A 4LYEA 4NI5A 4TS1A 2R85A 1TJPB 5IJWA 1YS6A 2C9YA 4ZI7B 5K6RA 4TLBA 4P33A 1GPBA 5KAPA 1RBMA 2DAPA 3KQWA 4NS4A 4RSMA 3V7UA 2PL9A 1GR1A 1XLVA 1DRWA 1UPTA 3CPSA 2XZPA 2WF7A 3E3AA 2X9LA 4L4RA 4LPKA 4LYGA 1Q1AA 5FOSA 1KEVA 4ZVNA 5JRJA 3RYIA 4J9VA 1IATA 2QE6A 5EXXA 3GGGA 1P7VA 1SCJA 2R79A 3ADKA 3D3QA 2PNJA 3L0YA 4UAVA 2NZWA 3WMFA 4Y2XA 1X8LA 3OF2A 4S1OA 1EDZA 2CSUA 4XXHA 1JIKA 3ZLTA 4BVGA 1N7JA 2UZ0A 4PAOA 4WHMA 5DE3A 1TM3E 5G0TA 3M1LA 3RANA 2Y99A 1SWWA 4UUOA 1N1MA 4G3XA 4ZVSA 1Z0UA 3DAHA 2C4UA 2WFLB 1HQYE 4KR9A 3C8ZA 4UATA 1M73E 5DNAA 2A3NA 4O2BA 3TM5A 2QG9A 1JHQA 4GOJA 5LZ7A 3GQBB 3VNSA 1EA7A 4GI1A 5EWMA 2Q7DA 1IN1A 2XKAA 2G0AA 2FJPA 3N8NA 1CVRA 2V98A 2WIGA 4FHFA 3V46A 3HCWA 1DWQA 4CKEB 4F06A 1X74A 2QZJA 1LPSA 4FQ5A 4HWKA 4HYQA 4UM8B 1CP3A 1B6SA 2P9TA 4IQGA 1BU5A 2XXPA 4JJEA 2RSLA 1X9GA 3F6BX 3GVPA 4YECA 3U4CA 4DLKA 2F64A 3BDAA 3OVMA 4QNNA 4Z9YA 3ZWVA 4B8ZA 4YRZA 4WLOA 4R84A 2G28A 4FPXA 5EJAA 3WIOA 4E32A 3PR1A 1RWQA 1NX6A 2PRZA 4Y30A 2YY6A 2ZWPA 3ADCA 4BFTA 2IPNA 3WZ2A 1KYVA 4U63A 1OYWA 1UK7A 1V71A 4B82A 3JD0A 2YQ5A 2OO5C 2DUWA 4MMXB 1F14A 1T8YA 1YI8A 4N0EA 4BL5A 1XRMA 3IT0A 3CU5A 1OBOA 4G1EB 2Y9MB 1EX6A 1NONA 4JUDX 4WA8A 3TKLA 1YF3A 3VU0A 5AW9A 1LFDB 1I6LA 2L18A 5A62A 3FDFA 2GF9A 5BV2P 4D4MA 3OFVA 3JYOA 2Q6TA 1P2SA 4BLPA 3PFBA 5CBPB 2MT9A 5KB3A 3JQCA 4MDYA 4NOKA 4R51A 1K2VN 1A9YA 5AICA 2J0SA 2Y93A 3WFJA 1Z2NX 4OQXA 5IJ0B 4D74A 1T15A 4IDCA 1YFJA 1H1LA 5AH0A 5F1YA 2EOAA 5DGXA 5ARBA 5E7JA 3MTBA 5H1YA 5AJUA 3ESQA 4R8KA 4WK4B 5EIHA 5TIIA 2R65A 4DLNA 1G4HA 4JJ7A 4PU8A 2CNNA 3DMYA 2VN8A 1AUXA 3OAAD 2FVYA 4I55B 3TOZA 3VTKA 3FBTA 4AFNA 4LSGA 3FJ1A 5K7SA 1M0EA 2IU3A 1KVUA 1CY7A 3OPNA 5ERGB 4RTSA 4M9UA 2UYCA 2O54A 1E9CA 2ACEA 1Z4KA 1Z45A 2IGTA 4X7MA 3WGZA 3BB1A 1UXDA 1BKDR 1JQKA 1GG9A 1XUOA 1Z5VA 2BFEA 