1VPWA

Structure of the purr mutant, l54m, bound to hypoxanthine and purf operator dna
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSMKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title The structure of PurR mutant L54M shows an alternative route to DNA kinking.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 119
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1998-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1vpwA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpwA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpwA02
1OSLA 3SCHA 4YS6A 4RU1A 4RY0A 1S7EA 3H5VA 3MYYA 1SXIA 2P9HA 4X4CA 1DRJA 2ID9A 4X4DA 3KYJB 3LFPA 3ZKCA 4G86A 3OMXA 2MYTA 2R25B 3HEBA 4FE7A 5KI6A 3G85A 1D1PA 3R0JA 3GL9A 4JP1A 3GT7A 4GPAA 4IRXA 1NEQA 3PXPA 3JXDL 1DCKA 1QO0A 3BBLA 1USGA 2QSJA 1WH8A 4D6XA 1B00A 3JS5A 3N0RA 4YR7A 4G0ZA 4I6UA 1Y1LA 1Z18A 3JY6A 3KG2A 2GZUA 4MR9A 4QYMA 2E4XA 3GBVA 3LMKA 3I45A 2LIVA 1ZZ9A 2E4UA 4NQRA 2FMIA 2WWVD 1RIOA 1DW9A 2FEWB 2R1JL 2FKAA 1Z25A 4KVFA 3URMA 4E7PA 3QEMA 2PMCA 3Q41A 1JH9A 3LKVA 1QP0A 3I09A 4KZKA 2GI4A 3EQZA 4G0XA 1Z13A 2LUOA 4KQ9A 3OMTA 4X4EA 4YCSA 4LDZA 4IILA 3LUGA 4YV7A 3O1HB 4F3TA 3OLYA 3QLUC 3HDGA 2YHBA 1Z17A 3Q7TA 3JXBC 1Z16A 3H5LA 2H0AA 3HUUA 3JVIA 4RS3A 1RXIA 3L6UA 5FBHA 4EYQA 1DBWA 4IMJB 1TMYA 1NERA 2QVGA 2KEKA 2HINA 1UDRA 1UTXA 1VLZA 2RGYA 4P1ZA 2IVQA 3SY8A 1BA2A 2M1ZA 2FQWA 4W5TA 2ICTA 2E4WA 1O4XA 4JAVC 4O1IA 2HSGA 1A04A 1P6UA 1YIOA 2R63A 1NXXA 1AB5A 1TJYA 1DBPA 2QW1A 3KS9A 3Q15C 5TPZD 3ROFA 3SG0A 1CEYA 1FSPA 2FEKA 1KRWA 1ZZBA 2XIUA 3HUTA 3K4HA 4H3KB 1P2FA 3O1JC 2QZJA 4O5AA 1PERL 3I5AA 3GBFA 4RK0A 5TPWB 1U2QA 2QU7A 1FFGA 1SD5A 2IPMA 2LYPA 1WIZA 3QLVA 5DKFA 3QEKA 3QX9A 1R69A 1L5ZA 7ABPA 3H5IA 5BRJA 1Y9QA 1POUA 4X4GA 5HKOA 4YG7B 3KSMA 1JYFA 2A9RA 4YG1A 1PRAA 4NICA 4MS3A 4EYOA 4PU8A 3F7NA 3C3WA 4KV7A 1MIHA 4UHKA 5FWYB 4IMIB 3HZHA 2OFYA 2WMYA 4RXMA 4MYRA 3HXMA 2FVYA 4O8BA 5TQ2A 2PUFA 1RZRD 2MQKA 2HPHA 5TE9A 2OR1L 4L85A 5IULC 1DCFA 3Q7SA 3LUJA 1OCTC 5C5CA 1OXBB 1ZS4A 3DBIA 3LISA 3TD9A 4PU3C 1JX6A 3F51A 1SQ8A 1M2EA 1GUDA 1M2FA 4OLAA 3Q7RA 1YSEA 4MS4B 3DLHA 1Z2DA 1NXOA 3FYAA 2XI8A 4W5OA 3EQ2A 5TPZA 5JNUA 2M98A 1L1MA 2QR3A 3SAJA 4Y42A 4MS3B 1U04A 1LBHA 1ZAYA 1X57A 5IEBA 2GX6A 3K9CA 2IOYA 2O20A 1QNLA 5JNTA 3H1EA 4RK5A 3E3MA 4EY3A 3LTEA 3LKBA 1NTRA 2PKXA 1PUXA 2E4VA 4LX8A 4MAAA 3T8YA 2FEPA 2EWTA 2CHEA 2FTKE 3FYMA 2ICPA 5EWJA 4RXTA 4OB4A 4RK7A 4OATA 1LQCA 2PE5A 1QQBA 1I3CA 1PNTA 3DGEC 2FQXA 4XAQA 3LUFA 3BRQA 3D02A 2I6FA 1WETA 3MLFA 4Y9TA 4YGXB 4YP9A 2YHAA 2WRZA 1JBEA 4DN6A 2IPLA 4X4IA 4TLMB 1LK0A 3EUSA 1W9HA 3OQOA 1K66A 2FLWA 3SCFA 4RSMA 1TVMA 5DGCA 1RZRA 2D5VA 2FN9A 3UK0A 2KEIA 3NNDA 5KWSA 3EGCA 2LPMA 4QYWA 2J48A 3KZ3A 2AUWA 4NDWA 1YS7A 4MCTA 2AYZA 4TLLB 3C6QA 4WUTA 4Z58A 1DCMA 5KQGA 1JYEA 1P6QA 2WY2D 3U3WA 2E4YA 2NZVG 3GV0A 3H6HA 3LUKA 1H9CA 3T95A 1XWRA 2BNOA 3RVOA 3QLTA 4XFKA 1ZDMA 3IPCA 3KKEA 4EUKA 3QF3A 2QVCA 2LYKA 3IP6A 4EGSA 3QK7A 2O38A 2DRIA 3RVLA 3MM4A 5CNIA 4Z59A 3TO5A 3HJFA 1ZZCA 5EWLB 3OO0A 2BGGA 1EWTA 3G1WA 4KK3A 2JVKA 3LOPA 2FJRA 4PEVA 2AXVA 4G0OA 4LE0A 5BQ3A 4JCYA 3BRSA 3S8QA 4Z99A 4JB0A 3IVPA 2EBYA 4N0PA 4ETMA 2LBPA 3FGZA 3IP5A 4EYGA 2QV0A 2L2QA 3L49A 1YTUA 4ETIA 2JCGA 2A6CA 3QQ6A 4HNRA 1QMPA 3GYBA 1RZSA 3UKJA 3UFDA 5HM6A 1RPEL 3M9XA 2ZWMA 1BDJA 2L8NA 2JRLA 4PE5B 3ZHIA 2A9OA 4MLDA 4YO7A 4GNRA 3LUCA 1PNRA 5PNTA 1Y7YA 2EF8A 4YG4A 3JXCL 5T3YA 1DC8A 4S05A 4JOQA 1B0NA 2MSKA 3OLWA 4MQEA 1DZ3A 4KK4A 1T34A 4G0PA 3A0UA 5IEJA 3TMYA 3HZIB 3C97A 4Z5DA 4UHJA 1DC7A 1GCAA 3JPYA 5TPWA 2W42A 2NT4A 4F11A 1Z26A 4Q6BA 3D1NI 1SXHA 2VK2A 2VUHB 4RK6A 4ZYLA 3BREA 3C3KA 4HYEA 3QYXA 2PUCA 2O49A 1ABEA 3DZDA 2VUIB 2FW0A 1EHCA 2CD7A 4Z4EA 3CLCA 3ILHA 1R8JA 1VRVA 3IP9A 4GQMA 2JVIA 5T7BA 5HSGA 1E3OC 5FWYA 4JB2A 4IVZA 1ADRA 3NHZA 4MQEB 5KQMA 4PU4C 3OQNA 3BDNA 4IA8A 4KMRA 4KNYA 1NY5A 1QP7A 3H5OA 4PU7A 3CROL 2L19A 2XSDC 4N76A 4EYKA 5IX8A 4D74A 3GN5A 1MVOA 4XXHA 1Z15A 5DCLA 1ZY2A 1LJUA 3H6GA 3MMNA 4KREA 2E4ZA 2WJAA 3TB6A 4Z4IA 4MS4A 3F52A 3O9XA 2O4AA 1GUBA 1SRRA 1URPA 2PJUA 1JDNA 3OM0A 3OO1A 2PUBA 4J1WA 3H5WA 2GKGA 2JB9A 4Z9BA 4RDCA 2R4QA 1SXGA 3CS3A 3HCWA 1ISSA 3GBPA 2HQRA 1KGSA 3M6MD 1JL3A 4ZPJA 4ZMSA 4KPYA 1Z2EA 5CNMA 4GHJA 3RVKA 3G5GA 1D2AA 3QX8A 4N0QA 1JLKA 1YMVA 4O1HA 4F8JA 3GN5B 1AB6A 2L49A 4N47A 2WIUB 3W9SA 3SQNA 4TMYA 4F12A 4MRMA 5IC5A 1MB0A 2JBAA 3TX6A 4RY9A 2LCVA 1JFSA 5KQPA 2IYNA 2FQYA 3CZ5A 2IV1A 2LP4Y 1GCGA 2B5AA 1PRUA 1W25A 3NNSA 1BDIA 1DG9A 2FLKA 3M9WA 1DJMA 2PAFA 4PICA 3RVMA 5C5EA 1NXPA 3H75A 3HV2A 4Z0NA 4YBAA 3VK0A 2FMFA 1WH6A 3MIZA 3RVJA 5JNVA 4G0QA 1ABFA 3T6KA 4NCBA 1EWKA 1YS6A 3KCNA 1U0SY 2H3HA 1MAVA 4YRZA 5A7LA 1CYEA 1FQWA 1RXEA 3O74A 3O2JA 5IBQA 2R47A 3O1IC 1FFWA 4MRMB 1EAYA 2JBAB 3CG0A 2JK1A 2WJWA 2KZ8A 3H1GA 1PEYA 1E6MA 1IC8A 3EULA 4I6RA 1E6LA 4XASA 2F8SA 2PPXA 2AW6A 3I42A 5ED4A 5ABPA 3OM1A 1M5TA 4DQDA 3DNVB 4H3HB 1BDHA 3O75A 3L1PA 1BAPA 2AXZA 1CQTA 1EWVA 3JPWA 5EWLA 3RVSA 2XCJA 5BR1A 1BVHA 2KPJA 4X4BA 3FFXA 3RZZA 2N9UA 1XWWA 5KC8A 2GRLA 4RY8A 4MR8B 2PUGA 1PRVA 3RVQA 1X2LA 