5DSXA

Crystal structure of dot1l in complex with inhibitor cpd10 [6'-chloro-1,4-dimethyl-5'-(2-methyl-6-((4-(methylamino)pyrimidin-2-yl)amino)-1h-indol-1-yl)-[3,3'-bipyridin]-2(1h)-one]
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
328
structure length
316
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTNTRPSTGLLRHILQQVYNHSVTDPEKLEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 316
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dsxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dsxA02
3OU2A 3HNRA 2PLWA 3VC1A 4RTKA 4OQEA 2GB4A 3G2PA 5HZMA 3DP7A 2V74B 5E8RA 3T7TA 3MQ2A 5DWQA 4BLVA 4F84A 4FP9A 2LD4A 3H2BA 1TW2A 2NXEA 1R6AA 4GUAA 1ORIA 3SX0A 2QYOA 3PFHA 3RIEA 1XVAA 2IIPA 2BR4A 2ZBQA 3AY0A 3AJDA 3HVJA 3OFJA 4FSDA 3KPWA 4BLWA 2Z6QA 1PRYA 2P35A 3EVZA 3R0QA 4XCXA 3M6XA 1NKVA 2DULA 4RSRA 2FYTA 4X60A 4A6EA 4RTNA 1G38A 2PT6A 3M6UA 2H00A 3KKZA 5CCBA 1INLA 2GAFA 4PYJA 1D2CA 3E23A 3SSOA 2WA2A 4X63A 4PYNA 3NVMB 2P7IA 4OA8A 5E9JA 4GC5A 1YF3A 4DM3A 5GIPE 1G60A 1YUBA 5K0EA 3CC8A 1G6Q1 3MTIA 2ZWVA 1JQEA 3KQTA 5EEHA 5LQUA 2QRVB 3IV6A 3EEYA 4X1OA 2IGTA 3EEOA 4YUVA 2PGXA 2PKWA 2ZIFA 3DMFA 5DTQA 3CVOA 4E2ZA 3LBYA 2GPYA 5K0BA 5LQAA 4OBXA 1RI2A 3B3JA 1V39A 4KDRA 2IP2A 3HA3A 3HA5A 4RVDA 3FTDA 2AOUA 4C4AA 2AOTB 2O05A 2OB1A 3ELUA 4PWYA 3ERCA 3KQPA 4AZTA 5BW5A 3GXOA 4LWOA 5LR6A 3GWZA 3K6RA 2GS9A 5FWAA 2UYHA 4IV8A 3KR1A 3TKAA 4QQKA 3ELWA 2F8LA 4LG1A 4HGZA 2OBFA 3AWIA 4QPNA 2I62A 1N7JA 4AZWA 3MAGA 4LWPA 5CVUA 3FUTA 5B1SA 3UJBA 1KHHA 3NDIA 4YV1A 4OX9Y 1FBNA 3P9KA 3JWGA 3UJAA 2ZW9A 5EZSA 5K03A 1KPGA 5FCDA 5EVJA 2IBTA 4P7FA 2I6GA 4HSGA 5EEGA 3TQSA 4YUYA 2ZTHA 3EVCA 5DLYA 3G89A 4FGZA 2O57A 1NW6A 5MHTA 2AOWA 2NXNA 2B78A 3HVHA 3O7WA 3PX2A 2FRXA 3LSTA 5FWDA 1VPTA 2JHAA 3SVZA 3HCAA 3ELYA 2ADMA 4DCMA 2NP7A 4LECA 1L3CA 2FHPA 1ZG3A 3BGVA 3LKZA 5ICGA 2IBSA 2WA1A 5EPEA 2P7HA 5FUBA 2YXDA 2R6ZA 3DUWA 5F2OA 5LQKA 4E30A 1TPYA 1IM8A 3GRUA 2BR5A 3R3HA 5T64A 5EC8A 1EIZA 4C07A 4PGHA 2ZIGA 3G8AA 3IEIA 2PWYA 1VBFA 3OZRA 1SQFA 4CTJA 5K05A 2AN4A 3OCJA 4E70A 1DCTA 2G70A 3MB5A 3CJRA 1RI1A 3C0KA 1JTFA 5CCXA 4HRAA 1NT2A 5FTWA 3NJRA 4PYIA 5E9WA 5BW4A 1KYZA 3Q87B 4GEKA 5KS2A 4KIFA 2YVLA 5KVAA 2Q41A 1XJ5A 4PYMA 4U7PB 5K0LA 3MCZA 3VYWA 4RTPA 1FJXA 1UWVA 1D2GA 4GF5A 2EG5A 1I4WA 4X41A 5E1OA 1SUSA 3DLIA 3I5UA 4HTFA 1NW5A 3G5TA 5EZQA 1R8YA 4FT2A 5LQRA 3IHTA 1NE2A 3FPEA 3GNLA 3TFWA 2NNWB 3FTCA 2PBFA 4CKBA 2ZSUA 2P3OA 5EMJA 2PXCA 4PYLA 3A25A 2IH4A 1NW7A 5HFJA 5K0JA 5GIOE 1P39A 2NYUA 3HVIA 5DX8A 5LQJA 5DX0A 3KU1A 3FTEA 1SVUA 2DPMA 4B17A 5EHGA 5LSAA 1FP1D 3ELDA 2XYQA 2P3LA 4RYLA 1F3LA 2JH8A 4IKPA 1FPQA 5DM1A 3LDUA 5ICFA 3C6MA 5HEKA 2OXTA 3TR6A 1VL5A 1VLMA 3X0DA 4FT4A 3BWCA 3FPHA 3VSEA 4K6MA 4ER7A 1KPIA 4FS8A 5EMKA 1I1NA 3TKYA 2FPOA 3ORHA 4P58A 2JH9A 2G8NA 3UJ8A 5EHIA 5GWXA 3KPUA 3C3PA 3KHKA 5DM0A 3DMHA 2XVAA 5HIJA 5HILA 4C05A 5H02A 5FA8A 3LL7A 4XUDA 2AOVA 2QM3A 3R9XB 5E1MA 2AOUB 4PYQA 2G72A 1JSZA 3KQYA 1VP9A 3G7UA 2O07A 3OU7A 5CVJA 5FADA 5ICEA 2H1RA 3V97A 2VP3A 5EIFA 3S68A 1QANA 3PS9A 2XVMA 4RTJA 2AOXA 2C7PA 1Z3CA 4EVIA 1EG2A 3SSMA 2IDKA 2PX4A 3G5LA 3K0BA 3OU6A 2AS0A 5DPMA 4KIGA 1WZNA 4U7TB 4DMGA 1ZKDA 3BZBA 3NW9A 7MHTA 2B2CA 2BH2A 3HCBA 5ERGB 2ZLBA 2HTEA 3AXTA 3UJ6A 5CD1A 1M0EA 1WXXA 1NV8A 4ISCA 5GM2A 3FPFA 1XDSA 4E2WA 2IH5A 1ZGAA 4PCAA 3ER8A 1NW3A 2AN3A 3KQQA 1RI3A 3TMAA 3NTVA 3EGEA 3ANXA 2OY0A 1X19A 3EVDA 2HR1A 3P8ZA 4AX8A 1YB2A 4OA5A 2P40A 3M70A 1JTEA 3HEMA 3BGIA 2GH1A 3P2IA 2CKDA 2PV0A 4V0QA 2B9EA 3JWHA 2OYRA 3THRA 3I58A 3B5IA 3KR2A 4DF3A 3E8SA 3ER9A 1AF7A 3B7PA 1WXWA 2OZVA 3THSA 2OPBA 3OPNA 3UZUA 4MHTA 4CWAA 1BKYA 1Q0SA 1XCLA 4E2XA 4RVHA 4R8SA 8MHTA 4P7KA 3O31A 1JQ3A 5DXJA 3UA4A 2IPXA 1EAMA 4AUKA 1WS6A 2EJUA 1PJZA 3BKXA 2OKCA 3TRKA 3G2OA 4C04A 3F4KA 3MCTA 2E5WA 3V8VA 2XYVA 5DT2A 1DL5A 1MJFA 3M33A 3PFGA 1XDUA 5DRTA 2ZFUA 5C0OE 4YUWA 4YUZA 3FYDA 5DSTA 3T7RA 3LDFA 4RV9A 3UA3A 4F86A 2VDVE 4E33A 3GRVA 3NWEA 3U81A 5JR3A 1P1CA 5E9QA 1X1BA 4H0NA 1RJEA 2WK1A 3SGLA 5F2KA 3FRHA 4KWCA 4ER3A 3LCUA 4PYKA 5P8WA 2IFTA 4EKIA 2O0LA 1N2XA 3GO4A 3FUUA 2IDJA 5GOZA 4PNEA 5BP7A 4RTQA 2XBMA 2NXCA 4HTFB 4R6XA 2BZGA 3LKDA 3BWYA 2YUIA 4GC9A 1OR8A 2I7CA 2VZ9A 3TM4A 3QV2A 5GP1A 2V7EA 3DULA 5T6BA 2B3TA 5C9ZA 4ER6A 3HTXA 2AVNA 4PYOA 2NXJA 4M36A 5CVVA 2ZZNA 5CIYA 3MGGA 4OQDA 3DXXA 3DR5A 1JQDA 2FK8A 4GOMD 5DX1A 2B25A 2EFJA 5EMMA 5F2NA 4BY9E 2ZWAA 4R6WA 3P2EA 3G2MA 1RI4A 1U2ZA 3BUSA 1G55A 5FULA 1SG9A 3FUWA 4PIMA 4AZSA 3UBTA 1EJ6A 1QYRA 1VE3A 1AQJA 3PB3A 4BP1A 3EVEA 3HCDA 1XXLA 3GRZA 3EPPA 3TM5A 2A14A 1SUIA 1D2HA 4PONA 1F38A 3Q7EA 5K8VA 3QOXA 2YTZA 3VC2A 4DA4A 3DLCA 4QTUB 3UJDA 4YMGA 2HNKA 1X1CA 5EG5A 3NMUF 3SM3A 3HP7A 4O29A 2YX1A 4PINA 2UZ4A 3BGDA 1G8SA 2HV9A 4YV0A 1YZ3A 4GOND 5T67A 1ZGJA 3LGAA 2Z6AA 2ERCA 2AR0A 2PY6A 3HCCA 2NP6A 4GQBA 1UFKA 1IY9A 1NBHA 3HCFA 4QVGA 3T0IA 2GA9A 2R3SA 2UYCA 3BWBA 2PT9A 2PSSA 3L8DA 2N47A 2VS1A 3GRYA 1R18A 3O4FA 5EIWA 5KQRA 5FQOA 1M6YA 3UFBA 5LQNA 1I9GA 5HIMA 1L9KA 2ZZKA 3LPMA 3KQSA 4QQNA 2C7QA 1KYWA 4GOLD 4RTMA 3FTFA 5IKMA 5E1BA 3C3YA 3FRIA 4IV0A 2PVCA 3OE4A 