3GN5B

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
130
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
total genus 38
structure length 130
sequence length 131
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5B02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5B01
3G7DA 2CSFA 4I6UA 1WETA 3H5TA 4JQDA 2R63A 3JXDL 1Y7YA 2BNMA 3KXAA 4YARA 2L49A 1AU7A 4GQMA 4X4BA 1CQTA 2LCVA 2LYQA 3OQNA 1RPEL 3UFDA 1NERA 4Z5CA 4X4EA 2L8NA 2KEIA 3F6WA 1VPWA 3TRBA 3F51A 4X4HA 1XWRA 1EFAA 1QPZA 3S8QA 2BNOA 3GN5B 4X4IA 2EBYA 3QQ6A 1RZSA 3RZZA 4Z5DA 4I6RA 3LISA 3D1NI 1ZAYA 3B7HA 2XJ3A 2PUDA 1PRUA 3QWGA 4J1XA 4YG4A 3MLFA 1ZPQA 2JVLA 1L1MA 2CROA 4X4FA 3OQOA 4OB4A 3CROL 3ZKCA 3G5GA 2GRLA 2PUEA 1IC8A 4PU7A 1B0NA 1DW9A 2WUSR 4NDWA 1LMB3 4I6TA 4JCYA 2O4AA 1BDHA 2PUCA 1YSEA 2AXZA 2AXVA 2D5VA 3VK0A 1GT0C 1Y9QA 4YBAA 2IVQA 1JWLA 2PUGA 1RZRA 4I8TA 1PRAA 1UTXA 1UXCA 2IU7A 3SCGA 2LYKA 3GN5A 3L1PA 4Y42A 3O9XA 1S7EA 1ZS4A 4JCXA 1ZZ7A 2FJRA 1QP0A 1ZZCA 1PERL 2AXUA 3OP9A 4PU8A 3LFPA 4O8BA 1WH6A 1LCCA 3GA8A 1NEQA 1POUA 1QP7A 2LYJA 2AUWA 1O4XA 3ZHMA 1PRVA 3F52A 1R69A 2ICTA 1DWKA 3FYAA 4Z59A 1JFSA 4PU3C 1SQ8A 1RIOA 2PUFA 1ADRA 1ZUGA 2XIUA 1OCTC 2O49A 2AWIA 2O38A 4F8DA 4YG7B 3SCHA 1HF0A 2LYLA 2PE5A 3EUSA 1UXDA 2WIUB 1ZZ9A 2JCGA 3R1FA 3QF3A 2GRMA 4FN3A 4MCTA 4IVZA 4X4DA 2OR1L 3JXBC 2H8RA 2KZ8A 1LLIA 3HI2A 4FBIA 4YG1A 4X4GA 4GHJA 2PUBA 2B5AA 3CLCA 2R1JL 3JXCL 1QQAA 3KJXA 3KZ3A 3OMTA 4X4CA 3CECA 1RZRD 1PNRA 2IVGA 3QYXA 4J1WA 1E3OC 1WH8A 2MQKA 3OQMA 1OSLA 5K98B 3SCFA 1QQBA 1X57A 3ZHIA 1ZZ6A 3DNVB 1ZZBA 3BS3A 3GBFA 1ZZ8A 1JH9A 4Z5HA 4IWRA 3FMYA 3BDNA 3FYMA 2LYRA 3PXPA 3U3WA 1BDIA 2LYSA 2KEKA 2MEZA 2BJCA 2LYPA 1LQCA 4Z58A 2KPJA 2ICPA 2KEJA 2EF8A 2HSGA 2GZUA 2XCJA 1LCDA 3IVPA 2A6CA 1ZVVA 2PPXA 2PUAA 2XSDC 2BNNA 1WIZA 2OFYA 2IVBA 2XI8A 3BD1A 3HZIB 4MCXA 2AW6A 2HINA 1JFTA 2IV1A 2PIJA 2EWTA 1CJGA 1X2LA 1QP4A 1R63A 5A7LA 2IUOA 4IA8A 4PU4C
chains in the Genus database with same CATH superfamily
