5DSXA

Crystal structure of dot1l in complex with inhibitor cpd10 [6'-chloro-1,4-dimethyl-5'-(2-methyl-6-((4-(methylamino)pyrimidin-2-yl)amino)-1h-indol-1-yl)-[3,3'-bipyridin]-2(1h)-one]
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
316
Chain Sequence
b'LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 316
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dsxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dsxA02
3KR9A 1I1NA 4QPNA 4OBXA 3KQSA 5JR3A 1TPYA 1SUSA 5EMMA 2UYQA 2I9KA 1I4WA 1G6Q1 1F3LA 4A6DA 5HOQA 3G2OA 2Q41A 3PFGA 5DLYA 3TPZA 3FTFA 1QYRA 4M36A 5EIFA 1KYZA 2ZWVA 2VS1A 3NDIA 5EHIA 3OFKA 2Y1XA 3GXOA 4EQZA 5KQRA 5CVDA 4DMGA 4K6MA 4AX8A 4FSXA 5EZSA 5FA8A 3EEOA 5EIWA 3OZTA 1JG3A 4IWNA 5EMKA 3FPFA 4QVGA 3V8VA 3CJRA 5K05A 3V97A 2F8LA 3M6UA 1G8SA 3TM5A 5C1IA 3B3JA 5DX0A 3WSTA 2PT6A 3B3GA 3ME5A 1P1CA 4RVDA 1DL5A 5P8WA 3LBYA 3DH0A 3G8AA 2H11A 4CKBA 4CTKA 3KQWA 3S68A 3OCJA 2R3SA 5F2KA 5BW5A 1I9GA 2V7EA 5CVUA 4MHTA 1SG9A 3MTIA 3O4FA 3FPHA 5CVJA 4PYMA 1O54A 1JG2A 1RJFA 2ZZMA 4FP9A 1XDUA 1XCJA 3L8DA 3MB5A 2NXEA 3BGIA 3PLAE 3KHKA 3HCAA 4YV0A 4FZVA 4V0RA 1N7IA 3HCEA 5HIMA 4QTUB 5EOVA 3KQPA 3M6VA 3EGEA 2ZULA 3GCZA 3HM2A 2WA2A 3D2LA 3SSNA 3OU2A 3FPEA 3C0KA 4R6WA 1WG8A 2XVAA 2ONZA 2CMGA 2ZBPA 4MTLA 3NJRA 3TRKA 4PNEA 5LQNA 4GEKA 1P39A 4RTKA 1YF3A 1M0EA 1X1AA 2VDUE 1R6AA 5EC8A 2PXCA 3FPJA 3T7SA 4YMGA 5E8JA 3ER9A 1EAMA 3C3PA 4F85A 5ICEA 2YX1A 2IBSA 3ID6C 3R6TA 4E70A 2NP6A 4V0QA 1X1CA 4P58A 5DPMA 3ER8A 1VQ1A 1NW5A 1G55A 4PWYA 2ZW9A 3CVOA 3LDUA 1X19A 5EKXA 3BWMA 4RSRA 2ZWAA 4XUEA 4E30A 3REOA 5LQCA 2AOTA 2JJQA 2AOVA 3ELDA 3SXJA 1L3IA 3KQTA 3VSEA 4C08A 5KS2A 3UJBA 3EVCA 3MERA 4XCXA 1KYWA 1X1DA 2O57A 4IV0A 4PYOA 4Y30A 3QOWA 2PX4A 3OU6A 1AV6A 3GRUA 4PIPA 2V74B 3MCZA 3AXSA 3KKZA 3SSMA 2GH1A 3O7WA 3GGDA 3UJCA 4YUWA 3KQVA 3EMBA 5GM1A 4OA8A 1L9KA 4BLUA 2ZLBA 2E5WA 5K0EA 3GRVA 3EVAA 5EG5A 5EZQA 1G60A 2NNWB 4RX1A 3BGDA 2GPYA 4AZWA 5K0LA 4ATNA 2G72A 2K4MA 4AUKA 1T43A 5T67A 1FPQA 1EIZA 1M6YA 3R0QA 4OQEA 5FA5A 4ER6A 3I64A 1BOOA 3CCFA 3UJ8A 2AOXA 4U7PB 4E2YA 1EJ0A 2NP7A 2IDJA 3MGGA 1RI2A 3Q7EA 4C4AA 4RTNA 3HCDA 3I58A 1KXZA 3C3YA 4RYLA 4P7KA 1XJ5A 4C03A 3T7TA 5FHRA 1VP9A 3F4KA 2CMHA 2WA1A 1XXLA 8MHTA 3PS9A 5EGSA 4RTLA 5ICCA 4FT2A 1RJGA 2JG3A 5GP1A 1DCTA 3DMFA 2BR4A 3NW9A 2IFTA 3B3FA 3ELYA 3BUSA 2IP2A 3E05A 1BKYA 1ZG3A 2GA9A 1UWVA 2PT9A 3MCTA 4YUXA 5T64A 5EQJB 1H1DA 3HP7A 3TKYA 4E2WA 5BW4A 2QM3A 3UA3A 3GU3A 1BC5A 2ADMA 1VPTA 2EG5A 3NWEA 4FR0A 3LCUA 3G7UA 4KW7A 1NV8A 3P2KA 5IH3A 3DR5A 1JSZA 2PVCA 4CXMA 1YZHA 2ZFUA 3H2BA 4POOA 3PTAA 1RJEA 3OZRA 5H02A 3CJTA 4RVHA 4BP3A 2R6ZA 1JTFA 5DSXA 2GAFA 4M38A 3SGLA 3VC2A 2C7QA 2OB1A 5KVAA 2DULA 2O06A 1AQJA 4YV1A 2PV0A 1R74A 3HTXA 1QANA 1VIDA 2EJUA 2XBMA 5E9QA 4DCMA 5E9WA 2YXDA 4QDKA 3VC1A 2FK7A 1JTEA 3HNRA 4PIMA 4XUDA 5EMJA 2P35A 4CTJA 3UJ6A 5GM2A 10MHA 3FUVA 1SUIA 1XCLA 1G38A 2PGXA 1KR5A 2OZVA 4GC5A 2YUIA 2I7CA 4GOLD 5HILA 5K01A 5KYGA 4QQKA 5K0BA 3FUWA 2I62A 2NXJA 2ZIGA 4IV8A 5FCDA 3ELUA 1P1BA 3ELWA 1VP3A 3BXOA 2JHAA 3R3HA 4RTMA 3LPMA 1ZGAA 5DRTA 2YR0A 2ZZNA 5EEHA 5DM1A 2JH9A 4GOMD 4R8RA 1WXXA 4GOND 5E9JA 2AOUB 2C7OA 2IIPA 3SSOA 5K0FA 2C7RA 2O0LA 4EKIA 1IM8A 1ZKDA 2AN3A 1KIAA 2FRXA 1FJXA 1EJ6A 3DOUA 1RJDA 2AS0A 3LBFA 5LQJA 4A6EA 4OA5A 5DXAA 2G1PA 2YXEA 3ORHA 2XYVA 1NW7A 5CM2Z 5ERGB 4PYJA 3JWIA 1VE3A 5GIPE 2DPMA 2P7IA 2YTZA 4QQNA 1WZNA 2NXNA 3P8ZA 1BHJA 3HVIA 3MAGA 4HSGA 1UIRA 4KDRA 1MHTA 5E8RA 3PB3A 2HTEA 5JUWA 2VZ9A 3KPUA 3DMHA 1JG4A 3UFBA 1JQDA 3EEYA 1AQIA 3BT7A 2JHCA 4E33A 1RI4A 5FUBA 3UWPA 5LR6A 2AOWA 4ER5A 1EG2A 1NT2A 1XDZA 3IV6A 3P9NA 1Q0TA 2P3QA 1OR8A 2XYRA 3GIWA 3BKWA 4IKPA 1YZ3A 3MTEA 5EMLA 4F86A 4OQDA 2P7HA 2GB4A 3ERCA 3G2MA 2UZ4A 2B25A 3K6RA 4RVGA 4C05A 1RI5A 2I6GA 3M6XA 5MHTA 1INLA 4PGGA 4B17A 4BLVA 2PX5A 4YUZA 2GLUA 5DTRA 3EMDA 3FZGA 3G2QA 4RTJA 3LECA 5DXJA 1KP9A 1RI1A 5K0GA 2IH5A 2Y1WA 5DT2A 3PX2A 4FGZA 5LQKA 4HTFB 3GDHA 3DMGA 3CGGA 1IY9A 4PONA 3OPNA 5LQRA 5DTMA 2PWPA 3A7EA 3GWZA 4EMSA 2P3OA 2PKWA 1O9HA 3FTCA 1TW2A 2IPXA 2PJDA 4X60A 4DZRA 4RTOA 3M4XA 5K0NA 2HNKA 5HEKA 1NW6A 3C6MA 3SX0A 3HCCA 2PXXA 3TOSA 3HCFA 3TQSA 3HA5A 1L3CA 3LDGA 4OBWA 3KPWA 2Z6QA 3JWGA 2Z6UA 3FUTA 1MJFA 3DULA 4P7FA 3A27A 5CUQA 2OO3A 3KU1A 4CKEA 5E1DA 4EVIA 1JQ3A 3ANXA 3LHDA 4AZVA 2G8NA 3CC8A 5CD1A 2G70A 4DCGA 1V39A 4HGYA 2H00A 1QZZA 3UA4A 4KWCA 4WXHA 2O05A 4BLWA 2IBTA 1XVAA 3NDJA 3X0DA 5DRYA 4BY9E 1SQGA 5E2AA 4MWZA 2BM8A 3B5IA 4PYNA 5C0OE 3KPJA 1FBNA 3GRZA 2PLWA 3UZUA 4G56A 2QY6A 3B7PA 5K0JA 2ZVJA 1QAQA 2G71A 3EGIA 3FTDA 3GRRA 3PVCA 3EVFA 3NVKI 2XVMA 3DLIA 3OE4A 3MQ2A 1D2HA 3RW9A 4C04A 7MHTA 5DM2A 4P7GA 3P97A 4KRGA 4Z2YA 5LQAA 3HEMA 3DUWA 1FP1D 3FRIA 3G5LA 3R9XB 3QV2A 3LCVB 5DM4A 3G2PA 2NXCA 3E7PA 2PXAA 1UFKA 1L3BA 1JG1A 3AY0A 1ZQ9A 3G8BA 3GO4A 3M33A 2CWWA 2XYQA 5CVVA 4HTFA 4UOEA 5B1SA 3FPGA 3EPPA 2YQZA 3THSA 3BZBA 1B42A 4ER7A 2AN5A 4C06A 2PX8A 1KPHA 2KW5A 3K0BA 1X1BA 2GS9A 3TM4A 4OX9Y 1NKVA 3TLJA 2AVDA 3B89A 4PYIA 3UJ7A 4LWPA 3HA3A 3AXTA 4CWAA 3BWBA 4GF5A 5GIOE 2EFJA 3DXYA 3EVGA 1VBFA 3UJDA 4C07A 