4RVGA 2QE6A 1X1AA 3NDJA 3HVKA 2PX5A 3HA7A 1UIRA 5DM4A 3EGVA 5FQNA 3GCZA 5E8JA 4MWZA 5EOVA 4HG2A 2YXEA 4QDKA 1YFJA 3KQVA 2ZVJA 3FUXA 4RTSA 2Y1WA 5G02A 5DTRA 5C1IA 3B3GA 1Q0TA 1QAQA 3I64A 3LCCA 2ZIEA 3GIWA 2BM8A 5IH3A 1JG3A 3UJ7A 3CKKA 4P7GA 3EVBA 5EKUA 2GLUA 3BWMA 5U4XA 1NBIA 5E2BA 2YQZA 1BC5A 4QDJA 3SSNA 3HCEA 3P9IA 5JUWA 2FCAA 1B42A 1QZZA 2HMYB 2ZBRA 2JG3A 4CXMA 1G8AA 1O9GA 1RJGA 2ORED 3A26A 2BR3A 5EMLA 3QOWA 3EVAA 5DXAA 1HMYA 4KW7A 3UJ9A 5K0GA 1YZHA 3LDGA 3RODA 1BOOA 4BLUA 1YFLA 5E1DA 4RX1A 4DCGA 4EQZA 4OBWA 2UYQA 2AN5A 4DQ0A 1X1DA 3IYLW 4RVFA 1JG2A 4ATNA 1XTPA 3OE5A 5K01A 5K09A 3E05A 2VDWA 2PX2A 2ONZA 3TOSA 3LECA 3PX3A 1KIAA 3C6KA 3WSTA 3DOUA 4EKGA 1R8XA 5CUQA 3TPZA 3KPYA 2C7RA 3I53A 2PX8A 2IH2A 5DSXA 3FYCA 1L1EA 3CCFA 1KPHA 3R24A 4G56A 1EJ0A 1VP3A 1KP9A 3G2QA 4KDCA 4E2YA 1EQAA 2ZULA 1NW8A 2PXAA 1AQIA 3P2KA 4FZVA 3MERA 2ONYA 4KVZA 2P41A 4ZTBA 1AV6A 3PLAE 1ZQ9A 1ZHFA 4AZVA 1O9HA 3KPVA 2JHCA 3PVCA 3FPGA 1R74A 4F85A 4P7JA 3SXJA 4A6DA 3GJYA 5HIKA 3OZTA 3CJQA 2C7OA 3BT7A 2PWPA 3T7SA 3OFKA 1P1BA 4E31A 3CJTA 3BKWA 3KR0A 3GU3A 4HC4A 3MTEA 2EX4A 5HIIA 3NWBA 3DTNA 1KR5A 3EMBA 3LX6A 1Y8CA 2OO3A 3TLJA 1XCJA 5CVEA 3UJCA 4GBED 4M38A 1DUSA 3P9NA 3P97A 4XUCA 1T43A 4V0RA 3G88A 5DRYA 2H11A 2P8JA 2KW5A 3DH0A 4R05A 3R6TA 5FA5A 1R00A 5EQJB 2Z6UA 3LBFA 3DXYA 1L3IA 3ME5A 4RTLA 2P3QA 4R8RA 3KR9A 5GM1A 1N7IA 4DZRA 2CL5A 1JG1A 2BM9A 4Y2HA 5EGSA 2QRVA 2G71A 1TW3A 4HGYA 1QAOA 5K0NA 4KRGA 2JHPA 4X61A 4BP3A 3PTAA 2YXLA 2AZTA 4EK9A 5HOQA 4YMHA 4FR0A 2HWKA 5E2AA 1RJDA 3BXOA 5K0FA 1FP2A 3DMGA 2ZZMA 4CKCA 3JWIA 3SR4A 3FPJA 4WVLA 2QY6A 5BXYA 1MHTA 4M7RA 5KQSA 2AOTA 2UYOA 3KQOA 3LHDA 1M6EX 4RWZA 4C03A 3B89A 4UOEA 1BHJA 1WY7A 4Z2YA 5M5BA 4HH4A 3UWPA 2CMGA 2XYRA 3EGIA 3FZGA 3HM2A 3P71T 3M6WA 4WXHA 4YUXA 1O54A 1KXZA 3CGGA 3EVFA 5D1HA 4IWNA 4C06A 3M4XA 4YV2A 10MHA 2ZCJA 4EMSA 3GGDA 4FSXA 2YR0A 3D2LA 2OB2A 3M6VA 5FHRA 4MQ4A 3A4TA 1HNNA 3JWJA 1H1DA 4L7VA 1XDZA 1SKMA 4GOOD 4M37A 2PXXA 3RW9A 3SMQA 3GRRA 5LQCA 4CKEA 1ORHA 2O06A 5KYGA 1RI5A 2AVDA 5FHQA 1WG8A 3A7DA 1IXKA 4C08A 5ICCA 3LCVB 4RTRA 4Y30A 4DKJA 3KQWA 2G1PA 2K4MA 3E7PA 3OZSA 2I9KA 3P9CA 4PGGA 2EJTA 4MIKA 1SQGA 5CVDA 4PIPA 1NV9A 1VIDA 1L3BA 1JSXA 3ID6C 4ER5A 4NECA 4E32A 4JXJA 3A7EA 5CM2Z 5D1NA 2CWWA 5DM2A 3REOA 4CTKA 4POOA 9MHTA 3I9FA 5GINE 1RJFA 4MTLA 2FK7A 2PJDA 2ZBPA 2JJQA 5EKXA 5DTMA 3EVGA 3FUVA 3EMDA 3B3FA 3NVKI 3DXZA 3A27A 3PT9A 4QVKA 3AXSA 3KQMA 1VQ1A 4QPPA 3MHTA 3CBGA 2CMHA 4ER0A 1JG4A 2ESRA 3KPJA 2Y1XA 1P91A 2P1DA 1QAMA 4PCLA 3GDHA 1JR4A 3G8BA 5K0CA 4XUEA 4QTTB 2VDUE 4RTOA
chains in the Genus database with same CATH superfamily
3RFCA 4RPJA 5C5IA 4D80A 3E0QA 1XZNA 3PWKA 4G86A 1XQWA 2PXDA 5K8JB 5CA0B 2ZYSA 4G0XA 4CMCA 3PL1A 2QT0A 1V7PC 3H2BA 4QTYA 3JATA 5B2FA 2QYOA 2VTDA 5ILQA 1QPZA 2HLDD 2WD7B 3R23A 4K6GA 4C0JA 4OBMA 5DN6A 4TROA 1GPLA 2BC9A 2ZDGA 1MO2A 2QNIA 3R0QA 2IHJA 3KEOA 4X45A 2AZMA 4XCXA 4DIUA 3K4HA 1HQDA 1SCUB 1GZ7A 2AXEA 3OZAA 4FGSA 3M6UA 2PBZA 3UMFA 5BSFA 2R1VB 1IY0A 3QVTA 3M1YA 5J2UA 3T3OA 5TMDA 1QE0A 2QAJA 5CYOA 4K6OA 3MWEB 3D1LA 2GMWA 1LQ2A 2OLJA 2P6NA 3GEEA 5H7XA 2Q0XA 2HRDA 3EGOA 4X1KA 4ZN6A 2FRVA 3T3MB 1X7ZA 1LPSA 3QU9A 4I6EA 4O59O 2WHQA 4WGGA 4ZMRA 3OM8A 1ZHOA 3B9BA 1P0MA 1ZJ6A 5LOVB 4YRSA 2OL4A 4PLGA 1IC6A 3OICA 4DUGA 2P75A 2JJ8A 1T9GR 4FHDA 3UUGA 4RVDA 2R63A 1B0NA 1P45A 2OK8A 4FOSA 2FMIA 1UEXC 1IAQA 2R8EA 4U6SA 3UFXB 4PN7A 5L6LB 1MNQA 4AJHA 1A82A 1JU9A 2ZG6A 5J63A 3K71B 4DEVA 1PAUA 3IC5A 1HEYA 3V34A 2PBRA 1KH2A 2I1VB 1U28C 2P6PA 3RARA 4TSRA 1T6ZA 1KEPA 3B70A 3LPAA 4RVCA 3RRBA 3RASA 1KIMA 4RNCA 2BDEA 2GF2A 2QIOA 3VR5H 4G5XA 3FUTA 1KI8A 1YNSA 3FDZB 4MSUA 4GLOA 2BJVA 4LE0A 3KXAA 1BWSA 1J2YA 1PR2A 2HJHA 2QEQA 1EZ1A 1RLUA 1UOPA 2E4XA 2Q6TA 1X8XA 1XAIA 4KO1S 3GY0A 3LRPA 3QQPA 1UK9A 1YH3A 4KWHA 1V5EA 4TQGA 4B9EA 1ULHA 1AKWA 2B61A 1NPDA 4TRNA 4F6CA 1XO1A 1MC8A 3BYZA 5JAHA 5A6SB 3A1DA 3HJRA 3QH4A 3HCAA 3ELYA 4JLOA 1G21A 4OHRA 4P7BA 2H5IA 2FHPA 2Z04A 4BMXA 3QKIA 1AURA 1U3UA 2JGKA 4R31A 1G18A 2JCYA 2IBSA 1L5QA 4XCQA 3ZE1B 1G1MA 3R3JA 5BO5A 2IX3A 3P9SA 4OGFA 4OXQA 1ZMRA 4PFKA 4EKEA 2R0QC 1JECA 1UDXA 1TTHA 3G8AA 4FFRA 1NYLA 3GN5B 1E7WA 3O4IA 2OPHA 4J0KA 1HT0A 5BSKA 3UQZA 3C45A 5AI9A 2MSKA 2Z2IA 3OEEA 3RYCB 3K0EA 2G83A 2AF3C 4E70A 1OKKD 2IXGA 4BPBA 1NX9A 4XR9A 1JIUA 2G0TA 2QRZA 2CVHA 4ZCSA 1GPMA 3G0CA 2WHPB 3PEWA 2YS7A 2JC3A 3N9IA 3MCWA 4ERNA 5E9WA 4FDAA 1QRDA 4U2FA 3HN7A 3Q8XB 1UWVA 3WJ1A 1NI3A 4PQYA 1UXKA 2BSAA 3RSCA 1Z26A 3A6KA 4KWEA 1NW5A 1YB1A 1TO1E 1HETA 2Q9BA 3DT9A 3QE4A 1BQ3A 1RP1A 1QQ7A 5CR9A 1CUUA 1ECLA 3IBTA 4HWTA 3PHGA 3M82A 4IIBA 2VXOA 2I9PA 5HQJA 3USES 1UDAA 3MWDA 3NHBA 1P0FA 3JQBC 2IHUA 4LJ9A 1MV8A 2NPOA 4JXZA 1PYDA 5BWBA 1WZCA 1NQTA 5KSPA 3EZ6A 2XECA 2AUTA 4A2QA 1E2BA 3OWQA 3ZQUA 2K7FA 1GQOA 1OTYA 2C9OA 2ZJ1A 2FLVA 4RYLA 1LCDA 3CFYA 5A9TA 3KEFA 2OAQ1 3ZUGA 1NA5A 2P4EA 2GN2A 3O74A 5B7QA 4FT4A 1VECA 4CT5A 3R5JA 2RGYA 2WFLB 1KVQA 3FPHA 4ER7A 1T9AA 1GFIA 4NHOA 2B0JA 3ZBQA 1TQ6A 4NHEA 4JJEA 1ZZ9A 5JLJA 1NNUA 5AJXA 5GWXA 3GFGA 2F67A 1K9VF 1RXIA 2RHCA 4XFJA 5CLJA 2GEFA 4WH0A 4G3XA 