3G7DA 4UEMA 4DR5T 3ZT5A 4KHZF 4TNWA 4QHOA 1HG2A 2Q9QC 4OK0A 5LJMA 4LF8T 3QWGA 2MPKA 2JIWA 2UXNB 5J0ZA 3RQUA 3ZKCA 4P0AA 2PUEA 3AA7B 3AE2A 2PXBA 3CWZB 2YINA 4GKKT 4WZXA 4I8TA 1RZRA 1ZP0A 5AQOB 3LFPA 4DMWA 3N9QA 2IAKA 3P4PA 2VVNA 3NZPA 3O1HA 2PUFA 2X0HA 4YXDA 4NPPA 2J7UA 2O38A 2PE5A 4JI7T 1ZZ9A 2DNXA 5CJ5A 2FJAA 5E0OA 1HS7A 4P09A 5HWYA 2DL1A 3K8PC 5L47A 3WAJA 4AKRB 4AKLA 2JQKA 5L4EA 2BG9A 5ADXL 4DR2T 3AA6B 3N9OA 4IT4A 3PUQA 3MJXA 4J1WA 1IBKT 4QXCB 3OQMA 5JR9C 1X57A 1UGOA 4X65T 4QH1A 2D9DA 4IWRA 4ZI7E 5IWAT 3CPZA 4KX6A 4MLKA 4AKIA 2UXBT 2EHOC 2V6XA 1SUMB 2KEKA 4GK5E 2H89A 2NR4A 4JI2T 3RQWA 4CQIA 1GQEA 2W0GA 3E08A 5KXJA 1DULA 3RPUA 2IHR1 5LHHB 2IUOA 2BS4A 2IC9A 3H5TA 3JXDL 1Y7YA 4ISTA 4WYVA 4X4BA 4JBWF 3CQCB 1XZYA 2LLYA 4CZZB 2XAHB 5FY0A 3VU7H 5HEOA 1LVKA 3KINB 1XWRA 4IE4A 1B7TA 5JDGA 2VVSA 3O4XE 2YKSA 3CQGB 1NEKA 1BR1A 1YQ4A 3B5MA 2KXPB 4YJ2E 2XY8B 4EOZB 4BAYB 2FJEA 3KV9A 4NDWA 4UVAB 4H9OC 2XZEA 1BDHA 3H3AA 2JMHA 4KMCA 5LBQB 4GIWA 5AQFB 2L3LA 2V7KA 3Q5XA 4AISA 1ZZCA 4KI0F 1LCCA 3AE8A 1X79A 2XQ7A 2ZM6T 5L3FB 4ILBA 3UT5E 5J1GA 2AWIA 2F4VT 2N9DA 5JDNA 2WIUB 3F2EA 2K24A 4DV3T 2H8RA 5LG3A 3ZMUB 4OBMA 2PUBA 3D0TA 3SR4A 3EI0A 1W0AA 3LBXA 2E9XD 3DNVB 4EB6E 4ER3A 5EK3A 1KK7A 2BKPA 2WAUA 1OWAA 2HPLA 5JRCA 3RC3A 4EK9A 4HE8A 3E0ZA 1KF6A 2XI8A 1DU2A 4YJ3E 2VKJA 2FFHA 2OA5A 3V5SA 5A7LA 3ZLIA 2VKDA 1VOMA 4DR4T 2L49A 3ZMTB 1G8XA 2UXDT 1T7SA 1VPWA 3AA1B 1W09A 3ETUA 4TN7B 1D0XA 4TWDA 2LSIA 2BNOA 5L4HA 5HYAA 4K0UA 5DSXA 4DIDB 3PJAJ 2BBJA 4ZI3C 3AEDA 3EDVA 4IGUA 2AXZA 4PJNA 4JYAT 2YU1A 4V1Av 2EHOA 4X20E 1S94A 3AE6A 1YXRA 4PFPA 2FBWA 2JMKA 2V6YB 3FYAA 5JR9A 1IBLT 3C51A 2LT3A 2YN6A 2VL0A 4F8DA 2MOZA 1L0VA 5JH7E 4HFDA 2CBJA 5DT2A 2BG9C 2ZM0A 1E1HB 4H9SE 3ZYLA 3HI2A 3FBLA 2Y6XA 3J7Yq 2PBIA 3CLCA 3TEPA 3RX6A 4EYYR 1WYCA 2MBGA 2XQ3A 4EEDA 4DV0T 2XXAA 3HKCE 2V7JA 3L09A 1VCSA 4X1YE 4IE6A 5F8PA 3LG7A 3AAIA 4N78D 4EXTA 3DM5A 2LRLA 2KZ7B 2PUAA 2XPKA 4EIWA 3NBXX 1T98A 3W15B 3ZPXA 2DWKA 2X51A 1X2LA 1HX1B 3PV0F 1WFDA 4F8HA 5CGMA 3PE5A 2Q9QA 4JQDA 4IL4A 4Z5CA 3HKBE 3AE4A 3OBVE 3TLVA 3PU8A 3RKGA 3LISA 3F31A 4YLHA 4X4FA 4HWDA 5FYMA 4DV4T 3LFMA 3CROL 3GZCA 3Q5DA 2X67A 4B3ST 1B0NA 2AXVA 1LVFA 3P4RA 4GKJT 1UTXA 3L1PA 2XSAA 3C4ZA 2LM2A 1PERL 3ZC1A 4GYRA 3P4SA 2LYJA 3F52A 1ZV4X 3UU3A 3JCFA 3CK6A 4DBRA 3TFLA 4J2CA 3SX0A 3I0OA 2AXDS 4MCTA 4FN3A 3FXDB 4JI6T 1XDOA 4ILAA 1QQAA 1MIYA 3NRXA 3CECA 5F3JA 2LJLA 4Z91A 2XASB 