5DSXA

Crystal structure of dot1l in complex with inhibitor cpd10 [6'-chloro-1,4-dimethyl-5'-(2-methyl-6-((4-(methylamino)pyrimidin-2-yl)amino)-1h-indol-1-yl)-[3,3'-bipyridin]-2(1h)-one]
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
316
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 316
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dsxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dsxA02
10MHA 2PSSA 3LCCA 1O9GA 2OY0A 1WS6A 3PS9A 4R8SA 3KR0A 2OKCA 4CTJA 3GWZA 3THRA 4PIMA 4GOLD 4PYKA 2XYVA 2IBSA 2CMGA 3KKZA 3UA4A 5DRYA 3B3GA 2V7EA 5CM2Z 2HNKA 5KQSA 2IH4A 3I9FA 3BWCA 4RX1A 3P2KA 3NW9A 1X1AA 3MERA 5EKXA 4EVIA 3H2BA 5E1BA 8MHTA 1Q0SA 5HILA 5DSXA 3P2IA 5T6BA 5E1DA 2O07A 3UJ7A 3SVZA 1XVAA 1KPHA 3IEIA 3CKKA 4HSGA 1EJ6A 4QQNA 5GM2A 4BY9E 5D1HA 4E31A 3PT9A 1EG2A 1KR5A 4M36A 4RVDA 2EG5A 5EC8A 3LX6A 4RTMA 1D2HA 2KW5A 2YX1A 3GDHA 2P7IA 3EVGA 3KR9A 4QDKA 2IDJA 3T7TA 3G8AA 1PRYA 2YQZA 4IV8A 4RV9A 5GWXA 5M5BA 2G70A 4EKIA 1AV6A 2P8JA 5EZSA 2UZ4A 3GGDA 2XYRA 1NW6A 1QAOA 2PVCA 2CMHA 1MHTA 1YB2A 1P1CA 2P1DA 4MWZA 5DX0A 3FUWA 3P9KA 4FSDA 4PCAA 3OE5A 3AXTA 3MB5A 2JHAA 4R6WA 1I4WA 1L3IA 5LSAA 3SM3A 4IKPA 4HGZA 4QPNA 3UJ8A 3B89A 3IHTA 5C0OE 5CVUA 2Z6QA 1XDZA 3UZUA 3G2OA 1KXZA 4P7KA 1ZGAA 5K01A 5LQKA 1ZGJA 3FRIA 4CKBA 2JHCA 4JXJA 3CJTA 1L3CA 5LR6A 2HV9A 5LQNA 4YUZA 2I6GA 3DULA 3BT7A 1JQDA 1KYZA 1H1DA 2P3QA 3KQSA 4MQ4A 4ER5A 3I5UA 4BLWA 2FPOA 1BKYA 3HCEA 2BR3A 2EX4A 1QANA 3QOXA 3EVEA 3K6RA 4PYNA 2OXTA 4YMHA 3KPVA 3KQMA 3GRUA 4AX8A 5FUBA 3G2QA 4ER0A 3E7PA 1R8XA 3KU1A 4EKGA 3V8VA 4DCGA 5DM0A 5BP7A 3HNRA 5E2BA 2XBMA 3EVZA 2I62A 3KPJA 2V74B 2Z6UA 4U7PB 4YMGA 3JWJA 4A6DA 4P7FA 3G5TA 5HFJA 1YZHA 2JG3A 5MHTA 4WVLA 1RJGA 4ER3A 4MTLA 4XUEA 5EVJA 5BW5A 3HA5A 1F38A 1R6AA 3B7PA 1G8SA 3D2LA 3R0QA 5LQAA 4KVZA 3R24A 2GB4A 2P3LA 3GU3A 4X63A 4RTRA 2PKWA 3EVDA 4WXHA 3KPYA 3KR1A 4PIPA 5CVJA 4DF3A 1JSZA 4CWAA 2UYHA 1UFKA 4GBED 1YF3A 3NJRA 1IXKA 4E70A 1JSXA 2K4MA 4HRAA 2ZIFA 2CWWA 3A7DA 4KDCA 4P58A 5FWAA 1OR8A 4HGYA 5DX1A 1RI4A 2ZLBA 3OU2A 3R6TA 5FTWA 4M37A 4XCXA 5DSTA 4AUKA 3HVIA 1SUSA 5K0CA 4CXMA 4PNEA 3FZGA 1FPQA 4P7GA 1MJFA 1NW8A 3KQPA 3VC2A 2I9KA 4KIFA 2PT9A 4LWPA 1RJFA 1L1EA 1DCTA 5EPEA 3JWGA 2BM8A 3P2EA 5DM1A 5K0LA 1AQJA 3FTFA 2I7CA 2LD4A 3MGGA 2N47A 1L9KA 3NWBA 4BLUA 2Z6AA 3FPJA 1EIZA 1JQEA 2PX8A 3BKWA 5GINE 4G56A 3MQ2A 2IIPA 4QVKA 5HIMA 2UYOA 3CGGA 3DR5A 4GOOD 4KWCA 3SMQA 3G8BA 4DQ0A 2PJDA 3M6UA 3U81A 2ZFUA 3LKDA 3MCTA 4OQEA 2ORED 3DMGA 4FP9A 3VSEA 3HEMA 1AF7A 2GLUA 3SXJA 3WSTA 4EMSA 4PYIA 3G2MA 4PGGA 3I64A 2JHPA 3PX3A 1SVUA 3G89A 5F2KA 4QTTB 4XUDA 5DXJA 3ER9A 4HTFB 4RTNA 1IM8A 1NV9A 2B3TA 4PYLA 4PYMA 1B42A 4PINA 1JG2A 1QYRA 2AR0A 4PWYA 4E33A 4LECA 4RTPA 2YVLA 3GRYA 2CL5A 3LDUA 4DM3A 3SSOA 3SSMA 3MAGA 1R18A 2OB2A 3LCVB 3T0IA 4DCMA 3QV2A 5CD1A 2FYTA 2NXEA 2AOTA 4ER7A 1TW2A 4GOND 5T64A 1NE2A 3FPHA 3RODA 1DL5A 3G7UA 5K0FA 1KPIA 4PONA 2EFJA 3F4KA 2XYQA 3M70A 4GUAA 1SQGA 2AOWA 3ER8A 3T7RA 3LKZA 1RI3A 3CJQA 4IV0A 2QE6A 4MIKA 5IKMA 2FCAA 5C1IA 5DM2A 4YUXA 3THSA 2IH2A 1WZNA 4HTFA 3L8DA 1PJZA 5CVDA 5F2OA 5FQNA 2P35A 3E23A 3LBYA 4X61A 1P91A 5D1NA 3VC1A 2VP3A 3EVFA 3FTEA 2AOXA 5DLYA 1X1CA 3OZRA 3PFGA 5FWDA 3JWHA 4RVHA 5E1MA 2AOUB 3B3JA 1KYWA 3EVAA 3BKXA 3AJDA 1NKVA 1G55A 5K03A 2OZVA 3BWBA 2XVAA 4RTLA 3GXOA 2PX2A 3Q87B 2GS9A 2PY6A 4YUYA 2G1PA 2P41A 5H02A 1AQIA 4E32A 5HIKA 1N7IA 4R05A 3C0KA 3NDIA 2ZBRA 3BGDA 1X1DA 1FP1D 3EVBA 4DKJA 3TPZA 2O57A 3FTCA 3MHTA 1NW3A 3MCZA 4HH4A 3HTXA 1YZ3A 2VDWA 4V0RA 1HNNA 5EOVA 3DH0A 3NDJA 4EQZA 1KIAA 4O29A 1QZZA 1VP9A 1XTPA 2ADMA 3UFBA 3PFHA 2PXCA 5KS2A 1R00A 4MHTA 3RW9A 3PLAE 2PXAA 1R8YA 2AOUA 3FUVA 1JG4A 1D2CA 3OU6A 4GQBA 1JTFA 1EJ0A 4RTOA 1ZQ9A 3CC8A 5EQJB 1YFLA 1V39A 4XUCA 3FYCA 2OPBA 3PB3A 3M6XA 1NBIA 5HEKA 2BM9A 3A25A 4PYJA 3DP7A 3UJ6A 4AZSA 4BP1A 3DXZA 4KIGA 5EMKA 1XDSA 3CJRA 4QDJA 2ZVJA 1SG9A 4QQKA 1O9HA 1NW7A 2EJTA 2IGTA 1SKMA 2NYUA 3OE4A 1QAMA 1YUBA 3EGVA 3HP7A 2NNWB 5CIYA 4M7RA 4RVGA 3KQOA 4IWNA 9MHTA 4L7VA 2R6ZA 1NBHA 1TPYA 2HWKA 3EEYA 4GEKA 4HG2A 1BHJA 2ESRA 3G5LA 2WA1A 2XVMA 2ZBQA 4FT4A 2F8LA 1BOOA 5DM4A 1G6Q1 1VPTA 2PX5A 3CBGA 2Y1WA 3FUXA 4CKEA 5CVVA 3TM5A 5T67A 2ZIEA 4FR0A 5GIPE 3LDGA 4RTQA 2AN5A 3UA3A 3GNLA 3JWIA 1O54A 5FHQA 3C3PA 3EGIA 1VBFA 3PX2A 4C04A 5GIOE 2GA9A 2UYQA 2H00A 5KVAA 1ORIA 5DRTA 4PYQA 3EMBA 3V97A 4LWOA 5EHGA 2VS1A 4C05A 4C03A 4DZRA 3HCAA 1FP2A 2VDVE 2DULA 2YXDA 1P1BA 2ZIGA 1I1NA 2P7HA 3NMUF 3LPMA 2PWYA 4OA8A 3TKYA 2PT6A 3ELUA 3KPWA 2B2CA 3HCFA 3T7SA 3TFWA 4GF5A 4FZVA 2BR5A 1WY7A 4FSXA 3EMDA 4YUWA 5K0BA 4OQDA 5FA5A 1XJ5A 4M38A 3I58A 3TRKA 5DTRA 1EQAA 2O06A 3HCCA 3UJBA 1M0EA 3UJCA 4ZTBA 4GC9A 2CKDA 4BP3A 3OZSA 1XCLA 3UJ9A 2FRXA 4K6MA 4YV1A 4U7TB 1TW3A 7MHTA 1SQFA 4KDRA 5K0GA 2AOTB 3UJDA 5KQRA 5HZMA 3B5IA 2WA2A 3NVMB 1R74A 5F2NA 3SSNA 4C4AA 4X1OA 3HA3A 3Q7EA 4YV0A 2PX4A 5ICGA 3GRZA 3MTIA 3A26A 1INLA 3BGIA 1G60A 3QOWA 1WXWA 1RI5A 2QRVA 5ICCA 3DLIA 3UJAA 5IH3A 4X60A 4RTJA 4F86A 5DX8A 5ICEA 1UIRA 5G02A 5JR3A 1D2GA 2ZZMA 3DMFA 2R3SA 3TQSA 3KHKA 4UOEA 3G2PA 3NWEA 3B3FA 4AZWA 