3GNLA 1ZHFA 4F84A 5FHQA 2UYCA 3LL7A 4PINA 5EPEA 3TFWA 3A4TA 4RTQA 4RVFA 2EX4A 4HRAA 1ORHA 3A7DA 2HMYB 5E1BA 5DX8A 3EVBA 2ONYA 3P9KA 3LDFA 3SR4A 2YVLA 4GBED 3DP7A 3KQMA 5EEGA 1NBHA 2CKDA 3FYCA 3FYDA 3M6WA 3P2EA 4JXJA 1G8AA 2FHPA 5DX1A 4PYLA 2AZTA 4R05A 4X63A 3OFJA 4NECA 2PX2A 1PRYA 3TKAA 1ZGJA 5LQUA 3T0IA 4RV9A 4YMHA 4MQ4A 2FPOA 3FUXA 3UJ9A 4YUYA 4H0NA 5DWQA 2OXTA 3DXXA 3NVMB 5FULA 3EVZA 3FRHA 4ZTBA 3RIEA 3T7RA 2OKCA 2OY0A 4KDCA 2BZGA 2AOTB 2ZZKA 2ZSUA 3O31A 5T6BA 3EGVA 3SMQA 4AZSA 4KIGA 2ESRA 1AF7A 4GUAA 3KPYA 4AZTA 5LSAA 3G5TA 4GC9A 4L7VA 5K0CA 3GRYA 1WS6A 2VDWA 1SKMA 5D1HA 3PX3A 2CL5A 3FTEA 2UYOA 5M5BA 2PBFA 4YUVA 1N7JA 3HVJA 1N2XA 2PSSA 2PY6A 3E23A 2OB2A 5ICFA 4DM3A 3E8SA 3IEIA 3KR0A 4FT4A 3EVDA 4Y2HA 4KIFA 2P1DA 1NW3A 2ORED 3RODA 2BR5A 3I9FA 4LECA 1F38A 2P40A 5FQNA 2B3TA 2ERCA 4RTSA 4DF3A 5BP7A 3IHTA 4QPPA 3G89A 3SVZA 1Y8CA 4DKJA 1YFJA 4DA4A 2P3LA 3NTVA 5BXYA 3UBTA 1D2CA 3KR1A 1IXKA 2YXLA 4PGHA 3FUUA 2ZIEA 4LWOA 3VYWA 2B2CA 2ZBQA 2BH2A 1VL5A 3BWCA 4P7JA 2B9EA 1ORIA 4E2ZA 3QOXA 1QAOA 1XDSA 5EHGA 3BKXA 3HVKA 2JH8A 1DUSA 1JQEA 2AVNA 1R8XA 4PCAA 5CVEA 2C7PA 3BWYA 2P41A 5EKUA 3JWHA 2ZBRA 1Q0SA 1O9GA 4PCLA 4HH4A 4PYQA 5FQOA 3LKZA 5GWXA 5CCXA 4KVZA 5HIIA 1KHHA 5CCBA 1KPGA 1R8YA 4X61A 1NW8A 4R8SA 2AR0A 2AOUA 5E2BA 4ER0A 2PWYA 5DSTA 4LG1A 4WVLA 3TMAA 5DTQA 1EQAA 1VLMA 1XTPA 2P8JA 5C9ZA 5HZMA 1HNNA 1SVUA 2B78A 3A26A 4U7TB 1YUBA 4MIKA 2VP3A 2NYUA 5HIKA 3NMUF 1NBIA 2H1RA 1L1EA 5FWAA 3HA7A 3SM3A 1JR4A 2QRVB 5KQSA 1U2ZA 5GOZA 4ER3A 2N47A 1NE2A 2FCAA 3MHTA 3AJDA 1SQFA 4X41A 3PT9A 4E31A 3M70A 1KPIA 1D2GA 2OBFA 3LCCA 4GOOD 2JHPA 3A25A 2QE6A 3LGAA 2LD4A 3LX6A 1WY7A 2ZTHA 3LSTA 4QDJA 5CIYA 9MHTA 5IKMA 1P91A 3KPVA 3P71T 4ISCA 1R00A 3G88A 4YV2A 5K8VA 1R18A 3DLCA 3CKKA 4X1OA 3KR2A 1FP2A 3P2IA 2FK8A 3GJYA 3P9CA 1YB2A 2BM9A 3OZSA 2EJTA 4QVKA 2FYTA 4GQBA 2OPBA 3NWBA 4RTPA 2VDVE 2IH2A 4HC4A 1JSXA 2AN4A 3HCBA 5FTWA 2OYRA 3R24A 2IGTA 3U81A 3BGVA 3TR6A 3KQYA 3CJQA 4CKCA 5K03A 1RI3A 4DQ0A 4M37A 4E2XA 2ZCJA 5EVJA 1M6EX 2QYOA 2HR1A 3P9IA 5GINE 2WK1A 5FADA 5FWDA 1WXWA 1TW3A 3JWJA 3HVHA 3KQOA 2O07A 4QTTB 2IH4A 4FSDA 5DM0A 5E1MA 4EKGA 3THRA 5F2OA 3C6KA 2ZIFA 3OE5A 4RWZA 4O29A 2HV9A 4HG2A 5E1OA 3KQQA 1PJZA 4E32A 4HGZA 4R6XA 3LKDA 1Z3CA 3I53A 2UYHA 5HFJA 5U4XA 2Z6AA 5D1NA 3DTNA 2IDKA 5HIJA 1HMYA 2BR3A 3AWIA 3CBGA 4EK9A 1QAMA 4PYKA 4BP1A 4RTRA 1NV9A 3OU7A 2QRVA 5K09A 5F2NA 4M7RA 3I5UA 3UJAA 5ICGA 3EVEA 3PFHA 4FS8A 5G02A 3DXZA 3IYLW 3Q87B 4XUCA 2HWKA 1YFLA 2A14A
chains in the Genus database with same CATH superfamily
4UXIA 1HNWB 3VHLB 3ZC3A 1YR1A 4WBSA 4JK3A 4QGAA 2H3HA 2P62A 5FOWA 4OOEA 2JGKA 4XIIA 3ROKA 3PZBA 4QYIB 5CDFE 5LZ4A 4ZEVA 1TEXA 5ESXA 1KYZA 3SQWA 3OQHA 1OGYA 2FEAA 3V1NA 4O2BA 1GXSA 4RD3A 2ZYRA 3ROEA 3KRTA 2WWGA 3V8VA 4ZOLF 1CNMA 1YR3A 3QMWA 2F8LA 2BGNA 2H0QA 3AKZA 2XNJA 1OU4A 1N92A 1T8PA 4BZZA 1U2PA 4TTIA 1WF3A 2AEEA 2JLSA 1XRRA 3LYHA 1QNLA 3NETA 3CE6A 4IXDA 3VTAA 4NYIQ 4FS3A 1JHQA 3O26A 3OMWA 4BFYA 3BH7A 1OUMA 4NULA 4CG1A 2CFCA 2H11A 4V0ME 1E61A 1ZIYA 2O7RA 3KUKA 1ZD4A 4YONB 2ZKIA 5B7PA 4DBVO 2V7EA 1XZKA 5G4KB 2RFLA 2REBA 4KH1A 4PHHA 2JFOA 2PSDA 4PSCA 4G2TA 4EARA 2QTWB 2JC3A 3HCAA 5E6UB 2AXUA 2ZAYA 5BNFA 4M9QA 2CJXA 4KGDA 4BQNA 1DFIA 3MBIA 1T5OA 2XZLA 4QJ3A 4DXDA 1XD8A 2I71A 4MGZR 1SU4A 4Q03A 2HO4A 2HDHA 3F8TA 4X85A 2OGSA 5G3YA 2O0HA 1B6RA 4EHJA 1EM8B 5GVRA 1EFAA 1RC1A 1XZMA 1DIGA 1T3GA 2VDUE 4AP9A 1AC5A 4L2IA 4QULA 2Q2OA 5EGNA 2AMYA 2HF7A 1K75A 4L15A 1NVVQ 2IT1A 3JQFA 4KFRA 5FBVB 2XB4A 1F4LA 1N3YA 2FW1A 4I1SA 3LDUA 2I55A 4HEA1 2R87A 3N0RA 2AGVA 1I2CA 2JJQA 3NV7A 3T9CA 4KXUA 5CFLA 2A92A 2HW8A 1QHHB 4BATA 3V42A 4EENA 2ACWA 3KC2A 13PKA 2CFOA 2WE8A 3QQ5A 1E2GA 3EF1A 3EOBI 3RADC 4GQIA 3WL3A 3D6TB 4HWOA 4QOIA 3O7WA 2AWNA 2OVFA 1EUQA 3PEYA 4P3OA 4JB8A 2ODRD 1YDGA 4EKYA 1MA0A 2GK7A 1Q0TA 4GPAA 1MJHA 4S1OA 2GCOB 5EZQA 4ZJUA 1E3LA 1Q7GA 1VFPA 1DX9A 4YHHB 3IUBA 4CPDA 3H2GA 1GNSA 1XLVA 3BWDD 4KXWA 1GJRA 3CUUA 1NP6A 5F4BA 1JEYB 1F6WA 3JQ7A 3KVYA 3ZQUA 2DHEA 3L6OO 3V3KA 3P4YA 3K9LA 3D3WB 3HR4A 1E9AA 5AUPB 4PBSA 2AI1A 3U48A 4A8HA 3WYFA 2D0DA 3USZA 2QXUA 1VP9A 4YP6A 3F4KA 2HCTA 2CDCA 1PSDA 1PEAA 1U2TA 2OZEA 1WX1A 3NHSA 4KB5A 4PO8A 1OE0A 1C1XA 1T8TA 4Q82A 4XJSA 4YMWA 3TGWA 4HAUA 3W0LB 4CIBA 1DCTA 4CU2A 5AKZA 2DBRA 1J97A 1WZUA 1YZNA 3GMDA 1XTVA 5CLQA 4D41A 4Z6KA 5FYDA 4MV3A 1IZ0A 4HF7A 4L74A 4GZMA 1J42A 5FB3A 3UA3A 1G21E 3HFRA 1BC5A 3QPCA 4HN2A 2Q3DA 4IAOA 4M9RA 5HVNA 2VAPA 2BFMA 2VDWB 3FMIA 5IS2A 2GBGA 3K0AB 1C7IA 2R6AA 5GZ6A 3GZ4A 4KREA 2ZXEA 4J7AA 1EEHA 5KAPA 3MWGA 1UZNA 3Q9UA 1FJGB 2JBWA 2IIQA 3F5SA 4KXNA 4BP3A 3ENZA 3K1ZA 3IQFA 3DPSA 2JATA 3TDNA 1J8YF 2DGDA 5CG1A 1MGOA 3AF5A 3R1IA 1ADYA 2AT1A 2YIMA 2XDAA 3BL8A 4CQMB 2W42A 1SRRA 3X1KA 1ENPA 3GJ3A 4OL9A 4TZKA 5EMJA 1VE1A 3VSBA 3LOQA 4ZAGA 4AMUA 1MTZA 1SBCA 2NADA 1RYMA 3IALA 1MO5A 1G38A 3RVMA 4B40A 2W7TA 1DULA 3ZHCA 3IKMB 5C7IO 3P0EA 3HUUA 1XAGA 4F9EA 3LY9A 4A91A 1CY6A 3CMCO 2QD1A 1RPEL 3AFOA 3GDFA 3GEPA 5IAEA 4HUQB 3T9FA 1P73A 2AJ8A 1JDNA 4BECA 1GTG1 3HZHA 2PZEA 2AJDA 3BXOA 4JB2A 4GKJB 1SCBA 2PZ8A 