3GT0A 4DIKA 3BS4A 3ACDA 4GOND 3J81A 3MBIA 4LXQA 5A4MS 3GJQA 1YBHA 1MC1A 4L9SA 4Q9NA 2C8KA 1OIVA 2WIJA 2VRWA 4Z1MD 2JFUA 2KMLA 1OMOA 2H8GA 3EXFA 1POWA 4HNAA 1U7UA 2ZI5A 1OASA 1BA2A 1XU9A 5JCJD 3DMNA 1JHDA 2QWXA 4S1WA 2IBSA 2JGJA 1Y5RA 5DT2A 3DLIA 2PM8A 1VJ5A 2QR5A 2PS1A 4PZUA 3DFIA 3OEEA 3ORRA 3G5UA 2I66A 3I0ZA 3S28A 5K0LA 4C22A 1HDYA 4N4AA 2H3EA 4XX0B 5B2EA 1PRAA 3N2KB 4L72A 2JFVA 1CETA 3LUFA 5HBGA 2CWDA 4X7PA 4QJBA 1P39A 3UZUA 3AVTA 1J1UA 3VH2A 2DUUA 1BHJA 2D2XA 4Y18A 1BCSB 4YB8A 2GBCA 4PSKA 2GN2A 1S3GA 3FOCA 4RACA 3W1EA 1SUPA 3OQNA 2V7TA 3PYLA 3S70A 3SD7A 2YJ3A 1X1CA 4RMIA 1EWRA 2B5VA 4B4DA 4WBNF 3R3ZA 3CTPA 4HN4B 3DAYA 1Q11A 1CJMA 2J48A 1ZMRA 2MTBA 4RVFA 3F49S 5DHPA 3RBVA 3GQBA 5AM0A 5AD1A 5JCOC 3U3DA 3P0EA 4OP1A 5AW6A 1GPAA 1TFUA 2VCYA 3OOHA 4JI2B 2P0EA 2YWXA 1CUSA 2CUTA 1IJEA 1HV8A 1NJ2A 2I7DA 1QLJA 2LR0A 3AF2A 3BA6A 4MPPA 3I5YA 2J4FA 1M2KA 2HHJA 3M6VA 4J1WA 4WOKA 1NF8A 2I9KA 1L4EA 1O5OA 1BWQA 1UQTA 2YY7A 3MJRA 2WM2A 4C4XA 4EUHA 1E1QA 4PCAA 1A2KC 1VPWA 1Y7HA 1LQTA 4BE7B 2Q8PA 3IS3A 3TVYA 3RG2A 3C6YA 5LYYA 3ZWMA 1N6OA 4GUDA 1QAOA 1I94B 2IHJA 3VZSA 2C9MA 4EGCB 5IZCA 5IT5A 5FBKA 3OT5A 1ESDA 5KNDH 3ROQA 3C70A 1VIDA 5CJPA 3AVUA 3GUZA 3I2FA 4QXQA 1EUYA 4OHBA 4M9RA 3FYUA 1ORTA 5JQGA 4JBYA 2L17A 2P9EA 3TGWA 4PPNA 5ALWA 1MO2A 5JIBA 2GZMA 3T7AA 5B1DA 1YUBA 2C59A 2X9VA 2ZSDA 4QUKA 4CJXA 1PKXA 1TMGE 4UUMA 4Q4JB 1Z33A 1ZUNA 2HHCA 3RFFA 1SZCA 1VBKA 1DT3A 1USGA 1ISFA 3LNCA 4FDVA 1TA4A 3O03A 1H4TA 1QOZA 2VVTA 3NBQA 4TL9A 3DTTA 2QSJA 5ESDA 3R4CA 4QX6A 3P1JA 5ILQA 3RODA 3QKUA 1M54A 1HFKA 4LWPA 3AXSA 3ZR4B 4QUDA 1YRAA 1SOUA 2A5DA 1DC7A 1Y9ZA 2X5NA 3MC1A 2A3RA 2I6QA 3GRRA 2B78A 3NAZA 1UH5A 4RVSA 4RV5A 1G16A 3ZDAA 1O94C 4XQEA 1IDN1 3SCZA 3C4JA 3HJHA 4ZJYA 4ZIRB 4FFLA 1NUPA 4NICA 2OR1L 3TX2A 1MW8X 2Z3WA 4BZQA 