2C7OA 1KHHA 1XDUA 2HR1A 3HCBA 4CTKA 5EG5A 3NTVA 4PCLA 2OYRA 2ZWVA 2BH2A 3FPEA 5JUWA 2DPMA 2HMYB 2EJUA 5EEGA 3DXYA 3M6WA 5EIWA 3K0BA 2PV0A 5GM1A 5FHRA 4C08A 4DA4A 2PGXA 5ICFA 5E2AA 5K0JA 1VE3A 2JH9A 1UWVA 4R8RA 2WK1A 1RI1A 4FS8A 2ZSUA 3HVHA 2Q41A 3GRRA 5EHIA 5LQRA 3M4XA 3DUWA 5HIJA 3REOA 5EMJA 4A6EA 3AWIA 2YXEA 2FHPA 2OO3A 2Y1XA 3GCZA 3O4FA 4RTSA 2C7RA 2AOVA 3E05A 3HVKA 4OA5A 2B9EA 2IDKA 1XCJA 5K0NA 2VDUE 3KQWA 3LSTA 3M6VA 3TOSA 4CKCA 3FYDA 2G8NA 2GPYA 3EPPA 1FJXA 3C6KA 2OBFA 3EGEA 3KQVA 3P8ZA 1IY9A 3GIWA 1L3BA 2FK7A 1X19A 1M6YA 2E5WA 3CVOA 4OBWA 1ZHFA 3HA7A 3KPUA 3OZTA 4Z2YA 4QPPA 3SR4A 4NECA 2H1RA 2AN4A 1JG1A 3OCJA 5GP1A 3ELYA 5K0EA 2ZZNA 3KR2A 2QY6A 1ZG3A 4Y30A 4RTKA 2G71A 5LQJA 2YTZA 4GC5A 1U2ZA 2NXCA 3O31A 3PVCA 5EZQA 2C7PA 5EMLA 2ZCJA 5E9JA 4ATNA 2IFTA 4AZVA 5U4XA 3TR6A 2OB1A 3OFKA 3AY0A 1JQ3A 5DXAA 3OU7A 3BZBA 3C3YA 3KQYA 3ME5A 3FUUA 4FGZA 3R3HA 2IPXA 3DLCA 3OFJA 5DT2A 2B78A 1NV8A 3LL7A 4PYOA 4BLVA 5EEHA 2NP7A 1VL5A 3C6MA 3FPGA 3I53A 3ID6C 3HCDA 3FTDA 3RIEA 5CUQA 5K8VA 2O0LA 1N2XA 4RYLA 3DTNA 1P39A 3E8SA 2VZ9A 2NXNA 3SX0A 5CVEA 1QAQA 1BC5A 1VP3A 2O05A 5FA8A 2IP2A 2ZWAA 4LG1A 3DOUA 1I9GA 3AXSA 3SGLA 1N7JA 3LDFA 3FPFA 3BUSA 2ZULA 2AN3A 3ORHA 3LCUA 3ELDA 3LECA 5HOQA 1KP9A 1Y8CA 3FUTA 3O7WA 4C07A 5E9QA 3KQQA 5KYGA 3EVCA 5FADA 4HC4A 1SUIA 2P40A 5E8JA 3ERCA 2BR4A 4H0NA 3LBFA 5K05A 1NT2A 3BXOA 3TM4A 3IV6A 1FBNA 1JG3A 2PBFA 3BGVA 3VYWA 2H11A 1Z3CA 4KRGA 1Q0TA 1DUSA 1WXXA 4OBXA 2GAFA 2C7QA 1YFJA 3EEOA 3DMHA 3FRHA 1EAMA 2GH1A 1VLMA 2QM3A 1WG8A 2IH5A 2ONYA 1VIDA 4P7JA 5DTQA 4E30A 2QRVB 2UYCA 3LGAA 2JH8A 4PGHA 5E8RA 3KQTA 3P71T 3BWMA 4GOMD 3M33A 4E2WA 2AVDA 5FCDA 3UBTA 4X41A 4E2XA 5C9ZA 1G8AA 5CCBA 3X0DA 1JTEA 3ANXA 4OX9Y 2ZW9A 3BWYA 2NP6A 3UWPA 2PLWA 4KW7A 4B17A 4E2ZA 4C06A 2G72A 2NXJA 5P8WA 1JR4A 4QTUB 2A14A 1X1BA 3A7EA 4RWZA 1ZKDA 1XXLA 2IBTA 4YUVA 3PTAA 5DWQA 3OPNA 3HM2A 4YV2A 3P9CA 4EK9A 2AZTA 3DXXA 3GO4A 3TMAA 4ER6A 3TKAA 5ERGB 3GRVA 3HVJA 3P97A 5BXYA 2PWPA 4ISCA 3P9IA 5EIFA 5E1OA 1G38A 3P9NA 2ZBPA 3A4TA 1RJEA 2P3OA 4V0QA 4DMGA 5DTMA 1ORHA 5DPMA 2FK8A 1RJDA 1NW5A 4Y2HA 1F3LA 5EGSA 5FULA 1T43A 5EMMA 3CCFA 2YXLA 2JJQA 2ERCA 5E9WA 5LQUA 5LQCA 4FT2A 3ELWA 3LHDA 4RSRA 2AVNA 5CCXA 5GOZA 4R6XA 1M6EX 2YUIA 4QVGA 3G88A 4RVFA 4POOA 4E2YA 3IYLW 5K09A 3TLJA 2AS0A 2YR0A 5FQOA 4F85A 1RI2A 5HIIA 2B25A 1VQ1A 3GJYA 4F84A 2BZGA 3MTEA 3NVKI 3S68A 3R9XB 2PXXA 2QYOA 5EKUA 2ZTHA 3A27A 1HMYA 4AZTA 5BW4A 1KPGA 5B1SA 2ZZKA 2ONZA 2HTEA
chains in the Genus database with same CATH superfamily
10MHA 2IZ6A 4RKWA 3AC0A 1JYEA 2E5LB 3NH9A 4PHGA 1YRWA 4UDNA 5CGQB 1R69A 3UMRA 2I2AA 2VJDA 4X5OA 2JI8A 3KKZA 5C5CA 4YR7A 4MP6A 2Q1UA 1MW9X 5CB6A 3FPKA 5C1BA 4BXOA 3MBOA 3BWCA 4XJVA 7YASA 1NEQA 3DVRX 4P32A 3PDUA 4LKOA 4MRAA 5B3JA 3NEPX 3OJOA 4NCXA 2F9MA 1W0JD 3OICA 3QBEA 4LZOA 5HTOA 1TKBA 4EI8A 1E3IA 2XI4A 3KJHA 5GM2A 4AY5A 4ZGWA 1G19A 3BH0A 3VUEA 3WYGA 5HJ2A 1TLLA 3UK1A 4II7A 2LVBA 2PSDA 5ADHA 1AKRA 1UBEA 1AKEA 3R74A 4G0YA 1I4LD 4OO3A 3TMKA 4M1KA 3ZW8A 4U2EA 3RRMA 4H1UA 1GPMA 2CSFA 1D9ZA 1KJIA 2FE1A 2Z58A 1RAHA 1WCYA 4REQB 3WMGA 4F2GA 4O4HA 2XYRA 4TUYF 4BMZA 2JIZA 1V6AA 3ND5A 4P4NA 3HZOA 4XTCS 1DJNA 1PDVA 3BGSA 1Y7PA 1YB2A 3ELBA 2P1DA 1KVSA 4G25A 4I3FA 4MCHA 3WGZA 3DQPA 2QN2A 4R6WA 2A92A 3D6HA 1J5XA 1S1CA 4YJ3F 1RLOA 1CP2A 1J8YF 3AINA 2PL1A 3H04A 4PG7A 4J2TA 5KYWB 3EZYA 4RULA 2HFZA 5AXDA 1NFRA 3FKJA 1FBTA 4CFYA 2OCIA 3TD9A 1Z13A 2OR1L 3QVWA 2HYDA 2JLWA 4GMXA 3OIWA 1GFZA 4FKZA 2VZEA 1KJYA 3JWEA 1XL1A 2F8SA 1JHVA 2ERYA 3UT5A 4JYAB 4ZANA 5KNDD 2V1UA 4ES6A 4EYGA 1OWLA 2AI2A 2NUAA 3P52A 1UM9B 4MVJA 4QG3A 1ZRHA 1BD3A 2QUZA 3WJAA 1QZTA 1XWWA 3OUZA 4PZDA 5B5SA 2JGDB 1B93A 2DM6A 2XNKA 1GT6A 3OZEA 3TAUA 4EY8A 4QAQA 4RHCA 1L7DA 3A58B 3TPCA 3KOZA 5EE0A 121PA 1WCIA 3QXJA 4WMLA 1GJRA 3R8XA 4FCCA 1W9HA 2E85A 2QL9A 4IJMA 4Q7LA 2H2GA 4EI9A 4DR5B 1UEXC 2BI4A 4Q6WA 1ZC3A 4PSVA 4MK4A 2NNLD 2D1YA 4KLZA 4CLRA 3WSWA 5JJIA 5ADVA 1BMFA 3DGFC 4XLLA 5LZ4A 1GLVA 2A5GA 1B1AA 2FUNB 2EP8A 3LFHA 2ZWPA 1QK4A 3TZHA 3WQHA 1KH3A 2NZYA 9LDBA 3JS5A 1JA0A 1EG7A 1Q0RA 1TQHA 4WN9B 2C07A 4J7XA 4NTZA 1SB9A 2KEIA 2FSHA 1VSTA 3LI2A 4B7CA 5EKTA 4RTRA 1X2BA 4HLUA 5BQXA 5I4IA 1J1UA 5HJ5A 1EVQA 4LRXA 4DCCA 2IHJA 3N2KA 2UUPA 2PLNA 4P58A 2GJ9A 4A0GA 4DMRA 4HGYA 1ODCA 1RI4A 3O4JA 2HRDA 3OU2A 3R6TA 4ZK2A 4MIEA 4XJTA 5J4YA 2X1VA 1KP2A 2QN6A 3EXHB 1J7KA 2FP4B 2WKRA 4I9NA 3HVIA 1BNCA 1H3FA 3K0CC 3W78A 2R4QA 1I2AA 2NMVA 4KR9A 3ZE9A 4OFBA 4ZCTA 5GVSA 2BKEA 2Y66A 4HY3A 2BCJQ 3KLOA 4DPKA 4ZEXA 3ZDYB 2I9KA 2GBLA 1ZIOA 1ISGA 4YT2A 2DUMA 1C3OB 2BKXA 3UXEA 4NYIQ 5IF9A 1D0IA 2VH2A 4FN4A 4V39A 4BGUA 2F43B 3FPJA 4W8GA 3R76A 5JBNA 1U6JA 4R5HA 5BO5A 4KJZA 3K9HA 1O7JA 4NOJA 4V03A 1EFDN 5A71A 2IXAA 2R6JA 3NIFB 2QRLA 5BMVF 2QN1A 3CGGA 3C5VA 2O8FB 1RXYA 4GOOD 3SJBA 1UBCA 2OCLA 1BYUA 4KGVA 5B6PA 3B48A 1YWGO 1HDYA 1GG2A 1KI6A 2XQKA 3Q7RA 3WTCA 3FVTA 1PT8A 2CLOB 1T4MA 2XPCA 1ZESA 4LYAA 4YLYA 1GTG1 3M6IA 2RKWA 2CY0A 2ENWA 2QL6A 3DQQA 5F2KA 4H0CA 2ZYHA 2JJ2D 5F77A 1QG0A 1AGXA 2GAAA 5IBQA 1J8DA 3QG5A 1E4EA 2FSIA 1PJRA 2H8RA 