3GN5B

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
130
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 38
structure length 130
sequence length 131
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5B02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5B01
3OP9A 1LCCA 1IC8A 3MLFA 4IVZA 4Z5CA 3QWGA 4FN3A 1ZZ7A 2BNOA 1PRVA 2AW6A 2HSGA 3H5TA 1RZRA 1ADRA 2JCGA 4I6UA 2XSDC 3ZKCA 1OCTC 1X2LA 1L1MA 1ZZ9A 1EFAA 2PPXA 4Y42A 2KZ8A 1VPWA 4PU8A 4PU3C 1S7EA 2H8RA 3OMTA 4PU4C 3S8QA 1QP0A 1AU7A 2R63A 3D1NI 3U3WA 4X4BA 2LYQA 3G7DA 3OQMA 2IUOA 2IVQA 3G5GA 4MCTA 2KEKA 1ZZ8A 2A6CA 1ZVVA 2CROA 4MCXA 2PUBA 4YG7B 2OR1L 1X57A 1UTXA 1LMB3 1NERA 1QP7A 3ZHIA 1OSLA 1PRUA 2CSFA 2XCJA 3GN5A 3LISA 3B7HA 4X4GA 4YARA 4O8BA 3QQ6A 5A7LA 1POUA 2BNMA 2MQKA 4X4IA 1JWLA 4I6TA 2IV1A 1ZPQA 3JXBC 1LLIA 2FJRA 1LCDA 2HINA 1JFSA 2IU7A 3JXDL 3O9XA 3PXPA 2AXVA 3RZZA 3SCFA 2L8NA 2PIJA 1RZRD 3GA8A 4Z5DA 4GHJA 2EWTA 2AXZA 2XI8A 2PUAA 1SQ8A 4JCXA 1NEQA 1QP4A 3FMYA 2PUDA 3L1PA 1B0NA 2LYPA 5K98B 4Z5HA 1ZZCA 1WH6A 2IVBA 1QQAA 2LCVA 4YG1A 3F51A 3QYXA 1RPEL 2D5VA 2PUEA 4I8TA 2B5AA 1PNRA 2EF8A 1ZZBA 1Y9QA 3FYAA 3DNVB 2LYLA 1XWRA 3CECA 2GRMA 2PE5A 2PUCA 3HI2A 2OFYA 4X4HA 4X4DA 4J1WA 1BDIA 2KPJA 4IWRA 2BJCA 2ICTA 1QQBA 3BS3A 1PERL 2IVGA 4JCYA 3JXCL 4FBIA 3KJXA 1RIOA 1HF0A 3SCHA 2AWIA 1WH8A 3BD1A 3EUSA 3BDNA 2O49A 4F8DA 2LYRA 3IVPA 1CQTA 4Z59A 4GQMA 2AUWA 3F52A 1ZS4A 2BNNA 1Y7YA 4JQDA 1WETA 3OQNA 3KZ3A 3QF3A 1ZZ6A 3SCGA 2KEIA 3R1FA 4J1XA 1DW9A 2MEZA 3GN5B 1QPZA 4IA8A 2PUFA 3ZHMA 1R63A 2WIUB 3TRBA 3UFDA 1O4XA 2O4AA 2L49A 1WIZA 3HZIB 3OQOA 3KXAA 1ZAYA 2R1JL 2LYKA 2EBYA 3GBFA 1UXCA 3LFPA 4OB4A 3FYMA 4X4EA 4I6RA 2JVLA 1GT0C 2XIUA 2GRLA 1UXDA 2AXUA 1CJGA 3CROL 1ZUGA 2GZUA 2LYSA 4NDWA 1JFTA 3CLCA 2WUSR 2KEJA 1YSEA 2ICPA 3F6WA 1JH9A 4YBAA 4PU7A 3VK0A 4X4FA 1PRAA 1DWKA 1E3OC 2XJ3A 2PUGA 2LYJA 1RZSA 2O38A 4X4CA 1BDHA 1LQCA 1R69A 4Z58A 4YG4A
chains in the Genus database with same CATH superfamily
4BAYB 5FL1A 1CUNA 1ZZ7A 3P7IA 1PRVA 2OA5A 4DR2T 2VL0A 3TLVA 1ZEEA 2W0GA 1D1CA 3S4UA 2H8RA 2WDRA 5LMNT 2CHNA 4IGUA 2A9UA 3CQCB 3G7DA 2HPJA 2X9YA 5AQQB 2LT3A 2JPFA 2X67A 4GK0E 2VB6A 1N32T 2Y48B 4HKAA 2WWVA 4LFBT 2YK0A 1NEKA 3RRWA 3CX7B 3WAJA 1LCDA 2I6HA 4HFDA 3O9XA 2VK9A 3Q5WA 4MALA 3ONLC 2V7MA 2EWTA 2WDQA 3T8OA 4JCXA 2VWAA 1QP4A 2C0SA 1OEDB 4IDPA 2XQ5A 3NRXA 1ZZCA 4LF4T 2D5VA 3ONJA 4JI5T 1EZ3A 1YKEB 3DNVB 4L5GA 3CECA 2PUCA 3ZN1B 2AWIA 3PUGA 2CXLA 4BJNA 4EK9A 3Q2MA 3NKZA 3ZMZB 3KZ3A 5KMGP 3RIUA 3N2GE 4UELA 3LJCA 2LYKA 3PV0F 2V3CC 2D0UA 3N9NA 4HGAA 5IWAT 2E2AA 2V26A 1Y64B 2ICPA 5KDMC 2H7OA 1O3XA 4ZI3D 3AE4A 4O4JE 3UT5E 2V7LA 1LCCA 3DP7A 1T98A 2L3LA 4IVZA 5HEHA 4M1PA 3H5TA 2JMHA 3KV4A 2M67A 4PU3C 4MLKA 2VEOA 1YW0A 3NVOA 3U3WA 4IE5A 5HEJA 2VVNA 2UXNB 1IJ5A 5AQPB 1SE7A 3AE1A 3LISA 1D1AA 4PK5A 4YLHA 3ZLIA 4AKLA 2YDRA 2XSBA 4UV9B 1QB2A 4CXXA 2KT9A 4DR3T 3WAKA 4EZHA 3K3NA 2MBGA 5DTRA 4GHJA 2R6GF 4ER6A 3ZMTB 5JH7E 4H9SE 3C98B 2FUPA 1QQAA 4YG1A 4YSXA 2CXDA 4H9OC 4DE9A 4QHOA 3RX6A 4I55E 1PERL 2LNMA 4UF0A 1IJ6A 4P09A 2CHOA 2KLQA 5LHHB 2LYRA 3OTOT 3V5SA 2QA7A 4TZ4C 4ZEYA 3SCGA 4ZXLA 4HN9A 4EZIA 4X4EA 5F3JA 4LF6T 4IE0A 3L3PA 4KUMB 4IHJE 4PU7A 2DL1A 4X4FA 4X65T 3FZLB 4PJLA 2Q9QC 5JRCB 4KMCA 5AQHB 5AQVB 5DRYA 5JQGE 5DABA 3QWGA 2WS3A 2IIUA 4I6UA 5HXSA 2KZ8A 3GMIA 2BG9E 1UGOA 2DWKA 3KVBA 2JJ9A 2PXVA 1US7B 3MXZA 1ZVVA 1HF8A 2LSYA 4B3MT 4C90A 3IF8B 2J47A 4WYVA 4C91A 2BKPA 1LLIA 2SPCA 4LFCT 4HFIA 3JXDL 5CA1E 3RZZA 3KBTA 3SCFA 4QXCB 5ETWA 4F8HA 2KWIB 4OBMA 1G73A 5JR9A 2PUEA 4QH5A 2OFYA 4ER3A 3AE6A 3PUAA 3OBVE 2BG9A 2Q9QB 2ICTA 5BMVE 3JXCL 5JR9C 5FKYA 1R8IA 1G8XA 2KNDA 2EHOD 2VL8A 5ABEA 4YSYA 4OHFA 4HTEA 2PXTA 2AUWA 4Q25A 2DWGA 1I6ZA 3UUNA 2PUFA 1KK7A 3TRBA 2A3DA 2LM2A 5FXZA 3OYZA 2ODVA 2EBYA 4EGWA 2LHNA 5L4HA 4HWIB 2KEJA 4DMWA 1L0VA 1Z8UA 3N9MA 3LBXA 3VR8A 2HHHT 2MXDA 1HNXT 3P4SA 1R69A 1N34T 2PJQA 4U7YA 2MYSA 2X66A 2WMNA 2JCGA 2XSDC 3ZC1A 3AE2A 1X2LA 5ABGA 2BS2A 1VPWA 2XTLA 4U33A 2J7UA 2K48A 3LK42 3GUUA 3N9LA 4H63H 2UUBT 2QRXA 2ZLYA 5JDFA 3OJAA 3OQMA 4AI6A 3GZCA 2KEKA 1N36T 1UTXA 1LMB3 4JEUB 2F4VT 2XCJA 1E7PA 3GN5A 2LEHA 1AJ3A 3UUXB 4ASKA 2XI8A 1W9RA 1DULA 1WLXA 3EABA 1HFAA 4CI1B 2IVBA 2XSAA 5LGTB 5LJMA 1HCIA 2HFZA 1D1BA 1BDIA 2XQAA 1MIWA 2I0MA 2RA1A 2D2SA 5JDNA 3CIRA 3ZYKA 1WR6A 4GKKT 4GQMA 3TFLA 5FVKA 3PJAA 5JDMA 1XDOA 3ZHMA 1O4XA 5LBMA 3OQOA 4ZHQE 3P4WA 2JVLA 5EK4A 3EDVA 2GZUA 1MMNA 2E9XD 3Q9DA 3NRYA 2LKHA 1OWAA 1CHUA 4CI3B 2Y6XA 3I0QA 2JQ9A 1LQCA 1XMQT 1E2AA 1M7KA 1ADRA 2LE8A 2WY2A 3ZKCA 4BJMA 2XAFB 3QB5K 2BS4A 5LCYA 4WZXA 4ADZA 4ERRA 4H9RC 5AQGB 4G63A 3ZPXA 4KBMB 1H7CA 3G06A 3FXEB 2VVSA 3PTRB 3BQKA 3H37A 2V7IA 4NUUA 1ZPQA 3JXBC 2HINA 3ZSSA 5L2LA 3PUWF 5HXHA 2N9DA 2PXUA 1HX1B 5FVLA 2PG8A 4WBNE 3NROA 1MFQC 1W0AA 3FXDB 2UUCT 4CZZB 2IMLA 1WH6A 1MMDA 3QYXA 3FYAA 5TAOA 3RIAA 4WVLA 2GRMA 4Q2JA 1RIOA 4A98A 3UFGA 2UXBT 2VQFT 4O2BE 4DBQA 2LSGA 4AIUA 1QZXA 2YU1A 2LRKA 5BR8T 1BR4A 2BZBA 3IEEA 1M62A 2XQYA 2E8IA 3VRAA 5FYMA 3SR4A 4DR6T 3UULA 4LF7T 5FXWA 1ZUGA 3PUSA 4ZI2C 4HWHA 1OXZA 3CWZB 3I9WA 2B1EA 4CQIA 3QOXA 1OEDA 4EV6A 1WRDA 4LF8T 4HE8A 2NTYA 3R84B 3OP9A 4X5TA 3ZJ2A 2WU5A 2V6XA 5ABFB 3RYFE 1KF6A 1OCTC 1ZKEA 3MKDA 4ER0A 4ZZCA 3B5MA 3HKCE 3UU4A 3GWHA 3S8QA 3FHNA 1BR2A 2JRKA 1LRZA 5A1LA 5FXVA 5DTQA 3ZEFB 5JDGA 2OR1L 3LDQB 3PU8A 4OYKA 3DM5A 2FJEA 3F57A 5HCMA 1HS7A 3KBUA 2YBDA 3VU7H 1UCUA 3ANWA 2IU7A 3NXHA 3RKOA 2HCNA 4IE7A 3ZYLA 5FNVE 3OKQA 3FMYA 2XXPA 5KX5E 5HWXA 5LOVE 1RPEL 2M6BA 3KV6A 5IYZE 4U74A 4YTNA 3AVSA 2VKJA 4DUZT 3UTKA 2W67A 2XHEB 1D0ZA 3HI2A 4U72A 3AVRA 3KJXA 1HF0A 5JUWA 3BD1A 4F8DA 2BVLA 2BBJA 4Z59A 4H9NC 3AEAA 3PU3A 4IE4A 2BNNA 1Y7YA 1GQEA 2E9XB 3IBPA 3UFDA 2L49A 4TV9E 3RHWA 4AQGA 4IIJE 2IC9A 2R1JL 5AQSB 4OB4A 3CX6B 3J7Yq 3AAAB 1CJGA 2XM2A 3PE0A 3A9YA 2LLYA 4YHJA 2WUSR 2MPKA 1Y01A 2WAUA 4YBAA 3QB5A 4O2AE 4CI2B 2CM0A 3CK6A 4XAXB 3MEJA 3KDSE 4DR4T 3P4RA 2VKOA 4PK6A 3UUMA 1S7EA 2M4HA 1QP0A 3VR9A 