3OMLA 1IXSB 2ERCA 5FLYA 3B52X 3OWXA 2R2GA 2W90A 1YV9A 4R41A 1RHMA 2IA5A 2YMMA 3D2LA 1TEZA 1JYEA 4FQ8A 4OMCA 1FZQA 3E9CA 3SZOA 1RI1A 3PCRB 4CT4B 1MX5A 4ITRC 1X1TA 4O8ZA 3T1YB 5IBQA 4FT4A 1BRMA 1GA4A 4LNAA 4JCXA 4M3NA 4Z9XA 5CVJA 4AU1A 4GD3Q 3DMHA 2YR0A 4M36A 4X61A 4NH4A 1QSGA 1QYXA 3HV0A 5E6RA 3VX3A 1XL0A 4J0IA 1IUPA 1KPHA 3ZHCA 1SH7A 1FDOA 4F2GA 1CUYA 3D3KA 4OHVA 2IH2A 1MQ9A 3E18A 3IILA 1E2KA 3QELA 4UZFA 2ZUTA 2JFYA 2IELA 5JO0A 4MEJA 4U7WA 1T26A 4NYJR 3WL8A 3RJZA 4JI6B 2PLFA 3OMWA 2HSGA 1A1SA 1V35A 1WNFA 2XIQA 3EHEA 3K72B 4HAOA 4YCSA 5EKTA 2ABWA 1QRRA 1X7ZB 2BGLA 2EU8A 3C7AA 5FRDA 5YASA 4PLVA 1C7RA 1KF0A 2HIGA 2V6MA 2VYND 1OZHA 3IIEA 3LT2A 1PR1A 2NACA 4I4TF 1R5JA 4I8TA 1UBHS 4I14A 6ADHA 1IAVA 2XWPA 4IV8A 3K1TA 4GM0A 3ZHZA 2PXDA 1B41A 4QJ3A 1N8KA 2XX3A 2PUJA 4GH5A 4TTTS 1P4AA 4DV2B 3LU1A 1D2MA 3E82A 1K0UA 1Z7YA 2QMUA 2R9VA 2XTJA 1P9NA 2C2GA 4X65B 4IMJB 4JJ6A 1AOXA 1DTSA 4ICIA 2KX7A 4OQZA 5ESXA 2XE7A 3TTYA 1DVRA 3UAXA 1WZ2A 2JGEA 3LBHA 3V32A 1ZIXA 3UQYS 3GQVA 2C00A 4BAGA 4R3UC 2WWFA 3G1TA 5T6BA 2X6QA 2WAAA 2ZWAA 3EEIA 1K7SN 2RHMA 4E13A 3SIPA 4MB2A 1PERL 2DZDA 3W9SA 2EDAA 4L02A 2QY6A 3MT7A 1IMJA 4ZMRA 3S1AB 1B26A 1XA0A 4DREA 4JLPA 5JS2A 2UXBB 3VC7A 2BFDB 1IJFA 3AFHA 4B4WA 4KFRA 3E1GA 4L8YA 4DKXA 4ES6A 1KY2A 1Z29A 2C4HA 3CX3A 2I4MA 3GNLA 4A8JB 4D3DA 2QTVA 4JJGA 4RY2A 3CROL 1WB5A 1X1BA 1KFEB 1NXWA 1T8WA 2IYVA 2JKYA 4YK7A 5JQGB 1OV6A 1L7MA 4ACAA 5I4KA 3AWIA 1UIRA 4A10A 1UZLA 1THGA 2QF7A 1YB4A 4IINA 2VJAA 4IHAA 1A8QA 1AUVA 2FGKA 4MB6A 2VKTA 4DANA 3F7MA 3TRHA 4C1BA 4PN7A 1G21A 4OJTA 3DV9A 2IXAA 3OQ1A 4K46A 1RXVA 1YUNA 3NZLA 4N01A 6PFKA 4XJSA 2YWFA 1OZAA 4TLLB 5JBIA 4FFRA 3V80A 1E79A 2IDMA 1L5WA 4Y67A 3UMVA 2EIHA 1V45E 4NBTA 1JEJA 4C04A 1NTOA 2AN9A 2VNAA 3NHRA 3IEXA 4PC3A 5ERXA 3ZCTA 1FDSA 3MWGA 