5DSXA

Crystal structure of dot1l in complex with inhibitor cpd10 [6'-chloro-1,4-dimethyl-5'-(2-methyl-6-((4-(methylamino)pyrimidin-2-yl)amino)-1h-indol-1-yl)-[3,3'-bipyridin]-2(1h)-one]
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
316
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 105
structure length 316
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dsxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dsxA02
1O9HA 5CVDA 2C7PA 1EIZA 2DULA 1JTFA 2PX4A 3BKXA 3R9XB 2WA1A 2PGXA 2LD4A 5LQAA 5FWDA 4OX9Y 4DA4A 5HIJA 3FRIA 4BLUA 1I4WA 2AOXA 3GRUA 2ZLBA 3KHKA 3OU2A 5F2NA 1WXXA 4DCMA 3P9KA 3V8VA 5ICCA 1L3CA 5GP1A 2JHCA 3EVBA 4RTNA 3FTCA 1XDZA 3OE4A 3FPEA 1NE2A 3NTVA 4KDCA 3LDFA 5E1DA 2NP7A 5ERGB 4X60A 5E9JA 3UA3A 4NECA 3QOXA 4HSGA 3KPUA 3TQSA 1O9GA 1IY9A 3M6VA 4JXJA 5K0JA 3G89A 1G55A 4IV0A 4B17A 5EMJA 3HVHA 3ID6C 3TMAA 4POOA 5GINE 1BC5A 3DULA 5M5BA 2FPOA 2P41A 3LHDA 4ISCA 4PIMA 1RJEA 3G2QA 5CCXA 2OXTA 2KW5A 5KS2A 2BZGA 3HVJA 4IKPA 3LDGA 2AOUB 2PV0A 5GM1A 1YZ3A 3FUWA 3P9NA 3I58A 1VP3A 1WG8A 3JWJA 4MHTA 1Q0SA 2CKDA 1G8AA 4GOND 2PSSA 2V7EA 1HMYA 5F2KA 4YV0A 1SKMA 3CCFA 5C0OE 3UJ7A 2YXEA 4PYNA 3DXZA 3ORHA 1ORIA 5H02A 1V39A 2ONYA 4PNEA 3C3PA 1D2GA 1I9GA 2ZZKA 4CKBA 3MAGA 1R6AA 4RTKA 2ZIGA 1RJDA 1WS6A 1ZKDA 1KP9A 4CKCA 5K09A 2QRVB 3UJAA 1EJ6A 3KQSA 4QDJA 2C7OA 1G38A 3OFJA 1P1BA 3MGGA 4PYQA 2HNKA 4YV2A 2XYVA 1JG2A 4GOOD 3SR4A 3NW9A 3B7PA 2GA9A 5FULA 3G2OA 5CM2Z 4KDRA 3IHTA 4M7RA 4AUKA 5K0FA 3KQMA 4GUAA 5KQRA 1SUIA 3ELYA 3G88A 1XCJA 4XUEA 4RTMA 9MHTA 5CVVA 4RX1A 4C07A 1SQFA 4ER6A 2JJQA 3AXTA 3F4KA 3M33A 4GBED 4DM3A 3KU1A 5LQRA 2GH1A 3RW9A 5D1NA 3OFKA 3X0DA 4WVLA 3LKZA 2XYRA 4V0RA 5DRTA 2CWWA 4FZVA 2B2CA 1M6YA 4OBXA 4L7VA 2PWPA 4HTFA 4QTTB 3M6XA 1INLA 3FPGA 5EEGA 4P7JA 1JG1A 3DUWA 3E8SA 4C04A 3PLAE 3LCVB 1VPTA 4RTQA 2AR0A 2HWKA 3QOWA 4GC9A 3HCCA 1NKVA 2JH8A 2IIPA 5DSXA 3C6KA 3I53A 3I64A 1NV8A 3P9CA 2OB1A 4GC5A 5EG5A 3T7SA 2Z6UA 1RI2A 3GNLA 4C08A 3HTXA 4PYOA 3KQQA 4X63A 3CJTA 3HP7A 2AOVA 5EKUA 1FP2A 5CVJA 5EZQA 2QY6A 2GS9A 2I6GA 5EGSA 3DMHA 2BM9A 3V97A 5FHQA 2E5WA 3P2IA 3BT7A 4FGZA 1U2ZA 2Y1WA 1FJXA 3TFWA 3KR0A 3UZUA 4RTSA 3BWYA 4GOMD 4LWOA 2PWYA 5EOVA 1SG9A 3TRKA 2YXLA 2JHAA 3HCDA 3EVAA 3KQTA 7MHTA 1ZGAA 4K6MA 2OYRA 1RI3A 3A7EA 3BWCA 3UA4A 2PVCA 3ELWA 3FTFA 3PB3A 2PXAA 2GAFA 3KPJA 3O31A 4GEKA 2FHPA 2VDUE 2YQZA 4PGGA 5FHRA 1VIDA 5BW5A 4XUDA 3LSTA 1G60A 3UJBA 4DQ0A 2C7QA 3ER8A 3NVKI 3HNRA 2YVLA 4PYIA 3NMUF 1NV9A 2B3TA 3D2LA 4PGHA 4ATNA 4E32A 1P39A 1BOOA 2YX1A 3EPPA 5K0EA 2ZZMA 3OU7A 3P8ZA 4LECA 4BLWA 2YUIA 1VL5A 1N7IA 3DXYA 2JG3A 3UJDA 3A27A 3G5TA 2P3LA 2QYOA 3ELDA 3TPZA 4A6EA 2ORED 1JR4A 5DLYA 3GU3A 2HMYB 4DZRA 4E70A 3Q87B 4YV1A 5MHTA 3GXOA 1ZGJA 1UWVA 1EJ0A 1L9KA 2N47A 2XVAA 3BXOA 5EMLA 5DX8A 2IDJA 3LL7A 5E1OA 3T7TA 1QAOA 3IYLW 4RTLA 3KKZA 1X1BA 1RJGA 2ZIFA 1XDUA 2BM8A 5C1IA 3HA5A 5E1MA 5P8WA 2I9KA 3G2MA 4QVKA 2NYUA 1KYZA 4EK9A 10MHA 1UIRA 4HTFB 2AS0A 3OU6A 3OZTA 3HCEA 2UZ4A 2UYHA 1VBFA 3GRYA 2ZWAA 5CD1A 3O7WA 4FR0A 5EVJA 2ERCA 5JUWA 2K4MA 5EIFA 5KQSA 3M4XA 3EEYA 1R00A 2PJDA 2PXCA 1RI4A 4M38A 2ZIEA 4E2XA 3O4FA 2YXDA 5LQUA 3BZBA 2CMGA 5DXJA 1Q0TA 5EPEA 2HV9A 2IDKA 3EVFA 5DXAA 3GRVA 3FZGA 2AOUA 4H0NA 4FS8A 2VDWA 4E33A 3PT9A 3I9FA 5E1BA 5DSTA 3KQVA 2O57A 3ELUA 2P1DA 2ZTHA 4E31A 3KQYA 1YFJA 2IPXA 1N7JA 4RWZA 5DPMA 5EMMA 1KIAA 3HM2A 1EAMA 3C0KA 5E8RA 1BKYA 5EC8A 3I5UA 3LX6A 4Y2HA 4ER0A 5FWAA 4MQ4A 5LSAA 3FUTA 4CTKA 3P71T 4IWNA 2GPYA 1RI1A 2CMHA 2NXCA 4X61A 5EHIA 1ORHA 1G8SA 3FPJA 3EVZA 3CGGA 5FA8A 1AF7A 2UYQA 3HA3A 3FPFA 5DTRA 3GDHA 4FP9A 1QAQA 2GLUA 3LBFA 4P7FA 3EGIA 3G7UA 2UYOA 4PIPA 3R3HA 2IH5A 5CVEA 3BUSA 3HCFA 5JR3A 4AZVA 3C3YA 2BR3A 4EQZA 4P58A 4A6DA 2ZWVA 3TKAA 1SQGA 4U7PB 5CVUA 2VDVE 4R6XA 3EMDA 2CL5A 5FADA 5HZMA 5E9QA 2VS1A 3DLCA 4EKIA 3SSMA 2ZULA 4X41A 3KPYA 3M6UA 2YTZA 4R6WA 1JQEA 2ESRA 3BGVA 1ZG3A 2G71A 2P3QA 3REOA 3A7DA 3FUVA 1T43A 1NT2A 1YUBA 1KPIA 4QQNA 2G72A 1EQAA 2EX4A 5C9ZA 1VP9A 5HIKA 3EVGA 5DX0A 1VE3A 1X1AA 4Y30A 1M6EX 3K0BA 4PYLA 2P35A 2P7IA 2ZBQA 4AZSA 3FPHA 3FTEA 2VZ9A 1JQDA 2FK8A 1X1DA 3DMGA 4KWCA 4AZTA 4CXMA 2C7RA 1R74A 2ZZNA 3MB5A 1XJ5A 3UWPA 3UJCA 3DR5A 2Z6AA 2IGTA 4DKJA 4RTRA 5LR6A 2BH2A 1QANA 4ER3A 4GQBA 5FTWA 5LQKA 5T64A 1FPQA 5FUBA 3M6WA 4IV8A 2AOTB 2PX2A 3NWBA 3KQPA 1D2CA 4OBWA 5KVAA 5GIPE 2G1PA 1ZHFA 3PFHA 3ERCA 1G6Q1 5K8VA 2PKWA 2ZFUA 3AXSA 2G8NA 2V74B 2YR0A 3BGDA 4AX8A 3FTDA 2IH2A 1SUSA 3EVDA 2PBFA 3DMFA 3GIWA 1KR5A 1PRYA 3KQOA 3OPNA 3HA7A 1P1CA 3CJRA 4HRAA 5F2OA 4YUXA 8MHTA 5EMKA 4YUWA 1QZZA 3SM3A 4P7KA 1EG2A 2XVMA 4HG2A 5K0BA 2O06A 1AV6A 4V0QA 1RJFA 2OBFA 3GRZA 1BHJA 3GGDA 1OR8A 4ER7A 1AQJA 4FT2A 5CCBA 5HFJA 2ZSUA 3SXJA 5K01A 1P91A 1XVAA 3G2PA 3LKDA 4FSXA 4R05A 1L3IA 3PX2A 2ONZA 2P40A 2AOWA 2IFTA 1QYRA 3GRRA 3P2EA 5DT2A 4FSDA 4GF5A 4M37A 3ANXA 5EEHA 3U81A 4F84A 4YUYA 2IP2A 2NXNA 4QPPA 2P8JA 3UFBA 2AN4A 3NVMB 5HOQA 1DUSA 3VYWA 3R24A 4FT4A 3SSNA 2XBMA 3JWIA 3SGLA 2HR1A 4RTJA 2OKCA 5BW4A 1NW3A 2PX5A 3B3JA 3CVOA 4YUVA 5GWXA 3EEOA 2AN3A 1JSZA 2AN5A 3LCCA 2H00A 5G02A 2ZCJA 5HILA 