4IL9A 4OFZA 1AU7A 2CCQA 3ETUA 4X4BA 2K5BB 1J1JA 4GKJT 3CPZA 3X1DA 1U2ZA 4PK4A 4O8BA 3A7MA 4YSZA 2BNMA 3CKDA 4H9PC 2KSRA 3K1SA 3MA9A 2XXAA 2IDOB 3NBXX 2AXVA 5AQMB 4JEHB 1U5PA 2IAKA 3C4XA 1I94T 1XNRT 2DCFA 4X66T 2L9QA 3UU3A 3C50A 2NP9A 1ZP0A 2B5AA 1J5WA 3N2KE 3RF1A 1FMWA 2OLTA 5J0ZA 3PUYF 4JI8T 2H7VC 2H88A 3SCHA 2CBJA 4TN7B 5HWYA 3ZMVB 3CX8B 2JQEA 3EUSA 1BR1A 5KXJA 4MBQA 2FJAA 3ME5A 3PURA 5AQJB 3C64A 2M6IA 2GK9A 3ZSTA 2KEIA 2NR4A 4EXTA 1WFDA 1WIZA 3QK6A 3MJXA 4QXBB 1S35A 3IHRA 4YHHT 3VKGA 3F31A 2GRLA 1JFTA 4E7SA 2LM9A 4IDNA 3U3IA 3GZDA 4EB6E 3RYHE 2JQHA 4TWHA 4ER5A 1PRAA 1VOMA 2HPLA 2KXPB 2ODUA 4COFA 5FL0A 3CVRA 3GZDC 3MLFA 1D0XA 5DQVA 4NIQA 2HSGA 2AW6A 1RZRA 2CWOA 2CEAA 4ZS2A 2FFHA 2PXBA 2PPXA 4Y42A 2Q9QA 2V7KA 5LB7B 4QWNB 3TLTA 4UXNB 3TKLB 2DHRA 3E0ZA 1ZZ8A 4F6RC 1ZOYA 3ONXA 2CROA 2PUBA 2V5DA 2WQYA 2PXDA 1HQ1A 3N9PA 3SS1A 4DMVA 4I6TA 4DNDA 4ANJA 4B3RT 5DQWA 4U2ZA 3AB3B 3C4WA 5FP3A 1UUSA 2KINB 2XASB 3OYXA 2AXZA 4ZI3C 5LNKA 2PUAA 3JAEA 2PUDA 1J5ET 2NWBA 1T8BA 1B0NA 5K98B 5CA0E 1N33T 1ZZBA 5E0OA 3P50A 5LYJE 4L0RA 1XWRA 4PFOA 1LVKA 2C5KT 4X4DA 4LMKA 5AFUL 3RH3A 1XNQT 4ILBA 4YFSA 3SOLA 4OX9T 2PXEA 3FZKB 3QOFA 4H63V 3HZIB 4J2CA 4DIDB 3LFPA 2HH7A 2AXUA 3CROL 5HAXA 1QUUA 1YXRA 2D0TA 5LXTE 1X9BA 3UQ7A 2WU2A 3ZYMA 4CN1A 3A9ZA 1YQ4A 1IC8A 4QX8B 4P1NA 3UU5A 5AQNB 1JNRA 2ACXA 4PU8A 1BR0A 3EAMA 2FJDA 2L8KA 2IC6A 5GONE 5DJQC 4O4IE 5AQKB 2LJLA 4JYAT 2IUOA 3TELA 5C3JA 2PXPA 4EZ4A 1X57A 5CB4E 4KHPT 1MMGA 3N9OA 1KNPA 5H6QB 2ZM6T 3RPUA 3QQ6A 2AXDS 1T7SA 3Q5EA 4XZCA 4YT0A 1HR0T 2BDEA 2JMKA 4AISA 2LLWA 5JDHA 1NEQA 4NUVA 3M65A 4AXPA 4GIWA 3KL4A 1MMAA 4B3TT 2WZIA 2BKNA 2PBIA 2WP9A 2A2FX 4X4HA 2LSKA 4DV6T 4G2AA 5C2TA 4ILUA 4EKGA 2PTFA 3IVPA 4DV2T 2W62A 2VURA 4JQDA 3B13A 3JADA 1W0BA 4UIGA 4ISTA 5ABHA 2X9XA 2O4AA 2DI4A 3QFIA 4UR9A 2X0YA 5AQUB 1WR0A 5FMNA 4QH4A 3VK0A 1B7TA 3V5UA 3KINB 3N9QA 4CN6A 1IZNB 1NW3A 3I0OA 3A5XA 2CXFA 3PUQA 1L1MA 1ZZ9A 2J4GA 4PU4C 4K0UA 2CMRA 1E1HB 3RQUA 3LBXB 3O1HA 5J2TE 3KV5A 2NW8A 4MCTA 2XAQB 2PXKA 1NERA 2H3RA 5L3FB 1FEWA 4HFVA 2H89A 1XWMA 2IHR1 3EI0A 1MIYA 1JFSA 3T1YT 2J62A 5EZYE 3GA8A 2PIJA 2XAHB 2CLYC 5AQTB 3AXJB 1IBMT 1UX4A 2PXQA 3O1JA 1KNRA 3A9XA 2V5CA 3PE5A 3MZKB 4AKIA 3E22E 5LHGB 2CWYA 3HKEE 1PNRA 2BBHA 2LYLA 5ABFA 4DV7T 3I1AA 2BJCA 2X51A 3C4ZA 4TX5A 3OWQA 4FBIA 4JI1T 2IW5B 4GYSA 4YTMA 1ZV4X 4O8SA 3FB2A 4UV8B 5L3CB 5DSXA 3RIFA 3D0TA 5EK2A 3F52A 5FXXA 3ZC0A 2QYWA 5L4EA 3B57A 3OQNA 5LGNB 3ZCIA 2LOSA 4TNVA 2EHOB 4IDZA 3RC8A 3L8RA 1VRBA 4HWFA 3K3QC 4CN4A 2XIUA 3AA7B 4TWDA 2XM1A 1HG5A 3F2EA 3SFDA 4JI2T 2X68A 2ZM8A 1JH9A 1Z0PA 1YKHB 2VKDA 3AA6B 4ZOLE 2MOZA 2YKSA 3HA4A 4Z5CA 5JTGA 2ACZA 2CLYB 3HR0A 3LSVA 3E08A 3AE5A 4Z90A 4YY3T 1SA0E 4JI0T 2R63A 1LVFA 2X0HA 2LYQA 3DTOA 4ILAA 2UXDT 4Z91A 5JVDE 4MCXA 4CXWA 3R09A 3P4PA 2WB5A 5GAGi 3B7HA 3EDUA 5LHIB 5IHYA 3JC6C 3LK2B 5LJNA 1POUA 4QH1A 3MK7C 2E9XC 1V9DA 2LSIA 4B6XA 1ZHCA 5L3GB 3PXPA 5J1GA 3ZT7A 2ZM0A 4L9IA 2BKOA 2A72A 5HEOA 3AEEA 4QXHB 3F51A 4GYRA 2V6YB 4X62T 3AE3A 4JUYA 5J2UE 2KPJA 1D0YA 2N1GA 3OVUA 1WH8A 3A8YC 2ZM2A 2X0LB 2XQ3A 2PXLA 2NTXA 3RKGA 4Z8XA 4IL4A 2CA5A 2L1PA 1ZAYA 4FI5A 1WYCA 2D9DA 3AEFA 1FIOA 3AEGA 2OV9A 4U7IA 1W09A 3NZPA 4UVBB 4X1IE 2FBWA 1UK5A 1QLBA 3F6WA 2P9BA 3FBZA 4A56A 1DWKA 4LFAT 3PUZF 4I43B 5C8YE 1VCTA 3BQIA 3LK3B 5LP6E 5EK3A 4V1Av 4EEBA 5FY1A 2W66A 5M4YA 4O4HE 4A5XA 2WSSV 1HTJF 2B76A 3ESLA 2YU2A 4BA9A 2IVQA 5DT2A 3FBLA 2XXQA 3OPCA 3QC9A 5L3EB 1OSLA 3RLFF 4XBFB 3R6NA 3ZPOA 5DRTA 2HCSA 4DE8A 3Q5DA 1JNZA 2VASA 5CGMA 1XMOT 2L8NA 1RZRD 4LMJA 1LKXA 2XQ7A 3CQXC 3KVAA 2W4XA 2X9WA 2HN2A 2Q9QD 4AKHA 2J7WA 2LRLA 3NWIA 1KNZA 2KZ7B 4KI0F 3QUJA 1UX5A 3G0TA 3FZMB 3RIUC 3ANWB 3QNUA 3UQ4A 3PUVF 4DV5T 1WCRA 3LG7A 3DJBA 4AQFA 5JRCA 2BS3A 4LF5T 1ZS4A 4WW0A 3ZT5A 4DV4T 3R1FA 4IA8A 1KEYA 4TUYE 4AQFC 2N2NA 3VRBA 5CJ5A 2CE7A 3GBFA 3PDYA 4I6RA 2XAJB 5LG3A 4NDWA 1YSEA 4I0UA 1QSDA 3BK9A 2LYJA 2O38A 2NW9A 1BDHA 5AQOB 3ZN0B 4ZI7E 4GK5E 2XUEA 2DLRA 4UVCB 4DVDA 4JI4T 2YEVC 3BQLA 4PJMA 1NWMX 3D1NI 2LHRA 5LMUT 2E5LT 4GOUA 2A6CA 3TLWA 3IA3A 2QGSA 4IDOA 4X20E 1HNZT 1QP7A 3C51A 3H3AA 3M3ZB 4PJNA 5AQFB 4PW8A 2MQKA 1JWLA 4YJ2E 1DU2A 4MFRA 3UUBA 2FJBA 3UU6A 2XPKA 1SQ8A 3UFEA 4OK0A 3L1PA 4Z5HA 3HKBE 1NENA 2K9AA 2LCVA 4H9QC 2EF8A 1Y9QA 3AA0B 2D5UA 4P0BA 1UURA 4IWRA 3ABVA 4HEAA 4P0AA 5JREA 3U78A 2IVGA 3NDBB 4PNIA 4IDQA 5IUXA 2MTQA 3BDNA 2AE9A 5JDLA 3RGLA 1IBKT 4HFCA 2I59A 2C5IT 2QVAA 4IT4A 4J1XA 4X1YE 1R63A 2UUAT 4HWDA 2ODRD 3KXAA 1MNEA 2UXCT 5H6RB 3AE8A 2WM9A 3RC3A 4JBWF 3OKZA 5LGUB 2XQ4A 5FY7A 4NPPA 3ZJ1A 1RZSA 4X4CA 5HXCA 3ZT6A 1FJGT 5L3BB 4LMLA 3WI3A 2K24A 1EFAA 2JQKA 4PAGA 4UF0B 4U2YA 1IBLT 2K3WA 4YXDA 2Y8DA 4YTPA 4YG7B 1S94A 4NXNT 4JI3T 4OYJA 2IUBA 2YDSA 1VCSA 3SFEA 2XQ9A 4JLEA 4IREA 3ZCJA 5JDQA 4Z5DA 2BG9C 5L3DB 3I9YA 4TV8E 4EOZB 2CPTA 1YQ3A 2LYPA 3ZKRA 3EHZA 2V1DB 3T1HT 3L39A 1T72A 4DBRA 3VHLA 4DR7T 3BS3A 3AE7A 4EYYR 2LSJA 2CRBA 3JCFA 2O49A 2WCAA 4HFEA 5HCJA 3FZFB 4UEMA 3RRCA 2VQET 1WETA 4B3ST 3QF3A 1ZZ6A 1XDPA 1UXCA 4AKGA 3NZQA 3EUHA 1IAPA 5AQLB 2LYSA 4JV5T 3CLCA 4EAHA 5HXRA 1E3OC 4U3CA 3AXJA 2HN1A 4Z58A 3O4XE 4YG4A 5DTMA 4U31A 4NXMT 2YINA 5JR9B 3AAEB 3LQXA 3VKHA 3P4QA 4PFPA 2PFVA 2WWUA 2BG9B 2BVMA 1MIVA 4CXYA 2X9HA 2W61A 3KV9A 3RI5A 3CQGB 4ILCA 4QX7B 3ETVA 3G5GA 3H3MA 2C5JA 3SX0A 3TEPA 3ZHIA 1PRUA 2CSFA 2JIWA 2EHOA 4YARA 5CFBA 2NW7A 2FJRA 4I50E 3UWPA 2KWHA 3N2OA 3MACA 4KP3C 3FZHB 2XQ8A 2EHOC 2RP4A 2E5VA 4I4TE 3UU8A 2UXXB 4ZI2D 4IE6A 4LF9T 5L47A 5F8PA 3ZMSB 3K8PC 4UVAB 3TLSA 2WMOA 3AA1B 3N5LA 3AECA 5HEUA 4AQYT 3JC6D 4EYUA 4J1WA 2YDQA 2V7JA 4KX6A 1QQBA 2WDVA 4X1KE 3HKDE 4JCYA 4TNWA 5GAHi 4N78D 3P8CD 3TLUA 2MAWA 5LBQB 5HYAA 4DV0T 4ER7A 2KMFA 2W2UA 4X64T 1SUMB 2YOEA 3VWSA 4EEDA 1DW9A 3GN5B 3W15B 3CMLA 3M9LA 4ISSA 2G0UA 3L09A 5HEGA 4K0KT 1UXDA 2PXFA 2XQ6A 4QKNA 4DR1T 2XY8B 2XJ3A 2PUGA 3RYCE 5LG4A 1WYBA 4TWFA 3PJAJ 4O4LE 3AE9A 4FN3A 3QOWA 2V6YA 5HXEA 2BNOA 2JQQA 3SWHA 2V8SV 4EIWA 4PJJA 2VKHA 4ZS3A 1KFYA 3LFMA 4FJOA 5AQRB 3OMTA 3EVYA 2LOPA 3JAFA 4JI7T 4EKIA 2UU9T 2ES0A 3HL6A 3O1IA 1OEDE 2CBIA 2LKGA 1XZYA 2RPAA 4EQZA 3RYIE 2DNXA 4X4GA 4WNKA 5A7LA 4AKRB 4E7ZA 4X4IA 2IV1A 2WBLA 3K3OA 1YD8G 1HNWT 4HWCA 1HX8A 3AAIA 3NZLA 5LA6E 5F5WA 3ZMUB 4A97A 4WBOA 1SHZC 4HFHA 1U4QA 2E9XA 4DUYT 4ZZBA 4I8TA 4KHZF 2PE5A 4JI6T 1HG2A 1X79A 2YN6A 1MNDA 2XJ7A 4YJ3E 1CQTA 1FMVA 5ADXL 4HFBA 4DR5T 3SRZA 2WZHA 1NAFA 2MEZA 1QPZA 3KFWX 3AEDA 2WIUB 5FY0A 2ZMAA 3AEBA 1OEDC 4DV3T 5AQIB 3RQWA 3Q5XA 3FYMA 1GT0C 2J1DG 2W00A 4MHCA 4DV1T 3J9X1 4DO0A 4HRAA 2NOXA 2LLVA 3PUXF 2XZEA 2XAGB 2Z6EA 2W63A