3VA7A 1BRTA 3LVFO 3B78A 3L1KA 5HCIA 5TMBA 4LBWA 4GP6A 1G17A 3NOQA 4BVBA 4WH0A 1X86B 1M5RA 1SXJE 4KQKA 3WIUA 2HFJA 4WESB 3IKTA 4DM7A 1W6RA 1ZEJA 3BL8A 3JQAD 4B6SA 4D4HA 1L5KA 5JRDS 3K9FC 1NPYA 3IBYA 2CMKA 3ZGNA 3QWBA 7ABPA 4PC7A 1HOXA 2Q3EA 2V8OA 3AUYA 2GS9A 1U0SY 1Z6PA 5EKDA 4AP5A 3WLQA 3CVUA 1TJ5A 4PYRA 3B9BA 3O4VA 1KIMA 2VT7A 2FUEA 4MJ3A 4P08A 1B0ZA 4YMHA 4NVRA 4IZIA 2FCAA 1AN0A 1PI3A 3IR6A 1C5KA 3WIVA 3OAAA 5TPWB 4M0FA 1RI4A 3L7CA 5IJAA 3W1WA 3DDZX 3G85A 4QLBA 3L84A 4YMVA 3ZHMA 3FHLA 3FD8A 4R98A 1KNQA 5EJEA 2WYOA 4COKA 4GLOA 3B2EA 5TDHA 3L3BA 3VJMA 3K09A 4U5XA 2GILA 4P7GA 3UK7A 1AQJA 1RKVA 1BG6A 1EZ1A 2VHZA 4G4SO 3G2LA 1PK8A 1WXWA 4CM4B 5EIBC 2WILA 4W5NA 4F8EA 2AG8A 3K8ZA 1FYDA 4RJLA 1XT6A 5I01A 1QFJA 2YCBA 2EZ9A 4RK0A 4CL2A 1HX7A 2ZRFA 3C8DA 3OH8A 1VXRA 2BBOA 1W88A 5DP1A 4LC9A 4DR7B 2X0EA 2Y0PA 5K20A 1PFVA 3GFTA 2A0WA 3LQ2A 2QOEA 1LF0A 1Z38A 1K5GA 4Z8XA 5F5XA 2ZM6B 1XMXA 2ZRBA 4I8IA 2XXJA 1SIBE 1RYZA 1E7RA 3EDQA 2E5WA 5LP6A 2DUNA 2HQ1A 4TROA 4RK1A 3RFCA 2NNLD 4OGKA 2NUTA 3H75A 1J2UA 4R0VA 2UUAB 3SLRA 2H4JA 1NYRA 1DL5A 4D8XA 3OX1A 3KXDA 5KCZA 2PUAA 1T2VA 1Z39A 2IWRA 1GHTA 4BJ1A 1EAMA 3HXQA 3ZKWB 1RAGA 2EARA 1D2HA 5CHYA 4IM7A 4WCFB 1GPLA 3EC2A 2O3QA 2BI8A 4L22A 3FAKA 2XCUA 1XTZA 4A03A 5HNKA 4AMVA 3DLCA 5FI1B 3VDQA 2GWRA 3ZWOA 2PUWA 1YT5A 2C58A 2Q46A 1K92A 3RADC 1RMYA 1EE1A 4ZQIA 4BNZA 1BE0A 1J2YA 3N75A 2ZB4A 1MH9A 4NJOA 5DEIA 1CUAA 5I47A 2MYPA 1DP4A 4C88A 1Y3BE 3AGPA 3KOUA 1RE1A 4KH1A 4UTXA 5AXDA 1EP3B 2HJSA 1JA0A 2H5LA 2I62A 3I9JA 4CM8A 5CXQA 1T8PA 4F5DA 3RG8A 4A4DA 4TTPA 3SEQA 1OROA 4GZ5A 2IUTA 2YH2A 3QKSA 4UPEA 2FWAA 1LBIA 2KBEA 5AVSA 4LZNA 4BNIA 3NLLA 4V03A 3CLKA 3N74A 2GAOA 5DJ5A 2GD6A 1JU9A 1QP7A 3R7NA 3ERCA 3ELUA 3EXIB 3HKBB 4M8LA 2EFYA 1NPDA 2XAAA 5ALRA 3X2SA 4ZGGA 3TTXA 4UTNA 4M6WA 