3IEKA 4LJ9A 5DBHX 3RUFA 3WKCA 3ZWQA 1ZJJA 2I80A 1SBZA 1II0A 4KIUA 1ZAKA 1Z8DA 3BXEA 1Y3AA 4TSFA 1CRZA 2XQIA 2QLTA 5CB4F 2ISCA 5BOSA 3KZCA 3LBFA 3LD9A 4PE5B 3GZTB 2DT8A 3TWOA 3ORQA 3HBLA 1RZ3A 2GHTA 3N58A 4R7GA 1IWOA 4HDSA 5DXAA 2G9RA 1WCXA 1IJBA 3OPVA 3D4PA 2AUMA 1VE3A 3LC0A 5DTEA 5LLDA 3RBVA 2IE0A 4IA8A 5JRZA 4JQDA 2XH8A 2YJNA 3L4BA 1XCOA 3ULKA 5JXGA 4YROA 4I81A 1FSFA 1NQOA 2FSVC 3PYLA 2FFBA 3DZIA 3DMHA 5LMCA 1G9SA 4AAYA 1UZAA 1W0CA 2QTTA 2Y1LA 1JQDA 2X42A 4NMLA 3UFBA 1Q74A 3DT8A 2DFKB 5IYZF 3RUEA 3R8FA 3WGIA 2WC1A 3V80A 3W77A 3AHHA 4NBUA 2C96A 3W5VA 2ZB3A 3R74A 1E2KA 2TMKA 3ACBA 2DTXA 2RHHA 4QXMA 3RAJA 5JCPA 3TQIA 1FYEA 1JR2A 1U3UA 1R0WA 2ZTSA 2P7HA 4URXR 1QC5B 1GUDA 3K5PA 4RADA 5JV5A 2ZYWX 3DE3X 2UV8A 3OM9A 3SZRA 2CVQA 3TAXA 3AIKA 1FRVA 4YPOA 4KR6A 1F2TB 3K1AB 1OC4A 3ZYZA 5CA0B 5E3HA 3RIYA 2EZUA 3V1YA 4HNUA 1MT0A 4RTJA 1X3LA 4XAQA 1B8UA 1EVJA 1PUJA 4TLEA 3THYA 2PGOA 3H0CA 1QH9A 2QPTA 2IVGA 4D02A 1U6JA 4D0NA 1ZPQA 3A4YA 3PFWO 2B5VA 3A7EA 1TF7A 3FZEA 2FZ4A 2GEUA 2W4IA 7ADHA 5CNJA 4X60A 2P0YA 2AX3A 3SBDA 3W5HA 2DYKA 3L6RA 1J20A 4RM3A 3UJPA 5J5AA 3SX0A 3MK31 1ZD2P 2P9JA 2WTEA 3HB7A 3LDGA 2H06A 5CJ2A 3RASA 1GV1A 4EITA 3BRCA 4LSWA 1IC6A 5C1BA 4YPFA 3GJZA 1JHPA 1R5BA 2X9QA 4JUAA 3EDYA 4PR3A 4O6VA 4PSUA 4WUVA 5LZ8A 3T8YA 3VI4B 2HJSA 1JE0A 1RZUA 2OO5A 4UMFA 4YRFA 2OXIA 1JG6A 1J8QA 3D7SA 3O4GA 2JZCA 2H92A 3I9NA 1A9QA 1QH8B 1VG8A 4RF4A 3QBVA 4WWHA 4ENUA 4ZGWA 4EPTA 2JZNA 1PJQA 3A9ZA 4ZKEA 3V2UA 3RYCA 3O7MA 4I8XA 1T8WA 2NUTA 1ZINA 4XJVA 1T3ZA 4CR8A 1ZOPA 2XZOA 1EBFA 5C0OE 1ZJWA 4FEEA 3VOTA 3OPYB 4HXGA 2BHSA 5CCDA 4D4JA 2G71A 4D9EA 2CEKA 3D8HA 5HFAA 3FX2A 1HDCA 4PF1A 2HZ7A 3GEBA 4JFRA 3FDZB 4X3PA 1MB0A 5KAMA 1UF9A 3BB1A 4LV5B 1B8PA 3BTUA 1U0OC 3AKCA 4O4JA 5B2ZA 4CIVA 4F4UA 3W1VA 3IOYA 2BWJA 4NU5A 4Z2YA 3LT1A 3G0GA 3U3XA 3BIOA 3VHRA 3NJ8A 4H7DA 4TYMA 3IDQA 4GX2A 4KP7A 3VHQA 4BNFA 1E9BA 5AW4A 2FA9A 3ILSA 5K6TA 3VNBA 2XIJA 3FOZA 4JL8A 2MR5A 1FX0A 2OR3A 3JYHA 4CMJA 4EJSB 4CQLA 1F12A 1LI4A 3BK2A 4ZU3A 2ANCA 3ER6A 4FTWA 1GL7A 2DKOA 4JLDA 5K6AC 2V0GA 1BH2A 3VK0A 1FP4B 3MJTA 4XR9A 2PL5A 2R6DA 2Y68A 3IAXA 4X7RA 3B6JA 2G67A 1F51E 4UKDA 3TD6A 1TAGA 2CXOA 2ODNA 1UBRS 5CTJA 3IMEA 3QPUA 4GVLA 1UKEA 4C22A 4UE6A 3HFGA 4YJFB 1MZPA 2YUTA 5DIFA 2QM8A 1N6IA 1XD9A 2JJ2D 1KH1A 4ARVA 4F84A 5F5NA 3HWSA 3ECSA 3H8SA 1VCIA 1GGEA 3AJ8A 4INPA 3V00A 3U6BA 2RHJA 2I6QA 5AI9A 4CI9A 3D5EA 4DLKA 5DX8A 2I9PA 3WGNA 5LIRA 4MVJD 4P80A 2ATCA 5ICSA 1A8SA 4EYEA 3C5WP 2WU3A 4J49A 3DDNA 1UTXA 3PL1A 5IBPA 2PBLA 1DQPA 3C70A 3W2HA 4OGKA 1WRBA 4WESB 5A4DA 2ZK7A 3G0TA 4HGOA 1XMJA 4BMXA 1O4WA 3BREA 3RBXA 2C98A 4ROTA 3ZBQA 3GCGA 4JVLA 1U0EA 3H9JA 3VNRA 4PZAA 2CLMB 1LNQA 2IZ0A 1WW8A 2AOTB 1XXHB 4TWBA 1VDZA 3OMTA 4FFMA 1M75A 1G19A 2YS6A 3DAOA 4Z5DA 2W5UA 2GPBA 2MJLA 4KLRA 1U2DC 4GYKA 4GUAA 3IILA 5C8YA 3CHYA 4R2WA 4A8PA 3TZCA 3V1TC 5D1HA 1NVUQ 7MDHA 1DJOA 2V4ZA 3ZUGA 3Q8LA 2PBFA 4YUVA 1N7JA 4L85A 3H99A 3HVJA 1OI7A 4PBRA 1E96A 1WF6A 4WZBB 2I7XA 4N7JA 2QUBA 3ND9A 5HKLA 4G5YA 1A2QA 1X14A 2ORED 2EWMA 1H2AS 1X13A 2O3QA 5JAOA 2XXAB 1ECJA 1Y7TA 4CL3A 2PKCA 5ITWA 4DRXA 1Z7BA 4I4CA 1A1VA 1TQ2A 1RJ9A 3CV3A 3IT2A 2BMAA 4NX2A 4DIFA 1G8GA 2X0FA 2ONCA 4EPRA 1S3FA 4JGGA 1VRWA 2K7ZA 5EI5A 4EJ0A 4KXYA 3A31A 1SKBA 3KR1A 4IMPA 1CY7A 4BASA 4KAJA 4KQGA 3JVVA 1RD4A 3S2IA 3L77A 1T34A 3FVWA 4FHDA 3GZDA 4O8BA 2FEKA 3MT9A 4RA6B 3RBZA 4C0AC 2P9QA 2WHXA 5JJCA 4GLJA 2XXBA 3AKYA 3W3ZB 1NNSA 2FLVA 2Z8YA 4F5ZA 2WW8A 4TXLA 4WK4B 5CFRA 1WB4A 1YE5A 3EODA 3FUCA 4LHSA 5D5HA 5AM1A 2C2KA 4FU0A 4ZV7A 3T0FA 1Z15A 3WJ7A 4M1TA 3WI7A 2NZWA 4DM4A 3D81A 1W0JA 2ECFA 2PXQA 3RVDA 2AQHA 2VJKA 1G21B 2IHBA 3RYIB 2MSEB 1RM5A 1J0BA 2IHVA 4ER0A 4YWHA 4D74A 1LQTA 2FI1A 1U3DA 5DTQA 1LBTA 2WJ6A 3MSCA 5IC5A 1J1ZA 3ZY4A 2FFRA 2IY9A 4ENSA 7REQA 4AS3A 5TQ2A 5HYVA 5A3RA 3T4XA 1VKOA 3DO8A 5TVKA 2I66A 3AVTA 3F0TA 3NP9A 1L1EA 3LHKA 3GLUA 1ORRA 2WJZB 2VLBA 1ODTC 3GJ8A 1QP0A 3O1LA 2MYPA 2H0AA 3MXTA 4PG7A 5GOZA 1OFVA 1CJGA 3LVBA 4GMHA 1XZLA 3AJDA 2BFNA 3DDZX 2JCXA 2C8JA 2QZ4A 1U0JA 3KS9A 2G5PA 3PT9A 4JEUA 2VEDA 2XMQA 2JHPA 3EIEA 1SBHA 2W2OA 3HEBA 3LGAA 4GOOD 2HMVA 3L49A 3PR1A 3CPEA 9MHTA 1DOZA 4F12A 5SY6A 3T3MB 5JCXA 3PYMA 3G88A 4KFUA 2EKBA 3BXZA 1E5XA 3DO5A 2FUCA 4P31A 3DGEC 5IVDA 2QR3A 3WNZA 5JLJA 3ON5A 1A76A 3VPFA 3F47A 5JHGB 1T4MA 1UADA 2FYTA 5JXIA 3THWB 4PZZA 3SY8A 3TEJA 2DX7A 2KBEA 4UMVA 2AN4A 1ETHA 2LVBA 3K2QA 3V4VB 1XR3A 1NUTA 1BKDR 1RKXA 1B4DA 3IA7A 5GJCA 4CKCA 1B1AA 1NUSA 3E22B 3QJ5A 2DWOA 4UOZA 4M37A 2PMDA 2HXYA 5JO0A 2VJMB 5IUNC 2H2HA 2GZHA 1Y3CE 3RS7A 3IXQA 2A4KA 4EF6A 3JWJA 1QX4A 4I4IA 1GITA 1RWQA 3BE5A 1PFVA 3O21A 4PVDA 3X1YA 4YG4A 5IKXA 1VIVA 1Z0SA 3G2LA 1K63A 5IX8A 4X8HA 3RSFA 1Z8NA 4YR9A 1DZIA 1K7EB 5IPFA 1GYQA 2IEAA 1EHCA 2H8RA 3OM1A 1C1HA 4PG4A 2XUGA 4E32A 1O0BA 4LJ6A 1FFGA 2DFNA 3KHTA 4O5AA 2X5KO 4JA0A 1HLPA 5H0IA 5LZ2A 3KHSA 3OP1A 3AWIA 3BD9A 1M3SA 2X4DA 2DLCX 5FV4A 1V48A 2QM7A 5E4FA 5AJZA 3UGKA 3IQHX 5F2NA 6Q21A 1RHMA 2RKOA 4HATA 2XNCA 1J4AA 5I8ZA 4OLFA 2O52A 5B7NA 3VR1A 3P0RA 1WHSA 4M9SA 4D4IA 3A1FA 1YGYA 1ZMXA 