3A25A 4MWZA 3NJRA 4XUCA 2AVNA 1N2XA 1YB2A 4F86A 2ZW9A 4E30A 1MJFA 4PYJA 3A4TA 2OB2A 3G5LA 3PX3A 4GOLD 3KR1A 2EJTA 5K03A 1KPGA 3DLIA 4RVDA 4HC4A 3RODA 2EFJA 4BP3A 2H1RA 2I7CA 3PVCA 4P7GA 4UOEA 1KHHA 3K6RA 4X1OA 1TPYA 3WSTA 1D2HA 2VP3A 4M36A 5EQJB 1YF3A 4KW7A 3UBTA 2UYCA 2G70A 2ZVJA 2PXXA 3M70A 1L3BA 1NW6A 3TKYA 3MTEA 4C05A 3UJ8A 2QE6A 2B25A 5HIIA 1L1EA 5DTQA 3GWZA 3P9IA 3B3FA 3GO4A 1PJZA 1DL5A 5FCDA 3EVEA 3JWHA 5EKXA 5FA5A 3LDUA 4OQDA 1NW8A 2AZTA 2B9EA 4PYMA 1B42A 5K0CA 3EMBA 4OA8A 2XYQA 3NDIA 3DP7A 1NBIA 3HCBA 3LPMA 4E2WA 2OO3A 2QRVA 4QVGA 3FUXA 2PX8A 1R8YA 1WY7A 3PFGA 3P97A 4YUZA 2NXEA 1X19A 5IKMA 5E2AA 4QPNA 4R8RA 3LECA 5IH3A 4RVHA 1HNNA 3BKWA 5GIOE 1NBHA 1Z3CA 3HVIA 3KR2A 4QTUB 1TW2A 1XTPA 1F3LA 5EIWA 2DPMA 3CBGA 3SSOA 3DTNA 3PTAA 5DTMA 2AVDA 1R18A 5CIYA 5K0NA 3SX0A 3LCUA 1QAMA 2WA2A 4KRGA 1ZQ9A 4ER5A 1UFKA 3DXXA 2FCAA 5DWQA 2JH9A 3OZSA 4Z2YA 3B3GA 4PCAA 4MTLA 1I1NA 3L8DA 3HVKA 3QV2A 2ZBPA 2O05A 5DX1A 4U7TB 2R6ZA 1JG3A 3NDJA 4PYKA 3IV6A 3H2BA 2NP6A 2H11A 2AOTA 4RYLA 1XCLA 3THSA 2O0LA 5GM2A 3RIEA 4KVZA 3T0IA 3KPVA 4PONA 4YMHA 1VLMA 5DM0A 2P7HA 3FYDA 3EGEA 1JSXA 3T7RA 4BY9E 4BLVA 2PT6A 4C06A 4G56A 3TM4A 1O54A 2FYTA 4WXHA 5E9WA 2I62A 5E2BA 1NW7A 1MHTA 2NXJA 4EVIA 3OCJA 4QQKA 3AY0A 2IH4A 3P2KA 1TW3A 1F38A 4C03A 2A14A 5K0LA 3HEMA 4QDKA 5K0GA 2PT9A 5E8JA 2NNWB 5HIMA 4F85A 1DCTA 2BR4A 1R8XA 3CKKA 1H1DA 1Y8CA 3OZRA 1FP1D 3ME5A 1FBNA 2P3OA 3SMQA 3B89A 2QM3A 5ICFA 4RTOA 1IM8A 3LGAA 3MHTA 4KIFA 4RV9A 1JTEA 3KPWA 5U4XA 4YMGA 5LQCA 5ICEA 3G8BA 4EKGA 4E2YA 5HEKA 2ADMA 3MQ2A 3NWEA 5GOZA 4LWPA 1RI5A 3DH0A 5FQOA 2FK7A 4MIKA 3TLJA 1KYWA 3R6TA 1YFLA 3TM5A 3CC8A 5ICGA 4DMGA 3FUUA 4RTPA 1NW5A 5BXYA 2WK1A 4AZWA 2IBTA 3GCZA 3Q7EA 2BR5A 4OQEA 4BP1A 3LBYA 4HGYA 4LG1A 4XCXA 4C4AA 2R3SA 3C6MA 3TR6A 2O07A 1AQIA 2IBSA 3SVZA 3MCZA 5DM1A 3JWGA 3ER9A 5LQJA 2Q41A 5B1SA 4RVFA 5K05A 4O29A 5DM4A 2B78A 4DCGA 5LQNA 3A26A 4E2ZA 1XXLA 4CWAA 1X1CA 3FRHA 3KR9A 5BP7A 2OY0A 5EHGA 4KIGA 5EZSA 4CKEA 5KYGA 4RVGA 1JQ3A 1VQ1A 4ZTBA 3TOSA 2Y1XA 4DF3A 1JG4A 5DRYA 2OZVA 3HCAA 3S68A 3UJ6A 2Z6QA 1WXWA 2OPBA 2ZBRA 1XDSA 3CJQA 3BWMA 3R0QA 5D1HA 3GJYA 5T67A 4R8SA 3UJ9A 3MERA 1M0EA 1KPHA 3EVCA 5CUQA 3OE5A 2HTEA 2PLWA 3FYCA 4HGZA 5DM2A 1IXKA 1YZHA 3AJDA 3AWIA 2PY6A 3PS9A 4PINA 4PWYA 5T6BA 2EJUA 2GB4A 3EGVA 1SVUA 3KQWA 3MTIA 1WZNA 3DOUA 5FQNA 4EMSA 3BWBA 3E23A 3IEIA 1KXZA 4CTJA 3VC2A 4HH4A 3THRA 3E05A 3E7PA 2EG5A 4RSRA 2F8LA 3BGIA 4OA5A 3VSEA 3B5IA 3VC1A 3MCTA 4PCLA 2JHPA 2FRXA 3G8AA
chains in the Genus database with same CATH superfamily
2J9ZB 2W2OA 2ZU0C 3ADKA 5EFZA 2AG6A 1P72A 1Z6GA 4P5DA 3IB6A 2W4QA 1SIWA 2KEKA 4L72A 4ND3A 4OAPA 4URVR 4Z3OA 5FWDA 3NTOA 5I7AA 3OKZA 2Q1SA 2GTPA 4IDNA 4B3MB 1Q0PA 4WOCA 4XE5A 3RYIA 3K0CC 4MV7A 5G4LA 3U4MA 1KDVA 3Q2KA 1Q91A 2GKSA 2C3YA 3NNSA 4G9BA 5FOUA 2OD9A 3AERB 5FPYA 2PG3A 1N5JA 4ZOAA 5C18A 5EZ6B 1BA3A 4OBMA 2NTYC 2O3JA 4LTNA 4ZRDA 3T3NA 3DV0A 3O47A 1YRBA 1M5UA 1WUKS 5E9JA 4N47A 3QELA 2ZBVA 4PIVA 4PAQA 4A2CA 5IBRA 3T1VA 1W581 1Y42X 1M34B 2FY8A 2RHLA 3T6KA 1E6KA 1EFRD 3WR5A 3SS7X 1Z5PA 4POOA 2O38A 2VRCD 1SCUA 1XEXA 3G5UA 3VVMA 3LDHA 1QGAA 3CEJA 4R1SA 1XCMA 2Q1XA 2F3PA 3MBKA 4N9WA 1DAOA 4FUQA 1QOPB 4DTCA 1P4HA 3N2EA 1QSGA 1R0XA 3BTOA 3Q4GA 4CCAA 1EXDA 1H6DA 4C3VA 1JUDA 1PEAA 3P9NA 4HQ6A 4XR9A 1HE8B 1U65A 3F2IA 3A0RB 3ZY2A 1NSYA 2VTVA 3ZD6A 4GMGA 3CG0A 5KQMA 2QUKA 3LU1A 3WBFA 4XQCA 3V80A 1ZL2A 3CB2A 1P1KA 4HBZA 1NWCA 5CGQB 1F8UA 1MD9A 4D3ZA 3IAM6 2FP3A 3VOAA 3QXXA 3U4DA 1L5LA 1RJWA 4LCJA 3FOFC 1RJDA 3GZJA 3IAFA 2F8MA 3MJDA 2BUAA 2C2MA 2NN3C 3PGA1 2Z95A 1EJ6A 4JASB 4LYGA 2RAUA 4M9QA 4ALNA 3IQWA 3PC8A 2W37A 1T8SA 4I6TA 1P1BA 2H29A 4I50A 3GLIE 3DT6A 3A70A 4LW8A 1OH6A 3G2OA 4FC7A 3DDHA 3IODA 3QIAA 3MWGA 1W36C 4JCYA 4NJMB 4Y7CA 5CVVA 2OZEA 4OX9B 3DNMA 3RYIB 4KH0A 1YI1A 1UJMA 4FZJA 3KAQA 4YRMA 1QK5A 3OFKA 3LKZA 3QZUA 2OG2A 1FRFS 3AP1A 2OV1A 1GHTA 5IAKA 5BSGA 1NXXA 3E5RA 3GNTA 9LDBA 4GVPA 3IMEA 4KO8A 1W2HA 1D2MA 2JZOA 2IP4A 1Z6AA 4Y2JA 2HK7A 2XCQA 5ULLA 3C7KA 1MXHA 3I05A 1P1RA 2P62A 4PC2A 1LNQA 3QKRB 1E2GA 4QQFA 4S2EA 4UD6A 1KRHA 1L5KA 1E2EA 1VE7A 4E5PA 2X8AA 3NFYA 1SXJD 3O21A 4CEJA 1NV8A 3U4QA 1QB2A 1MX9A 1R4NB 2I2BA 2B20A 1ZU5A 4X63A 1D3AA 2QT0A 4F4IA 4Z53A 3OX4A 4IGFA 4CM5A 2RARA 1FP2A 2P9JA 1NHWA 1FU4A 1BEZA 3KAPA 4RVOA 3UMBA 3DFIA 3FZNA 4INAA 4IKEA 3K09C 3MJRA 3VH3A 1U2ZA 2Y1WA 4U7JA 2ANBA 1AUVA 4IXWA 1PWZA 1U3DA 5K3OA 1ZGGA 1T2NA 4NU6A 3QA9A 1VKNA 2VO1A 4OV6B 5LA6F 3UBMA 2LYPA 3ZY5A 1XJWA 5DI3A 1J2JA 4EFNA 2ZRMA 3AEKA 2CHFA 2X42A 3ITKA 5KYNA 1G60A 4XVQA 2IKSA 3FYUB 4ZQBA 3VPGA 1JWAB 1LPOA 5CT6A 4CUKA 5B7QA 1M8PA 3TRFA 4QT4A 4FM9A 1Q16A 3K9NA 4NCXA 3NATA 2CNBA 4GWLA 4U7HA 4DM4A 3D8HA 1ZAYA 2LIPA 3DONA 1OASA 2CDNA 5HTOA 1R0YA 5KOJB 3D1NI 2QTBA 3GLFE 1DIBA 2WB4A 2ZBDA 4UNNA 1C1DB 4M1SA 3PFFA 1EUCA 1RXCA 5FA6A 4DLLA 3WVNA 4ENTA 4ESVA 5KTYA 1YZTA 5EERA 1AZTA 4HGRA 4BS9A 1RBZA 1CY8A 3SZRA 3KYJB 4G8JA 3AB7A 4ES6A 5E1MA 2D5IA 3H5VA 4DFDA 4EMUA 6NULA 3LBNA 3A1VA 2NYUA 1A8QA 1Q6YA 1WOYA 4DPLA 3H2SA 1UIRA 3RF6A 1J1UA 1S3IA 1T91A 2R65A 1TZ2A 