3IQDB 1W0JD 2J6HA 3N0VA 1Z2AA 3RE1A 4NZYA 3C1OA 3ZW7A 2X41A 1SKYE 1SCAA 3NCHA 4D7AA 3ZV5A 2ZTMA 4ZVKA 3B6EA 4ZJPA 4PYQA 1YFKA 5FADA 3CZ4A 3MMXA 3NC1C 4NTZA 1LJUA 1PZMA 4PZYA 4A6XA 2QSJA 3ZWWA 5F3WB 3WIBA 2OCKA 2WFAA 4GFDA 4A16A 2A6CA 5IARA 2C8VA 1SIBE 4TKVA 5J4KA 4KYUA 1YA6A 1WZIA 2Y93A 1J9GA 4QD3A 5JMWA 1DAKA 3ROGA 4BO7A 4DSTA 4DMGA 4NK5A 5HM8A 2EGGA 4RETA 5HF6A 1M2GA 2I2DA 4NZOA 3W2HA 3E9QA 2P79A 3I9KA 4MJLA 5ALYA 9GPBA 1HOXA 3PKJA 3CEJA 3KT3A 5L3QA 2PTGA 1VIVA 4IIJF 1A7JA 1TK2A 1Q20A 1T8RA 2B4RO 3PT5A 4XX1A 1I4OA 1IHYA 3ZU5A 2QPOA 1Q6YA 4MV9A 1Z4QA 2HOQA 3BBPA 3M2TA 3UUFA 5KYWB 3QKTA 4L28A 5NLLA 4YECA 1EFVB 1GGHA 1ZZGA 2NLOA 2XUIA 3BPSA 2QD2A 4E5KA 5L40A 1P19A 5KMGA 3UWSA 3ZOKA 3SKYA 5GVSA 3PQ6A 4P2GA 3U7RA 4DJAA 2J5XA 2JAWA 1V16B 4C7BA 1ZUNB 4MWSA 3H9QA 3MJRA 5BSMA 4OUDA 4WCDA 3ZN2A 1GQQA 3I01A 1DQZA 1UZMA 2G7MC 1PD1A 3G49A 4QU8A 2A2ZA 2D00A 5JD6A 2FN4A 4IVZA 1Q3HA 2UVQA 4BMVA 2GD2A 4H0FA 1WS6A 3BL8A 4OVKA 4Q37A 7GPBA 5K8CA 2WV9A 5TIIA 1PJLA 4Y2VA 4JP8A 4QSHA 2R6R1 4KREA 5C0OE 2ZFUA 1LH0A 4URUR 4IHJA 3W8FA 3G9UA 4V02A 2AYYA 2AJ8A 1GGNA 3JALB 4KFSA 1PN3A 4D9JA 1XEFA 4TQAA 2PGOA 1SA0B 5CA1F 1F6BA 1GO2A 3OQMA 3QEMB 4LBWA 2IFTA 4QDUA 1E2MA 3WKAA 1YZYA 3EG9B 4G81A 2D7CA 2XCQA 3X1KA 1E2FA 1BIFA 1L5ZA 3JR7A 3IIEA 1LEHA 2B1QA 1B6RA 2J07A 4OM7A 4JT2A 4UAGA 5ULLA 3VHLB 3IP1A 1LNQA 5FD8A 1QFJA 2QTGA 1SUEA 4R2XA 1GWNA 1VRCA 3C8HA 1EWYA 4YHHB 3ZWPA 4H7HA 2IYTA 4QOGA 1DQNA 4UBLA 2IUFA 1Y8RB 3DVRX 3OLVA 4EZIA 2G08A 2EFJA 1ZPDA 4AO8A 4JI4B 1ST3A 5E7MA 1CJGA 4C1BA 1KEKA 3DKRA 3L6OO 4W1PA 2EATA 2UYGA 4MRMB 4H1HA 2P2ZA 4ND5A 5JYDA 3EDRA 4WLNA 3MTDA 5ALDA 1DBWA 3IPYA 4L08A 3U44B 4NR0A 4XGKA 4TKLA 2FSVC 3WI7A 3TEPA 1ENOA 1N0HA 3BSSA 4CLRA 3TFOA 1T35A 1RDFA 1U11A 2J6BA 4N03A 2O8BA 3HCDA 1XXLA 1CY6A 2PXLA 3E9DA 1IXSB 4HT3B 4RLHA 2VF5X 5JZMA 4U3JA 1K6JA 2J9FA 1K7CA 2QPLA 1G7SA 1UBNA 2YQ5A 3CSSA 5F5NA 2VJOA 3KAJA 1X1CA 2P67A 1TT5B 3HZOA 1E3TA 4PR3A 5JSFA 5AYVA 2HV9A 1MRSA 2FFQA 3NHSA 4GX5A 4UQPA 5LA6A 1G59A 1YR6A 4X24A 1I36A 2HRQA 2CROA 3U6KA 1KH1A 5EFOA 2PH5A 4PBTA 4ZVUA 2X19A 3WLOA 1EVZA 1G6HA 1ZIOA 2MIIA 3CZPA 1NLYA 4HK4A 4LGVA 4QUKA 1OZFA 2VLBA 3V7FA 1WBDA 1CF4A 3T5TA 1UFQA 3PK0A 3LUJA 4QHYA 1G16A 2GZHA 2H17A 2V6MA 4Y2XA 4BNUA 3FZQA 1W8DA 1AQNA 3PWSA 2QVYX 2ZYWX 5IKMA 1HC7A 1TGYA 3G3EA 3CKYA 5JMPA 4CM7A 3GW8A 4P0PB 1XMJA 1HGXA 2QE6A 3LO5A 1IONA 4OH7A 1DAEA 2OBLA 3BE4A 4XUGB 5IJAA 1A2KC 1HDIA 4A6PA 3EGVA 1Q21A 4QREA 5E4FA 3Q9UA 4QELA 3U09A 5A71A 4R51A 1YFJA 1Q5PA 4KO8A 4PAOA 5K4HA 2WBLC 1B6GA 4U7GA 5KSYA 4RACA 1CF9A 3C1AA 2JBAA 3MZ0A 4KE9A 1BHO1 4CG3A 1YZVA 3IVRA 3DMTA 2VHWA 3FTNA 3L8ZA 4QULA 3RVJA 1H93A 4TVBA 1Y6FA 4K9SA 1NP7A 3HCEA 5FDFA 1C5KA 1Q0QA 1DBRA 1AK2A 1YVRA 2QTWB 3ZQ4A 2JG3A 4CXMA 1BX0A 1G8AA 1EFRD 1RJGA 1XRMA 3CYFA 3EFHA 4W1QA 4DHEA 1YO6A 1VJ5A 3CPSA 5K3FB 2BEWB 1P0QA 4UVGA 5IRCD 4KW7A 4B80A 1FSGA 2ZTUA 1QBGA 2LPMA 4GPAA 4JI1B 5LXTA 3GJZA 3GRPA 1U9IC 5H3HA 1XXHE 3DT8A 4E2FA 1P4JA 3HUTA 2MINA 3S2GA 1PGQA 4ATNA 1YJBA 3OQIB 4BNWA 1TU0A 2G9VA 1SO8A 2ZJ4A 3MOIA 3OLYA 3S2FA 3TOSA 4E15A 5KYXA 3C6KA 1PZFA 3R6DA 2QNBA 2PSJA 4RY2A 5HP4A 2VJMA 1AA9A 5CUQA 2XIJA 1A9PA 2R79A 2RJ3A 4WXMA 4BV2A 4QYIA 3T7CA 3PRKE 2AJDA 5F64A 2HINA 4RKYA 1LS1A 1THGA 3BWDD 3EUAA 4LHZA 5K1ZA 3SIXA 2O1WA 3B6ZA 3DV0B 4RABA 4E2YA 3GK3A 4RXMA 4X90A 1JIVA 2BD0A 3LC2O 3BH7A 4UPVA 4LVNA 1A5ZA 2OHHA 1IY8A 1OZ0A 2P41A 3HZZA 3VU9A 2WUEA 1DELA 4IDCA 2PGLA 1G3IA 5A4MS 3OPVA 4EY3A 3HXLA 3IVMA 5TE9A 1P61B 4UQLA 3A6PC 4R1PA 2HJSA 2YZ7A 2J7PD 1G5HA 4KRYA 1Q1EA 1UPXA 2EX4A 2WSSD 4WXRA 4S04A 3IAHA 3AMVA 3DG9A 5LQJA 1ZITA 5I4KA 2CXOA 2ODPA 3GEBA 2XYGA 1SEPA 3E5RA 3OUZA 4CLOA 1JEQB 5A5EA 3GEHA 3TRHA 3HKDB 3JQFC 3QEOA 4CCSA 4I4IA 4RHFA 4MCXA 4G26A 5KQMA 5EZYB 3ZWBA 2IW1A 2I65A 3V48A 4I1OA 4DIEA 3SZOA 4PIVA 4UEOA 2X4DA 3VV3A 5ALGA 5ICSA 4DRZA 2CL5A 1JG1A 3HCRA 4ILEA 4Q03A 4YY3B 1W96A 3O3MB 1PR6A 4TVKA 3A2KA 1FYFA 1YUMA 13PKA 1QF7A 4BV9A 3DW1X 4K46A 1NNEA 5ES4B 4IRXA 3HWWA 2NZ8A 3L4SO 4X61A 5K0NA 3BB1A 3ZWNA 4LK2A 4R68A 5JE8A 4E11A 2J4DA 3B1KA 1SWVA 1GYPA 1R6VA 4HF7A 3JW8A 4N8SA 5IDYA 4XFKA 3DBHB 3K6SB 2JFGA 4RPHA 5GADl 4W5OA 2DERA 4EUHA 3CX4A 4CI0B 2QTZA 5KQSA 4FGJA 2A6PA 3TLAA 1JFLA 2YW2A 4MX8A 4Z1MD 2D13A 3LHDA 3EOBI 4UQOA 1M6EX 3L0YA 1XRQA 2WLSA 3RTDA 3JASA 4DR3B 5L45A 2IQ5A 1IZ9A 2CHEA 4O8CA 4TL8A 1SHZA 3E22B 2JCGA 4HH4A 3NBYC 4NS1A 5DJ5A 5IM4A 5E6SA 2P4UA 4ROTA 1DBSA 2FPGA 3EHDA 2TMGA 5JWHA 1R0YA 2GYUA 1GUYA 2MSWA 3C7TA 4M9ZA 3JQGA 2GBLA 3ENQA 4MQ4A 3K9HA 2VRBA 1XDZA 4GOOD 3KOYA 3RHTA 2B2NA 3OLWA 2X6QA 3GRRA 4LRWA 5LL6P 4HN9A 4MXDA 3UH1A 1W581 4LXUA 4QO7A 3R9IA 4CTMA 1H0RA 4TS4A 2ZT5A 3KSZO 3A7DA 2BSQA 3G0BA 3CO5A 3L9XA 1E7QA 1GD1O 1NR7A 2VF4X 5FUXA 4UTRA 1LDGA 3D81A 1SQGA 2KI5A 4R0NA 5C35A 3CB2A 5L4SA 1GAJA 1YI1A 2G17A 4ZAXA 1LLUA 4CIAA 2XCSB 4R7TA 1OXXK 1F17A 3Q12A 2WABA 3BORA 1P8JA 2IU4A 2V54A 1TD9A 3IMCA 3NIBA 4I5EA 4IGFA 4H3KB 4RZIA 5K3OA 1ZZCA 4F97A 3H4TA 1CRZA 1CZOA 1D2NA 5IN5A 3FF4A 1HQ1A 1U1DA 3CLUC 3T0GA 2ZBPA 3OJXA 1KAHA 1PV4A 4C2UA 2G09A 4OQZA 1M1NA 3R0XA 3DXZA 3O3NB 