1QO9A 1ZM4A 2MMCA 4F38A 5EQTA 3TLXA 1XXHA 4GPD1 1RHQA 4CCYA 5HQTA 3W79A 2C7OA 5LWQA 3LXMA 4B7UA 1KYQA 3SS9X 5C35A 3TLMA 3QX3A 4GF5A 3DMGA 1QX4A 2TRSB 1IY2A 2ID4A 3EW9A 3ICEA 1RXCA 4P82A 5CH8A 2GOYA 5K3CA 1ZGJA 4Q03A 1B0NA 1KP2A 2ZBPA 1F8GA 4DDHA 3R20A 1QHIA 1NN5A 4XQCA 2J9ZB 4OAOA 4UAUA 5IKEA 2Z98A 2Q9CA 3ANYB 4MJXA 4RF2A 3OY7A 1AKRA 1RCUA 1D1TA 2WU1A 3NHBA 4U2GA 3D8TA 2ID9A 3RYCA 3K2IA 1E5DA 1GOTA 2V5VA 4OLFA 4HI0E 5IHXA 5JRZA 3OP1A 2PMDA 1FX0B 2WMNB 4BWGA 4NYMR 1JEQA 4OTZA 1Z47A 2ZLBA 3I72A 3SXJA 2I4LA 4E3ZA 1E9DA 4RGQA 3T9AA 1Y37A 1FA9A 4L4ZA 1Z15A 1MAWA 2IP1A 4PHCA 4WBXC 3LFPA 3ELBA 4YQEA 3VC2A 3WIBA 1KYIA 2QX4A 4Q1VA 2V59A 4MQ4A 5B5SA 4PRKA 4EITA 3QHPA 3KT3A 1H2BA 3AH8A 5FB3A 2DLDA 4ACBA 5DM2A 1IY9A 3GFBA 3ANLA 1XBTA 1DBIA 2Q3FA 1J2TA 3ETGA 3VO1A 3WWPA 4RTLA 3IR5A 4R1TA 3ED1A 4FBGA 2G88A 4PF1A 4RYLA 3SZMA 3WLHA 4YJ2A 3QPCA 1UODA 3ES9A 3ZD8A 3EYWA 1N6PA 1NATA 2Q5CA 3DZIA 1UEIA 2YDYA 4O4IB 1LGYA 4ZDIA 1J24A 1GFSA 1GGEA 1WR8A 2IUFA 2VT6A 3CVYA 4E5PA 2A9KA 4FHGA 4NJEA 5CX1B 2Y92A 5D86A 3ZXYA 1C8VB 1CR2A 4HQRA 5EXDA 4IIHA 1WCWA 3AKZA 4Z4HA 3RT1A 2CLKB 4XARA 4YP1A 1TIBA 1SBTA 3HMKA 3IQXA 3MGBA 5HDQA 4F1WA 3X0DA 2UUCB 2CJFA 2YV2A 4AT1A 1QS0A 1NJ5A 2RONA 2VHVA 1W34A 2ZEJA 1DG3A 3NHUA 4RHYA 3KSMA 4A1OA 2ORYA 2AH5A 2H06A 2D7JA 3ZVLA 5A3RA 2O07A 4WESA 5JZVA 4NBVA 1KAMA 1TOAA 5CM8B 3LI2A 2G63A 2XMGA 2FI1A 4AKEA 1QZZA 3L05A 5DW3A 1ZIOA 3LWBA 4RD4A 1XXHE 4QOHA 2B5OA 5DYYA 3ICCA 1DU4A 4DILA 3R6TA 2O8DA 5BSGA 4Y9RA 1FFXA 4EENA 2E6UX 3ITKA 2HZ7A 1YKSA 4ENUA 1KHTA 4WLNA 3OCZA 4HX9A 1JSZA 3AJDA 2QRPA 3C3WA 2Q1SA 3HJBA 3K0AA 1P1KA 4KE7A 1JAIA 3HZZA 4WJKB 4WPGA 3SN6A 4CM8B 4EF6A 1K5HA 2PBZA 3NKVA 1VYVA 4HEJA 5JASA 2BHSA 2WVJA 1AN9A 5FBRB 5B4UA 1N5DA 4ASUA 2HUPA 3PC7A 3V7WA 3AY0A 1HDOA 3IQGX 3HEAA 5CA0B 4MR9B 