4O1IA 4PZEA 2DHQA 3INGA 3BPSA 1NASA 1P2SA 4QFMA 4ARUA 4D9FA 1Y3HA 2J87A 2BTQA 4NYMR 4CR7A 4AXBA 1J90A 1F20A 1S1CA 2QSUA 2OD2A 1KE2A 5AJWA 4DY4A 1VXRA 4UM7A 2DQZA 2SKCA 2HA2A 2BGJA 3IIEA 4E2XA 3FKSD 4OXRA 4RFSA 4U2CA 3ZJTA 3MPUA 1KDRA 2HV9A 2OQRA 3Q1KA 3SJZA 3I72A 3HXOA 3FZGA 1MLDA 2XDWA 4PX5A 2OHGA 3LKBA 3KETA 1AGXA 1J2TA 1NIPA 1JLLB 3OWHA 3B1YA 4DIBA 1M2KA 5FPPA 3WK5A 3HJHA 3BD6A 2H2DA 5BW6B 3QNUA 4TYWA 5EMMA 1QVAA 2J09A 3IPXA 4DUZB 1EAMA 4HB4A 4ZVSA 4CFSA 5A5FA 1A9TA 2VJCA 3LX6A 4Y2HA 3C3JA 3SZGA 1IM2A 4ZCSA 4BB9A 3NFRA 2FFQA 2VHXA 2ZE7A 4TWZA 3FPJA 3UFDA 1GGJA 5SYMA 2RHWA 2FWMX 4WOBA 1LCDA 4KIJA 2VA9A 2Q3LA 2OHFA 3BXZA 3CZMA 1A2OA 3FDFA 4P92A 4AFNA 1P7PA 1S4MA 2B99A 5DU2A 2UYOA 3D5TA 5G0VA 4YJ3A 4FNOA 4OB6A 3HUUA 3UGTA 5J47A 1TCAA 5CVEA 3N7AA 1HRKA 2RSLA 3S27A 4F45A 1I3CA 1YZYA 3BJIC 3HJRA 1AHHA 3KUXA 3ASUA 4F46A 3PUYA 3ZV6A 3KVVA 4CQMD 4EKIA 3KKOA 1X2EA 1FLVA 2IOFK 2FB9A 2IHKA 1E3MA 1T5IA 4U3JB 1MO2A 2ZT7A 4MW5A 2AXNA 4MO9A 3LCRA 5E4TA 2P3QA 5C8YF 2LZ0A 2FPIA 1GG8A 4DSNA 3KTFA 2FJ0A 3GY0A 4MKZA 1DDIA 2WZCA 4M89A 2BE9A 3KYDB 2ZBFA 1NYTA 1EX6A 3LIIA 1PV2A 2PXLA 2ZOSA 1X1AA 3LMKA 4KPGA 1U2GC 1GCGA 4JYCA 2XWQA 4O2LA 5ALGA 1KK2A 3CCBA 3EGCA 4IF4A 2QTRA 4UFNA 1JU3A 4ZV7A 3AR5A 1Z4OA 2HRCA 2P4SA 2X23A 5K51A 3ZE0B 4EYEA 5H4GA 3KLNA 1EDZA 1JMVA 4L0CA 1U81A 3GBVA 3HB0A 2QW1A 3OEWA 2A88A 3E9QA 4R16A 3UJCA 2Z6AA 2H06A 3L0ZA 2C3OA 2GRLA 3MCAA 2DCMA 3A2MA 4FQ8A 1GTJ1 4B3JA 2W2VA 2AHRA 2AOTB 2PX2A 1LVGA 3GVCA 3BXXA 3KQPA 3PRJA 3VR2D 1RQGA 2GXQA 4B4UA 1N32B 1P1FA 1HTTA 1NXVA 2W2KB 4GZ6A 1UPBA 1PG2A 5F7JA 4PC7A 1QYXA 3A28A 3O3OB 2C98A 5FUWA 3FCOA 2NUTB 3UYKA 1OVGA 3B9BA 5DLEA 5HYVA 4LN1A 3L7DA 1JLKA 3F5SA 1JB9A 5BQ5A 3OKAA 1CRWG 1E7MA 3I4FA 1QZZA 2R7LA 3MINA 4OLAA 4HG2A 1Z06A 2GCOB 3R5XA 4G97A 4BPRA 1BHJA 3DEFA 3Q3CA 1RVDA 2O4CA 1XPJA 3A6EA 2ID9A 3GAMA 5LQSA 2JD2A 4OB8A 1CYDA 5A6SA 2D6FA 1KFEB 2IYFA 3LKDA 1SHJA 2X2OA 3MTQA 3GMIA 1BX1A 3BIXA 2F1KA 4H60A 2YOHA 1G5IA 2D5VA 1DOAA 1G7SA 3HQ4O 1CPYA 1OYWA 3PP8A 2QMYA 5AHXA 2PR2A 1YZQA 3ENVA 3V1MA 1JDVA 3VR5D 3ZJVA 3B6ZA 5G4KB 2BBTA 5BRNA 2I8CA 1MZVA 3I73A 1HQ1A 3DKIA 3OKFA 1NNSA 4IIUA 2AN5A 2IYOA 3JZMA 1MOPA 4KSBA 2QL7A 1OX6A 3CSSA 3FNIA 4BNHA 2E2WA 2H2GA 2XUOA 3C5VA 3GN2A 3UB3A 1RQLA 2B36A 4CM6A 2C5LA 1MJFA 3UAXA 4K6HA 3USCS 1W2WB 3JQ8B 3MMPA 3D6TB 2ODRD 3GX1A 1M7GA 1PW5A 2XQIA 2GZDA 5DBOA 1XHLA 3MG9A 1SRQA 2GYWA 3O6VA 3KDPA 3SJBA 5IDYA 3EC1A 1IIBA 4OXQA 3IESA 4C7VA 1C3EA 4IDEA 3Q11A 1GPMA 3KOMA 4GNKA 4IYRA 3VKWA 5HZHA 4LZOA 3D6UA 1ZX1A 2X77A 1MVOA 5K6RA 4TN1A 5KBYA 1JR3E 4FQ7A 3IDFA 4LE2A 3TTTA 1LBIA 4DLAA 4UTRA 1TFUA 3G0HA 1V4BA 1JHDA 1WPQA 1Y4SA 2EJCA 4MLCA 3AOEA 2GHQA 2R1TB 4IHKA 3S7TA 4KLAA 4XIIA 3UM9A 1CUSA 4HAVA 3THWA 1WP9A 3MMZA 3AEZA 1JPVA 3GL9A 5K3DA 1PVDA 2XYQA 2X1VA 3NT2A 4FWIB 5CFNA 3LPMA 2ZTUA 3UC5A 2QTGA 2QLMA 5LD2C 1D8AA 3VTZA 3WIOA 3P97A 2B5WA 5B3KA 4R0VA 2PH5A 3L05A 4KXWA 5IBPA 5TSDA 2KQUA 3C7CB 3UO8B 4M8SA 4BEVA 1I0LA 4JSYA 3GGCA 3N5CA 2HDWA 2CJXA 1Z3CA 1F8XA 4MP3A 1GV0A 1GAEO 2TS1A 1KJJA 3NYIA 5CMLA 5AR1A 4J03A 5FP0A 3MT8A 3QYAA 4G2TA 4CGYA 5DTMA 2C97A 4DLBA 4RADA 4RF5A 2HF2A 3EY9A 3K9HA 1F4PA 5CIYA 3LGSA 3AT1A 4ZPXA 3WKBA 4OJMX 4Q39A 2COKA 1UFKA 2PJZA 3K4HA 4KVAA 4KMMA 1NI4B 2F4VB 5F2EA 4AY2A 4MTLA 3ZCVA 5D3MA 2MOKA 3SJUA 4D2IA 1XSEA 2ZVPX 3B12A 5JSQA 1YR7A 4XJTA 4BMCA 1MNQA 2VATA 2CXPA 1N78A 3ZW7A 1GPUA 1T34A 4DC0A 5BMOA 3SBXA 4YMHA 3RABA 1QO9A 3KVNA 2LNMA 4US1R 2ICTA 1QO0A 4NZZA 3PGKA 3CNEA 3FYDA 4MQFA 2Z4RA 4KXUA 2WWXA 4F91B 3JCZA 2ZI4A 2Y0DA 5K2MA 3HA2A 2LYRA 1U6KA 3CF4A 3B36A 3O82A 3QMVA 4FGWA 4WXHA 1L5QA 3P96A 5CR9A 1DV1A 4J1TC 3OCJA 3TTXA 3M0EA 3VZQA 4CI0B 4DE5A 2PV7A 4E4RA 1Z4JA 2JEOA 5D84A 1DEOA 1U8XX 1M5RA 1NZJA 4W99A 4RIEA 1QX3A 2RHRA 4L0DA 4XDZA 5EP4A 4JEMA 2LE0A 3AG5A 4LISA 4EPTA 3IEPA 5J23A 4TPKA 5DMXA 4FINA 4A0FA 2HHHB 3HBFA 2NIPA 3EZXA 3O8OB 3KKNA 4JCOA 2XT6A 5H1YA 2I2DA 3AHCA 1OOEA 2AK3A 3ME5A 3OZRA 2V98A 5EIAA 5JLAA 3SX4A 2CSFA 4DEYA 3NALA 2HI0A 3MHTA 3VBCA 3ROXA 2HNBA 1UPAA 2IA5A 3G1UA 5KTRA 1M75A 1KMIY 5F9MA 5TGZA 2BFDB 3G8BA 4B43A 5BYKA 4D8WA 2GBFA 2VHQA 3E3MA 2WICA 4F3YA 4Z2AA 2O3RA 1FLAA 4XDYA 5L95A 3VZSA 3T1QA 4LAFA 1OFTA 1K6MA 4G36A 4TRRA 3AZOA 3ZI4A 4ETMA 2MR5A 2G6BA 4BWYA 1DG9A 2QVBA 5IAGA 4PHGA 3L4KA 3C5EA 2NZ2A 1GNRA 5T4FA 4CUJA 3EVNA 1TKCA 2R3SA 4UNSA 5LBIA 3K0AA 1PU2A 1GQFA 3O4JA 4FBGA 4WK0B 3IC5A 3DEJA 3PIDA 3L1UA 5B1SA 1PNVA 1QNFA 4D9HA 2WTBA 4O29A 9LDTA 1NDUA 2FEPA 4YCSA 4ZYVA 1P0MA 1OZGA 4KXYA 4ZQEA 3TMKA 3PNSA 4OFBA 4CEIA 2D3TA 2PQMA 1G3IA 3KLOA 3S7ZA 2Y1XA 4RYDA 4I9HA 3ZDZB 2FUKA 3QU4A 1E89A 3SZOA 4ZDWA 1BGWA 1ADBA 3D3QA 5DHUA 4AN1A 3ZX5A 5IFLA 3LQQA 3VR6D 2VOJA 1WV1A 3LUCA 1VDMA 4QBHA 4US0R 3W5SA 4R1TA 2JJ2A 3C1TA 1B2RA 2FF7A 3K9GA 4YMGA 1PK7A 2X9QA 2HQOA 2GBLC 2LUOA 1TT5B 3WKEA 3SJAA 1WMBA 5AKJA 4F21A 5HGJA 4F8JA 2QT1A 3D54D 4IVZA 1N2IA 4HJXA 1RYHA 3RVLA 3S99A 4D4KA 1JZSA 3F6PA 3KXAA 1LDGA 3GLUA 4OA5A 1RMTA 4MLZA 2JGDB 4QYWA 9ATCA 2ZIVB 1R10A 1SQSA 2FRXA 2IHTA 4I3FA 3EQ9A 2F6RA 1PSZA 4IUYA 3RIGA 1E92A 2ZB3A 4MUYA 1NF9A 