1E2BA 3FMVA 2QXYA 3ZHMA 2IPNA 4OBBA 4Z4GA 2PLNA 3H1FA 1ZUGA 3QLVC 3QLUA 2PUEA 1ZN2A 4OG2A 3JVDA 2MYPA 4D6YA 3NBMA 1PHRA 1JWLA 2R48A 4RV5A 2WB4A 3KHTA 3Q9SA 2BJCA 1RPJA 4LRQA 4YLEA 4Z9AA 4YARA 2GBPA 3CECA 2PL1A 3NHMA 4IGAA 3BILA 2BNNA 4Z5HA 2NT3A 4P98A 5KQLA 4RKQA 3KJXA 2MSLA 1PEAA 3CNBA 4JQDA 3B2NA 4XARA 2X7XA 1LBIA 4MCXA 3KLOA 1P8AA 4LZLA 4MS1B 4EVSA 4W5NA 3N0WA 4TN5A 1QP4A 3N8IA 3NNNA 4I6TA 1LCCA 4Q7EA 3MQ4A 5FBKA 2XJ3A 1CJGA 4QPJC 1L5YA 2P4UA 1AU7A 5GQSA 5JS2A 1RNLA 4DADA 4FB4A 1LCDA 2JVLA 3QELA 2OQRA 3B7HA 3CRNA 1ISRA 1ZZ8A 3KLNA 1QKKA 4Z5CA 1Z12A 3FFTA 2ZAYA 3F6CA 1VKRA 3F6PA 1D5WA 3N6VA 1D1QA 3LUDA 3OMWA 5JS1A 4EVRA 5BRAA 3HVRA 3S99A 2FXIA 3RVRA 2CSFA 4MR7A 2TMYA 2LYRA 3CTPA 2PIJA 1EFAA 2MEZA 2OENG 4X4FA 5IUKC 3C3MA 3RH0A 4KQCA 2HJ9A 2KYRA 4N03A 3F73A 3CLKA 2IVBA 3OP9A 4WXMA 3HSYA 3HO1A 4I8TA 1LLIA 1VPWA 1KMIY 5CHYA 3KXAA 1U8TA 3FFWA 3R1FA 3A10A 3CFYA 5JNWA 2LYQA 3QELB 4FE4A 4HNQA 3KTOA 1USKA 1YVUA 3FDFA 5JNSA 2LYJA 1GLGA 2ID7A 3A0RB 5EWMA 3H5TA 1YMUA 3SM9A 4PZ0A 6CHYA 2FN8A 3DLBA 2HQBA 4NCAA 4W5QA 3OLXA 1LMB3 1A0OA 2XDYA 5E3JA 1ZITA 4OLBA 3LUAA 2VYCA 4MR7B 4NV3A 4Q6WA 4L4UA 4PYRA 2V0NA 3RQIA 1DP4A 3O2QB 1YK0A 2AYXA 4HNSA 4Z4HA 5CNJA 3KYIB 4MR9B 5JNRA 1QPZA 4JCXA 4RKRA 3HM9A 1APBA 2KEJA 1MB3A 1U2PA 2FMKA 3HDVA 2IPAB 4KFCA 4H60A 3TRBA 4YWHA 5EWMB 4RZSA 1M5UA 3QEMB 3O2SB 1UXCA 3O21A 5DTEA 4CBVA 4XLTA 5FWXA 5B3JA 3FMYA 4F06A 1NXTA 3CU5A 3N53A 1NXVA 4RK1A 5F64A 1HEYA 3E61A 1C4WA 1XHEA 1OXKB 2AXUA 2L17A 4LDAA 1CHNA 3A3KA 1F51E 4ZMRA 1ZHHA 3RVNA 3CZCA 4WZZA 3GWGA 1UXDA 3BD1A 2FSPA 1JF8A 1ZGZA 2A9PA 1DBQA 1JFTA 2PL9A 2HQOA 5DLEA 2IDMA 2WUSR 8ABPA 4Z4FA 2Q5CA 4FBIA 1USIA 1ZH4A 1KRXA 1XHFA 4OTZA 1JHZA 4ETNA 1DWKA 1E6KA 4MQFA 5TQ0A 1C0EA 5D2CA 5FWXB 4RXUA 1YK1A 1ZZ7A 3N0XA 1FFSA 5IUJC 1ZZ6A 4MLCA 2IKSA 4LE2A 4MR8A 3T38A 2F8TA 3QWGA 3JTEA 2PUDA 2NZUG 4RK4A 4MGEA 2LYSA 4X4HA 4G0MA 3OLZA 1NXSA 4G0YA 2JVJA 4KRFA 1ZGGA 4WT7A 1ZPQA 1R63A 3G7DA 3CHYA 3ROTA 3CG4A 3LUHA 2H8RA 2AWIA 1DRKA 2MSWA 2B4AA 4G97A 4ZJPA 1TLFA 1QQAA 1TM2A 3P9YA 4J1XA 5HQJA 4MPTA 3MF4A 2RJNA 4MQFB 5TQ0B 3EAFA 5TQJA 5IUNC 1GT0C 4FN3A 3UUGA 2BNMA 4E7OA 2CROA 5TQ2B 1IIBA 4EVQA 1J56A 4MS1A 1LJLA 1ZVVA 3OQMA 3GRCA 3SNKA 9ABPA 3CKMA 2IU7A 2IVGA 1QO0D 3BS3A 4W5RA 1K68A 2PUAA 2MYUA 2RDMA 2MYNA 4F8DA 2A9QA 1S8NA 3EODA 3GA5A 3HK2A 3F6WA 3IDOA 5GOTA 4ML3A 3DGFC 4RWEA 2RJOA 4B09A 1ZH2A 1HF0A 3VNBA 3SCGA 4Z4CA 4S04A 2NUBA 2B1JA 4JASB 4QICA 2CHFA 5KC9A 2IUOA 2CWDA 5B3JC 1ZESA 3IP7A 4LE1A 3OLVA 4IF4A 4WXEA 1D4ZA 1NATA 2FMHA 3N75A 2GRMA 1JDPA 1NXWA 2L18A 4WWHA 5I4CA 4N41A 4M88A 3RVPA 5CNKA 1A2OA 2GWRA 2LYLA 3HS3A 3EJWA 3IPAA 3VNAA 4IWRA 3D8UA 6ABPA 3MA0A 3ILYA 3LFTA 1F4VA 5EWJB 3EDCA 1JFVA 4JA2A 5K98B
chains in the Genus database with same CATH superfamily
3G0GA 2P3SA 2VDRB 1CUFA 1XRNA 2HMSA 2QRQA 3MLBA 4X4CA 3NHRA 4XUEA 3MT7A 4GXQA 5JYDA 1Z5NA 1C9DB 1K2VN 4HEJA 2GVDC 3PL5A 3LFPA 4H7HA 4WLVA 3ZDRA 4Q4JA 4KH0A 4BUCA 4C0SA 5CA0F 2C78A 1HE8B 1YQXA 3NDRA 2OLEA 3HN7A 4XR4A 1R0BA 2B30A 2GYWA 2V6MA 4ENPA 2UUOA 4UUOA 3RUHA 2KWIA 1JQDA 3PKIA 3MYRA 3O0TA 1SUCA 4HWGA 4KE8A 2XB8A 3JY6A 1E4EB 1CUYA 1LQ2A 1NYQA 2WOOA 3EEBA 3LY7A 4MGYR 4X1IB 1YA8A 1YOVB 3SI7A 4I1SA 4PFQA 3U4AA 2OM2A 3PQ7A 1QQ6A 2HHJA 3E22B 5J63A 4TV9B 2R1JL 3IIMA 4H1TA 3M49A 1KWGA 1ZBQA 2PXCA 3ER8A 4DTCA 2VQ3A 3B6MA 4Z49A 3EXG1 3C5EA 1JDVA 4FFWA 4ODIA 3REOA 1IUNA 1W49A 4AD8A 4C4OA 4RMHA 3V32A 5C37A 4Z0TA 4ECAA 5KYUA 3COSA 3VYTB 1I5RA 2QTFA 2X0IA 3EZFA 1G41A 1Z17A 4HB0A 1Q1NA 2PBZA 1XAHA 3H2IA 3ONWA 4JI5B 2ZZNA 2PCLA 1JU9A 1KO5A 4JC0A 4NFLA 1DEXA 4G26A 5D01A 4CKZA 3FDIA 1PGPA 2FFRA 1W44A 1YL6A 1AKVA 1ZQ1A 2M1ZA 2WWXA 2ICTA 2E0IA 3EC7A 1Z6TA 3Q5GA 2KPOA 1GSHA 4QBFA 4ZC8A 1Z4IA 2QZ4A 2RGXA 3EY4A 1J2TA 1NXXA 1AB5A 3A32A 3Q15C 1ZGJA 3QITA 1OTXA 4UM9B 2R1ZA 3UMBA 1CERA 1PQYA 4GX0A 4PANA 1IN4A 2OE2A 3CRQA 3EF3A 5LUBA 1OIVA 4P4SA 5DI3B 5FBVB 2ZRJA 2OAGA 1XNJA 2C04A 2HWXA 2YHSA 5TPWB 4Y98A 3TR5A 3G2OA 3ZJUA 5J5CA 4A8TA 1BOOA 3Q8KA 3O5AA 5EL0A 3ZD7A 1KHHA 1PJTA 1YFZA 3DR3A 1Y98A 3LY8A 4YRTA 2QUZA 4WPGA 3LBFA 3MWYW 2A9RA 1CUJA 1UXIA 1JXMA 4DA0A 3I8SA 3BGSA 3H9EO 2AFIB 2C5HA 2WHEA 3NR2A 3N6RA 3QJ5A 4RD2A 2OFYA 4IUBS 6PFKA 1E1YA 5JVDF 2ZXUA 4GSKA 2ZJYA 4EATA 2O8FA 3N8DA 4L85A 2QVZX 3P0JA 4JKYA 4LHZA 3THRA 3WLLA 1Q3TA 3PFFA 1D8TA 3EPJA 1QF6A 3F51A 4E6EA 2JFXA 5JEDA 1IDOA 4OI1A 1X0VA 2DPGA 1IZ9A 2FJUA 2BKLA 3NDBB 3DDHA 3T7KA 4B3CA 3RSCA 2WJHA 4M0CA 5MDHA 3DAHA 3S8YA 4ENVA 1KYZA 3A4YA 2CBGA 2RKBA 1MAUA 2H5IA 2OCLA 5ALKA 4I8IA 5CVTA 4H7DA 2NUPA 2Y71A 4AWXA 1I7DA 4B6RA 4CKBA 2LW7A 3IVAA 2QRUA 1CNMA 4EZIA 1M3SA 3CB2A 3LTEA 4S12A 4XGKA 5DYGA 4U0JA 2PKXA 4EY3A 4NXNB 3K8OE 5BSRA 2GAFA 1DT5A 4FS8A 4RENA 3IDAA 4CR7A 1H65A 5EWJA 3MWFA 1G20A 4Q4DA 4QQNA 4PTYA 1XZKA 1ODKA 1TOAA 5ELXA 4FEYA 4QLAA 4Z4FA 1N6LA 3FCXA 2PLFA 1ZC3A 3PGLA 1KP2A 4H6VA 4I1OA 1COWD 2OAQ1 5AXAA 3RYHB 3OQOA 4INZA 3TVDA 3ICQB 4RSMA 1TVMA 1UDWA 4GO1A 3STXA 3GZNA 1W30A 3WQBA 1KMMA 2PS3A 1VE3A 3WQRA 2J08A 2Q6LA 3GLKA 4FYMA 1A9YA 5I3ZA 2WE8A 4P3NA 5HOEA 3LGSA 1QRTA 1W47A 1RMTA 5K0LA 3PQFA 