5ED4A 3TB4A 4HS9A 4TWZA 1Z5WA 2YV1A 1SVOA 1EGHA 2BBWA 3NBFA 4ZYYA 3IQXA 3RTAA 2QX7A 4TL9A 4OQXA 2WB4A 2OYCA 2BGKA 2X0IA 2Y92A 3G59A 3HK2A 1J2RA 1YKGA 5BYJA 1H4QA 4E4RA 3RRBA 3M5DA 4FDMA 1A9SA 5GAGi 3I04A 4I46A 3CW8X 3AVQA 5ALYA 1N6LA 1O58A 4TKUB 1PLKA 4WT7A 4FSXA 2X2EA 2OOSA 2FQXA 1XU7A 2BGLA 4YJ2B 5EMKA 5FPSA 3UC9A 4BBZA 4UEKA 3Q9NA 4R81A 3WK5A 2GRLA 3M6UA 2BFBB 2O2YA 3O0TA 4KHZA 4RVOA 6CHYA 1QU3A 1XZGA 4LHZA 1LXCA 3R6DA 3AGQA 1AQLA 1SUBA 1ZVMA 4DCJA 1GVNB 1PGQA 1R6BX 2FKAA 3DMYA 3R5XA 3TNFA 3TPCA 2LTAA 3DDSA 3OQ6A 2CV2A 4KQ6A 4B6FA 2G9QA 4J4BA 4BP1A 1MZVA 3KQWA 3R5KA 1UDXA 1V95A 4B9EA 1E8NA 2O0MA 2OFOA 2G8LA 3WMFA 3UK6A 2QX9A 3CX4A 1S2DA 4GYJA 2FR8A 3ZK9A 1Z0AA 2FZKA 1E4YA 1P0MA 2WLSA 3KHKA 3WHKA 3RYTC 2PZKA 3R75A 4CM6A 4C5CA 5HIMA 1NDHA 4NNOA 4BO3A 5BNWA 2O8DB 1E4EA 5JSZB 2P9GA 1J99A 3E5NA 2JGDA 1AVTA 2I7VA 3FSGD 3HDVA 4KPGA 5ALLA 4CMIA 4J2TA 5K7SA 3HDHA 3NJ4A 2PZFA 2Z3ZA 2H16A 4JLKA 5IXYA 4AJHA 4WXMA 1LPMA 4M8KA 3ADKA 2J4FA 4XA8A 3GAZA 2QI9C 3ANLA 3N87A 3AEQB 4QXQA 3K32A 2WAMA 5DPMA 1JQAA 2RH5A 4DE8A 1AURA 2CLLB 4XW2A 5KOYA 3ILHA 2ZW9A 4NHEA 3SCZA 1Z0UA 3JASB 5DT9A 5K51A 3ZU2A 3NYRA 3REOA 3GFBA 1DIAA 2OO7A 1LF0A 3F9CA 4WA8A 3VAZA 1FRNA 3L92A 4EHKA 1C7JA 4HDRA 1CE8A 4IV0A 4OK3A 4X4FA 1BEUB 1L5OA 1QOZA 3ANSA 3V5NA 3VU0A 3WWEA 3ZWPA 2WLTA 4IVZA 2QT1A 3D6UA 4J43A 4BJ1A 1FYXA 1XQWA 3BF8A 3G1UA 4YCDA 4CIAA 4G8BA 3EXG1 3KQVA 3MWDB 1XWIA 2E55A 4IO0A 1Z6PA 4HAWA 1BXGA 3EZ2A 2LWIA 2Z8ZA 1JDJA 3MWYW 3GF4A 1K89A 2PH7A 4J2OA 3IELA 4A26A 6REQA 4P93A 1G60A 4ZYTA 1VBMA 2BRUA 4O4LF 4Z59A 3URMA 3ZK7A 2PE5A 4N5LA 4ZVKA 5L3SA 3BMNA 2EZ8A 3SE0A 1CUHA 1EIZA 5THXA 3AHDA 4N01A 4ZVQA 1WCWA 4IIUA 2OZKA 4HEQA 4FOOA 1M6VA 3V4SA 1SZDA 3MGGA 3SJAA 3Q9SA 3RSHA 3ZU4A 2P2NA 1GAWA 1K6IA 2PNFA 2LXNA 1Y4UA 5DULA 3SZGA 1J0CA 1C1YA 3S7TA 3VR6D 5LU9A 4YDSA 2CMHA 1Q14A 1JIJA 1XWWA 1FQJA 1JS1X 3OJXA 5F5LA 1J70A 5DNDA 5BYAA 2IC5A 2FTKE 3P94A 2RGNC 5EP3A 3SX2A 1ISJA 4DFDA 1AMOA 1SURA 4L95C 4A6XA 4IP0A 2VSFA 3NC1C 1VJRA 2D1SA 2MMGA 3EEIA 1Q20A 2OHFA 1U0TA 4V38A 3T35A 1OBHA 3O3MB 1ODCA 3LUFA 1ENOA 3MCTA 4WK2B 5EQJB 2OM6A 1XDDA 2YY6A 2O14A 3KYBA 2VP4A 2GGSA 3RUCA 2O7SA 3Q98A 4KE7A 4EMUA 4DARA 1DEHA 3NEPX 1YB5A 4ZOQI 3PTAA 1EVIA 4QU8A 3OLWA 4UFPA 1NHWA 4FYIA 1SIWA 3C8HA 4EHLA 1APBA 4CLOA 1P75A 4Y67A 1A27A 1G2OA 2RIPA 5IT5A 3KTOA 3SHWA 4MVWA 5HXAA 3EPJA 2DULA 1C9KA 5TF0A 1M0TA 2FPLA 2G7ZA 2NV2B 3NHAA 4BWFB 3VPXA 4DWWA 4JP5A 1ULHA 4EYQA 3O9ZA 3AVXA 5A4IS 4QUKA 2LYJA 1SY7A 4O4IF 4OHZA 3JQAA 4D96A 4ZMRA 4XUDA 2QA5A 1OX6A 3AHCA 4Q3EA 3S70A 1QHYA 3FUVA 4D56A 2RHDA 4JCCA 1T1GA 3ADOA 3M1YA 4P5DA 2BIFA 4GOLD 1ZXLA 1B8NA 4ME6A 5I7HA 2ZIWB 4QQ8A 3NNSA 1YI1A 3ZZTA 5HJ7A 5K0BA 1A8UA 3ELWA 1Z5NA 3P9SA 3R3HA 4CR6A 4LXXA 3W7AA 3KIPA 3MMNA 5EXXA 1BX0A 1VZ2A 3KYDA 3L8CA 4Q3KA 3ZWNA 1A3CA 4X6XA 3Q2OA 1KY5A 1G5TA 1SPXA 2JW5A 3SSOA 1QV6A 2H1VA 3FSJX 3QY0A 3W1EA 1FDIA 4Q21A 4XJTA 4TWJA 2CDNA 5C31A 2ZAOA 3A1DA 1RYHA 3QLTA 2P9YA 3B20A 2R1UA 3B7WA 3KJFA 4LJRA 1HFWA 5FNVF 5TSDA 4R4JA 4N41A 4UCQA 3ROQA 1WP9A 2FOLA 1JHUA 4GMGA 1P77A 2ZT7A 1EWTA 1LX7A 3PUYA 1NG9A 1LCCA 4D5GA 2YTZA 2IOHA 4J16C 3H4IA 4LC1A 4Q4AA 1RLIA 2P5UA 1D03A 2F3RA 1XDWA 4FBIA 3GHYA 1JXMA 1UT8A 2P4SA 2RGAA 3MAGA 4MQ5A 5IM4A 4XFJA 4OMFG 2HF2A 3PB3A 2OVBA 3ZWVA 5J2UA 2XE8A 4R51A 3ZE7A 1H23A 3S99A 2GJ8A 4LE1A 4Q3CA 2QTVB 5K3DA 3IAUA 5EE3A 4I6UA 1NI4A 4DDTA 5LR6A 3RI3A 4I1OA 3P9PA 2B20A 1KDVA 2VBIA 1CB0A 2MSCB 3V4FA 1Z5ZA 3WISA 1VL6A 4W5TA 2OKGA 3OE7D 1LLQA 3TNJA 5LWHA 3VUFA 2B25A 2HRBA 4C05A 2GO1A 3FYUA 1ZHOA 2HYIC 1L7AA 3ZWKA 1RLMA 1EZ1A 1EG7A 4FONA 4QYSA 3VPSA 2PU5A 1W96A 3FZGA 3G2QA 2BFWA 3S3TA 4G09A 3DMTA 5K0GA 2C1ZA 3NT4A 1NASA 2A2ZA 5DT2A 2XMPA 4MQFB 1NBMA 3HVUA 3PIRA 4FGZA 4N0QA 3S5JA 3GDHA 5LQKA 3WGZA 3GWZA 3A9XA 3BFXA 3B9QA 1K6XA 1UPAA 2RCNA 3GWGA 4WFKA 1J39A 4OQNA 2JLAA 2PRZA 2A5GA 3FLEA 1X87A 3ANYB 4Z0NA 3ZDXB 3S81A 3ZZNA 5F7ZA 2QUAA 3IT1A 3BS3A 3HCFA 3QX7A 4EHAA 1IQRA 2A59A 4X7PA 4KGZA 4OYHA 3WG9A 3R0VA 4OQMA 1C3JA 1YS9A 5DYIA 3UUEA 1E6MA 1E3IA 1Q7CA 5TS2A 2QZSA 4G4IA 2PUAA 4XD7A 3SSAA 3ZKAA 1TVKA 3BSWA 1BW9B 2J67A 1QZZA 1U3WA 2X9GA 1X7WA 4I6EA 4KVGA 3TTWA 5KHOC 5A3VA 3EY9A 2YHUA 2AE2A 1E1MA 1WABA 1XJ0A 3QSGA 2BFPA 4PZCA 2Z0MA 2FHSA 3DLPX 3T1HB 3ML1A 4MWZA 4NMHA 4HLCA 4AMBA 4ZVOA 2JIQA 1R9GA 4YJ3B 2CLCX 3T1QA 5AW6A 2XKJE 4QJIA 2WM9B 4D9JA 1AMNA 2C2WA 2FMHA 1H9CA 3SYKA 2A9FA 3J80A 1GPJA 1YQUA 4MP8A 3TJZA 5JY6A 3K6KA 1DAIA 2CEAA 1DGQA 3GW8A 4DVGA 2BPOA 1KK3A 4YWJA 4OB4A 4L3VA 2F3QA 2WTBA 4FFVA 5IFLA 3OJ0A 2V7TA 2FG5A 3ET4A 5IAAA 5LQAA 1YXMA 2RH4A 3BRSA 3GLHE 4LIPD 4YEDA 3LZ6A 4EELA 3NHJA 3QYFA 4WFJA 3J81A 3LFHA 4B82A 3E3AA 4DMRA 1H22A 5DP1A 2W6QA 3P52A 3T34A 5A4KA 1ZQ9A 5AI6A 2FZLA 1PDVA 1DS6A 2CWWA 2DHCA 1S89A 5JHHB 4I1YA 2XZDA 2OCPA 3FPKA 3RKUA 1ICEA 2KEKA 2Z43A 5DCUA 3K0BA 4N6GA 4OGFA 4V0NA 2GS9A 3F8SA 1V7PC 3FWKA 5AK6A 3QX9A 4I5GA 4FHZA 2DQ4A 3VNSA 3B89A 4PYIA 3QQ6A 2FN3A 1YDHA 2X9VA 3SHTA 3TTUA 5L3VA 1BN6A 1JU9A 1A2OA 1L7RA 4K40A 3OFNA 2EFCB 2OGWA 2PIDA 1YVEI 3DFFA 3ZHSA 4DNFA 1KFKB 1D2NA 3BSFA 4GDFA 