3RYFA 3T8YA 3NVKI 4QVKA 1CK4A 1NG1A 3AI7A 4J91A 4ZFNA 4ZKDA 1Q6ZA 4DA0A 1YHYA 2DCUA 4F3NA 3IOCA 1WJGA 4QGFA 1SD2A 3QEKA 2DE0X 4UAJA 6ABPA 1JR4A 4Y2GA 4F84A 4LVCA 5C31A 3MELA 3DTTA 4ID9A 1O57A 4UTNA 5K3BA 5J43A 2EWWA 4UNSA 1TF7A 3FVTA 4U7JA 4YACA 1M67A 1NY5A 2QPAA 4Q4HA 3W8RA 1YS1X 5HHTA 1WXQA 1EE1A 1WUTA 1I6KA 2YQ4A 3B7WA 4FKZA 4GUAA 4Y0AA 4N0QA 5E38A 2FZLA 5JWRA 2BR4A 2OC4A 2OORA 2JGEA 2OV4A 4IDPA 4MINA 4CLHA 4BO4A 3TO5A 3SFZA 1AQYA 1ESCA 2DULA 3WG9A 2FYTA 3ETEA 3N70A 5E3JA 4V2IA 2XKBA 4C3OB 1OSLA 2ID7A 4EABA 1CB7A 3COZA 3DB1A 4PG5A 5ILGA 3RIGA 3SSOA 1ESNA 1LNZA 3JTMA 3L0OA 1A8PA 3G9ZA 3LD9A 1TZMA 2B92A 4F72A 5GIPE 5HE9A 3ITEA 1BN6A 4PC3A 4J9VA 4LY6A 5TF0A 1ZM4A 1T10A 1E3IA 1EGMB 1DCMA 1OASA 3MIZA 4AKTA 1ZH6A 3CUSA 4RZSA 2H4ZA 3NOVA 2BHSA 5IT9A 1DG9A 1FRVA 1TUEA 2ZE8A 3PNSA 4P2BA 3T7EA 2NTNA 2ZYAA 5JDCA 1KTVA 1FZQA 2WIJA 3GVHA 2YHSA 2O8VA 4MWOA 4YROA 4PC6A 1ZICA 1V11A 2GPYA 3LBYA 1P2DA 1L4HA 2G8LA 1MPTA 1PFUA 4RMNA 2VNAA 4F1WA 4EY7A 2W58A 2WF5A 4NENB 3OTWA 1YDEA 2ACVA 2VNKA 3GELA 1WM1A 4Q19A 5C51B 3WRYA 1VPLA 2RGDA 3NLLA 1PK8A 4AY6A 2EXXA 3BRWA 2Y27A 3RC9A 1ZIYA 3H18A 5EE5B 4Y0NA 4IV8A 4CTNA 3L2OB 5IJZA 1QHEA 5I9MA 1JBQA 1P1JA 2DBQA 2ADFA 2JLAA 3DT6A 4TOIA 5J58A 2VJCA 4Z5CA 2H0AA 3G9QA 3GLUA 1PNQA 2QTNA 4YBAA 2FSUA 4TV8A 1FMCA 3VH4A 4F7DA 2QPTA 3UYLA 1E7MA 3EAFA 1EHYA 2EARA 3EX7C 3UMJA 3QPVA 5EY5B 5HA5A 3TSCA 3TQSA 3AVYA 1J00A 3EOZA 4UHDA 4NF2A 2P4HX 2HGZA 3MINB 1XF9A 2JNWA 3L8HA 4G1MB 5J1TB 4G5OA 1I3OA 4BEWA 3MYYA 4JKYA 4DV6B 1CV2A 1UM9B 3PX2A 4MUFA 3FOCA 3LSTA 1NJ1A 1P80A 4PX9A 2ADMA 3HJCA 2CHUA 3GX1A 1LC3A 2V9CA 4DAOA 2IYZA 3RRYA 5I3ZA 2WA1A 3PQEA 2P7HA 2ZJ3A 4BAGA 4FHGA 1PL0A 5F2OA 1D4OA 3LY9A 4TSKA 3VKHA 3GN1A 2FGKA 3IKMB 4LHXA 3VNBA 4FFBB 1P0PA 2PD6A 3S7ZA 4ENWA 4XX0A 5DZSA 1V1RA 2C4TA 3TFLA 3CF4A 3FI9A 4G0WA 5IJ0B 6AT1A 4N76A 3RADC 1XJWA 1QVAA 4F4IA 2DUMA 2QG9A 1HXHA 3PI7A 4O8ZA 1RI1A 4L4SA 4PEVA 1YC5A 2Y0CA 3IKJA 1SZDA 2FOLA 1XMPA 3CLTD 3KXKA 2YDYA 1DAIA 3W2EA 4DLTA 4WOPA 2VHYA 3I0ZA 3I6IA 1L4MA 2CVZA 4DYHA 5CFZA 2ZJFA 3ASYA 4KQKA 4OHCA 3T0FA 1F6WA 4UCFA 2W2VA 1ZH4A 3DLIA 3I5UA 4HTFA 5T6MA 3A9VA 4O4HB 4DY6A 1MQSA 2HK8A 4P4GA 4BFZA 1Q12A 3PRYA 5AVOA 1LFAA 9ABPA 4BE7B 2RG1A 1ZD2P 4AL4A 4B5KA 4L50A 4DQXA 1S9DA 4WKBA 2XXJA 3L0CA 5TQVA 3Q2IA 4A0HA 1AKYA 1E4OA 1Z8FA 3R0JA 2ZZNA 1Z7BA 3ESCA 2HN9A 2SCUA 1PZNA 5B57C 5JAOA 1E66A 5IX8A 2Q99A 3X2FA 1A8IA 1K6MA 2XYQA 4GRAA 2FEOA 1YB4A 3C70A 4C4XA 1EUQA 3HABA 1RSZA 1W5TA 2P3LA 1KYTA 4X91A 3CM0A 5DM1A 3OE1A 3H6KA 1QTQA 1MEJA 3R5XA 5DGHA 3KKQA 3X0DA 4I1VA 4TS3A 2WYVA 1KJQA 3AL3A 2YMQA 3VSEA 2P2SA 3ZD7A 5C7OO 2CZCA 4Y9SA 2AKEA 2FPOA 4HLUC 3ZE8A 3C24A 1G20E 2IE0A 5EHIA 3DEZA 3LHSA 4MVJG 4D4KA 3JQ9C 1FFEA 2BM1A 2NW6A 4IMJB 4JL5A 2MT9A 2XVAA 1U63A 1SB8A 1YS2X 2R751 1L7PA 5AVSA 2A33A 4TM8A 3H04A 2AOVA 2WTBA 3U9LA 3TRFA 2BMVA 3BIXA 2KEIA 4MMXB 1NP3A 1G66A 3G7UA 1IIBA 3JRXA 1TEXA 1N4DA 4P92A 5BNWA 4DNFA 4AURA 2PRSA 1SXQA 4FEEA 4LCJA 4ITUA 4YS6A 1GPUA 3NHFA 1ZYUA 3IULA 2LWIA 3MT0A 4D8UA 5B5SA 1EQUA 1LZLA 1L7AA 3OU6A 2BFOA 1PCXA 3BHNA 4OLFA 4U7TB 1NGSA 4HRXA 2HTEA 5DNEA 4IHQA 4DDKA 1DBVO 2ZT8A 4S1NA 4CIYA 5CD1A 1H6BA 1ZM9A 2DC1A 1EU1A 4GOJA 5F78A 3R09A 2WAYA 3EBOA 4L15A 3PD1A 4LVOA 2XNDD 1STOA 1P7ZA 1BG6A 2BUAA 3E7DA 4CDRA 3KQQA 2IH5A 4FCWA 5DI3B 1XLWA 2W71A 3H9JA 4D6YA 4G1CA 2H06A 2QLMA 3ENKA 1GT91 1QRRA 5JSZA 3LT0A 4J8PA 5KTSA 2WVAA 5CT8A 4QEDA 3KE9A 2I67A 1AGYA 1F2TB 1ZIDA 8ADHA 2O3TA 3D1VA 2CXPA 3MWYW 1AF7A 3EK2A 1ZUD1 1P73A 2FPRA 4B6QA 1CUBA 2OPBA 3LQKA 4M1TA 4G4GA 1BKYA 4KXXA 2A7QA 1XTZA 4J07A 4NBNA 1KI6A 2CFTA 3H9UA 4BNGA 1ID8A 3QFHA 3FNFA 3SC6A 4AG5A 3C6XA 3R3UA 4OL0A 1F5NA 4PLFA 1WW2A 2UUPA 5L4LA 1IBLB 1GG2A 1DHRA 5BSEA 5KEIA 2ZB2A 4RV9A 4NY1A 2VDVE 1Z68A 3U48A 5KVQA 2NYAA 3QGMA 3N58A 4HPJB 5G0UA 5G53C 4BB5A 4CG0A 2IPNA 2C1ZA 2QUAA 3FLEA 5EKDA 2JI9A 1ONNA 2DBRA 3WLAA 4EGSA 1I5OA 4DC0A 3ZK9A 1A9QA 2OE2A 1FX0B 2Z2XA 2QYSA 3D7LA 1E1LA 3DXFA 4EX6A 4UXIA 3AF1A 5H59A 5EUCA 2IYAA 1ECFA 1ZPQA 1UXJA 2VZ8A 3A3KA 5T6BA 3K8QA 2I34A 3OA2A 3Q0EA 1GGVA 1U9JA 2I1LA 4KAXA 2ZRFA 3MFQA 3W05A 2A7XA 1G3UA 4ZWNA 1UBKS 1W5SA 2P9CA 2FK8A 2GYWA 4AUEA 4NAVA 4J43A 5HQ3A 3FPAA 1RI4A 1U5BB 4R9RA 3FPBA 1U2ZA 5DGTA 2ZYDA 2GAIA 4HUQB 2VBFA 3D7NA 3QFTA 4PIMA 4CV1A 1JLRA 3H97A 3C6BA 3SQOA 2I3ZA 4J0QA 3PNBA 5JLAA 1OXKB 3Q7QA 4UUAA 3ZGXA 3TM5A 4ED9A 1OYOA 3NRCA 1YTLA 4HNSA 1V37A 3X1DA 2BMJA 1VBMA 3U26A 4ZVLA 1Y1SA 1OB5A 1T8YA 1ZM3A 3FOAA 4DA4A 2ON6A 4XM0A 2RGRA 3K94A 1IUPA 1Z62A 2J59A 4DDHA 1S8AA 2P6OA 3I3OA 2V0CA 5KJFA 1PW7A 4O02B 4DE8A 2V7BA 4RH1A 3BTSA 1RYEA 4HQKA 1WNTA 4BTVA 1VLQA 2OAP1 2PFKA 3OCUA 1Z2CA 3A05A 5BN1A 4B35A 3TW8B 1ADFA 4MUHA 1AHIA 1GG5A 2R65A 2VA9A 3WKDA 1SCDA 1UFKA 1TVKB 1IY9A 1FNDA 1E1DA 1KZ6A 1UJMA 2WR8A 3P45A 4LVUA 3T7JA 2GA9A 4ZVSA 3P52A 1DTWA 5BYKA 4AJPA 3B9RA 2GCGA 2DUJA 3UMVA 4UNRA 1A77A 3GZNB 1YC2A 1KGDA 2BELA 1SKAA 2RAVA 4BHTA 4E46A 4M8KA 5KINB 4Q16A 4RHCA 5FLKA 1QH8A 2BDTA 4UMDA 2J3EA 3UXMA 5F7JA 5AKZA 4EAQA 2IYXA 3IUJA 4QTXA 1YZGA 4ZYWA 3AEQB 3U39A 1W19A 3DBRB 4KI7A 4MLDA 5DM4A 