5ETWA 2YDRA 3C4WA 1N34T 4LF5T 3GUUA 3PDYA 4I50E 2MYSA 1ZZ8A 4Z5HA 5FMNA 3FYMA 2WBLA 3ZKRA 2PXFA 2KPJA 2EF8A 4B6XA 2Y8DA 3MZKB 3MACA 4AQYT 4QWNB 4ER7A 4DBQA 3CX8B 2HN1A 4MCXA 4X1IE 4LF6T 3K3QC 5H6RB 4DV5T 4YHJA 3O1JA 2CSFA 4WBNE 4HRAA 3FHNA 2R63A 5LNKA 3EAMA 4X4EA 1OEDB 2BS3A 4EKIA 2L1PA 5AQSB 2C5IT 5AQHB 4X4HA 1D1BA 2EBYA 3QQ6A 3D1NI 3PURA 4EYUA 5DJQC 3B13A 4PK4A 3LK2B 5ABHA 2BBHA 3ZN1B 3AB3B 3PUGA 4PU7A 1DW9A 4KHPT 5FXVA 4O4IE 3SOLA 3RLFF 4ANJA 3GN5A 3LBXB 3A7MA 1IJ6A 2CXFA 4ADZA 1DWKA 2XQ9A 1ADRA 2ES0A 3N9MA 2V7MA 2LLVA 2D2SA 1UXDA 3ZMSB 5AQPB 4HFBA 3SFEA 4BJMA 4X4DA 2XQ4A 5AQIB 5L2LA 1UX4A 1KEYA 3G0TA 4YG1A 4I4TE 1MIVA 2LRKA 3BQLA 4ER0A 4HTEA 4P1NA 4PFOA 1RZRD 2ACZA 5JRCB 3RF1A 2WS3A 4YHHT 2OV9A 5JDLA 4XZCA 3ETVA 5L3DB 2XXQA 5ABEA 5AFUL 1LQCA 2Z6EA 3SWHA 4A56A 2GZUA 2A6CA 3I1AA 5FXWA 3M3ZB 4QXHB 3TLWA 2UUAT 3Q2MA 2D0UA 2R1JL 5EK4A 2BNMA 1MNDA 3VR8A 4EAHA 4LF7T 2JJ9A 5IUXA 4ZI2D 1NAFA 1RZSA 4I6RA 3NZQA 4AQFC 1XDPA 2PXEA 2B76A 3OQOA 3KV6A 1YD8G 3GMIA 3N2GE 4Z8XA 1BR2A 4I0UA 2XQAA 3GZDA 2IMLA 2NTXA 4JI3T 2WMOA 4UR9A 3CQXC 2BVLA 3LQXA 3BK9A 2CPTA 2PJQA 1QP7A 3ZHMA 4ER5A 2WDVA 3I9WA 4DMVA 2BS2A 5LYJE 3OJAA 3MXZA 1OCTC 3BQKA 3QNUA 5A1LA 1U2ZA 2YDQA 3NROA 5DTQA 4UIGA 2ODUA 5CB4E 3EHZA 5HCJA 2XAJB 5LP6E 2KLQA 5C8YE 2ODVA 4C90A 1FMVA 3UFEA 2E8IA 1QB2A 3FXEB 2MQKA 2LSJA 3IBPA 2RP4A 1HNZT 1CHUA 3NWIA 3AE3A 3ZSSA 1XWMA 1J5ET 4I55E 2CEAA 2LEHA 2WQYA 2PPXA 3VRAA 1KNPA 2BNNA 1FIOA 3BD1A 2W2UA 1JNZA 2E9XA 2WU5A 1V9DA 2UXXB 5AQGB 5DQWA 3QUJA 1HTJF 4AXPA 2CHOA 2VQET 2KEIA 2W00A 3T1HT 3S8QA 4Z5DA 2E5LT 2XJ3A 3AECA 4YG4A 3AA0B 2PTFA 3MLFA 1KNRA 2WDQA 4UV9B 2CRBA 2V7LA 2XTLA 3EUHA 3RKOA 4IDOA 1LMB3 3RC8A 2LE8A 3IEEA 2LM9A 5HWXA 2IVQA 3RH3A 2PUGA 3KBTA 5LGNB 2WDRA 4O8SA 4ZHQE 3LK3B 3RIUC 2E9XB 4DVDA 1T8BA 3A8YC 5ABGA 2J47A 4YTMA 2XUEA 5LGUB 3EABA 1JFSA 2FJDA 1RIOA 4BJNA 4JV5T 4IE5A 2LOPA 1WCRA 2C5JA 1O3XA 4GOUA 3H3MA 4IE7A 2VURA 4QH4A 4TV8E 3OPCA 5LMNT 4FBIA 3A5XA 4AKGA 2HCSA 4E7SA 1WR6A 3U3IA 2IVGA 3QYXA 4PK5A 3PUXF 2X9WA 4KP3C 1ZZ6A 1N33T 5CA0E 2D0TA 4TWFA 3FMYA 3AEEA 2VWAA 2A72A 2IC6A 4EZHA 1BDIA 4Z58A 4YSZA 1X9BA 3C50A 1WLXA 2NP9A 3UFGA 2XCJA 1D1AA 4DR3T 3AEFA 4O2BE 1W0BA 4U74A 