2WY2D 1L5MA 1D1SA 1U0RA 2RIPA 3PDIB 2J8ZA 4L4RA 4LVNA 1DC4A 3PI6A 4PGAA 2VQSA 4WBXC 5MFPA 6AT1A 2I76A 5EIAA 2JKYA 4MWBA 2LCIA 1FP6A 1I6LA 2ZETA 5EIFA 2DRIA 4BAZA 4B17A 4DSNA 1W6UA 5JWHA 5JSZA 2IH5A 3B8HA 1TCBA 1JR6A 3GA0A 1JPJA 1AA6A 5DLPA 2XUOA 3A11A 3I1IA 3W34A 4WFKA 2O3QA 4CLRB 4TMZA 4CMBA 1EXWA 2JHCA 3T0FA 1MNQA 1DBVO 1QG0A 3ZDQA 4OVKA 1OV4A 3B6KA 3OSZA 4MVJG 4EUHA 3PB3A 5E9WA 1XD9A 1L5SA 5LVAA 2N42A 1TZCA 4I4TB 4GLFA 1ESMA 4I66A 4IKEA 2X0EA 4PSKA 1SIOA 5BWBA 2BEVA 1PFKA 2R6GA 1FP4A 1NF8A 1V6AA 4D8TA 5HM6A 2CLDX 1JDBC 1TIKA 3DFZA 1NDHA 1AGPA 2PS0A 4R2MA 5DHRA 3IUSA 3TFWA 2I6GA 4S05A 3FD8A 3I23A 3IX7A 4OBEA 3TIFA 4JUCA 3ZIUA 3RUDA 4NCJA 1FX0A 2WWYA 4WZAB 4M0EA 4Z5DA 2GAIA 2JIBA 1JI3A 4G67A 4EJFA 1Y37A 4XVUA 5F9HA 5MN4A 4IXMA 3JWJA 1LUAA 3FCCA 2Q2NA 4H0NA 2DC1A 4Q6BA 4X85A 4J8PA 1Z4MA 4LJ6A 3BREA 5CBKA 2IQ5A 1E98A 3C3KA 3IBSA 4H6PA 3RBVA 2I6SA 2YQ5A 4FFDA 4RJKA 1M1XB 3EIQA 1NWHA 2JIZA 1E2EA 1PWYE 3DZDA 4UMEA 1CEEA 2FWNA 4BZXA 1QK4A 2ZAGA 4QQFA 1ADGA 3NASA 4HDRA 3SX4A 2AKEA 3J81k 1P75A 1QCZA 3FSGD 3WJ2A 5HJ5A 5JARA 3C0KA 3WLPA 3Q4GA 1WMSA 3GJ6A 3C87A 3G2NA 2ZSFA 4KMRA 3ORQA 3UK6A 2DU8A 3CLTD 3H5OA 4PU7A 4YRNA 2L19A 4LUCA 1RE0A 3ZTWA 3TI9A 5IX8A 5KHOC 5KVCA 4OHBA 5BW4A 1DBIA 1VMKA 3RIEA 5DCLA 2OLKA 3PK0A 3TIVA 4WZBE 3TB6A 3AJRA 5CLIA 2BFEB 1YR2A 3R8CA 2PJUA 1IZYA 1GUBA 3CUWA 3L1IA 4B31A 2BGTA 2NVWA 4E14A 3VKFA 3UF0A 2FPGA 4CQNA 4QDZA 2QB5A 1HMPA 3ZDZB 3M6MD 2HF7A 4ZU1X 3JARA 3AZPA 5CNMA 3W3AH 1MO4A 4IUYA 3L05A 2ZKIA 1D2AA 3INNA 2YXEA 1KEWA 2C0CA 2TSYB 2FUNB 2JLAA 2VNKA 4GRDA 1V1MA 5AOCA 5SZKB 3VAYA 2RK4A 1VHDA 2FG5A 2R86A 3CZRA 4QDUA 1E63A 2BHNA 4QJ3A 4MVJM 4LCEA 4JFRA 4BFXA 3T61A 2XBMA 3NBAA 4NYMR 4OJNA 4EG5A 1K89A 1UBJS 3CRW1 1Y6GA 1ORHA 3HV2A 5JJKA 4BVLA 4YBAA 2C9OA 4QKQA 4HVLA 1ZMXA 1YQ9A 4WXYB 1ONOA 1P4GA 4L5IA 3D4OA 2VDLB 5JMOA 2PX8A 1E0AA 4KQMA 5EKXA 4YRZA 4Q12A 5B37A 3UHPA 3CVYA 4KKXB 2XWBF 3IDQA 4DA7A 3OEHA 1D0SA 1SOUA 5IF3A 1EX7A 3SEAA 2J9RA 2JK1A 2P0YA 1ULSA 3BTUA 5G1PA 2R79A 1E9RA 1RXCA 1T5SA 3HR7A 3KEFA 4XASA 4JJ6A 4O2BA 3NBUA 1KSJA 2PZEA 2JLBA 2PPXA 1RLTA 1XGKA 2D0IA 2QAIA 3OX1A 5SZIA 1MJNA 4UCWA 1GUYA 2WFMA 4KGZA 3LUBA 1IRXA 1VCIA 4UEJA 2C4VA 1NA5A 2O2CA 3KAPA 2O8DB 3M6LA 1D04A 1UBMS 3HY3A 1PAUA 2HSJA 2OV8A 2UZ0A 3QPWA 1JG3A 4QODA 2GTPA 1JHOA 1NONA 3LCVB 1HF3A 1NFQA 3A4VA 4G0NA 3K8QA 3VR6H 4PINA 2YOFA 1Z4JA 4IH4A 4CM4A 4D4HA 4WNIA 5L45A 2P9GA 4OBBA 1JFRA 3TL2A 4NMXB 3ZLJA 4BNGA 4RZQA 2X40A 1ZN2A 2HB6A 3JATB 5IF9A 2ATVA 3TDNA 4IP0A 1J97A 1U9CA 4IHJB 1NBME 5AVVA 4DUZB 13PKA 5IVHA 3HB1A 1CUDA 4RPIA 3DMTA 3NB0A 1E7WA 1R6TA 2PHZA 1B15A 4JEHA 4Z5HA 4CG1A 1U2TA 1ZCFA 4DPKA 3UHJA 5DP1A 4AULA 3HZOA 3SS9X 4XARA 3KAJA 1P8AA 4UTZA 3C8MA 3QVMA 4TOIA 4CG3A 2PUVA 2WD9A 2PN1A 4QLBA 5MHTA 1N8NA 2NYUA 3KJNA 5IJZA 2WP8J 5K8LA 1OLXA 3BRWA 1C7IA 3CPHA 1EWQA 2ZB7A 1GA6A 4EA6A 2C9CA 4PZAA 4WY5A 4F91B 3KJGA 3UJAA 1L7EA 4F8EA 1QIKA 2V7GA 4KR7A 3G0DA 3PD0A 3QELA 3WRWA 1ISRA 1ZSYA 1G291 4NF2A 1IG0A 1P77A 4FT4A 1IN5A 5IARA 3ZY3A 4R71A 3STTA 5JJLA 1GNPA 3I01A 3ZXUB 5LQAA 3A58B 1VKRA 5FBZA 3REQB 1D1QA 2OM6A 4I36A 3NH6A 5ALOA 5HDBB 1MVLA 1WXDA 4EX6A 1AZSC 4WFIA 3ZJTA 1XRMA 3MWEB 2ZE8A 4DZRA 3TTWA 3N05A 4X0EA 1XQ6A 2HV9A 2JLSA 4Z54A 1MV5A 3TKLA 1WB6A 3BD7A 1Z2CA 3BC1A 4ESVA 3EA5A 3WNVA 1B76A 1LLIA 3N86A 4FUQA 4R54A 4DG8A 3GFQA 3R1FA 4J1QA 1T8WA 3OOHA 4O4HF 4ESHA 2VIIA 1Q7TA 1ECLA 4TQ9A 2I8LA 1OYWA 1H6BA 3VHLB 2W58A 1XVLA 2IYWA 2X9VA 3ELYA 3W8NA 3IA2A 4R4JA 2QYTA 2ZTVA 4HS4A 4ALKA 3TEMA 1O6CA 3LUAA 3OESA 3ZHCA 3WDKA 1R3DA 3L82B 2C7RA 3AIOA 3DDWA 2IXDA 4O4JF 4WEQA 5CLQA 1Y42X 3AH8A 5AJVB 4ZRMA 3S70A 1DVRA 1ECFA 2E85A 1MBZA 1ODSA 1VDMA 2GCNA 4WCFB 5EZSA 3IHWA 4HX5A 1OAAA 1WHSA 4MV0A 5GV7A 5IKOA 4LK3A 5EJEA 1WZUA 3ICCA 1ZD3A 4GH5A 5HPYB 2WW8A 1Q1GA 2IPAB 5LQDA 2R8EA 3JZAA 2V7BA 3M5CA 3QF4B 3U1TA 5BWLA 3T1TA 4ED9A 2AN1A 4RHYA 1VL1A 4PSVA 4EY8A 1YDMA 3O2SB 4G9EA 1ZD9A 3I62A 3CSSA 5ALXA 5DIZA 4NOKA 3F5QA 3K09C 5EE3A 1NE7A 3DQPA 3KXIA 4QEDA 3RS7A 4JSYA 1HEYA 1ZONA 1PR0A 3NKVA 1YS4A 4FSHA 1C4WA 2YICA 3UGKA 5TRTA 3HKDB 4HATA 3UA4A 2JFYA 2ZFUA 4IOKA 3CUYA 2R60A 2UZAA 2PYZA 2ZRCA 4PU0A 4UDYX 1RZ3A 3O4JA 2I1WA 2XGGA 5ELMA 2AEJA 2CL5A 1XTSA 2OZVA 2P6MA 4OXYA 4ZRDA 4DEXA 1MDFA 1ULUA 4OL0A 2VDQB 1NHWA 5KNDH 2ZYDA 1E6KA 5H0IA 3OEWA 4J2TA 3AZOA 1TLTA 3WJ7A 2Q3LA 1RRFA 3VDQA 1ZRMA 2IE8A 2ODTX 3P0IA 2DE0X 5KSYA 3TCNA 3QWGA 3KOZA 2DFTA 4E2XA 2OPHA 4RK4A 1B0UA 1RRVA 4FR0A 4L73A 3ER9A 3T12A 5UKDA 1T3SA 1O9GA 3AFOA 3AZQA 4WJLA 3C41J 3NIGB 5A9SB 1XDGA 1Z35A 1M10A 3K16A 2N1MA 4DV5B 4KQ2A 2IQIA 3R4CA 4J94A 5FV4A 1GR0A 3HU3A 4G97A 1Z74A 4E21A 4U2CA 5CFZA 3T1HB 4MPTA 5D3MA 1EZZA 2PYIA 4II7A 3ODPA 2HF2A 1UWCA 4MICA 2F6RA 4JJZA 1J5EB 5AUNB 3JR3A 3QHQA 3WTBA 5H8WA 3P4YA 3EXIA 4TTRA 5M2QA 4NKRA 4CR8A 3E3OA 5L3ZA 4MV6A 4RL4A 4BLQA 3P0EA 2DJ5A 3ZC3A 3IHTA 5FEMA 1U1GA 3BMNA 1Y5MA 4WGFA 4Z4CA 1S7GA 3EPLA 4A26A 1FFAA 3D6TB 2OK7A 2ICAA 1NVVQ 3L7YA 3UT6A 1IY0A 2Z6QA 2DH5A 2J0SA 2ZQZA 2JG3A 1LI4A 4BJ6A 1MO5A 1N6OA 3MD0A 2RGEA 2F8MA 2FU5C 2JFZA 2ZRKA 5ETJA 5K45A 2G8NA 1HM5A 3DE4X 2H4WA 