2NTEA 2P4QA 4XX0B 3PNSA 4LF5B 4FIDA 3GLKA 1XZMA 1UJ6A 3G0DA 3PNMA 2Q62A 1WU8A 4HMOA 1CX9B 1HSOA 4M0PA 2JGNA 2KS6A 3ZWNA 1ESEA 4QU9A 1G7SA 4L6IA 1S02A 2HFJA 1AS3A 1DAMA 5LYJF 3S2SA 5CBPA 5HX7A 3Q9UA 5I8ZA 3FBWA 1M0WA 4HNSA 1EFRD 1RHUA 3KL2A 3L0YA 3G5AA 3ZHBA 3GZCA 4JJGA 1T0BA 3VOBA 4B35A 4KKVA 5I9MA 2AH5A 1RI3A 2O50A 3LYAA 1Q3TA 4IBOA 3D5TA 3PI6A 2HJRA 1E7YA 3Q8XB 5EXPA 4BV3A 1DUVG 3E23A 3D3QA 3PFGA 2XA2A 1NSFA 2HO4A 1PO7A 5JI3E 4L27A 2IOFK 2FRDC 4HB2A 1RM5A 2AFIA 1NMYA 4HNAA 3UFXB 1RLMA 2YV1A 3GBPA 3M4ZA 3B2EA 2ORVA 3ZXSA 3K2IA 2X4GA 4R05A 1J21A 1IK6A 4Z0PA 2CNBA 4W8HA 3PFIA 4N0EA 1MP0A 1N1MA 3TSAA 1QXSA 2GSWA 2J45A 4KODA 1NW3A 1Y7IA 4CYMA 5KSWB 4KQEA 2XKBA 4I8TA 2PMWB 1NVBA 4QG7A 2DU8A 3GNQA 3TVTA 1XTPA 3AUYA 3BN3A 3BRWD 3PFHA 4XFKA 2C2YA 5JNSA 4Y2YA 3WIEA 1R8YA 1GEEA 2OEPA 4GQBA 1T91A 3W8RA 1BU8A 4YJFA 2P2SA 3NT4A 3AW9A 2AKAB 1DC5A 2LIVA 3LXMA 1GNPA 2QL5A 4NZNA 5T57A 3UJ6A 2CGEA 4UHKA 3ZV6A 3DKVA 4IXMA 2BSAA 1JRLA 1QWSA 4KV9A 4Q4JB 1QRAA 4RJLA 3U7JA 3UT6A 2NAPA 2WI8A 3HP7A 5F7ZA 5B7PA 2YY5A 1H5UA 4BAGA 1BE6A 2NYVA 1WD5A 2FPPA 5FV4A 5D3KA 1YDHA 3AWDA 4CMIA 1C5KA 4CIAA 2NU6B 3EEYA 4ZARA 3ECCA 1M83A 3I6MA 1BFUA 4P81A 3STVA 3ZGLA 2JF0A 1P4GA 5H7XA 5B58T 2YYYA 1LRLA 2P9FA 1P31A 3QKTA 3UBTA 1EWTA 1VPTA 1C0LA 2PFGA 3E4CA 3JXDL 2CL0X 2V5UA 2YFYA 1J0CA 4GICA 5FRDA 1Y4AE 4BFWA 4B87A 4XDGA 1WNFA 3WL3A 2BGGA 4Z1MD 1PQUA 1R4NA 1XMIA 4DA0A 1W5SA 3B6KA 3DBOB 4O4JF 2DFTA 5AICA 4Z4CA 3D4NA 2DEUA 1X38A 2VS1A 1R4MA 2EBYA 4EO4A 2G88A 2IWRA 3CZAA 1G5PA 3CSDA 2AD5A 3PWKA 4EA9A 1GDTA 4IIUA 1JX6A 3KPWA 2AQ8A 3QM1A 2AMFA 5FB3A 4PZPA 1Y3BE 1IIBA 5AKGA 3W7VA 2VQ6A 4OSEA 3P0RA 1JEDA 1QIGA 4IFTA 3UCFA 2MR5A 3S2IA 2P67A 1XRPA 1XXHB 1LQTA 4PLWA 4HS4A 2PFSA 1PEAA 2WABA 3UJBA 2RGUA 1USKA 1YR9A 1N2OA 1X7ZB 5F1OA 2CKDA 1K68A 4QUEA 1FDWA 4D9HA 3BMXA 3EMKA 5FL3A 1RZVA 3LH5A 3IMKA 4PSUA 4JDUA 1SUBA 3FN4A 3QTBA 5DOZA 4MPRA 1OZ0A 2Y1KA 4W7IA 4BNTA 4ENUA 2QI9C 1C0EA 2KQUA 3V8EA 2D4AA 4AAYA 3O3NB 2JHGA 3ZZTA 4Q1FA 3PKJA 1C9YA 1LW6E 5F7JA 4A0HA 3IVMA 3GZJA 4C4AA 4RHTA 1A4IA 2B5OA 2IKQA 1PGJA 4LRSB 5DNEA 5FDFA 1KARA 1KY4A 2QSJA 4YV0A 2PX4A 5ICGA 3ESRA 3OT1A 1RC1A 1JZQA 4RW0A 2WKQA 3KV3O 4RF2A 2WLSA 5FOWA 3QEJA 2V5VA 1C9DB 2EKPA 4N5MA 4KYTA 4KSBA 3T06B 2VYFA 1NLFA 4ZQBA 5JD3A 2HK8A 1D2GA 3RH0A 2BNOA 1JR3D 4Y0VA 3BIXA 1JJBA 2WWWA 3BRCA 4OLHA 1TUEA 4J1TA 1E9SA 3VNBA 1K6EA 3PDCA 2VPIA 1Y42X 4D9BA 1TJPB 3FF1A 1NNLA 2HA2A 1U4NA 1WPRA 1MRSA 3N2EA 1N78A 1E7WA 1FRFS 2OUIA 4R4JA 4CTMA 4G41A 3TZQA 1IZYA 3LXRA 3Q7SA 1N6HA 2KMLA 2BGWA 1SC3A 2XVYA 3KYCB 4V3CA 2HUNA 5DYTA 3IS3A 4XPIB 2RGAA 1UWVA 4D4MA 2N9UA 3ZD8A 2D1TA 4K5QA 3GFTA 1CUWA 3JVIA 1K3UB 3PL1A 3RWMB 1JB1A 1PZFA 1M75A 2W43A 2Y1XA 5TEWA 4B75A 2GCOA 3BF7A 2CLFB 3UENA 4AB1A 2O2ZA 3ZDAA 3JAWB 2GXUA 3AETB 2QT1A 3M6VA 1EINA 2B61A 1ZINA 2G8NA 2JGMA 3EEQA 3NM5A 3EGEA 4NAUA 3W4JA 2CKMA 3TBHA 3ZWVA 1E2UA 2UXBB 3GIWA 1M6YA 4BU1A 4CKXA 5DBEX 2AD1A 1XA0A 4EPVA 1X2LA 1B74A 1NPDA 4CLDA 4DLZA 4I2NA 4RELA 1U7XA 1FTWA 1NI4A 1ZGBA 4B3IA 1SXQA 1FFYA 3G49A 1LSOA 2NVOA 4HDKA 2AN4A 4NYMQ 1ZEJA 4PF1A 3LMKA 3OCJA 4GWKA 2V7GA 3L79A 3COSA 3PQ7A 1Z2AA 2O6LA 1XVIA 2VF8A 3R3SA 4IDEA 1IQUA 4OG2A 4YDSA 3G59A 2GEDA 5FL7D 3RCBA 1LRKA 3WAKA 1DRUA 3CG4A 2BNNA 3OWQA 3OJFA 4TV8F 1EA5A 3JATB 4UXJA 1WZUA 2FUKA 2Y0EA 4MVJP 5LWQA 5H8WA 4EJMA 2Q5FA 1FZQA 2B3DA 3K6SA 5ALXA 3RFUA 5JZSA 1KY2A 4FGZA 1TAUA 1DEXA 3IOBA 2GKSA 3TR0A 3H4VA 2JHFA 4KQHA 3VXKA 5IF3A 4JI6B 4L8LA 1XR3A 2AC4A 1M0SA 1VL5A 2XUQA 2ZRBA 2VQDA 4JWKA 4S3MA 4YK7A 1H94A 4FQ5A 621PA 1JDNA 1V43A 3AR9A 3I76A 4RYLA 2L82A 2VJMB 4W6ZA 4WKPA 4ZD6A 4LA4A 3K4QA 2VZ9A 4AN0A 3TSOA 2D6FA 1FU7A 2OXCA 3ESCA 4R0MA 3Q2KA 4QL3A 1HE3A 2WYWA 2Z0MA 2O59A 5ILOA 4NPAA 4TL8A 4Q16A 5KDOA 2X42A 2WHYA 2FSGA 3DOUA 5M34A 4B3DA 4HEJA 5TPWB 2R0QC 3Q88A 5HOQA 2SCUA 1Q0HA 1SKUA 1F0PA 4ZI2A 5T4HA 3KQQA 3W8FA 3FOCA 1HQKA 3MSCA 4JROA 4MVJM 4OXQA 3ZTYA 4AROA 4ZOLB 3U5TA 4Q47A 1WOYA 5IFKA 2JVJA 4JEUA 5EZYB 2IT1A 5ABPA 2H4XA 2YRWA 4M1OA 3VV3A 1UKYA 1CF9A 4ZCRA 4KRGA 1XZAA 2Q4DA 4ILKA 2QLBA 1WNTA 5KQLA 1KNXA 3CWQA 3PA6A 2J9ZB 1KRXA 3FMGA 5ALHA 2QRVB 3JYNA 5FBZA 4DEYA 2YDYA 1EVIA 2W6JD 4GOMD 2RBGA 3F96A 1Y1LA 2CB0A 3K9BA 4UD6A 1NVMB 3DDZX 3KRTA 2V9CA 3WXMA 3AF6A 2VBCA 3GVIA 3X0DA 3STYA 2HREA 1W2HA 1NJFA 4MV6A 5ITVA 4R83A 1YQ9A 3ZK9A 1GNSA 3DNPA 4B3XA 2RHCA 1GQ2A 4MVJI 1JR4A 3DVQX 1AGPA 2OCAA 2EOAA 1DC4A 2Y67A 1P2GA 1SU7A 1Y9JA 3D6NB 2C9YA 4K40A 1Z38A 2UV8A 2GOYA 3PTAA 3GN2A 4ZI7A 2WIKA 1OLSB 4EF6A 1Z5GA 1DIAA 1PTJA 1IU9A 2HLDD 1ENPA 2RAFA 2NQTA 3G5UA 3ONNA 1KOLA 3UICA 4EWLA 1WQ1R 3U7HB 1AMOA 3F9IA 3BXGA 4D80A 2CL7X 2X9NA 3HI6A 4J16C 1ORHA 2G1JA 4WXMA 3U3XA 5KSZA 2H4ZA 5EE5B 2P2NA 5E4YA 5K2MA 1RZRA 1G18A 2B37A 4QOGA 3NHYA 5DHAA 4L22A 2CLKB 4URVR 3ODGA 3RRJA 2X7JA 3ILHA 1NUTA 1UDCA 4D9JA 1N5DA 2ZSDA 1D2EA 2A5JA 2NUPB 3H87A 5DHQA 3ANMA 3GP8A 4DUYB 3COVA 1JYSA 3M8KA 1RU3A 3C43A 3R44A 4LXGA 3KKKA 4G5XA 4NHOA 4EJ0A 5JWRA 1M2OB 4KQ2A 3KQUA 3RIYA 4W5HA 1QR6A 3PRHA 1PV4A 2FKAA 2Q99A 1BRMA 2A3RA 4NZYA 3RU2A 4LVUA 1YZNA 2VUIB 3WO1A 