2CE7A 5LHIB 4LFAT 2UUBT 5AQUB 3UU6A 4HWCA 1HX8A 2XM2A 4PU4C 4TX5A 1VRBA 4TUYE 3I9YA 3AXJB 2SPCA 4HFHA 1YQ3A 2CMRA 3VHLA 1ZAYA 4HEAA 4WW0A 1JNRA 2BZBA 3FB2A 4JLEA 5J2UE 5F5WA 3RGLA 1U5PA 4K0KT 5IHYA 4DV6T 1R8IA 4U3CA 2O4AA 1ZOYA 2HH7A 3U78A 1MMGA 2PXDA 1UXCA 4JUYA 2HHHT 2NOXA 4H63V 5IYZE 3L39A 2PXUA 4O4LE 2DHRA 2IIUA 4PNIA 1HF8A 2XAGB 4COFA 3A9XA 1H7CA 3BQIA 3SCHA 1D0ZA 2CXLA 4PJMA 5LA6E 2XM1A 3ZJ1A 3CVRA 5AQKB 2H7VC 5HAXA 1OXZA 4QKNA 1IBMT 5L3EB 4ILUA 3RYFE 3NXHA 1XMQT 3OMTA 2KSRA 1PNRA 1ZZBA 2JRKA 2WM9A 2DWGA 4X66T 1ZKEA 2K48A 4WVLA 2JQEA 2HSGA 4MBQA 3PTRB 1LCDA 3IVPA 1LKXA 3CMLA 1HNXT 3NVOA 2VKOA 2HINA 1JFTA 2EWTA 2PG8A 1XNRT 5M4YA 1QP4A 4IA8A 3G06A 3RYIE 5LG4A 3N9NA 2XXPA 2A3DA 2LSKA 4PK6A 3AE9A 3C98B 4ZS2A 2W67A 4ZI3D 2KINB 5KX5E 1D1CA 5JUWA 1XNQT 1IJ5A 4LFBT 1PRUA 2IDOB 3PUWF 4IL9A 4WNKA 2YEVC 1ZEEA 3KBUA 3IF8B 2W63A 3ONLC 4I6TA 2R6GF 2WWUA 2CHNA 3Q5WA 4OX9T 5AQRB 1ZS4A 2XQYA 2ZM2A 4JI5T 2OLTA 2K5BB 2AXUA 3CX6B 2V3CC 1LRZA 3QOWA 4F6RC 3QOFA 4PU3C 4U7YA 1Z0PA 1ZUGA 2Q9QD 1UX5A 1HF0A 2LYLA 3P4QA 2LHNA 3PUAA 4U33A 1Y01A 3K1SA 4TV9E 2LSYA 2EHOD 2E9XC 3L8RA 2V1DB 1FJGT 3ANWB 4GHJA 5AQJB 1SE7A 5JDMA 3K3NA 4HFEA 2HPJA 4NUUA 4NUVA 4QX7B 3ZSTA 2M4HA 3CKDA 4B3TT 3UU4A 3BDNA 4HFCA 1UCUA 5LCYA 3ZCIA 5LMUT 2VEOA 3ME5A 5DRYA 2CWOA 5DQVA 2OFYA 4L0RA 2BDEA 1R63A 3ONJA 3ZCJA 3R09A 4QX8B 4TNVA 3SRZA 3VR9A 2BG9B 5J2TE 2ODRD 3I0QA 4HGAA 2PXPA 3PE0A 5FY7A 2Y48B 2LKHA 1ZPQA 4OFZA 2E2AA 2NW9A 4EZ4A 2VB6A 4IDPA 2PUCA 2I0MA 1MIWA 1PRAA 2IU7A 4AQFA 1S7EA 1EZ3A 3S4UA 1QP0A 3H37A 1U4QA 2AUWA 3P8CD 1MMDA 3ZC0A 3A9YA 2CBIA 3FZKB 3QC9A 4YG7B 4DR6T 3EUSA 3HL6A 2NTYA 4C91A 2MTQA 4IVZA 2KZ8A 4DR1T 4UVBB 2J7WA 1FMWA 2B5AA 3KJXA 2PFVA 2N2NA 1QQBA 4HKAA 4IIJE 5HEUA 1MMAA 4DNDA 3FZLB 2X0YA 1YKEB 2XQ8A 3OWQA 2G0UA 2QYWA 4XAXB 3U3WA 2BJCA 2ICPA 3RIFA 4B3RT 4MHCA 4O4HE 4HWFA 3OTOT 1WIZA 4P0BA 3EDUA 4U72A 3LK42 2YDSA 3FZFB 5H6QB 3AVRA 3UULA 2LOSA 4I6UA 3MK7C 5BMVE 4CN6A 2LYQA 3L3PA 2KMFA 5LHGB 5LJNA 4E7ZA 1NERA 4ZXLA 3PUZF 2QVAA 3UQ7A 1EFAA 1HQ1A 2PUDA 1QZXA 2WZIA 3ANWA 1MFQC 4LF4T 5FXZA 4UV8B 2WY2A 5TAOA 2X0LB 4Q2JA 1QUUA 5HXRA 4UF0A 3TLTA 4IDNA 1Y9QA 4YBAA 3HKDE 3JAFA 4ZZBA 3UTKA 4JCXA 4IDZA 3GA8A 