chains in the Genus database with same CATH topology
4BAYB 1IC8A 4ZI7E 1CUNA 4GK5E 4QX8B 1ZZ7A 3P7IA 1PRVA 2XUEA 2DLRA 2OA5A 1ADRA 4UVCB 2LE8A 3ZKCA 4BJMA 2XAFB 2ACXA 1ZEEA 2W0GA 4PU8A 1BR0A 1D1CA 4DVDA 3S4UA 2L8KA 2YEVC 5LCYA 4ADZA 2H8RA 3BQLA 2IC6A 4ERRA 4H9RC 4PJMA 5GONE 1NWMX 5DJQC 4O4IE 3D1NI 4G63A 2LHRA 2LJLA 4IGUA 3CQCB 3G7DA 2HPJA 2X9YA 4GOUA 2IUOA 2LT3A 2A6CA 2JPFA 4EZ4A 2QGSA 2X67A 4KBMB 4GK0E 1X57A 4X20E 5CB4E 1QP7A 2VB6A 1H7CA 1MMGA 3N9OA 3C51A 3FXEB 2Y48B 3H3AA 5H6QB 4HKAA 3RPUA 4PJNA 3QQ6A 3PTRB 2YK0A 4PW8A 3RRWA 3CX7B 2MQKA 3BQKA 1JWLA 2V7IA 3H37A 4NUUA 3WAJA 1ZPQA 3JXBC 1LCDA 4YJ2E 4XZCA 2HINA 4MFRA 5L2LA 5HXHA 3O9XA 2N9DA 2VK9A 3Q5WA 2BDEA 4MALA 2JMKA 2PG8A 2V7MA 2EWTA 4FI5A 4WBNE 3T8OA 1SQ8A 4JCXA 2VWAA 1NEQA 1QP4A 2C0SA 4OK0A 4NUVA 3UFEA 3FXDB 5JDHA 3M65A 3L1PA 4GIWA 3NRXA 4AXPA 4CZZB 4Z5HA 1ZZCA 2K9AA 1WH6A 3HKBE 2LCVA 1MMDA 3QYXA 2D5VA 4H9QC 2EF8A 1Y9QA 1MMAA 3AA0B 3FYAA 1EZ3A 3DNVB 1YKEB 2D5UA 4L5GA 3CECA 4P0BA 5TAOA 2GRMA 2PBIA 2PUCA 2A2FX 4X4HA 4IWRA 4HEAA 4P0AA 2LSKA 5JREA 3U78A 2IVGA 4G2AA 4PNIA 3ZN1B 1RIOA 2AWIA 3PUGA 2CXLA 4ILUA 2MTQA 3BDNA 4O2BE 4DBQA 5JDLA 2LSGA 3IVPA 2YU1A 2W62A 4BJNA 3Q2MA 4JQDA 2I59A 3B13A 2C5IT 3ZMZB 3KZ3A 1BR4A 4J1XA 2BZBA 5KMGP 3N2GE 3IEEA 4X1YE 4UELA 4UIGA 1R63A 4ISTA 2XQYA 2E8IA 2X9XA 2O4AA 5FYMA 3LJCA 2DI4A 3UULA 3KXAA 1MNEA 5FXWA 5H6RB 2LYKA 2WM9A 2D0UA 4HGAA 3N9NA 1ZUGA 3RC3A 5LGUB 2V26A 1Y64B 3PUSA 2ICPA 5FY7A 2H7OA 5FMNA 1O3XA 3ZJ1A 4ZI2C 5KDMC 3VK0A 1OXZA 1B7TA 3CWZB 3V5UA 3I9WA 3KINB 2B1EA 3N9QA 4CQIA 1RZSA 4X4CA 4ZI3D 1IZNB 1WRDA 4O4JE 3UT5E 4HE8A 2V7LA 5HXCA 2NTYA 3I0OA 3OP9A 1LCCA 3DP7A 1T98A 3R84B 2L3LA 3A5XA 4IVZA 3ZJ2A 4M1PA 3H5TA 2JMHA 3KV4A 2M67A 5L3BB 2CXFA 3PUQA 3RYFE 2K24A 3WI3A 1OCTC 1ZKEA 3MKDA 1L1MA 1ZZ9A 1EFAA 3HKCE 4PAGA 4PU3C 4UF0B 3GWHA 4MLKA 4PU4C 3S8QA 1BR2A 3FHNA 2CMRA 4K0UA 1E1HB 2JRKA 1YW0A 3LBXB 3U3WA 3O1HA 1LRZA 3KV5A 4IE5A 5FXVA 5A1LA 5J2TE 3ZEFB 2UXNB 2NW8A 4MCTA 5JDGA 2XAQB 2Y8DA 1IJ5A 4YG7B 2OR1L 1NERA 1S94A 3PU8A 2H3RA 4OYKA 3LISA 1D1AA 3F57A 4PK5A 5L3FB 4OYJA 1FEWA 4HFVA 4YLHA 3ZLIA 4AKLA 4UV9B 1HS7A 3KBUA 4KP3C 4CXXA 2KT9A 1MIYA 3VU7H 1JFSA 1UCUA 3ANWA 2IU7A 5EZYE 3WAKA 4JLEA 4EZHA 3K3NA 3GA8A 2PIJA 3RKOA 3ZCJA 2MBGA 5JDQA 4Z5DA 2XAHB 4GHJA 2CLYC 4IE7A 3ZYLA 5L3DB 3I9YA 4TV8E 5FNVE 4EOZB 1UX4A 3OKQA 3FMYA 3ZMTB 4H9SE 5JH7E 3C98B 3O1JA 5KX5E 2LYPA 5HWXA 4AKIA 3MZKB 5LOVE 3E22E 5LHGB 1QQAA 4YG1A 1RPEL 2CWYA 2V1DB 3HKEE 3KV6A 5IYZE 1PNRA 4U74A 2CXDA 4H9OC 3AVSA 2LYLA 2VKJA 4QHOA 3RX6A 3UTKA 2XHEB 1D0ZA 4I55E 3HI2A 4DBRA 3VHLA 4U72A 3I1AA 2BJCA 3BS3A 1PERL 2X51A 3AVRA 3C4ZA 4TX5A 4EYYR 4FBIA 3KJXA 1HF0A 4UF0A 2LSJA 1IJ6A 4P09A 2IW5B 2KLQA 5LHHB 4GYSA 3BD1A 2O49A 1ZV4X 4F8DA 2BVLA 3FB2A 2LYRA 4O8SA 4UV8B 5L3CB 3V5SA 4Z59A 3D0TA 4H9NC 5EK2A 3PU3A 3F52A 2QA7A 4IE4A 2BNNA 4TZ4C 1Y7YA 4UEMA 5FXXA 3ZC0A 3RRCA 3B57A 1WETA 2E9XB 3OQNA 3IBPA 3QF3A 5LGNB 1ZZ6A 3SCGA 3ZCIA 2LOSA 2EHOB 4IDZA 4HN9A 3UFDA 3RC8A 2L49A 4TV9E 1VRBA 4AQGA 4IIJE 2IC9A 3K3QC 2R1JL 1UXCA 4OB4A 4X4EA 3CX6B 3J7Yq 4AKGA 3AAAB 2XIUA 3AA7B 3NZQA 3EUHA 1IAPA 1CJGA 2LYSA 3PE0A 1HG5A 3F2EA 5F3JA 3CLCA 4IE0A 3L3PA 4YHJA 2WUSR 2X68A 4EAHA 2ZM8A 5HXRA 4KUMB 4IHJE 1JH9A 2WAUA 4YBAA 4PU7A 4X4FA 4O2AE 1Z0PA 1YKHB 2VKDA 2Q9QC 3AA6B 4PJLA 4KMCA 4ZOLE 3ZMVB 1E3OC 5JRCB 4Z58A 2MOZA 4YG4A 2CM0A 3HA4A 3O4XE 5JQGE 5DABA 2YINA 4XAXB 5JR9B 3AAEB 3KDSE 4Z5CA 3QWGA 3VKHA 4PFPA 4I6UA 2VKOA 2PFVA 5HXSA 2WWUA 2CLYB 2BVMA 3HR0A 1MIVA 2KZ8A 3GMIA 4PK6A 3UUMA 4CXYA 1S7EA 3E08A 2DWKA 3KVBA 2X9HA 1QP0A 1SA0E 2W61A 4OFZA 1AU7A 2R63A 1LVFA 2CCQA 2JJ9A 3CQGB 4X4BA 3ETUA 3KV9A 2LYQA 2K5BB 1US7B 3DTOA 3G5GA 3ETVA 3MXZA 4QX7B 3CPZA 5JVDE 1ZVVA 1HF8A 2C5JA 4MCXA 2LSYA 4CXWA 4C90A 4PK4A 3ZHIA 1PRUA 3IF8B 2CSFA 3B7HA 2EHOA 4YARA 3EDUA 5LHIB 4O8BA 5IHYA 3JC6C 3LK2B 5LJNA 1POUA 2BNMA 3CKDA 4H9PC 4C91A 2NW7A 1LLIA 3MK7C 2FJRA 2E9XC 1V9DA 2LSIA 2KWHA 4I50E 2SPCA 3N2OA 4B6XA 3MACA 1ZHCA 3MA9A 3JXDL 2EHOC 2RP4A 3PXPA 3NBXX 2AXVA 3RZZA 3KBTA 5J1GA 5CA1E 5L3GB 3SCFA 4I4TE 4QXCB 5ETWA 2UXXB 2ZM0A 4ZI2D 4JEHB 1U5PA 4IE6A 2IAKA 2KWIB 3C4XA 4L9IA 2DCFA 5F8PA 3ZMSB 3K8PC 2L9QA 2A72A 4UVAB 3C50A 2NP9A 4QXHB 3F51A 1G73A 5JR9A 2PUEA 4GYRA 2B5AA 3N2KE 2WMOA 3AA1B 1FMWA 3N5LA 4JUYA 3JC6D 5J2UE 2OFYA 3PUAA 4EYUA 4J1WA 3OBVE 2H7VC 2KPJA 2Q9QB 2V7JA 1QQBA 2ICTA 1D0YA 4X1KE 3HKDE 4JCYA 2N1GA 5BMVE 3JXCL 5JR9C 4N78D 3P8CD 3SCHA 1G8XA 4TN7B 1WH8A 2EHOD 2KNDA 2VL8A 3CX8B 5HWYA 5LBQB 3EUSA 5HYAA 2ZM2A 1BR1A 2X0LB 4OHFA 4HTEA 4MBQA 2KMFA 3PURA 2AUWA 3C64A 2NTXA 2GK9A 2DWGA 3UUNA 2PUFA 2KEIA 1DW9A 1KK7A 3GN5B 3W15B 3TRBA 3CMLA 4Z8XA 2A3DA 4EXTA 1WIZA 2CA5A 3OYZA 4ISSA 5FXZA 3QK6A 1ZAYA 1WYCA 1S35A 3IHRA 2ODVA 2EBYA 2G0UA 2LHNA 3MJXA 3L09A 3F31A 4QXBB 3VKGA 2GRLA 1UXDA 1FIOA 1JFTA 3NZPA 4E7SA 2LM9A 4UVBB 2KEJA 4DMWA 4X1IE 3N9MA 3U3IA 3F6WA 4EB6E 3RYHE 4QKNA 3LBXA 1PRAA 2P9BA 3FBZA 4A56A 1VOMA 1DWKA 2HPLA 4I43B 2XJ3A 2PUGA 2KXPB 2ODUA 3RYCE 5C8YE 1R69A 3BQIA 3LK3B 5LG4A 1WYBA 2PJQA 3CVRA 5LP6E 4O4LE 5EK3A 3MLFA 1D0XA 4V1Av 4FN3A 5HXEA 5DQVA 2BNOA 2HSGA 2AW6A 1RZRA 2MYSA 2X66A 2JQQA 5FY1A 3SWHA 2WMNA 2JCGA 2XSDC 3ZC1A 2CWOA 2CEAA 1X2LA 4EIWA 4PJJA 4ZS2A 2VKHA 2PPXA 4Y42A 2Q9QA 2V7KA 1VPWA 2XTLA 4ZS3A 5M4YA 4O4HE 2K48A 3LK42 4FJOA 3LFMA 2WSSV 4QWNB 3OMTA 3EVYA 1HTJF 3N9LA 