2Q5EA 1E1QA 2QMHA 1U28C 4K05A 3R9XB 1UFVA 5SY9A 1QQAA 3VI4B 1KJ9A 2GXAA 3O1HB 3MJFA 4GWLA 1G98A 5HKKD 3WGLA 2FQ1A 1VTKA 2M1XA 1TGYA 2V7XA 3M4NA 4UAJA 4M88A 3VR3D 3W3AD 4CTJA 5TQJA 3JASA 4G07A 5L45A 2JJ1A 1UXCA 3DD5A 1USWA 4JUFA 4J2HA 1P9LA 1RWMA 1L1MA 4CTOA 1XTSA 4RVCA 3DONA 4RIEA 5IBCA 1R10A 2AXQA 3P2KA 4UW9A 5EP4A 4RAQA 2A0FA 3KDPA 3IIEA 4KEAA 5EKXA 3UY4A 4I4TB 3BMOB 3FYSA 4JH0A 4ZU6X 4KMSA 3QBJA 4TLCA 4FHDA 3C8ZA 3VOAA 3RSCA 4YCJA 2PUDA 2XWSA 4RLHA 1E32A 2GAOA 2GK4A 3EFEA 3NKLA 4BY9E 1BYIA 2WZQA 1Z2NX 3HV0A 2EG5A 2O8BB 3LX6A 1DU4A 1ACLA 2YJ4A 1GRCA 2FZLA 2ZS8A 2X0JA 4PFQA 2IZ1A 4Y6RA 5EP3A 3GEEA 2ZUFA 1X7YB 3L7OA 1CZKA 2EW8A 3ZQUA 3CR7A 4ZQHA 5IN5A 3QUCA 4FYIA 4HYQA 3WV4A 2LLVA 8OHMA 3L6CA 3AZOA 1T5SA 2HF7A 3IAS1 5CAEA 1KF0A 4BMXA 2D1RA 1KGSA 1JHUA 4LJ7A 1UJ2A 3KUCA 1PVVA 3SQXA 2C4VA 3W05A 4L08A 4P4SA 2XTMA 3E9DA 2ZBEA 4PW0A 3B89A 4JOCA 2VL7A 3QLVC 5IJZA 4YRGA 2IOYA 4HAUA 4S35A 2NZJA 1GT0C 1J07A 1VYUA 3HABA 4POAA 2IV2X 4PO3X 2I6GA 2H1HA 3MILA 5EP2A 3E3LA 4ER5A 3A6GA 3FOWA 4D0RA 1HKUA 3S7TA 3SZOA 3WB2A 4MEBA 1UPAA 2C2BA 4JHLA 3SP1A 1Z4JA 2DLNA 4QOSA 4AX8A 4B43A 2ZYRA 1JBKA 2BGKA 1L5FA 3EUWA 3V8VA 5JNUA 2DHQA 4I1YA 1L7MA 4IF6A 5JSHA 3PXPA 5E7JA 3I4CA 1A9TA 4TVOA 3F6EX 3ZOZA 1GU1A 2BBOA 3P2JA 3TF5A 2J0UA 5I7RA 3NR2A 1P75A 3I05A 2JLXA 5DTIA 2WY2D 1SQ8A 1L2TA 5EVJA 2P2GA 2NYRA 3QA3E 1RD4A 3WDSA 2YNMC 4K6HA 1AT1A 4GPAA 4MGHA 2E4UA 1O4WA 4O2AF 4IHKA 1NR7A 4IOJA 2YYAA 1SOWA 2DZDA 3DOIA 2GN1A 3R24A 4GPEA 1A5BB 4K3UA 4RZIA 5AI8A 4DCTA 4EVSA 2NTVA 5C7IO 3FLAA 1HM5A 5J58A 1V96A 3FZQA 4KWHA 5JWHA 1GOTA 1WTAA 5KJEA 4RMIA 1YF3A 3QVMA 5K5EA 3LCMA 4KDCA 1NHWA 1DARA 1TM3E 1L8XA 3H65A 4BLRA 1RP7A 3F49S 4N4AA 2C95A 1LPMA 3FPLA 5AVVA 4DV1B 1KEWA 3RHZA 1MZPA 4E4YA 2D1SA 3M83A 1T0IA 3GLFE 2GLTA 2W6QA 1C4KA 1V11A 2JJ8A 2RHBA 1OH6A 1J9GA 2HH9A 2G25A 2Q1YA 4Q02A 2IZ5A 1PSZA 1R7RA 4E2FA 2DFVA 1MC1A 1R4ZA 3CR8A 3ZOKA 5LD2C 4CG1A 2Z6AA 2MSNA 3VPBA 1IXRC 1T9DA 5BY2A 3BCSA 3D4IA 3NV9A 1R0KA 3TEJA 4F91B 1M72A 1NZDA 1LDBA 1X1TA 2IHUA 3QA9A 2JFVA 1JA9A 3B70A 1IVNA 2ZFUA 1SULA 4NCIA 4QFMA 1QX3A 4ROTA 5FKJA 3D3KA 2FAXA 3MJEA 4EMSA 3P0JA 4KL8S 1O6GA 1QYXA 3KEMA 4EGAA 3FVQA 1A9QA 2CD9A 2J7KA 3GLSA 4S1NA 5THKA 3HKEB 2PKYX 1E63A 1BHQ1 1IZ0A 4FD2A 4LHEA 5FLKA 3ROZA 2ORYA 2ZQYA 3QXHA 2I03A 3E9ZA 1V6CA 1KZ4A 3ZXYA 1QK5A 3I2JA 5JAZA 1VXRA 5LUAA 1DRWA 1O0BA 3MFQA 1QIIA 5ESWA 1B2RA 2OQIA 2I65A 1MC5A 3QVKA 3ER9A 4BZZA 1XD9A 2WIUB 1KJZA 2NU7A 5IKOA 2RK4A 3OPMA 4Z7QB 4KIWA 3FPHA 1P1HA 3PC8A 3EEBA 4RWEA 4X1YA 4OP3A 4KI0A 5HFNA 1R63A 2XSZA 1H9CA 5AUOB 1K5PA 3ETDA 4E08A 4QO7A 1JPNA 3AHDA 4M1WA 4HB4A 4MP8A 2ZAOA 4X54A 3I5YA 1U3DA 3VGPA 5AOVA 1LZLA 1N8KA 3LY8A 1G0OA 3W6PA 3LKVA 3QHQA 4RFLA 3EVFA 1GZVA 1R12A 3FNIA 1X0VA 3K9LA 3FTEA 4AJHA 2LWIA 1Y4SA 3M2TA 4D92A 3H2JA 3NUGA 1I36A 1TM2A 3EIQA 1VGRA 3QU7A 1Z9BA 3U4QB 3K5IA 1MDBA 1RRFA 4W5RA 3MOGA 5GJCA 5DN6A 3ZJ4A 2WF7A 1OKKA 2IA5A 5LC1A 2G1PA 2OHHA 1Z8FA 4LDAA 4IDHA 5EUBA 3PF9A 4QUBA 3RJTA 4CMJA 4E32A 4PBTA 3NTXA 5JJBA 2EHDA 1V3TA 3O93A 1X3SA 1DFGA 4FX2A 2C7BA 3E1SA 1YJAA 2HMUA 2H2AA 3O03A 3LVQE 4ED9A 3EQ9A 1U1EA 2RHOA 2Q2NA 1LDEA 5AW8A 3PUIA 4ND7A 4HDSB 4DN6A 3IDQA 2IEAA 1UBLS 1ADFA 3WIBA 1CUSA 4F0JA 2YVAA 2DUWA 1HTWA 6LDHA 1X1EA 1L0BA 2J9GA 2PLAA 3FYHA 5FPSA 3M3HA 1ZQ9A 5D7NA 3TMYA 4EMBA 2CUZA 3RYHA 3VU8A 3W06A 3EC1A 4GAEA 2C3MA 2QG6A 4I50F 3A25A 3WAJA 4WX2B 2PUCA 5EMKA 5EJMA 5SZHB 4BOYA 4KN8A 5J47A 1HE4A 3MINA 1LJLA 3ZS9A 4P34A 2BFWA 3UMFA 4ENWA 2NYUA 4EW1A 4J1XA 3RNOA 1Y33E 4QE3A 4JR1A 1TK2A 4MR7B 3HDHA 4ZRMA 3O73A 2KWIA 1NXTA 4FFNA 3RSGA 2R84A 1T8YA 3G3EA 1ADBA 1GUFA 1ZOLA 3G5LA 4OGFA 1S7GA 2WA1A 3H9CA 1CBUA 3M5PA 4FUTA 4AT1A 5KJ1A 1NA5A 1WIWA 4B4WA 3FKQA 4RH3A 1XG5A 3HA2A 4AJ4A 1XMXA 2X4IA 2B7CA 1K8XB 2C84A 3BA6A 5ALIA 2QTWB 3DZDA 4ARAA 5DJ5A 5LU9A 4ZQGA 1ULSA 1H4QA 2INGX 2AMVA 2I34A 3IBGA 2C4TA 2V97A 5E38A 1M6VB 3KD3A 3GGGA 5H0IA 1QM5A 2XT6A 4KR0A 3V97A 4GDFA 1NN5A 3M6MD 5KX5B 3ZHTA 3A9SA 4R68A 1I30A 2NN3C 3JQ9C 1JFFB 3HCAA 3ADKA 3CISA 3HMKA 4FLFA 5JT1A 1T2AA 2X5XA 1ZJZA 5D86A 4CQLB 1Y5MA 1PR4A 4G0UA 3NMUF 1QGOA 2HBRA 3FPCA 5IRCD 2BE7A 1MLDA 1Q1AA 5BRJA 3K0SA 1Q2UA 2E4AA 4FZVA 3IBTA 3H3FA 4QFCA 5IDVA 1SXJB 4M49A 3SC4A 2QTZA 2BM0A 4E5VA 4DV4B 4JLVA 1ZDMA 1W96A 2X13A 2FHSA 1M0EA 4OQMA 3Q8KA 2IOFA 1WULS 3R77A 1JT2A 1JL3A 3IUYA 4DPLA 5I8PA 3BMQB 4RPIA 5CB4F 2DQ4A 2PN1A 3ZU3A 4YV1A 3L1KA 3DDCA 3I8SA 3EUFA 2AOTB 3AM5A 4O25A 2BC9A 2P9QA 4M1TA 3BDNA 3B5IA 4PU0A 1P6XA 3AOGA 3VR5A 4JQDA 2C4MA 1OX4B 2JLRA 5E3IA 3GFRA 3SEQA 4MV3A 2OILA 3OZWA 4YQZA 3Q41A 3EPJA 1PGNA 1FRQA 1G60A 4ARSA 3CB4A 1DAEA 1T4CB 1WXGA 4FYMA 4L4XA 5IH3A 3UJAA 1E5XA 2YXBA 3T3DA 3EZXA 3FCUB 3Q6NA 5DGDA 3HE3A 1UBTS 4OMFG 2YJNA 5LZ8A 1OU0A 1MBZA 3EIEA 3MT8A 4N0DA 3X44A 4BNYA 2ZZMA 4M2LA 3FI0A 1SCQA 3DSRA 3ZGXA 4YCAA 5EYPA 3Q5EA 3V55A 1KHHA 3LK7A 4K9DA 1KORA 3KUUA 1UTXA 1LH0A 5ITSA 1VSQA 1XCGB 2QVYX 3M34A 5JUWA 1FSSA 2DWQA 4G0QA 3V4ZA 3HVRA 3R6GA 4PG6A 4URZR 1P60A 1CT9A 1D1TA 2GK7A 2Q5HA 4DLVA 5LOVB 2OGSA 4EA7A 3ZNOA 4EJSA 1RXSA 3DKIA 3C3BA 2XLBA 3DYVA 