5DSXA

Crystal structure of dot1l in complex with inhibitor cpd10 [6'-chloro-1,4-dimethyl-5'-(2-methyl-6-((4-(methylamino)pyrimidin-2-yl)amino)-1h-indol-1-yl)-[3,3'-bipyridin]-2(1h)-one]
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
316
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 105
structure length 316
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dsxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dsxA02
1R00A 3GWZA 3WSTA 1JQ3A 3DP7A 5E9JA 2DPMA 1JG4A 3UA4A 1JQDA 4R6XA 4OA8A 3KQVA 1TW2A 2PXAA 2ZIGA 2ZVJA 4QDJA 4DA4A 2LD4A 3BWBA 1QAMA 2AOUB 5HEKA 2O07A 2OXTA 2CL5A 3HA3A 5EOVA 2G1PA 3MQ2A 5U4XA 4YUZA 3OE5A 5EKXA 3MB5A 5DX8A 1DL5A 1KR5A 3DH0A 3FYDA 2GA9A 2XVAA 5DX1A 5EVJA 1AF7A 1VBFA 3B3JA 1XCLA 5EGSA 2C7PA 1PRYA 4EKIA 2FCAA 1VP3A 1JSZA 2V74B 4BY9E 3HCAA 3LBYA 3E8SA 4Z2YA 5EHIA 4NECA 1BC5A 5K01A 3EMDA 3PX3A 3DMFA 2JHCA 3C6KA 1RJEA 2OBFA 4OQDA 3C0KA 5K0FA 4KIFA 4PYQA 2H1RA 4MIKA 3UJBA 3DOUA 4RTMA 5DTQA 4Y2HA 5E1BA 4PIPA 4RYLA 3CC8A 1V39A 3HCDA 2ZW9A 1ZGJA 1L9KA 4GOLD 4HGYA 1I4WA 3I5UA 4PGHA 4GOND 3D2LA 2Q41A 2BZGA 3C3PA 2O57A 2ZIFA 5DSXA 3NWEA 4GOMD 1ZGAA 3EVZA 3VYWA 4UOEA 5F2OA 4YMGA 1Z3CA 4LG1A 2I7CA 3HCEA 4YUWA 5LR6A 3G2PA 4C03A 1DUSA 5FHRA 3THRA 2FK7A 5LQRA 2VDUE 1YF3A 3P9CA 1XDSA 3MTIA 3SM3A 5DT2A 1UWVA 2DULA 4YUXA 3KQQA 3T7SA 1RI4A 2AOVA 5FA5A 3LDGA 1INLA 2HTEA 3HCCA 3NVMB 3OU7A 5E2AA 3C6MA 3EGEA 4IV8A 2Z6QA 4RV9A 1NW6A 5K0EA 3GRVA 1XJ5A 3B7PA 3FUWA 5DM2A 5E8RA 3DULA 1FJXA 3QOWA 5K0JA 3ERCA 2IIPA 2XVMA 3NTVA 2P3OA 4KW7A 1X19A 2QM3A 3CJRA 5JR3A 2AR0A 2UZ4A 3RODA 2IBSA 3AJDA 3LBFA 3A4TA 4QQNA 5K03A 5EKUA 3OZRA 4MWZA 5D1NA 2H11A 4C05A 4FR0A 4FGZA 3NJRA 3GDHA 4MQ4A 3P9KA 3DMGA 5GIPE 1AQJA 3DXZA 5ICCA 2B25A 4KIGA 5EC8A 4RVDA 4V0RA 3MTEA 2ZBRA 5JUWA 1SUSA 3P2KA 4IWNA 3ELDA 1XDUA 4CWAA 3LDFA 1R6AA 5HZMA 3BT7A 3EVBA 3EEYA 4L7VA 3FUUA 5DRYA 1KXZA 5K09A 4DF3A 4E2YA 3A27A 3G7UA 3M70A 3ME5A 2HNKA 3AXTA 2PKWA 5K0NA 4DZRA 3LCCA 5DRTA 5D1HA 1SVUA 1XDZA 3KQPA 4HH4A 5T64A 1RJFA 2AN3A 1G6Q1 4U7TB 2NXCA 3R0QA 4PWYA 4X1OA 4FSDA 4OQEA 5K0BA 2CMHA 3KQYA 3LPMA 3TMAA 2YXEA 3I9FA 2NXJA 2ZSUA 1KYZA 4LECA 2ONYA 2BR4A 4PYOA 1KPIA 1VIDA 5EEHA 3TPZA 5FA8A 4BLVA 2ZFUA 5EPEA 5B1SA 5C9ZA 3M6XA 4ER3A 5E8JA 5KQRA 3KPJA 4QTTB 2EJUA 3OU6A 4MTLA 3R3HA 5T67A 4KWCA 3TKAA 4ER7A 3G2OA 3LCVB 4XUDA 3BGVA 5DTMA 2AOTA 3TOSA 2XYQA 5EZSA 4E33A 3P71T 1NV8A 3SXJA 3GGDA 1RI3A 1XTPA 3DMHA 2NXNA 3PFGA 4GC5A 5DLYA 3FZGA 2XYRA 3FPEA 3EVCA 4X41A 4CTJA 2UYCA 1ZKDA 2VDVE 2ONZA 4GC9A 4PONA 2AOTB 5GM1A 3TM4A 3BZBA 3B3GA 3S68A 5E9QA 1ORIA 1O54A 1EQAA 4M38A 1R18A 1JG2A 5P8WA 3I53A 5ICFA 1D2HA 2OB2A 1U2ZA 4GEKA 4POOA 3A7EA 4LWOA 2V7EA 4CKCA 5CCXA 3R9XB 3GRRA 3MERA 3I58A 5FADA 1HNNA 5C0OE 2O0LA 1MHTA 1QZZA 3M6UA 4FT4A 4QVGA 4YUYA 2ZTHA 2P8JA 1RI5A 3KQOA 3OCJA 4GOOD 1KHHA 3HEMA 3JWGA 3LDUA 3UJ8A 3E23A 1O9GA 4YUVA 1JR4A 2IGTA 3LL7A 3P97A 2OY0A 4G56A 5H02A 4AUKA 2IH4A 3ELUA 4HTFA 4QQKA 1H1DA 4ER5A 2OPBA 3IEIA 4QDKA 2PBFA 2I6GA 4P7KA 2Y1WA 3UFBA 3CCFA 3OZSA 1EAMA 1HMYA 3OFJA 5LSAA 3FTEA 3SGLA 2IH5A 5E2BA 2PXCA 4M36A 4RTKA 1EJ0A 3TRKA 2FPOA 5ICEA 3G8BA 4YV2A 1KPGA 3G2MA 4HTFB 5FQNA 1NW3A 4XUCA 3ER8A 3GXOA 3AWIA 2B9EA 5HIIA 1IM8A 2YQZA 3G5LA 4IV0A 4PYMA 4AZTA 2AZTA 2ZWAA 4CKBA 5BP7A 3CJQA 1RI2A 4QTUB 3FUVA 5K0CA 2PX4A 3FUXA 4K6MA 3UA3A 2QY6A 3FPJA 3BGDA 3ELYA 3NDIA 3X0DA 1YFJA 4EQZA 1YZ3A 1EG2A 3LHDA 3LSTA 3P9IA 3R6TA 5BW5A 2QRVA 3BWYA 3EVFA 3I64A 3HVIA 3O7WA 2AS0A 3FUTA 3PX2A 2HMYB 5K05A 2G8NA 4M37A 5E1MA 3GRYA 2PLWA 4JXJA 3SSMA 4DCMA 2ADMA 5KQSA 1FP2A 4E2XA 1VL5A 5CVVA 5G02A 4PIMA 4RTSA 2CWWA 1R8XA 2IBTA 2ZIEA 1RJGA 1KP9A 2N47A 5LQCA 1X1AA 3M6VA 3GIWA 4RTNA 3G8AA 5HIKA 2PVCA 1QAQA 5FHQA 1P39A 4WVLA 3EVDA 2PX5A 3LKDA 2GH1A 2R6ZA 3FTCA 2PT9A 2B78A 2IP2A 3PT9A 4FP9A 4OBWA 4P7GA 2PX8A 5FWAA 1FBNA 3B89A 4XCXA 3UJAA 5EHGA 5FQOA 4PYLA 4V0QA 3HA7A 3HVHA 4DMGA 2NXEA 1VPTA 1NBHA 2AOUA 2B3TA 3BKWA 4Y30A 4XUEA 3IHTA 4E30A 3KR2A 3KQWA 4PYNA 3TM5A 4A6EA 1G38A 1Y8CA 5DTRA 2JJQA 4QVKA 1N7IA 4HGZA 4HG2A 1M0EA 3DTNA 3T0IA 2AOXA 3TQSA 1JSXA 2HR1A 4RVFA 3E7PA 1G8AA 1O9HA 3DR5A 2AN4A 2IPXA 1SG9A 4PCAA 1ORHA 3HCBA 4H0NA 1KPHA 1DCTA 2KW5A 2YXLA 5KVAA 2WK1A 3NVKI 4FT2A 3TLJA 1TW3A 2GS9A 3KKZA 1Q0TA 1MJFA 3LCUA 3UJCA 5K0GA 4QPPA 5DX0A 5ICGA 4AZVA 2PT6A 3HP7A 2JHAA 1XXLA 3THSA 3ANXA 1JG3A 2C7OA 4EVIA 3KQSA 2CKDA 3V97A 3QOXA 2UYQA 3MHTA 1AQIA 3GNLA 3G5TA 4HSGA 1FPQA 3DUWA 9MHTA 5BW4A 1YB2A 1L1EA 5CVEA 5FULA 2Z6UA 3LGAA 3T7RA 3OPNA 5DM0A 3IYLW 1JQEA 3EVEA 3CVOA 3OE4A 1IXKA 2H00A 3DLCA 3UJ7A 5CD1A 3B5IA 5CM2Z 1TPYA 2IDJA 1NW7A 2ZLBA 3HA5A 3NWBA 5ERGB 2F8LA 3G89A 3KHKA 10MHA 4GQBA 1F3LA 1RJDA 2OKCA 3UWPA 1R8YA 4C07A 2ZZKA 4CKEA 2ZZMA 1UFKA 2FYTA 1L3BA 4PCLA 3KPVA 1NW8A 5HIMA 2G70A 2WA2A 3U81A 2VS1A 1P91A 3SSNA 5HOQA 3VSEA 1SKMA 3IV6A 2UYOA 3O4FA 2CMGA 5DXAA 1YZHA 4ZTBA 2P40A 2UYHA 2PWPA 4DM3A 4F84A 2YVLA 4EKGA 5BXYA 5E1OA 2IH2A 5EZQA 5LQJA 3LKZA 3KPYA 3B3FA 3K0BA 4RX1A 2G71A 3QV2A 3VC1A 3M6WA 5DM4A 4DCGA 4P58A 2P35A 3GCZA 4RTQA 1NKVA 4PYKA 8MHTA 3CBGA 4FZVA 2FRXA 2ZBPA 3GRUA 