2WAMA 4QUDA 4JDUA 1Q77A 3H3JA 1C2YA 1O57A 1Y3DE 3LPDA 3EHEA 4TT3A 1G59A 4OX9Y 1L1FA 2BMAA 3RC7A 2VYVA 2WIBA 3V7YA 3FNBA 2AOXA 2XMZA 4MZXA 5BPHA 1NZDA 2SKDA 3P7MA 5IVKA 3CF4G 5FB3A 4Z4EA 3R5SA 2DPYA 3QUQA 2AQKA 4GXNA 2XNJA 1DC8A 1U1CA 2WJ6A 4JJ6A 3RIYA 4KYVA 4G4SO 3CLUD 1H9CA 4BBJA 4E1AA 5BWBA 2O2XA 3ZXUB 3QK7A 3R44A 1QIMA 4MV0A 4BKMA 4Q05A 3MXTA 2NUAB 1MF7A 1JLHA 1R6UA 2OOKA 2BRUA 1PHPA 2WPDA 4IDBA 1WEKA 2DFNA 5DOZA 1Z82A 3RREA 3O75A 3AM3A 4YK7A 5FBWB 2WQZA 4LQLA 2B8TA 5FF9A 4D9IA 1HL7A 1GNLA 5AVOA 3W6UA 1SUCA 3RAFC 4G4IA 1ZIDA 3ZE9A 4BQEA 4QUJA 6ABPA 3BIFA 3M2TA 4TMZA 4EYKA 2E5FA 1UFOA 1UKBA 3AIOA 3M7IA 4IKPA 3EOZA 4AYTA 2VK2A 3BBPA 1FP4B 3E7FA 2IQ5A 2J48A 4UU7A 5GONB 3OM0A 4AMYA 5A1JA 3KQKA 4Q4HA 4QUBA 2PSDA 4FD3A 5LA6A 5JJLA 1LX6A 1AM4D 2GPTA 3BREA 3K9CA 4HDCA 1NL3A 4QX6A 5A6SB 4ZZIA 5AW7A 5FOSA 1M7HA 4QYTA 1ZHOA 3S4YA 3ZE1B 3KXIA 3MJHA 3HKBB 2Q5OA 3ORHA 3T8YA 2PGAA 2YICA 3FNQA 4N0QA 3VH2A 4BAUA 5BN5A 3BICA 1HQKA 4EB3A 4NZPA 4RTKA 2WSBA 2XPCA 1MJHA 5DLDA 2B69A 5C7IO 3EXAA 3TBKA 2BFEA 2J3MA 4I4LA 3BMOB 5KNBD 1R0SA 4ZOLB 2HY7A 1G3UA 4IIVA 3FAKA 2C54A 3FW1A 3OLZA 3P0RA 1Q7CA 4Y67A 5JSFA 3IHTA 3WWZA 4ASUA 5K0FA 1N5DA 3WQHA 1O5OA 2HWWA 2OEPA 5GMOA 5U1PA 1FFDA 1PRAA 1GAXA 1BQ4A 2B34A 1F0KA 1QVWA 2E4ZA 3IDZA 3QU9A 1R4MB 1O6BA 4ER6A 2O2DA 3OLWA 4NBUA 3NBQA 5EXPA 1O08A 5HHTA 4N3CA 1DBSA 3T35A 5I01A 5AQEA 2JARA 3EFHA 4XQGA 3WQSB 3O4IA 4P2GA 2Q7XA 5JEDA 2OGUA 3HEAA 4JXZA 3LC0A 2CB9A 1ZDMA 5DW0A 1ESCA 3IKMB 4M60A 3EQ8A 4C04A 2OZPA 2X5NA 5A3SA 3DEYX 3MBIA 3LCVB 4C3OB 5JSHA 1EX1A 1HE5A 2G1UA 2X4LA 4JLWA 3QOWA 2BI7A 2IXDA 2RC5A 3K4PA 4O4JB 1GPBA 1SKUA 1KZYC 5EE9A 1Z0IA 3OZEA 3EIWA 1WKVA 4FFBB 3KK0A 4QSHA 1MV8A 4L4ZA 4ZN6A 3CLCA 1P0CA 3S28A 1GRCA 2WINI 3GPDG 2AOVA 4W9MC 1XT6A 1Y63A 2Z1MA 3C85A 2I6GA 4P35A 1Y98A 1DCFA 4YRZA 3F2VA 1P4AA 2Y1GA 4JA2A 5AK0A 1S9DA 3HFGA 3TQRA 5G1PA 1CF2O 1BJRE 2AI1A 3I9LA 1EEHA 3IQXA 2IXEA 1ZRNA 2GEJA 2I29A 2IEYA 3QMMA 4JI1B 2V5AA 1A69A 4DQ0A 4HNTA 3BJZA 4MJLA 4D41A 3C3AA 3RFTA 1KI7A 2OC4A 2QBYA 3PR2B 1FTSA 3GFVA 3SKXA 1CY1A 2WUSR 3GRCA 4NMXB 3TLAA 2H1LA 4RETA 1R27A 4DMUB 1Z0FA 1XJCA 5DULA 1XZHA 3JVUA 3SIRA 1UM9A 1MJGA 3LXMA 1UBEA 3F9IA 2PX6A 2E4UA 1CUHA 1NBME 1E3OC 2WJPA 1ZGJA 3GXOA 3QPDA 1SXIA 4KBGA 1WXQA 2VDMB 1DWQA 1NEQA 2IDJA 5DE3A 1YC5A 2Q29A 2V4UA 3KKZA 1ZW6A 4B74A 1TJYA 3QITA 1X42A 2Q5HA 3BVPA 2O7RA 3DFUA 3FFAA 3HA5A 5E95A 4AMGA 3VSCA 3W1EA 5ALVA 1FJ2A 5ADVA 4ZYXA 3ZNQA 2I6TA 1U7OA 5A06A 3M89A 3M5PA 3CNBA 4Q4AB 1V3QE 1RU3A 2ZIWB 2H9IA 3OUZA 3R5TA 4NATA 1MQ9A 4LDNA 3X1WA 3NKLA 5BQOA 1IQUA 2LP4Y 3OUTA 1C5KA 1LRKA 1RC0A 3PGMA 3HXPA 3Q40A 1JHYA 4XB2A 5ITSA 1ZD4A 3GJ0A 2XCTB 3GQBB 4JD5A 1YV9A 4OHXA 4LCBA 3TSAA 1C1DA 2V7QA 4HGOA 3AM5A 4OK3A 4XWKA 5TT0A 3KJGA 4YP9A 3QLUA 2O8FB 1IYZA 3PNYA 4L6IA 2P9EA 4NOMA 2GYVA 5IXSA 1U8EA 4Z99A 4DMRA 3GJ3A 4GSKA 4DSZA 2J0SA 1DWUA 4M55A 1YFJA 1E77A 3ADBA 1Z18A 3HCRA 1V4VA 3TTVA 3WRVA 1U3FA 3CZQA 4YDRA 3IJEB 3Q3HA 2MT9A 3IUQA 1FX0A 1QTQA 1Y3CE 3N05A 1U31A 1VJDA 5B7NA 1UJCA 1NN0A 1WMSA 1XCBA 3AW8A 4X6YA 1JAHA 5THQA 4H6XA 3ZH9B 4BMOB 2IYUA 1P1JA 3LY5A 2O7NA 5IBCA 1NXPA 5ES3A 1N1DA 1NVMB 4URUR 2I3BA 4IRMA 3ZNNA 1C30B 2IW1A 3EDMA 2CNKA 4HLUC 4K88A 1JRLA 2HB6A 4UU0A 1AK1A 3M6IA 2QBYB 2ZSKA 2RH5A 2M9MA 5DHAA 1SQGA 3OETA 5KHLB 2F8SA 5GAHi 1ZD1A 3K5IA 4H3HB 2XQKA 5DLPA 3CO5A 2R2AA 5TV2A 3MTDA 1JT9A 1ATZA 4ZDIA 5HZMA 1NYLA 1RIIA 2QW8A 3AERA 3DXFA 1DMRA 1IHXA 3JU3A 1B41A 5DSZA 1JJFA 3FUVA 3GJRA 2E55A 3QVVA 2JLCA 2JIRA 2NSJA 4G8BA 3ZHSA 1LU9A 4Y1RA 4OU4A 3SEQA 4IF6A 3PQ3A 2IHNA 4TVBA 1M6EX 4EG4A 4K05A 1UBTS 2C4TA 4TV8B 5KAMA 4F1KA 3GMSA 2P35A 4W7HA 3UNXA 4YONB 4DARA 5I48A 2XB2A 1K8QA 3KXKA 1I4LD 1POXA 2AH5A 2RG7A 3DHVA 3E7WA 2CK3D 2Q46A 4N8EA 4RY8A 4PZLA 3UWPA 4ZO6A 4GT1A 3RRFA 4E5DA 1QOQB 2IGTA 3WGKA 4KE7A 3CVUA 1M83A 2BMFA 3I6BA 4JDPA 3DL0A 3KM0A 3LLVA 4XQ0A 5H82A 4EECA 3O1JC 5CK5A 3AI2A 1S2NA 1FJHA 3CNHA 3ZHCA 2WWHA 4Y6SA 3ABIA 3CPHA 2PKWA 1ORDA 2ZFUA 3BGDA 3N8DA 3PQ7A 4LZWA 1XLVA 2XB8A 4QPDA 3F3SA 1KKMA 3IXMA 3WLPA 1ECFA 1II9A 2HBYA 2X7HA 1DRJA 4G0ZA 1PQYA 4KGVA 3FWHA 2LCIA 4C7BA 3AV3A 3MSCA 4LOLA 2BF4A 5DISB 3H9CA 5DYIA 2VHUA 1U4OA 4Z8XA 4WBXC 3KNZA 5FBQB 3MF4A 3Q9NA 3O2JA 1GQRA 3HS3A 1TI7A 5ICMA 4C0QC 4QVIA 4O2AB 4TV9A 3LYAA 4O4LB 2C2GA 3WHLA 4DV3B 5KZMB 3ORFA 5HIJA 2ONZA 4PZDA 3WNCA 1T2EA 1UXCA 2QPOA 1LBHA 4K6GA 4QHSA 3ANXA 4UJ3A 3ZKWA 2ORIA 3ECSA 3T15A 2DOKA 2P8JA 5A1TA 4L8GA 2ZPAA 5JAQA 1NVKA 3JYPA 1EUCB 1NAHA 4CIWA 3A6GA 1E8DA 1IN1A 1O8BA 1C1XB 4KQEA 3AK4A 4XX0A 2VZEA 3VMFA 3RRJA 1CQTA 4DRYA 1QCDA 2EFHB 3L8EA 3QGMA 5AHRA 5DTJA 4EUKA 1MA3A 3TB4A 1VE1A 3V8RA 3SICE 4CFZA 1LJ8A 1UXIA 2EW2A 4B48A 5CB4A 5CBPA 3EG9B 4QUAA 1CJVC 3NIFB 1SXJB 3OJCA 5SZIA 2YFQA 1ZU4A 2OB2A 2BP7A 3U4IA 4GOLD 4HAYA 3PNLA 4LXGA 3ZYZA 4JVOA 3AM4A 2P78A 3TSZA 4C6HA 1RKQA 2QPLA 3GYBA 2HF9A 2QXUA 3RODA 3RU7A 4C4SA 2GJAA 4D3SA 4BUCA 3D5EA 2I3ZA 1TPYA 4BNLA 2FEKA 4X1KA 4EX7A 4KAXA 2FQXA 2D7DA 2G70A 5B3LA 1B43A 2XDAA 4RLHA 4C05A 1V2HE 2VBGA 4Y8VA 1KYTA 1MB3A 4IW3B 3V8MA 5ADHA 4M9UA 5J2UF 2RGBA 3GWZA 