3I92A 5CD9A 1JDSA 5CEFA 2V7VA 1D3AA 3MMPA 4HLQB 2R4TA 3P9SA 1S7EA 3M4XA 4M9SA 3ASZA 1C7ZA 4R8LA 3RAPR 5HQ3B 1M5RA 4ZOEA 4H2DA 5GZ1A 4QLAA 1C3XA 1E6EA 1XAJA 5F1PA 1RLIA 3BTUA 3C15C 4LFAB 2PLRA 3RVQA 3BAZA 3HRHA 2EFDB 2YHIA 2CLLB 3U0VA 5A4IS 1HT1E 5JQGF 1P7YA 3TINA 2CV2A 2VWPA 4HAVA 2V4MA 5JARA 5JVDA 1U3FA 2C9CA 3G0IA 1NFFA 2RHMA 3H0EA 4N3GA 3EQ7A 3I6ZA 3M1LA 3ETLA 4LXIA 4DV0B 3HI4A 3SZRA 2ZBFA 5KHLB 6YASA 1JG1A 4C2TA 4GX1A 1GAQA 2HDNB 1CLEA 2W6NA 3KR2A 2DCUA 4EKEA 4H7JA 4KREA 4PXYA 1GCGA 2XUAA 3IX7A 1R37A 3D02A 4Q37A 3L05A 1QHNA 1P18A 4AF7A 1A50B 2IFTA 2P90A 3CZPA 1XZNA 2VT2A 4XD2A 2FLKA 4C4SA 3OFKA 4QXPA 1EK6A 2EIHA 3GLHE 4KQ9A 5DXAA 2QTHA 3QELB 1YR1A 3QITA 4MI9A 5IC6A 1MQAA 1RM0A 2R44A 4TSKA 4WK6A 3SC2B 4DZTA 3OFJA 2J3HA 4NZZA 1L5LA 3NORA 3WLKX 1SCUA 4BLVA 3OTOB 1JHYA 3GJ0A 1QH1A 3ID6C 3G2KA 4MEAA 2IPOA 3FTDA 1T9BA 2WINI 3WRXC 4DDHA 4ARIA 2C42A 2AG8A 1BKDR 2O0LA 3G85A 3HFSA 4Q0MA 4RMNA 2BEVA 5K4AA 1J0BA 3OC0A 3QQ6A 2I2CA 3IQZA 2X0KA 3EULA 4MUIA 1ECGA 3CLSC 1O0CA 4J7AA 3A4LA 3IPYA 4HDNA 1FXWA 4TXHA 4UU7A 2YWXA 5COAA 1X87A 4NF2A 1UFQA 1OBOA 4X4GA 1Z2DA 2Q1SA 4FE3A 4LZLA 5CEEA 2BFPA 1Y8CA 2GWRA 2YHSA 3BRQA 4IVPA 4TXLA 4HNRA 3LUDA 3LFPA 5ES3A 3IPAA 3TEMA 1DV1A 5L7TA 4G89A 3AHFA 1XEXB 1OFIA 5EIBD 4D7AA 4I3HA 2LYLA 4OB6A 4UMDA 3L1JA 1E9RA 2XCSB 1NUSA 4OLFA 2ZB3A 3B60A 2YJTD 2A9KA 3OVMA 3GJRA 5HE8A 4XWWA 1XN4A 1P45A 2JIRA 2O3JA 4LVOA 2BFNA 4M54A 5BQOA 4FB4A 8ADHA 4KYVA 1L5KA 1VLMA 3RWOA 5GAJA 1WG8A 3VPAA 1RMQA 2P5SA 3UMVA 3AY7A 3OQOA 3PU6A 5E8RA 3N8HA 2Q8PA 4NNOA 2G4LA 3AEKA 4R71A 1V5EA 1F2TB 3IQXA 4S05A 1QE5A 3NM6B 4KE9A 1E5LA 1G17A 1CQWA 3ESZA 4J94A 4MWGA 3S2YA 1CUJA 1R8JA 3LW7A 4Q4AB 1N1EA 2R87A 1SKQA 4OJQA 1YC5A 5KPDA 3HRKA 2NXWA 3FLMA 4KW7A 3GGOA 5H83A 5FUQA 3HUDA 4NXNB 1A27A 4C06A 4HGRA 4KO4S 1Y80A 4RSHA 3V1YA 1E0KA 3V3TA 3ZV7A 1YBVA 4FQ8A 2QLNA 3S44A 2DY1A 1I10A 1A3CA 4AQYB 1PUJA 1ZK0A 2ZUEA 2QTVB 3UHFA 1FMJA 4Z5XA 2H29A 1KXJA 4P7BA 5EVCA 1NIPA 1IY8A 4ZO4A 5TVGA 1NVFA 3GT7A 3TKAA 3BM5A 2UUCB 1CF4A 4ER6A 4I99A 4B5LA 1AD2A 1RHJA 4D42A 5JC1A 2O3UA 1QBKC 3AP2A 3EAQA 1A4UA 4C0QC 2NSYA 2DE0X 3P9NA 1K86A 1Y6ZA 3QPWA 3C6XA 2D5CA 1RFLA 2VAPA 5CHEA 2DSTA 5JYBA 2ZRIA 3LLSA 3N2NA 1N32B 3PUYA 1F2UA 5CCXA 4JKOA 5KTNA 1T0HB 1CB0A 2XODA 5HDBB 1VJ5A 1X8KA 2JIPA 3C1OA 3WIVA 1LUAA 2HEIA 1SQ6A 2RGWA 3EY4A 4G5GA 3PFNA 4QDZA 4ZU3A 3VMMA 4POOA 1LLCA 3U2QA 4LE1A 3DM5A 4XQ0A 3A04A 1PEDA 1Y89A 2B25A 3GJYA 4HN4B 4CN8A 3F2VA 4YAKA 1HDGO 5F64A 3OEHD 2YBEA 4JAVC 2L0XA 5KBYA 3ZH9B 3DC2A 1G6KA 2R00C 3KS9A 3K94A 2P91A 4UPDA 1T3TA 3WK4A 3DWFA 4BX3A 5I9TA 3R7NA 5IKPA 3DO8A 4CNBA 2UXCB 2AMJA 4C4TA 1SB8A 1FUEA 3CEAA 4FYYA 3FNGA 5A03A 5KQSA 3TG8A 3F9RA 2I6TA 2B1QA 3RZZA 1AKVA 3V2IA 3VBEA 1EHIA 1SEVA 1AQUA 4A73A 5J2UF 3IR6A 3RC7A 3ZIAD 2EC5A 4LF8B 1NLZA 4NONA 2I3ZA 4HMPA 3UJ7A 1E3JA 3GF4A 2LDBA 1PF7E 4TMWA 3W6UA 4MDFA 1B43A 4NSNA 2YXNA 4ZPXA 5L4NA 3B52X 3ON5A 1XPOA 3F6PA 3Q5DA 3RC2A 4MYHA 1OXXK 1U1DA 2WWFA 5C35A 3FOBA 2WU1A 4EG4A 1HTTA 1MC4A 5FBHA 3JZIA 4B5KA 4CF5A 2XJ3A 4P4LA 1W76A 1NUQA 3MSXA 3LBHA 2CJPA 4GLLA 2XOKD 4ARUA 5IHPA 2CMHA 1E0JA 4D02A 5JYEA 4DBLC 1MA0A 4BWYA 1RP1A 3BZUA 4S2UA 3K1AA 1QPBA 3B1JA 4J90A 5AVWA 3MB5A 4D44A 1I4WA 4JLOA 4AJ1A 3ZNNA 4GS5A 1WCIB 3T9EA 3EBLA 1JWBB 5J4VA 4UTZA 1EVYA 1LW7A 1O5IA 3QNWA 4NBUA 4LTNA 1D2RA 1GLNA 5IDYA 4DSTA 2ZDGA 4F6LA 1E3WA 5JCJA 2AQKA 4LJ8A 1WB4A 2X5KO 3JX9A 1NWCA 4CR8A 3H5VA 4MQ4A 3QKWA 2F48A 2ZE6A 2YASA 3HCEA 4PFSA 4Y9UA 5IBRA 1PK7A 1VLHA 3LVRE 4E1AA 2VHVA 3EN0A 3OX2A 2REBA 5BYJA 2D5VA 1WVGA 4MZDA 3UB4A 4DTIA 4I8XA 3WZ2A 2JLQA 1XJ0A 4G67A 5C34B 4GG1A 3MXOA 2JL1A 1QR2A 1LFAA 1ZUHA 2XWQA 1YACA 1JSCA 4AD8A 3A28A 3C7AA 4XD7D 3IP9A 5FORA 3VZQA 3G5TA 3IKVA 2WQZA 3U7IA 2JG3A 3V2GA 1BXRB 3I01A 4O1HA 1RJGA 2G08A 3NEJA 1LI7A 2JCVA 1F38A 1MA3A 1QO0A 5JO9A 1AO3A 3H9EO 1Q7TA 4K46A 1FLVA 4KO8A 3AU8A 2ONKA 2DETA 3AEYA 3PQCA 4UE2A 2NYAA 2WIFA 3DTTA 1R5OA 3WK9A 6AT1A 4L85A 4HQFA 1OV6A 1UFKA 4RAOA 2CFRA 1IJKA 5IU6A 4LF6B 3FHOA 3SJAA 4N8DA 2F90A 3SJCA 3L1UA 1LDMA 2PO5A 2XDQA 3DT6A 4CG3A 1SHTX 2Q5LA 2Y2UA 4RV4A 5LB2A 4YAGA 2C2HA 4WNIA 5REQA 4NG4A 4RLQA 1KKLA 3KYDB 1ZGZA 4P7GA 3SHTA 1NW8A 2I4NA 2O1XA 2I2FA 1HORA 3GFVA 3J81A 1NMSA 5AVTA 3RVBA 1MOQA 4XGRA 2WSSA 4P35A 5J23A 1L1EA 3TDKA 3WL4A 4ASUD 4F93B 4UVGA 5DBIA 4OHYA 2X77A 1T8UA 3K09A 4JI5B 1XMSA 3MGGA 3P2OA 3ZNPA 4CQMA 3SQWA 3BG5A 1GGMA 1QMGA 4KXNA 3TI7A 4BFUA 4PRKA 3DHWC 4QGAA 5ERXA 1PUXA 1WHTB 4LCJA 5I4CA 4W9NA 3E5NA 1DJOA 1GXSA 2ZAMA 4RXMA 3E9EA 2OV1A 1MH9A 3ENNA 3IMGA 4U5QA 3CLCA 3EGWA 4GX5A 3V80A 1DJLA 4UBOA 2GGSA 2IPMA 2R8EA 5FX2A 3QW2A 3WSTA 5KWVA 1JE1A 4H7FA 4PYIA 1N4AA 2IYVA 1Z36A 2Y6VA 3VR5H 4UQLA 2VYCA 4U4AA 1SVUA 4I55F 4WKOA 5F9MA 3R9KA 3F3SA 5FOVA 1S4QA 2RAPA 3VO8A 4GBMA 3MTGA 3V7WA 4CL3A 1L4NA 2XXJA 1V4BA 3JAKB 2QORA 4QTZA 4URYR 3IMEA 2D7DA 3JYPA 1QYRA 1XQYA 2XMZA 3CY6A 3IHWA 4QPDA 1U8YA 1NONA 4DE8A 2J5XA 3G2IA 4LECA 4MUGA 3N0TA 4F5ZA 4UTPA 2F55A 1L7VC 1L5ZA 4DM3A 4OFZA 3HXQA 4CMEC 1GYQA 2WFLB 4FFBA 4U39A 3BXXA 4JUCA 2NXEA 3IP6A 1YE8A 3TH5A 2MINB 