2VTBB 1W73A 2BGJA 3QITA 3RVLA 1GUZA 4ZCMA 4YMLA 4RTQA 3AKEA 1PBNA 4JS0A 2GEFA 2C5LA 3AX6A 3PK0A 3U7JA 5K3CA 5ABPA 4YMVA 4RNCA 5E7IA 2ZBDA 5EHXA 3LHSA 2CUZA 2W43A 4H6PA 1UXHA 3EFEA 3ZE6A 5B6IA 2R00A 4L73A 4MV7A 3TKAA 1RKBA 1AIPA 1Z0FA 2HHLA 4GPZA 5B55A 1QCDA 4Y1RB 4Z4GA 4EUFA 3OP4A 2V7QD 3KWMA 3UJ9A 3CVYA 1WHTB 5CXUA 2QQ5A 3KB2A 4RD1A 5DN9A 5KU1A 3GFPA 1J0AA 2FN9A 4DIBA 2WFLA 1RT9A 2XMZA 2Q5JA 5LYYA 2O1WA 1FSSA 2YN4A 3CO0S 3LBNA 3EIFA 2H4YA 4KYUA 2NSLA 3BFPA 2BTQA 3J7AC 4KRXA 2XOKD 2DFDA 1SKMA 2FW9A 2CL5A 3E35A 4O2BF 4F46A 1YKFA 4YHBA 4RY2A 1FUUA 1T1RA 4N82A 1N33B 2Z4TA 1SCDA 1KK0A 1PZGA 3FPSA 3LS2A 2BNNA 1L7DA 3L8HA 3QPAA 3QKWA 4Y2HA 2QR5A 1MAWA 2QVXX 3DDCA 3L7IA 4JL5A 3PGLA 2LCFA 1K6JA 2B7BA 2PO7A 1U8AA 4FOTA 4DLZA 4EG6A 4LI3X 1FLNA 2QD3A 1JYSA 1K6EA 1C29B 4NZYA 2WZCA 4EF5A 1SFRA 4DDKA 4ISBA 3ZHIA 3SVTA 4EGQA 3F7OA 3BDIA 821PA 2H9IA 2IEDA 2H9AA 2P27A 3RSCA 2GAOA 4Z1MD 1JQLB 3WHPA 4RJTA 3NAMA 3R6LA 2FSHA 2O5CA 1RRCA 3DDWA 3EC1A 3PRJA 5FTJA 3H13A 3D4BA 1NATA 4WECA 4Y9TA 2H85A 5JXWA 1GEGA 4ENVA 5BVGA 3G7DA 3HDTA 3CNEA 3N6XA 1M1YA 4I6TA 1OZAA 2ZDHA 1JDBC 2OV4A 4IKOA 5FQOA 1ADFA 2AJTA 2W8ZA 4GI2A 4AF7A 2D5IA 3OIWA 1UJ2A 1AQ6A 4HGQA 3TLZA 2DH6A 3LC1O 3U9TA 4YCCA 1UBNA 1O6FA 2PWYA 3FCOA 4KSYA 4S04A 1YJCA 2IXBA 4MGYR 1SXJA 1HNNA 3MJDA 5KDOA 4P82A 2EL9A 1K8ZB 4LRSB 3NAQA 2BGUA 2H1RA 3PJDA 1ZVVA 3HA7A 4XD2A 4FI3C 2QRVB 5KZMB 5AVJA 3VR3D 1XZDA 1N1DA 1I3CA 2YVQA 3EG5A 1K4YA 3KEGA 4Q4LA 4Y42A 3NXSA 4KFTA 2CDAA 2I8LA 1LQCA 2XCJA 2OBFA 3ORFA 1U5BB 3DOFA 2Q5HA 3NT5A 3QUCA 4YUWA 4E21A 5J3JA 3V8BA 2LCQA 3WK6A 1XTTA 3IJEB 3K9QO 3AR3A 1P91A 3FM9A 3K9NA 1OB5A 3G79A 2O8EB 4GMXA 3JAWB 1JKJB 2E4XA 3I4CA 3D4IA 3O0DA 4QXPA 4WINA 4YDHB 4BNKA 1CU1A 5TLSA 1ZONA 1YWGO 3QPDA 2XDQB 4PCVA 4ZVLA 1ZEMA 4YLEA 5EYPA 2HUNA 2JVJA 4CUZA 1RYEA 1CUEA 2V5UA 5EKTA 8ADHA 2Q3HA 2JFHA 3B1XA 3QNUA 2IPAB 2HREA 1P5JA 3CEHA 1W5SA 4B2YA 1JG7A 4LBVA 1I1HA 5EXPA 6AT1A 3OZVA 3QVVA 2R1VA 1K7XB 3N8KA 4M2LA 3USCS 3M2TA 4WV3A 3P20A 4Z53A 1QQ6A 4MX8A 1NZFA 3QQPA 3BILA 3NPMA 2OFPA 3P9IA 4F1JA 1WXWA 3UBMA 4UTNA 3GEIA 3TUJC 2B37A 2AQIA 2SNIE 2WJGA 3HI6A 3JV7A 3ZQJA 2HHAA 3AUSA 5KSYA 2O8CA 1CQJB 1R0LA 1RQXA 4YECA 5JVDF 2FR1A 2JIZA 1I6KA 4PNZA 2D0IA 2PMKA 4NWIA 1AKNA 1X80B 4NCAA 5KOJA 2PIAA 3ETLA 4CRWB 5AK3A 1U2RA 3E53A 1V3TA 2FX2A 2BM0A 2NUPA 5EWJB 3ZE9A 4NYJR 1BMFA 3SZ3A 4KXFB 3A04A 4FE3A 2C84A 3ILVA 1DWQA 2UYYA 2ZRAA 1B2LA 1QAMA 5C52B 1G9TA 5JANA 4UVDA 4B74A 3VWSA 2XUIA 5LA6F 3RC3A 4M7RA 4X92A 4DV1B 1Q11A 2ZJ6A 3I8XA 5ECDA 1FNBA 3SAJA 1KZ4A 2DBYA 3PGXA 4X4BA 1G5IA 2X1HA 3N2ZB 4ZK2A 5C5CA 3QX8A 3BT7A 3HBNA 5LB2A 3IP8A 2YYSA 3P1JA 1ADGA 2HWUA 1B1CA 4ID3A 1KU0A 1ZBDA 4G01B 4BUJA 5AI4A 2ZDGA 3UB2A 1L7VC 1XALA 4V3CA 4TL7A 3ZD8A 5IJZA 4M1SA 2WIJA 2CBXA 4O33A 1AS3A 4YPVA 1ZU4A 2V1UA 1WMFA 3W7VA 3U7EB 2LDBA 2ERXA 1HL7A 4B32A 1FRQA 1TAQA 4MS4A 5C1OA 4UUBA 1JP7A 1HT0A 1AZLA 4V39A 1DEAA 1QFSA 1G59A 4PTYA 3UVEA 2R84A 1E2MA 1XRJA 1MNAA 2FMXA 1JG3A 2I2CA 1TKCA 3NQ41 3BXPA 1OBOA 2YYZA 3DHWC 2VPPA 4YQFA 2LYLA 1Z5UA 3VZDA 4JOCA 2VLIA 3ICOA 4O4HF 5JCJA 2IXAA 1P1CA 2Q1YA 2NO9A 4L16A 1MGPA 4CMEA 3FR8A 3EFBA 1M7HA 2X7JA 3INNA 3AIMA 1RHKA 4UW9A 5KX5A 3EUSA 1S9DA 3K0EA 1JVBA 1OTYA 3ZKWB 5J1TB 1BXZA 2R3SA 1WDTA 2Z09A 1QIIA 4TRJA 1U8UA 1FFDA 2C99A 3CKMA 3OG9A 1G6KA 4L0CA 3O4FA 3HABA 3MTIA 1MIHA 4LYEA 5AJTA 3VZPA 4F6RB 4EYSA 4CKEB 3GUHA 3RUIA 1VMKA 4F93B 1NYTA 2WUEA 4EL0A 5EJ7A 1O03A 3X2FA 2JARA 2NXEA 5DNWA 1NU8A 4CTOA 5BMOA 4QXOA 5D3MA 3VZRA 3ZY2A 4F3TA 4OXXA 1EFVA 3CTMA 3EGEA 1FVHA 1OI4A 2DUJA 4DIEA 2O8FA 1YQEA 1U4SA 3OQOA 1KAHA 2CMGA 1CIVA 2NQTA 3QENA 1OAKA 4M22A 3AVOA 1M0EA 4DDWA 3P4UA 2QBYB 3TR0A 1IL0A 3T7SA 1OTHA 3QFHA 2AEJA 3LPCA 1B76A 2R60A 2OWDA 1S2IA 1T9GR 4MRPA 4MK4A 4IWXA 4E70A 5EAIA 4PVCA 3GLHB 4WKNA 4IGKA 4TMZA 4K7JA 3DE0X 2ZJZA 3BIJA 3L8EA 3CH7A 4OB7A 3RK4A 2VYVA 2IPNA 1T9ZA 1OYWA 1W46A 2YWXA 1FSGA 1T8SA 3N8DA 5JDIA 5KS2A 4P22A 4J0CA 3QX3A 3UOWA 1X1DA 3MTGA 2Y0EA 1A71A 4PIPA 1UXIA 1P7VA 4IIHA 4WK0B 3T3IA 1WPGA 3U56A 3AXSA 4H4EA 3AR4A 1WUHS 3S27A 3DEJA 3EPLA 3LOPA 3TZEA 4BNWA 3RUDA 4LS3A 4DANA 3QYJA 1P2SA 2FQWA 1IBMB 4BUCA 1VJTA 3IAEA 4CV3A 2EDAA 4JR1A 3OC0A 5HRCA 1L5RA 2COKA 4HNRA 1MO6A 2JGMA 4P4UA 1OWLA 2OV8A 3AONB 3ECAA 4IJWA 5CRIA 5H68A 3RJMA 4B8ZA 2ECPA 4ER6A 4X24A 5AW5A 5HHTA 2V97A 3T38A 1JAHA 3W90A 1JIKA 3STVA 4G3XA 2QI9F 1U2SA 1Y5LA 4PHGA 5I7WA 2VJOA 2JZOA 3Q40A 4GOJA 5E6UA 1WXEA 1LPNA 3CF4A 1DDOA 4PRZA 4MWEA 5AW8A 2WIDA 3TMYA 1DWKA 2IQ5A 1PHRA 4RTLA 1U3VA 4ZCQA 1F2DA 4I5FA 4W6QA 1QWSA 2QU7A 1MC5A 1OFHA 3AV3A 2VPTA 4KO2S 1KARA 3K15A 4Q34A 3TD9A 3ELYA 1HOTA 3TSZA 3WGOA 4E11A 1P4GA 4FMBB 1R10A 2CKMA 2OHGA 4LNUB 3CUKA 3DMNA 2ORIA 4Y2GA 4CEJB 1CFJA 5ECGC 3HCNA 1H1DA 4IOLA 1TJ3A 1L5GB 2GBLC 4NEGA 2EHJA 4IJQA 1Z25A 1P5FA 2ADMA 2EG5A 3UMRA 3LCUA 4O4JF 3V9PA 2AZDA 1OX5A 1THMA 4H1TA 1UXCA 4POOA 4GSLA 5TQVA 3TQHA 2ZYSA 1Z22A 3D6AA 4XPIB 5DW0A 4RVHA 1RACA 4G1VA 1JTFA 3HWWA 4QTZA 3A6DA 4W9NA 3EQ9A 3UK0A 3JQ8A 4AO7A 5KVAA 1PR2A 3V9AA 4JT8A 2PV0A 1VPEA 2IYFA 3ROMA 3GJ4A 1UCFA 4NENB 1JDUA 