1Y5NA 2R2GA 1M0SA 4B45A 2PANA 2PMEA 1E9EA 3JR7A 3SE0A 1KO5A 1QKKA 2ZXEA 4FD2A 4H7JA 3BXGA 3OJLA 4FBLA 4FCVA 5F73A 3TCKA 4OQDA 1UWKA 1TADA 1Z08A 4BNUA 2ET6A 5ALYA 3EMBA 3DQPA 4CF6A 4RY0A 3C2QA 1GQQA 2RJOA 4D9CA 3DDZX 1KKLA 1KS9A 2B8WA 3DD5A 5EIBC 3IMCA 4L6CA 4ENVA 4OH7A 5A4JA 4ZI2A 1KBQA 1L4EA 2J7KA 2CBGA 2PCJA 1PDWA 4YP1A 3RR2A 3ZI7A 4ZIRA 2NO5A 3DDOA 3M2PA 4PHTA 3RC3A 1DFHA 3C74A 3K0CA 4Y1GA 4I9UA 1RPJA 3D4LA 3PNVA 2Y0BA 4KG7A 4PZUA 4JIMA 3D7NA 3BK7A 3PXDA 2JIQA 1I5EA 1SXJC 3E27A 4PQRA 4XEUA 4QRHA 4D9NA 1RBQA 2I4RA 3FGOA 1CLUA 3MJCA 1QDUA 5F76A 4X1YA 2JGDA 4JLPA 4S24A 1E99A 3SNHA 2QLLA 5DM70 1PZEA 1XMIA 4FOOA 4YXFA 3AF6A 4CM7A 1XPOA 3NTLA 2JH9A 5AJHA 4TMTA 4EJMA 5AVYA 3B3GA 3PD7A 3I12A 4N6OA 1NVGA 1MAVA 2YXPX 5FV7A 3SDZA 2JIZA 1HGXA 4MR8B 1YJQA 3OTIA 3PHCA 5DK6A 1QTNA 4REQA 1Y8QA 2AXEA 4MWSA 3THSA 4A0HA 1VRCA 2C84A 3PL5A 5LBTA 3Q12A 4MXDA 1IWOA 1ECCA 1PZHA 3CW9A 4O2BA 2E1PA 2HRQA 1SAYA 4BFLA 5KWJA 1Q0RA 1CEXA 3Q3JB 1U11A 3PQCA 4TWAA 4A8HA 3PLNA 2ATCA 4FFNA 1GR0A 4JKIA 1ZITA 4OOEA 2Q6LA 1SXGA 3B51X 2P3SA 1O54A 4C4XA 3UEOA 3ZEAA 3O8DA 1RWMA 2HIGA 5L7WA 4NARA 1R88A 3P2KA 2IYEA 3VV2A 5TQVA 4M54A 4Q4AA 2A9VA 3R77A 3UWKA 2BWJA 4C03A 2PT9A 1LV8A 5DBGA 3ENZA 3NBUA 3AR7A 4QDTA 1VJTA 3OQVA 4KXLA 1M0WA 5CA0A 3GAZA 1BVUA 3THOA 1TO2E 4CETA 3AHJA 4GWGA 3C70A 4AN4A 3LUFA 2C2KA 4O6VA 3SMQA 1R9JA 2O7VA 1V43A 3EQZA 4I1IA 2BGTA 1FNSA 4EABA 2UZ1B 2ZR0A 4GOXA 1C81A 2NVBA 5JRDS 3WK8A 1EWKA 4AECA 4B6JA 2GWRA 2GFHA 4DCSA 5FR2A 3K1YA 1A8HA 5C51B 3TLJA 4IO0A 4RHTA 3O93A 1PFKA 3WICA 4DXDA 2EU8A 1L1RA 4R8KA 5SY4A 1WIWA 3ZD9A 1QGDA 3EXHB 3FH0A 1KSGA 3U7GA 4E07A 3OZBA 4B3SB 2Y8EA 1GWNA 1W49A 1Z25A 3H04A 4HGYA 2HRDA 1H8HD 3O8OA 2R6CA 1BRMA 3D6HA 1F06A 1K5HA 5KMGA 3R09A 2JASA 1R3DA 2OE2A 3EPLA 2RKBA 1B26A 5K05A 1K92A 1DARA 2R5NA 1DTEA 4EB8A 3LTNC 3CW8X 2GPNA 4CWAA 2O59A 1DRKA 1X2LA 1VBMA 1SK9A 3FVVA 3PXAA 1F2UB 3NANA 2XSZA 4GXTA 3S44A 3B52X 3IP6A 7GPBA 5LQDA 3SQDA 3OC0A 2P2GA 1J25A 1JECA 1F0NA 1SD1A 1XP5A 4Q3BA 4UTPA 4A36A 1KEVA 3NKVA 1DC3A 3MUOA 3QPBA 4P22A 5CBKA 2Y71A 4W5JA 3AJDA 5JNLA 4GSYA 4PGMA 4JJGA 4PINA 1RZUA 4HY3A 3MOGA 4RNCA 2HCFA 3W6NA 1T5SA 3BWBA 5ELXA 4D4JA 5COBA 4NU8X 4TXMA 1D0VA 3UOAB 2C1EA 3MK31 3U7EB 2EKQA 4D8XA 1CZHA 3CGWA 1RTTA 2PBLA 3WOHA 3VC1A 1KK0A 5EXEA 4JL8A 4E5VA 1BVRA 1I0IA 1JPUA 1CLEA 2A5JA 2FH5B 3EXIB 3HB1A 5REQA 1XA3A 4ID9A 4J16A 3WXBA 4DA9A 1KY4A 1DB3A 4MV9A 3W2TA 4EG6A 4H16A 4EARA 3GC6A 1QRDA 5L4LA 2V7PA 5IT4A 3VYUB 1TDJA 4UEJA 2IS6A 3MT0A 1GIAA 3B7WA 1R0KA 2RHMA 5JH7A 6LDHA 1YA8A 1RWKA 1V2GA 1X9HA 4TL8A 1DULA 3QVOA 4OFXA 3H97A 3HSKA 2IZ5A 1M5TA 3B9RA 4J0GA 1KH3A 1Z0KA 3U1VA 1LD3A 3OE4A 3G7DA 3V00A 2ZATA 4X4GA 4OSEA 4BFXA 3UKDA 3RRXA 2YVKA 1J9EA 1RP1A 1RWOA 2J9GA 1VYVA 3R7LA 4YJ2B 2HKIA 4EW6A 1SNYA 3L7NA 1URPA 3AGQA 3DTVD 4B17A 3FZEA 2FPRA 1TTHA 2ZANA 3H16A 4EHDA 1ISSA 2PIAA 1B8PA 1HKHA 3PC8C 3PQ6A 3ICOA 5BUSA 2DYKA 3HY6A 3GUZA 3IH5A 1X70A 4RZIA 2JANA 2VPQA 4UU8A 2COUA 4OYLA 1PR6A 4Y7DA 2QTFA 3N0TA 3OMXA 4DL9A 3FNRA 3PI7A 3VGPA 3BFVA 3A9SA 3KOUA 1JN0A 2JA1A 2Q3DA 1DAMA 2BCGY 2EDAA 2PV0A 3W04A 4AB1A 3ADDA 2I6QA 3FD8A 4N0MA 3JWJA 3R9IA 2EQAA 3D0RA 3D1JA 1UP4A 3H11B 2FX2A 4HEHA 3RTCA 1Q6ZA 1O0BA 1KQNA 4N6NA 2PWAA 2BBWA 2ZUVA 4PSVA 1WB5A 2E4AA 2O0MA 2ODAA 5DTEA 5AOAA 3H9GA 1ZOIA 3DXZA 3B20A 4YCNA 1A7AA 2VYQA 1V9LA 3R4CA 5F51A 3WA6A 1NPYA 2BNOA 4NMWA 3LQ4A 3QF4B 4MJ7A 4URXR 1RBMA 1XTTA 4MRMA 4HNSA 3LQFA 3UATA 1CDZA 1NBMD 3K8QA 3RV3A 4ARZB 1CJSA 2FWJA 3AL3A 1RM3A 3BMNB 2C7OA 4YV2A 3I23A 5IMSA 1CIPA 2I71A 2EFDB 5TRTA 4E03A 1C4OA 1MDBA 2CMDA 2GMWA 1ZUHA 5L45A 2J5KA 4Y6QA 2POQX 1AZWA 3SCGA 1SKYB 2C8VA 3LQ1A 3LSYA 1JQ5A 2CXNA 5HFNA 5JD6A 3RTAA 1FSGA 4X4HA 3K2IA 4QATA 4FK8A 1NRXA 2NV2B 1SQFA 4TTRA 3A4IA 1QGOA 3LHFA 3FJYA 4HLNA 4D8VA 4BC1A 2R1VA 4F04A 2M6RA 4WVLA 2RAVA 2OILA 1VYHA 2CWWA 1C9YA 3HP1A 3KHSA 5I7SA 2AYYA 4G24A 5KX5F 3C87A 2QTVA 1ZM9A 3FPGA 1RE1A 3UW3A 4A2WA 3RUIA 1XLWA 4D1YA 4KBYA 1WCYA 1XEWX 1VPTA 2IV1A 3P9ZA 3GMTA 2E4WA 3MHPA 1KH2A 3ENKA 2RH4A 3NEPX 3E81A 3HCCA 3EDOA 1SH7A 3I64A 2O2CA 1R63A 2ZEJA 3BRWD 4HUQB 3DT9A 3NWOA 5LYJF 2VHWA 3JQCA 5D7BA 5EP3A 5JMPA 5A4FS 3CJTA 4LOKA 4U2FA 5DP1A 1QF9A 1XMXA 3BD1A 1D8TA 4DRXB 5IKOA 1XNGA 3KG2A 1ZKMA 2IT1A 2WMOB 3ED5A 3ORRA 1NERA 2GI4A 4H1TA 4J75A 1WD5A 4IQ4A 3V97A 2E5WA 2GNAA 2WDPA 1XK7A 3U09A 3SBDA 1WHTB 5EWMA 2IODA 2ZJYA 4YARA 3UZUA 4EA9A 1DAFA 1JHZA 5A0VA 2Q1UA 2WWIA 5K3FB 4EW1A 1DUIA 1WDLA 1ZGAA 4H3KB 4LEIA 2BEJA 3IUJA 5EUMA 2WNIA 4B6GA 3O31A 2YQZA 5FHRA 1LEHA 1RT9A 1KEUA 4PGGA 4CGZA 3SX2A 1WXGA 1ZSVA 3FYSA 5H9VA 1NLMA 4IICA 1VLJA 1NV9A 2DT8A 3E9EA 2FETA 4RPKA 5DNUA 2UZ1A 4DNPA 2G7ZA 3EY4A 1BAPA 1A88A 4GOJA 3OC6A 1LPPA 2V7VA 4F8EA 5KX5A 2VC2B 1N7IA 2GOYA 4IDCA 4MS3B 3T12A 3UJDA 1QIKA 5JLJA 4A6EA 5CEJA 5CJ2A 3VYSB 4AP5A 4QFDA 1C2TA 4RHFA 4QBGB 1MB4A 4E21A 1O58A 3I5MA 4K6CA 1WU7A 3TQTA 5TQ2A 4ZKDA 4OPMA 5JNVA 5MHTA 2N47A 3USES 1XQ6A 2P11A 3R6GA 5DX8A 1A1SA 3LPCA 4RA9B 1RXIA 2AI2A 2IDZA 3MS4A 1NVBA 1OI2A 4TL9A 5DYYA 4CM4B 1XDUA 2RBEA 4AI6A 3W4IA 1X2BA 1NF2A 1M6VA 1MEEA 