5ETJA 3TD6A 3PENA 1GKLA 4GX2A 3V80A 5EOVA 4LF4B 1Y9JA 2XQKA 3EY4A 1DCKA 1O6CA 4QDKA 3RVSA 2FJ0A 2XZPA 5ITZB 3PJRA 3V55A 2A9KA 3QVJA 1GSHA 3PFIA 3PE4A 5C1IA 3B3GA 4AP9A 4EUKA 2IC5A 3FCOA 3I64A 3QOYA 4RPIA 4YCBA 5REQA 4EPTA 5AW6A 1RMQA 2MCFA 5EIHA 3TAUA 1SHTX 4JB2A 4O2BA 2QY9A 4RHEA 2C3UA 3NKVA 3BXEA 4ZXPA 1GL9B 3BGSA 5E4YA 3ZZMA 2WY2D 2QTRA 5LMCA 1KU6A 1Q3TA 1VMEA 1W73A 2O2JA 2YJ4A 3CEHA 3LL4A 3EVAA 5AVKA 3RPEA 3ZDBA 4OGWA 5K45A 1QHIA 4KRFA 3AEXA 3KSUA 2APJA 4KCGA 4AJNA 1T0IA 5HE8A 3HDVA 4HQNA 4LIPD 5LVAA 3A4IA 2VH5R 3C4VA 3SF8A 4YXFA 1XMOB 2MR5A 3OE5A 3KTFA 1Z4NA 4G0ZA 1F5SA 3QYXA 3I6BA 3D3EA 3WQRA 4DRYA 3EVNA 4DYVA 1UPAA 2NOAA 5IDWA 1R6DA 2QS9A 2NZYA 3CNQS 1Q1ZA 3GGCA 2WQ6A 6YASA 4AJIA 2CV2A 1FFGA 5ADWA 3R20A 2OXEA 3I12A 4HNQA 3L4BA 1VCIA 5CDFE 2IH2A 1T4CA 2Q21A 4QSMA 1L1EA 2O38A 5BWOA 1L7OA 1RWOA 3K8OE 3K70C 2W0SA 3PR3A 2G0AA 2KPOA 1QCDA 5KU7A 2YL2A 1PYGA 1M76A 3JQQA 3M7IA 3V4PB 1AQIA 1PDOA 2GEBA 2X4IA 2JZOA 2VYND 5DCYA 3SBOA 5CA0A 3TE7A 3LTNC 4I55B 2I8CA 3PLAE 3SFVA 1DOAA 5GV8A 1CJSA 3R8CA 1I0ZA 2CK3D 3CUKA 4RE5A 4P7JA 1XSEA 4BBZA 3GJYA 2K5UA 2ZSIA 3Q41A 4PICA 4R0VA 4UBIA 1I3LA 3AYZB 1XLTA 4D8XA 3VQTA 3UPTA 2PU7A 1YHZA 4HC4A 2QMOA 3BAZA 3GAZA 4R2WA 4CMKA 4EHIA 1KVSA 3ROEA 2IOQA 1SCUA 2IPLA 1VFNA 3O0TA 4QKQA 1DNPA 1B26A 2QX4A 4GE3A 2HPZA 2R1VA 3ODGA 2VSOA 1NVGA 3HB9A 1V5WA 1TF5A 1VG0B 3UC5A 4V0RA 5GAGi 5D86A 2H11A 1QGED 1OBCA 2JIZA 1JSCA 4D6XA 2A8YA 1NZDA 3MWEA 3R6TA 3G0OA 4PX5A 4DNQA 1ZMXA 3RJZA 3T9BA 5FWXB 1U04A 4OQPA 1E6KA 3ZIDA 3VPGA 2QXTA 1OZGA 1C1DB 3K2EA 3RNLA 3QUAA 1PTJC 2C4KA 4BFXA 4CMEC 3IQGX 1SC3A 2RGUA 5LOVA 3C5CA 5HZHA 4MCIA 5HJ5A 1HKUA 2FPIB 4E5UA 3IEKA 3KELA 4YMHA 5HOQA 2HWKA 5JDIC 2HSZA 2AG5A 1E2DA 3BXOA 1H65A 4R2HA 4XW2A 1FP2A 1GEEA 3FF1A 2CHFA 5CIQA 4D9HA 4DZTA 3LV8A 3UFXA 4JU8A 5IH7A 4LJ5A 4GBMA 5A4JA 2HCJB 3N39C 3F4LA 3QW2A 3SHOA 2ZJZA 1YB7A 3KFVA 5B4VA 3LQ1A 3P0FA 3HSYA 1DJQA 1T4BA 1GDTA 3IDFA 3P0RA 4BO1A 1J70A 5L53A 2YXBA 1QTRA 1CU1A 3CX3A 3EEIA 3EVFA 4C06A 1U65A 4RK7A 2DLDA 3ZIAA 3KBOA 1NE7A 4X84A 3NBXX 1RHMA 2ATIA 3TMYA 2I80A 3OQNA 3BA6A 5FHRA 4BKPA 2CXHA 5EE9A 1MB0A 3FDZA 3O94A 1PWHA 3P19A 2JFXA 4DKXA 3A6GA 3ER6A 5FUQA 4FW9A 1QM5A 3CNHA 5AHWA 1QOPB 1G5TA 4IXDA 4K86A 4OHPA 4CMIB 4EVSA 4Y2UA 4ZV4A 4Y30A 2OSVA 1G19A 3BIFA 3I0MA 4IAOA 2QYHA 5FT9A 4G4SO 1QYWA 4D3DA 2P77A 2QD5A 4MWCA 4RJIA 3KOUA 1DQYA 1DZIA 5A6SA 4KRXA 4JYMA 2CNWD 3H1EA 4E32A 5K4AA 1LI4A 4D96A 2AEJA 2JDID 1HZJA 4TQUS 3MD9A 3CPHA 5CM2Z 5AI0A 5M3BA 5LZ4A 4K9LA 1A50B 1EWTA 2O23A 3GMTA 4I4TA 5LMUB 2ZE5A 3HU1A 3I9FA 3QEJA 4IHAA 2IUSA 1UH5A 1KS9A 2G63A 1ZJ4A 4HGRA 4OMCA 3RUPA 3ZWOA 3EVGA 4B4DA 4KGDA 4URWR 1PS9A 3GN5A 1U1GA 5FO0A 3SE7A 1DPFA 1L7XA 2ZR0A 3VR0A 3AUXA 4QPPA 4INJA 3TOVA 3V33A 4C0WA 3IE0A 2PRJA 3RF7A 3RYCA 2YMPA 3F6RA 3IVAA 1PJ3A 4M86A 3B3QA 2DBYA 2QXUA 4HATA 4TXMA 4LN1A 5FBHA 4PBSA 3TTXA 4QBKA 2ZT7A 2H6EA 1R5JA 4BCCA 2VDUE 2GVDC 4XWOA 2LVBA 2X15A 3OU2A 4H7IA 1H5UA 4FSHA 1ZNZA 1X86B 3VC1A 1FMFA 3I0NA 4JVNA 1K7FB 2A1TR 2IYUA 2XWSA 4IILA 4KGZA 4ZPJA 3F8TA 4FDVA 1TC2A 3T4EA 1P2UA 3ZE7A 3FHOA 4QBHA 2FV8A 3FPCA 3UXHA 2LD4A 4BL5A 3UCEA 4IFIA 4IGAA 2H7YA 1L4FA 3S2EA 4PC1A 5B4TA 3RIEA 1GNVA 1CUDA 2GHIA 2IIPA 4BLWA 2Z6QA 1IN7A 2ZSEA 4JUAA 2YVUA 4TKUB 4O2RA 4NMLA 1XCPA 4AJJA 2GEUA 4RVSA 2WDPA 3QJ5A 1T1JA 5ALSA 4U2DA 3EDQA 1INLA 3RSFA 4DUYB 4LXHA 4PYJA 2WSYB 1FYWA 3HNOA 1IBMB 4ZVRA 4L4UA 5I4CA 3S1AB 3M1IA 3LXUX 1DT3A 1QVZA 2BHNA 4F5WA 4B7UA 4GC5A 4AS3A 1YF3A 2RHRA 4INOA 1G60A 2IF2A 1ZC3A 5LDGA 1SBIA 1AJEA 1ESEA 5C8YF 3P0HA 4Y1GA 4PPNA 3SDBA 1Z5VA 4GAEA 5LIPA 1YQUA 1LSSA 3WLMA 4JLJA 1E0AA 5IKPA 1ORWA 1NEQA 1H6AA 4F0JA 1X9HA 1V39A 1UBCA 2V7GA 5T4BA 4CKCB 2JZNA 4HVTA 3N28A 1WKBA 5IDQA 3SF0A 5FIUA 2WFZA 4GKVA 1VHJA 2M9MA 3G0IA 3KP1A 4AU1A 3RRZA 2CLDX 1UMDB 2B8NA 3RKSA 2JIDA 1UPCA 3HNPA 1UUFA 1BFDA 2AMYA 3K0AB 2WNHA 2O7RA 3HV0A 4KLRA 4LWOA 4R9NA 3EIOA 1SC9A 3K6RA 4R1LA 3B7HA 4ZK6A 5AVVA 3KR1A 1T5BA 3IR6A 3GBVA 4X93A 3BDAA 3QFSA 1TADA 4ZI7B 3O8BA 5K9ZA 1L5FA 4U02A 5C1DA 1EFLA 1POXA 4NZ9A 2OKGA 4G25A 3DO8A 4F60A 1KSHA 3TCKA 1E6WA 2HSWA 4JYPA 1SGWA 1MTZA 1CETA 4I8DA 2I4IA 1WMSA 3N0XA 1U3GA 4HX5A 5EP4A 1DDGA 2HU2A 4YUYA 5LYJF 5EEGA 3GGSA 3PLNA 4WERA 3LO8A 5G1NA 3AR8A 1ICIA 4FGZA 4UHHA 5KYWA 3EQ8A 4H27A 2NXNA 1EFVA 3PGKA 5CT5A 2A0UA 3TRBA 3FCEA 1CRWG 3N75A 3NTXA 4C0SA 5JBNA 1NLUA 3HVRA 4EHAA 3ONDA 1V16A 4QQ8A 1ZUNA 1AZSC 5FA6A 3WP1B 4ADSG 2Y77A 4MW0A 1KO5A 4NL4H 4QVIA 2OXRA 5A9RA 4X4CA 3SY8A 1DS6A 1MPXA 3K9QO 3EPKA 4JWTA 2O0HA 3AB8A 2YJGA 3ZXUB 2HU5A 4ZZ2A 5T8KC 4BJ5A 4L9RA 5DV9A 1FDSA 1UBRS 1XTSA 3P9XA 4OHOA 1ODLA 1C9JA 2HZ7A 5I9IA 3OJLA 5LLSA 3CRW1 2VJAA 3UHPA 5KYUB 5ITVA 3JALA 1HM5A 4EG4A 1EKXA 3A4LA 2GPBA 5AW0A 4DANA 4HS9A 4X66B 2VHVA 1EQ2A 2PX6A 1CSEE 1HZZC 4KIFA 2WIAA 3VYTB 1CW2B 3K09A 2O7NA 3CRNA 4WFQA 2AQHA 3QEMA 4D4HA 1QG0A 4RTPA 4B71A 1FS5A 2Y3IA 3EG9A 1SUSA 3A3OA 3LUCA 3MJVA 1ZZ8A 1RRPA 3KZOA 4QJ5A 4D02A 1S5PA 5LQSA 1Q92A 1VXOA 2JRCA 3RFFA 1GPJA 3F46A 1OTXA 3A25A 1OQAA 1JXMA 3D6JA 4DWVA 2UZIR 1JZQA 2PSFA 3OHSX 2ERXA 4JFAA 3SE0A 1B6SA 3LYAA 