3GEMA 5B2FA 2VK2A 1RQPA 4F6LA 4CYMA 3UAYA 5JPDA 2N0SA 3ETHA 5E9WA 1M5TA 1KZHA 2F17A 3L7DA 2JL1A 3OLVA 3RC9A 4PFJA 5KTSA 2QW0X 3DT6A 5AWFC 3G0OA 3UAWA 4F91B 2QK4A 3E4DA 4ZYWA 5GZ3A 5IVKA 1AKYA 2YUIA 2JJMA 4MVJI 2NPFA 5IDQA 2H2AA 3SC3A 2JFNA 2BLNA 2Q5QA 3SQDA 3QUBA 4QASA 1PYGA 4LDNA 1ZSYA 2QTZA 3E0QA 3T94A 1D1QA 2Q3FA 3QI7A 4P54A 3DM9B 3SLGA 3ZDEA 4BNDA 121PA 4M9UA 4WBNB 4W5NA 1E4OA 1GU1A 1LC0A 3EF3A 1MIOB 3CNLA 4IDCA 2YXBA 2AOUB 3EA0A 3M3PA 5EUMA 2C7RA 3CLRD 4ETIA 5KSWB 5JS1A 3RJ9A 5NLLA 1YASA 2DP4E 2EBFX 3NORA 4NQRA 1KSJA 2JBAB 1NSTA 4TZTA 2Z2ZA 4G81A 2YXEA 3KDPA 3LLMA 3PEFA 4KJZA 4ZVNA 3A6EA 3DYBA 4Z7JA 2PZMA 2PA3A 4KDFA 2ROQA 4WNAB 3K0AA 4MOWA 3PHLA 4NOLA 3ZH9B 3OT1B 3IAAA 5LP6A 2ZR0A 2CVFA 3D8TA 4CN8A 3U7FB 4DB2A 4JR0A 2XLBA 1H3NA 1ODIA 3K0CA 5JUWA 1E8DA 2CSUA 2KI5A 2PK3A 1QOPB 2Q7DA 3UKJA 3EQZA 1LVGA 2JHCA 3IKTA 3C1TA 3OKZA 4HR7A 2VXBA 4MO2A 4CQMA 3O73A 1H2RS 5K0FA 1WKBA 4ND4A 1ZXXA 1BFKA 2WMYA 2I34A 2RGRA 2X3FA 1NX9A 5DVZA 4KYTA 3IMFA 5DHPA 3V55A 4HVTA 1WOYA 3AIIA 3CKLA 4E5YA 2NX2A 3CR3C 2D3TA 2ZSKA 3I6QA 2XX3A 5M2QA 4RFSA 3N2KB 1Z0ZA 4I50A 5DXJA 1GZ6A 1Q3KA 1H0SA 1QE3A 2Y1WA 2YV3A 4BEBA 5GVSA 3GVIA 1WXQA 2ZCVA 1IHOA 3LWZA 1BQ3A 3OICA 4PLCA 4YRRA 4YR7A 4K6GA 1NW4A 1F8GA 3JZFA 2X0JA 4TUYF 3TSWA 5C18A 2Z2KA 4UU0A 5AW0A 1II8B 4JAVC 1JR3D 4TLDA 2Y1OA 4MXDA 4DPKA 2GK3A 3BHNA 1KI9A 1UZUA 2V96A 3MLAA 4IJMA 1F60A 2ZU0C 5KJEA 1XLUA 4J3JA 1Y1LA 4QGBA 3WGVA 4OBWA 1PF7E 2HWXA 4JVNA 3BXXA 2ZIXB 5CT6A 3T15A 4QYTA 2V6JA 1VECA 1UBKS 5LVAA 3NH9A 3URKA 3OIFA 5U1PA 4X1YB 2PL9A 3RHSA 4EVIA 4QL3A 3ANXA 1UDWA 4GPD1 2HM7A 3MWKA 5HQ3A 2VUTA 3U9SA 5AKIA 1O94D 1ZZ7A 1XVAA 2A0YA 5GGYA 4EGAA 1U81A 3TZKA 4KRYA 3RPEA 1U28A 5IT0A 2GN4A 1E89A 1CD5A 2O0JA 2SBTA 2W2LA 2QUHA 3BBLA 2F00A 3JD1A 4G4SO 3CLTD 1G4AE 2FQYA 3OIYA 4J0QA 4N0DA 2C5EA 5DASA 2PJUA 3JSAA 5AMXA 4ZEWA 2WU0A 3MINB 2QTNA 2RCYA 2YJZA 4X4EA 1N3BA 2PGLA 1MG0A 3GRRA 3PPXA 5FEUA 3MILA 3E5RA 2X77A 1E6LA 4OI1A 3B5EA 3GCXA 4QUJA 4UVGA 1YB4A 3G8YA 3L7CA 3RS8A 1XNRB 3JVEA 3HN2A 3C1AA 1U2GA 2IXGA 3FKSD 2RHGB 3MQFA 4RV5A 4EYOA 3G5LA 3GUCA 4A0FA 3L1JA 4PQFA 5H7XA 2NU8B 3A0RB 5CA0A 3A70A 2K2QB 2PXAA 2V65A 2V54A 3G9UA 1OAOA 3D4OA 2RI1A 1IEWA 1SZPA 4AJ9A 2WM8A 1OWPA 3CIOA 3VTKA 2XWPA 1N5OX 4FDUA 1DX6A 1C0PA 4MCHA 1GTZA 3NR2A 3THSA 4DCOA 2VYFA 3U7QB 4A36A 4MWGA 1CETA 4QE3A 2BEVB 1U2EA 2ID8A 3K73O 4KEAA 2XMBA 1QO0A 2V6GA 3LT5A 5BQOA 5TDHA 1NGSA 3PRKE 5AUOB 3U5TA 1RQLA 2CHEA 2ZB7A 1GPUA 4YO7A 1S02A 4MI3A 3JQ6A 4LEIA 4IDPA 1A9TA 3UJDA 3NZLA 4Z1OA 5EEHA 1XYYA 1PX0A 3IOBA 1DIRA 3LL7A 4Q02A 1EZZA 5FPYA 1IOWA 4RVNA 2RAUA 2RHLA 2YXNA 1CYEA 1EFDN 1ZFNA 2HMYB 1PI3A 2ZUBA 3LA8A 3LX5A 4K9OA 4U02A 3TL6A 5AD1A 3V48A 3FYCA 3MWEA 3JQGB 3GLIE 1UBCA 1YOVB 1DU4A 4UDOA 5AXBA 5BR8B 4X63A 2YWDA 1WKCA 3N2IA 1HZJA 3ENNA 1T5BA 3BQMB 3CQ9A 3OPYA 4Q7KA 4B8WA 1FTQA 2XTZA 5KB3A 3H1AA 1KOGA 4QA9A 4Q1AA 3GJ0A 1SC3A 3NVMB 1U0HC 4AKSA 4R2JA 2WUDA 1HXHA 1NVBA 3N6RA 3TFQA 3WL5A 4BGDA 5ISMA 4KIGA 2P67A 5A7HA 1X6VA 4EG1A 1CFZA 3GJQA 5F9HA 2V4UA 3KTDA 3L1HA 1YS2X 3GAFA 5CTAA 3JXEA 1KP3A 3PPIA 5TX7A 2PXBA 2OV2A 3DWIA 3KLMX 4X4HA 1ESDA 2H1LA 3DZBA 4TLMB 5AJYA 4CG0A 1GCIA 3D5TA 3F7MA 3PFCA 1M34E 1JZQA 3LIIA 4CM8B 4V0LA 1IN7A 2FRVA 4ALKA 3ZE2B 1X1QA 3BAZA 3LXXA 3B1KA 2UUAB 1W2WB 4JCYA 3C4JA 1DBRA 4JKOA 4Y6QA 3E81A 1P3DA 3MCUA 2CJYA 5DO9A 3E5HA 4YO8A 1ESCA 1TTPB 1N6OA 2R86A 1YBVA 3ITNA 5GGXA 2P3LA 4EG7A 5BXYA 2EKPA 2BT4A 3DFKA 1JSLA 4ID9A 5TR9A 3UCXA 1H6AA 3FUUA 4H1UA 2IHZA 3C6YA 1D9ZA 1T9BA 2QQEA 3HL4A 3OZFA 4AN1A 3U7HB 2FPMA 1EM6A 1VL5A 2QVZX 3G9ZA 4X4IA 4JVSB 4YJFA 1WSAA 2WAXA 4D44A 1TK2A 2WJWA 2PXPA 2PJZA 2PX3A 2PDAA 3PR2B 3LIPA 4E2ZA 1DBIA 3BM5A 2L19A 4L72A 3VU1A 3HXOA 2BGWA 1IRXA 2VCHA 2EZTA 2VWPA 3U19A 1R66A 3HPRA 3PXUA 2KJQA 5BSVA 5ES4B 5JI3E 5KC9A 4RJKA 2L49A 1ZW6A 3TCKA 4B09A 2VK4A 4JNCA 3VX4A 1D5CA 2XVZA 4OF4A 5EWMB 3QYXA 4M0PA 4C3OB 3EVTA 5IF9A 1QO7A 1AB5A 1R50A 5E7MA 3F9IA 2ID7A 3BWVA 2P8JA 1V41E 1ZZ8A 2COUA 5IUJC 1XXHA 3GFGA 3FW1A 4U7TB 4C78A 4NAVA 3EDMA 1LB1B 4GX0A 3GQBA 4RDHA 2ZI7A 1ESZA 4MINA 2OQVA 721PA 1W85B 4O08A 4Q1EA 2GKSA 4DG8A 3AI3A 2BKUA 4WZBA 3NHLA 1DBWA 1KPIA 1KFCB 5MN4A 2EFEB 1G41A 1YZLA 3FHTA 3ZVMA 1UP7A 5C2JB 1LPSA 4IH1A 2OHIA 2P6MA 1NLFA 1SCNE 2FUKA 5K8VA 4QOHA 1QPGA 1M7GA 3P26A 5J23A 1QFJA 3P9CA 3H7IA 2DR0A 1J24A 1MB9A 3IBGA 3SQXA 2NU9B 4GQBA 4ZOLB 5LZ9A 4RY0A 1W5EA 4E5NA 3W04A 5B3KA 5JASA 2H9YA 2OGUA 4AYTA 4BMSA 1G7TA 2UUPA 5T8KA 3SIPA 1M10A 3E9ZA 5HUJA 4NDZA 4RA6A 3R24A 4BRSA 2O1EA 3H1GA 1SCJA 1GRNA 1TM3E 2C4WA 4NMMA 4DCPA 5LD2B 4M1OA 4A0GA 3Q3IA 1DFGA 5EVJA 2WTAA 4YJDA 5B1IA 3X43A 4JX9A 4INAA 1ZUD1 1GUBA 4FE4A 3JZAA 3PUWA 2G36A 4G65A 1X0VA 3SOPA 3UN1A 3Q8WA 2ZCUA 3BG5A 4L5CA 4UVEA 1CULC 4HN4B 4C6TB 1K92A 2J7PA 4E07A 1J5PA 1D6JA 4HGZA 2JDIA 4EI7A 4JLAA 4L51A 4BZXA 2UYHA 1CJVC 2JFGA 2C20A 1NRJB 4NBSA 1SB8A 4NLLA 4XQ0A 5HIJA 2IVQA 3FY4A 4FOLA 2XSZA 5AH0A 4F11A 4ZMBA 1KEEB 5DYNA 2XXJA 1VDMA 2D00A 5M34A 4K3UA 3OLXA 3EVEA 2FY8A 3IIIA 3EXHC 1WH6A 1KOLA 4DJDC 3USES 4YX9A 1FFCA 1KDPA 3Q87B 4NAUA 2MU1A 4MP6A 