2V26A 3ZJ2A 2X9HA 5AQLB 3ZMVB 2XAQB 2UU9T 3UU8A 1E7PA 5FKYA 1HFAA 3RYHE 4CXYA 2B1EA 3ESLA 4EKGA 4ZI2C 3AEBA 3KVBA 1OEDA 4OHFA 4ASKA 3ZT7A 4JI1T 4GYSA 2HFZA 5JREA 3K3OA 5FL1A 3BS3A 4DO0A 4H9PC 4HWIB 3PUYF 4G2AA 4DE9A 3VKGA 4A97A 4U2YA 2C0SA 3ONXA 2KEJA 3MKDA 2LKGA 2FUPA 4AI6A 2VASA 1XMOT 3IA3A 2IV1A 2IW5B 3Q5EA 5HEJA 4X62T 2M67A 3PJAA 3RHWA 3MEJA 2V5DA 4KUMB 1CQTA 4BA9A 1RPEL 2CXDA 5L3CB 3UFDA 2WWVA 2PXLA 5JDQA 2NWBA 3TRBA 3DTOA 1YW0A 2BKOA 4HWHA 4X5TA 2JQQA 1IAPA 1L1MA 4NXMT 3JC6D 5JR9B 1T72A 1HR0T 2PXVA 4DV2T 4YT0A 3PU3A 1GT0C 1JWLA 3HA4A 4Y42A 3AE5A 1IZNB 3FZHB 2XQ5A 1E2AA 3N9LA 4O8BA 5FY1A 3ZN0B 2H88A 3AVSA 1R69A 4YSYA 3RRCA 3QB5A 4PW8A 5EK2A 4ZOLE 2XIUA 1MNEA 3HKEE 3TLSA 3AEGA 5FVLA 2JCGA 4FJOA 3R1FA 1M62A 2LNMA 4X4GA 2KT9A 2WU2A 2E5VA 2J4GA 4WBOA 1NW3A 1OSLA 5K98B 4A5XA 4UELA 1N32T 1M7KA 5LGTB 3R6NA 3RIUA 4LF9T 2DI4A 3V5UA 2WCAA 4Z90A 1J1JA 2KWIB 2CWYA 3T8OA 1ZVVA 2YU2A 3EVYA 2I6HA 5GONE 2PIJA 5KDMC 3JAEA 2DCFA 4CI3B 3KDSE 3OYXA 3P4WA 4EQZA 2ZM8A 3A9ZA 4OYJA 3ZPOA 1OEDC 2AE9A 4HN9A 3RZZA 3O1IA 2V7IA 3JC6C 4DE8A 1VCTA 3NZLA 4ISSA 3F57A 2ACXA 5L3GB 3G5GA 2GRLA 3RIAA 5LB7B 4DV1T 5DTMA 1MMNA 2NW8A 2D5VA 3IHRA 2QGSA 4IDQA 2M6BA 5DABA 3TKLB 3SCGA 3O9XA 2X66A 3GWHA 3OP9A 4U31A 3VRBA 2ZLYA 3UUXB 4PAGA 2O49A 4H9RC 4H9QC 4OYKA 1WYBA 3RYCE 4CXWA 3HR0A 2K3WA 2GRMA 4IE0A 2UXCT 5FVKA 4B3MT 4A98A 3OKZA 1HCIA 5HCMA 4JI0T 5C3JA 5CFBA 4JI4T 4ER6A 3CX7B 1WR0A 3AEAA 3SCFA 3T1YT 2WMNA 4EZIA 2CM0A 1NENA 4NXNT 3GBFA 3QFIA 4GK0E 2XSBA 4X1KE 3QK6A 4O4JE 4TWHA 3C4XA 3GZDC 2BKNA 1NWMX 2BVMA 1UK5A 5L3BB 2HN2A 3X1DA 3LDQB 2QA7A 4AQGA 3ZYMA 3RI5A 1WETA 4H63H 3FBZA 1AU7A 3VWSA 3AE7A 5GAHi 5LBMA 2LLWA 3N5LA 2X9YA 4ILCA 2W62A 1QPZA 4X4IA 1HNWT 4UF0B 1YKHB 2JVLA 4OB4A 1ZHCA 4ZS3A 1S35A 2WP9A 4JCYA 3NKZA 5HXEA 3VK0A 1SHZC 4O2AE 4LMJA 3SFDA 5DTRA 2YOEA 3ZYKA 4PU8A 1WH6A 1POUA 2P9BA 1O4XA 5JTGA 1CUNA 2ICTA 2YK0A 4Z59A 4CN1A 3ZEFB 5HXHA 4XBFB 5HEHA 3M9LA 3SS1A 5JDFA 3JADA 4UVCB 2XHEB 2WZHA 1LLIA 4MALA 5FP3A 1BR4A 2VK9A 4DV7T 4X64T 3LSVA 2CLYB 4X4CA 1OEDE 3TLUA 1WRDA 3FZMB 3ZHIA 2DLRA 3OYZA 5C2TA 4TZ4C 2LYSA 4IREA 2KWHA 4LMLA 3TELA 2K9AA 4PJLA 2V6YA 3UU5A 2V8SV 3UUBA 3HZIB 2YBDA 4EGWA 4DUZT 4JEUB 5DRTA 