4H63H 2LOPA 2ZLYA 5JDFA 4UXNB 3ESLA 3OJAA 3TKLB 2YU2A 3OQMA 2DHRA 2IVQA 3E0ZA 3FBLA 2KEKA 4BA9A 1ZZ8A 4AI6A 2ES0A 4F6RC 3HL6A 3ONXA 2CROA 2PUBA 3O1IA 3QC9A 1UTXA 1LMB3 5L3EB 1OSLA 4JEUB 4XBFB 2XCJA 3R6NA 3GN5A 2DNXA 3RYIE 3ZPOA 4X4GA 3N9PA 2LEHA 4WNKA 5A7LA 4AKRB 4E7ZA 1AJ3A 4X4IA 3SS1A 4DMVA 4I6TA 4DNDA 2IV1A 4ANJA 2WBLA 3K3OA 3UUXB 1YD8G 5DQWA 2VASA 3AB3B 1HX8A 3AAIA 3C4WA 5FP3A 2L8NA 1RZRD 5LA6E 2KINB 4ASKA 1LKXA 2XASB 3OYXA 2AXZA 4ZI3C 5LNKA 2XI8A 2PUAA 3CQXC 3KVAA 2X9WA 3ZMUB 2Q9QD 2PUDA 1WLXA 4WBOA 1HFAA 2NWBA 1B0NA 5K98B 1SHZC 5CA0E 4CI1B 4AKHA 2IVBA 1U4QA 2E9XA 4I8TA 1ZZBA 5E0OA 5LGTB 1KNZA 5LYJE 4L0RA 1XWRA 4PFOA 1LVKA 2KZ7B 2PE5A 3QUJA 2C5KT 5LJMA 1HCIA 1UX5A 4X4DA 1D1BA 1BDIA 1HG2A 1MIWA 3ANWB 1X79A 1MNDA 2RA1A 2D2SA 5JDNA 5AFUL 3RH3A 4YJ3E 1WR6A 3ZYKA 3LG7A 3DJBA 4AQFA 1CQTA 4YFSA 4GQMA 3SOLA 5JRCA 1ZS4A 1FMVA 5ADXL 4WW0A 3SRZA 5JDMA 1NAFA 3R1FA 2MEZA 1QPZA 4IA8A 3ZHMA 3KFWX 2WIUB 1O4XA 4H63V 5LBMA 4TUYE 4AQFC 5FY0A 3HZIB 3OQOA 2N2NA 2ZMAA 4J2CA 4ZHQE 2CE7A 4CI2B 3GBFA 3LFPA 3PDYA 3Q5XA 3FYMA 2HH7A 4I6RA 2JVLA 1GT0C 2XAJB 5EK4A 2AXUA 3CROL 2J1DG 3EDVA 5HAXA 2GZUA 4NDWA 1MMNA 1QUUA 2E9XD 2W00A 4MHCA 2D0TA 5LXTE 3J9X1 3Q9DA 3NRYA 4DO0A 1YSEA 1QSDA 1OWAA 2NOXA 3ZYMA 3BK9A 4CI3B 2XAGB 2Y6XA 3I0QA 2LYJA 2O38A 2NW9A 2Z6EA 1BDHA 1LQCA 3ZN0B 2W63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP9 A;  1LCC A;  1IC8 A;  3MLF A;  4IVZ A;  4Z5C A;  3QWG A;  4FN3 A;  1ZZ7 A;  2BNO A;  1PRV A;  2AW6 A;  2HSG A;  3H5T A;  1RZR A;  1ADR A;  2JCG A;  4I6U A;  2XSD C;  3ZKC A;  1OCT C;  1X2L A;  1L1M A;  1ZZ9 A;  1EFA A;  2PPX A;  4Y42 A;  2KZ8 A;  1VPW A;  4PU8 A;  4PU3 C;  1S7E A;  2H8R A;  3OMT A;  4PU4 C;  3S8Q A;  1QP0 A;  1AU7 A;  2R63 A;  3D1N I;  3U3W A;  4X4B A;  2LYQ A;  3G7D A;  3OQM A;  2IUO A;  2IVQ A;  3G5G A;  4MCT A;  2KEK A;  1ZZ8 A;  2A6C A;  1ZVV A;  2CRO A;  4MCX A;  2PUB A;  4YG7 B;  2OR1 L;  1X57 A;  1UTX A;  1LMB 3;  1NER A;  1QP7 A;  3ZHI A;  1OSL A;  1PRU A;  2CSF A;  2XCJ A;  3GN5 A;  3LIS A;  3B7H A;  4X4G A;  4YAR A;  4O8B A;  3QQ6 A;  5A7L A;  1POU A;  2BNM A;  2MQK A;  4X4I A;  1JWL A;  4I6T A;  2IV1 A;  1ZPQ A;  3JXB C;  1LLI A;  2FJR A;  1LCD A;  2HIN A;  1JFS A;  2IU7 A;  3JXD L;  3O9X A;  3PXP A;  2AXV A;  3RZZ A;  3SCF A;  2L8N A;  2PIJ A;  1RZR D;  3GA8 A;  4Z5D A;  4GHJ A;  2EWT A;  2AXZ A;  2XI8 A;  2PUA A;  1SQ8 A;  4JCX A;  1NEQ A;  1QP4 A;  3FMY A;  2PUD A;  3L1P A;  1B0N A;  2LYP A;  5K98 B;  4Z5H A;  1ZZC A;  1WH6 A;  2IVB A;  1QQA A;  2LCV A;  4YG1 A;  3F51 A;  3QYX A;  1RPE L;  2D5V A;  2PUE A;  4I8T A;  2B5A A;  1PNR A;  2EF8 A;  1ZZB A;  1Y9Q A;  3FYA A;  3DNV B;  2LYL A;  1XWR A;  3CEC A;  2GRM A;  2PE5 A;  2PUC A;  3HI2 A;  2OFY A;  4X4H A;  4X4D A;  4J1W A;  1BDI A;  2KPJ A;  4IWR A;  2BJC A;  2ICT A;  1QQB A;  3BS3 A;  1PER L;  2IVG A;  4JCY A;  3JXC L;  4FBI A;  3KJX A;  1RIO A;  1HF0 A;  3SCH A;  2AWI A;  1WH8 A;  3BD1 A;  3EUS A;  3BDN A;  2O49 A;  4F8D A;  2LYR A;  3IVP A;  1CQT A;  4Z59 A;  4GQM A;  2AUW A;  3F52 A;  1ZS4 A;  2BNN A;  1Y7Y A;  4JQD A;  1WET A;  3OQN A;  3KZ3 A;  3QF3 A;  1ZZ6 A;  3SCG A;  2KEI A;  3R1F A;  4J1X A;  1DW9 A;  2MEZ A;  3GN5 B;  1QPZ A;  4IA8 A;  2PUF A;  3ZHM A;  1R63 A;  2WIU B;  3TRB A;  3UFD A;  1O4X A;  2O4A A;  2L49 A;  1WIZ A;  3HZI B;  3OQO A;  3KXA A;  1ZAY A;  2R1J L;  2LYK A;  2EBY A;  3GBF A;  1UXC A;  3LFP A;  4OB4 A;  3FYM A;  4X4E A;  4I6R A;  2JVL A;  1GT0 C;  2XIU A;  2GRL A;  1UXD A;  2AXU A;  1CJG A;  3CRO L;  1ZUG A;  2GZU A;  2LYS A;  4NDW A;  1JFT A;  3CLC A;  2WUS R;  2KEJ A;  1YSE A;  2ICP A;  3F6W A;  1JH9 A;  4YBA A;  4PU7 A;  3VK0 A;  4X4F A;  1PRA A;  1DWK A;  1E3O C;  2XJ3 A;  2PUG A;  2LYJ A;  1RZS A;  2O38 A;  4X4C A;  1BDH A;  1LQC A;  1R69 A;  4Z58 A;  4YG4 A; 
#chains in the Genus database with same CATH topology
 4BAY B;  5FL1 A;  1CUN A;  1ZZ7 A;  3P7I A;  1PRV A;  2OA5 A;  4DR2 T;  2VL0 A;  3TLV A;  1ZEE A;  2W0G A;  1D1C A;  3S4U A;  2H8R A;  2WDR A;  5LMN T;  2CHN A;  4IGU A;  2A9U A;  3CQC B;  3G7D A;  2HPJ A;  2X9Y A;  5AQQ B;  2LT3 A;  2JPF A;  2X67 A;  4GK0 E;  2VB6 A;  1N32 T;  2Y48 B;  4HKA A;  2WWV A;  4LFB T;  2YK0 A;  1NEK A;  3RRW A;  3CX7 B;  3WAJ A;  1LCD A;  2I6H A;  4HFD A;  3O9X A;  2VK9 A;  3Q5W A;  4MAL A;  3ONL C;  2V7M A;  2EWT A;  2WDQ A;  3T8O A;  4JCX A;  2VWA A;  1QP4 A;  2C0S A;  1OED B;  4IDP A;  2XQ5 A;  3NRX A;  1ZZC A;  4LF4 T;  2D5V A;  3ONJ A;  4JI5 T;  1EZ3 A;  1YKE B;  3DNV B;  4L5G A;  3CEC A;  2PUC A;  3ZN1 B;  2AWI A;  3PUG A;  2CXL A;  4BJN A;  4EK9 A;  3Q2M A;  3NKZ A;  3ZMZ B;  3KZ3 A;  5KMG P;  3RIU A;  3N2G E;  4UEL A;  3LJC A;  2LYK A;  3PV0 F;  2V3C C;  2D0U A;  3N9N A;  4HGA A;  5IWA T;  2E2A A;  2V26 A;  1Y64 B;  2ICP A;  5KDM C;  2H7O A;  1O3X A;  4ZI3 D;  3AE4 A;  4O4J E;  3UT5 E;  2V7L A;  1LCC A;  3DP7 A;  1T98 A;  2L3L A;  4IVZ A;  5HEH A;  4M1P A;  3H5T A;  2JMH A;  3KV4 A;  2M67 A;  4PU3 C;  4MLK A;  2VEO A;  1YW0 A;  3NVO A;  3U3W A;  4IE5 A;  5HEJ A;  2VVN A;  2UXN B;  1IJ5 A;  5AQP B;  1SE7 A;  3AE1 A;  3LIS A;  1D1A A;  4PK5 A;  4YLH A;  3ZLI A;  4AKL A;  2YDR A;  2XSB A;  4UV9 B;  1QB2 A;  4CXX A;  2KT9 A;  4DR3 T;  3WAK A;  4EZH A;  3K3N A;  2MBG A;  5DTR A;  4GHJ A;  2R6G F;  4ER6 A;  3ZMT B;  5JH7 E;  4H9S E;  3C98 B;  2FUP A;  1QQA A;  4YG1 A;  4YSX A;  2CXD A;  4H9O C;  4DE9 A;  4QHO A;  3RX6 A;  4I55 E;  1PER L;  2LNM A;  4UF0 A;  1IJ6 A;  4P09 A;  2CHO A;  2KLQ A;  5LHH B;  2LYR A;  3OTO T;  3V5S A;  2QA7 A;  4TZ4 C;  4ZEY A;  3SCG A;  4ZXL A;  4HN9 A;  4EZI A;  4X4E A;  5F3J A;  4LF6 T;  4IE0 A;  3L3P A;  4KUM B;  4IHJ E;  4PU7 A;  2DL1 A;  4X4F A;  4X65 T;  3FZL B;  4PJL A;  2Q9Q C;  5JRC B;  4KMC A;  5AQH B;  5AQV B;  5DRY A;  5JQG E;  5DAB A;  3QWG A;  2WS3 A;  2IIU A;  4I6U A;  5HXS A;  2KZ8 A;  3GMI A;  2BG9 E;  1UGO A;  2DWK A;  