3UXMA 4BKPA 4E08A 3OECA 1ECPA 1I7LA 5I8WA 4H17A 1XL0A 2IYUA 3L0ZA 2WPDD 1U5AA 3GELA 4MO9A 5BSTA 1OH6A 1I4WA 1X7XA 2W9XA 1F3LA 1O87A 3FTQA 5JSKA 5CFOA 4D3FA 4QNNA 2GZ2A 1J2JA 1A98A 3TBHA 2DSTA 3A1WA 3C1OA 1RWWA 2QTHA 5KYXA 3UPTA 1OLOA 4NOJA 2DWQA 2OBMA 4HDMB 5H82A 4GKVA 1IXYA 3I32A 1JDSA 2ES4A 2CDRA 3DOJA 5K2OA 2YZ7A 3ZDDA 1R69A 4TTRA 2XF8A 4CVNA 2GETA 2IY7A 2Q6IA 5EJ9A 5P21A 1EXMA 4B43A 4MQEB 1IHDA 3K8YA 1DL5A 5C8YF 1XTUA 4JSTA 4BO9A 2L0XA 1BFUA 5ADVA 4MYTA 4FSHA 3V7NA 1OWOA 2QUJA 4JT4A 1DKPA 2NOAA 4DUPA 3QUTA 1CJUC 1OXVA 3RC2A 4HBGA 2IYSA 1GFZA 4HH0A 3BTVA 2CXPA 1KDOA 4YP5A 2QPAA 1W581 3BK7A 2F59A 2DOKA 2G88A 5ERYA 1XCJA 4DEYA 3ZD6A 2PGNA 3SDSA 3PLAE 4FNMA 4FYYA 1B0NA 1Q1AA 2FPGB 5IP5A 2IV3A 4QTUB 5IXJA 3GVXA 5EOVA 4TYYA 3K2EA 1J0DA 4WNCA 3SBEA 1TIPA 3VDNB 2NIPA 1P6UA 3K16A 3OU2A 1R3DA 3N2EA 3DB2A 3UHPA 3D2CA 1JLLB 1WV0A 3AIOA 3H3XA 4IS2A 5ARBA 2G1JA 2JRLA 3JS5A 3CTPA 4M8NE 1RE1A 3WB0A 3HCPA 2W58A 2BFDB 2OAQ1 1OZGA 2HX1A 5C8ZA 3RTDA 2PLRA 1OKKA 2WOJA 5LKAA 2FSPA 4E30A 2GN1A 1CUGA 1FMCA 1KZYC 1UBOS 4G5HA 2G83A 1LSJA 1KSHA 4YMSA 4BE9A 4D0SA 3ICEA 3NH6A 2BONA 4G5OA 4KTVE 5FL7D 1C3OB 1V6AA 2Y3IA 4W6ZA 3SC2B 2AX4A 1BQ4A 1T10A 1PE0A 2QAGB 2Q5OA 1E62A 3ESZA 4HX2A 1ZUGA 4E0BA 3H5TA 3I72A 1DHTA 4N12A 5I8PA 5SZIA 4AS1A 5IAKA 1WP4A 3QU9A 1TLLA 1O95C 1V37A 4IXNA 1TO6A 3SHOA 3DZGA 4BKRA 4MPRA 3DL0A 3K9GA 4M54A 1L9KA 1NYQA 2CVZA 2Y4OA 3C7TA 2PKEA 4PZ0A 4TYPA 4PPFA 5PGMA 1PD0A 2H2FA 4GR4A 2C4MA 1X2EA 2GEJA 2NNWB 3GFRA 3M6FA 3MZ0A 3AI2A 3OZCA 3P7MA 4EABA 5KYUB 3PCRB 5BMVF 4QARA 3KWJA 1ENZA 4H60A 3QOYA 2YNMD 2YV4A 1VPWA 2ZRGA 1YRBA 3KKNA 4F7WA 2FMTA 1RCUA 4N6NA 3A6PC 1NNLA 1WCYA 3GLIB 3G2NA 2XVYA 3I58A 2IY8A 3L7MA 1UWKA 4EGCB 3K0FA 1O89A 1T2CA 2W6ZA 2YY7A 3A1TA 1K1EA 3MHPA 3ORSA 4X84A 4N0MA 3EZXA 3NHBA 3EXIA 1DAHA 4OQYA 4KCGA 1RJGA 2H08A 4IZOA 4PPNA 4XWAA 5FJJA 3DWFA 1G1MA 4LJ8A 1T2EA 3ES9A 4AJJA 3QVMA 3OOHA 2B4YA 4DEXA 2QMHA 2EJBA 1T9HA 3CWQA 2NZVG 4C30A 3Q3EA 4MYUA 5DBEX 1GR1A 2CXUA 2HWYA 2P9TA 1SVKA 3A2NA 4FYKA 4U6SA 3ZWOA 4F6CA 1G3RA 2TRSB 4OHKA 1T6XA 4L4SA 3GU3A 4URHA 3E9CA 3RD5A 1L5SA 1TMGE 3QUSA 3JXBC 3GMIA 4QX6A 3N8IA 1M34B 5AKEA 4OATA 3ZLBA 1QDLB 4G2NA 3WP0A 3I12A 5DYGA 2QJFA 1O9BA 1V7QA 1WZIA 1L5HB 2DRIA 1OLUB 3DR5A 4RXUA 3ESCA 4TX1A 2VUUA 2XXQA 1FNSA 5DEIA 3VC1A 4AZ0B 2JAQA 1ULZA 1QJ4A 1K7CA 2GAFA 3JYLA 3KJHA 1YCGA 5TY0A 2C7QA 1ZLXA 3CLSC 4TV8A 3UHOA 5BWMA 4A15A 4RZSA 4OHUA 4YMUA 3MPOA 2PJRA 4HWPA 1KJ8A 1K0UA 5A4MS 5JBNA 3OLYA 4FMDB 4C21A 4DCMA 2Q3BA 3AF3A 3UKDA 2PMWB 1R8QA 3QEOA 2I3BA 4ZWNA 3BERA 3G17A 2YOGA 3VR0A 4EPWA 2FWRA 3PF8A 2JJ1D 1SU7A 3AESB 1IM5A 1W5AA 1TU4A 5JYDA 2AE1A 1SOMA 3A3NA 1WD5A 5FBZA 1VPDA 3SJZA 2HK7A 4M0EA 4Z4EA 2X19A 2I62A 1P1BA 3WA7A 2R4TA 4RK4A 3SC6A 4BQOA 4AKGA 3ZGLA 2QVLA 2VHVA 2C5AA 3JQFC 3OEWA 4RK1A 4RGVA 5FTNA 3PE5A 2WD7B 3G9XA 4JUDX 4M0DA 1Z4QA 4GOND 4HJRA 4ROSA 4NZPA 5M7EA 5CEEA 4YRMA 2FXVA 1U0NA 1C8KA 3HN6A 3ND5A 2KEJA 4NABA 3ZVRA 4Q9DA 4Z49A 4DB4A 1FXUA 4IX9A 4MW7A 2ZRHA 2BMDA 2B1IA 7AT1A 1UFVA 3QEMB 3L04A 2DPMA 3QLVC 4JL6A 1R5JA 3TW8A 2BEJA 2NXNA 3WWPA 5A3SA 4UJ5A 4AX4A 4NU0A 3DKKA 5E4YA 4BEJA 3GLRA 4GW3A 4A03A 3W8DA 1E2UA 2KPOA 1TNDA 1I33A 4RS3A 2AIRA 3NOQA 3TQFA 4UNRA 5DBGA 1L5LA 2I7DA 3DAYA 1XKLA 4KVFA 3ZCRA 1JHOA 3CUTA 1FDSA 1LTKA 3BX1A 1W19A 1MXHA 2F3TA 1FMLA 1XDZA 3HU2A 1U8TA 3VDQA 1ENYA 4W8GA 3O8DA 4KR9A 1DRKA 2LR0A 4BFTA 4RD0A 3KAPA 2CBZA 3V4LA 1TIKA 5FUVA 2CMKA 2Q4TA 3TBFA 2GB4A 2UZ4A 1YDWA 3VZSA 1QS0A 1UFOA 2IX9A 4AFNA 2YWRA 3M6XA 1GO2A 1USIA 1DC7A 2Q6TA 1AGPA 1E1QA 3QF7A 5JWRA 4GT1A 2YC2C 3UMJA 2BMVA 1M2VA 3A6LA 2ODTX 1OXMA 4FCCA 1QZTA 4OP3A 4XGQA 4F2DA 1SO8A 5DYYA 4BU0A 1JJ7A 4KQEA 1L7PA 4PYRA 4HUJA 3V6LA 2GN8A 4ZT4A 4K28A 2I22A 2KBFA 4AJKA 2ZYIA 3FTCA 4FMCF 4DZRA 4X91A 3G3EA 2FQ1A 5JS8A 1OI2A 1I3LA 2Y8EA 2B30A 5K0NA 3DCJA 3IBTA 3DMRA 2HRQA 2OFXA 5ULLA 4BDSA 4DNOA 1N7GA 2EKDA 2XQFA 1X39A 4GI1A 4ZYXA 4DLVA 4D0GA 1RMTA 4ARBA 2CNKA 3K0KA 4ARUA 1GEEA 4I8TA 3WIOA 2W83A 4UQOA 2OO3A 1LRLA 3KU1A 4B3GA 4F4DA 2AXNA 3F5QA 3M0EA 4A5SA 2X6TA 2YWHA 4HGYA 4XFDA 4LYHA 3PSAA 3P2OA 4OPMA 1KJIA 3CT6A 2EQAA 2FPPB 1CDDA 4NXMB 1SC4A 5HF6A 5JSYA 3UPUA 2DVMA 1J2TA 2QTVA 3V8RA 3VU9A 1TVCA 4M0KA 1LK0A 4D9KA 5KOHB 1R4NA 5KYWA 1Y1QA 2ZVJA 1G66A 2E1RA 4C6HA 1BRTA 4CIYA 4KACA 4CTNA 2OSVA 2DH5A 4PSDA 3WIDA 2E82A 3MUFA 2YDXA 5TJHA 4FKMA 1F9EA 4YFYA 5EWLA 2ZUUA 5ALRA 3A6ZA 1Q0RA 1VKNA 3AUUA 1J2YA 1YZTA 3FNBA 4FN5A 3ICWA 2IPMA 4GZ5A 2R0QC 5I9IA 3COVA 1R2QA 4CF5A 4FGLA 1UP4A 1UFKA 2JEZA 1IZ9A 4E46A 4QHSA 5CDSA 1F4VA 4E88A 4MQFA 5ETJA 4NMWA 3OY2A 5CDUA 2G40A 3RV4A 3DBHB 4OM8A 3V6MA 1Z17A 3LY8A 2Q2NA 2AN5A 3VTFA 3T5BA 2HIHA 2ZRCA 3SEAA 2ORWA 4OOFA 2FETA 2Q5CA 3CO5A 3FBTA 4Q7EA 3K2IA 4TV9F 3TLJA 3HXQA 3UJ7A 2LYRA 2EF8A 2H48A 2KHZA 4N5MA 4CWAA 3QU4A 1GKLA 1HQKA 2B0JA 1AGRA 2JFFA 3DXYA 3CW9A 3EVGA 4ZN6A 3LHIA 1T25A 5A1TA 4W1PA 3SF8A 2TSYB 2PQ6A 4XQGA 8OHMA 1Y89A 1Z45A 2UYCA 2PH1A 1ODLA 3WXMA 3KUUA 1D2MA 2DQSA 5A1JA 4L9AA 4OU4A 2ATIA 3I6ZA 3M6LA 1UANA 5CURA 3T3PB 5EEGA 1SN7A 2J6IA 3S8QA 4M0CA 3FCEA 1A5SB 1XYGA 