4R05A 1IY9A 4KRGA 1G60A 4IKPA 1VQ1A 2QE6A 3Q7EA 5LQKA 1QANA 2PXXA 3A7DA 5HILA 4KVZA 2VZ9A 1M6YA 4RSRA 5HFJA 3KR1A 1NW5A 3BXOA 3PVCA 2O05A 2OYRA 5GWXA 3T7TA 3TR6A 3SX0A 2A14A 2PJDA 3BWMA 3FRHA 1ZHFA 3ORHA 3BGIA 3KPUA 4M7RA 4PNEA 1KIAA 2P3QA 4DKJA 2JG3A 2IFTA 4ATNA 3KPWA 3NMUF 3G2QA 4EMSA 1WS6A 2OZVA 3FYCA 4X63A 2I62A 4LWPA 3Q87B 2O06A 3HNRA 5K0LA 4B17A 1WY7A 2AN5A 3V8VA 3UZUA 1T43A 2ZZNA 5IKMA 3JWJA 2OB1A 3F4KA 4YMHA 4GBED 5GP1A 3HVKA 1NT2A 3UBTA 1WG8A 1M6EX 1I1NA 1WXXA 2P1DA 5EG5A 5CVJA 3KR9A 2E5WA 2FHPA 3BUSA 2NP6A 4F85A 4X60A 4R6WA 1D2CA 5K8VA 4CTKA 1ZQ9A 1N2XA 4ER6A 5DPMA 3SSOA 3A26A 3MCZA 3PLAE 2NP7A 3AXSA 3P2EA 1FP1D 3OU2A 3E05A 4KDCA 4R8RA 4RTLA 4RTRA 2Z6AA 3OZTA 3P8ZA 2VDWA 3UJDA 1NV9A 3VC2A 1EJ6A 1AV6A 3FRIA 3ID6C 3L8DA 1X1BA 1PJZA 2PX2A 3ER9A 3FPFA 2JH8A 3LECA 3CGGA 2JH9A 5FWDA 4C06A 1G55A 3LX6A 4PINA 3BKXA 2EFJA 3EGVA 3K6RA 1JTEA 2YTZA 3UJ9A 4EK9A 3SMQA 2C7QA 4C04A 2PSSA 4E70A 3CKKA 3GO4A 3FTFA 1F38A 4A6DA 4E2WA 1WXWA 3TKYA 3PS9A 3REOA 2BR5A 3HTXA 1VLMA 3C3YA 1L3CA 2BR3A 4OBXA 3EMBA 2GB4A 3M4XA 2YX1A 4PYJA 3PTAA 4C4AA 1XVAA 4RTOA 2YUIA 3JWIA 5DXJA 2ZBQA 4KDRA 4U7PB 3SVZA 4BP3A 4ISCA 2ZULA 3RW9A 1L3IA 3AY0A 1QAOA 5EMJA 3MGGA 5CUQA 1OR8A 4E2ZA 2QYOA 3P2IA 1YFLA 2IDKA 1SUIA 2AOWA 3HCFA 3SR4A 5LQAA 2ZCJA 5T6BA 5F2NA 5KS2A 2BM8A 3H2BA 5C1IA 2HV9A 3GJYA 1I9GA 4RWZA 5LQUA 3TFWA 3EEOA 2NNWB 1RI1A 3BWCA 3NW9A 5E9WA 3PFHA 4AZWA 1R74A 1QYRA 5EIWA 1WZNA 2P41A 2PGXA 4P7JA 2EJTA 2WA1A 4BP1A 2XYVA 2XBMA 2P7HA 4PGGA 5GOZA 4MHTA 3EVAA 2ERCA 3FTDA 4ER0A 1VP9A 3KQTA 5FUBA 5CCBA 5FCDA 5DWQA 2GPYA 1BKYA 3A25A 2EX4A 1B42A 2FK8A 4X61A 4BLUA 4DQ0A 2YXDA 2OO3A 3P9NA 2PV0A 5EIFA 1NE2A 3FPGA 3MAGA 1P1CA 2AVDA 2VP3A 2P7IA 3KQMA 3UJ6A 3R24A 5DM1A 4P7FA 5EMLA 4HRAA 1N7JA 1X1CA 4OA5A 2K4MA 4RTPA 1P1BA 2B2CA 1KYWA 3DXXA 3G88A 3M33A 5EMMA 5FTWA 5GIOE 7MHTA 1YUBA 3EGIA 2G72A 4OX9Y 2P3LA 4BLWA 3DLIA 2QRVB 5DSTA 3RIEA 4RVHA 3CJTA 3DXYA 3MCTA 1X1DA 3OFKA 4O29A 4F86A 5KYGA 5CVDA 4FSXA 1G8SA 4YV1A 2GLUA 4GUAA 2Y1XA 4QPNA 1Q0SA 5E1DA 5LQNA 2BH2A 4R8SA 2AVNA 3KU1A 5EEGA 4GF5A 3ELWA 4E31A 3FPHA 5GM2A 1UIRA 2GAFA 1VE3A 5GINE 5CVUA 5CIYA 1BHJA 5MHTA 2ESRA 3NDJA 3PB3A 5M5BA 4HC4A 5HIJA 3O31A 4AX8A 2EG5A 4E32A 1EIZA 2ZWVA 3HVJA 3EPPA 4FS8A 1JG1A 5EQJB 4CXMA 1BOOA 3GRZA 2NYUA 1NBIA 4AZSA 1SQFA 3HM2A 3GU3A 5EMKA 1XCJA 4RTJA 3JWHA 1D2GA 2PY6A 1JTFA 1SQGA 2HWKA 2YR0A 2ORED 3KR0A 4C08A 4YV0A 5F2KA 2JHPA 3EVGA 5IH3A 1ZG3A 4RVGA 2C7RA 4WXHA 2I9KA 2PWYA 2R3SA 4PYIA 2BM9A
chains in the Genus database with same CATH superfamily
1RCFA 3RIGA 3BJEA 3IS3A 3KHTA 3ICVA 3NRCA 4LMPA 5FXMA 5HIAA 2FW0A 4R6XA 1LNSA 1BG6A 1ORVA 4YECA 3WWEA 3TRDA 3ZR4B 5KQLA 4U7FA 1LF5A 3KWJA 4CIAA 4HNQA 4S05A 3EYAA 2Y66A 3QYXA 2ZUCA 4GDFA 1FXWA 1Z9BA 2NTJA 1IXSB 3BMQB 1FL9A 3ZY6A 4F4HA 1UDWA 1K68A 1V11A 1WKCA 2CXQA 2PUTA 3HJCA 3CUTA 4N8EA 1T8SA 2ZR0A 4IUDS 4O1MA 2VHXA 3V33A 1J56A 2M6SA 1VKJA 1G0OA 5KMGA 2Q9AA 5HJ7A 1HYEA 1K7YA 2C7GA 2LCFA 3AR9A 3CEAA 4J0JA 1V48A 3LBYA 3E8SA 1V3UA 3DZGA 4L8GA 1HDIA 1W36B 3MEQA 1HTTA 1E9DA 2HF8A 3VJMA 4OXKA 4U02A 4KL8S 3K8QA 2VK4A 4GMHA 4KIFA 5TS3A 5A3SA 3RSCA 3A6LA 2NUBA 4OQYA 2MR6A 5LYJF 3P9QA 4OGFA 4PZUA 4RYLA 2E1RA 4Z86A 1SC1A 2O38A 1CNEA 1FS6A 1VJ1A 1YCGA 3EIXA 3PJGA 5CB8A 2ECPA 1KSHA 3CS3A 1OH6A 4FLFA 1NBEA 4QLAA 3VYWA 3HI6A 3UPDA 1UPBA 3DHEA 3L7DA 4IQGA 5HKLA 3IT3A 2RH9B 2ACKA 4EF6A 2JLQA 2FPKA 3W34A 1E89A 2GBLA 3W8DA 5DT2A 2HA5A 3P5SA 1YQDA 3GIDA 4OV6B 2YUTA 3T7SA 1VB5A 2XNHA 1PJTA 3GLHA 3JR7A 3BSFA 1Y82A 5AXAA 1HFEL 3EGEA 4TQAA 3E15A 3KYIB 3RTEA 1XWWA 1YKGA 3DEHA 4RIEA 5CJPA 4Z7QB 2PWBA 3HBNA 2IYVA 1T2DA 2BM0A 3V1UA 3NHJA 4RK0A 5CFOA 4V03A 3THYA 1GPMA 3R74A 1A82A 3OEHA 5T3YA 3V4RA 1N1EA 3R3WA 3WWZA 5ELLA 2PUEA 5B30A 2BFNA 4H4CA 4C05A 4OM8A 3H5AA 4FR0A 4IHQA 1YE5A 1QNLA 2XAAA 3DD1A 3QNMA 5CEJA 3JZFA 1CQIB 3GJ6A 3MWEA 4PY2A 4R0VA 3SP1A 1S2GA 2FSUA 4U2CA 4LGMA 5F23A 5HKBA 5EC8A 3TOVA 3FCOA 1L4EA 5LYJA 2B30A 1JH9A 1EM6A 4Z5HA 1MH1A 2BI4A 1II8B 3ANLA 1X8LA 4TV8F 1XPJA 3Q11A 5GJBA 4DABA 4OXRA 2F1KA 5KKAA 1E2BA 1IJFA 1SZJG 1LJ8A 3H8JA 3TTXA 2MOKA 2YHIB 1XDZA 1HE8B 3KXAA 3FIUA 5C7LO 4LZWA 1G3MA 4ZT2A 3GELA 1JLHA 4MXDA 2B83A 1Q12A 3MD0A 2WT8A 2GJAA 2V8BA 2IYQA 2JFVA 4X00A 1J90A 1U2GC 2W8ZA 1N4DA 3BJIC 5AM0A 1T25A 2CMFA 3E4DA 1LPPA 5JY6A 3RYTC 3TZQA 3U7EB 4DMCA 1T4GA 3NXHA 1V41E 3ENKA 4R2MA 1QQTA 2C20A 2IV2X 5CFQA 3DDOA 3S2UA 3ENQA 3FWYA 1V2HE 2XEDA 4ZC1A 2AR9A 5EJGA 3EUAA 3Q7TA 2KBEA 1ZXLA 4OKNA 3TOSA 1U0JA 4LYDA 1G5FA 3QWFA 3B82A 3SXJA 4Z7NB 4E1VA 3JD3A 2FWRA 3NH6A 5CTAA 4IHAA 4DE5A 5IJ9A 5LBUA 1FFBA 2E4UA 2P9YA 3L92A 1HDXA 5B37A 2XADA 3HHPA 2I6FA 3A6JA 1FUUA 3VDQA 1PNOA 2DBRA 5FUWA 4ZAWA 5LJIA 4C6TB 4PTLA 2I3DA 1M10A 3OE7D 5BPFA 4Y2PA 3STWA 4HKTA 4POOA 1HOTA 4HLUA 1MA3A 2H2IA 4PHTA 3QFIA 3ENVA 4HR7A 4OSEA 1XHLA 2V7QD 4NOLA 1YVUA 2HEIA 5C0OE 2R1TA 3X1DA 4ZQBA 3FYMA 2J5XA 1N8NA 5E4YA 4URHA 2O8BA 4FT4A 3C3CA 1N2CB 4RLSA 3AU9A 1ZVVA 3MCAA 1PT6A 4EG3A 4XGIA 1KHHA 5HKKD 4Q66C 4X85A 4REQA 2DR3A 1DG1G 4AP5A 4ARZA 4G63A 3LL7A 4XJSA 2OY0A 3X1MA 2IH4A 3ONVA 