1I2MA 2MSWA 4BFYA 2Y4NA 4EKNB 2Q4EA 1QWOA 3IQZA 1CFJA 3EVEA 3LQFA 3RK1A 2FUG6 5LMCA 5TXGA 4P84A 1A7KA 2RH4A 4KXXA 4OB8A 3KXAA 1KK0A 4LGYA 3U9SA 2A4MA 2OP0A 1JDVA 2WQ6A 2IIVA 3JQAA 5JAZA 1LJLA 1J56A 2ZI7A 4WZBB 2YZMA 1CTQA 1RQLA 3WC4A 3UPDA 4HYTA 1KI7A 3IEKA 3LF1A 3WZMA 4RSGA 1ZZ7A 2B4KA 2ZP1A 3D1VA 4J6FA 4AQDA 1KAEA 1LZLA 4U9UA 3EGEA 4UBLA 5BW5A 4RUKA 5L4SA 1U1GA 3BXEA 3S3TA 4B3RB 3VXKA 4KI0A 1G7CA 3LISA 1I4WA 1D6SA 2O50A 4OHRA 1R4MB 1TKAA 1Y1PA 3AVOA 3ROFA 2A2ZA 4DQDA 4IJ6A 1AURA 2VCHA 2VSOA 3FUTA 2SHKA 4DMLA 1CR1A 3WGLA 4TKLA 1ND6A 1PV1A 4FMDB 3UPUA 4W82A 1X7YA 2XXQA 1TT7A 1BD3A 3IJPA 1U8ZA 4ZK6A 5EAIA 5FUWA 2R87A 2I54A 2ZJ5A 1ZJYA 2WU0A 3AUFA 4RK5A 5CXUA 1L8LA 4CDGA 3VZPA 4YMIA 4DV4B 4BO8A 3LH5A 4GKKB 5CCDA 4BX8A 4EFLA 2LYQA 3HYSA 1GR0A 3U39A 1RSZA 2JFQA 4F5WA 1SBZA 3T1TA 5FADA 5CHEA 3H1GA 3I58A 1LDGA 2RHHA 3REFA 3K9NA 1L1FA 3GLVA 3LBFA 2EBUA 3CLRD 1N92A 3C2QA 2Q7OE 3BZBA 3ZWYA 1T2NA 4LHWA 5INTA 4XB6B 4F21A 3GUUA 4YUVA 1ZX1A 3V8MA 1CUHA 2D5LA 3QTTA 4FFPA 1U7WA 1HE1C 1FU8A 4JKOA 3KZVA 4O0MA 4DG5A 4K5QA 5REQA 3EWAA 1O0CA 3PEYA 2HLDA 1GQ2A 1QVZA 1YR1A 3KSDO 4UPVA 2JKZA 1RHJA 2ZJOA 1FNDA 2ZS7A 4PYMA 3KLOA 1LXCA 3THXB 1CZNA 4KXMA 3QEAZ 3EZ2A 3IDOA 4I1OA 1DCKA 4IEFB 5KI6A 4X20B 1ZM3A 1V7CA 3G2MA 3K6KA 4TYMA 3OHPA 1FNCA 4LFCB 5HSGA 4FOOA 4MO2A 1B0UA 2CKMA 3MTJA 5GGYA 1Z6QA 2A4KA 2XSDC 1J2EA 1EP9A 1QG4A 5AKYA 3KS9A 3LDHA 3TFWA 5LQAA 2YKGA 2R7AA 1OR8A 2GA9A 1V9LA 1OFUA 2J3MA 2Y05A 1J99A 4FINA 1GAXA 3NYRA 3VR3A 1B0PA 2ZT6A 4GKAA 4GU5A 1S3IA 3QNUA 4MYSA 1YNSA 1Y3AA 4Q48A 5KVVA 2ZTSA 1TK2A 4KACA 4QGHA 1UOEA 1JEYB 2ZU0C 2AOWA 3E2PA 2C9ZA 3JAKA 3RKUA 3MWKA 1G21E 1X77A 2ZYDA 3G2PA 1K08A 1OILA 3TZEA 1IZYA 2ZBGA 1SUIA 3DBLB 2VP0A 2YJTD 2OG2A 4MAFA 1FSPA 3C6BA 1FW6A 3BDVA 3MF4A 2YHIB 4INOA 4LQ4A 1E1QD 