3KVB A;  2JJ9 A;  2PXV A;  1US7 B;  3MXZ A;  1ZVV A;  1HF8 A;  2LSY A;  4B3M T;  4C90 A;  3IF8 B;  2J47 A;  4WYV A;  4C91 A;  2BKP A;  1LLI A;  2SPC A;  4LFC T;  4HFI A;  3JXD L;  5CA1 E;  3RZZ A;  3KBT A;  3SCF A;  4QXC B;  5ETW A;  4F8H A;  2KWI B;  4OBM A;  1G73 A;  5JR9 A;  2PUE A;  4QH5 A;  2OFY A;  4ER3 A;  3AE6 A;  3PUA A;  3OBV E;  2BG9 A;  2Q9Q B;  2ICT A;  5BMV E;  3JXC L;  5JR9 C;  5FKY A;  1R8I A;  1G8X A;  2KND A;  2EHO D;  2VL8 A;  5ABE A;  4YSY A;  4OHF A;  4HTE A;  2PXT A;  2AUW A;  4Q25 A;  2DWG A;  1I6Z A;  3UUN A;  2PUF A;  1KK7 A;  3TRB A;  2A3D A;  2LM2 A;  5FXZ A;  3OYZ A;  2ODV A;  2EBY A;  4EGW A;  2LHN A;  5L4H A;  4HWI B;  2KEJ A;  4DMW A;  1L0V A;  1Z8U A;  3N9M A;  3LBX A;  3VR8 A;  2HHH T;  2MXD A;  1HNX T;  3P4S A;  1R69 A;  1N34 T;  2PJQ A;  4U7Y A;  2MYS A;  2X66 A;  2WMN A;  2JCG A;  2XSD C;  3ZC1 A;  3AE2 A;  1X2L A;  5ABG A;  2BS2 A;  1VPW A;  2XTL A;  4U33 A;  2J7U A;  2K48 A;  3LK4 2;  3GUU A;  3N9L A;  4H63 H;  2UUB T;  2QRX A;  2ZLY A;  5JDF A;  3OJA A;  3OQM A;  4AI6 A;  3GZC A;  2KEK A;  1N36 T;  1UTX A;  1LMB 3;  4JEU B;  2F4V T;  2XCJ A;  1E7P A;  3GN5 A;  2LEH A;  1AJ3 A;  3UUX B;  4ASK A;  2XI8 A;  1W9R A;  1DUL A;  1WLX A;  3EAB A;  1HFA A;  4CI1 B;  2IVB A;  2XSA A;  5LGT B;  5LJM A;  1HCI A;  2HFZ A;  1D1B A;  1BDI A;  2XQA A;  1MIW A;  2I0M A;  2RA1 A;  2D2S A;  5JDN A;  3CIR A;  3ZYK A;  1WR6 A;  4GKK T;  4GQM A;  3TFL A;  5FVK A;  3PJA A;  5JDM A;  1XDO A;  3ZHM A;  1O4X A;  5LBM A;  3OQO A;  4ZHQ E;  3P4W A;  2JVL A;  5EK4 A;  3EDV A;  2GZU A;  1MMN A;  2E9X D;  3Q9D A;  3NRY A;  2LKH A;  1OWA A;  1CHU A;  4CI3 B;  2Y6X A;  3I0Q A;  2JQ9 A;  1LQC A;  1XMQ T;  1E2A A;  1M7K A;  1ADR A;  2LE8 A;  2WY2 A;  3ZKC A;  4BJM A;  2XAF B;  3QB5 K;  2BS4 A;  5LCY A;  4WZX A;  4ADZ A;  4ERR A;  4H9R C;  5AQG B;  4G63 A;  3ZPX A;  4KBM B;  1H7C A;  3G06 A;  3FXE B;  2VVS A;  3PTR B;  3BQK A;  3H37 A;  2V7I A;  4NUU A;  1ZPQ A;  3JXB C;  2HIN A;  3ZSS A;  5L2L A;  3PUW F;  5HXH A;  2N9D A;  2PXU A;  1HX1 B;  5FVL A;  2PG8 A;  4WBN E;  3NRO A;  1MFQ C;  1W0A A;  3FXD B;  2UUC T;  4CZZ B;  2IML A;  1WH6 A;  1MMD A;  3QYX A;  3FYA A;  5TAO A;  3RIA A;  4WVL A;  2GRM A;  4Q2J A;  1RIO A;  4A98 A;  3UFG A;  2UXB T;  2VQF T;  4O2B E;  4DBQ A;  2LSG A;  4AIU A;  1QZX A;  2YU1 A;  2LRK A;  5BR8 T;  1BR4 A;  2BZB A;  3IEE A;  1M62 A;  2XQY A;  2E8I A;  3VRA A;  5FYM A;  3SR4 A;  4DR6 T;  3UUL A;  4LF7 T;  5FXW A;  1ZUG A;  3PUS A;  4ZI2 C;  4HWH A;  1OXZ A;  3CWZ B;  3I9W A;  2B1E A;  4CQI A;  3QOX A;  1OED A;  4EV6 A;  1WRD A;  4LF8 T;  4HE8 A;  2NTY A;  3R84 B;  3OP9 A;  4X5T A;  3ZJ2 A;  2WU5 A;  2V6X A;  5ABF B;  3RYF E;  1KF6 A;  1OCT C;  1ZKE A;  3MKD A;  4ER0 A;  4ZZC A;  3B5M A;  3HKC E;  3UU4 A;  3GWH A;  3S8Q A;  3FHN A;  1BR2 A;  2JRK A;  1LRZ A;  5A1L A;  5FXV A;  5DTQ A;  3ZEF B;  5JDG A;  2OR1 L;  3LDQ B;  3PU8 A;  4OYK A;  3DM5 A;  2FJE A;  3F57 A;  5HCM A;  1HS7 A;  3KBU A;  2YBD A;  3VU7 H;  1UCU A;  3ANW A;  2IU7 A;  3NXH A;  3RKO A;  2HCN A;  4IE7 A;  3ZYL A;  5FNV E;  3OKQ A;  3FMY A;  2XXP A;  5KX5 E;  5HWX A;  5LOV E;  1RPE L;  2M6B A;  3KV6 A;  5IYZ E;  4U74 A;  4YTN A;  3AVS A;  2VKJ A;  4DUZ T;  3UTK A;  2W67 A;  2XHE B;  1D0Z A;  3HI2 A;  4U72 A;  3AVR A;  3KJX A;  1HF0 A;  5JUW A;  3BD1 A;  4F8D A;  2BVL A;  2BBJ A;  4Z59 A;  4H9N C;  3AEA A;  3PU3 A;  4IE4 A;  2BNN A;  1Y7Y A;  1GQE A;  2E9X B;  3IBP A;  3UFD A;  2L49 A;  4TV9 E;  3RHW A;  4AQG A;  4IIJ E;  2IC9 A;  2R1J L;  5AQS B;  4OB4 A;  3CX6 B;  3J7Y q;  3AAA B;  1CJG A;  2XM2 A;  3PE0 A;  3A9Y A;  2LLY A;  4YHJ A;  2WUS R;  2MPK A;  1Y01 A;  2WAU A;  4YBA A;  3QB5 A;  4O2A E;  4CI2 B;  2CM0 A;  3CK6 A;  4XAX B;  3MEJ A;  3KDS E;  4DR4 T;  3P4R A;  2VKO A;  4PK6 A;  3UUM A;  1S7E A;  2M4H A;  1QP0 A;  3VR9 A;  4IL9 A;  4OFZ A;  1AU7 A;  2CCQ A;  3ETU A;  4X4B A;  2K5B B;  1J1J A;  4GKJ T;  3CPZ A;  3X1D A;  1U2Z A;  4PK4 A;  4O8B A;  3A7M A;  4YSZ A;  2BNM A;  3CKD A;  4H9P C;  2KSR A;  3K1S A;  3MA9 A;  2XXA A;  2IDO B;  3NBX X;  2AXV A;  5AQM B;  4JEH B;  1U5P A;  2IAK A;  3C4X A;  1I94 T;  1XNR T;  2DCF A;  4X66 T;  2L9Q A;  3UU3 A;  3C50 A;  2NP9 A;  1ZP0 A;  2B5A A;  1J5W A;  3N2K E;  3RF1 A;  1FMW A;  2OLT A;  5J0Z A;  3PUY F;  4JI8 T;  2H7V C;  2H88 A;  3SCH A;  2CBJ A;  4TN7 B;  5HWY A;  3ZMV B;  3CX8 B;  2JQE A;  3EUS A;  1BR1 A;  5KXJ A;  4MBQ A;  2FJA A;  3ME5 A;  3PUR A;  5AQJ B;  3C64 A;  2M6I A;  2GK9 A;  3ZST A;  2KEI A;  2NR4 A;  4EXT A;  1WFD A;  1WIZ A;  3QK6 A;  3MJX A;  4QXB B;  1S35 A;  3IHR A;  4YHH T;  3VKG A;  3F31 A;  2GRL A;  1JFT A;  4E7S A;  2LM9 A;  4IDN A;  3U3I A;  3GZD A;  4EB6 E;  3RYH E;  2JQH A;  4TWH A;  4ER5 A;  1PRA A;  1VOM A;  2HPL A;  2KXP B;  2ODU A;  4COF A;  5FL0 A;  3CVR A;  3GZD C;  3MLF A;  1D0X A;  5DQV A;  4NIQ A;  2HSG A;  2AW6 A;  1RZR A;  2CWO A;  2CEA A;  4ZS2 A;  2FFH A;  2PXB A;  2PPX A;  4Y42 A;  2Q9Q A;  2V7K A;  5LB7 B;  4QWN B;  3TLT A;  4UXN B;  3TKL B;  2DHR A;  3E0Z A;  1ZZ8 A;  4F6R C;  1ZOY A;  3ONX A;  2CRO A;  2PUB A;  2V5D A;  2WQY A;  2PXD A;  1HQ1 A;  3N9P A;  3SS1 A;  4DMV A;  4I6T A;  4DND A;  4ANJ A;  4B3R T;  5DQW A;  4U2Z A;  3AB3 B;  3C4W A;  5FP3 A;  1UUS A;  2KIN B;  2XAS B;  3OYX A;  2AXZ A;  4ZI3 C;  5LNK A;  2PUA A;  3JAE A;  2PUD A;  1J5E T;  2NWB A;  1T8B A;  1B0N A;  5K98 B;  5CA0 E;  1N33 T;  1ZZB A;  5E0O A;  3P50 A;  5LYJ E;  4L0R A;  1XWR A;  4PFO A;  1LVK A;  2C5K T;  4X4D A;  4LMK A;  5AFU L;  3RH3 A;  1XNQ T;  4ILB A;  4YFS A;  3SOL A;  4OX9 T;  2PXE A;  3FZK B;  3QOF A;  4H63 V;  3HZI B;  4J2C A;  4DID B;  3LFP A;  2HH7 A;  2AXU A;  3CRO L;  5HAX A;  1QUU A;  1YXR A;  2D0T A;  5LXT E;  1X9B A;  3UQ7 A;  2WU2 A;  3ZYM A;  4CN1 A;  3A9Z A;  1YQ4 A;  1IC8 A;  4QX8 B;  4P1N A;  3UU5 A;  5AQN B;  1JNR A;  2ACX A;  4PU8 A;  