4JELA 1SN7A 4UNSA 1N5DA 1QUEA 3H2HA 4P4UA 2FPRA 2D7CA 3M4NA 3FZQA 4IICA 1T1SA 3GN1A 1YOVA 1O0SA 2PLRA 3MYYA 4RFLA 4WTOA 2FFAA 1I36A 3E22A 1X8XA 1B6TA 4TV9A 3PPXA 3F5FA 3VYSB 1H2FA 4Q3OA 5CG1A 1Y6JA 3ZU3A 2G04A 1NLUA 2XA2A 1UT6A 4GR5A 2R25B 4Y6LA 3TLCA 5KAPA 2H07A 2FW9A 4MIYA 3TZKA 4CGZA 4DE8A 1SUIA 1QH8B 4FJ2A 3BFVA 5HR5A 4UCXA 2G07A 3JAWB 3PXPA 2VNJA 5FFNA 3ZOKA 1B6SA 1ESCA 4BZQA 1UODA 2VUUA 1Z2AA 4HSGA 4X8HA 1ISPA 4KR9A 4GZLA 4IOJA 3FUWA 4K0RA 4QYMA 2E4XA 3RRJA 2NNWB 3I45A 2WINI 3NWEA 4E5PA 4EECA 7REQB 2E4UA 2JDIA 1YULA 1PUJA 1OKKA 1N2CB 4XVCA 1EK2A 3WGUA 4F60A 1ORRA 3UPUA 3ZD9A 2XTNA 4N48A 4E7PA 2W2QA 3U5ZB 4AXXA 4DV3B 3V1YA 1N0HA 2OD9A 2EWVA 2L1PA 1NW4A 2PFKA 4EA9A 1V16B 3ZDDA 4IQFA 2BYTA 4GC9A 3ZXSA 1NW6A 5IN4A 1YRLA 5EI5A 3A1CA 5C18A 4DKXA 1B43A 4MLPA 4GX1A 5JBIA 1O4WA 1T9GR 3I9LA 4KCGA 1GT6A 5DI3A 3PFHA 4G84A 3RBZA 4MQ6A 3Q7TA 1FDOA 1RABA 3Q1LA 3GU3A 5DM60 4CV0A 1XP5A 4ID3A 4B34A 3U7QB 5LQNA 2VHUA 5DIFA 4AJLA 2RGGA 1P2SA 2YHIB 3SSMA 3TINA 2HINA 2H9YA 3OZBA 5AKKA 2QPAA 4ZANA 2HI0A 1A9QA 3DLPX 1NVAA 1U2DA 3V46A 1RHMA 1JGTA 1OZGA 1T0HB 1XIVA 2VLBA 3S3TA 4ID9A 3KS9A 1NF9A 2ZREA 4IX1A 4JSRA 4OREX 4U8GA 5NULA 1AS0A 5J3JA 2C7GA 2B20A 3OT1A 2BEJA 1WO8A 3IUEA 3QYJA 1ZIYA 2XIUA 3OPXA 3V97A 4H3KB 4ITRC 2A5FA 3O4IA 4LVUA 2G36A 3FBWA 1T36B 3ZE6A 4D0SA 2VDJA 1XMSA 2QU7A 1V9LA 2BFDB 3OURA 1G3MA 3QPCA 5LU9A 3QEKA 4K6CA 5C4MA 3VA7A 4Z53A 3OUZA 4RCYA 4WGGA 1JTEA 4FOLA 3RAPR 1XA4A 2BLNA 1LVUA 2Z4TA 3K1JA 1PDOA 1K88A 3K30A 1QWOA 5FADA 4LRWA 3EWIA 3LYHA 2ORIA 4KXQA 2Q8PA 1KOGA 5FKJA 2FQ1A 2VT6A 3AUFA 1HKHA 1E9BA 3DBLB 3EDYA 3QMVA 4ZO7A 3AV3A 5IAGA 4BBAA 4AJ4A 4E5YA 3ZU6A 1LLFA 4YCMA 3FR8A 1U8ZA 4QFDA 4IHAA 4QT0A 1SQ8A 4RV9A 1O0BA 1SCNE 3A9WA 3GELA 3NC4A 4LG1A 4P5PA 2IIBA 5LQCA 4MPJA 2EFDB 2PSEA 3BIFA 2R6CA 1J2UA 1BWPA 3HH8A 3IC5A 3PDCA 3DS8A 3Q7RA 3QI7A 1QYVA 1MH9A 2EZ4A 4IY1A 4U7GA 2HJWA 3PC7A 3HU1A 2RHMA 5B3LA 3RHSA 3OC0A 3BWVA 4CDMA 3FDXA 4O02B 4Z3KA 5BNZA 2DSNA 3ULKA 1TPYA 4M53A 2PX5A 2YDXA 1FUEA 4OXQA 1GNQA 3WR5A 5E3HA 1PUXA 3QVLA 1VYUA 2VNSA 2GR9A 4AP5A 3B8EA 3AKYA 4YUXA 1CE8B 4XYLA 3HXKA 4LJAA 3PDIA 4FEGA 1TL7C 4RYDA 4H0FA 1LS6A 1MC4A 5DK4A 2HOQA 3GLIB 3ES9A 1IJFA 4XIFA 3UKOA 2PTHA 4B81A 3MJFA 1CP2A 4B7AA 1PQUA 1Z6ZA 3TKAA 2JFVA 4B4DA 3BE5A 4NY1A 2HF9A 2DHCA 1HYHA 1LK0A 1RJEA 1PE0A 1VOTA 1JG7A 3OQBA 1FSZA 3BIXA 4DIKA 3RYFA 2D5VA 2B36A 3RJMA 4GBGA 3VX3A 1E7SA 5TLSA 4YT4A 2A6PA 3SHFA 2HIGA 5J43A 4CLRA 2IEYA 2AWOA 1W87A 4HDAA 1BHSA 4HQ0A 4UBKA 4DY4A 4DCJA 6NULA 3W6OA 3I2JA 3OH8A 1SVKA 2FEMA 3NROA 5AHKA 5CCBA 3OPYA 3U3WA 2BW0A 1G8YA 2PL5A 1JA9A 2EX1A 4I4TA 4PHCA 5DYWA 2A0UA 4LZWA 1X7HA 2H17A 4Y0AA 4BKMA 5KJ1A 1OW3B 3AM5A 4QPPA 3CLHA 4HGNA 2YOGA 2ZWAA 4OFXA 2JIZD 2LZ0A 3P52A 5AK4A 3UJ6A 3VYUB 1HYBA 2BFBB 4N4AA 2REQA 3F7TA 4FBGA 4W7IA 5KBYA 1AA9A 2K87A 2QL7A 4WZAA 4B83A 5IJ0B 4OQZA 2G4CA 2J3DA 3OU6A 5KYKA 4GDFA 5IKPA 3G5TA 1WM1A 5C1DA 5CB4B 3C5HA 5I4IA 2GK7A 4C0WA 4E5KA 4DRZA 1QU2A 5CFLA 1N2IA 1C9KA 4YN3A 2ZVJA 1E18A 1WXGA 2EZ8A 4DMKA 3JQQA 4NBUA 4XSVA 1YDGA 1RPEL 4RV4A 3HA2A 2J6HA 3JQGB 2X5XA 2L8NA 3OY7A 1BXKA 4PQYA 3UTCA 3EX7C 2YV3A 5CDFE 1CUGA 1SVIA 3KFLA 4A8HA 3GW8A 1YBHA 4GNRA 1H0KA 4HFNA 4KN6A 1Y7YA 3JXCL 3MJRA 3AFNA 3USZA 1R8XA 2Z4RA 1AHHA 4KK4A 1FFXB 4G0PA 1SMKA 3AHEA 1O6GA 5CJ2A 1CQJA 4B76A 3H2JA 1A76A 2AFVA 4CLDA 3I92A 3S1SA 1REQB 3C15C 3O3OB 1AM4D 1AZTA 3D8NA 4ILKA 3UMCA 3N2ZB 4H77A 3PR2B 4MINA 1V4BA 1K3FA 3BJIC 1ABEA 3H17A 3AVXA 2YWGA 3LX6A 2VUIB 4H15A 2V8OA 3N2GA 3V3TA 3AF6A 5THXA 1DB3A 2WVAA 2Y9MB 4P92A 1K7FB 4QDXA 3MZ0A 1B1AA 4BN5A 3UKDA 4R2JA 3EXFA 1G66A 1ZJJA 3A27A 3NHPA 3WKEA 1EH5A 4MQEB 3MILA 5JZVA 1K7SN 3ZE0B 4NLLA 1P74A 1FUIA 2RONA 4BMVA 5JPDA 1XDSA 2WTEA 3HJNA 1P5JA 5E1OA 1FU7A 1A1SA 1XCGB 3OEHD 3NAZA 4YDSA 1QKIA 1GSAA 2PYDA 2OXTA 3X1WA 2X13A 3O9XA 3OO1A 3R9XA 1RWOA 3C4VA 3T0GA 2V9PA 5H16A 1N1GA 2H85A 3EE6A 4BMCA 1PX0A 1FLNA 2HQRA 1RZUA 1JEYB 3S8EA 1XXLA 5CVDA 4M8KA 1RJ9B 4DMUB 3IB6A 1HEUA 2FWPA 1AQIA 2ANBA 3D4PA 3TRHA 1DQPA 2WUEA 4N01A 1O8CA 3G5GA 3L7MA 3OOJA 3FOCA 3QX8A 4Y9RA 1TEZA 4MWGA 4REOA 5SYMA 2Q4BA 1F5SA 1OVGA 2H5EA 2QN3A 2VZ0A 1ZW6A 2ODQA 1WNFA 4TMYA 3BBPA 1PL7A 5DV9A 1OC4A 1VGVA 3WIBA 3VDMA 4CF5A 1MENA 3DV9A 3WMEA 1FF9A 4FK8A 3V4SA 4HDNB 2IHBA 4KO8A 3ZEIA 5KX5F 3CZ5A 1IDN1 3SBXA 2B6NA 5K09A 4F45A 3IAAA 2C54A 1CR0A 3M9WA 4UDNA 2QNRA 3OUUA 4QHTA 3O4FA 5JR3A 4H7IA 3CCBA 4BNXA 3RS3A 3K05A 2FRDA 2ZUUA 3SXUA 2NUAB 3K53A 1RHQA 5FNVA 3KCNA 2DLCX 1X19A 1KZ1A 1DQRA 2PVSA 5I7UA 1T9AA 1RXEA 4G4GA 5EXEA 4CMIA 1WCYA 2GZRA 2B1GA 4MUFA 4TMTA 3TN7A 1AQJA 1WJGA 1UPCA 3U7IA 3RFXA 1F0YA 1R10A 5D87A 4ND8B 3BRWD 4DBLC 1P0FA 4F3NA 1K27A 4IHJA 4WOBA 2F8SA 2XI4A 3GUCA 3I42A 2WILA 5TIIA 1LLDA 2QRZA 1NXQA 2B3TA 5HK8A 4OB8A 3LTNC 2GS9A 1WW3A 1BVHA 4MZDA 2BL4A 4N9WA 3DNPA 5JVDB 1A8HA 3KK0A 1K5DA 3FKSA 4XDZA 3SYKA 3WIVA 3U44B 2A4KA 3VJKA 4L0QA 4D96A 4U7FA 2PMWB 1VJDA 1U8XX 2EAUA 3FPAA 5K51A 3FMVA 1X7YA 1TIPA 2IPNA 1J99A 2GVNA 2C8VA 3DVLA 3I9KA 3SU8A 3IMEA 4ARSA 4CIVA 2CVHA 1UDCA 2EQAA 1Y9AA 2ZYVX 5KTRA 2BF7A 2H2IA 2HJRA 2XYRA 3ETCA 