2FZGA 1YR9A 4PZPA 3ISTA 1P0FA 5HVNA 3DHWC 3ZWWA 3IE0A 3RDPA 3Q7SA 2GCPA 1OV4A 4CW7A 2YHAA 3PK0A 2CLSA 1KSJA 1FDIA 2HUPA 3DLAA 4RL6A 5JAMA 3G2NA 2DCUA 3U7QB 4UE2A 3B78A 3L84A 2AQIA 4QJ5A 3SQOA 4FFVA 4U5QA 1YS1X 3LHIA 4JI4B 1XRLA 2MSWA 1OWPA 5LKAA 1QVZA 3PWSA 4ZXPA 1DLIA 3I6ZA 4P31A 1WUJS 3WB2A 4RNDB 3A10A 4ZYTA 1SZDA 3DWFA 1JU9A 5J58A 2BJCA 4RWZA 2GXSA 2QTLA 2OC9A 3NCTA 4HQLA 4WXEA 3IVAA 1UH5A 3F47A 1ATIA 4UASA 5I9TA 2PXVA 1YDWA 2GCEA 2IJGX 1HDEA 3IDQA 1KY3A 3MBOA 5TQJA 4YG7B 1H3FA 2A8YA 2W0SA 3IB3A 3RVJA 1NI4A 3WLFA 4NBTA 2AKAB 3N0XA 2C2OA 1C7IA 2Q5EA 2D2IA 5EE0A 3GQBA 5DKFA 4HVLA 3ES9A 2QN7A 2J6CA 4IZOA 4JSRA 3GAAA 1UBCA 5CXQA 4DQVA 1E20A 4X4IA 2WHPA 4IDGA 1XTSA 4CFYA 4AULA 1I13A 2IHVA 3TKAA 5I4KA 2CEAA 1WULS 4C76A 1Y1TA 3V3KA 1O9BA 1JHXA 1QYVA 1RRPA 3LFTA 3NTRA 5E7QA 3KEGA 3L1IA 2IEIA 1O6CA 1A8UA 1USUA 2J0VA 2LCFA 4AJ9A 4E88A 5KKCA 4UBLA 1SM4A 3EISA 5CYPA 3WNVA 5JXIA 3QNMA 3GVHA 4QXPA 1QORA 2EX4A 2Q2NA 1NJ8A 3ZBQA 4U7WA 3HFJA 3CMMA 2P69A 4J1NA 3VPXA 1KJZA 2UUPA 3K0BA 1S96A 3AIKA 1OH8A 3PDCA 4HGNA 3H5LA 1SC3A 3FDZB 1Y1RA 2PMKA 1THZA 1HNWB 1G291 2ZZNA 3MB5A 1N8SA 2Q5IA 2X9GA 3RV4A 1RZRA 3FLMA 5CDUA 2ZQYA 1JILA 1YBAA 2GETA 4DLNA 4KLCA 4RTRA 1YJBA 2Z8XA 3TDNA 3THYA 1YQXA 1JT2A 1H4QA 2ACVA 1CJTC 2WY2D 5CW1A 1CY7A 2MHCA 4NYIQ 1N6OA 2I3GA 4BWFB 4A6PA 4PRYA 1U3GA 3O1LA 3GJ5A 4P4UA 3VTAA 5KJFA 2HLDD 3T38A 5M29A 2HRZA 4U0JA 1UFQA 2QZ4A 2OO5C 3DBHB 1K5DA 2BDTA 4YUXA 2HDOA 3NRJA 1XTVA 2AFIE 4PV7A 3GLHE 4YUWA 1EG2A 2G3YA 4ZHQA 1R8JA 1N8NA 3RRNA 4DGQA 2V7UA 3C45A 1UZLA 5EUQB 3PPXA 1TZMA 1HDGO 2HRBA 1MQSA 3RC1A 4YRSA 3BD7A 1YHYA 3ADPA 2NWQA 3L92A 4ILEA 4KJXA 1T3ZA 1Z16A 2WV7A 3MWEB 5JHHB 4Z4CA 1XVAA 1D0IA 3AKEA 4YAJA 3D02A 1PTJA 2ZIZA 3ZZ1A 16PKA 1Z9BA 3H2IA 4EJSC 4AMZA 1VLLA 5KTKA 1SCBA 4X90A 1K06A 1ZI8A 2CZGA 1WNFA 2PWZA 4NS4A 2EFCB 2MINB 1R69A 3VYWA 2FPMA 3L04A 4AP6A 2L8NA 4XVCA 3NHAA 3SKVA 2A3NA 2OO7A 2QVXX 2WP0A 3SM9A 4RFSB 4G5XA 1JH9A 1FS4A 4MGHA 1KOLA 3A25A 3EASA 3NJRA 4CF5A 3ZCQA 3KLBA 2BM1A 2YWHA 4K0RA 1TYDE 3DE4X 1JIKA 3SVLA 2EJTA 1EFCA 3PXGA 1N75A 4O4LA 4Q21A 3TFQA 1XN1A 5DHTA 3WL7A 3PVCA 4FHZA 4A7PA 4CM9D 4DLZA 5F23A 3ULKA 2G4VA 4PBRA 2J4DA 4H4CA 1NQXA 4JHLA 4L4XA 2BEWB 2P5SA 3RUEA 3TKYA 1PRVA 2WIDA 1XC7A 2WT9A 1BYUA 4CHTA 3T1YB 5IAEA 1IHYA 3RSOA 4EUFA 3DYBA 1OGJA 1QGYA 1AQLA 1DKNA 3GO4A 4MTCA 3TLGA 4II3A 5DDIP 5FA5A 3KWFA 1FDTA 4RUKA 1UEIA 4PYMA 5D5PA 2GZMA 1TCBA 3SY8A 4J07A 1Q57A 3PDHA 2GZ1A 3UMMA 5C37A 3N2GA 4JL6A 4TSFD 1V9CA 2JFFA 2M2IA 1CBUA 2VJPA 3FUXA 4LE1A 5IJWA 1MZPA 2NSDA 3ZQ4A 1U9IC 2ODBA 2UZ3A 1ZCZA 4QXMA 5E9AA 4BFWA 3AEXA 1PWHA 1QKIA 3VKHA 1HURA 2UYYA 2NAFA 2YZNA 1O0CA 3NASA 1QE3A 2JBHA 2LCVA 1CJMA 1TW2A 1XTPA 2IGBA 4FDLA 4UU1A 3ROKA 2C92A 4DDWA 2C77A 4G37A 4CL3A 5KQLA 3CR3C 1SKAA 2CXOA 4YS6A 5FWYB 3HJUA 4YMSA 4Q34A 1TC2A 1B3BA 1H1LB 3U4AA 1Z7EA 4D9EA 1W46A 1VLHA 3E84A 3N87A 2NUPA 4R01A 4O3FA 3T9AA 1ZQ9A 4TLEA 4BB5A 1TYBE 4D97A 3DXXA 4GDFA 1YI0A 1MRZA 4Z2YA 3IVRA 1RR6A 1F8FA 1B1AA 1N3LA 1IDOA 3TAUA 3VR4D 2GZAA 2C5EA 2C4UA 1A8SA 1CWUA 1JG3A 3OMWA 5KYUB 3H2BA 2MU1A 4XFKA 3VPCA 4OH1A 1CP2A 4XI9A 4ZOBA 5BNFA 4P98A 3ZOKA 4D80A 3WDSA 1JXQA 1NNI1 2WG0A 1TPZA 2WKQA 4HKTA 1G9TA 2X0FA 4BLRA 4D74A 1QLHA 2YMMA 1ZJZA 1QLJA 3FKSA 2RDMA 2VP4A 1GPH1 1Y9JA 2J67A 1H9BA 2WVGA 3EGEA 4UHCA 2C3MA 5B4VA 1Z38A 2OXRA 2XQFA 5B37A 5FWYA 1APBA 2YYAA 4GE0A 2ECQA 1L8XA 2PT6A 4MCXA 5KYYB 2J6HA 2Y3IA 4PTZA 2ICPA 4MQ5A 4L78A 4Q9LA 4P38A 3HKEA 1UOEA 3FN4A 2GAIA 1YSCA 3DNPA 3PXCX 1I3KA 1ADRA 1KI9A 4KQMA 4R41A 4UM8B 3JRNA 3I4LA 2PUGA 1DAEA 4J3NA 2XVZA 4IEIA 1GZ3A 2H1WA 2QM0A 4U39A 2G36A 1TAUA 1KO1A 2C7GA 2V03A 2WBLC 5K0LA 2OSBA 4LFAB 1XD2B 4GKJB 2XA1A 3AILA 1WHSA 4HDSA 3KHTA 3N75A 4JP2A 4PSKA 5FOQA 3F74A 1T29A 3TEFA 2Y77A 3SHVA 4FR5A 2IZ6A 3A58B 1ENOA 4GZ5A 1P3Y1 4V02A 5AW5A 3T7EA 3BS4A 5CPFA 1W48A 4NMHA 4CKCB 2V0GA 2EYUA 3ZW8A 4EPVA 4MUKA 1JTEA 1XYGA 2X2PA 2RK3A 4NOKA 3BRQA 1OI4A 2DQYA 4B76A 2O8CB 4IIYA 5GOZA 2PS3A 2ZRBA 4Z7OB 2V5VA 3IV9A 3T5AA 4MKHA 1O4WA 1P4GA 1WUIS 2PGDA 4I6GA 5A9SA 5C8VA 1HTBA 4US2R 4RTPA 2Q8NA 3EDRA 5JECA 1LWOA 3QE9Y 2R4QA 3GLIB 3FKJA 3C3BA 4IDFA 2VHVA 4W8HA 5HQTA 4E2FA 3ONFA 3C6MA 1F6WA 1K2VN 3V2IA 5LN1A 5IT0A 3IV7A 1NOIA 1SQ6A 8ADHA 4TLLB 3U3WA 4U7GA 2FR8C 3OT1A 3LNCA 4RL4A 4B3FX 2EBFX 2IU3A 1QQTA 3B1JA 5A0FA 4BNDA 1VKHA 1E0JA 4RWEA 1E32A 5BSHA 1YJ8A 3PHBE 3COYA 2B9VA 5FL7D 3OO1A 3VYVA 4NFHA 1GZDA 4CKEA 1OIWA 1YZUA 3KCQA 4GR5A 5HUQA 5AO9A 1RYZA 3G79A 1AO3A 3WISA 3C3CA 3M3PA 5HTKA 4C0XA 2DWUA 5GGYA 4Q3DA 4Z3KA 1BX3A 1QYDA 1T8PA 1TYCA 1X1SA 2BKXA 2FSSA 3CJQA 1XQXA 3FVTA 4I6EA 4R98A 4WEQA 1ZESA 3WO1A 3ZBUA 3LQXA 3K2BA 3LF2A 4QGHA 5IP5A 3WS7A 4EX6A 1SVOA 4XCQA 2IRWA 2OL4A 2A59A 4YGXB 5KVQA 1GZ4A 3CEHA 3ICVA 3TDMA 1PTKA 1Y9DA 3A2NA 3KZXA 3M6MD 1USGA 3HMQA 3NHSA 4M0CA 5HE9A 1S2GA 2FZLA 4BO3A 3G6KA 4JNKA 4UQPA 4H7DA 1PYDA 1BTOA 1EFPB 2DUMA 2GZ2A 3F7NA 4ALKA 4UREA 1H4TA 4BFUA 4G63A 4I8TA 5G1NA 1MH9A 2CNOA 4RVUA 4Z9YA 2EG5A 1U7DA 3TIGA 2EBYA 5JO0A 3WAGA 3RANA 2V1UA 2JCGA 4MO2A 4YQFA 1PS9A 4BB0A 1U0JA 4IJKA 4DWVA 4DG8A 