1BR0 A;  3EAM A;  2FJD A;  2L8K A;  2IC6 A;  5GON E;  5DJQ C;  4O4I E;  5AQK B;  2LJL A;  4JYA T;  2IUO A;  3TEL A;  5C3J A;  2PXP A;  4EZ4 A;  1X57 A;  5CB4 E;  4KHP T;  1MMG A;  3N9O A;  1KNP A;  5H6Q B;  2ZM6 T;  3RPU A;  3QQ6 A;  2AXD S;  1T7S A;  3Q5E A;  4XZC A;  4YT0 A;  1HR0 T;  2BDE A;  2JMK A;  4AIS A;  2LLW A;  5JDH A;  1NEQ A;  4NUV A;  3M65 A;  4AXP A;  4GIW A;  3KL4 A;  1MMA A;  4B3T T;  2WZI A;  2BKN A;  2PBI A;  2WP9 A;  2A2F X;  4X4H A;  2LSK A;  4DV6 T;  4G2A A;  5C2T A;  4ILU A;  4EKG A;  2PTF A;  3IVP A;  4DV2 T;  2W62 A;  2VUR A;  4JQD A;  3B13 A;  3JAD A;  1W0B A;  4UIG A;  4IST A;  5ABH A;  2X9X A;  2O4A A;  2DI4 A;  3QFI A;  4UR9 A;  2X0Y A;  5AQU B;  1WR0 A;  5FMN A;  4QH4 A;  3VK0 A;  1B7T A;  3V5U A;  3KIN B;  3N9Q A;  4CN6 A;  1IZN B;  1NW3 A;  3I0O A;  3A5X A;  2CXF A;  3PUQ A;  1L1M A;  1ZZ9 A;  2J4G A;  4PU4 C;  4K0U A;  2CMR A;  1E1H B;  3RQU A;  3LBX B;  3O1H A;  5J2T E;  3KV5 A;  2NW8 A;  4MCT A;  2XAQ B;  2PXK A;  1NER A;  2H3R A;  5L3F B;  1FEW A;  4HFV A;  2H89 A;  1XWM A;  2IHR 1;  3EI0 A;  1MIY A;  1JFS A;  3T1Y T;  2J62 A;  5EZY E;  3GA8 A;  2PIJ A;  2XAH B;  2CLY C;  5AQT B;  3AXJ B;  1IBM T;  1UX4 A;  2PXQ A;  3O1J A;  1KNR A;  3A9X A;  2V5C A;  3PE5 A;  3MZK B;  4AKI A;  3E22 E;  5LHG B;  2CWY A;  3HKE E;  1PNR A;  2BBH A;  2LYL A;  5ABF A;  4DV7 T;  3I1A A;  2BJC A;  2X51 A;  3C4Z A;  4TX5 A;  3OWQ A;  4FBI A;  4JI1 T;  2IW5 B;  4GYS A;  4YTM A;  1ZV4 X;  4O8S A;  3FB2 A;  4UV8 B;  5L3C B;  5DSX A;  3RIF A;  3D0T A;  5EK2 A;  3F52 A;  5FXX A;  3ZC0 A;  2QYW A;  5L4E A;  3B57 A;  3OQN A;  5LGN B;  3ZCI A;  2LOS A;  4TNV A;  2EHO B;  4IDZ A;  3RC8 A;  3L8R A;  1VRB A;  4HWF A;  3K3Q C;  4CN4 A;  2XIU A;  3AA7 B;  4TWD A;  2XM1 A;  1HG5 A;  3F2E A;  3SFD A;  4JI2 T;  2X68 A;  2ZM8 A;  1JH9 A;  1Z0P A;  1YKH B;  2VKD A;  3AA6 B;  4ZOL E;  2MOZ A;  2YKS A;  3HA4 A;  4Z5C A;  5JTG A;  2ACZ A;  2CLY B;  3HR0 A;  3LSV A;  3E08 A;  3AE5 A;  4Z90 A;  4YY3 T;  1SA0 E;  4JI0 T;  2R63 A;  1LVF A;  2X0H A;  2LYQ A;  3DTO A;  4ILA A;  2UXD T;  4Z91 A;  5JVD E;  4MCX A;  4CXW A;  3R09 A;  3P4P A;  2WB5 A;  5GAG i;  3B7H A;  3EDU A;  5LHI B;  5IHY A;  3JC6 C;  3LK2 B;  5LJN A;  1POU A;  4QH1 A;  3MK7 C;  2E9X C;  1V9D A;  2LSI A;  4B6X A;  1ZHC A;  5L3G B;  3PXP A;  5J1G A;  3ZT7 A;  2ZM0 A;  4L9I A;  2BKO A;  2A72 A;  5HEO A;  3AEE A;  4QXH B;  3F51 A;  4GYR A;  2V6Y B;  4X62 T;  3AE3 A;  4JUY A;  5J2U E;  2KPJ A;  1D0Y A;  2N1G A;  3OVU A;  1WH8 A;  3A8Y C;  2ZM2 A;  2X0L B;  2XQ3 A;  2PXL A;  2NTX A;  3RKG A;  4Z8X A;  4IL4 A;  2CA5 A;  2L1P A;  1ZAY A;  4FI5 A;  1WYC A;  2D9D A;  3AEF A;  1FIO A;  3AEG A;  2OV9 A;  4U7I A;  1W09 A;  3NZP A;  4UVB B;  4X1I E;  2FBW A;  1UK5 A;  1QLB A;  3F6W A;  2P9B A;  3FBZ A;  4A56 A;  1DWK A;  4LFA T;  3PUZ F;  4I43 B;  5C8Y E;  1VCT A;  3BQI A;  3LK3 B;  5LP6 E;  5EK3 A;  4V1A v;  4EEB A;  5FY1 A;  2W66 A;  5M4Y A;  4O4H E;  4A5X A;  2WSS V;  1HTJ F;  2B76 A;  3ESL A;  2YU2 A;  4BA9 A;  2IVQ A;  5DT2 A;  3FBL A;  2XXQ A;  3OPC A;  3QC9 A;  5L3E B;  1OSL A;  3RLF F;  4XBF B;  3R6N A;  3ZPO A;  5DRT A;  2HCS A;  4DE8 A;  3Q5D A;  1JNZ A;  2VAS A;  5CGM A;  1XMO T;  2L8N A;  1RZR D;  4LMJ A;  1LKX A;  2XQ7 A;  3CQX C;  3KVA A;  2W4X A;  2X9W A;  2HN2 A;  2Q9Q D;  4AKH A;  2J7W A;  2LRL A;  3NWI A;  1KNZ A;  2KZ7 B;  4KI0 F;  3QUJ A;  1UX5 A;  3G0T A;  3FZM B;  3RIU C;  3ANW B;  3QNU A;  3UQ4 A;  3PUV F;  4DV5 T;  1WCR A;  3LG7 A;  3DJB A;  4AQF A;  5JRC A;  2BS3 A;  4LF5 T;  1ZS4 A;  4WW0 A;  3ZT5 A;  4DV4 T;  3R1F A;  4IA8 A;  1KEY A;  4TUY E;  4AQF C;  2N2N A;  3VRB A;  5CJ5 A;  2CE7 A;  3GBF A;  3PDY A;  4I6R A;  2XAJ B;  5LG3 A;  4NDW A;  1YSE A;  4I0U A;  1QSD A;  3BK9 A;  2LYJ A;  2O38 A;  2NW9 A;  1BDH A;  5AQO B;  3ZN0 B;  4ZI7 E;  4GK5 E;  2XUE A;  2DLR A;  4UVC B;  4DVD A;  4JI4 T;  2YEV C;  3BQL A;  4PJM A;  1NWM X;  3D1N I;  2LHR A;  5LMU T;  2E5L T;  4GOU A;  2A6C A;  3TLW A;  3IA3 A;  2QGS A;  4IDO A;  4X20 E;  1HNZ T;  1QP7 A;  3C51 A;  3H3A A;  3M3Z B;  4PJN A;  5AQF B;  4PW8 A;  2MQK A;  1JWL A;  4YJ2 E;  1DU2 A;  4MFR A;  3UUB A;  2FJB A;  3UU6 A;  2XPK A;  1SQ8 A;  3UFE A;  4OK0 A;  3L1P A;  4Z5H A;  3HKB E;  1NEN A;  2K9A A;  2LCV A;  4H9Q C;  2EF8 A;  1Y9Q A;  3AA0 B;  2D5U A;  4P0B A;  1UUR A;  4IWR A;  3ABV A;  4HEA A;  4P0A A;  5JRE A;  3U78 A;  2IVG A;  3NDB B;  4PNI A;  4IDQ A;  5IUX A;  2MTQ A;  3BDN A;  2AE9 A;  5JDL A;  3RGL A;  1IBK T;  4HFC A;  2I59 A;  2C5I T;  2QVA A;  4IT4 A;  4J1X A;  4X1Y E;  1R63 A;  2UUA T;  4HWD A;  2ODR D;  3KXA A;  1MNE A;  2UXC T;  5H6R B;  3AE8 A;  2WM9 A;  3RC3 A;  4JBW F;  3OKZ A;  5LGU B;  2XQ4 A;  5FY7 A;  4NPP A;  3ZJ1 A;  1RZS A;  4X4C A;  5HXC A;  3ZT6 A;  1FJG T;  5L3B B;  4LML A;  3WI3 A;  2K24 A;  1EFA A;  2JQK A;  4PAG A;  4UF0 B;  4U2Y A;  1IBL T;  2K3W A;  4YXD A;  2Y8D A;  4YTP A;  4YG7 B;  1S94 A;  4NXN T;  4JI3 T;  4OYJ A;  2IUB A;  2YDS A;  1VCS A;  3SFE A;  2XQ9 A;  4JLE A;  4IRE A;  3ZCJ A;  5JDQ A;  4Z5D A;  2BG9 C;  5L3D B;  3I9Y A;  4TV8 E;  4EOZ B;  2CPT A;  1YQ3 A;  2LYP A;  3ZKR A;  3EHZ A;  2V1D B;  3T1H T;  3L39 A;  1T72 A;  4DBR A;  3VHL A;  4DR7 T;  3BS3 A;  3AE7 A;  4EYY R;  2LSJ A;  2CRB A;  3JCF A;  2O49 A;  2WCA A;  4HFE A;  5HCJ A;  3FZF B;  4UEM A;  3RRC A;  2VQE T;  1WET A;  4B3S T;  3QF3 A;  1ZZ6 A;  1XDP A;  1UXC A;  4AKG A;  3NZQ A;  3EUH A;  1IAP A;  5AQL B;  2LYS A;  4JV5 T;  3CLC A;  4EAH A;  5HXR A;  1E3O C;  4U3C A;  3AXJ A;  2HN1 A;  4Z58 A;  3O4X E;  4YG4 A;  5DTM A;  4U31 A;  4NXM T;  2YIN A;  5JR9 B;  3AAE B;  3LQX A;  3VKH A;  3P4Q A;  4PFP A;  2PFV A;  2WWU A;  2BG9 B;  2BVM A;  1MIV A;  4CXY A;  2X9H A;  2W61 A;  3KV9 A;  3RI5 A;  3CQG B;  4ILC A;  4QX7 B;  3ETV A;  3G5G A;  3H3M A;  2C5J A;  3SX0 A;  3TEP A;  3ZHI A;  1PRU A;  2CSF A;  2JIW A;  