2LIVA 5FPTA 4Q19A 3UAGA 5CXQA 3CRW1 2UVPB 3JAWB 4PLYA 1EVJA 1ETUA 2BTEA 3I01A 4TX1A 4ER5A 4FYPA 4ZEXA 3LLVA 1DKUA 3PD1A 4HK4A 3L0DA 3CCFA 3UFBA 1CUBA 4RKEA 4EGQA 4CN8A 2YHSA 5AUPB 5K8JB 3K3PA 4NG5A 5TMBA 4MS3A 1YS2X 2ZRLA 2GYWA 1KO4A 2FJUA 3N5KA 5G2OA 1B7GO 4C7VA 3OUTA 2L19A 4AZ3A 1KI6B 5AQEA 2J7WA 1H66A 1IM8A 1DP4A 1WCIB 2B6NA 2QN7A 3D8NA 1XP8A 5AR1A 4EYGA 1S1CA 3CJQA 3IBTA 1G6HA 2BL4A 3NHLA 4QTUB 4UEOA 1WX1A 9ABPA 1Q74A 3V4LA 1VPEA 4TLEA 4UM7A 1M1YB 4OLHA 2ZI7A 3EXFA 3GUHA 3HL0A 1OPRA 1Q1QA 3VU3A 1PJ4A 4IDPA 2C2MA 3UOWA 1V9LA 2VPYA 4TKVA 1N57A 3PIDA 3SJBA 1K5DA 2XYGA 3KSBC 2GXUA 1F06A 2F43A 4JGGA 4Q6WA 4IG4A 4E2XA 1NVTA 5ALSA 3VYVA 3PC8C 5G02A 2I99A 4KXYA 4KLRA 4TZTA 5DKFA 3REFA 4CLEA 5LQCA 3G8AA 1TC1A 2NMVA 1XA3A 3G0BA 5FHQA 2VBGA 3G2LA 5P21A 2WUSR 1S8FA 1ZMBA 2P9BA 2VAMA 3L1IA 5JVDB 1UP7A 1EE9A 5JH7B 4KE8A 1NUPA 1UMBA 3HV0A 3IUBA 4BFVA 5K8VA 3COWA 4G8BA 2IXEA 1BGVA 4IRUB 2Y2UA 3GLIB 3IQIX 1NAHA 2WIUB 2ZJ6A 1JNXX 5H3CA 3BKWA 4Y30A 1ZZ7A 4DWVA 3PGKA 5ALUA 3ACCA 2OXIA 1Q84A 1NJGA 2IXGA 2VJOA 1PERL 1LW7A 4YCBA 4C43A 3QXCA 3WNDA 3AVYA 4EITA 1H2WA 3FFXA 3ZHRA 2PL3A 4RORA 3DTNA 4F9TA 2OC4A 5DCWA 4GU5A 3T0IA 2WKPA 2DCMA 2A3NA 3BULA 2W2QA 1O9HA 3IMCA 4ZU6X 3Q7PA 2J3QA 3E3NA 3WLRA 3HK2A 3DTVB 1UPFA 4QGFA 4D9FA 1IXZA 1G8HA 1FF9A 4GPTA 3D3NA 1X1EA 1WIZA 3ESYA 3DBHA 3UANA 1GNVA 3O3OB 4BZPA 2GF0A 2CN1A 2P1ZA 1AMOA 4U0KA 5PGMA 4I9UA 4MV1A 4DLZA 1MJFA 2RHLA 3LCUA 1JQBA 1F0PA 3NAGA 4RW0A 4NCJA 5KI6A 1N5KA 3JQQA 1PVVA 2XSDC 1AVTA 1TECE 3GGPA 4DEVA 3I23A 5IFKA 1NQ5A 3D4BA 3RTCA 5IS2A 5HBRA 3KQLA 1MAWA 3TD6A 4YRGA 4EY5A 1CY7A 1DB3A 2WD7A 4X97A 1E2IA 3MHTA 4E5MA 1PZMA 1AT1A 1DQSA 2Q6KA 3UMJA 1P6XA 2GHTA 4MEAA 1E3WA 2CYBA 2V9ZA 9LDTA 1YB2A 2PO5A 4G85A 4KMMA 3LGAA 1WTCA 5G0SA 4PSCA 3ZI4A 3HACA 1Z2AA 3N8NA 4D3YA 3A3OA 4LRUA 2X86A 1KEWA 1FYXA 2NAPA 4OMDA 4R68A 2R4QA 3LHIA 3OQVA 2J41A 1DFHA 3I3SR 1F8FA 2IDJA 3WK8A 4Q7EA 5ADVA 4TLCA 2RI6A 3KLBA 10MHA 3A1WA 1F3LA 3ROGA 2RB4A 3RUFA 4HHEA 4FDUA 1Y3DE 2ZSFA 5A6SB 4TTTS 3IEVA 3D02A 4NMLA 4OAPA 1A8SA 1YDMA 3PEVA 3ZEAA 4W8GA 5BNTA 4OU5A 1QZTA 2YS7A 3UXEA 4EVSA 2FZ5A 4RPHA 1MO3A 1X7ZA 3MCWA 4WKGA 5KYYB 1NXVA 4EHHA 3DVAA 4EEKA 2GKGA 4YIHA 4PPQA 1R8JA 3KETA 1E7YA 3KSDO 1M7HA 2X0JA 3LA6A 4JT8A 4ZT5A 4A2QA 1W34A 1GTMA 1VLLA 1C81A 3P4UA 3BK7A 4NX2A 4JL5A 4O4HF 4MWBA 2VP2A 2FPPB 3VC1A 4JCYA 4GLFA 1VBKA 4IIJB 3JATB 2KEJA 2PKEA 3MOIA 4I2NA 3OJEA 4R05A 2ZIUB 3WAKA 1P17A 4GP7A 5CGZA 1Z4MA 4FINA 3P52A 1E9VA 4RSRA 2ACEA 3IEPA 1NW5A 2GZ3A 2B37A 1JG6A 1EM8A 4F4IA 3OWQA 3O9ZA 3TR6A 2R8ZA 2A9KA 1XCPA 2AG1A 4BNLA 1X7ZB 3KPUA 4M7RA 3U7JA 4C7MA 1MBZA 3G2QA 3VSCA 3DOFA 1WXFA 2EEZA 4LSMA 4NCNA 3PFIA 4B9EA 1RZ3A 3DL0A 5LZ2A 4NARA 4TLLB 5CNMA 1VJ0A 2I4RA 7ADHA 3EWNA 2DUJA 2ZXUA 1BGXT 1SQ6A 4FFPA 4E5KA 4ZOBA 3HVKA 1GITA 2WQ6A 2P1DA 2PH3A 3LJKA 4ENVA 2O4CA 3OJLA 5J23A 4UM5A 2JVJA 2YW9A 1J42A 1LJLA 1Q5PA 1RW4A 2QAGC 4H3KB 4E2FA 4EUHA 4YRSA 2G7MC 1WKVA 2OBBA 2QMUA 2X1MA 3AUKA 4JEMA 4LJSA 4MINA 4YDRA 1DMSA 2OBXA 4R8LA 4DQVA 1C7EA 1FRNA 3DMYA 5D00A 2C0PA 5TGZA 4WESB 3VK0A 4OY3A 4Q34A 4UAUA 3CSUA 5E4FA 4DV2B 2I4NA 3BXZA 4QYIA 1CUYA 3IKJA 1CR0A 3BSSA 3FDIA 4MKIA 2FEMA 4UUMA 1GZ3A 2IP4A 4ZU1X 1U5BA 3V3TA 2BUCA 4PXSA 1SULA 3ULKA 3G0HA 2CXNA 4RD1A 1M73E 1LLCA 2Y0BA 4ZT6A 1FLVA 2A5GA 4BE9A 1QHXA 4EJ0A 3GFGA 3NKFA 4DOMA 1R5NA 3BKXA 1M0WA 3R0VA 4CHTA 4DV7B 2JRLA 2JK1A 3HJRA 5CAEA 3NHZA 4HRVA 1U8FO 1V71A 1R6VA 2GBCA 4OG2A 3M7IA 3TD2A 3FSRA 3FMYA 3EIQA 4XVRA 4E46A 2DE0X 3REOA 3AF0A 3QVXA 4WTOA 3TVTA 4EPVA 2FOXA 3GUCA 2HSZA 3JRWA 1OX4B 1XTQA 2E1PA 2WAMA 2GLXA 3QXJA 1XVAA 2GCGA 4RPKA 3WYAA 1PNTA 4X6XA 5DXJA 2AWOA 4F2DA 2XTJA 4F93B 3BE6A 1P75A 1ZH4A 3E3MA 4D9CA 5ICSA 4OJTA 1EE2A 5A05A 3RRJA 4ESHA 4I81A 3ZCPA 2HK9A 2WF9A 4YFYA 3M1LA 2AC7A 3MWDA 5LQAA 4MYHA 2XDQA 4KDFA 2XSZD 1NVFA 4BKOA 2GNPA 1FU7A 3DT9A 4U5QA 1XZJA 3S7ZA 3CEPB 1TO2E 4HQ0A 5FAXA 1L4UA 1V8OA 3PUKA 4EFDA 5CB4F 1QYRA 3PA6A 3PUHA 2HJ9A 1WZNA 2GJKA 4FGJA 1RPJA 4JIGA 3WXBA 1I4LD 1XAHA 4B31A 4ECAA 2JAWA 3Q1LA 1X0VA 4PGGA 3MMZA 4HOYA 1K7EB 2ZRKA 5CX1B 1USIA 4JUIA 5DFAA 1TADA 1PQWA 4LVOA 3QENA 3NBQA 1T8RA 2LYRA 2AXZA 2ATVA 3WNZA 4YX9A 3BORA 2F90A 2H4XA 2AVDA 1DBSA 3RC9A 5K4HA 1U2PA 2LXNA 2AK3A 3E82A 4HEHA 2LDBA 3RLFA 2JZCA 2ZETA 3G85A 3KT6A 2XUHA 3AW9A 1V96A 1UM9B 1XTVA 2NQTA 4IEEA 4ZVPA 3N0RA 3STVA 1D09A 5K8CA 7MHTA 2GRMA 3T4EA 1Y8QA 1O1YA 4BJ3A 4OX9Y 1EVYA 3NH9A 5EQTA 2IPLA 3CJTA 3MT9A 4ZHQB 2ZTVA 1PJ3A 4RDXA 2BH2A 3OO1A 3A1NA 3BXHA 3EZ7A 1MFZA 2V6BA 2RDMA 1RRCA 3B51X 2QVGA 1ZIYA 4J7XA 4N3BA 3ELWA 1RPEL 1C80A 2BNNA 1NW9B 1TQHA 3AR8A 3KUXA 3QXGA 3ETNA 4RD0A 5CM9C 4JFRA 1J33A 2C5LA 1JHPA 2D59A 5E7IA 3TNLA 3TQFA 4GICA 5GINE 1G1MA 3WQRA 4MKRA 3LTEA 3R8XA 2HC9A 2J45A 2UZIR 2GJ4A 3O31A 1PTJC 2D7CA 1V3TA 3ANNA 2YW2A 3OX1A 3PENA 4IIGA 2PMCA 4M8IA 5DBIA 1STOA 2DY1A 2PK3A 3IHLA 4IXMA 2WQZA 4YMUA 3FZNA 3O8NA 1GCAA 2JI6A 1J0BA 4W9NC 5LWQA 3MT7A 3V6MA 1P6QA 3AJ9A 3HM2A 4QUDA 1SB8A 4KK4A 2GCPA 1D2GA 4AY5A 2HCBA 3A4NA 1S0UA 1G8GA 2W2PA 4DMHA 1UZAA 2IYLD 3CV3A 3IL2A 3TIGA 1X7YB 2VA9A 3EPRA 