3QKUA 4D9MA 3NTQA 1Y8RA 3WRVA 4B17A 3RTBA 5M34A 4MV6A 3U13A 3CVJA 1U99A 2FVXA 3ELDA 4II3A 1J07A 1MB9A 1N2OA 1SBZA 1UWLA 1VZ3A 1YZNA 2BFDB 1KY3A 4GOXA 5AKJA 2OXTA 3WBJA 2QL9A 2VCHA 3TR6A 4DADA 4C0BA 1ZD9A 3P5BA 3U44A 2IS4A 1QO0A 4HWRA 4N8EA 4R84A 3V3TA 1QKKA 5ED4A 1TFRA 3HUUA 3KQLA 2G77B 1CY8A 4ML3A 3H8VA 3I1FA 1XZMA 1GNSA 4PCUA 3MC1A 4FX5A 3DCYA 3PDCA 1ZWLA 2FB9A 3BS3A 1MZVA 1TKCA 1JG6A 1PT8A 5HILA 4G85A 3ZCTA 4ENRA 1XKQA 3BIJA 2JD2A 1JSZA 3D6MA 5LWHA 3C5VA 5GMOA 1T9BA 2ZBEA 2H1RA 1YGYA 2I5PO 3G7NA 3B1FA 1PQWA 1Z5GA 1BMFA 4OBBA 2DJ5A 4DW8A 1TJYA 4UHCA 3SSMA 3BTVA 4YMTA 1E94E 3CZ9A 3AKYA 5JHHB 2YOFA 2HAEA 2ZS8A 2VNSA 4JJIA 5AVYA 2O5RA 3UBMA 3D6NB 1AKRA 1DSSG 4RKFA 3N5KA 1OE0A 3ZDZB 2XODA 3Q5GA 4FYJA 4YG1A 3DPIA 3KALA 3QKWA 2OCDA 3LRXA 2QA5A 3DHEA 4QOSA 1ZP6A 2Y0BA 3TNYA 4G5SA 3ICPA 2H4WA 2QTTA 3DL4A 1ECJA 1KO4A 1RI3A 4DG9A 3EW9A 4N3AA 2WAOA 1R1DA 2J08A 1X19A 3G6WA 3NAGA 3P8ZA 1WOMA 4ZTUB 1B4DA 1QFMA 4KXUA 5DULA 5A0TA 3R75A 4TV8F 2R6JA 1JAXA 2B9EA 4MW6A 1ORDA 3OP4A 3GPIA 4BN4A 4YRDA 4HXYA 3TQOA 4BXOB 3PIRA 1UPBA 4BOYA 1RYZA 1Y9ZA 5G3YA 3NWJA 5A5GA 3UMMA 3P94A 2BNMA 1LVHA 4WVFA 2R97A 4AZ0B 1P1KA 1V3QE 1R3UA 1YE8A 2C61A 5FAKA 2Y1FA 8MHTA 4FYVA 4AULA 5A1TA 4L3VA 1HE3A 1PJZA 2AFVA 4EKYA 1AK1A 1NI5A 3FOFC 5K3FA 2BEWA 3VJLA 4KQ9A 1UINA 2ZE7A 4E5MA 2CFSA 1QU2A 1NLFA 1X2BA 4HDOB 3LFPA 1KMNA 1ZXXA 2FKAA 1VKZA 3PIDA 4LQLA 1ZJYA 4IKEA 1LDNA 3W8DA 1ETHA 3OQIA 3F6CA 3EZXA 5ALWA 4EGAA 4LNUB 3WGJA 1J2RA 3A6FA 4LSMA 1FFYA 3JQCA 1QO9A 5L7TA 1CJVC 5JADA 5FPPA 3KUDA 2YUIA 4EDHA 9ATCA 1N2SA 2KS6A 3I45A 3DV0A 5D87A 5GP1A 1Y80A 4OXRA 1XWWA 4RE6A 3AFIA 2VVTA 1JH9A 2FGJA 1IMJA 5TS3A 3K1JA 2IYYA 1KAMA 1NJFA 1WU8A 5DASA 4E7PA 4IM7A 2EKQA 5I9BA 1OV6A 3MVEA 4FKBA 3WO0A 4C0AC 3EB9A 3EH2A 5CB4B 5F2NA 1D7OA 1U81A 2CY0A 2WZQA 3Q3VA 1FBTA 1NHWA 2C3OA 4D3XA 3KXPA 2ZBVA 1LGYA 3ABZA 1ZM2A 2GKGA 2I2WA 4LV5B 4EDFA 3HB4X 4PAQA 1OI7A 3Q7PA 5IAGA 4BLPA 1H0SA 4BAUA 2HREA 3HDYA 3ZQJA 4QGBA 3H2KA 3M89A 1E9AA 1JEQA 3VU3A 1U1CA 3ZV7A 2A58A 5IKOA 2YTZA 3AY7A 4OYYA 3LY7A 3C98A 2QDKA 1IBCA 1Q22A 2BOVA 1P2TA 3FG9A 2O6HA 1O6BA 1R16A 3KJZA 3LQRA 3H5RA 4TKZA 5EZYA 1DJOA 2XGGA 3UHFA 3AP1A 3DFKA 2H3EA 1E98A 1I2BA 3B48A 3BFVA 2JGRA 4J7UA 5DN6D 1MQ8B 3DNPA 5T67A 1ZGJA 3L01A 2QRGA 3SYLA 4H0CA 5GPBA 4W7IA 4BFSA 4BB9A 3WLPA 4Z58A 3T0IA 1E7YA 4OJQA 2X1LA 2XCUA 3DM9B 3G79A 1QV9A 3K5PA 5FV7A 1EYZA 2YMLA 4KN6A 3RSGA 1CNEA 1NQ5A 2N47A 3DBHA 4Q9DA 3WYBA 5KQRA 4XVRA 1AS3A 3QNUA 1X1TA 3KC2A 5CLHA 2C7QA 3PA6A 1JBEA 2A3RA 1UTXA 2QN1A 1FQOA 1Y8QB 3PKIA 4ZCPA 1I7LA 1UXIA 2XXPA 5L51A 4G0NA 3V7NA 1E3MA 1X1AA 3FIUA 4P4UA 1UBOS 2C9BA 3HRKA 3OQVA 3TL3A 3N2KB 3TXXA 1PT6A 5E8JA 5TRTA 4AICA 1MVNA 3BIWA 5JI3E 4KE8A 4DUGD 3ZCXA 3L02A 5HS6A 1UXOA 3PC3A 4JENA 4Q3OA 4TWRA 2CCJA 5PNTA 2ZIZA 4XR4A 1P74A 2IXAA 3INGA 2IGBA 1PUXA 1A5TA 5G4KB 4DFDA 1N34B 1JG3A 2R8RA 4YK7A 2O2DA 2GLUA 5AI6A 5KYYB 3H5VA 5TARA 2AD5A 2Z30A 1AHNA 3ZW9A 1EDEA 3AZPA 3TQHA 1D07A 2OFFA 1UFRA 2WICA 1SD1A 1E5VA 3QRWA 3KIPA 1FB5A 4E12A 1UP4A 3DZIA 4YRBA 4WI1A 2A86A 3N86A 4WADA 2KE5A 3QOWA 2XUQA 4C20A 3AILA 3NBAA 4KODA 3FFAA 3RODA 1QRAA 3RWMB 5KX5A 1YFLA 2VTEA 5E1DA 3ICWA 4B4UA 1CQJB 5AVUA 4DQ0A 1OBOA 1AGXA 1AGRA 5B37A 3TIIA 3HXTA 3W2IA 2W42A 3EDMA 3B1ZA 1PHRA 1IHPA 4I9NA 2IEZA 4JXKA 4NAHA 3RREA 3RVBA 2ZS7A 1UXHA 1M72A 2RHJA 3QE9Y 3ZJTA 4MV3A 3TLEA 1WXDA 3D5EA 2VSXA 3BWVA 1ONPA 3TPZA 3C5EA 2E4ZA 3DZCA 3N59A 5J2TF 3S1SA 2PX8A 3AG6A 4CRWB 3Q6IA 3DEFA 1KPHA 1EFAA 2YHAA 3C3XA 3G2QA 4YGXB 2XOXA 1JHMA 4MJ7A 3PFBA 2QM0A 3K9BA 4MZDA 1G20B 4WD3A 1RKQA 2VC2B 2RB5A 3DC7A 3B6KA 3E27A 2F90A 3UB3A 1KWKA 3SKVA 3UKDA 1J20A 2HDWA 5EXDA 1EHCA 2WHXA 2CLFB 3WFZA 5CXXA 3KOWA 4MWEA 2GZSA 3ROFA 1Z2PX 4CM4B 4MB2A 1P1BA 1J42A 3OEED 4OB8A 1W6UA 4ZVPA 2A92A 1JVSA 3E53A 3U31A 1EXWA 4WINA 4HYTA 2B5AA 1A5AB 1PJTA 1NVTA 2CSUA 3AJ9A 5LN1A 3T4PA 4BBAA 3D54D 4D3SA 3GVIA 4BNIA 4GH5A 4EB0A 4LFBB 4OQMA 2UXCB 1AZTA 1EZ4A 2ZJAA 4KI0A 4KSYA 2Z6UA 5HZMA 3COWA 2GPJA 2OZLB 1B15A 5LD2B 4P3PA 4GXQA 3A6DA 1YR8A 3LT5A 4H1UA 1QVVA 3DD1A 4IGEA 2QTCA 2WWRA 1N9ZA 3OFNA 1THTA 2BRUC 1VLHA 1OA0A 3BH6A 3AR9A 3W9YA 5I9LA 2JA2A 4L5AA 1IEXA 3TTVA 4J0IA 1JYFA 1L7DA 1S7GA 3OX1A 4MUXA 4JT9A 4IIGA 4I3HA 1CS4C 3JQ8A 4P33A 1CIJA 1RBZA 1EI9A 2AN1A 2Q1XA 4NENA 3U80A 4LCBA 2H4JA 1L4GA 1XTBA 2REOA 3LKVA 3ZHUA 4EI2A 4WKNA 3VR3A 1QR2A 2CHVA 2WF6A 1YBVA 2QT9A 3FE2A 3L5KA 5AQEA 4B2LA 4UOEA 3IL2A 1JA1A 3RCBA 1BCRB 1Z8NA 3UAVA 1XNJA 1SCJA 3O1LA 4QECA 1JWLA 4BFWA 1O54A 3OPYI 1IQUA 4NARA 1JEAA 2BLNA 1XZAA 3OQOA 1NONA 1JQ5A 2HRBA 2HZBA 1GDDA 2GETA 4IF4A 1KMMA 3TD2A 5IJWA 3SD7A 4EGCB 3WLFA 1UXCA 1H1DA 2HMWA 5AJHA 2AL7A 3H17A 4UUOA 3L8MA 2A5DA 4C2BA 3OTQA 1OD6A 4M1QA 1TJ3A 1VMKA 5L7WA 1H1LB 4BMDA 3AJRA 5ICCA 3BG5A 2GM4A 1ACMA 4RU1A 3BXFA 3L40A 3MINA 5T4HA 4PX3A 2NV0A 5L3ZA 4LRXA 4Q7EA 5HS4A 2C4VA 1UM9A 5DGDA 1E0SA 1NV9A 3QMWA 4KLAA 4M0PA 2C96A 5ALTA 4A1OA 4OQNA 4H3HB 1OYYA 4S1WA 3KHSA 1M74A 2E6UX 4JZKA 2ONJA 4XWGA 3GA0A 5EIBD 4CTKA 3DHYA 2YJZA 4B47A 4EATA 2P9GA 3GQBA 1Q7BA 2CBGA 1PK7A 4L5JA 3GP5A 3OMWA 5FTJA 3W3AD 3JYNA 