1LFAA 1TFRA 5FI0B 3UWPA 1Z8HA 1ZC3A 3H9CA 5FTMA 2PZFA 5L40A 1P45A 1O95D 4KKXB 3BXFA 4PZZA 3DOHA 4WKCA 1JHXA 4P7JA 4M7PA 3PHHA 4D56A 4I6GA 5F33A 3CW8X 4D57A 5AIAA 2XT9A 2FRVA 4HDQB 3IQWA 3A06A 4XB2A 5HE9A 3X1YA 4WVLA 4MMZB 1H0HA 3O9MA 4HNQA 4I5DA 1JHZA 1JQ5A 4Y0AA 4ARSA 2F1OA 2ZJ7A 4RIEA 3B6EA 2V0NA 1UPXA 3IIMA 1L9KA 2YZKA 1XQXA 1IWOA 2WHEA 3MQFA 3O3OB 3IQFA 4DN6A 5KNCA 1MRNA 2J3DA 1CLUA 3BBLA 3PGJA 2OAP1 4CKCA 4DRXB 4QQFA 5EP4A 1BQ4A 1XA3A 3QVGA 4K0RA 1P8AA 1UKBA 3L77A 3GPDG 3HB4X 3SHQA 1A9XB 1W0JA 2WV7A 3PHJA 4KO1S 4HAVA 1VCOA 4Z1OA 2WAMA 1DJLA 4GMGA 4LSWA 4HG2A 1A77A 5KTOA 2FQ1A 2WHXA 1L5NA 5KSWB 2WUEA 1GZHB 4N5DA 4NMMA 1IPHA 1AXRA 10MHA 3LUKA 3RTEA 4YT8A 2OXFA 1E66A 2X8WA 2JH9A 5FTJA 2IF2A 3C3CA 3ZTTA 1WL8A 3AFMA 5JCJA 2B82A 3NG1A 3IURA 3LOQA 4Q12A 3QKTA 521PA 3RU3A 3ZHTA 3C1AA 4TTJA 1LKZA 5C46F 2W2PA 4OGLA 1U2EA 4NBLA 2WIUB 1P6QA 3DT8A 2F1HA 3FYHA 4X1KB 1RE0A 3K0EA 4NBSA 2CD9A 5ITVA 1NXPA 5ICSA 1BS1A 3C7DB 1EGMB 1SXJA 4TMKA 4TMFA 3A2NA 1WLSA 2EQ5A 3E9ZA 3HDJA 4KBGA 4EUNA 4L7VA 5LOVF 1II9A 3SQDA 5C81A 3O4HA 2XA2A 3OETA 1D9XA 4WCFC 1C80A 1T5TA 2ZE8A 2XKKA 1XPOA 3PX7A 1SC1A 5EP1A 2Q5JA 4EECA 1GT91 3SGLA 3OPYB 3KZOA 1QE5A 4RK4A 5A7LA 1BHO1 3AQIA 3G79A 5J5VA 3AUJB 4GBJA 1FFDA 1OLUA 2AE1A 2ATIA 3K1AB 2O1XA 1RTTA 4BLQA 1YA8A 4MMYB 4LGCA 4NK4A 1VSQA 1C4WA 1X1SA 2BGRA 4QDKA 5HIIA 1EFTA 3S1SA 3EQ7A 2AG1A 2WNIA 4DBVO 2AMJA 4G81A 1EX1A 4IFEA 1LRLA 3AFIA 2W42A 2IPXA 3W2HA 1MCZA 3D6FA 4ISBA 3ZVRA 4NU5A 4UQLA 4EEXA 4MYCA 1ZM2A 4RZIA 3TTSA 1NLYA 4W9MC 2BGUA 1XZBA 1YCFA 4GC9A 4Q9KA 1NY5A 1TYEB 4JP2A 1Q14A 1WXGA 2GZSA 2XMZA 1HO3A 3KPUA 3I76A 5ARDA 5AOVA 4NCIA 2YZNA 3LX5A 3ZV5A 4CRWB 2XB2A 3C74A 3GFSA 5SYAA 4RMJA 2FWMX 2HMSA 1ZRHA 3KAJA 4QICA 2H7CA 3KTFA 5CA1A 3QPVA 1M0SA 3U17A 5IXSA 5KYGA 3I9V6 1GA1A 2J6BA