3GN5B 2NZWA 3I6QA 5HFNA 3THXB 3L1HA 3DDWA 3UM9A 2C7RA 1T4CB 2XODA 5EA2A 1CXZA 4PYIA 2XTAA 4QUJA 2HPZA 3GWZA 5FOXA 4MVWA 3WSTA 2C00A 3PPYA 1OH8A 5B7QA 1CZOA 4ZCSA 1GDHA 1X80B 2QL5A 5IYZF 5ECYA 1G21E 5F7OA 3A1FA 3EH2A 3RT7A 4C4ZA 3HBAA 2ZEJA 5F73A 2OXTA 3FMVA 6REQA 1D7OA 2MWMA 2A92A 3O73A 4Q47A 2XH8A 5EKXA 3ZHUA 5K8IA 2VUHB 4EA8A 1ULUA 2RGRA 2W2NA 2XVAA 1HEYA 4IDBA 4KQWA 4C21A 2V6JA 2ZBFA 4H6XA 1Q22A 4B0PA 4E4YA 5JSUA 1MAVA 3COYA 1IZ8A 4GLOA 3GMIA 3KS9A 3GGCA 2IXBA 2A7QA 2JGDB 3DMFA 5ED0A 4HS4A 4BMDA 2BM1A 3H6KA 4IIDA 1TQ8A 1YR7A 2I65A 2MJLA 4M6WA 4C4XA 3VOAA 1UBFA 4HQNA 3IAEA 3JPYA 4MRMA 4AJ4A 4MWSA 3V2GA 3GN2A 3IVRA 4HGYA 3MUEA 4UVIA 2QRNA 4ASUA 1XB2A 2XF2A 3C6XA 2UZ3A 2VUTA 2AZ4A 3LP5A 4UTOA 2WABA 3WLJA 2GAAA 4E7OA 3HNPA 3EZFA 2EGGA 4DE9A 4N49A 1XD2A 1M1NA 1I01A 3IMEA 1GG2A 2PKYX 1HORA 2TMDA 4ZOLB 4EYEA 3DLBA 5IAJA 2HH9A 1FTWA 4XFJA 4CM3A 4CIBA 3STXA 4LXUA 3VNAA 3K2IA 5CBPB 1NW6A 4NKRA 4YB8A 1JHQA 3F67A 3QUAA 4O5AA 1V4NA 4GZ5A 4LFCB 4A10A 2LWIA 1EEXB 4Q21A 5K0JA 2NG1A 4EH1A 1ODCA 4D41A 3NASA 4H59A 1AV6A 1ISPA 4OFBA 4UNPA 3WNVA 3I42A 3KKKA 3RODA 4QQNA 4LDPA 2WJZB 3UH1A 1O0BA 4CF4A 1R0SA 1UDCA 4C4SA 2OFXA 3KWLA 3H3JA 5FUQA 1XTRA 4PU7A 1FQJA 1PRUA 1VMEA 2BSXA 3F51A 3NBFA 1RKXA 3NJRA 4HQFA 4U8HA 5JNVA 2IUTA 3DXZA 5KSYA 4TTJA 2VI5A 1XLUA 3T8YA 2WQ7A 1SXJE 1SXPA 3HXTA 2IWRA 1X1TA 3H9CA 1AX9A 2BFCB 4EEZA 3P2KA 3WLMA 3YASA 4IWNA 5JFOA 2I2CA 3BT7A 1ML3A 3DVAB 1ULHA 2P9GA 4L7VA 4YJDA 1V8PA 1JHOA 3ZY3A 3ZHVA 2EBFX 1MEJA 2BCEA 3GBFA 2JFYA 3OQIA 4ZV7A 1WH8A 5K0NA 1EVLA 2C4TA 2OGWA 3B6MA 3C98A 3KQPA 2QD1A 4MOWA 3RTAA 3DC2A 1EK5A 1N8KA 5G4KA 4GX1A 5CGQB 4JU9A 5CU7A 5FTKA 5K0BA 3SJAA 3KQYA 3JVIA 2GN4A 2NXJA 1MQSA 3DE0X 3JD2A 3LYLA 3ZCXA 1RP1A 1JE1A 1XZ8A 2X13A 5IVPA 3RKRA 5EZ6B 2I2AA 3UPUA 1J09A 2E2WA 4C7XA 1UH5A 1D7AA 1P5JA 1WW2A 2V7UA 4QFDA 5AW4A 3U4QB 3HJFA 2E4ZA 2VO1A 1YS1X 3CRVA 3HN7A 1RPZA 1P4AA 1V47A 3IPXA 1R9NA 3TG2A 3LX8A 4ZCIA 5KSZA 4TQ9A 4ER7A 2GNAA 2YN4A 2IDMA 4G0ZA 3VAYA 3CIOA 3P0JA 5KYWA 1WNTA 4YP9A 4BWYA 3QPCA 2ZRBA 5MN5A 1WB5A 3DWFA 3FPKA 1JFSA 3LE8A 4OLFA 1DKQA 1NXXA 2GEDA 4TT3D 4CTJA 2HDOA 2VDWB 4F3KA 4JVOA 2BBTA 4DV6B 3PJFA 4BVBA 4D4KA 2BYTA 2AOTB 2UV8A 2SBTA 3ABRB 4JLPA 5BMOA 4IUCS 5E9QA 2RAUA 3TLGB 3FKJA 2HF7A 2YMPA 5ICFA 1Z4LA 1ADJA 2VDNB 3NO4A 1UKEA 1EJ2A 4GEKA 1U9IA 3GJ8A 4GPD1 3ROQA 1DT3A 1NURA 2H5JA 3N8IA 3QPAA 3AO0B 3PUYA 2OHGA 1DKLA 3ZDDA 4D6XA 3K05A 3UHAA 4WUVA 2C4MA 4O63O 3AONB 4O4LA 4Z4IA 1CNFA 4ACAA 1M66A 1NX9A 3IVXA 1RI5A 2CE2X 4BU0A 2G9RA 3LI2A 3K7EA 3QWBA 4DT1A 4BFTA 5BR4A 3JWGA 3OM9A 2PVSA 4EKDA 2B2NA 3P97A 4MPDA 5DI3B 5H02A 2PKQO 2X58A 4ESEA 3ZHXA 1KEUA 3HB0A 4NBSA 3F8SA 3WK9A 5FTLA 1CWUA 1CYDA 3VVLA 1H1DA 4ZK2A 2AFVA 3KEGA 4GX2A 3ZD9A 4C0KA 5BXQC 3FPAA 4AS2A 5I7FA 3OFJA 3RC3A 2B21A 3TRKA 5CURA 3A31A 3RHFA 7REQB 1ZCAA 1NW3A 2G1UA 4LK2A 3AWIA 1WH6A 1OX4A 5AI6A 1FRZA 4AZTA 2AGVA 2DPXA 4I50F 2R1JL 1UBJS 1ZK4A 2PM8A 2QR5A 4U2KA 1Q7EA 4K6MA 3PP8A 1YZ3A 1QC5B 2VHQA 1D4OA 3OLQA 4WXEA 3ZHZA 4WLOA 1FUKA 3QEMB 2AS0A 4JT9A 4MB6A 3VR6D 4DIBA 5ECDA 5EE5B 3WXMA 4CV2A 3LD9A 5KWIA 3VNUA 1JXAA 1JYSA 2JJMA 1J00A 2IV1A 3DNVB 1OE0A 2P4UA 2VXBA 4XGRA 1RM0A 1P2VA 3JXEA 3ZVKA 1GFIA 3DLAA 3GUUA 2PMEA 4B3DA 4AXXA 4EY8A 3LUHA 1WF3A 2PGAA 4GGMX 4N03A 2IBTA 1XZDA 1X1RA 4DQXA 1E3IA 1DADA 4LE1A 1GVHA 2NN3C 1AE1A 1ZMTA 5G0UA 5KINB 1LK5A 4NYJQ 2R6ZA 3TX6A 1G4AE 3ZDQA 3EA4A 4QSMA 2VK2A 5HHTA 3TTWA 2DTDA 4GOXA 1GXSA 1SBIA 2ZJ2A 3N2ZB 4PYLA 1AZLA 1U04A 4GWKA 4NU5A 4PNPA 5EWLB 5JMTA 2PUFA 1NBHA 1NJ5A 2H7VA 4TMFA 4C1BA 4D4JA 4MGHA 4F2WA 2PE5A 3Q2IA 3PHJA 2VF5X 4RENA 1DIBA 5ALZA 1HQYE 3TM5A 3VVMA 3FCEA 3L1JA 4JJ6A 2MINB 2R8PA 4I2VA 1SM4A 1XU4A 4KYIB 4Q4JA 3A3YA 4CTMA 3KJIA 5KEIA 1XP5A 2IYNA 4G07A 2FG7C 3PFCA 1NZDA 3L7YA 2Q5OA 5CFNA 2UKDA 4TS4A 1KBOA 2GCNA 4UTZA 2AI2A 3A3NA 4LJ4A 4M7OA 6ABPA 1CUWA 2P6PA 4FE7A 2E5LB 2VRCA 4MK4A 2A6CA 1C9JA 1IYZA 4WOJA 3GPLA 3L8HA 3GGGA 1SY7A 4E5YA 4X84A 3H65A 1PG0A 2D5LA 4G26A 4I3GA 3HP7A 1FFXB 3BDIA 3GZTB 1YS7A 2E4YA 3HCOA 3HPRA 1ZPQA 4CQMA 1HV8A 1SHJA 3NU1A 5EIHA 4EVIA 1Q17A 4GE0A 2IEAA 4DSZA 1MB4A 2NU6A 1LDBA 1UCFA 3KAKA 3PRYA 4K9KA 4FEAA 5HF8A 2JFXA 2XRFA 4N3CA 1FNCA 2EYQA 2CNBA 2HLDD 2EKQA 2BVNA 4KWEA 1EK6A 2ZU0C 4JMPA 4R1MA 3FHCB 4R54A 4TVKA 1GGVA 5H4HA 3PEEA 1HE5A 3KJEA 1FU8A 3ZBUA 2Z6UA 1VBNA 3GK3A 4JKIA 3PSAA 1H9CA 3LZCA 4IH4A 4QBGB 4YRFA 1JEYA 1DDGA 2LUOA 1IOWA 1EUDB 1MC5A 3HV2A 3L84A 4QPCA 4AFNA 3E6AA 1DOZA 4WK4B 4ID9A 2Z57A 4DHEA 3H87A 1XTKA 2VZ0A 2B6HA 3UWPA 1P7CA 3ZGNA 4KGZA 2XD9A 1EZ1A 2ZJ8A 5LD2B 4LZAA 1SUEA 1QH1B 1IUKA 4KLZA 5I7WA 2CE7A 2XOKD 1IUNA 1MNAA 2WM9B 3SEQA 4CJXA 1BDMA 4RPCA 1SKMA 1ADYA 4TSRA 2Y1FA 3RROA 2PUJA 1BEEA 1OLOA 3PUJA 4NY1A 3JATA 4DDMA 2YVLA 5BXYA 2IH2A 3TOZA 3TFLA 3B3FA 3MGAA 1Y37A 1ZVJA 2DP4E 3AU8A 4L5IA 4N9QA 4UPVA 4BC0A 3ZPXA 1CUJA 2JGDA 3N2KB 4WECA 4N8SA 2XCLA 2LGJA 3G5AA 3MFYA 4KR0A 3ZH2A 3HVRA 2QR3A 5AW1A 1NFRA 3IP3A 2ZYAA 3LQ4A 4CQJA 1POWA 3HMQA 1IY9A 4MW0A 3D5QA 2F3SA 1VZ2A 4KJZA 3ZE2B 1U2EA 3ZVLA 2PXXA 3IERA 3BJRA 5EWJB 4OX9B 1S8NA 4OF4A 2JNWA 1A04A 