4LRQA 1IVSA 1XZBA 1WCIB 4TXLA 1K8XB 4ZTUB 2WJPA 2X7HA 5L4SA 4IEFB 3NHMA 4OHCA 1JAIA 3CF4A 3F5DA 2R97A 4TTPA 1D9XA 1HTWA 4RSHA 3DZKA 3N28A 3G0BA 4G85A 2MSLA 2SCUB 3AYZB 4JQDA 4LJSA 2Y1EA 3PFGA 5JANA 3KQHA 4CUKA 3MWEA 2C2OA 1TM3E 1Q22A 3I2YX 3NPMA 2NO0A 5E4FA 1QP4A 1XVTA 2UZ4A 3GJ3A 1QOZA 4L0MA 3GFTA 3M5DA 4FONA 5CT5A 3DOEA 5FBKA 3WKCA 1I2BA 3PPWA 1GA4A 5TNXA 2PXLA 3UJPA 4U9UA 3ORYA 1ESZA 2VJDA 5EQDA 5H59A 3UOWA 4EO7A 2DPLA 2IDJA 1ZZ8A 5AI5A 1EUQA 1LQTA 4WFJA 1SK8A 4FOPA 5EJ8A 4DE5A 4Z5CA 2F9LA 3ED5A 3MOIA 3DEHA 3EOAI 4C89A 4LHSA 1CJCA 1HH4A 2A9VA 3LI2A 4FDLA 3I9OA 3TEJA 3T35A 3K32A 2VCEA 3ELWA 2ORVA 5GJCA 1M8PA 2EW2A 3LA6A 3WL8A 3LE8A 2V03A 1B8OA 5IM4A 4WCFA 1F1BA 3OIGA 5CK4A 3RYCA 2VPIA 4I8TA 4HPXB 2O52A 4YP1A 3UHAA 1VJ5A 1OWNA 1RYHA 2NSDA 3WK5A 1U7XA 1TYZA 1R0LA 3TPZA 3ZTYA 1E62A 3TBFA 1FRVA 2GZSA 5JD4A 3QF4A 1A8SA 1MA3A 2OB1A 1ZIOA 1EHYA 1YVUA 2P69A 2ZRDA 4NZNA 3BTVA 4LYAA 1BFUA 4K9QA 3GNQA 3CONA 4K9KA 5HK9A 1ZINA 1FLVA 4GGPA 6CHYA 1GAWA 1I2CA 2B2NA 4FYVA 4J07A 3R7BA 4MUAA 1RXUA 4OLBA 2FEXA 4MR7B 1FW6A 2H4YA 2KB0A 3C43A 3EMDA 3NONA 3K0CA 1TKAA 1BH6A 2KS6A 4XM1A 3Q3JB 1OU0A 5E9JA 1DCTA 1GHTA 3HKDA 3VKWA 2Q21A 5BN5B 2XQFA 3PUWA 4UTPA 3LRPA 1E6WA 2E4AA 2PKQP 5AI9A 3WB1A 4UC0A 4H60A 3RO7A 3UXEA 3SC3A 2FX2A 1KYXA 2QL5A 1WUJS 3ISTA 3KAKA 3L8FA 4YWHA 3K35A 3RSSA 4BB6A 4BNTA 1DTEA 4RZSA 1J0XO 2ZJ8A 4YAFA 2VJKA 2AB0A 5IHPA 1L5FA 3DH0A 2C99A 2GEKA 5JO9A 1C3JA 2O0JA 3FF1A 3QSYA 2EJBA 1RJWA 1A8UA 2I4TA 3CU5A 2GHRA 4QXQA 3JD4A 5DOZA 3R7SA 4I08A 4L9RA 3IO5A 3R6LA 2AXUA 1LBQA 2QP4A 3CT4A 4QDTA 5GGYA 4GPD1 2NXCA 5DNYB 4L8LA 2GAJA 3RVNA 4MROA 4HAYA 4E09A 1CJKC 1UOEA 2DG2A 2OHOA 1PEKE 4M1QA 4CM3A 4G8BA 4DM4A 1Z68A 4B3SB 5AJXA 4DJFC 2J0UA 2OFWA 2WUSR 1EUYA 1GGEA 2WWFA 3SFVA 3WLEA 1BMDA 2YN0A 3G2QA 1XHFA 4ETNA 2XH8A 4M54A 1DWKA 2DBQA 9LDBA 1F6WA 2FPMA 4QTUB 2BGKA 4JLVA 5TT0A 4NCKA 3U4QA 5IBRA 3HJHA 1CQPA 3FFAA 2R6HA 1NW5A 1VMEA 3T1YB 4FFNA 3ZV5A 2UUAB 2LYSA 3I6BA 1ZHOA 4P83A 3NYQA 4CVNA 1J8MF 4Q18A 4FHFA 3UTDA 7AT1A 3QA3E 4PGFA 2BTQA 2W6JA 4QFBA 3E18A 4AROA 4D46A 2NMVA 3HCCA 4LYGA 3PGJA 5FA5A 2ZRPA 4QGGA 3W2EA 3IR5A 1E2LA 5TX7A 4CIWA 1N7HA 1TEXA 3KSAC 3KEQA 3BA1A 4K46A 4YRGA 3HP4A 3EAFA 3K15A 2B92A 1QGOA 2WJVA 3BXFA 3SQLA 2B8WA 3UUGA 4EUNA 5I7SA 5KNCH 2C2BA 1LJLA 1LSOA 3LQXA 1IM5A 1QLJA 2ISSD 2B34A 3DHYA 3U3OA 3VZRA 2WFAA 1YB7A 1UPFA 2LR0A 3BD8A 4RLSA 5DH9A 5GPBA 3VR5H 1ZOIA 3E0QA 4FYHA 2H1VA 1W36D 1WU8A 3IGFA 5CR9A 3UQZA 4ZKDA 4BV9A 5LOVA 1EDBA 3VO1A 4W8HA 2JDID 3TL3A 1NFFA 3M4XA 3QVGB 1OKKD 4JXKA 1GU1A 4V0LA 4YB8A 1WMEA 4FQ5A 4D9KA 5H82A 3MHPA 1W7AA 2ESRA 4F0JA 2O2ZA 4P53A 5HNKA 3WLTA 2X5JO 1CKEA 3ROEA 1KYTA 4RZHA 1DIHA 2L18A 1IHYA 4UM9D 5EG5A 5AR1A 2P2LA 5EFZA 5GMOA 4CL3A 4CF7A 3ERCA 3AI1A 3U0VA 3EDMA 1T9DA 1PYGA 2GSDA 3NPAA 3U49A 3VNAA 4ALJA 5BWNA 1V26A 3MOSA 1WHTB 5JRDS 4KO3S 1K8YB 3T7JA 3Q2KA 1XRSB 2QTHA 1IY2A 5IVPA 2G7MC 4U2FA 1M1NA 3SCHA 1MPXA 3AHDA 1N3BA 1UIMA 1SUFA 3MS2A 4V0QA 1U1FA 4H17A 4X66B 1L7RA 1DG1G 4C2UA 1ZLYA 3C45A 3ECSA 3BIJA 1XZ8A 2BRUC 3D4NA 3LT1A 1WX1A 4TWRA 4YMHA 2FRDC 3D6HA 4ZOLF 3TCXB 5C1PA 4CMEA 2IH2A 1V16A 2EKBA 1YC2A 3CJQA 3OFSA 1KDPA 3R0JA 4X3OA 3PVCA 4G1FA 4A73A 3DMRA 1EFLA 1ULBA 3D2BA 3PRKE 4D6XA 4DBVO 5ICGA 4G0ZA 4I6UA 3B7WA 3M2TA 4PQEA 3HVHA 2V4UA 2P35A 1IBMB 1IM2A 4HLCA 3QTBA 2E5LB 3CKLA 2YHIA 4INOA 4NQRA 5FPHA 5KSWB 3SZGA 2VF8A 1DW9A 3N76A 3TLJA 3AEZA 1G8PA 4YH1A 4D9JA 1SIWA 4GNKA 4P6VF 4J1NA 4G56A 4ADSG 4CJXA 5C7LO 1X3SA 1JH9A 3LG2A 5DWQA 3GRKA 1K5HA 1V7QA 1OZFA 2W90A 5TB5A 4YJFB 2FXVA 4AJ2A 2JCSA 4BQNA 1B0ZA 2HADA 1E1KA 2V3VA 5DXFA 1L5VA 2NQ8A 2IYVA 3OZAA 1K8QA 1E3EA 3OD5A 1NMQA 1XPJA 2FNAA 1J0CA 1MZVA 1FOEB 1HT3A 1V43A 1GPYA 2FZGA 1CG6A 3OWHA 2BFDA 4LWZA 3AGPA 2ONJA 3VV3A 1RQ7A 4TTIA 3U16A 1OB5A 4TQUS 3B9BA 5DN9A 2QU8A 2W4QA 3DO5A 3JQFA 2FQWA 2ZBEA 1RLJA 1O4XA 1J39A 1H2RS 3A6GA 1UXJA 2EU8A 2ZR8A 4P2GA 5JPIA 4EHHA 3AEXA 1QRRA 4V0NA 1D2CA 1CLUA 1JHMA 2WTMA 2FEKA 1CUSA 2X5NA 1Y4UA 2O8CA 3JWPA 1E64A 1T0UA 2YCLA 1P2FA 3KQQA 4TXMA 4YRFA 1DMRA 1PQPA 2J33A 2QZJA 3PJGA 3QUQA 4PC6A 5ALJA 3TLGB 1CSEE 4CLOB 3E9DA 1N2GA 1R7RA 2IHUA 2WNHA 4ND2A 2I3AA 1PT7A 4UDXX 4E3WA 1GNRA 1LCIA 4XWYA 4EPRA 3BULA 2X0KA 3CINA 3B53X 4RAOA 4DQKA 1Q0ZA 4EARA 1V5GA 4M1ZA 4QRDA 1NE2A 4P0PB 4L3WA 4CKWB 5ESXA 4FKZA 1SBTA 2QI9C 3AIKA 3NBZC 3BEDA 4MVWA 3RKSA 1PSZA 2DR2A 3BWCA 3RK1A 5J59A 1EMDA 2JGMA 3TQTA 4DXAA 3HZHA 4LQ4A 2J9XB 3ILXA 1CVRA 4FS3A 4JLAA 3ENVA 4OEHA 3ZE9A 2IYLD 4J6EA 4YJ2B 4MMXB 4WCFC 1H5QA 4JSTA 2XBUA 2XA1A 5TE9A 4HKTA 4MA0A 3T1VA 4BLUA 2WIJA 5C5CA 1XK7A 1IZ0A 2Z98A 4KQXA 1U65A 4XGQA 2ZJFA 5HIIA 4YK7A 3ADDA 4MCIA 4N7JA 2XODA 4MRSA 3GLIA 1B2LA 3D8BA 5TQVA 3SR4A 5IXSA 2I4NA 3L0BA 4GR4A 2W83A 4UAJA 5CDSA 2ZRMA 5F1PA 3VOAA 1GTSA 4Q00A 2IK8A 1IHUA 1V3TA 4P3YA 1NC3A 2O5VA 4XTCS 1JECA 2GX6A 1J7KA 3K9CA 4DR6B 1VJRA 3K0CC 7ADHA 1EJBA 4Q4HB 3VDRA 1RYFA 3AOGA 1DQSA 2QLJA 5KTKA 3I9JA 2GXAA 1TK3A 3GGJA 2VHZA 5FTLA 1ZUNB 4PYOA 1JMYA 2PKYX 3EWAA 4FDAA 3WDLA 3IP8A 3IQGX 2PX4A 4RK7A 5EVJA 3WWPA 4I99A 1QHXA 3RFUA 1I3CA 4M89A 4O2BF 2GCGA 4WDQA 4YGXB 