1JMVA 1I01A 1PNQA 2FX5A 2QP9X 2JCBA 4ZQIA 2RC5A 1POWA 1JB1A 4R05A 2P75A 5EE9A 3W4JA 3PRYA 1QOQB 1OBFO 4RV9A 5F9MA 4KIJA 2J5KA 1XU9A 2IE8A 4AJIA 4RQBA 2P9BA 3EVZA 1L7EA 2BFCA 3J81k 1YMVA 2HNBA 1OGIA 4J0EA 3PWSA 1A2BA 2ZXUA 2BZ1A 2LKDA 2G25A 4ZO6A 4ZC1A 3PGVA 1N6RA 4MRMA 1U98A 2A3RA 1X7GA 4Y2UA 4M1MA 3G5TA 4BFZA 1JIVA 1YFZA 1ANKA 4J7CA 3V4ZA 2YWGA 5DTIA 5I9TA 1S8AA 2RB4A 1AUXA 2OAP1 3G5UA 1UXOA 2ZYAA 4Q6BA 1LCDA 5T6MA 2QD5A 3DP9A 3EASA 3W5JA 4IHJA 1ORTA 1GPDG 2DLDA 1RYNA 4EO9A 2FPIB 4YCNA 2E37A 1VI5A 3Q88A 3F4BA 3UOAB 4BZQA 1I3MA 1E1RD 2PFKA 1GT6A 5A0VA 2OO5C 2WIKA 1RLJA 5KX5F 4QNMA 3TF5A 4DA4A 1NF3A 3HLTA 3L93A 4E1BA 1Z26A 2ZIEA 4B6QA 1P9LA 2BGTA 4HT3B 1XZIA 4QAJA 3W5DA 3MCWA 2MHCA 3KBBA 4CHGA 3E48A 4MUNA 4R83A 1U2QA 4RQTA 1VPVA 4NYJQ 4JODA 1V5GA 2RSLA 3KELA 3EA5A 4ESVA 2JFQA 3CBQA 4K9PA 1JQEA 3THXA 3HYRA 3PC7A 5EKUA 3JWHA 4DSZA 2Q21A 2C9YA 3EUAA 1NXOA 1FTWA 2VHEA 3X1DA 1PL7A 4JOSA 4GBGA 5AM2A 4C1NA 1KO5A 3UM9A 2UYGA 3ZDQA 4FHCA 4X61A 5AM0A 4MB2A 3AL2A 4DV2B 2WQ6A 1E77A 1JFSA 3DPIA 3H6GA 3IP7A 5DSTA 4LG1A 3T4UA 1VJ0A 1BVHA 2A5LA 1YBAA 2W22A 2V0CA 3AVPA 1KI6A 4G5GA 4Q05A 1G42A 1JYFA 1SUDA 3SQMA 5KYTA 2Q9CA 5JIBA 4BNUA 1PD1A 4MIKA 3DA8A 1G2PA 2NAFA 1XEWX 2WOOA 4OJMX 4QJ5A 4I1RA 1ML3A 3HNPA 1ISIA 4V3BA 5E3IA 3CXRA 4WH0A 1YRLA 3HB5X 2H3EA 2HLDD 3KYCB 3MHTA 1KYXA 3RRZA 2WZDA 5HIAA 4BTLA 1PNTA 3V8QA 5F23A 5K6RA 3LX6A 2LD4A 4WLUA 3RS3A 3B8EA 3GLKA 5JZSA 4KR3A 4LHWA 2IF2A 5DHSA 1KVSA 2BD0A 1GGVA 2Q9UA 4PLWA 4BV3A 4EY8A 5B37A 5J4YA 1V45E 4GWGA 4YAUA 2NU7A 3NKFA 2Y0DA 1TZMA 1FP2A 1RRGA 3DOOA 1MTOA 4P0TA 4BX0A 1T6ZA 2Q28A 4V0SA 1RXVA 2C5GA 1RABA 3PHCA 5CA1A 4PW0A 5CXSA 1AUQA 2FZWA 4RTPA 1QHFA 4P4GA 2GN9A 4W82A 1CWUA 2V58A 4YACA 2B9VA 3CJQA 3KQYA 5ED0A 2A6CA 1BKSB 1RP7A 4U63A 5HGJA 3ROPA 2VZ0A 3PFNA 1A95A 3D64A 3FYAA 3H2KA 3O5AA 4OHRA 4Q0MA 4CZ2A 1UL1X 1EFLA 1Q1EA 2Q6LA 3IBYA 2BGGA 3AR8A 4NYMR 2WBLC 2YRFA 4IF6A 1LPBB 2RHTA 4GGMX 4O29A 3E9EA 4J7XA 3E3LA 4L07A 1MO2A 1XEWY 1BDBA 1GSIA 1HDEA 2CL6X 3E9QA 3NDPA 3OE7A 2R5FA 2XHZA 3I53A 1I1OA 1TQHA 3ZV4A 3OJOA 2P2YA 3DTNA 1DBPA 3OE1A 3EYAA 2V5AA 1C30A 4F3CA 1C2YA 1UDBA 1ZM4A 3E70C 4D26A 1CPYA 5EL0A 3GY0A 5GTDA 1IN4A 2QRVA 2IYOA 1KKUA 4BX3A 5FX2A 5DNCA 3L2OB 4ESOA 2VDJA 1RSZA 3JTMA 4KITB 1W5FA 4NOMA 1YQWA 4HXYA 5J2TF 4DEVA 5AJVB 5FUQA 2HQBA 5BT9A 4LZPA 1X2LA 3K8OE 4FDAA 2IHYA 1WVIA 3OETA 1D09A 1DAPA 4FJ0A 5HDBB 3ZJ4A 5BN5A 4TTAA 3ROXA 1LJUA 1P8JA 1GPNA 3GZDC 1DAKA 2DPYA 1CC1S 3BMOA 1O5IA 3M83A 4CLRB 4Z5CA 1ZNWA 4L8VA 5IUKC 3PC2A 3U80A 3RLIA 1QDUA 2X4LA 1F1JA 2X2PA 3BPSA 3R3VA 4ND7A 4R1PA 1XEXA 5CVDA 1YVRA 4PLZA 2R97A 3W6UA 3FPFA 3IHKA 3TEPA 3AHIA 3MJRA 1YDFA 3KQLA 4RORA 2VNIA 1L8XA 1UM8A 4O4LB 3I6BA 3AUXA 1FUKA 1ATIA 1BFDA 3DBRB 4BO8A 2PGJA 4JFAA 2OCYC 3A1NA 1XZHA 1Z4KA 3DH0A 3OLCX 1L4NA 1Y3HA 1CQJA 3AQ4A 3G8AA 5CYPA 1J7KA 3VR2A 4B0PA 4N9QA 1S1MA 5EFZA 4CTKA 4EBFA 4MCJA 4DYDA 4NCHA 4MLCA 1ULBA 5BN4B 3LO5A 2XTJA 4YRQA 3IJPA 1O54A 2JEYA 2WYWA 3OWXA 3SS8A 4ZYVA 4YIKA 4Z7QB 1SZJG 1D7AA 3GLSA 5EWJA 1PJRA 1Q50A 3BGIA 2E4YA 5REQA 4UBJA 3TLAA 4QU9A 3C4VA 1J2UA 1PVVA 2J4DA 4ML3A 4ARZB 2GASA 3KM0A 3CVWA 3CZ4A 5LP6F 2BDTA 1YE8A 4K9NA 8GPBA 3I5YA 1DDGA 1D6SA 2CNWA 3OQIB 2I3ZA 3L6DA 2BLLA 4CV1A 2AD5A 1UK7A 1U8EA 4Q7MB 5L53A 4CM9A 5E8JA 3TLMA 2EFGA 1MENA 5CD9A 4RAQA 1XL1A 3COSA 4QAQA 4DJTA 2VYND 3ZHXA 4YRKA 3W79A 3R3WA 2XB9A 2RGYA 2ZSFA 5JSUA 4OX9B 1T2NA 4N6OA 2KQUA 3BWMA 4PX2A 4DLNA 5BN3A 2Z8YM 4Q3OA 3HS3A 4EFMA 2WUWE 4MIOA 2AC7A 5EJ2A 3MERA 1O7JA 4A8TA 4NVRA 5C8VA 5E9AA 2Q4DA 3GLTA 4PV7A 1Y6QA 4W5RA 3HUDA 3OU6A 5ESRA 4QHYA 4RHXA 4UD2A 1TU3A 1F2VA 4I50F 3BS4A 2Y2VA 1KS2A 1P17A 5E4JA 3KV1A 1O8BA 3ZBUA 5D87A 1HQDA 1RWOA 2E2WA 1XNHA 1RFLA 3U4DA 5I5EA 1DV1A 2EF0A 4O4IB 4C4SA 1EXWA 4GIBA 4BLUA 2AWOA 1ADRA 1I6LA 4WMLA 5C81A 4A27A 5JNLA 5LXTA 1GTL1 3OZDA 4Q7JB 3PCXA 4P33A 3CX3A 2CD9A 4WASA 2UZ0A 1FB5A 4XQCA 1YRWA 3I2JA 4AUKA 1T43A 3D7MA 5T67A 1YS6A 3QVKA 1Z33A 3VOAA 3TRIA 3FFTA 2VRCD 3F3MA 1D8AA 1D4OA 3HB9A 1X3SA 4KLCA 4Z8XA 3UXYA 3ZQ6A 4EA9A 1JI3A 4CIDA 5JYEA 4AY6A 2P30A 5AK5A 3ZNNA 3Q7EA 1RI2A 4RNDB 3Q1LA 5F4ZA 1P2VA 2Q2VA 1R12A 3VSCA 4MMZB 4AMGA 4BP8A 2CHGA 2FPWA 2P90A 1FUEA 2YZGA 4JQYA 4ZAYA 1XCMA 3ETNA 3I1YA 3IPCA 4JP3A 3TLBA 3TG8A 3PRHA 5L6MB 1W35A 3C4QA 4BNJA 1DKUA 4HZUB 4PS0A 3W3AD 5LMNB 1GP2A 5FNVB 5LDDC 4M9CA 4QT4A 2A84A 3EQ2A 2I29A 4GE0A 3VO2A 4JVMA 3EAGA 4JUCA 4OKIA 2OQRA 4YB8A 2FG6C 4QUEA 5A5DA 5BRNA 3BDNA 4PLGA 6GPBA 2MINB 1LDNA 3ENVA 5KQPA 1YA4A 1OYYA 2GESA 3EEFA 3G1WA 3R7WA 2PT7A 1JAZA 1V3QE 4CV2A 4S3MA 1FVOA 4CCSA 3G7UA 2J59A 3IE2A 3JQBC 4IXMA 4LYAA 4QDZA 1Y4AE 3H19A 4PANA 4TKVB 1F8XA 2H51A 2GUGA 2ZFUA 4Z1MA 3GNTA 2XV1A 1PX2A 1RPTA 2AK3A 2XNHA 3WBKA 1UC4B 2GSWA 5E6RB 4FYPA 3S1SA 3L1VA 1H2BA 3NHYA 3NBKA 1FL9A 3EXHB 4C6RA 2NVUB 3OOSA 4YC7A 2V9CA 1DMSA 2Q1WA 3D59A 3V33A 3KZMA 1C14A 3MJ4A 4MW1A 4CMAA 4F9GA 2CHUA 5LQMA 1XA3A 1LI5A 4H7HA 4C0QC 3HVRA 2YRWA 1VHJA 1YNOA 1FDTA 2FR8C 4I3HA 3PLNA 1SQ6A 2FK7A 3BK1A 3NKVA 2EQ5A 2V1XA 2EEZA 3QNWA 4GU5A 3L7OA 2R1JL 1P62B 3LG2A 5JQGF 3FDJA 4H7IA 1B0ZA