3VPXA 1HFWA 2WMDA 4WCFC 4WT7A 3RBZA 1SXJD 1EGAA 1KRXA 1FQKA 3OPQA 1QB8A 2YHIA 5G53C 1C9MA 1P4GA 4C5AA 3IA7A 1PJBA 1UDBA 5LLTA 1ABFA 2H4HA 1RKQA 3V4OA 4TXLA 1JMVA 2QTVA 3OMLA 1LFAA 2OZVA 2QOEA 2XCQA 4MV6A 2XT0A 4YS6A 4AN4A 1DAKA 1GN8A 2XQFA 5F77A 4XEHA 4EGSA 4NCXA 4IWRA 3PQ3A 3JQ8A 3OWHA 2JIMA 4G8CA 3FCSB 4GR5A 5I9TA 4BO5A 3LIIA 2OECA 4L0MA 2A4KA 3ILYA 3KR9A 3FHJA 5AVTA 1VC2A 1XRRA 3GFFA 3N76A 1VHDA 3BFJA 1YHZA 4PO1A 1MN6A 2FZWA 2QSYA 2I29A 3O93A 4A8JB 4WBNB 4NZNA 4US2R 3IE0A 1UAGA 3WLPA 1T0PA 4L3WA 3RF7A 3K8ZA 1FP1D 3VKWA 2PDAA 1UXJA 4GLBA 4QGSA 2VVTA 1VJRA 2XZOA 3ROZA 5SY9A 1MGPA 4BNMA 2FUKA 1G4HA 3E70C 1ZY2A 2D2EA 3TSYA 4C0WA 1RHKA 3L8DA 3ZXXA 1E79A 5FL7A 3W2TA 3CNEA 2BLNA 1W0JD 4RD3A 5F9HA 3BH0A 2FEWB 2YV3A 4PINA 1IHXA 2Q1SA 3E0XA 2CT8A 4RJ2A 3DMPA 2O8CA 4XTRA 2I22A 2QN2A 2CDNA 1E2NA 2DPHA 2P6UA 3BSWA 2PSSA 3AR4A 4Y6SA 4LYFA 4NE9A 3PPVA 3IBGA 3O8BA 2F3PA 1WF6A 2Q3LA 5IVIA 2XUJA 3UJDA 1CUDA 4LYAA 1OHHA 5HTOA 1U7PA 2ZYUX 4HD8A 1BMQA 1LU9A 1PFKA 1A2OA 1IUOA 1Y5MA 2RBKA 1YRBA 1K75A 2XR1A 3BYZA 3DEFA 1WTAA 3SVZA 4DVGA 1XZKA 2REQA 2ZULA 1VI6A 3ZHMA 3HFGA 2QTWB 4L6CA 4PZ0A 2ZIZA 3QQ6A 2I55A 4TWRA 5L4SA 3FMIA 4G9GA 3RSZA 1NYLA 3D43A 3B7WA 1YSCA 3NTOA 5DGCA 4RPLA 5TE9A 2BDUA 4YRRA 2GPTA 2HUNA 1VPWA 2HV9A 1CF2O 1SIUA 3WICA 1Y9QA 1UKVY 3BMXA 3ESZA 1JSRA 1XBTA 3M9WA 5DT9A 1KU6A 3TZKA 1RI1A 2ZB7A 4FJ0A 4ZO7A 1E6UA 1KI2A 1YIAA 2GUGA 4LCBA 4FYHA 4X1IA 3RE1A 1XDBA 3L7BA 1K92A 4E08A 1AUPA 2A1IA 1A5BB 1F4VA 2XB6A 3MINA 3QBVA 1U9YA 4UCXA 1S3GA 2MCFA 1IVSA 1TVCA 1OC4A 1P9NA 3HDVA 4ER0A 1C3XA 1J0XO 1W75A 4K9RA 4AMGA 4HB2A 4DC1A 5D5HA 5AVZA 2FK8A 4QFMA 2IYOA 2G82A 3JASA 3QHPA 3QLJA 2FWPA 1ZCJA 1F20A 2CXUA 2Y68A 2H59A 4RM2A 3ZHTA 2P7IA 1GCGA 3KQMA 2UUCB 3DV9A 3QPWA 2XB2A 4GR4A 4E5PA 1DKMA 1WPQA 1OFHA 1U3TA 2JGKA 3IIKA 3OMWA 4GKAA 1HWYA 3BD1A 3SM9A 2FKAA 1UBOS 2K4MA 1EDEA 1P1BA 3WA7A 4JROA 2ZYVX 2Y92A 4RIIA 1FDUA 1ZMRA 2XUPA 4BLWA 3QSYA 4YJFB 4LOJA 5G41A 2KLBA 1TMYA 2ZBEA 3MCTA 4M2LA 4ND5A 3GLIE 2GLUA 4GUAA 4DLAA 1TMGE 1Q0SA 4Q4CA 4O4HA 2ZDHA 4BFZA 4CIYA 4ZI3A 3KQUA 1OOEA 1CS0A 4MIYA 1GAXA 4MJLA 3T7KA 2A7XA 1Z6GA 4IR7A 3B7HA 4M8SA 4B6PA 4WCVA 3G68A 3A1TA 1BHJA 1WUHS 1KI9A 5M5BA 1CY2A 3P9SA 4HC4A 1L4MA 3R4VA 5DHSA 3JWPA 4MGKR 3RJTA 1H3NA 3V4FA 3OPYI 1LUAA 3OD5A 1QCDA 3BGOS 1Z06A 2EQBA 2XGSA 3HL4A 3K8OE 1QS0A 3H5WA 2W71A 2NZYA 4LUCA 3RWOA 2EJWA 2WOOA 4YHBA 2G36A 4QREA 3NV7A 2OD7A 3SYLA 2XY4A 1BOFA 1JKFA 3KUCA 1E3SA 1B3BA 1TCUA 1KRWA 2XMZA 3PIIA 2SCUB 3KCQA 1D6JA 3OBBA 4G1FA 2PWYA 3BJMA 2EP8A 5EKTA 2HSDA 2VN8A 3N87A 4AJ2A 2NO4A 2QXUA 1H6CA 3T3GA 2OHOA 2YJGA 3NHFA 1IOZA 1MA0A 2BMEA 3I37X 2PXLA 3ASZA 4YRDA 2BCJQ 3EXAA 4PX2A 4AY6A 2WBLC 4KQEA 2B8JA 4OA8A 1VSQA 3NYRA 4G4SO 4ZYWA 1JVBA 4EJSC 4ZDJA 2CL7X 1E4OA 1X7XB 4IDOA 3K30A 5AW2A 2CHEA 2JRCA 2G1PA 1PN3A 4BMVA 2ZSHA 1CJKC 1ECGA 3NT5A 5L3RA 3ZHYA 2JZNA 1QGUA 2E48A 3FBGA 1V9CA 3GA0A 5EJ4A 2V74B 3OQBA 2DLCX 1LBEA 1FQWA 5ED4A 4F8YA 4TXJA 3T95A 1UOPA 3A6EA 3V9PA 3ZD8A 2P0AA 3L4JA 2OBFA 1QF9A 4GRIA 2WWFA 1QCZA 2PKQP 2P4SA 4N7MA 4RTMA 4DR5B 3PDCA 4BO9A 1JE0A 1G8YA 3P2OA 4JT4A 3FWNA 1SUAA 2XHEA 5FYQA 4PGHA 3HUTA 2ZUEA 1GJRA 5HFAA 4L8WB 4EW3A 1MQ9A 4H1UA 1I3LA 3G7DA 4CLOB 1CFJA 2BZGA 3C3PA 2ZK7A 3A1SA 2RHMA 4DANA 4X4CA 4IAOA 5F2OA 1Z29A 3HCEA 3IUEA 4MYDA 3G2PA 1M2EA 1JMKC 5FHRA 2VBCA 3W5HA 1YRHA 1DEKA 1MPTA 1C9DB 1A2BA 4HLDA 4C4PA 1F7UA 1XDSA 1CG6A 2WVHA 4IXTA 5L4NA 2JGLA 3EBLA 1E0JA 3L6UA 4EW2A 1P19A 4FIDA 1AQ6A 1RI4A 4KH0A 1ONNA 4EABA 1P1HA 1UDXA 2O8NA 1XU7A 1RAAA 4IV8A 1YSEA 1U1GA 3N70A 2AJ8A 1YJCA 2JD2A 2VEOA 4H7PA 4NH4A 1D2NA 1FJXA 2QRQA 4HH0A 3AKYA 4WH0A 1C5KA 4WACA 5IVHA 1Y33E 3W0LB 2GZMA 1NVXQ 1X19A 1J2TA 2PTHA 5CH3A 1N77A 2WSIA 4MVJG 2BEUB 2O3RA 1TKAA 2R65A 5EKUA 1WABA 4PCVA 3QWIA 1DBQA 4L5JA 2GA8A 1LEHA 3KAQA 4MQ4A 4WESA 4X4EA 4EY4A 1D9XA 5ALKA 1TJ3A 2KQUA 4FE4A 4QPDA 3N6VA 3PYXA 3MTEA 5AVSA 3TGLA 1ESEA 3WLTA 1WB9A 1FFHA 4ZO6A 5AT1A 4UJ5A 3M0EA 3LDFA 2O2YA 3CUEF 4HZGA 3EVBA 4ZYZA 4QDTA 4YDHB 3VKUA 4E2YA 3BMOB 3GHYA 4D74A 1ZOIA 3AXTA 4PR0A 1LBTA 2C1EA 3KK0A 3H6HA 4Q01A 5DSZA 2Y1KA 1V5FA 4HNRA 2WPDD 3WWCA 4F38A 5FPKA 1MXHA 5EIOA 1O4XA 3P9YA 2I6UA 4ZEMA 2TMKA 1BIFA 2NPOA 3I9FA 1L5RA 1QH8A 5LA6B 4HUQB 3PXPA 1VLVA 1WUTA 3EXHA 4EB3A 1E2EA 3FVQA 1G8MA 2QMQA 4BFYA 5TC4A 4ES6A 5C9ZA 1P62B 3U3JA 4NV1A 2HA4A 4W82A 4K6GA 4C0QC 2JATA 3A1EA 4LV6A 1EWTA 4MV3A 4YJ3B 5A0FA 3VR0A 3X1ZA 3ZLUA 1QGZA 3OD1A 3WGZA 3OU6A 4A9AA 2NTVA 2PRIA 2Y1LA 3LOPA 4TKZA 4EGCB 5K3OA 3B1KA 4M9QA 4G01B 3FSEA 4XD2A 4XM1A 4I7EA 3RFCA 2C98A 4R3WA 1CR1A 5B7GA 3U09A 4TVOA 3DOCA 4AJLA 2R2GA 3FNEA 1YWGO 5GVSA 5B1YA 4BXOA 2QJOA 2OPHA 2VATA 3RYCA 4ZQGA 3VVBA 1ZKDA 4R69A 4RHXA 3RS2A 4FDLA 1E5TA 1GU7A 2RKBA 2HMWA 4PXYA 1IBMB 2B92A 4DLVA 4FQ7A 5GM1A 5G0WA 1QP4A 1X1SA 4MQEB 3NRJA 4NC9A 3NB0A 5CB4B 4EJFA 1R18A 1YT5A 4O6VA 2YNMD 2JHFA 1ANKA 4YLGA 1J39A 4E12A 2A5JA 4A92A 4CGZA 1SVNA 3O1JC 1N78A 2JIQA 1T1IA 4K28A 1KQPA 1JT9A 1PEAA 3BHMA 4QFCA 1IEXA 1BNCA 1SCNE 1KSJA 3TRBA 4H7KA 5H80A 1Z0AA 2QTHA 5JS1A 1EUCB 5TQ0A 4QG7A 3X44A 3LIPA 1QLWA 4ML3A 