4PN7A 2VEOA 4CEIB 3ZHSA 1XRMA 5CW1A 3PRKE 1I33A 4G0MA 5BN5B 1B3RA 3F4KA 1PTJC 2O2GA 1DG3A 3QFFA 4RGQA 2VKTA 4O4LA 2A30A 1UMBA 3O3CA 5D51S 5TPZA 4ZICA 2GZSA 1C8BA 1MTOA 1NVDA 4KNWA 4FW8A 3RK1A 1ZW6A 2R7MA 2VP2A 3I2KA 2GYVA 2P35A 2PPXA 3RYIA 4G3XA 4KWTA 4CKBB 3C70A 4AS2A 2L8NA 1J70A 1FSFA 1OCEA 5KOHA 5COBA 3S5UA 4X6XA 3DOJA 1WZCA 3QSYA 5THQA 1XZHA 2HN9A 4PU3C 3E0QA 4OQQA 2Q0SA 2YHUA 4QQRA 1EX7A 4CV1A 3B8EA 5CITA 1N2SA 5DNCA 4I1PA 2PX2A 2GS9A 1JU4A 1WHSA 2GPSA 1ZL2A 1WXQA 1OYWA 5A9SB 1ZNXA 1A97A 2P41A 3D3WA 1C3EA 4GPD1 4H35A 5SY6A 3IPLA 3JQRA 5DULA 2E37A 3BGDA 1JU3A 1QNLA 2E55A 4Q3BA 4U3JA 4B4KA 4BNHA 1VGVA 1SU4A 4MSUA 2ZE8A 5D3ZA 3MHTA 4WA8A 4A7PA 5JH7A 1WR8A 1Y5RA 4QT4A 4II2A 3R0XA 5B6JA 1VPWA 1BG6A 4KR2A 2C0PA 1W48A 3MMSA 5B2FA 1DO2A 1EESA 2Q0HA 5JPIA 3L6DA 3HS3A 5K2OA 1DX6A 4PAWA 3O38A 2OCKA 1U3GA 1G8PA 2MSWA 4DLKA 1JPJA 5BN3B 4GI5A 1WUIS 1EM8A 5GJVC 1O9BA 3SS8A 4B7XA 4I4NA 3SBOA 2EAUA 1SXGA 2OUKA 1XDSA 4RH0A 4LGYA 4F7WA 1MENA 4GLBA 1MF7A 1FTYA 3JW8A 3QYFA 4IP0A 4OHKA 3LQFA 4K03A 3ICCA 4DSUA 4QX6A 1W5AA 1FVFA 3UG7A 5EHXA 3BICA 3VO9A 2HLHA 3FH0A 3N58A 5EQDA 3PZRA 1OH8A 4OPMA 4Y6OA 3ZTWA 4ZVRA 1JDTA 5TMDA 2CCKA 3ZEAA 3ZHCA 1I7SB 5A04A 4BMYA 3FNRA 4ZI5A 3E22A 3CHYA 2QX7A 2VBFA 2VZ0A 2XZTA 2ZJ1A 3KQNA 3NAZA 4QRDA 5ESXA 3BWDD 3LD9A 4RFVA 2QU8A 3QP9A 4NAVA 5JJKA 2UAGA 2RGRA 5CLIA 1FX0B 5K3DA 1Y9EA 1DKRA 3D7KA 2GXQA 1ZNYA 4UUAA 2H00A 3JARA 4AULA 2EERA 3SIRA 2WOJA 3KEFA 5BNFA 4CZ2A 2I80A 4C05A 4BUJA 4DIEA 2OMKA 4AJPA 2VDVE 3RAFC 1SZJG 4MYTA 5BSGA 4IJ6A 4JS0A 2AZXA 3MK31 3TKYA 1V5GA 2B20A 1AM4D 1QGZA 3O1IC 5IX8A 3B1KA 3FNEA 1Z5OA 5DCUA 1JBQA 2WHQA 2EQ5A 3PQ2A 1KYIA 1HPLA 2QKYA 4UHFA 4XPZA 3A70A 4ND5A 3V2HA 3I28A 4DCPA 3RTCA 3NHAA 4PSCA 4I6UA 2PO7A 2I4OA 2YMQA 4HJRA 1Q0ZA 3ABOB 4P3YA 4BQRA 5BN4A 3EODA 1ENYA 1Q0PA 3RSZA 4P9NA 4TL6A 4Z99A 3W6OA 2JARA 4DWWA 5BR7A 3FAZA 3V5NA 2CF5A 4TLAA 5U1PA 2UVPB 3ROGA 2DMRA 4INZA 4BKUA 4B8ZA 2Z6UA 5IT9A 4DJFC 3NATA 2AXZA 1AN9A 2BGNA 1FDSA 1PRVA 1R74A 2HHLA 2HPHA 2RBEA 2XUHA 3FCOA 1TVEA 2EFGA 3JR7A 4EY4A 3MJDA 4TMZA 1T2EA 2V55B 1VHJA 4YUAA 2BF4A 4DY4A 7MDHA 1O57A 1TEXA 3BGIA 1L5HB 1WXWA 1NW4A 3IAFA 3WA6A 1XKQA 4LHXA 1P1JA 1Q92A 3DLIA 4P4TA 1MB2A 1E9CA 2NVWA 4XFJA 4X60A 2H51A 4LE2A 1MT0A 5TLSA 2C5FA 3GUYA 2QYTA 1P7VA 2C29D 2GERA 3B3FA 2PSJA 2QX8A 5HUQA 2HR1A 2A9QA 4R1NA 1UT8A 1DT5A 4CPDA 4M3NA 1STOA 3ZY3A 1C7FA 1WABA 1TGVA 3ZKWA 3D8RA 4L16A 1E61A 1LCIA 4IG4A 5A5GA 4QSHA 3IRUA 1VRWA 4XWGA 1W581 5EIWA 3VJRA 4MVXA 1CIJA 3LOPA 2A0YA 2HMAA 2VFAA 5ER6A 1NI4B 3RLIA 5AOAA 5BWBA 3GEBA 1Z7YA 2D3WA 1SR8A 4MWCA 4R3WA 4U00A 3UUEA 4I19A 1FY2A 4YC7A 5FWXA 4MQEA 4RANA 2P30A 2GRMA 2DBVO 2C5SA 2FWPA 1U90A 3CX3A 2BGUA 4KDEA 3CZ9A 4KUEA 5EHIA 5LQRA 5HF9A 3REOA 4UM8B 4AX4A 3SX2A 5EWJB 3QENA 3PNYA 4OA5A 1XAIA 2LYKA 3BHNA 2VDUE 2ZYTX 1BDIA 3KQWA 3KZKA 3V34A 1TAHA 2GPYA 1DBRA 1ZVMA 3U39A 1I94B 2PXQA 2G4VA 4US1R 3VHXA 5DNDA 3IFSA 2CF6A 1HEYA 3HA7A 5FUYA 1JQBA 4JI8B 2GM4A 3K0AA 3OF2A 3WLAA 1YS2X 3I6IA 3ZPXA 5ALFA 3TTSA 2HMVA 3PL5A 4PLHA 1YJ8A 2VYVA 2PZBA 2OSVA 1NGSA 1RKVA 4NV0A 2QY6A 4Q1CA 3T5BA 3CRMA 1K9SA 4C9BA 3THWB 2O8NA 5KEIA 3VBCA 4I5FA 2Q9BA 4L50A 1JB9A 2E1RA 2I22A 3AHHA 5IJAA 4Q15A 1KRWA 5TMEA 3DJFA 1GZDA 3PC8C 1JQ3A 3BDAA 2YWJA 3BZBA 4KPGA 3R1FA 1JILA 3DEHA 4IQ0A 3ULKA 3FOZA 2QUJA 1KMNA 2APJA 2BTQA 2B78A 2D4HA 1GHTA 2IPLA 3AUFA 1C1DA 1X7WA 2RHHA 3QIAA 4PLVA 5EJ6A 5EEHA 4Q93A 4D4JA 2H1IA 2CDAA 2WP0A 4OB4A 1M1NB 1IWPB 1E2KA 3NJ8A 4MW6A 2WUGA 4KLAA 5K4HA 1YZQA 1R66A 1A04A 4D9NA 3NHFA 1LXCA 4Y0NA 3WGNA 1AA6A 2D0IA 5ALZA 1PIWA 5EINA 4X91A 4QGSA 1DIGA 3RS2A 4E5PA 7ADHA 1DC3A 1OW3B 4D2IA 5LM3A 4JYZA 3Q40A 3VYUB 1XNJA 1VG9B 2Q9UA 1I9GA 2MU1A 2Q6VA 1N7JA 1GSAA 2QTFA 2ZWAA 3PZBA 5IAEA 3AR5A 2IS1A 4TN5A 1EBBA 1X2EA 4WACA 2C9ZA 4HLCA 3WLHA 4B3JA 2VWQA 2OGUA 3CRQA 3IRVA 3MWEA 4YBAA 16PKA 2BMFA 4KP7A 1GRVA 3RFFA 1BVRA 1ZLXA 2QM8A 3RRNA 1GPDG 3MYRA 3TDMA 3TTUA 5IM4A 4JT2A 4YCSA 5ALKA 4IHJA 5CB8A 3PXGA 2QHXA 2ILTA 3L7IA 4GQIA 4ZCQA 3QLUC 4MS3A 4YRFA 4HNHA 2PNJA 3GPLA 3U16A 2QN9A 4IRXA 4MO9A 2CXTA 2FJUA 5DMXA 3VPDA 5E4JA 4RZSA 1N6RA 2BMDA 4ZI7B 4MWOA 1Y1PA 5DGXA 2I76A 3KFLA 1ZAKA 3I01M 4P7JA 4DPMA 3GT4A 3KZ1E 3SYMA 4FNOA 3M33A 4I1OA 2AA3A 5I4KA 1TMGE 1TU4A 1MNAA 2QV0A 4FJ0A 4M0FA 5EMHA 3RU9A 1XVUA 4QPJC 5C9ZA 1EJ2A 1TAQA 2VPQA 1AHHA 4EM6A 2GA8A 2DFDA 4J29A 5DBFA 3KZXA 2OCXA 3UOAB 1BOFA 2POCA 2QPOA 4GPBA 1CDZA 1RAAA 3WNQA 4ZAVA 2D0OB 3CG0A 2C04A 4WJLA 2IBTA 3DWEX 2ZSHA 4KFRA 2X5NA 4MLDA 1U7DA 3IO3A 1ISFA 1UAAA 2V6MA 4DUGD 3H1GA 3VK0A 5AO9A 2A0KA 2VP0A 3J81k 4B3CA 3G9QA 4TN1A 2W0MA 3CNEA 3DYBA 3HUFA 3MAAC 4XOIA 3OCVA 1EAYA 2CZCA 1SIOA 1YRYE 5T8KC 4L2IB 4A5SA 1YQXA 4IXNA 1OA0A 3AUTA 4DYVA 4COOA 2ATVA 4GHJA 3TGWA 3IJEB 3U4IA 3ILYA 1QZXA 2JANA 3DT9A 3I09A 1E0SA 1DQNA 1PR2A 2A59A 1DS6A 1ML4A 1XV5A 4XVRA 2G36A 3AYZB 4YBZA 4N03A 2E5FA 4J6FA 4BO6A 5LYJA 4G84A 4EYSA 1T5OA 1ULHA 2PD4A 1UDAA 2MXDA 4JV5B 5CA0F 1ZR2A 4Q9AA 3IELA 2G5CA 3K96A 5EA2A 1E6KA 3O1JC 1SZPA 2WE8A 3ETJA 3MTEA 3PFCA 1MTZA 4RY9A 1QB8A 5C80A 1J8VA 1SPBS 1Y3CE 3OBIA 