2EHO A;  4YAR A;  5CFB A;  2NW7 A;  2FJR A;  4I50 E;  3UWP A;  2KWH A;  3N2O A;  3MAC A;  4KP3 C;  3FZH B;  2XQ8 A;  2EHO C;  2RP4 A;  2E5V A;  4I4T E;  3UU8 A;  2UXX B;  4ZI2 D;  4IE6 A;  4LF9 T;  5L47 A;  5F8P A;  3ZMS B;  3K8P C;  4UVA B;  3TLS A;  2WMO A;  3AA1 B;  3N5L A;  3AEC A;  5HEU A;  4AQY T;  3JC6 D;  4EYU A;  4J1W A;  2YDQ A;  2V7J A;  4KX6 A;  1QQB A;  2WDV A;  4X1K E;  3HKD E;  4JCY A;  4TNW A;  5GAH i;  4N78 D;  3P8C D;  3TLU A;  2MAW A;  5LBQ B;  5HYA A;  4DV0 T;  4ER7 A;  2KMF A;  2W2U A;  4X64 T;  1SUM B;  2YOE A;  3VWS A;  4EED A;  1DW9 A;  3GN5 B;  3W15 B;  3CML A;  3M9L A;  4ISS A;  2G0U A;  3L09 A;  5HEG A;  4K0K T;  1UXD A;  2PXF A;  2XQ6 A;  4QKN A;  4DR1 T;  2XY8 B;  2XJ3 A;  2PUG A;  3RYC E;  5LG4 A;  1WYB A;  4TWF A;  3PJA J;  4O4L E;  3AE9 A;  4FN3 A;  3QOW A;  2V6Y A;  5HXE A;  2BNO A;  2JQQ A;  3SWH A;  2V8S V;  4EIW A;  4PJJ A;  2VKH A;  4ZS3 A;  1KFY A;  3LFM A;  4FJO A;  5AQR B;  3OMT A;  3EVY A;  2LOP A;  3JAF A;  4JI7 T;  4EKI A;  2UU9 T;  2ES0 A;  3HL6 A;  3O1I A;  1OED E;  2CBI A;  2LKG A;  1XZY A;  2RPA A;  4EQZ A;  3RYI E;  2DNX A;  4X4G A;  4WNK A;  5A7L A;  4AKR B;  4E7Z A;  4X4I A;  2IV1 A;  2WBL A;  3K3O A;  1YD8 G;  1HNW T;  4HWC A;  1HX8 A;  3AAI A;  3NZL A;  5LA6 E;  5F5W A;  3ZMU B;  4A97 A;  4WBO A;  1SHZ C;  4HFH A;  1U4Q A;  2E9X A;  4DUY T;  4ZZB A;  4I8T A;  4KHZ F;  2PE5 A;  4JI6 T;  1HG2 A;  1X79 A;  2YN6 A;  1MND A;  2XJ7 A;  4YJ3 E;  1CQT A;  1FMV A;  5ADX L;  4HFB A;  4DR5 T;  3SRZ A;  2WZH A;  1NAF A;  2MEZ A;  1QPZ A;  3KFW X;  3AED A;  2WIU B;  5FY0 A;  2ZMA A;  3AEB A;  1OED C;  4DV3 T;  5AQI B;  3RQW A;  3Q5X A;  3FYM A;  1GT0 C;  2J1D G;  2W00 A;  4MHC A;  4DV1 T;  3J9X 1;  4DO0 A;  4HRA A;  2NOX A;  2LLV A;  3PUX F;  2XZE A;  2XAG B;  2Z6E A;  2W63 A; 
#chains in the Genus database with same CATH homology
 4BAY B;  1IC8 A;  4ZI7 E;  1CUN A;  4GK5 E;  4QX8 B;  1ZZ7 A;  3P7I A;  1PRV A;  2XUE A;  2DLR A;  2OA5 A;  1ADR A;  4UVC B;  2LE8 A;  3ZKC A;  4BJM A;  2XAF B;  2ACX A;  1ZEE A;  2W0G A;  4PU8 A;  1BR0 A;  1D1C A;  4DVD A;  3S4U A;  2L8K A;  2YEV C;  5LCY A;  4ADZ A;  2H8R A;  3BQL A;  2IC6 A;  4ERR A;  4H9R C;  4PJM A;  5GON E;  1NWM X;  5DJQ C;  4O4I E;  3D1N I;  4G63 A;  2LHR A;  2LJL A;  4IGU A;  3CQC B;  3G7D A;  2HPJ A;  2X9Y A;  4GOU A;  2IUO A;  2LT3 A;  2A6C A;  2JPF A;  4EZ4 A;  2QGS A;  2X67 A;  4KBM B;  4GK0 E;  1X57 A;  4X20 E;  5CB4 E;  1QP7 A;  2VB6 A;  1H7C A;  1MMG A;  3N9O A;  3C51 A;  3FXE B;  2Y48 B;  3H3A A;  5H6Q B;  4HKA A;  3RPU A;  4PJN A;  3QQ6 A;  3PTR B;  2YK0 A;  4PW8 A;  3RRW A;  3CX7 B;  2MQK A;  3BQK A;  1JWL A;  2V7I A;  3H37 A;  4NUU A;  3WAJ A;  1ZPQ A;  3JXB C;  1LCD A;  4YJ2 E;  4XZC A;  2HIN A;  4MFR A;  5L2L A;  5HXH A;  3O9X A;  2N9D A;  2VK9 A;  3Q5W A;  2BDE A;  4MAL A;  2JMK A;  2PG8 A;  2V7M A;  2EWT A;  4FI5 A;  4WBN E;  3T8O A;  1SQ8 A;  4JCX A;  2VWA A;  1NEQ A;  1QP4 A;  2C0S A;  4OK0 A;  4NUV A;  3UFE A;  3FXD B;  5JDH A;  3M65 A;  3L1P A;  4GIW A;  3NRX A;  4AXP A;  4CZZ B;  4Z5H A;  1ZZC A;  2K9A A;  1WH6 A;  3HKB E;  2LCV A;  1MMD A;  3QYX A;  2D5V A;  4H9Q C;  2EF8 A;  1Y9Q A;  1MMA A;  3AA0 B;  3FYA A;  1EZ3 A;  3DNV B;  1YKE B;  2D5U A;  4L5G A;  3CEC A;  4P0B A;  5TAO A;  2GRM A;  2PBI A;  2PUC A;  2A2F X;  4X4H A;  4IWR A;  4HEA A;  4P0A A;  2LSK A;  5JRE A;  3U78 A;  2IVG A;  4G2A A;  4PNI A;  3ZN1 B;  1RIO A;  2AWI A;  3PUG A;  2CXL A;  4ILU A;  2MTQ A;  3BDN A;  4O2B E;  4DBQ A;  5JDL A;  2LSG A;  3IVP A;  2YU1 A;  2W62 A;  4BJN A;  3Q2M A;  4JQD A;  2I59 A;  3B13 A;  2C5I T;  3ZMZ B;  3KZ3 A;  1BR4 A;  4J1X A;  2BZB A;  5KMG P;  3N2G E;  3IEE A;  4X1Y E;  4UEL A;  4UIG A;  1R63 A;  4IST A;  2XQY A;  2E8I A;  2X9X A;  2O4A A;  5FYM A;  3LJC A;  2DI4 A;  3UUL A;  3KXA A;  1MNE A;  5FXW A;  5H6R B;  2LYK A;  2WM9 A;  2D0U A;  4HGA A;  3N9N A;  1ZUG A;  3RC3 A;  5LGU B;  2V26 A;  1Y64 B;  3PUS A;  2ICP A;  5FY7 A;  2H7O A;  5FMN A;  1O3X A;  3ZJ1 A;  4ZI2 C;  5KDM C;  3VK0 A;  1OXZ A;  1B7T A;  3CWZ B;  3V5U A;  3I9W A;  3KIN B;  2B1E A;  3N9Q A;  4CQI A;  1RZS A;  4X4C A;  4ZI3 D;  1IZN B;  1WRD A;  4O4J E;  3UT5 E;  4HE8 A;  2V7L A;  5HXC A;  2NTY A;  3I0O A;  3OP9 A;  1LCC A;  3DP7 A;  1T98 A;  3R84 B;  2L3L A;  3A5X A;  4IVZ A;  3ZJ2 A;  4M1P A;  3H5T A;  2JMH A;  3KV4 A;  2M67 A;  5L3B B;  2CXF A;  3PUQ A;  3RYF E;  2K24 A;  3WI3 A;  1OCT C;  1ZKE A;  3MKD A;  1L1M A;  1ZZ9 A;  1EFA A;  3HKC E;  4PAG A;  4PU3 C;  4UF0 B;  3GWH A;  4MLK A;  4PU4 C;  3S8Q A;  1BR2 A;  3FHN A;  2CMR A;  4K0U A;  1E1H B;  2JRK A;  1YW0 A;  3LBX B;  3U3W A;  3O1H A;  1LRZ A;  3KV5 A;  4IE5 A;  5FXV A;  5A1L A;  5J2T E;  3ZEF B;  2UXN B;  2NW8 A;  4MCT A;  5JDG A;  2XAQ B;  2Y8D A;  1IJ5 A;  4YG7 B;  2OR1 L;  1NER A;  1S94 A;  3PU8 A;  2H3R A;  4OYK A;  3LIS A;  1D1A A;  3F57 A;  4PK5 A;  5L3F B;  4OYJ A;  1FEW A;  4HFV A;  4YLH A;  3ZLI A;  4AKL A;  4UV9 B;  1HS7 A;  3KBU A;  4KP3 C;  4CXX A;  2KT9 A;  1MIY A;  3VU7 H;  1JFS A;  1UCU A;  3ANW A;  2IU7 A;  5EZY E;  3WAK A;  4JLE A;  4EZH A;  3K3N A;  3GA8 A;  2PIJ A;  3RKO A;  3ZCJ A;  2MBG A;  5JDQ A;  4Z5D A;  2XAH B;  4GHJ A;  2CLY C;  4IE7 A;  3ZYL A;  5L3D B;  3I9Y A;  4TV8 E;  5FNV E;  4EOZ B;  1UX4 A;  3OKQ A;  3FMY A;  3ZMT B;  4H9S E;  5JH7 E;  3C98 B;  3O1J A;  5KX5 E;  2LYP A;  5HWX A;  4AKI A;  3MZK B;  5LOV E;  3E22 E;  5LHG B;  1QQA A;  4YG1 A;  1RPE L;  2CWY A;  2V1D B;  3HKE E;  3KV6 A;  5IYZ E;  1PNR A;  4U74 A;  2CXD A;  4H9O C;  3AVS A;  2LYL A;  2VKJ A;  4QHO A;  3RX6 A;  3UTK A;  2XHE B;  1D0Z A;  4I55 E;  3HI2 A;  4DBR A;  3VHL A;  4U72 A;  3I1A A;  2BJC A;  3BS3 A;  1PER L;  2X51 A;  3AVR A;  3C4Z A;  4TX5 A;  4EYY R;  4FBI A;  3KJX A;  1HF0 A;  4UF0 A;  2LSJ A;  1IJ6 A;  4P09 A;  2IW5 B;  2KLQ A;  5LHH B;  4GYS A;  3BD1 A;  2O49 A;  1ZV4 