2OGZA 4Q6BA 4BEBA 2HUPA 3UH0A 3WR5A 4F85A 3HI4A 3UB2A 1Z25A 5BR1A 1XEWX 3QFIA 3FUVA 3F9CA 4FFBA 3ZS9A 2IUYA 1GNRA 1YL7A 2Z2ZA 3EMDA 4FE3A 5K3CA 3T15A 3TIGA 3ETHA 4OKNA 4RZQA 1DX9A 2CMHA 3PXEA 4TYNA 4ZDJA 1P9LA 4O4IF 5HKLA 5IJ0A 3ESAA 4I50B 1EM8A 2GJ4A 2YN4A 4OSEA 5KZMB 4QTTB 2ECPA 4OCZA 5MF6A 3DP9A 3BA1A 4ONEA 4Y9TA 1NXVA 1UT8A 1Z35A 5AW5A 2FMKA 3MN1A 5AIAA 4DRXB 4EHNA 4D1YA 3OQHA 2GO1A 2OLKA 1E63A 2QVBA 1DKMA 1VE5A 3DMTC 2PG3A 2VZLA 4OXYA 3WGTA 3TQFA 4DDVA 2EL7A 1MJHA 4XVQA 5BOVA 3SX0A 1JFTA 3ILXA 5FAXA 4O4HA 2WD9A 1AUPA 4ARUA 2W4MA 1TUGA 3AY0A 3HVJA 3JZDA 3DWGA 5JAZA 4RY0A 5DNVA 4NYMR 3NVAA 4UKDA 1NKVA 2XUDA 4FZ3A 1IIRA 4DBZA 1WXIA 4KXWA 4NFLA 3EISA 3KOMA 1KARA 1P18A 1VDMA 2FX3A 1KAEA 3F2VA 3KHUA 3QKRB 4R40A 1Q95A 4LKOA 4BO3A 2GN9A 3ZR4B 3GLTA 4K05A 3K05A 3OWXA 1X94A 4QWMA 4OOFA 1OYVA 2FQQA 4RFVA 3SEAA 3F73A 4JB3A 2NVBA 5GTDA 1OC4A 2RHWA 3RS0A 3W2FA 3T9EA 3L5OA 5KHAA 4Q7MB 1X38A 1MFZA 4TWJA 5LQUA 5JAQA 2QRVB 3OKCA 4G37A 4HUTA 5JJLA 3M4ZA 4UDYX 2I3AA 4F6LA 2XRZA 4CQLB 5AK6A 3KSAC 2WMYA 3VSCA 3PHJA 1THZA 3QG1A 4GNKA 1DU4A 2FW6A 2Q6OA 5HF9A 1MV5A 2O49A 3AM5A 1XZHA 3O6VA 2C8KA 3U61B 2FFBA 5SYNA 2WT8A 1FSFA 3ELUA 4FR2A 4NE9A 1QHSA 1JJVA 2QUBA 3W9UA 4KQCA 2ZXFA 1WPGA 4AG3A 4TMKA 4WIAA 4XCVA 3VVCA 1IHOA 3R5KA 4AROA 4NABA 4Z8XA 1UPFA 3AQIA 4H60A 3RVQA 2F8LA 1EG7A 1P2GA 1SFRA 1U0JA 4YRAA 1GL3A 4KR3A 1XYGA 4G07A 2ZI7A 4XSHA 5E7IA 1NPTO 4JLAA 4V3CA 1KNXA 2R8ZA 2YHBA 3CG0A 3JSXA 3HDJA 3MXTA 3OZDA 3PTLA 3FYAA 1KHHA 2QMHA 3OIVA 4D74A 1Z83A 2ICTA 3K35A 5F98A 1MHPA 1KS2A 3C5HA 3O4RA 5FCDA 2RIPA 5DI3A 2V59A 2I6GA 2NO7A 2GNAA 2M6RA 4N01A 4NMHA 2JAHA 4TMTA 5K8UA 2H2GA 1ETUA 2HC9A 2IXTA 4HLNA 1KI9A 4JUFA 4E2ZA 2EKBA 4BNKA 4DCMA 2QN3A 3E15A 3SVZA 1F2TA 4R4JA 4B34A 4C4SA 2ZM6B 3ND5A 1XAGA 3EIWA 5IC5A 4AP5A 1TCUA 3LVFO 2DF8A 3CNBA 3O8NA 1DAOA 1FPMA 2I66A 3QU5A 4AO6A 4NDNE 5JCZA 1TPYA 3FGOA 1GN8A 2FN9A 2NT4A 5JW6A 1E59A 3OZRA 3GDWA 1FRZA 1RQPA 1TKBA 2PYZA 1CUHA 1JPJA 3BRCA 3UGQA 2FWIA 5BV1A 2CDBA 1DAHA 4I4TF 3S81A 3PQDA 4MGZR 1SHUX 5LQDA 5CCXA 2GBLC 2VRWA 5B58C 2WJ3A 4IWYA 2C42A 3O8RA 4MRAA 1DAMA 1FDWA 4ENUA 1HF0A 1DFHA 1DRVA 5LZ5A 3CIOA 4YMLA 4KQEA 3RD5A 4KXNA 4YAWA 4Z3KA 4IQ8A 1ZGZA 3I09A 3Q6MA 4OH1A 1IPFA 1FX0A 4LYAA 1RXUA 4KG7A 4AX8A 2Z2JA 3QLUC 5BT8A 3VH2A 3GNLA 2RHOA 1OLSB 2AMFA 3IA2A 2ZSUA 3G02A 1QZ3A 2IIVA 3H87A 4XTRA 4YMUA 5IANA 3QPUA 2NYUA 3HVIA 5EYPB 1WMFA 3TZ6A 2TMYA 3OD5A 2NTYC 3AM1A 1GFZA 4S2EA 1ZDMA 2VAWA 2FFAA 3RSQA 3AR2A 3U40A 1MNAA 2DY1A 3ADKA 3ZDYB 4BAZA 1UK8A 2VAMA 4EY5A 1U5BA 4Q3KA 2OHXA 2IK8A 4HUQA 4C7JA 4G9GA 4QUHA 1R63A 1NPYA 4J0CA 4ZDIA 1B0PA 1SC6A 5DCLA 4Z54A 1KPIA 1VPVA 4FS8A 4C5CA 2CL7X 1ND5A 1AO3A 2W6JA 2ZAYA 4G5QA 4NAUA 4QU5A 4CKWA 2Q5HA 4P58A 2G8NA 1S7CA 2EG9A 1Y1KE 4IPTA 1YMVA 3I62A 3TRIA 1PSDA 2XQVA 1XL0A 1C41A 4RCVA 4FOLA 3LL7A 2DWQA 4XUDA 2AJCA 1RQXA 4KQGA 5IABA 5G41A 4I5FA 1WDKA 3RC3A 1AKTA 5CVJA 5MDHA 3V97A 2FUG1 5EIFA 3PGXA 2G5TA 1X15A 1QFXA 3PS9A 4YDHB 3SJBA 3TW8A 5AXAA 3ZZ0A 4CMBA 1R0WA 6NULA 2CUZA 3GA5A 1EG2A 1TVKA 1LPOA 4HWKA 3TGLA 1E8MA 2AE2A 1S89A 3MWGA 2KWIA 1J25A 1RRFA 2R7LA 3GZNA 1AQUA 4G0OA 4OUKX 2FFJA 1JEJA 4PXSA 4RHXA 1L6RA 5J1SB 1ZCAA 3ENNA 2R62A 4MARA 5BNTA 4BO2A 4EB6B 3SLGA 3CRVA 4FMDB 3BQNB 3M5CA 3ILVA 3FHTA 3KZXA 1V6CA 3AEQA 2OY0A 3DBRA 4D4JA 3AZOA 3RAEC 4MVCA 3BDNA 3PQ2A 5HIMA 2P40A 3HEMA 1KSFX 3AP2A 3A9ZA 3QBDA 2PV0A 4GPTA 4RKWA 1DKQA 5JDCC 3WYDA 5ITZA 1S8NA 4DQDA 4P4SB 2E18A 1EDOA 4DF3A 2D5VA 1X0XA 2GEKA 1DVRA 2DXIA 1JIKA 1U3TA 1Y33E 5FBZA 4DLYA 3UZUA 1TL7C 4Q47A 3EFOB 4FU0A 2OQ2A 4KYIB 3TLYA 1HEIA 1TYCA 5DHQA 4DGQA 5CDYA 2WIBA 4JOQA 1VYTA 3WRYC 3O31A 3IALA 4Y6PA 4ENPA 1E3LA 5E3IA 2EJUA 1XHEA 2I0FA 3BKXA 3K4PA 5ALJA 1YGPA 3MTGA 2Q3HA 2PUTA 4C04A 4ON9A 1X7DA 2XYVA 1UZNA 4HDCA 4CBVA 1DJNA 1CY4A 1DLIA 4DDMA 5HRUA 2N0SA 2ZIWB 2ISCA 3PR1A 4MV1A 1FUYB 3F98A 5DWDA 3L1IA 4YYZA 1Y5MA 1EFKA 1KYYA 1NSYA 3MUEA 3U81A 1RJWA 1XQYA 2O6LA 3IAEA 1EGQA 1GUDA 3LQXA 1SXJB 2JIRA 4L2IB 2X0FA 4E5SA 1A4RA 5DXFA 1QIDA 1NBEA 5C5CA 3CX6A 1A9YA 3IUBA 3BWEA 3THXB 1IOZA 1LPAB 3FUUA 2KBFA 4PNEA 5I5EA 1O6FA 2F3PA 4GGPA 2XNJA 4BWYA 4F8EA 3QI7A 4UPDA 3KAKA 3LKDA 1H3FA 3KKLA 3MJ4A 4ZEVA 4ENVA 2A67A 2VKQA 5CVCA 4CKBB 1O95A 2XUZA 1I1QB 2GTIA 2Q6VA 4R1UA 4DLVA 3IIKA 2OFWA 1AKEA 5CIYA 4NICA 1X8JA 3NXSA 3RSLA 1FX1A 4K6CA 4JL6A 4OO3A 3JQPA 2H4FA 3UBTA 1O58A 3MOSA 3O0DA 1G7CA 4JCOA 4Q93A 1II9A 1XQVA 2A0WA 2WMOB 4Q4AB 4R6WA 4ZO7A 3ANNA 5TT0A 3WB9A 1B1AA 5CBPB 16PKA 5DBFA 3LUAA 4LGYA 5JFOA 2P68A 1M7GA 2DQKA 3NM4A 3GUVA 4BB0A 2PH1A 3DONA 1R0SA 4MKZA 4P35A 4UFOA 5DCUA 5THKA 2GBCA 3WFJA 4L6CA 3UV7A 4OJKA 1QHYA 4E3ZA 2I3GA 2QD4A 1HDYA 2PQ0A 1RKBA 3VR1A 1PT9A 1Y4AE 2ZCVA 2ECQA 2I7DA 3N2YA 5DBGA 1TYZA 3ZDQA 4QTUB 2ZYHA 4X8MA 1OPRA 2NO0A 3DLHA 5FWXA 2X1HA 1K4KA 3G7SA 4JMPA 2I4RA 1L1RA 2ORWA 2WG2A 3II6X 1C1DA 1YZ3A 5EJMA 5D7BA 2R86A 3CA8A 3DVSX 4H1TA 1V1MB 3OJEA 4AJ2A 3UHAA 3O83A 5IYZA 3HCFA 2FPIA 1BWPA 2RK6A 1KKMA 2EZUA 1EP1B 1JFFB 2R3SA 3KZCA 3VHXB 4EX7A 1CUSA 4GL2A 4XWTA 1NXWA 3IMKA 4MVJA 2OEPA 1R8SA 3KB8A 1R5BA 3PU6A 4F3RA 2HTFA 