4TSRA 5B1SA 2GF0A 5AVKA 2HSGA 2HTEA 2VDPB 4NJMB 2C20A 3RC1A 4AKHA 1O9GA 4OV6B 4FMPA 1OIVA 3KR0A 2OKCA 4TKUB 1SCAA 1D9XA 4BQPA 4KOAA 4PIMA 1EVLA 2XYVA 1LLQA 3JQ7A 4L8FA 4XJXA 4AMYA 4JSYA 5ECWA 3OWHA 3D5EA 5MGBA 4TZTA 1XLWA 3N76A 4A2WA 8AT1A 2IE0A 2Y9PB 1EEXB 1X1AA 2AF3C 1YJ5A 3R5TA 3ENVA 4TMTA 5L7WA 1HDOA 2DBYA 2Y0BA 3PXDA 1ZRMA 1XQVA 4P4SB 2IHNA 1N2IA 1YZGA 4OXYA 4R3UC 1QIEA 3H5OA 3UXHA 1E98A 2JDID 4F04A 4HV4A 3EUSA 2GBCA 1UXJA 2J1LA 3C1AA 2LXNA 3P32A 4FDTA 1ZJJA 4KQWA 1T13A 4MPJA 5GV7A 3IHKA 3L1HA 1HUQA 3I3OA 4XE5A 4DE9A 3GA7A 4K9NA 3FCSB 3NG1A 1CQXA 5TMBA 2ACKA 3T7TA 9LDTA 1AUXA 3UV6A 3RG2A 1QVRA 1X80A 1B16A 3GGDA 3LISA 4GP6A 2B4YA 4OIMA 3T1QA 4EJSC 3HB1A 3KCQA 3MS4A 2AQHA 4LXXA 1SGWA 4UNNA 2CN1A 2FW8A 2CBZA 2OD7A 1FTNA 1TA4A 2PHZA 3FTQA 2IL1A 2G1UA 4AP5A 5AKJA 3UPDA 3Q8MA 3C7KA 4Z1OA 3R7FA 4ALKA 1PFYA 1EWRA 5B1IA 2ENUA 3QIVA 4DQVA 3N8DA 4Z7OB 1TTPB 3RI3A 1S96A 4GL4A 2PSHA 4YUZA 1G7TA 4FYPA 5I7SA 2P3QA 1M1YE 2AHOA 2J87A 2BR3A 2NQ8A 1U8AA 2V8BA 4AICA 2RGDA 2AZDA 3QOXA 3CRRA 3GVXA 4QYMA 3DLTA 5I7UA 2HOQA 4DILA 4IJ5A 4O4IB 5AJZA 4BV2A 2A1UB 3U7GA 1B26A 5BP7A 1U3CA 3CVVA 1VKOA 5TF0A 1J8QA 1UBHS 3CVJA 3JWJA 4N8EA 4TWRA 1JNXX 1YZHA 3MB8A 1GQOA 2PXHA 2J9XB 5LP1A 1WETA 4MP3A 5DHFA 4B3GA 4PSKA 3WC4A 4ER3A 3L7MA 1B0ZA 1NJ8A 1Z62A 1CE8A 4ZIRB 4BNGA 2HSZA 5TQ2A 2O3SA 1QF7A 2E18A 4QECA 1HDZA 3GVCA 4KVZA 4XWYA 2FW7A 5CA1B 1EEHA 1AHIA 3AF4A 1E3TA 1S6YA 1P2SA 2V9PA 2Q0QA 2XITA 1HT0A 3KR1A 3MWLA 3PC7A 4GOKA 3AIMA 2MSDB 1PJ4A 3NJRA 4PPQA 4YMVA 1ZHHA 1PFKA 4F1KA 4QUGA 1NJ2A 3ITKA 2LUOA 3SCZA 1C29B 2QOEA 3LC1O 3E8XA 4E03A 4JZYA 4PRLA 5B12A 3R7SA 5K0CA 2Q6KA 3NX4A 3K70B 3LA6A 3A9YA 1NUHA 4JP2A 4BO2A 2UUOA 3NDBB 4YAIA 1JHAA 1MJFA 3V8BA 5I7VA 3QE9Y 3KE8A 1KMHA 4U9HS 4M98A 4KIFA 2PT9A 4LWPA 4PFJA 4EHAA 2IWHA 5C8YA 1W47A 3ABRB 3NWBA 3P0EA 2N47A 2UVDA 2EDCA 4Q3NA 4U2CA 4X20A 3RYTC 4QU5A 4EAAA 1Q16A 2JFYA 1OUMA 3BKWA 3H5RA 5GINE 1CJTC 2ZYSA 3HXOA 3BDIA 3OPQA 2FETA 1Q7GA 2HJSA 2D5LA 2VRBA 4N7MA 3UQYS 5ADUS 4PPYA 1IN4A 2OT3B 3SMQA 2HHCA 4QXMA 3M6UA 3TPFA 2C82A 3LUFA 2W2OA 2XUJA 2CWDA 5DP2A 3SYLA 2QP4A 4E21A 1PVOA 1PL0A 3QGMA 3IOEA 3RUHA 1XRQA 2YFQA 3OQIA 2J3LA 1Z12A 6GPBA 2PGNA 1ZAYA 1Q83A 5B64A 4Q1AA 2BFBB 4YXWD 2GO1A 4DLWA 2HBZA 3KXLA 3F73A 1U5BB 2GHRA 1PJCA 4XM1A 2BFMA 1UC4B 1NV9A 4C3OB 3W4KA 2GK3A 4MRNA 4CU5A 2LKDA 4N5LA 5TARA 4E33A 1NHGA 2B8EA 3SNKA 1YZKA 3COYA 3EG5A 3BCRA 1ZD5A 5EUMA 3UUGA 2GHIA 1S9DA 3AFGA 3GZNB 2MJLA 5CD1A 3QV2A 1VFPA 1XALA 2FYTA 5DKFA 2G9RA 1YA4A 4NDWA 4ER7A 3PKIA 1LC0A 2FMIA 2FFRA 3TW8B 3WZMA 3WKAA 3L6RA 2AYZA 3D6FA 4BLTA 5HCUA 2EFJA 1N9GA 4JP8A 4NU0A 4UBKA 4WUTA 1VIMA 4ACAA 1JR3E 2HINA 1F6BA 3LXXA 5TQ0A 1AY0A 1IONA 4IV0A 5JBIA 2FCAA 4NX2A 4PXSA 3N6XA 1Y8QA 4L9WA 1RACA 2FWJA 2QTMA 5CVDA 5KNBD 4RGBA 2VNKA 4OB8A 1PDOA 4ZHQB 5JNRA 3E27A 4Y2PA 2QS9A 3NWPA 1JFSA 1JXQA 2X4LA 4RVHA 1AKMA 1RBQA 2K2QB 2GI4A 1P0QA 3KLPX 4QU0A 1CJBA 3TUIC 3ZVKA 5IAKA 5JZMA 2O5EA 3DCJA 1DEAA 4J0IA 4ON9A 2D2XA 2W4MA 2WUSR 1MOPA 1OLXB 1T5LA 2EKLA 3BSYA 3G02A 3QI7A 4J7CA 1PR5A 2WF8A 4M89A 3MINB 4ZVUA 1UBUS 1P9RA 1X1DA 4AN1A 2I4IA 2QD4A 3IR7A 1P8AA 1P1KA 1GPUA 4RF5A 3EW9A 3HEBA 3RTDA 2R79A 3MWGA 3MIIA 4WCFB 3TR5A 2BI8A 1IN8A 3NDJA 3ST7A 5KTRA 2B7BA 1HEIA 3M4YA 4MGIR 2ADMA 4HBGA 4M1EA 4PU7A 2V7TA 4PGAA 5FNVA 2O0HA 4PC7A 3RFCA 4GYKA 5CXSA 4FZRA 3X2SA 1U3UA 1UP4A 3P5SA 1B8PA 1JDUA 1QQBA 2H9AA 3GNTA 2QG4A 1C1XA 1IRXA 4XI9A 2R66A 3WAGA 3M6XA 1E9DA 3RIGA 1Z7WA 3TNDA 5JSZB 5GTDA 2HX1A 1V5WA 4P54A 4HAOA 2YFKA 4XWTA 1BIFA 2JFUA 3MC1A 4RXTA 1GNTA 3KV1A 3O4RA 3W1WA 1X92A 2NNWB 2C59A 2WU4A 4NABA 2DUUA 2YZMA 4IWNA 4ZAFA 421PA 3RC3A 5JZOA 1QE0A 3EWSA 1JMVA 4ZYLA 5LZ2A 3JYQA 3O4IA 4PVCA 4W5WA 1D5WA 2GNPA 2R1VA 3ZQKA 1U2PA 4PLTA 2Y4NA 1JIJA 5AIAA 2O19A 4DM4A 2HPZA 2QT9A 3HU1A 3I9OA 1VPDA 5E3JA 1QFYA 3WWDA 5B3KA 2WZDA 1YI8A 4KMOA 5KVVA 4YLGA 1XELA 2VJPA 4ZN6A 1PRUA 3L7AA 4ZGBA 4JUAA 2WHXA 3JWIA 4G0WA 1X1SA 4D98A 2J7WA 1T8SA 4C76A 2PZEA 4MUEA 1QGUA 3G2NA 4FFMA 3HBMA 4LRTB 1YKGA 1O89A 3DCNA 3HJCA 3MTAA 1C4WA 3PCRB 3GLUA 4LWOA 3TB6A 3ZXXA 1XZPA 4RMJA 2PRIA 2YJGA 2YXDA 2O4UX 1ONSA 1VSBA 1GAJA 4IS2A 1E79A 4INJA 5C4GB 4XQEA 4DRXB 4QLBA 4I1SA 1JJAA 2C2GA 4MR9A 3HCFA 1UBMS 3C5WP 4YJGA 2QBYB 1RRVA 2CSXA 1JAIA 4HGNA 4GXRA 1VDZA 5JRZA 1Z73A 3O91A 2H0AA 1WUYA 3FHLA 4DCVA 5DTRA 5ETJA 2UYYA 1ODSA 4DG8A 2EKBA 2HNBA 4ZTBA 4UAGA 4D3ZA 3LG2A 3FIUA 2DG2A 4EG7A 3OZSA 5JC8A 1ZD2P 1LS6A 1M2EA 3T15A 3LQXA 4GLOA 5E6UA 1MABB 4IGAA 1ID1A 1ISMA 1IE3A 1KNQA 1E3MA 1Q2XA 4ZAGA 3DPUA 3KWLA 2R6DA 3KP1A 1O95D 1Z37A 4UDXX 2X0EA 3O4GA 1B6GA 4LJ9A 2AK2A 4ZTZB 1NXVA 1KFJB 4L28A 2OE2A 3HB9A 3O0TA 1OI3A 3AU9A 3PDIA 4N0QA 3QU4A 5JW6A 3MTIA 4EGJA 2Z3WA 1CC1S 4TYMA 4MGZR 3TLCA 4IR7A 4BGDA 1RWOA 2K2WA 5HDQA 2IUYA 3KXDA 2Q8QA 2QRKA 1BGWA 5JOQA 4BP8A 4TVSA 3ZCRA 1QO7A 1MO5A 1ONPA 3LHFA 2NG1A 2R3SA 5EERA 4YRPA 4O8CA 1I32A 2PKCA 4LZNA 1Y6FA 3OX3A 4MTCA 2ZJOA 5EE3A 1U2DA 3EJWA 5C3UA 1K4KA 3SYNA 4EB0A 4F4UA 3NTVA 3A06A 2LNDA 3Q6MA 3U7FB 4W1SA 4IGEA 1BXGB 3HG7A 2WILA 3OOYA 4OUDB 4ZAYA 5C4IA 1FYDA 4ESVA 