1D1SA 3ESXA 1G9XA 2JLYA 4UBKA 3JZAA 3RYHA 1P4RA 2WU8A 1FRVA 4QQKA 1EX7A 1PK7A 5H4GA 4I9GA 3UXYA 4NH0A 2VKTA 3GT3A 1ESMA 2HIAA 4R2JA 4B43A 5A3JA 3W5BA 2IYPA 5F5NA 2LYKA 1RAHA 4IIEA 5ALRA 4QT4A 2MIIA 3DHWC 1HT2E 2Y4NA 3ACBA 1EJ0A 4I66A 5DN9A 5K4AA 3SCZA 4BVFA 5IASA 4WY2A 2Y77A 3NETA 2C3PA 5BN1A 3C8ZA 3ZZNA 4Z3KA 1AQLA 5EXDA 5ITVA 2OQVA 2GCIA 4QXPA 3FLBA 2V6MA 3SI7A 5B58T 2Z2YA 5BP7A 1ZXBA 4MA5A 1H5NA 1OA1A 3PR3A 4G24A 3ZNQA 1KEZA 3PKZA 4BYMA 4TV8A 3O0DA 3BXXA 3UA3A 1SELA 5EPOA 2WYWA 4D5GA 1QF6A 1TJPB 1G8JA 4IHKA 5DHQA 1XEXB 3R6TA 4MRRA 2RARA 5BW5A 1MENA 2OFOA 5AJWA 4ZCTA 4Z53A 4P2BA 5IJZA 3GRYA 2VC2B 3BB3A 3JSXA 1HQDA 1HGXA 2ZUSA 3PHHA 2L0XA 3L4BA 1RNLA 1SC4A 5F7ZA 2X41A 4O59O 4AF7A 2EL7A 3VTZA 4E03A 2J87A 1MF7A 1B1AA 1X7YA 4Q3KA 5F51A 2J09A 4J29A 1SXJB 1ZZ9A 2FZ4A 2A0FA 2QVLA 1T4CA 4N7BA 4YN3A 5HGXA 1TT5B 5I4IA 2AD1A 4I8XA 3MMSA 5C8DA 3L6EA 1GY8A 5U1PA 3PT9A 1I2AA 4YH1A 5A4AA 1VLQA 3VYSB 1CRZA 4DMGA 1YE8A 2YH2A 2VWGA 4IXNA 4R9NA 6REQB 3ZS8A 3IHTA 5IXYA 2XNJA 3KQWA 2I7DA 2P79A 2R8EA 3PNKA 5DOZA 2OORA 4TS1A 1PFYA 5DIZA 3U60B 3VNQA 1XCGB 2IDZA 1HETA 4LRQA 3FTPA 4QVKA 4GVXA 4UHCA 3JXDL 1IK6A 1ZUNB 2G5CA 2BGRA 2QGNA 3WDKA 4R0MA 1YQEA 3UWSA 4RVUA 4CIVA 5IN4A 1I94B 3VZSA 4MRNA 3W8EA 2DETA 4R9VA 1M8FA 2J5KA 4LJ6A 2B5WA 5TF4A 1W29A 3I1FA 1HDEA 2ZROA 3KEMA 4L4XA 4JCXA 1FP4A 2JFPA 1WR8A 3BWXA 1HXHA 1ZM9A 3EIUA 4M99A 4PIVA 5GAJA 4F8DA 3GMSA 3W5UA 2NU6B 2QL7A 3NHKA 5FA6A 2VRBA 1M1UA 1L7PA 1P5FA 1FXWF 3MT8A 4WUTA 3NCHA 3HEBA 1EHIA 2WF8A 2HA3A 1EPUA 5WRFA 2QN6A 5B3KA 2HPHA 5AI4A 3EEBA 4OH7A 4CUKA 2V1XA 3ZNNA 1A8UA 3T1HB 5DW3A 3VR5H 1ESNA 1XQ9A 3EBOA 1YAHA 2GEKA 3DFKA 3T4XA 1UXDA 5JAIA 4J3JA 3B78A 1T24A 4BMYA 5LOVA 1Q21A 4JNCA 1KDVA 1L5NA 1DW9A 1A2KC 1M2GA 1XZPA 5DM0A 1SXGA 3I32A 4GDMA 1DEHA 1YONA 2XMPA 1PX0A 4U39A 3JRNA 1P3DA 2IYRA 1P1FA 3UGKA 2J7KA 4CT5A 1UXKA 2MR5A 4O2AA 2W2LA 4TXMA 4AQ7A 3OUUA 2X0RA 4C0HA 5BR8B 2X9LA 3F3KA 1T0UA 3QJGA 2W22A 3VR4H 3EH1A 4MMXB 4NPCA 1USVA 2GYVA 1U8YA 1G2PA 3BE4A 3G7NA 5BQPA 5CEFA 3MTGA 5HM8A 5HIMA 1RIOA 5B57C 1BA3A 1E3TA 1Z12A 2CHQA 2CYAA 2DLNA 2Z0MA 3IIMA 4W5OA 3Q40A 4ZEOA 4HN4B 1YQXA 3VSEA 2IYTA 4EB6A 1BQEA 1MOPA 4QDZA 2WC1A 2WWHA 1MKYA 3WLIA 1R69A 1FW6A 3SBOA 1GRQA 2DBVO 3O4JA 4UHKA 4G0MA 3P9ZA 3GVHA 3LKZA 1AJEA 4OQFA 1V26A 1A4RA 1HUQA 1NLFA 2WYHA 3JAKA 1C2YA 3SQMA 1T9AA 3I72A 5EXXA 3O4IA 2RC6A 1S4MA 4OQZA 4DYDA 1QRRA 3J81k 3HYCA 3GLGA 1CVRA 1QJCA 4H4DA 1ZCZA 2AFIB 4HWRA 4O25A 4F8EA 3NZEA 4UUNA 4OJKA 4QBKA 5BV1A 5NLLA 3R5SA 1R37A 4BMSA 2ZPUA 2AJDA 2DXIA 4AKIA 5KHLB 4KRGA 3OZUA 3WMXA 3OA2A 4S35A 2QLJA 2ZB3A 5BWCA 4KI7A 2AFRA 4F3NA 2AB0A 2Z4SA 1CRPA 3RLIA 3HJTA 4UCQA 2HHCA 4QUKA 4B8WA 3EFOA 4QYIB 5TR9A 3KE9A 3LW7A 2HBYA 3N7UA 4MW2A 4NBNA 4ZVQA 1M2FA 4BX8A 3HDTA 5A02A 5AW0A 1NDHA 4B48A 5INTA 4DKJA 2JG3A 1QGOA 2ZUDA 4O4IA 2BDTA 3CW2A 3KYCB 2YN2A 3QKWA 4IZ6A 2O06A 3UB2A 2ZAGA 1Z07A 1Z22A 3ANYB 3ZGLA 2NO9A 2YCBA 2O7RA 3PF8A 2OB1A 1YMVA 2E3JA 2QWXA 2FPSA 1PEDA 3H2IA 3UKDA 3ZTTA 3ZJ4A 4F6RB 2D0DA 1WXXA 1HL7A 5EWMA 2VBFA 4FHGA 3GJ5A 1XTZA 5D3MA 1R4ZA 2GT1A 3Q6IA 3THYB 1HR0B 4Z2AA 1FDVA 1UXHA 1Y8AA 2O5VA 3GGSA 1W35A 1VL8A 3CR8A 1FTSA 4AO7A 1A3CA 4EY3A 1N2XA 4UC0A 4X20B 5C8YA 3S2GA 2ZR8A 1SVLA 2X2PA 3I2KA 4KIUA 4BVAA 1CR2A 2H48A 2YFQA 3MWEB 3VZQA 2DKFA 3E05A 2QUZA 3AQ4A 4KHZA 2QQGA 5D3ZA 2HF9A 1LC3A 1GPUA 2VDWA 4JYMA 4U4AA 2R48A 2JI9A 1KSFX 1YK1A 2Y9MB 3EDRA 4A6EA 4BB5A 4D4HA 2Z5LA 4WBNA 3ER9A 3Q3EA 3V5NA 3KX2A 3KQNA 3O9MA 2Z8ZA 5FBZA 4P5EA 3L1VA 3NTRA 4MUBA 1BXRB 4Y6GB 2CSFA 4K3VA 2V65A 4EI9A 1ZL2A 5DN6A 4HFMA 1CIJA 4Z49A 4K1LA 4ZGWA 5T4FA 1VOTA 1QH8B 4NZOA 2WP8J 3F3YA 3P7MA 4P0PB 2NPIA 3DEAA 2EV9A 3ITDA 2O8CB 2Q7OE 4HN2A 4B3MB 2VCYA 4PU3C 3DF7A 1UPUA 1VYTA 3RRFA 4L1KA 4XQ0A 3HABA 1A27A 2MSCB 2HWUA 4Q9NA 1GKLA 4DWJA 1YS9A 1NQWA 3E2IA 3R7BA 1PWYE 4A2WA 4MR8A 5I3CA 4URFA 4B4OA 4EA6A 4JA2A 5CUQA 1DCFA 1TVEA 3MJVA 3PXBA 3HCFA 5AVOA 2YYYA 5K2OA 1RVDA 4L0CA 1IEWA 5CHYA 1JTVA 3RVMA 3I8OA 3TFWA 4BBZA 2HIGA 1L1QA 3Q7SA 1CU1A 2EEPA 4YO8A 5I9SA 3AIIA 2CJXA 3B2NA 4ARZB 1Z08A 1DARA 1XUOA 2B8EA 4JLVA 5LXTB 2DR2A 4FOSA 4UE3S 3WYNA 1SVWA 1H1LA 2WA1A 3CTPA 2ZBUA 4J76A 4M9ZA 4OHWA 2WVGA 3HRIA 4BTVA 3KNZA 1YDGA 2G3YA 2NXWA 3FTDA 3ONEA 3QF7A 3K35A 1YRLA 3ON5A 4XQCA 4PLHA 5AUQA 2RE8A 3AVUA 4EX6A 2VQ3A 4KLNA 4DCVA 2YXDA 1E3EA 1ZRSA 1NE2A 2GD0A 3V2IA 3PWSA 4G2NA 3LVBA 5TXGA 1FDWA 1NMYA 2KHZA 3A6GA 2CMKA 1O94A 2ZQZA 4H18A 4HGRA 5EMLA 3EGDA 2RJNA 1ZL0A 5JALA 3DXXA 3VHXB 1H4TA 2PZGA 2XDQB 2YJ4A 3EGIA 2HNBA 5FJJA 1J1ZA 1A9SA 1W7AA 3ZLVA 5ECGC 1XVLA 4F86A 2CNOA 2P11A 4D0SA 4ENSA 1RYNA 5FF9A 3LU1A 2BFDB 3M6LA 5IJ0A 4QXMA 4F9GA 2H07A 2FSGA 3F46A 2X0FA 4AY4A 4TMYA 3SDZA 3Q5DA 3G0OA 2QJFA 2PPXA 3SBDA 2C5EA 3RT1A 5IG2A 1PGJA 1I8TA 4L8LA 4QUHA 2R96A 2QQ5A 2EF8A 3R5JA 4EHLA 5FLEX 2VHJA 1QG2A 1X94A 3S8YA 4P53A 3NI2A 4GWLA 3W04A 4IIUA 4CNQA 3PL1A 4Y18A 3BICA 5AIBA 4FMDF 4HAUA 4GZ6A 1B4DA 3SKVA 1OVMA 1UBGA 1ORTA 1K1EA 3FZEA 2ZI6A 3TUIC 5AD1A 1RLMA 4UQPA 2L18A 3H5VA 3D6AA 4NU8X 2O1SA 5BRAA 3JARA 5LXTA 3R1IA 5ALHA 3LO8A 2M98A 2Q21A 1DAGA 