2DRIA 3AR2A 1ABBA 1NG1A 1JSRA 2CHGA 1KP3A 4ZVQA 2ORVA 5CLQA 2FG5A 1JX6A 5IAOA 3CM0A 3BCHA 1Q1AA 4DA4A 1EP3B 4C2AA 3EAQA 3GRUA 2YNMC 1WXXA 1YS4A 3STHA 4NZYA 3UWSA 4RH0A 3QSGA 5ICCA 3OEHA 4X44A 4UDXX 2A57A 3CX7A 4ZT2A 3ZTWA 1OYYA 3FMGA 2WTXA 4XH9B 1TIKA 1LBSA 3PGJA 4U6SA 3S2ZA 2P6NA 3I2GA 5CDGA 1FX1A 2R48A 3P0JA 5JBQA 3LVQE 4LFBB 4UW9A 1C80A 1UK6A 3UA3A 3KJIA 4NECA 2E21A 3EPHA 1NUAA 2WIGA 5A9TA 3RRYA 3WGYA 4B1FA 3GJSA 3KPUA 1PGQA 2XTZA 3M4YA 3ZQ6A 2BFNA 1X7GA 2P9BA 2H5EA 4UNRA 5AT1A 4PC3A 3PD0A 4LF4B 1SR8A 3E70C 4ITUA 3TEPA 1RLUA 4R5MA 3UMFA 1KAMA 2CDCA 5JDIC 5AXCA 1H2EA 1RXSA 4RM2A 4WA7A 5LNK6 5AFSA 4FFOA 1YGYA 5CCXA 4NNOA 4HHEA 3BJRA 1KE1A 4F38A 3HVJA 3JY6A 4A4DA 4A91A 3OOEA 2QD1A 1FPMA 4YJGB 3UKOA 2N1BA 1CDDA 2IVBA 1MIOB 5DEOA 4DUYB 3WLRA 3O9MA 1ABFA 4J76A 1NUPA 2C03A 1HE2A 2AUMA 2IY8A 3UANA 4X8MA 4YV0A 1E6LA 1NW4A 3C97A 5LWQA 1QVRA 2JK0A 3FLBA 4PAOA 2P9TA 4N48A 1QFXA 1Y0BA 5CM9C 3MT9A 3FZYA 1GCOA 3RNLA 4NR0A 3TKLA 2C3UA 1OXXK 1MTZA 1T35A 3GJ6A 3I0MA 2GYYA 4UUQA 3TLZA 4D3YA 1PNQA 4PSDA 4EYOA 3OOWA 2JAWA 1XDBA 5LDDC 1Y5MA 2E82A 2YJGA 3W6PA 1E7SA 5EIEA 5JYEA 3A05A 4XGKA 4DYHA 4O8ZA 1LK0A 4OJYA 3C5HA 1KKUA 3GP3A 4M7RA 2BGIA 4JQZA 3AEUA 3UJHA 4QHTA 4D4GA 3I5YA 2DF8A 4IWYA 2BFOA 1BJTA 4QUGA 2G83A 2PFGA 3SIPA 1Z6XA 4C78A 4Z4QA 2WUEA 3SYNA 1W47A 3NTXA 2NU7A 1HDYA 1R50A 4Q3KA 2C58A 5I9SA 5D1NA 1A97A 4FMPA 1G5TA 2XNSA 4MDYA 1CEQA 1WW8A 1PQPA 2X58A 1N2CA 4OQPA 1N6IA 3A9VA 4RVNA 4Y2XA 2COEA 4D0SA 4MUNA 1P5HA 1WWKA 1H0KA 3PI6A 5KWVA 1INLA 1VL6A 2IPMA 3QE0A 3ZZ0A 1M1NA 1IBSA 1DHTA 1BZYA 4P7JA 5LWHA 3TBHA 2L18A 3FAZA 1VE6A 1RACA 4Y1EA 4B3DA 4DMCA 5L8VA 5B5SA 2CV0A 2IOYA 4MB0A 1DKQA 4A0GA 2B2NA 1W85A 5JDCC 1RYFA 3WP1B 4QUIA 3I83A 3G3EA 4YJFA 5C31A 3CRRA 3P9CA 2FXVA 2H2FA 4NFSA 5AVKA 4PICA 3HTXA 3I4CA 3LT1A 5B7GA 3D3JA 1ZLYA 2VZLA 1MNAA 5ALMA 4BE9A 2A5LA 5EJIA 3BQ9A 3NGLA 1VCNA 5DGHA 1QIIA 3TOCA 1JLSA 1TU0A 1EFDN 3EBPA 4DVGA 1XJ0A 1L0BA 2W6OA 3IR5A 2JD0A 1OJ7A 1Q0ZA 1E3IA 4Q9AA 4OQXA 3B60A 1T26A 4RHYA 2RK4A 4C6TB 2PIJA 4JROA 3KR0A 2BKVA 1Q3KA 4RD6A 1BDIA 2PH7A 1A2QA 1C9KA 3E1GA 3HCDA 2RGXA 3AI7A 3IFSA 5E6SA 3ZYCA 7MHTA 1CRPA 1ZL0A 4N39A 3HYTA 4PF1A 3FA2A 1X3LA 3PB3A 2ETVA 1T6NA 2JKYA 3ROFA 3VU0A 1VIDA 3A0UA 4ZEMA 4C3ZA 5L9AA 5BWOA 2VI5A 3MLAA 4RKWA 4ZZ3A 5FOWA 1P7CA 3MJTA 4RS4A 2B1JA 3AKZA 4E32A 3QOFA 2QM7A 2D8AA 5K7SA 1BOOA 3W5VA 3L1KA 4XVUA 3EXHC 3IPYA 2AG5A 2HXGA 3REGA 2I80A 3CQ9A 3SN6A 3QE2A 1YB5A 5DLYA 1ONPA 1VE9A 5IUJC 2WJJA 3GLFB 4OOFA 2WTAA 1Q0QA 3DFFA 3E9MA 4K8RB 2QK4A 2VJKA 3ND5A 3T7TA 1CQWA 1KORA 1Y48E 3GB9A 4MUBA 4NBNA 4BO4A 2HYDA 1LH0A 3Q8KA 3NYQA 1SIUA 1SVNA 1DX6A 4F4JA 4MA0A 2UXCB 1A5SB 4GMDA 3RK4A 5EJ4A 2LXNA 3VHQA 3Q0EA 3OY2A 5ILQA 3FSGD 4MYDA 4BQFA 1TCUA 1TKBA 1X7XB 4LYAA 5I7HA 1PEKE 1GGFA 2UAGA 2QTAA 1QNLA 3PPWA 4R81A 1Q2UA 1LLIA 2HSEA 2P4UA 1Q20A 1R00A 3EEYA 3E3OA 3FCEA 1CZOA 4EA6A 1T6ZA 4YJHA 4MX8A 2QVLA 4FEEA 4KUGA 4JLAA 4RHXA 1C0IA 3QUAA 5EPEA 4X4FA 1EVQA 2I03A 4E94A 3ETNA 3UOWA 4MYRA 3U4CA 1A9ZA 4L9SA 4DDMA 3WHKA 3EE6A 2GXAA 3O2NA 3QLJA 4YRAA 2AZDA 1JXAA 5DTIA 1PFUA 2AMLA 1R0RE 1V37A 2VSYA 4HL6A 1WB4A 3RYCA 3VKVA 1JDZA 4A0RA 5FLKA 4YAKA 3DVLA 2D5AA 1HEYA 4X20A 2P1RA 3KELA 4I2VA 3WO0A 2GN6A 2OCDA 3ZD7A 5EC8A 5J4YA 4AQ7A 3H1TA 5K3BA 3IKTA 1RE0A 3CY6A 2ZWPA 4NDWA 3G9UA 3NORA 3PE5A 3IOCA 3O38A 4LYYA 1FFEA 1CR2A 2QRLA 4CI9A 1CERA 2AF3C 3IAS1 5ALZA 1I7PA 2PUWA 2KEJA 2VVTA 1N3BA 3KKLA 2OM6A 2WJZB 2GPSA 4MVJM 5EXDA 3U9LA 4EF5A 3LUJA 3O90A 4LQDA 4LRWA 2PL9A 4TL6A 1IVNA 3C3YA 4GGMX 1TVMA 1VYTA 4L0QA 3ZGLA 2P9GA 2O8EB 1J0XO 5AM0A 1RBYA 1ETHA 3A9CA 5LKRA 5DBHX 3SSMA 1JKIA 2ZPUA 4YYEA 3VZPA 4MLPA 5BT8A 4M2LA 1ISIA 1DAPA 3NV7A 2QN2A 3BGVA 3RTEA 4FZ3A 3FOEC 4GI7A 4F4UA 4FMCB 3UMVA 1HFJA 4P33A 3JXBC 1F51E 1E18A 1KPIA 4GQMA 1B0NA 2GF2A 2J0UB 3AHFA 3C4VA 3GZNB 4MEAA 1M1YE 4XIYA 1KEPA 3LUKA 1A7KA 1TA9A 3C1OA 4QOGA 5I9MA 3RHTA 1AOXA 5K6TA 1M2HA 2M98A 1GQOA 2G4CA 4WKPA 3C6XA 5FFMA 3Q8WA 1HQCA 3C8ZA 3TFLA 2XMRA 2DM6A 2ZJFA 3RHFA 4CXMA 4LF7B 1ZRSA 2WMYA 4GUDA 2WIUB 2X6RA 3OZWA 3F0TA 4JC4A 1TM4E 1CHNA 5ITWA 1I1OA 2XUZA 1YDEA 2REQA 1ETUA 1Q7RA 2JAPA 1MGPA 1H65A 4XZ3A 5J2TF 3RG2A 1A5BB 2PXEA 1UANA 2D0PB 3PJGA 4WKCA 4LJ9A 2VKQA 2P77A 2WZBA 4QOEA 1Y8QB 2O2ZA 2K2WA 2ZREA 3JZDA 2HAEA 4X8HA 4JI6B 4LXTA 4IQ0A 1FNNA 3ZR4B 4B40A 1T1SA 1JLMA 4U2DA 1VI5A 4P2BA 3ROMA 3ZXYA 2EWWA 1UF9A 3DOCA 3K35A 3M8KA 3OO0A 4LXQA 4R83A 5CTJA 5FLYA 3GZCA 3ZHYA 4CQLB 3L9WA 4IUCS 4TLBA 6PFKA 1U0GA 3ICWA 1Y7PA 4CUZA 4ICIA 3C8UA 4D4IA 4I5FA 4HDRB 4WASA 3BHMA 4BQRA 5B1DA 4V0QA 4RORA 2XUQA 5SY9A 3M3DA 1OR8A 1KOGA 1J42A 2EAUA 1SBTA 4OBBA 2QA5A 4M3NA 721PA 3KUDA 3CTPA 4A8PA 3X2SA 2MSLA 2FSFA 1P91A 2V7BA 3WGNA 1KMMA 1S8NA 2CXSA 3BYZA 1V7CA 5IC4A 5IJ9B 4JBLA 4GVLA 3P19A 4GF5A 4YUYA 1X8LA 2NG1A 3W8EA 3EXHA 1F4LA 2Z3VA 3CNOA 1TKAA 1MABB 3PU6A 3ZVRA 1PFGA 1FDWA 3F3MA 2GNOA 2PX5A 3I9V1 3PGXA 3BE4A 5FH9A 3LO8A 4ENUA 1GL7A 1DJNA 1N8TA 1UR5A 3TZ6A 1Z73A 4RMGA 1U5AA 3GJ4A 4WIAA 4XUCA 1CR1A 4CDNA 4M49A 1BFUA 3LZDA 1JQJC 4UMVA 1ZJ6A 3VDMA 3DAGA 4ANFA 4B7AA 4ZO4A 3TQHA 2PJUA 