3IILA 3MWLA 1CUWA 1NUQA 2CF5A 2W8BB 2Y8EA 4KEAA 3TD9A 2GDJA 5IJ9B 5KNLA 3PBKA 2LYJA 3R8FA 4A0GA 4OB4A 4JBIA 1LC0A 2XJ4A 3JQ6A 1W47A 1YUNA 3HA7A 4XA8A 3L6CA 1D09A 3K0HA 4LJYA 5FQNA 4E7OA 3UHOA 1U6JA 2XNKA 1JNYA 4ZVQA 4ENSA 1LA2A 4W5WA 4HB3A 2PO5A 3C16C 4R8LA 4MQMA 5AKHA 3I28A 2F1RA 5HK8A 2KYRA 1QUEA 1QQ6A 4JHXA 1IAVA 4OEHA 1P17A 5CIWA 7AT1A 2WWYA 4CMIA 1DXOA 3BRWD 4X6UA 4XVHA 4ECEA 1B42A 1G2IA 2G25A 2OD2A 3E3NA 4P98A 2R6CA 3PX7A 1SQSA 4BMNA 1TZKA 1O9GA 2GCEA 4N7RA 3TLKA 1J9ZA 2V7PA 2BR3A 2ZETA 2UZ3A 1EVYA 1PW5A 1Y3BE 3ADOA 3FWNA 3NHWA 1FNMA 1TVEA 1XUOA 2PS9A 3E2IA 5B3JA 3VJMA 1VTKA 1YMQA 5H81A 3WZLA 4CEIB 4FINA 4N3GA 1MMFB 1DMSA 1X1DA 2VH1A 4C6TB 4AI6A 3DZKA 5DK6A 3E05A 1MVOA 3AIOA 4CG1A 3F7MA 3JQ7B 2E7ZA 2XBUA 3LECA 1D03A 3HR8A 1X8LA 2R8OA 4PZEA 3U7QB 2OWEA 5JD4A 2KJQA 2A5GA 2R5NA 3FKSA 4XJSA 4Z1OA 2ZE6A 3QVWA 1YI0A 1IM5A 4DJFC 2XPCA 3S70A 4PLHA 3EH1A 4CEJB 3K9WA 2HFZA 421PA 4KDCA 5CH3A 2Z1DA 4G89A 2ANCA 1KEVA 2X2PA 3HUEA 2FPXA 4H4CA 3O91A 4IKOA 2IYEA 1JZTA 5B1EA 2CBXA 4OMUA 1HBJA 2ZJYA 5LLDA 4R83A 4A5SA 4Z59A 5T57A 3Q40A 3H42B 2IY9A 1T3ZA 4HZIA 4XIFA 1VYUA 4JIGA 2EAUA 4XQ9A 2LCIA 5HIKA 2A84A 3WXBA 2QN8A 4Z7QB 4E31A 4FM9A 2LDBA 2FQYA 3G5GA 1KI2A 3OQJA 5AKXA 4DNPA 3B51X 1QHGA 3R1IA 3DTNA 1OROA 1WCYA 2LYQA 3ET4A 3LX6A 3N8KA 2FOIA 1VA4A 1U2GA 3L0PA 3M4JA 1WTAA 2I6SA 3N8IA 3QFFA 1E1RA 4V0OA 1GGKA 1QU3A 3S1AA 3CTPA 4IJ5A 3MSCA 2P90A 4RTLA 2X9QA 2YV2A 1L2TA 2E87A 2CV0A 2HU7A 2NU7A 3WL6A 3E58A 1BWRA 5KPJA 3ESXA 2FN3A 1G42A 2ENWA 4QC2A 4IDAA 1XZKA 2NYRA 4P5DA 4RAOA 3QKSB 1IY1A 2QR2A 1A2QA 2W90A 3RIYA 3UW3A 3L1PA 2ZUVA 2B35A 2YNMC 1ULZA 4W7SA 1FTYA 3TSAA 4AIRA 4DMRA 5MN6A 4FKMA 3TH5A 2H51A 4KQFA 3UF0A 3V8QA 1VSUA 1A8QA 3MT7A 3OF5A 3V2UA 2MWMA 2GK7A 3O3CA 2PVSA 2XIQA 3FMYA 1QV6A 4CKCA 3JWIA 1NULA 1TM1E 3RRJA 2C2YA 1M66A 2WYWA 1IULA 3ABOB 2ZRHA 4R9SA 4URZR 3W9SA 2Q4BA 3LI2A 2NO6A 1CJCA 2N75A 4PGFA 2B5VA 1C9EA 4CL2A 1UMDA 3SEQA 4UHJA 1KJ9A 4WKCA 5F3DA 5M5BA 1XZPA 3A36A 1LXCA 5HTOA 1QGAA 4DCOA 4YUXA 1T4DA 5F3RA 3DJFA 3AG5A 5KSWB 4W5JA 4ZO9A 1M6VB 4ZI7A 5AW4A 3KQKA 4TT3A 1RQNA 5AVTA 1C1XB 1M73E 1GXSB 4EYSA 1Z7YA 3ZY5A 1VLLA 4JMLA 5GAHi 2ZBDA 1UZLA 3H4VA 3HDTA 4KYVA 2Q3JA 1HG1A 3R7SA 3ZCPA 2QGNA 3RW9A 5A4KA 4BZXA 1F0NA 1IBSA 1GTSA 4Z9AA 5K2MA 4LHEA 1VLJA 3LSYA 1ORHA 1TEHA 3GL9A 1WG8A 2L19A 1P4RA 2QIPA 5EXPA 1IH8A 1L5VA 3LPCA 4I46A 3E7PA 3MF4A 4PLCA 1B8PA 2ZJ5A 4MA0A 5F52A 3ETLA 1V96A 3OLXA 4M0DA 3SJZA 2NG1A 2REBA 1JDBC 4ER5A 1ZQ1A 2TYSB 3L05A 4XEUA 2H29A 3O2JA 4FZRA 2QBYB 2UUBB 2FOXA 3Q88A 3CRZA 1LRLA 1F06A 2DQYA 3ESQA 1FUEA 5C3MA 3WGIA 2V4ZA 3HLYA 1KSGA 4EG7A 3MPOA 2FK7A 2PJDA 3ZU2A 3MSXA 3INRA 1QIIA 8OHMA 5LZ9A 2HGSA 5K20A 2EW2A 3B3FA 1IFXA 2HHCA 3C41J 1IHDA 2AQKA 4LXGA 4JS0A 4QODA 2D2EA 1JN0A 3D9QX 3OOEA 2CNNA 5AOVA 4ARIA 3OJCA 1EK1A 3DLTA 3ESZA 4G84A 5KYUA 3LZDA 3I01M 2H3HA 3HNRA 1E99A 2ZWPA 5DYWA 1EHIA 2PLWA 2BE7A 1K08A 2WUSR 3MWJA 4QDOA 3DWEX 3ZXXA 5E8RA 2DMRA 3FN4A 4N5DA 1XCMA 4MJXA 4IA8A 3VH1A 2H07A 4BVHA 4PU7A 3HBMA 3PJDA 4GP6A 2ZRLA 4AJOA 4DIDA 4UM5A 3ETGA 1PWEA 1GCGA 1K8RA 4U39A 2XTJA 4LKRA 4HPXB 5ITSA 1YK0A 4RHTA 1G9XA 1FOEB 4AJKA 1DC5A 3NATA 1L5OA 1VKJA 2Y71A 3A14A 2VDRB 5KQPA 1LMB3 2Q0QA 2YC4C 1KEZA 3ACCA 3GJSA 2NTJA 5C52B 4IO0A 4AF6A 1Q2UA 1CYEA 1LF0A 1YQ9A 3UM9A 1W4AA 3LFHA 4IIJB 2NMVA 1L5RA 1LDEA 3BXGA 1UR5A 3EDOA 2BFDA 3GH1A 5E9JA 4AQDA 5JAIA 2XYPA 4NU5A 3WGNA 1MW9X 3GP3A 3PF8A 3QUQA 4F8YA 3C7AA 3ZGOA 4FOTA 1JV2B 1NN3A 5A62A 3M1LA 2H8KA 1EP3B 1UKAA 3IV6A 1UXGA 3TX2A 1DDIA 4DLUA 4AT1A 5K3EA 4U7DA 1VC2A 1WUIS 4HNHA 4EEZA 1WCIA 5K2OA 1L4KA 1W0KD 2YVKA 1JA9A 4R8VA 2IVBA 2C04A 3WLHA 5CCDA 1T8SA 3TR5A 4OBXA 1K66A 2VAVA 4DLLA 1KDZA 3N0TA 4LMPA 3V4ZA 3K1YA 4B3IA 5KPDA 4MKGA 1FIUA 1WH6A 1C50A 3JV7A 1JKFA 1CUZA 2C9YA 1M5RA 3ZCSA 4TMWA 1W0CA 3A4MA 4GI5A 4BLQA 1O1YA 1MCZA 1T5IA 4P32A 1VJ1A 2PJZA 3LIIA 3QQ5A 3ERCA 5BVGB 4KFCA 2PKCA 1W1UA 1XLTC 2C3YA 2IQIA 2VHQA 2AMVA 2ASVA 5AT1A 3LDAA 3T12A 4CI9A 4CN8A 4DMMA 6ADHA 3RS9A 4W5QA 4YP5A 4FC6A 1KZYC 2RHTA 3VO9A 1F8YA 1FLAA 2XKKA 5TGDA 2CNBA 3B36A 2O2IA 1RRMA 2C82A 3Q8WA 4YRFA 3F97A 4TYPA 3VJKA 5CA1B 3ICQB 1QC5B 4LRQA 3PYLA 3M4NA 2C5FA 3JAWB 1MOSA 4R3WA 2XSDC 4U9UA 3WK7A 2HT1A 2OP1A 4ZTZB 2GFIA 3JWGA 2NAFA 3KCNA 4ZCQA 3RSHA 3EULA 5K03A 2ETXA 2ATVA 4PVCA 1ZRSA 2JRLA 1N9GB 2B36A 3E2MA 3T3EA 2EZ4A 1K5DA 4CUKA 1NXPA 1YS6A 1QKJA 5BSHA 1FCJA 4X6LA 4RADA 2O57A 1NW6A 3HJHA 2W43A 2BFBB 3JYPA 1VGRA 1Z2DA 2CF6A 4RQUA 1MW8X 1XWIA 4OAQA 3FHLA 3P0JA 5AM0A 3AW9A 2NP7A 4ARAA 3OKAA 3GHYA 2V7XA 4LECA 4QT0A 1XVLA 4BXOA 3LWDA 1VG9B 4B75A 1DZ3A 1OFIA 3ESYA 1NOKA 1TI7A 2C9ZA 2HDOA 2YXDA 4XI9A 1H4VB 1AY0A 4O4JA 1CVIA 4N65A 5T64A 3WGMA 3ZKWB 4AZ0A 5IZ4A 5AJYA 5AM2A 2OCLA 2VOEA 3JZMA 4TN1A 3ONFA 1QP8A 2RD2A 4QOJA 4S12A 5F1PA 4IIDA 3T1NA 2H1SA 3D4LA 3MQ4A 4RS4A 2FMHA 4ZT7A 3A1SA 3WXMA 3L04A 1Z75A 2GPAA 2G70A 1Z45A 3OETA 3Q7TA 3MB5A 1L7MA 3GJ4A 2BCGY 4FMCF 4KIUA 4IICA 1JTFA 4YRZA 4Q02A 1ULUA 4URXR 2G3YA 2XF8A 4FUTA 3O2NA 1GZSA 4YJFB 5FTWA 4HR7A 1TECE 4O5AA 5EJ4A 4LJ7A 5KVAA 1PQUA 5LNK6 2HMSA 4MQEB 4RPCA 1ZAKA 1AGNA