4JBNA 3QV2A 2W70A 1EGAA 3TYXA 4B7ZA 1PJSA 3A1SA 2G08A 1W9HA 1V96A 2VO1A 3B78A 3IVRA 4FFMA 3RTCA 3W04A 3RB8A 2IX3A 2Q6IA 2D2FA 4OU5A 3BXOA 2X0JA 2ODPA 2XVXA 3SJCA 3TG2A 4IDEA 5LL6P 2EBFX 4RGYA 4UM8B 4RPCA 4YMSA 1PW5A 3MUOA 1J5PA 5IJ0A 1IK4A 5GJBA 2POQX 1YZKA 2XUKA 4OQXA 2BISA 3ZW9A 3HVKA 4PX5A 5M34A 1L7DA 3ZIDA 2XKAA 3SKVA 4V1CB 2HNKA 3QF3A 2M6KA 5EAIA 2A2ZA 4W4TA 1RT9A 3IPYA 3W3AA 2J3LA 1ZXLA 2V6GA 3RVLA 3EVAA 4A23A 3QPUA 2XCUA 3UZUA 4I46A 4IR7A 4A2PA 3K0FB 3KJFA 1EGMB 1A9OA 1UBFA 2IYQA 4GKBA 3W6NA 4K26A 4Q93A 3Q7PA 5BQ3A 3ZWAA 3P7MA 2B9EA 1Z4QA 1FFXA 1UC4B 2GN0A 4LBZA 2CT8A 2FK8A 4GKKB 4ETMA 2EBYA 4V0KA 2LBPA 4EG7A 1LBSA 3A1NA 4KIUA 1RQNA 1REQA 2L2QA 4U02A 1Z5VA 2G4VA 2DYKA 4DR3B 3UUEA 4N5LA 5HF9A 3G0TA 2P5YA 2XOKA 4FTWA 2B4YA 1JBQA 1N36B 2H7YA 3ENNA 3RTDA 3VZCA 2R4UA 1X77A 3KALA 2FSSA 4HH4A 1OREA 4DL9A 2YDYA 4KSBA 5A3JA 4YG4A 3W5CA 3W4IA 2XAAA 4UBIA 4MQEA 3W1WA 1DZ3A 2VA9A 5KVVA 3C97A 1IYZA 3IT3A 3PFWO 3LNTA 5KYWA 1CVIA 3VJRA 1SNYA 4WADA 1MEEA 4BAUA 1H6CA 4YRDA 3FPLA 5KQSA 1V8DA 3M33A 1CUAA 1TB4A 2YC2C 3M81A 1PV2A 2JFHA 1N4AA 2IEDA 1EHCA 1HDOA 1KJIA 1FVHA 4GL4A 1U4SA 1XA0A 1XJ5A 4K9DA 2A0KA 4B3GA 1N0WA 1VI6A 3IQHX 3VR6A 2OXFA 3TLXA 3SP1A 3EGWA 2LNDA 4JBXA 1LFDB 1M33A 4JB2A 1GCIA 2XQIA 2ZEJA 4PU4C 3M82A 1P9LA 4YP7A 4EGJA 4JVOA 2H54A 2YWXA 4GUAA 4BMZA 1YFJA 3U1BA 2ZSAA 5CP8A 2QMZA 4UNQA 4ZVLA 3PJRA 1TO2E 1TQ6A 1UK8A 2BVNA 3HXPA 1MB2A 2E55A 4ZAFA 4BFSA 4Q3DA 2G40A 1JU3A 1KETA 2MR5A 4FC7A 4LY9A 2I3GA 4HO1X 2F3RA 4HDNA 4KB5A 4NOJA 2XKJE 2O4AA 1UQTA 5DCYA 2PRYA 4ZXPA 3V8RA 1JDNA 1HUQA 4UNRA 2Q0SA 5JU6A 1KU6A 4CMEC 2JB9A 4HLUA 4I1IA 3G6KA 1XXHE 1N4DA 2Q2VA 4RO0A 3DTTA 1GZ5A 1VKOA 3JQ7B 4FLMA 3AGQA 4TVOA 5BSMA 4E4TA 1Z2EA 1ORTA 1WEHA 1KI1A 3BKWA 3OICA 3RVKA 3EGEA 2IV3A 3GLFB 1K5GA 1JLKA 3ME5A 2DQYA 3FKSD 3H05A 1JHDA 4KPEC 4L4XA 3AM3A 1IZ8A 1J1ZA 2YIVX 5DULA 4INAA 3OKZA 1EFPA 3CR8A 3DZGA 1IH8A 1RLUA 3IO3A 4Y2GA 1MB0A 1YHYA 4LXGA 4QPZA 2XQKA 4YASA 1X1AA 2J4FA 3TX6A 2FSFA 4P22A 1L5NA 3T9EA 1UFRA 1Q7RA 1DIGA 4AMZA 1MEJA 2O54A 2D7DA 5KYTA 1E9SA 3PQ2A 1PRUA 2G5GX 2GHQA 5F7OA 3TFLA 4G4SP 1MPTA 2B2XA 2PAFA 2HGZA 1WZCA 2ZU6A 5C5EA 1NXPA 5B2ZA 4B3MB 2J41A 4PLYA 3FVQA 1WH6A 3KM0A 3V8BA 4JQCA 4P4LA 5JVDA 1ZLXA 4AB1A 3AY7A 3NRBA 1P5FA 4RCVA 1JJFA 1ISGA 1GARA 1QV7A 1TW3A 2FZ4A 1P73A 2XWJI 1NV8A 4D98A 3IV9A 5HS6A 1L8QA 4ZEXA 4YMWA 2J7WA 2R47A 2P2SA 4KR3A 4HAOA 1L3BA 5LM3A 3PGMA 1ZGBA 2OC4A 3JQFC 1Q3HA 4HQFA 4J0GA 4RSRA 4B1FA 5L4LA 4RFSA 1PEYA 1NMSA 3F6BX 1BN7A 5AK0A 5ABPA 3PIDA 5DP2A 4YRQA 1CUIA 3SKXA 3IOCA 3EAQA 3RABA 5K0JA 1CJMA 2WAXA 3P4XA 1R5NA 2BDUA 4D41A 3BDVA 3IDSA 5AHWA 5D84A 5IMBA 1Z5PA 1KMNA 2FSIA 2PSJA 1L5GB 4E1BA 4X92A 1RM4A 3NHUA 3NI2A 4BPBA 4CNBA 2JCYA 1MD9A 2J59A 3AF1A 4P5EA 1G20E 4D6YA 4ZKEA 4G81A 4ZYUA 2DPYA 2JEZA 3BVPA 1Z2NX 2A92A 3L1HA 1ZEMA 3M1AA 3Q40A 2XUGA 4MK4A 1CJVC 1RPJA 3IHLA 1F20A 1R8QA 4UAVA 1XD2B 2AN4A 4OOFA 2GZ2A 5IBCA 3S2ZA 1GKUB 2Q07A 4Z9YA 5BMOA 4KXYA 1A9RA 1U5BB 3DE3X 2KQUA 2WD7B 4DQUA 3Q3VA 4DS3A 1PN3A 3HKCB 4WK2B 3AY3A 4MS1B 1M2GA 2QZSA 3KYDB 3N1UA 5FOSA 1RD4A 3QXJA 3PIRA 3RI3A 421PA 4C08A 4J3JA 4LXIA 2C98A 4FI3F 1MXHA 4UUMA 4EENA 1ZNWA 3QI2A 5A71A 4BO8A 4KXUA 1KYWA 4UMFA 2DMRA 2F64A 5KPJA 2AI3A 3NUZA 3FPSA 4PC7A 5FUXA 3OQPA 4RA6A 3LZ6A 4TV9F 4PN7A 1SD2A 2EWMA 5KNDA 3B7HA 4RTSA 4RKEA 4HDKB 3RSQA 4WJKB 2P9YA 1M6HA 3UH1A 2IYYA 4C3OB 3KOMA 3O9ZA 2XTMA 4NOMA 1D5WA 1UZAA 4MIEA 1ADCA 5JS1A 3BX1A 3EASA 2EV9A 3AVYA 2FMXA 3GCGA 4ROTA 4X1OA 4RM2A 5HA5A 3RVRA 1Y6FA 2CSFA 4MR7A 3O7WA 1U0OC 2FUG1 3FCUB 1ZNZA 3K8ZA 4KVZA 4TRJA 4TKUB 4WH0A 3SSAA 3Q9UA 4B3DA 4U7HA 3AKZA 3WP1B 4BUJA 1G8MA 3ZGXA 4URUR 5BN5A 5ALRA 1TEVA 4OFBA 4TMVA 2K5UA 2WZCA 2VP6A 1BROA 2RG7A 3LH5A 4LJKA 1PT6A 1T6XA 4FE4A 4LGYA 3UK2A 4A1FA 1PWXA 1Q74A 2B37A 3LUPA 4FZJA 4KJZA 4YCCA 1O57A 1ORDA 4H7FA 5KKCA 2FN8A 1ZSNA 5HHTA 3G79A 2QM8A 1P2GA 1HZJA 4AAYA 2I87A 1JR2A 4ZALA 2GO1A 3NVDA 4DSOA 1T1IA 3FBGA 2ORYA 4KBYA 4EQ6B 3UWOA 1IBRA 4WESA 2AYXA 1M7GA 3STWA 5DLQC 1UBOS 1V95A 1YZLA 4DUGA 5BSHA 5EHQA 4JGIA 4DY6A 4UEOA 4O8ZA 3WYBA 2Z8YM 1NLZA 4WBNA 1WCWA 3FPEA 1MB3A 3NAMA 3TLKA 4D2IA 2HZ7A 1HK7A 3OJEA 3HCOA 1K2WA 4MVJH 1C7FA 3AUJB 4JROA 4XQ9A 5FBWB 1NQUA 2W6JD 1OI4A 3A3YA 1M5UA 3INGA 3MVEA 1VI2A 1O97C 3DEFA 4JLUA 5K0ZA 2HT1A 4R1TA 3R7DA 4CHTA 1U0TA 1OF1A 2X2OA 2VOEA 1T15A 3LVFO 4D4LA 3C14C 3RTEA 3W78A 2ABWA 2J9FB 2JHAA 2H2AA 2XB2A 2W6CX 3T9CA 3NM4A 4ZT5A 3CZMA 1XHEA 2VBIA 1OQAA 2L17A 5JLJA 1VA5A 4TZKA 4LQDA 1DMSA 1CLEA 2PFGA 2WAMA 4LK2A 5C8VA 1TUBB 4YRLA 5FBRB 1S1CA 4AZ3B 4JYBA 1RRGA 4Q34A 5AOVA 2YJ5A 5F2OA 1MT0A 2W9XA 3KFXA 3RSHA 1UK7A 4S1OA 2X58A 1E96A 3I73A 2YWJA 1RAFA 1DU4A 3CNLA 5FR2A 1SM4A 2OCAA 3CNNA 1RBZA 1ULZA 3SC2B 5IUJC 2IKSA 2YNMA 3OBBA 5ICEA 5ITZB 3TW6A 2OESA 1DDOA 4DSTA 2YV2A 4F2WA 3G0HA 4UE2A 4DQVA 3AVWA 3AF5A 4R2HA 2W5UA 1S2NA 1YO6A 5E38A 1XFAA 4KLCA 1DWPA 2ZJBA 3KHKA 1YUBA 1CY1A 1Q3KA 1MVNA 4NZPA 1VYVA 1W19A 4U6SA 1W0JA 3L2OB 3PD7A 2WJYA 2YZ7A 1DL5A 3QVGA 1QZTA 2WTBA 4OYYA 3G17A 1ZRHA 3P9YA 3K1YA 1IN8A 1GKYA 5JAZA 1NT2A 4JD5A 3AEUA 5TQ0B 1IQPA 5B1SA 5TQJA 