2HCNA 1KNZA 3KV4A 1CJGA 3QOXA 4UXNB 3DP7A 4YARA 4ZEYA 4GQMA 2RA1A 5CA1E 4U2ZA 5FNVE 2L8NA 3F6WA 2NW7A 4ZZCA 5AQNB 5AQMB 3B7HA 5LOVE 3N2KE 3CIRA 3R84B 2N1GA 3AE1A 2CROA 2KNDA 3OVUA 2W66A 4CN4A 4QXBB 5AQVB 1SA0E 2X68A 4NIQA 4PJJA 1I94T 4L9IA 4YSXA 2LYKA 2Q9QB 3RRWA 1N36T 1UURA 2L8KA 3E22E 3C64A 4M1PA 2L9QA 1PRVA 4CXXA 4L5GA 3UWPA 3KV5A 3KL4A 2FJBA 2H3RA 2MXDA 5HEGA 4CI2B 5JDHA 3NDBB 1UUSA 3KVAA 5BR8T 2C5KT 2XQ6A 2WSSV 4YTNA 2QRXA 3N9PA 4AIUA 2XAFB 3KZ3A 2CA5A 3UUNA 3ABVA 1J5WA 2PXKA 3QB5K 4AKHA 5FXXA 3PUVF 3PXPA 5EZYE 3NRYA 5LXTE 2H7OA 3Q9DA 2M6IA 2GK9A 2WB5A 4LMKA 4LFCT 4MFRA 2IVBA 2CCQA 3ZMZB 2AW6A 2A9UA 4YY3T 1D0YA 1AJ3A 4H9NC 4JI8T 2J62A 5ABFA 2EHOB 1Y64B 3KXAA 4QH5A 3ZT6A 2LCVA 4YFSA 3OQNA 2V5CA 3M65A 2LHRA 2BG9E 2I59A 3F51A 4KBMB 5AQTB 4JEHB 3LJCA 3GN5B 1W9RA 3VKHA 2LSGA 3B57A 3DJBA 4J1XA 2X9XA 1BR0A 2ZMAA 2IUBA 2W61A 5GAGi 1FEWA 3KFWX 1QSDA 2JPFA 1IC8A 4I43B 3AAEB 2WUSR 2JQ9A 5AQQB 2PXTA 2RPAA 1YSEA 5JQGE 4HFIA 4IHJE 1KFYA 4YTPA 3WI3A 1ZZ7A 2FJRA 4HFVA 3AXJA 4EEBA 5KMGP 1NEQA 2W4XA 1Z8UA 2PXQA 2A2FX 2VQFT 2CLYC 1SQ8A 4EV6A 1HG5A 3UUMA 1QLBA 3MA9A 3UQ4A 3AAAB 4ERRA 1US7B 3QF3A 5FL0A 2OR1L 3JXBC 2UUCT 4DUYT 1I6ZA 5HXSA 3JXCL 4CI1B 1E3OC 1WH8A 3P7IA 2JQHA 1JH9A 5JVDE 4DR7T 2LYRA 3J9X1 4G63A 4U7IA 5ABFB 3P50A 2J1DG 4FI5A 3WAKA 2MEZA 2MAWA 1G73A 2LYPA 3PUSA 4Q25A 2XJ7A 2XSDC 3OKQA 5HXCA 2VKHA 2VL8A 3N2OA 2D5UA
chains in the Genus database with same CATH topology
4YHJA 3O1JA 3G7DA 3RYIE 2CSFA 3KDSE 3FHNA 3OYXA 4UEMA 4WBNE 2R63A 3N9NA 5LG4A 2A3DA 2LSKA 5LNKA 4PK6A 3C98B 4ZS2A 4ZI3D 4X4EA 2ZM8A 2KINB 4OYJA 5KX5E 1D1CA 4QHOA 3ZPOA 1HG2A 2C5IT 4X4HA 1D1BA 1IJ5A 2Q9QC 4OK0A 4HN9A 2EBYA 3QQ6A 3RZZA 3D1NI 5LJMA 3O1IA 3PURA 2V7IA 3JC6C 1PRUA 3QWGA 4WNKA 4EYUA 5DJQC 3B13A 4PK4A 3LK2B 2YEVC 2UXNB 3ZN1B 1ZEEA 3AB3B 4ISSA 3KBUA 3ZKCA 3F57A 2ACXA 3IF8B 5L3GB 3G5GA 2GRLA 2PUEA 3AA7B 4P0AA 3PUGA 4PU7A 1DW9A 2W63A 3CWZB 4I6TA 5FXVA 4O4IE 1MMNA 2NW8A 2D5VA 3IHRA 2WWUA 2YINA 2QGSA 3SOLA 5DABA 4I8TA 1RZRA 3Q5WA 3SCGA 3TKLB 3O9XA 4ANJA 2X66A 3GN5A 1ZS4A 3GWHA 3LBXB 2XQYA 2ZM2A 2K5BB 2AXUA 3OP9A 1IJ6A 3LFPA 3CX6B 1LRZA 4F6RC 4DMWA 3N9QA 2CXFA 2IAKA 4ADZA 1DWKA 4PU3C 3NZPA 3O1HA 2PUFA 