5BN5B 5JS7A 1G42A 4P4SB 4LTMA 1CUSA 3JQ6A 2QMOA 3LFTA 4R3UC 1Q95A 1SXJA 3B1XA 4LTDA 4OQLA 2OG1A 1T3GA 2VA8A 2HSEA 4WZZA 4CFSA 7AT1A 3QYPA 2IK8A 4RV5A 4YJHB 2ZE6A 3O8QA 2G0NA 3OP4A 3KBBA 3OLXA 1R10A 5E9JA 5DP2A 1M75A 1ZD2P 3UA4A 2B36A 1J5XA 4DMMA 4F04A 4IO1A 4XGQA 1DBRA 2A1TS 3JVDA 4WA8A 3AW8A 3B5JA 4MZXA 4Y2QA 2MU1A 3HA3A 5K51A 3FFTA 3OQJA 2L42A 4K9OA 3T7IA 1HY3A 4ZHSA 1RTKA 5JW6A 4OUKX 3P2MA 1OAOC 1X9HA 1U9JA 1ZJ5A 4L5AA 4NOMA 4N01A 3WZLA 1S9HA 4XYGA 1QKIA 1M6VB 4M55A 4B6EA 1NPYA 5CA1F 2R7NA 3MS2A 1L1RA 3NYQA 4KXQA 5AM2A 2NVBA 3UNXA 2JI4A 1EXWA 2VZEA 4RA9B 1RWPA 1ZVQA 4DCNA 1AXEA 1EQ2A 5EHIA 4AJHA 3PC3A 1Z82A 4FONA 4ARIA 3OSUA 1ZJ4A 4JP1A 2J6IA 4MJ7A 2QX8A 2XGMA 3E18A 4HYEA 4KBYA 1J7KA 3DMNA 4IMRA 2EW1A 4Y2HA 2XYHA 2XUFA 4LOIA 3O1LA 1JPVA 3ZG6A 2JAUA 4Z7JA 3IJPA 5FOWA 4ZPJA 5AQ1A 3F4LA 4CM9D 5HMMA 2O57A 5DSXA 3EVZA 2PXEA 1Y3HA 4J91A 3USCS 2F3RA 2HL6A 4N5DA 5TX7A 4U7WA 1FTNA 1FYFA 5EN4A 3HY6A 2X5JO 3ZD6A 5A9TA 1PNRA 1XZFA 2NUPB 2QLTA 1EGHA 1ILEA 4A26A 1HE4A 4LJAA 3DZJA 3T5PA 3HCCA 2WWTA 4E3ZA 4ZQHA 3TELA 1EWKA 5K0EA 2G9UA 1XJ5A 4TMZA 3ZKWB 1ZWKA 2DFTA 3C97A 5JQGF 1EBBA 1GG9A 4BO2A 4FS3A 1L8LA 4PBSA 4IZHA 3RSSA 3S7TA 1NNEA 4HDRA 1IQPA 3W8NA 1DCMA 4U3JA 4GPBA 3A4TA 1SKUA 1YZVA 2O0KA 1J99A 2QDKA 3UFXB 1NQOA 2ZXFA 1ZSVA 4J8PA 3K1YA 3W7VA 3WMWA 1B8VA 2GAJA 3FOEC 3OCCA 4OXIA 4YGXB 1Z8NA 2W6JA 3GD7A 4OI0A 3IKVA 1QWOA 4LGCA 5ALYA 1SXHA 4K6HA 1WY5A 2VYNA 5JRZA 5ICCA 4TGLA 3TQQA 2Q8PA 2PV7A 3OURA 4MPPA 3FRJA 1ZBQA 2HK8A 2XKJE 3O3MB 4MVYA 4YJ2B 2GPBA 5DZSA 5T4HA 3IDSA 2HFJA 3R0XA 1P3Y1 1RXSA 2IYAA 4HX5A 2IU0A 1V37A 2NU7B 1JFVA 1QHGA 3EDQA 3E9DA 2I87A 3M70A 3ME5A 3T7AA 2FPGB 3PFBA 4CKZA 1BH2A 3RS5A 1GKIA 5I7OA 1H05A 2VH5R 4RK4A 4XYMA 5HE8A 2QZSA 4UUPA 4JR1A 1RJFA 1SC9A 2YQ5A 4U5XA 3U13A 3QQPA 4PWYA 3OQHA 2JDIA 5K3SA 1RZRA 4Y0NA 1D3AA 4BN0A 3BOSA 3HM9A 3K9LA 4GNRA 2IF0A 3NGXA 1DWKA 3KB1A 5IM4F 1GDTA 4H77A 3M6XA 1T0BA 2TYSB 5AESA 2DQKA 1KTVA 2OESA 1WSAA 5K1ZA 4EELA 4QTTB 1A8IA 2IHZA 4OQQA 3W8RA 1XEWY 3MWFA 4ZIRB 3OWXA 1ZC4A 4FX5A 3WIEA 2NTYC 3O82A 5JZOA 2HPAA 5DI3A 5BN4B 1KZHA 3CZAA 2Q5FA 1LW6E 3QFCA 3K9GA 3FMOB 2Z56A 4ETMA 2GZ2A 2PS3A 3HU1A 2CNDA 4X7RA 4EMTA 3DGEC 3D6NB 3IHWA 1BDIA 1D2HA 5IAAA 2HCSA 3F6SA 5IC5A 1FW8A 2CJPA 2LVBA 3L8EA 4FTWA 4DSUA 3A1UA 3HLTA 1Z7YA 1THZA 2C5AA 3GRRA 3O2QB 3QE4A 5U4QA 2P77A 1GUDA 3VVCA 1KRHA 4BGVA 1NFQA 3ZJYA 3FZYA 2HLNA 2VP5A 1K97A 1ULSA 4B3FX 2D1FA 1DO0A 1H2EA 3LDUA 4HAYA 3C41J 3QY9A 4AB1A 4EKEA 5LMNB 1TYDE 4LJ8A 4JOBA 4S24A 3TLXA 1G5PA 3B1YA 2R6HA 4B3TB 1Z62A 1E3OC 3EAQA 4CT4B 2QK4A 3RHTA 3IPCA 4HTFA 2F8TA 3U49A 2OPBA 2VHVA 4KNWA 2PBFA 2V0NA 4RDCA 3OESA 3RVLA 3C5HA 3GLVA 4J2HA 2XKAA 1W5SA 2W4MA 3C48A 1Z8DA 2XTNA 1G5QA 2A0KA 3FLMA 1O8CA 3K96A 4TV8B 3RS9A 3D7NA 5FLYA 3SC2A 5J47A 1XVIA 3G2MA 4YWJA 4EAAA 3QP9A 3GXOA 4HAOA 4Y6RA 4IY1A 4BZQA 5HZKA 3LF2A 3DO5A 3RU7A 2VDKB 1FLNA 1QM5A 1A9TA 1SOWA 2AZTA 3E3LA 1YJAA 3V8EA 5BQFA 5K0CA 5HWSA 3ORFA 4JS0A 1JIQA 4HVAA 3PE4A 3UYKA 4B3HA 3RFVA 2EZUA 3MJEA 1Q1ZA 3MLBA 3WP0A 4TYWA 1DG9A 4TLDA 2XNKA 2PKXA 2IJGX 1OAOA 4RXUA 3I6YA 5KOJA 2G80A 4W5WA 2G8NA 2YWRA 3SC6A 4RULA 2AC2A 1P61B 4G1EB 2F62A 4IRXA 5TJ9A 3T5GA 4KQHA 4DDKA 3D8BA 2QSUA 4O4HB 2WSYB 3R7SA 5KX5F 1JLSA 1JDSA 5KYUB 2PJZA 4DRYA 3V4PB 1VL5A 5CVVA 2BFFB 4I55F 4CIWA 1KI4A 2HK7A 1JDVA 1YJ5A 2CWWA 4YDSA 3T7EA 1ZNYA 3D6JA 1ZOOA 1OGJA 1X1AA 3K0HA 3M6VA 1VXRA 3PZRA 5DEOA 4BJ5A 1SCDA 2ROQA 2VZ8A 2P5UA 5JE8A 3EQZA 5GOTA 1RQRA 4PC6A 2KB0A 2EJBA 1L8OA 3JYOA 4CKBB 2A8YA 4YUYA 3E9YA 5JLAA 4MVCA 2IZ6A 4XCXA 1K4MA 3ANTA 4Z0HO 4B7XA 1LBIA 2W8BA 4GLLA 5CDTA 4N40A 3LBHA 2C96A 2NXEA 1TQDA 2WE7A 3JCZA 5AM5A 1II9A 5ILQA 3MRTA 4KGDA 2Q07A 3TGPA 1PLJA 5E7JA 1EH5A 2P90A 2XQIA 3RDPA 2I3ZA 3NHUA 2B2XA 1PRVA 5AICA 3M89A 4ZAFA 2J3MA 3IURA 1M2KA 3MYRA 3DE6X 1NOJA 1SXQA 2V1UA 3ZWMA 5B6PA 3ADCA 2WJ4A 4XUGB 2RGCA 3E1SA 4C2TA 2GWHA 2DJ5A 2QTTA 1Z5UA 3G5GA 1ATIA 4BMOB 4F96A 3W79A 4XRGA 1QKJA 4LYJA 3PA8A 1D1PA 2V9CA 3HSKA 4HRXA 4M46A 2H3EA 5LBIA 1R4NA 3FFWA 4Y1EA 4EHKA 4ZK6A 3C4VA 5DX0A 3AM3A 4Q3BA 3T5AA 2BKVA 1YL5A 1LC0A 3ND5A 4B4KA 1Y9DA 2RGYA 2PUVA 2VHUA 4DGSA 1OF1A 2P9FA 1OXSC 5EJMA 5I9NA 2XNSA 5E0OA 3UN1A 2IBMA 1HDCA 3LDAA 1AV7A 3SJUA 3ZIAD 5FNVF 3E9NA 4XW2A 1SCKA 2K7ZA 3CLRC 2QW1A 5DGIA 4LWQA 3K53A 1J7JA 5BWMA 4QYMA 2ZM5A 2XDYA 4IHJA 1GUZA 1UT5A 1ADFA 4LHSA 4BLQA 5IYZA 1PJAA 1EP2B 1WV1A 4XPIA 3U19A 2VDMB 1Y7HA 3ZOKA 5D5PA 2VT3A 1U02A 4I9NA 4O2RA 2BEUA 4H7JA 4TYNA 4C07A 4A91A 1G63A 5G3ZA 4A6XA 4PCLA 3IVCA 4FNAA 3D3EA 4PVCA 3IV9A 1WEKA 3ND6A 4KO8A 2J0SA 5TMDA 3LHFA 4AIRA 5CK4A 4ZZ3A 3OTQA 1B0UA 2FPUA 2GFHA 2P9TA 1NUUA 1XN1A 4Q9IA 1KOLA 3ZLTA 1SCQA 4G1BA 4GI5A 1P4HA 2QLFA 5AI9A 3RRXA 4JP8A 3ZU4A 1O6ZA 4CMHA 1N7GA 1J8FA 1A77A 2PYDA 5CXSA 1YR8A 3UMYA 4K0KB 4UPEA 5IJWA 4OBEA 4C2UA 1VE5A 3K0BA 2HCFA 3CH7A 3F3MA 5AVVA 1IY0A 3CY6A 4ZYYA 4AU1A 4HNVA 4IHJB 4DLLA 2CL0X 1GL9B 1EUDA 1NY6A 1NFFA 5L53A 1C50A 3HXOA 3OJWA 2P35A 2PXPA 1F2UB 4XOUA 3CNBA 2NGRA 2WP0A 2YWHA 3GRUA 2FSIA 4UMEA 5KDLA 2LR0A 3ZV3A 4EFMA 4MW4A 3NATA 4IKPA 4IYJA 2UUPA 3WO1A 