2PXFA 4NH4A 1U3VA 4C5BA 4JHXA 4TV9A 1XKXA 1EVEA 4EP1A 4X1IA 2R7AA 2M9MA 3CE6A 3RAGA 3MYYA 3L4SO 4LBYA 4OH7A 1AZWA 3ZY4A 3K09C 5K0JA 1GTRA 1T2VA 3AKCA 3R5FA 5A7LA 1RI1A 1Y0BA 3KOWA 1GV0A 1LKZA 2X22A 4E94A 2PA3A 5HIJA 3HVUA 3AWIA 3JVVA 1ECCA 1GAEO 2GVZC 1D4FA 2OAEA 4RD2A 4WH0A 1EH5A 3ZWYA 3DJYA 2GDJA 3LSTA 3OJEA 5DO9A 3QF3A 2E3JA 1DADA 1UP6A 2QY9A 1HC7A 1UEIA 2C2ZA 1DKUA 2JGJA 3R3VA 4H0FA 4MUNA 1QG4A 5F3RA 4F2HA 5HPYB 3OZTA 5DT9A 2P1ZA 3TE7A 3CVXA 3VYTB 3ASVA 1NMQA 1PJBA 5HMLA 3BFXA 1JECA 3DHEA 4OH1A 1A88A 1G9SA 3KXPA 3IXMA 1DINA 3O21A 3RVDA 1Z8DA 1I4DD 1SKAA 2EBFX 3HWRA 3C41J 4YJDA 3BXFA 2XNSA 4GC5A 2P6RA 3QU9A 4R84A 4RZUA 4HDNB 1IHUA 4JI3B 3TVDA 3F3KA 2BZ1A 3TR6A 4E3WA 4LHZA 1MC8A 3VKUA 1Y8AA 1Z7EA 1QFSA 3PQ8A 3OU7A 3LQQA 1QB7A 3C3YA 5D3MB 1U8XX 1WW2A 2HF9A 2WC1A 1NOKA 3EAGA 3S40A 5IS2A 4KXYA 4Q12A 5CM8B 2IPXA 2HDWA 1Y9ZA 1PX0A 1YOVA 2I71A 5JMPA 3L40A 1G1AA 2J9RA 3C6MA 3VR2D 2GCIA 1YU9A 1QPZA 1GQFA 1P5FA 1K98A 2QVCA 1N36B 3HJAA 1P39A 4KR3A 2MYPA 4PU4C 1G5RA 4HWTA 2W22A 3FJOA 3GJ7A 3IBCA 3KEGA 2BHLA 3N7UA 4CMHA 4DNFA 1QH8A 2X8BA 3IAEA 2OA0A 2AZ4A 1P7WA 3P9XA 3WBJA 1VKJA 4FGJA 4CIVA 1DTWB 1TC2A 5BPHA 4RMGA 5K8CA 4DNXA 2DWCA 1QDUA 3NBUA 3GFOA 2VH5R 3HDGA 4PLYA 5HF6A 3PNVA 4WOJA 1YS1X 2C54A 3DL2A 1ITZA 4X4BA 2X8WA 3GJZA 1NL3A 3FM9A 4R1OA 2FPXA 3KLMX 3SZGA 4CMGA 4DV5B 2JLAA 2ATIA 4BQQA 2ZQ5A 1JIUA 5LA6B 3WGKA 3ISTA 5KREA 2CHGA 2JAWA 2OZLB 4C7BA 1YULA 2QLTA 1ZK4A 2D54A 6ADHA 2REOA 3A9TA 3QLJA 4LJYA 4DWOA 4JZKA 1KBOA 2J32A 3KAPA 1EXWA 1DUSA 1WXXA 2B34A 1L4UA 4TM7A 3TTVA 1SXPA 2H85A 2XZOA 1GTL1 1LVGA 1OC2A 1TF7A 4KZKA 1U0BB 4AS3A 4GE0A 3GUZA 3EXFB 2PXTA 3QFSA 3BL5A 1KMQA 1RWWA 2WJ3A 3LGAA 3MS7A 4NCAA 2PWZA 4OOEA 2A88A 5B2ZA 2AV6A 5KI6A 1LWNA 2AVDA 2JBAB 5M04A 4HXEB 2MHCA 5CT8A 4ZOBA 2CHFA 1EFVA 1ZZ9A 4NZOA 5CCBA 4QDTA 1H1LA 2C61A 2GZAA 2GBGA 4V0KA 2XWPA 1RR6A 1F2UB 2YICA 1YIDA 3EK2A 4LBZA 4CMCA 3M7IA 2X1LA 3M49A 5BOSB 2J9FB 4A6PA 1XF1A 3OWXA 1LB1B 2J33A 1S2LA 4Q6BA 2QVGA 2XCOA 3JR3A 3UC5A 4RKYA 1KAHA 1YVDA 2VHUA 3OFND 3E61A 4YV2A 3C7DB 3IIJA 3PFFA 2W48A 5ERGB 1IG3A 3HVJA 5BXYA 2VHYA 3X1MA 4D4IA 5IAOA 4YACA 2BTOA 1LLIA 3ND7A 2V59A 1LFDB 1UODA 1WV1A 2IP4A 4P0TA 3RK0A 1BXKA 3TRBA 4YRCA 5F51A 1RAIA 2IHTA 4OHWA 4YAFA 3U40A 1QU3A 4UZSA 1M1YA 3BC1A 1K0UA 1K8ZB 1P7CA 2P3SA 4MKHA 5HE9A 3FE2A 5AM5A 3UJNA 3NVDA 5GOZA 4HVLA 1N2CE 3PDHA 3CZMA 4HRXA 4PGMA 1CY1A 1J49A 1UKVY 4PBRA 4K6CA 4AZ0B 4UM9B 2PD6A 4WT7A 4QOIA 1TUIA 4PAOA 4Y98A 3N2LA 1PT9A 1Z0KA 3R8FA 1CS0A 2QX4A 4L5CA 5FWYB 2Y99A 2O54A 1QWOA 2VSOA 3EWNA 1XWRA 1N1GA 3A27A 3QEMA 5AI4A 2D5AA 3GLFB 1G5QA 4L51A 5HNKA 4LZWA 1DVRA 1JHMA 2V7WA 4E1BA 1XX6A 4KFCA 2VA8A 5HF8A 4KVGA 2QGZA 3H1TA 3HNPA 4FC6A 2A78A 1WJGA 3FFBA 4XASA 3RPEA 5GQSA 3A6HA 3IKLA 1GPBA 3ENZA 3O74A 3ZHYA 3ML1A 4JL8A 3WRWA 5HG0A 3QKIA 1FDVA 4K1XA 3I9FA 4MVYA 3BILA 3UG6A 2O8CA 3TX2A 1EUZA 1F6DA 2RCNA 2W00A 4YRDA 4TKVA 5KAMA 4F8EA 2EJBA 3UWMA 1D1SA 1FFBA 1JQAA 2PCJA 2R7NA 3PENA 3D7NA 2J7PD 2QAJA 3C98A 4OKIA 4QQFA 1PP4A 2O23A 3QVOA 5JXWA 3LYUA 1YUMA 4HSGA 4RJTA 5EQTA 4MYCA 5IK2D 3AFIA 1V6SA 1BDJA 5FF9A 4LQCA 2JKYA 1PAUA 2KW5A 3CVYA 3GC6A 1CD5A 1UBJS 1Z2PX 2IDJA 4MNTA 3K16A 3IVGA 1VYVA 2XE8A 4K28A 4LC1A 1C2TA 1TZKA 5GWXA 3SF8A 4IDBA 5AOBA 1FS4A 4F46A 4UUBA 2WTUA 2PIAA 2D5BA 3K30A 2H8GA 1UOQA 3RVSA 1IPEA 3D0RA 3CUWA 3GYGA 1II9A 4UUPA 3G9TA 2QD1A 4QJBA 2AXUA 1HYHA 2ZJBA 5CDTA 2P0EA 2Q6OA 3HB0A 5EN4A 4P31A 3CEMA 4B71A 4FM9A 5ICMA 1NMEA 1Z56C 4CLHA 1RYNA 2IYPA 1W49A 3BL6A 5H82A 4C22A 4Q82A 2RIPA 2X58A 1JQDA 1NPTO 2YYSA 1Y63A 1J42A 4RE6A 2D2EA 4BLWA 4KK4A 4YP6A 1TRKA 4CF4A 1KZGB 3OCUA 4PYNA 5BW8A 3NVAA 3SLKA 2EDAA 2OZKA 4L1KA 3KU1A 3X1YA 3QYXA 2PBLA 1TD1A 1C4XA 5CXXA 2PZFA 3VO2A 4BRUA 5LFAA 1JMYA 5H9VA 1A72A 3R9IA 2QRGA 1FRNA 1L7EA 4P7FA 4UAUA 3AJAA 2QZZA 2YZNA 4IIFA 2ZYGA 1PKEA 1W46A 4FFVA 4O2LA 1EE1A 4JYMA 1V8ZA 5FLYA 4F4HA 2UUBB 2PGLA 1R9MA 3L82B 4LV6A 2P2LA 3B7PA 4JC4A 4KOEC 1LEHA 1ULBA 1GZHB 1UCFA 4EFMA 1LTHR 1M2FA 3GFBA 5JHHB 3DZHA 2IX3A 1DIOB 2Q1TA 1T1IA 2BEUA 3R8CA 3SG0A 3U56A 4QDUA 4MLPA 1GA6A 3NPAA 2YRXA 4EG6A 5KNCD 3CH4B 3OOSA 3AR4A 3I32A 2OV6A 5L3QB 2Q3JA 4Q3OA 4ANFA 2VZLA 1VMEA 1SWWA 3CRZA 3QVVA 1U65A 1GADO 3O92A 3EG9A 3RIHA 3BWEA 3TQOA 1N3LA 1CB7A 1CYEA 2A0WA 4CXMA 1I3MA 5JJLA 4QGGA 4L73A 3G0HA 1RWXA 2W71A 2JBWA 4TS9A 1W36B 4PLZA 2FOIA 2OFYA 4A10A 3NRJA 2WUVA 4RUKA 4BFTA 2G5PA 3H97A 3EIOA 1IFXA 3DP9A 5J2TF 3RKRA 4MRMA 3NBAA 4RPKA 5K3BA 4MQFA 1E7RA 1Z6QA 3Q85A 4YP0A 1BS9A 1J00A 3BF8A 1ZN9A 2FX3A 2I2BA 1M33A 3L0ZA 3PYLA 1KQNA 4BLUA 2IS4A 2C4KA 1DW9A 3U6KA 4JJ7A 4P84A 3C5CA 1I6LA 2IELA 4X4DA 2RH9B 3MQ2A 3VTZA 1UPXA 2NW6A 3C8MA 1ILWA 3UV7A 4HZIA 1YRLA 3JQAB 5F98A 4KGXA 1GA4A 2GFQA 2A94A 5A3QA 2WD7A 2Y27A 2YJ6A 1NI5A 3MBIA 1AK9A 1MFPA 4HADA 1Q19A 5GADl 5LZ7A 1F06A 1ETHA 2VDNB 3D4PA 3L8EA 2WLTA 1QHXA 2NTYC 3S2EA 2LTAA 1QBGA 1A76A 1NM5A 3LLVA 5DBHX 2P65A 3AMVA 5DXJA 5ARDA 4EI2A 3JTEA 1BD4A 4DGQA 2QVLA 3EGDB 2FEAA 1BEUB 3HR8A 1B42A 1Y4DE 4A0SA 2PZJA 1ZFNA 2R85A 3BCUA 1TM4E 1NNI1 2XCLA 2FPGA 1WO8A 1H0KA 4OGLA 3WWEA 1KEEB