X;  4F8D A;  2BVL A;  3FB2 A;  2LYR A;  4O8S A;  4UV8 B;  5L3C B;  3V5S A;  4Z59 A;  3D0T A;  4H9N C;  5EK2 A;  3PU3 A;  3F52 A;  2QA7 A;  4IE4 A;  2BNN A;  4TZ4 C;  1Y7Y A;  4UEM A;  5FXX A;  3ZC0 A;  3RRC A;  3B57 A;  1WET A;  2E9X B;  3OQN A;  3IBP A;  3QF3 A;  5LGN B;  1ZZ6 A;  3SCG A;  3ZCI A;  2LOS A;  2EHO B;  4IDZ A;  4HN9 A;  3UFD A;  3RC8 A;  2L49 A;  4TV9 E;  1VRB A;  4AQG A;  4IIJ E;  2IC9 A;  3K3Q C;  2R1J L;  1UXC A;  4OB4 A;  4X4E A;  3CX6 B;  3J7Y q;  4AKG A;  3AAA B;  2XIU A;  3AA7 B;  3NZQ A;  3EUH A;  1IAP A;  1CJG A;  2LYS A;  3PE0 A;  1HG5 A;  3F2E A;  5F3J A;  3CLC A;  4IE0 A;  3L3P A;  4YHJ A;  2WUS R;  2X68 A;  4EAH A;  2ZM8 A;  5HXR A;  4KUM B;  4IHJ E;  1JH9 A;  2WAU A;  4YBA A;  4PU7 A;  4X4F A;  4O2A E;  1Z0P A;  1YKH B;  2VKD A;  2Q9Q C;  3AA6 B;  4PJL A;  4KMC A;  4ZOL E;  3ZMV B;  1E3O C;  5JRC B;  4Z58 A;  2MOZ A;  4YG4 A;  2CM0 A;  3HA4 A;  3O4X E;  5JQG E;  5DAB A;  2YIN A;  4XAX B;  5JR9 B;  3AAE B;  3KDS E;  4Z5C A;  3QWG A;  3VKH A;  4PFP A;  4I6U A;  2VKO A;  2PFV A;  5HXS A;  2WWU A;  2CLY B;  2BVM A;  3HR0 A;  1MIV A;  2KZ8 A;  3GMI A;  4PK6 A;  3UUM A;  4CXY A;  1S7E A;  3E08 A;  2DWK A;  3KVB A;  2X9H A;  1QP0 A;  1SA0 E;  2W61 A;  4OFZ A;  1AU7 A;  2R63 A;  1LVF A;  2CCQ A;  2JJ9 A;  3CQG B;  4X4B A;  3ETU A;  3KV9 A;  2LYQ A;  2K5B B;  1US7 B;  3DTO A;  3G5G A;  3ETV A;  3MXZ A;  4QX7 B;  3CPZ A;  5JVD E;  1ZVV A;  1HF8 A;  2C5J A;  4MCX A;  2LSY A;  4CXW A;  4C90 A;  4PK4 A;  3ZHI A;  1PRU A;  3IF8 B;  2CSF A;  3B7H A;  2EHO A;  4YAR A;  3EDU A;  5LHI B;  4O8B A;  5IHY A;  3JC6 C;  3LK2 B;  5LJN A;  1POU A;  2BNM A;  3CKD A;  4H9P C;  4C91 A;  2NW7 A;  1LLI A;  3MK7 C;  2FJR A;  2E9X C;  1V9D A;  2LSI A;  2KWH A;  4I50 E;  2SPC A;  3N2O A;  4B6X A;  3MAC A;  1ZHC A;  3MA9 A;  3JXD L;  2EHO C;  2RP4 A;  3PXP A;  3NBX X;  2AXV A;  3RZZ A;  3KBT A;  5J1G A;  5CA1 E;  5L3G B;  3SCF A;  4I4T E;  4QXC B;  5ETW A;  2UXX B;  2ZM0 A;  4ZI2 D;  4JEH B;  1U5P A;  4IE6 A;  2IAK A;  2KWI B;  3C4X A;  4L9I A;  2DCF A;  5F8P A;  3ZMS B;  3K8P C;  2L9Q A;  2A72 A;  4UVA B;  3C50 A;  2NP9 A;  4QXH B;  3F51 A;  1G73 A;  5JR9 A;  2PUE A;  4GYR A;  2B5A A;  3N2K E;  2WMO A;  3AA1 B;  1FMW A;  3N5L A;  4JUY A;  3JC6 D;  5J2U E;  2OFY A;  3PUA A;  4EYU A;  4J1W A;  3OBV E;  2H7V C;  2KPJ A;  2Q9Q B;  2V7J A;  1QQB A;  2ICT A;  1D0Y A;  4X1K E;  3HKD E;  4JCY A;  2N1G A;  5BMV E;  3JXC L;  5JR9 C;  4N78 D;  3P8C D;  3SCH A;  1G8X A;  4TN7 B;  1WH8 A;  2EHO D;  2KND A;  2VL8 A;  3CX8 B;  5HWY A;  5LBQ B;  3EUS A;  5HYA A;  2ZM2 A;  1BR1 A;  2X0L B;  4OHF A;  4HTE A;  4MBQ A;  2KMF A;  3PUR A;  2AUW A;  3C64 A;  2NTX A;  2GK9 A;  2DWG A;  3UUN A;  2PUF A;  2KEI A;  1DW9 A;  1KK7 A;  3GN5 B;  3W15 B;  3TRB A;  3CML A;  4Z8X A;  2A3D A;  4EXT A;  1WIZ A;  2CA5 A;  3OYZ A;  4ISS A;  5FXZ A;  3QK6 A;  1ZAY A;  1WYC A;  1S35 A;  3IHR A;  2ODV A;  2EBY A;  2G0U A;  2LHN A;  3MJX A;  3L09 A;  3F31 A;  4QXB B;  3VKG A;  2GRL A;  1UXD A;  1FIO A;  1JFT A;  3NZP A;  4E7S A;  2LM9 A;  4UVB B;  2KEJ A;  4DMW A;  4X1I E;  3N9M A;  3U3I A;  3F6W A;  4EB6 E;  3RYH E;  4QKN A;  3LBX A;  1PRA A;  2P9B A;  3FBZ A;  4A56 A;  1VOM A;  1DWK A;  2HPL A;  4I43 B;  2XJ3 A;  2PUG A;  2KXP B;  2ODU A;  3RYC E;  5C8Y E;  1R69 A;  3BQI A;  3LK3 B;  5LG4 A;  1WYB A;  2PJQ A;  3CVR A;  5LP6 E;  4O4L E;  5EK3 A;  3MLF A;  1D0X A;  4V1A v;  4FN3 A;  5HXE A;  5DQV A;  2BNO A;  2HSG A;  2AW6 A;  1RZR A;  2MYS A;  2X66 A;  2JQQ A;  5FY1 A;  3SWH A;  2WMN A;  2JCG A;  2XSD C;  3ZC1 A;  2CWO A;  2CEA A;  1X2L A;  4EIW A;  4PJJ A;  4ZS2 A;  2VKH A;  2PPX A;  4Y42 A;  2Q9Q A;  2V7K A;  1VPW A;  2XTL A;  4ZS3 A;  5M4Y A;  4O4H E;  2K48 A;  3LK4 2;  4FJO A;  3LFM A;  2WSS V;  4QWN B;  3OMT A;  3EVY A;  1HTJ F;  3N9L A;  4H63 H;  2LOP A;  2ZLY A;  5JDF A;  4UXN B;  3ESL A;  3OJA A;  3TKL B;  2YU2 A;  3OQM A;  2DHR A;  2IVQ A;  3E0Z A;  3FBL A;  2KEK A;  4BA9 A;  1ZZ8 A;  4AI6 A;  2ES0 A;  4F6R C;  3HL6 A;  3ONX A;  2CRO A;  2PUB A;  3O1I A;  3QC9 A;  1UTX A;  1LMB 3;  5L3E B;  1OSL A;  4JEU B;  4XBF B;  2XCJ A;  3R6N A;  3GN5 A;  2DNX A;  3RYI E;  3ZPO A;  4X4G A;  3N9P A;  2LEH A;  4WNK A;  5A7L A;  4AKR B;  4E7Z A;  1AJ3 A;  4X4I A;  3SS1 A;  4DMV A;  4I6T A;  4DND A;  2IV1 A;  4ANJ A;  2WBL A;  3K3O A;  3UUX B;  1YD8 G;  5DQW A;  2VAS A;  3AB3 B;  1HX8 A;  3AAI A;  3C4W A;  5FP3 A;  2L8N A;  1RZR D;  5LA6 E;  2KIN B;  4ASK A;  1LKX A;  2XAS B;  3OYX A;  2AXZ A;  4ZI3 C;  5LNK A;  2XI8 A;  2PUA A;  3CQX C;  3KVA A;  2X9W A;  3ZMU B;  2Q9Q D;  2PUD A;  1WLX A;  4WBO A;  1HFA A;  2NWB A;  1B0N A;  5K98 B;  1SHZ C;  5CA0 E;  4CI1 B;  4AKH A;  2IVB A;  1U4Q A;  2E9X A;  4I8T A;  1ZZB A;  5E0O A;  5LGT B;  1KNZ A;  5LYJ E;  4L0R A;  1XWR A;  4PFO A;  1LVK A;  2KZ7 B;  2PE5 A;  3QUJ A;  2C5K T;  5LJM A;  1HCI A;  1UX5 A;  4X4D A;  1D1B A;  1BDI A;  1HG2 A;  1MIW A;  3ANW B;  1X79 A;  1MND A;  2RA1 A;  2D2S A;  5JDN A;  5AFU L;  3RH3 A;  4YJ3 E;  1WR6 A;  3ZYK A;  3LG7 A;  3DJB A;  4AQF A;  1CQT A;  4YFS A;  4GQM A;  3SOL A;  5JRC A;  1ZS4 A;  1FMV A;  5ADX L;  4WW0 A;  3SRZ A;  5JDM A;  1NAF A;  3R1F A;  2MEZ A;  1QPZ A;  4IA8 A;  3ZHM A;  3KFW X;  2WIU B;  1O4X A;  4H63 V;  5LBM A;  4TUY E;  4AQF C;  5FY0 A;  3HZI B;  3OQO A;  2N2N A;  2ZMA A;  4J2C A;  4ZHQ E;  2CE7 A;  4CI2 B;  3GBF A;  3LFP A;  3PDY A;  3Q5X A;  3FYM A;  2HH7 A;  4I6R A;  2JVL A;  1GT0 C;  2XAJ B;  5EK4 A;  2AXU A;  3CRO L;  2J1D G;  3EDV A;  5HAX A;  2GZU A;  4NDW A;  1MMN A;  1QUU A;  2E9X D;  2W00 A;  4MHC A;  2D0T A;  5LXT E;  3J9X 1;  3Q9D A;  3NRY A;  4DO0 A;  1YSE A;  1QSD A;  1OWA A;  2NOX A;  3ZYM A;  3BK9 A;  4CI3 B;  2XAG B;  2Y6X A;  3I0Q A;  2LYJ A;  2O38 A;  2NW9 A;  2Z6E A;  1BDH A;  1LQC A;  3ZN0 B;  2W63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...