1KS9A 1T4BA 4XDYA 3RAJA 3QFTA 3TRDA 5K8IA 2GEFA 4JR0A 1Q57A 1E0KA 3OOSA 1QVWA 1NKSA 2VI5A 2BFPA 2QVLA 1YZNA 4BX2A 3USES 3K71B 4PZYA 1TZKA 1VYHA 3WMFA 1PKEA 1JHXA 2H9IA 1C7ZA 3IBYA 3JW8A 4FCCA 4BB9A 3OVMA 2RJOA 1KSHA 1WUTA 2XT6A 2O50A 4H7KA 3AR7A 2UYHA 4JASB 3OOYA 2Z2YA 2FG6C 3OLVA 4MCHA 4TSFA 3CCFA 1HL3A 3I30X 5TR9A 2GRUA 3OPMA 3WWYA 1EFVA 3P26A 2QNBA 4PHFA 1R4NB 1FDTA 3RVPA 4UBOA 2OVBA 1KOFA 3CKKA 3NCTA 4IWRA 3VH2A 2VXYA 5ILQA 1BA3A 1A82A 2FLVA 4JUBA 5FTNA 4I4TF 3WGOA 3X1DA 1PV4A 1QGAA 5K98B 1CF2O 2Y1OA 4OH1A 1QQTA 1YBMA 1FFYA 2P9HA 3NC0C 4ICIA 4NDZA 4RPGA 2D5BA 1A5SB 1QX3A 1KK1A 1M8FA 1TJ3A 1XN1A 2IW3A 2YHUA 3ENKA 3GDWA 3BCHA 4JVNA 4LSMA 1P4HA 4OQFA 4TTJA 1IWPB 3HZZA 1CUWA 3ZD8A 3EZNA 1M2NA 4NJOA 1TQDA 4CF4A 2R1TB 2GHIA 3G85A 4BTLA 4DCVA 1XJ0A 2JF0A 1JQAA 1W75A 3ASYA 4YJFA 1HNNA 2I4OA 2I62A 5FUYA 1Z08A 4JL6A 5B64A 5T41A 1G1MA 4B5LA 4Z7QB 3ZZ1A 4BWFB 5JEEA 4BMYA 3RS0A 3W2GA 4BNDA 2Q1XA 1EQUA 5TS2A 2LIVA 3ELUA 1ZZ9A 4G4IA 3KD2A 1ULAA 3V1MA 4BEJA 1JTVA 1C3LA 3JZMA 1P3JA 5GY7A 4WKCA 2BSQA 1JEQA 4EOGA 1ID1A 1KMQA 1SCAA 3I8XA 1EGVB 3LECA 4ISBA 4KHZA 4JVMA 4QTTB 1L3IA 1J0EA 2R8OA 4CDNA 2FW7A 3LOUA 4LSZA 3WA6A 2CL0X 4GOOD 1N9GB 3DFUA 4HNUA 2P5UA 4ANFA 3G1TA 4FKBA 4IILA 4XGIA 2N75A 1S3IA 1M34B 1WUIS 1QIEA 4CLOA 3SCZA 3TLGA 3U81A 2NXJA 3C7CB 4RLQA 1NFRA 1RXIA 4IO0A 4OGWA 3P2KA 3T9AA 3WGKA 5K8UA 4FDVA 5AQ1A 1TMYA 1G4UR 2HHAA 1JR3A 1KAGA 3W9YA 4X41A 4AZSA 2FZVA 2GARA 4W5TA 5TJ9A 5FI3A 1R5BA 1NV9A 4LYEA 5IAEA 1NNUA 4BO2A 1K1EA 4CL8A 1JLRA 1H2EA 3AWIA 3ROFA 3ZZNA 4BNUA 1UH5A 5LJLA 2HMVA 1Q0UA 3KVRA 3PC4A 1C0KA 2C0QA 2NU6B 4KI7A 1MR3F 4HL6A 4HAVA 3I04M 3DMFA 3LKZA 3NTXA 2Z6VA 3FI0A 1T6NA 2IXFA 2IYTA 3L6OO 3O8QA 1ZA1A 2BPOA 3DC7A 2C8JA 5DF1A 3ZHVA 5LP1A 2I33A 1WY7A 5KTTA 3KT3A 3OKFA 2ODAA 2F43B 3G49A 1A88A 3M2PA 4FZ3A 4IZ6A 5DKFA 4D3DA 1DAOA 3KB6A 2IUSA 4IIJA 1RVV1 5J4VA 1LTKA 1Z36A 3HSKA 2M1XA 1G7TA 1J0DA 1SUWA 2PMBA 2AJ8A 3KOWA 1UBTS 4KWHA 1KC1A 4KPFC 4PNEA 3X0DA 4CM5A 2XDAA 5BOSB 4WQMA 1L9XA 3F7NA 2RGRA 3FPJA 2VEDA 2UAGA 1RKBA 5BSUA 2FPWA 4UU8A 3OZEA 5KJEA 1QFXA 3IBFA 2FF5A 1BQEA 1NQTA 1SR8A 1LDNA 2XZPA 4F1WA 3QU4A 3AHHA 2VUTA 2VPYA 4TTVA 3EJ6A 4MUKA 4B6FA 4C4YA 3EAGA 3LS2A 1PJBA 2IYZA 3DBIA 1K0FA 4PU3C 1OAOA 3N70A 1GKLA 2I2XB 4XVRA 5HFAA 3UMGA 5C5IA 3QKRA 4CR6A 2FWMX 1M2FA 2JC3A 5CPFA 5FTWA 4ZGBA 3IBTA 4OHFA 4F4UA 4A15A 4LF5B 4MS4B 1YSEA 3I72A 1V11A 5B1DA 4AYTA 1CNEA 1SBIA 3QOFA 5AJUA 1XI2A 4B48A 1QTIA 3T5TA 1WY5A 4DBZA 4EDFA 1XEXB 1VPDA 3H1BA 4KYTA 3W3AD 5F5XA 3VHXA 2GNPA 3FHTA 1QGUA 5EPEA 1AUVA 5FNVF 1PJ2A 1O97D 1ATZA 1Z3IX 2P9ZA 2OORA 4O8CA 1OX6A 1WABA 2E4VA 2G1JA 3MIIA 3Q0TA 4EKYA 5KWJA 4IGEA 1OSNA 1VHJA 1P1BA 4Q7MB 3ESRA 4FQ7A 3D3JA 3H4TA 3RC3A 4PPGA 4UDOA 3MFYA 4MWSA 3WO0A 2H0QA 2GASA 4DYHA 3TEPA 4DLXA 1ZMOA 4V1CA 4ZOAA 5LYYA 3VPAA 4YR9A 1XDBA 2HDNB 3FSJX 1K5PA 3MBIA 3PEFA 1BFDA 1FYEA 2PX2A 2XOKD 3ENZA 5AKGA 4QYTA 5DSXA 2P79A 2ZVPX 3PHJA 4L07A 4C4TA 3UK0A 2WMOB 3K0FA 3DW1X 1QONA 1GL3A 2M32A 4LRYA 3OZWA 3ZHZA 3DTNA 1JLHA 1UPAA 2BGNA 4XRGA 1YS7A 1Q1QA 3GGDA 3TTTA 2XCSB 2A58A 4DLTA 8ADHA 1WPXA 1CY0A 1DCMA 5KQGA 3HJBA 1FZQA 1VSTA 4WKOA 2L69A 4CL0A 1PK7A 1I33A 3KXPA 4MP8A 1QB8A 1O7JA 1AKQA 2SKCA 4BFYA 2YBDA 4E15A 4B46A 4RTPA 5LYJF 2F3SA 3CLRD 4F2GA 3SR3A 1QAQA 1OPXA 4JS0A 1ECPA 4YROA 2XVMA 1OB2A 4TN1A 4ZRNA 4K8OA 4I4IA 5AI8A 1C81A 4LYJA 1H05A 1UC5B 3VR6D 4DCUA 5ARBA 1F1JA 4LE0A 5L9AA 4QD3A 2ZRFA 3BK1A 3W5DA 1RJGA 1IQUA 4C2AA 5IP5A 1GJRA 4JB0A 3GZDA 3UBMA 1ENZA 3HSSA 4L9AA 3IP5A 2XWQA 3HJTA 2L82A 1T8RA 1UINA 2DHQA 4R84A 2BFMA 4TWZA 4XWAA 2GOYA 4G8JA 3S8MA 2FWRA 3W2HA 2HR1A 3KRTA 4XIIA 4HCJA 1VL0A 4WK4B 1IN1A 2P4HX 4GS5A 4D82A 5CFQA 4YO7A 3KT0A 5BW6B 3FLBA 4NBRA 3A3OA 4M9RA 4HMPA 4JOQA 1V3VA 4NR0A 2P8JA 3QMMA 2UXDB 3HL4A 1F3LA 1T34A 2HRCA 4JENA 4PSUA 5IM4F 3TFQA 3B1JA 3I9NA 3L5OA 1GCAA 5ADWA 4MUGA 4PIPA 4F11A 3B6EA 4G89A 5F3WB 3IRVA 4TXHA 3B1WA 2VUHB 1QVZA 3LZDA 4J7UA 3ZHTA 2JGDB 3C6YA 1J9GA 2YZ2A 3BMOB 3CEPB 4ZT3A 5I7AA 2HLNA 3IUMA 4D0RA 4LVCA 3O4HA 1R8JA 2P41A 2UVDA 4IWYA 1MTZA 2PZAA 3LPDA 1N0UA 4W7SA 2VBFA 3HV0A 5CDGA 3HFSA 3G89A 3BA6A 2MOKA 3JQ7A 4BX8A 2ZSBA 5CITA 4MP6A 4WZ6A 1JSRA 3RCBA 4BC1A 4LKRA 5JFOA 4EG3A 4DZTA 1OZHA 4MRRA 3GLFA 4EABA 2Y92A 2GEUA 2CFSA 1A71A 1TA4A 3ER6A 3NGMA 4DRXA 4WCDA 1GVHA 1Z15A 1Y7IA 3DZ8A 4P7JA 1LSSA 2YY7A 1J20A 1ZN9A 1EFRA 2HMYB 3EIEA 1LEHA 2TECE 1MFQC 3MMNA 4PNHA 4JQSA 2XMZA 5JDCC 2VAWA 3JQDA 4QQRA 4DBLE 5DPMA 4D9NA 3QU2A 1QH9A 2ASEA 4D5GA 1C80A 5GONB 3CRMA 4MO9A 2KJQA 2NXEA 3I5MA 1ISSA 2AFIE 4TM7A 5I4BA 5LXTF 1OH8A 4NABA 3VKHA 4I55A 3GT4A 3LXRA 2C8KA 3P2EA 3R3HA 5AK5A 3TPFA 4DM7A 2XHZA 3W2IA 2BSAA 5F7JA 2I9PA 3VZSA 2HYDA 1AB6A 5DHAA 1PZMA 2L49A 4WLUA 2ZIZA 1PO7A 2QGNA 1VMIA 4YQFA 1CRWG 1H2WA 4ZVQA 1DFGA 3JVUA 3GPCA 4JLMA 2IV1A 3BJMA 4IFIA 3ZWVA 1W25A 3ZBUA 2Q41A 4MW9A 2FLKA 1DJMA 1PG5A 1ZU4A 2WDPA 4PICA 1ESNA 1BEUB 5FTJA 1XPOA 4F4CA 1Q7BA 4ATNA 4BQQA 2Q8NA 4IQGA 3R5KA 4QUGA 1DOAA 2C5FA 4NS1A 2GD0A 2HNBA 5HMLA 4XWWA 4AJEA 4LRUA 4DLPA 4BQFA 4F85A 2PX6A 3VGJA 2FPKA 2WUFA 1MG5A 2IX9A 2O1WA 2GN6A 1M72A 