1ADRA 1Z0PA 1ZUGA 2ES0A 2Q9QD 2ZLYA 3UUXB 4PAGA 2O49A 3N9MA 4H9RC 2O38A 2V7MA 1UX5A 4H9QC 1HF0A 2LYLA 2PE5A 4OYKA 2D2SA 1UXDA 2LHNA 1ZZ9A 1WYBA 2DNXA 3RYCE 3ZMSB 4CXWA 3PUAA 3HR0A 2GRMA 4X4DA 4IE0A 4BJMA 5L2LA 4TV9E 5E0OA 1HS7A 2LSYA 1UX4A 2EHOD 4P09A 2E9XC 3K8PC 5HWYA 3WAJA 4AKRB 2V1DB 4AKLA 1HCIA 4YG1A 3ANWB 4GHJA 4I4TE 5ADXL 1MIVA 3AA6B 3N9OA 3BQLA 4HTEA 4PFOA 1RZRD 3CX7B 3K3NA 3PUQA 2HPJA 3MJXA 5JDMA 4J1WA 5JRCB 4QXCB 3OQMA 4NUUA 5JR9C 3SCFA 1X57A 4NUVA 4QX7B 2WMNA 3CKDA 2CM0A 3GBFA 4GK0E 4IWRA 4ZI7E 5JDLA 3BDNA 4XZCA 3CPZA 3ETVA 5L3DB 1UCUA 4MLKA 4AKIA 5LCYA 2EHOC 3ZCIA 2KEKA 5AFUL 1LQCA 4X1KE 2Z6EA 3QK6A 4O4JE 3SWHA 4A56A 2GZUA 2A6CA 3C4XA 4GK5E 3I1AA 2CWOA 5DQVA 2OFYA 5FXWA 1NWMX 2BVMA 4L0RA 5L3BB 4CQIA 2W0GA 4QXHB 2BDEA 2QA7A 3E08A 3RPUA 3Q2MA 1R63A 5LHHB 2IUOA 2D0UA 3ZYMA 2R1JL 2IC9A 3ZCJA 4AQGA 5EK4A 1WETA 3H5TA 4QX8B 4H63H 3JXDL 1Y7YA 2BNMA 1MNDA 4ISTA 3FBZA 4EAHA 1AU7A 3SRZA 4X4BA 3CQCB 5J2TE 2JJ9A 3I0QA 5LBMA 4HGAA 3N5LA 2X9YA 4CZZB 2W62A 2XAHB 5FY0A 3VU7H 4ZI2D 1LVKA 3PE0A 1NAFA 1XWRA 1QPZA 3KINB 4IE4A 5FY7A 1B7TA 4X4IA 5JDGA 1RZSA 4I6RA 3NZQA 2Y48B 3O4XE 4AQFC 4UF0B 1YKHB 1ZPQA 3CQGB 2JVLA 3OQOA 1BR1A 4OB4A 2KXPB 3KV6A 1ZHCA 4OFZA 4YJ2E 1YD8G 4ZS3A 4EOZB 4BAYB 3GMIA 1S35A 3KV9A 3N2GE 4Z8XA 4NDWA 1BR2A 4UVAB 2NW9A 2VB6A 4H9OC 4EZ4A 4JCYA 2NTXA 1BDHA 2PUCA 3H3AA 2JMHA 2WMOA 4KMCA 3VK0A 1MIWA 5HXEA 5LBQB 1SHZC 4O2AE 3CQXC 2BVLA 1PRAA 3BK9A 2IU7A 4GIWA 4AQFA 1S7EA 2L3LA 1EZ3A 2V7KA 3Q5XA 3S4UA 1QP0A 1ZZCA 3H37A 1U4QA 3ZYKA 4PU8A 1LCCA 1WH6A 1X79A 2PJQA 1POUA 1QP7A 2P9BA 3ZHMA 2AUWA 1O4XA 3I9WA 5L3FB 1CUNA 2ICTA 4DMVA 2YK0A 4Z59A 5LYJE 3OJAA 3UT5E 3MXZA 3P8CD 1MMDA 1OCTC 5J1GA 3ZC0A 3BQKA 3QC9A 2AWIA 3ZEFB 5HXHA 4XBFB 4YG7B 3EUSA 3HL6A 2NTYA 2N9DA 5JDNA 2WIUB 4C91A 5A1LA 3F2EA 3SS1A 2K24A 5JDFA 4UVCB 2MTQA 4IVZA 2XHEB 2H8RA 4UIGA 2KZ8A 1LLIA 3ZMUB 2ODUA 4MALA 4UVBB 5FP3A 1BR4A 1FMWA 2VK9A 5CB4E 2PUBA 3D0TA 2B5AA 2XAJB 5LP6E 3KJXA 2KLQA 5C8YE 2CLYB 2ODVA 2PFVA 1FMVA 3UFEA 4X4CA 4C90A 2E8IA 3FXEB 3LBXA 1WRDA 2N2NA 2MQKA 1QQBA 2E9XD 4HKAA 4IIJE 2LSJA 3ZHIA 2DLRA 3DNVB 1MMAA 3IBPA 4EB6E 4DNDA 3OYZA 2RP4A 5EK3A 1KK7A 1YKEB 2G0UA 2WAUA 1OWAA 4XAXB 3U3WA 4TZ4C 