4D0NA 4IGKA 4URHA 1FSFA 1GV1A 4WFKA 2YJTD 4IL5A 4YVFA 2VQDA 1LQUA 1ZFNA 1AZLA 1J5EB 2FXIA 3E9RA 1NHGA 5EJ9A 1USKA 1GT6A 3C14C 4PHFA 4X97A 4M36A 4GDMA 2R63A 5GVSA 3JALA 3REFA 1V25A 2HBQA 1OKKD 4N9QA 1XUOA 2ZJ5A 2PTHA 4CG3A 4KPUA 3VU8A 4DRZA 3WL8A 4EHHA 5LP1A 2XBLA 5BURA 3QKRA 2NO4A 1UKAA 4LHEA 3O9ZA 5T3UA 4DHWA 4CDRA 1TIPA 3HBLA 1HUQA 4BVEA 2O8NA 5HK8A 1T8RA 5JPDA 4NJOA 4UEWA 3AUFA 4HMPA 3JATA 1EE2A 1OGYA 2A9KA 1AXGA 3HCBA 3BRSA 4E2WA 1OZHA 4J29A 4JCCA 4QVGA 4FFMA 5D3KA 1JQLB 4TMFA 3HBMA 1SVSA 3PG5A 5E2AA 4PXAA 4DG5A 1P2UA 1MIHA 1JR6A 1I5RA 4E7PA 4BJ3A 4BNXA 5IRCD 4M53A 3PF8A 5ECDA 3JTEA 3VVCA 3U3RA 3KR2A 5EZYB 1AKNA 1NQUA 3MCWA 3Q3GE 3SSOA 2GVZC 1E9DA 4YI3A 1PR5A 4FYKA 2JZNA 1U4NA 1R18A 3DE2X 5J1SB 1LVUA 3CINA 2QD5A 3LCUA 4V2IA 1VHJA 2WA2A 3AEQA 5CLLA 4E5SA 3FYUA 1EWVA 3QU7A 3OZSA 4P4SA 2OMKA 1DS6A 3OZDA 1CUBA 4D26A 3ECAA 3ND6A 4BJ1A 1AXEA 4WECA 4Z9XA 2FPUA 5IBQA 4CL8A 4OU5A 3VR3A 2YL2A 1USVA 5B58C 4IHJF 4DCTA 4F3CA 2CUKA 1AG9A 1W1WA 2B37A 3UIEA 5B6PA 2EIHA 4K0KB 4DLPA 3JQRA 4OHZA 1XU7A 3R3SA 1ISMA 5K2OA 5FPHA 3J7AC 2C9BA 5LPNA 2DUWA 4LDPA 4LHYA 4R8VA 4EJ6A 1E4OA 2G80A 4N1AA 2P2SA 3WTBA 2AJ8A 4H7IA 5DO9A 1YRYE 3TM4A 4DCJA 1LDYA 5FUXA 3RGGA 2X1MA 1Z2DA 5BV0A 1CVIA 3BTUA 3CLSD 4DNOA 4XYLA 5AVXA 2GHIA 3UB4A 4J3FA 2HCRA 1A0OA 3V4FA 3TNJA 1K7XB 3QXJA 4HRXA 2A14A 4GMXA 5TVGA 4KI7A 3AEYA 1PV1A 3QEOA 3VNBA 3VHXB 4UAGA 4PZZA 5ENZA 2F43A 3K1AB 4MUXA 4WEOA 2GPJA 5HIMA 4F85A 1JQKA 2J7PD 2HA0A 2OQIA 1XHEA 3NT5A 2HZBA 2DB3A 2E9SA 2WD7A 2F67A 2I1LA 3OZ7A 3JD2A 2QB5A 5D85A 4EPXA 2RI1A 2TYSB 1SVLA 3I5AA 3LGAA 3OCXA 1SU7A 5EUCA 4BYGA 3DMTA 1U5CA 1V8PA 1WB6A 2PRSA 3LLCA 1OWOA 3LLMA 2RGDA 4EKGA 4HPXB 2FZ4A 2VYND 4RXTA 2F2TA 2Q3FA 4I36A 4W9NC 5HEKA 1AIPA 4PAGA 2IOFA 3WL4A 1ZH2A 4YRFA 3ON5A 4AN0A 1YFLA 3QQPA 2JHGA 3OFNA 3MPOA 1JWLA 3L4SO 3O8QB 1VPLA 3K92A 3N7TA 1P9NA 4CCSA 4BMVA 4ND8B 1K68A 1K97A 3CUVA 4JJ8A 3RS7A 1NUHA 3AZQA 2CD7A 2Z8YA 1HPLA 2H4JA 2MJLA 4CMEA 1Z5NA 4OYRA 1XTKA 3I76A 4LV5B 1EFVA 1U8UA 1Y9AA 2VQSA 1BS1A 4W9RA 5G40A 1IULA 2WWGA 4X93A 3EA5A 1JHQA 1YR6A 3AETA 4X54A 3SEZA 5KYGA 5DGCA 1E2MA 4X5OA 2WG1A 1NR1A 4QARA 2X8JA 2C5AA 1FXSA 3MEJA 1K1EA 4NS1A 1HWYA 2YZKA 4IRXA 3FR7A 5JCZA 3LXRA 1Z74A 4FJ0A 1GU0A 1OLXB 3HC7A 3W5HA 3R0QA 1Y7TA 3I3OA 3STVA 1FFHA 5CUQA 1M34E 1P1IA 3FYCA 4Q6BA 1YQTA 2PHZA 1Z4QA 2Q5LA 3E9ZA 4PBSA 5H3LA 5JC8A 3RM3A 3MWLA 4KCGA 3FHJA 3GEPA 3I1JA 3HBJA 5JAPA 5E3IA 4QU0A 4HLQB 5L7YA 3BE5A 3RT7A 3BAZA 3THRA 3C48A 3IMKA 1Z7WA 2G28A 2P4HX 3OT4A 3MMXA 3Q8XB 3MOIA 4QAJA 1VMDA 1JH8A 1YVEI 2XA2A 2BI8A 3WKDA 5BQFA 4FT4A 2FP4B 1KAHA 4KQJA 7YASA 1XVTA 2HSZA 4ZQHA 3BH6A 4EHNA 3ETGA 4FU0A 1ZNQO 5TGDA 4UTNA 4O4HF 4L73A 1OQAA 4XD7D 5D01A 2CSUA 3HXTA 3EYWA 1G21B 1G0NA 4PBTA 3FRIA 1NA5A 2VSQA 4MCJA 1SVMA 4BIMA 4HDNA 1K7EB 3ORSA 2DWPA 3COPA 2FN7A 2V97A 3HKCA 4FMDF 2CMFA 3QBTA 1JG6A 1AZSC 2NUPB 1R3UA 3L41A 3VFDA 3ZGOA 5I3CA 1N8KA 5C8ZA 2QVYX 1GZVA 3FCYA 5G41A 1UFRA 4JX9A 3FPEA 4N0DA 3TCXB 4ND8A 3ZHVA 3DKKA 4CLRA 5G3YA 4DEVA 1X0VA 1XD8A 4IG4A 4N6GA 4O4IF 3R0IA 3LISA 2UUOA 4REQB 2HMAA 4GD3Q 1RP7A 3QWHA 4XTCS 3T4PA 4M83A 1ORRA 1C4WA 1ID1A 1WXHA 1I0ZA 3QPVA 4G07A 5GINE 1KYYA 3SCHA 1TU3A 2SCUB 3ZE2B 4DMHA 3DCIA 1M6NA 2QTZA 3C8DA 3WKAA 2BN4A 2FWBA 2G40A 3I0ZA 4TS3A 1RWBA 3TAHA 4Q01A 3VNVA 1AURA 2I66A 2O5EA 1BQ3A 5IDQA 2IYAA 4JVMA 5EXTA 2ERXA 5HCIA 2BZGA 2EF0A 3LDGA 4BV3A 2AOUB 1Z7GA 3E5HA 3LD9A 4OMFG 5BNZA 2WHPB 4PPQA 2QXTA 3DV0B 3D6NB 1ESEA 2WF6A 3UHAA 3ZDBA 2QL9A 1RM0A 3DL7A 4I4TF 5ECWA 3BJMA 1HMYA 5I51A 5T8KA 1PZGA 2BZ0A 4O8BA 2X5JO 2NX2A 1T1IA 3NAZA 3PE6A 1GRQA 1B0AA 3H9JA 4TMWA 2ONYA 5LB2A 3UXYA 3G5MA 3IA2A 4A8JA 1DPGA 2C7VA 2FUG6 1QR6A 4QGSA 4E12A 1AS0A 1QIGA 1WRBA 1I3OA 3L6OO 3UFXB 4CKCA 3QWBA 5BSWA 1JNYA 3K0AB 1XRJA 1Y33E 5ALXA 4C21A 2E18A 1EIWA 3DDWA 1O5IA 4IJWA 2CNNA 2VEOA 2VAPA 2D06A 5DGIA 3R7BA 2BLLA 2X5KO 2XQJA 3DW1X 3KQMA 4CEJB 1T6XA 3OHPA 1XCJA 3DBOB 4XUEA 2VBIA 1IM5A 3G5GA 1ULZA 4N5NA 2FMIA 2FZCA 5HKLA 4EZBA 5K9ZA 3DMPA 1IB0A 1V11A 2YOFA 1GCAA 1ZJWA 5DN9A 3T9CA 1V5GA 3QVJA 1RPZA 1ZUGA 4LMBA 1RKBA 2JIZD 2X3UA 3AVOA 4WZZA 3RWMB 4EL0A 1M6YA 2SBTA 4AL4A 2LPMA 1Y1SA 2G07A 3ONNA 4HTFA 5TX7A 3VPHA 3T1OA 5T4BA 4I7EA 4H6PA 2WIJA 3B2QA 1WZEA 3H13A 3RAEC 3SXPA 3RS8A 1K75A 2Q3CA 2R8PA 4IIJF 3D43A 1A95A 1T9KA 1JDBC 4LK2A 5JALA 2H48A 3GEHA 4CMEC 5HDQA 1W5SA 4AG5A 3EAGA 1KY5A 1IWBB 4GC5A 4R0MA 2DR2A 1RI2A 2Q4RA 3HLYA 4YO7A 5CFZA 4YXWD 3FNFA 4TVSA 3A04A 1CDEA 4NICA 1QP8A 4LPKA 1E58A 1UC4B 1W0KD 2HJRA 2QY6A 4GYKA 5IM5A 3WNDA 4CZ2A 4Y6PA 4HEA1 2AYXA 3GYGA 3OAAA 4RKQA 1RCTE 4BU1A 3WYCA 1LJLA 3RSHA 2ZIXA 4DZTA 4BASA 1QDLB 1AUXA 2F00A 2DJ5A 1DFIA 2JHAA 3ITEA 3KQTA 1G2IA 3DZHA 3D3KA 4B8WA 1CZLA 1V45E 2RGNA 4Q3CA 4D4HA 1YL5A 1F2UA 4L74A 4RFLA 5IYZB 2UYGA 3NHPA 1EE9A 4YCJA 2G9NA 1WCIB 5J4HA 3LX8A 3W9UA 1U1DA 4AT1A 4BJ6A 2Z3ZA 2H08A 2A9FA 4X7MA 2YVLA 2X6TA 5AKEA 3VU9B 2QY9A 2XNDA 3D2LA 1HG0A 3E2MA 2PK3A 5TXGA 5AW1A 3NU1A 5F35A 1NG9A 1M3SA 1VCIA 2EZ8A 3HRIA 2B0JA 4E4TA 2O49A 2IPOA 4L5IA 1OYOA 2JG3A 4EGAA 1XRRA 4MW6A 1ISRA 4UXHA 2DE0X 2JQEA