3CG0A 3F98A 3P9QA 4PLWA 1ZKMA 3QFIA 3LHKA 1JN0A 3NBYC 5TEWA 2TMKA 4IM7A 1KEUA 3SF8A 5KNDD 3L1PA 3TL6A 5GJWC 1U5BA 4P0TA 1YRWA 1ZSVA 1LPSA 3ORRA 3HKCA 4MR8B 5THQA 1PRVA 3RVQA 3PQ4A 1FUUA 3TI7A 5K6AC 3QG5A 4KIFA 1H3FA 1MJ5A 3OZ7A 4F1KA 1FPQA 2CKMA 1GXSA 1A98A 1HKUA 2O7RA 4UU7A 5D5HA 5M5BA 4L5AA 5LOVF 2AVDA 3JALB 1OBHA 3ZWKA 3BIOA 1TTQB 3O8BA 1YJAA 4GOLD 2HMAA 4HDKA 3NW9A 4KRGA 5EE1A 4OLFA 2EIHA 3WGNA 3B5JA 1IOVA 1AV7A 2AJDA 3BILA 3AW9A 3BN3A 1M1YA 3PQDA 1ZC4A 1I7NA 4MYUA 3TZEA 3DVAB 2ZUTA 4Z7JA 1CIPA 2NYAA 3LLUA 2G09A 1I4EB 1E1CB 3KLOA 4TGLA 2ID4A 5CT6A 5L53A 2V5AA 4TKUA 2JLXA 1OAOC 1U7PA 2D00A 3THWB 3EDRA 4G5GA 4Y2PA 2CLIB 1SXJA 1A7UA 2A67A 4XFJA 1BX3A 4JR2A 2GZ1A 4JC8A 1KDRA 4KSYA 4DUGD 2RGNA 4TS1A 1ZH8A 5GQSA 3UB3A 2DECA 4DADA 4AUMA 2C82A 2P6NA 3WQQA 4HAZA 5DM1A 3VPSA 4L8YA 3GROA 1G98A 1V39A 2VXBA 4EVIA 3F5MA 1UP4A 3NVKI 1RKXA 2OHHA 3INTA 4TXJA 1RFGE 3WHPA 4ZCRA 3MQ2A 3AHFA 1V8BA 5FIUA 3N8KA 3EYWA 4LJRA 1PLJA 4KPGA 3A1DA 4QTXA 5AVUA 2FUG6 4EQ6A 4X4FA 1P0IA 1ZXBA 2DH6A 2WFZA 3DBOB 1WXWA 3FHLA 4WZAE 5HQ3B 3BL8A 3LT4A 2AEEA 3TZ6A 4UMVA 3H11A 2WM9B 3NIDB 4IV5A 4CTMA 1PT5A 4FWIB 4QRIA 5KMGB 3C5CA 4Q37A 2X4IA 4F5YA 4GICA 3PQ8A 1OROA 4HWSA 1MRZA 4URHA 3BB3A 3LIPA 5CXXA 5A9TA 3WHLA 1USKA 2ZRBA 5KNCA 1CU1A 2Z30A 3A0RB 3CR7A 3LFHA 2IEIA 3NWOA 3PNYA 3UJCA 1MORA 3OQIB 2HSDA 3NXKA 1Q20A 4RIHA 4UW9A 5CG2A 3DLBA 5K3FA 5TVKA 5J4YA 3HP7A 4GSLA 3VR5A 2HL6A 3HBJA 2J9FA 2ZDHA 1Y63A 4PYRA 4YDRA 1P2VA 2P1DA 3LYAA 4RF3A 3MW8A 4Z4HA 1L7AA 2W8BB 2Y2VA 5D7BA 3R0IA 5BWOA 5IFLA 1HR0B 4YRAA 1NL3A 1JQ3A 1TVKB 1YBFA 2YN4A 1E9AA 3VBEA 1D2NA 3DOIA 3LQYA 4ISCA 1Y8AA 4EY7A 2C2ZA 4XDGA 2I6XA 2ZZKA 3D8TA 4CIAA 4Q1AA 4NRDA 1VB3A 4HBGA 4Q15A 1THMA 5C35A 3EFOB 3SC4A 1FB5A 2W2XA 1XZPA 4L51A 3IT1A 4EHNA 2OOSA 3IJPA 3DXZA 3FAZA 3BXHA 3GZDC 3SC2A 3FNFA 5C8XA 3E61A 4N3CA 3TW4A 2Y9PB 5ITZA 4A91A 3OE5A 3V8NA 3NC1C 1Z7BA 5SV2A 4GOKA 4AWAA 5FOQA 1G9TA 3FWHA 1ZHHA 4GOXA 4Y6GB 1PT9A 3JZDA 1I5EA 4V0RA 3W9UA 1LRJA 3V7WA 3IKVA 2BHSA 1KPIA 4C1NA 3N8HA 1AO0A 2A30A 3GOQA 3H6KA 4JBLA 3ANNA 4OGLA 1BCRB 3SDSA 4NX2A 4ZVMA 1SC3A 4YJHA 1FYDA 4FBIA 2KI5A 4LZZA 5JDIC 3F4KA 1XRLA 4TTAA 3FB4A 1TT5B 3L1KA 4ZIRB 3AVUA 5TQ0A 4IIXA 2AG1A 3IKMB 2DSTA 3ZNPA 3HCRA 1E6CA 4TSFD 4BO6A 4CCSA 1BVRA 4UJ3A 1VE1A 1OFHA 4MLCA 3WAKA 3QV1A 1XCLA 4RIIA 5IMSA 4IGFA 3T94A 5A9SA 2O0HA 1XQ9A 2CSXA 5DMHA 3H2SA 1J8YF 5EQFA 5D3KA 1MO6A 1QX4A 5ALUA 4DIBA 1FU8A 1TIBA 2V7XA 4FCTA 2QM0A 4FYPA 3SHVA 3MQFA 4RKFA 3SZRA 1DBSA 1ZEJA 3BK2A 5F23A 1UPBA 2W6ZA 4JT9A 1YH3A 1SBNE 1X80A 4GMFA 1P7YA 1I10A 2B4TO 4M37A 4N8DA 1DKPA 1KH1A 3O4GA 1RQ2A 3FRJA 3FRHA 3Q3EA 4J1SA 3MRSA 3B2EA 3CKMA 1W4AA 2WVHA 1OXSC 3BS3A 3PHBE 2JJMA 1CDEA 4ZC1A 3Q10A 1S8NA 1LPPA 3W4JA 3F96A 5TGTA 3VGPA 2V58A 2GZMA 2HU7A 2JI6A 4Z2AA 3PDJA 1XZGA 4GZMA 4Y7DA 2ODNA 5AW3A 5JCOA 3HCAA 1Z63A 1Y4DE 3NAGA 4HN4B 4ZDKA 2R11A 3PNMA 2IUTA 3U4GA 1Y8ZA 4C7OB 3VR0A 4I3FA 3SX2A 1NATA 2R1TA 1XCBA 4JJAA 5CK5A 4HMQA 1ZJWA 5CCEA 3A7EA 5I4CA 2DFDA 4MYHA 4K1XA 1WL8A 2XE4A 3RV4A 1NDQA 3V2IA 5DNWA 5FHRA 5HZHA 5KWIA 4BO9A 2VPQA 2A5LA 4YAIA 3CUEF 4RMIA 3P9SA 2OFFA 3TF5A 4CMAA 3BXEA 1WVIA 4B85A 4JA2A 3UXYA 1TFRA 1AQNA 1OSLA 4DEVA 1FFBA 1NSYA 1LC3A 1PZXA 2GCIA 2VF7A 3TZQA 3DPUA 1UJMA 4X4DA 1JR3D 4JBGA 5A5VA 2IH4A 3ZGZA 4MKFA 2VR1A 3R6TA 2JAPA 1N7GA 1QIGA 1TTHA 4Y1RA 3BT7A 3FPCA 1NEQA 1N9GA 1Z5UA 3GJSA 4GQIA 2A3RA 2AF4C 2VT2A 3LBAA 4II3A 1XTZA 4Q1EA 4YBRA 5F78A 3SICE 1DGQA 4ENSA 4ZQIA 1P9NA 3KG2A 1T4MA 3HDQA 2PMKA 3RLFA 1JKIA 1VKNA 2ZUFA 1S6YA 2J3KA 2O9JA 1FYVA 4YXFA 3ND8A 1EGHA 2KLBA 2Q5LA 4O2RA 1JIKA 2VP4A 4OHXA 4AQDA 2GHTA 1R1DA 2D8AA 5G4LA 1NW7A 3NM5A 1Q11A 1AE1A 2WHPA 3I76A 3E9QA 1C30B 1RM5A 2WM3A 2Z3WA 4X6XA 5EJAA 3VOSA 2ZIAA 5CA0B 3BHMA 5IT5A 3HWX1 3LT2A 1L5HB 5JBQA 2EDCA 1OTYA 3AY0A 4JGBA 3TGWA 1Z6GA 3I32A 4G5OA 4HHEA 5FV7A 3VR1A 5AJZA 4JK3A 2YHBA 3GGCA 1I9GA 1U1DA 1CDOA 1IBCA 4D45A 2QLFA 2ZJ0A 2CZQA 4HNAB 1Q1BA 2X6RA 1I3NA 5AVTA 4IMJB 2I80A 1OIXA 4AQYB 1UDRA 1K8RA 1XNHA 2HU5A 3EGVA 3EXAA 4P1ZA 3G2KA 3TEFA 3GNSA 2AZDA 3M6WA 4BFZA 4F9FA 3EVBA 3HCFA 4QG3A 1GRVA 2JGFA 1N34B 1WUHS 3L93A 2FV8A 1OD6A 4CQMA 3I6IA 5F73A 3TOZA 4DIDA 3PRYA 4C2BA 4EAQA 4DW8A 2E21A 2EHJA 5F2EA 4NU0A 1TI7A 1UWLA 1L4NA 2WQ7A 3ZQKA 1RWVA 3HPQA 3ETGA 1IE3A 2RGNC 3ZDBA 2AQHA 4K3VA 2TYSB 2OT3B 4FZRA 4X24A 1J25A 2PXTA 2LYPA 3AM1A 4UE3S 3O90A 1HDRA 2CV2A 5LDHA 3SJ7A 2CDNA 2W2NA 3OIWA 1B41A 1Y8RA 3GDFA 3FWZA 4HRAA 3ZQ4A 4FNGA 4EI9A 1EG7A 2J3IA 3L4EA 5HKOA 2ZJOA 2OZLB 1T0JB 2PJZA 4NS4A 3C3WA 3C85A 4KUEA 5U9CA 2PZLA 4O8BA 4NV0A 2HPHA 5IULC 5FTKA 4O33A 5I9TA 1S9DA 4NAUA 1GFIA 4F4DA 1BS1A 2NPOA 2CUZA 2DPMA 1HYGA 2UDPA 3OZXA 2FSUA 4E03A 4XM0A 2NYRA 3FMGA 1B3BA 2JASA 3F74A 3JSAA 3PYLA 2QTCA 2VDWA 4G36A 4LWPA 4TRNA 5FR1A 1NY6A 5FPQA 3BRCA 1XKLA 5J5VA 3SZUA 3EQ2A 3V1UA 4OHKA 4GWLA 4U2EA 4BZZA 3RC8A 3H0EA 6ADHA 4KWTA 2E49A 5BPHA 1M6VA 4EH1A 2WLSA 3RAFC 1AHNA 1ZOSA 3I2GA 2CJPA 4YUVA 5C46F 4YWJA 3T8YA 3TW8A 2VJNA 3PE6A 2SECE 4YXWA 2ECFA 3IQFA 2FEPA 3L0YA 2J07A 3BGOS 2CHEA 5ALTA 4LJ9A 621PA 9MHTA 1LDEA 5AVSA 4BNJA 1Q7GA 4C43A 1KTVA