1VQ1A 3FB4A 3VBEA 5ABPA 2EBUA 2I6XA 3PYLA 4JQYA 2IVQA 4BVJA 1QHFA 3W5DA 2VPZA 3MZ0A 2Q3JA 4G5FA 4HMOA 4L51A 3T7TA 1FX1A 1WMEA 1E62A 3IVGA 3BWMA 3WKDA 3LLCA 1PD1A 4ARUA 4DQUA 2Z6VA 4HGPA 3BEOA 4ME6A 1BMTA 5FI5A 5FNVB 2G9VA 1DWQA 4R8VA 1ODLA 1YDHA 3A2MA 3QXHA 3FFBA 3JY6A 5E6UB 3Q87B 3QE2A 2RK3A 3SOPA 1WPGA 4BNUA 4NAHA 1TO1E 3B38A 3VR5D 2ZZNA 5FOTA 1YVEI 4ZO4A 5KYVA 2HSGA 2XGGA 4IOMA 2VKQA 2D0OB 2EBWA 1ITZA 3MNFA 4MQEA 1ZPDA 2ZREA 5DLPA 2JVIA 5FD8A 3Q9SA 4I4IA 5F9MA 4ND1A 1P1KA 2FVXA 3S4YA 4FDTA 4B6SA 4B34A 1R2QA 4PG8A 2JCSA 1W2WB 3WLNA 2GESA 3QKRB 4GMFA 4IUYA 4ZDWA 3P2EA 3EZXA 2QT1A 3NFYA 3TH5A 5BWBA 1X9IA 1TAQA 3WAGA 1QG4A 4KDCA 3A05A 1G5HA 1U0OC 2HJVA 4CEIB 2AQHA 1TYAE 2VH2A 3FRIA 1QF7A 3M4YA 1SQSA 3IQWA 4EM6A 4Q15A 4H7FA 1QIEA 4ZFNA 1M72A 1YB6A 1WCV1 4UXIA 4ND3A 4RSHA 1OU0A 2EFJA 4CM1A 1XMPA 3SMQA 1M34B 5H3LA 3H3FA 3IAS6 2X4DA 1QBGA 1QDUA 2FNAA 3OEHD 4KN9S 3FVWA 3WGYA 4EL0A 4R9UC 3U9LA 4MB0A 4ZOAA 1N2CA 5HGJA 4LDRA 3DHVA 4X8LA 2O49A 1U80A 4MR8B 1GAEO 3U5ZB 2PZ8A 3EIWA 1PR9A 5CLHA 3OZXA 2I34A 2R7AA 3MJFA 4DLRA 2C59A 1PV1A 1U5AA 1HDZA 1RYEA 3WK5A 1PNQA 5ETJA 4LDQA 4BP3A 4CLXA 2OCLA 2CKMA 3RW9A 1GTRA 1UP6A 2MSLA 3G1UA 4LOAA 2E4AA 2XCJA 5TPWA 1KY2A 2B4KA 3E9MA 4NJEB 4XX1A 2A1TR 4BAUA 4CBVA 5JIBA 1OLXA 3SR4A 1T1EA 3KT8A 4P93A 1B15A 4PGAA 4IJ5A 3UAVA 3H2BA 4F4JA 5MF6A 2CROA 2BFWA 2OT3B 3LP8A 3ZWVA 5HKAA 5KQMA 3ETJA 1VKOA 4JCCA 5AKHA 1CUGA 4A8JC 3H9JA 2PGXA 5DK6A 3JQAD 3ZXUB 4MVJF 2IS1A 3CIFA 1E61A 3BX1A 3JTEA 4KIWA 3SYMA 1AB6A 3KUDA 3GH3A 2YC2C 4AF6A 2GM4A 3BL6A 2WHXA 3B1ZA 2ONCA 1VP9A 2C9ZA 5CJ2A 5HTKA 5JH7A 4UTVA 1DJLA 3AF2A 1RHUA 1TYEB 1G3IA 2GPYA 1FNDA 3BCUA 2CFOA 3M49A 2O2ZA 4GKBA 3TXYA 1NVKA 5IRCD 3WI7A 3P9NA 1D2MA 3BFKA 3GLQA 3H1GA 3AUYA 1JVSA 4Q6BA 4I3HA 4ZV4A 2YHAA 2IV7A 2D5CA 1XZNA 1G20A 5AM3A 4FX2A 4NMXB 3OIUA 5ADHA 3WGNA 2ZIWB 1C1XA 1L7MA 3QG1A 2XE6A 3RYIB 3TZEA 1SVSA 3UQYS 4HPXB 5TDHA 1ECPA 3GFQA 1E7SA 3KTOA 3JD4A 2PVPA 3I52A 1DXHA 3O8DA 4ZEWA 4HXEB 2HAEA 3W5JA 1J5EB 5KYGA 2ATXA 1M76A 4K8RB 3AP3A 5H70A 3WGJA 2QJRA 3CXRA 2VPXA 5E1DA 3TI7A 4YYEA 4ZZ0A 1Q3TA 3X2FA 3R7WB 1JEQA 2XVZA 2VSOA 4PSUA 3OFVA 4BVGA 4YR7A 1RAIA 3AJRA 3D1NI 4KKXB 4Z9BA 1YBAA 3LWBA 4II2A 1I30A 2HJGA 3SS9X 1PQPA 1RWWA 1XSEA 4I36A 3T7DA 3WB9A 4MCJA 4DNPA 1B26A 5ALJA 4TS9A 3DDSA 3KB2A 1EIZA 5KU7A 1GSHA 1Y5LA 2R9VA 2QE7D 4D8TA 1OH5A 2VYCA 2YQ4A 5LLDA 1SCUA 1XLVA 1KZYC 1JZQA 2DKOA 1BOOA 4WKBA 1L7EA 1GCIA 2CCJA 2ZUUA 3BPSA 1PQ4A 4S1PA 5GZ3A 2AZXA 1TUBA 3LM8A 4TUYA 3FG9A 2OGZA 2Z8YA 2G6TA 3S5UA 2AXUA 3OCZA 2PQMA 3T9CA 3GYGA 4H7HA 3GGJA 2IY7A 1DCKA 5I5GA 1T9BA 2WKWA 3ZWBA 1YKSA 4JBGA 4ZKEA 3VMMA 3Q8WA 1XA4A 1DKRA 1KQGA 3JZMA 1G8PA 3DDNA 4A1FA 1QQ5A 1MG0A 5JLJA 3EUWA 1MX3A 1BJTA 1G3UA 3NIGB 5AO9A 4L3VA 3NUZA 1RXIA 3UFDA 1OLSA 2VR1A 5SZKB 2W8BB 3RJZA 4DJ5X 4RPJA 3ZWNA 2QD2A 4E88A 2DQSA 3VBCA 3WOHA 1W9HA 1E3WB 2IU6A 1TZMA 3WMFA 5E3HA 4MP8A 2A9VA 4EUEA 4OHFA 3T3PB 1R4MA 3IUSA 4KU4A 1MQAA 5A5GA 3LISA 3JQCA 2CC2A 4WCFB 1N2GA 1U90A 4Q7MB 4TUYB 5EHNA 2I4OA 5KAPA 3QU2A 4E07A 2X6QA 4EKIA 4OUDB 4XM0A 3BWVA 3DT6A 5HF9A 1KF0A 4B3GA 5BMVF 2FJRA 2YJ3A 1LV8A 3LYAA 5BW6B 4A8PA 1SWVA 2V4UA 2IQIA 4MCAA 2VT2A 1QRTA 1C8BA 2J9FB 3CEHA 13PKA 3G0CA 2R2AA 4DRZA 4PYQA 2JFFA 2FR8C 4F6CA 3JAMA 1Z15A 2G17A 2IITA 4CTOA 3ZVMA 1PFQA 5CA1B 4JJIA 1JQLB 2SKEA 3OAAD 1GDDA 3L7MA 4S1VA 4C6HA 2BGWA 3HDJA 3I30X 3K0EA 2JJ1D 4Z1MD 3OKCA 1UUFA 2OV8A 4CQMB 3QVVA 5EXPA 2P6NA 1H3EA 1DUSA 1D2RA 5TLSA 1LRJA 4TL8A 5AJYA 3OY2A 5GJVC 5L4LA 1QQBA 1KY4A 1WDWB 2QIOA 3E03A 3DDZX 1PP4A 2ZT7A 1V5EA 1DJOA 4HBZA 4NZZA 3SM3A 4L4SA 4EPRA 1AKEA 1MTOA 3PE5A 2KI5A 2Z6QA 4I6JA 4LXTA 2G28A 4RCVA 2C5HA 1KJQA 4EO4A 5AVWA 5J4LA 2H2DA 1V4VA 2XVMA 2QW0X 3VR2D 2P3OA 3TUJC 2ZRNA 1XOIA 1U3WA 3NT4A 4RIHA 4UEWA 2I8AA 3NWPA 2KJQA 2CXPA 4QTZA 3CX8A 3MRSA 4EF5A 5JJ5A 5FKJA 4MWZA 5BSMA 2H11A 2APJA 1VCMA 1SHUX 4UXHA 1QZXA 5L7YA 1JVNA 4I19A 4UM8B 3SG0A 5JU6A 3F6BX 4B7UA 1B41A 3N0VA 4MV8A 4KMOA 1AKWA 1E2UA 1E18A 3A58B 2IEZA 5I9MA 2YIVX 3H42B 4O8CA 2PUWA 2X8LA 4O2BA 1I7LA 1N5LA 4B3CA 621PA 3ELDA 2E9SA 4GR9A 3ZIUA 4LZOA 3QM1A 1VDZA 1EX9A 4IS2A 4R81A 2P30A 4WNAA 3WGTA 3AB3A 2ZJFA 3TE6A 1ZNWA 2CLDX 3MSXA 4GHWA 4CKWA 5KYNA 3K70C 1PFGA 4ZI7F 1ZGBA 5AVUA 1WSBA 3H75A 2XVXA 3HKBB 5JI2E 4BV2A 3L0ZA 2GNOA 1PLLA 1V8DA 2CLOB 4FSDA 3VDNB 1C9EA 2EIHA 1BMDA 2YXEA 3DOJA 4XWGA 4E0BA 3TECE 3FY4A 2ZRQA 4LECA 1O94D 2UXCB 1VGRA 2TS1A 1PBTA 5EEHA 4BLVA 1Q2XA 1PR1A 3JSAA 3UQZA 3AHJA 3BK2A 3OQ1A 4DR1B 1P5RA 1KL7A 4B3RB 3Q3VA 4C14A 4N0QA 1G66A 3LGSA 5HS4A 4R2HA 2FQYA 1WSDA 4V0LA 3ZGVA 3PTLA 1DTEA 1UZMA 4HH1A 2JCXA 1A4UA 2PZMA 2BFMA 4XFKA 1KEEA 3I2GA 4LNHA 4HDMA 4Y6QA 4EHIA 4BV9A 4EG0A 5C46F 4B3JA 4HUTA 3ILVA 1TFUA 4GC9A 3SBXA 2XJ4A 4FI3F 1BE0A 4D0RA 1RHRA 1DELA 4ND2A 1JHXA 3AP1A 2Q6LA 4BO4A 3S28A 1O0SA 3DDUA 1QYVA 1TFRA 1LI7A 1JAHA 3R3XA 3GP5A 4KTVE 2PD4A 1YOVB 3CVXA 3KZKA 5CCXA 3ICQB 3OIVA 3IALA 1FVHA 1ZLXA 3E27A 5FADA 2PCJA 4F0JA 1AQYA 2FMHA 1RM5A 1XFDA 5JRDS 1IHPA 3ITKA 1BWSA 3PKIA 3WE7A 5DNUA 1C8LA 3CNOA 4XIFA 4R40A 5C31A 3VTKA 1UODA 3WLEA 3ZE6A