2HPLA 5JRCA 2LYSA 2KWHA 2BJCA 4I55E 2ICPA 3RC3A 2CEAA 4HE8A 2K9AA 4MHCA 2LEHA 4O4HE 3E0ZA 4PJLA 2PPXA 2BNNA 1FIOA 1WIZA 2XI8A 3BD1A 3HZIB 4P0BA 3EDUA 4U72A 3LK42 4JEUB 2E9XA 1KNZA 4YJ3E 2VKJA 3KV4A 1CJGA 5H6QB 2OA5A 3AVRA 3V5SA 5A7LA 3UULA 3ZLIA 1V9DA 2UXXB 2LOSA 4I6UA 4UXNB 2VKDA 3MK7C 3DP7A 1VOMA 4YARA 2L49A 5DQWA 3ZMTB 5BMVE 4GQMA 1G8XA 3QUJA 2LYQA 2RA1A 3L3PA 5CA1E 1HTJF 2KMFA 5LHGB 5LJNA 4AXPA 1NERA 5FNVE 4E7ZA 2L8NA 2KEIA 3F6WA 1VPWA 2NW7A 3AA1B 2W00A 3ETUA 4TN7B 1EFAA 1D0XA 2LSIA 3S8QA 2BNOA 4Z5DA 5HYAA 2PUDA 4K0UA 3B7HA 2XJ3A 5LOVE 4YG4A 3AA0B 3N2KE 3ANWA 3MLFA 3R84B 2N1GA 2CROA 4UV9B 4ZI3C 2KNDA 2V7LA 2XTLA 5FXZA 3EUHA 4UV8B 3RKOA 4QXBB 1LMB3 3EDVA 5TAOA 1SA0E 4IGUA 2X68A 2LE8A 1QUUA 2X0LB 3IEEA 5HXRA 3RC8A 2AXZA 4PJJA 4PJNA 4UF0A 2LM9A 1Y9QA 4YBAA 5HWXA 2IVQA 4L9IA 3RH3A 2PUGA 2YU1A 3HKDE 3KBTA 4V1Av 2LYKA 5LGNB 2EHOA 2Q9QB 4X20E 3RRWA 4O8SA 4JCXA 2L8KA 3LK3B 3UTKA 2E9XB 4DVDA 4ZHQE 1S94A 3E22E 3C64A 4M1PA 4IDZA 3GA8A 2XUEA 4PFPA 2L9QA 1PRVA 2JMKA 5LGUB 4CXXA 1JFSA 2V26A 3FYAA 4L5GA 5JR9A 3C51A 2X9HA 3ZJ2A 1RIOA 3KV5A 4BJNA 2LT3A 3ZMVB 2H3RA 4CI2B 2XAQB 4F8DA 2MOZA 5JDHA 2LOPA 4IE5A 5JH7E 2C5JA 1O3XA 2ZM0A 4GOUA 4IE7A 1HFAA 3KVAA 2C5KT 3RYHE 4CXYA 2WSSV 1E1HB 4H9SE 3ZYLA 2B1EA 4TV8E 3ESLA 3HI2A 4FBIA 3FBLA 3A5XA 2Y6XA 4ZI2C 3J7Yq 4AKGA 2PBIA 3N9PA 3CLCA 3KVBA 4OHFA 3RX6A 2XAFB 4ASKA 4EYYR 1WYCA 3KZ3A 2MBGA 4E7SA 1WR6A 2CA5A 3UUNA 3U3IA 2IVGA 3QYXA 4GYSA 4PK5A 2X9WA 4KP3C 1ZZ6A 5JREA 3HKCE 3K3OA 5CA0E 4AKHA 3BS3A 2D0TA 5FXXA 2V7JA 3L09A 3FMYA 4H9PC 4DO0A 3PXPA 5EZYE 2VWAA 3NRYA 2A72A 2IC6A 4EZHA 4G2AA 1BDIA 5LXTE 3VKGA 4X1YE 2H7OA 4IE6A 5F8PA 3LG7A 3AAIA 4Z58A 3Q9DA 2C0SA 3ONXA 2KEJA 2GK9A 3C50A 1WLXA 3MKDA 2NP9A 4N78D 4EXTA 2XCJA 1D1AA 2KZ7B 2PUAA 4MFRA 4EIWA 4O2BE 4U74A 2CE7A 3NBXX 2IVBA 4AI6A 2VASA 2CCQA 5LHIB 1T98A 3ZMZB 2AW6A 3W15B 2DWKA 2IV1A 2X51A 2IW5B 1HX8A 1X2LA 1D0YA 4H9NC 1AJ3A 4PU4C 4TX5A 2EHOB 2Q9QA 4JQDA 2M67A 1Y64B 3KXAA 1VRBA 4TUYE 3I9YA 4KUMB 1CQTA 2LCVA 4BA9A 4YFSA 3OQNA 1RPEL 2CXDA 5L3CB 3UFDA 2SPCA 3M65A 2LHRA 4Z5CA 3HKBE 3OBVE 5JDQA 2NWBA 2I59A 3TRBA 2CMRA 3DTOA 3F51A 4KBMB 3VHLA 4JEHB 1YW0A 3LJCA 3PU8A 3GN5B 2JQQA 3VKHA 1ZAYA 2LSGA 3LISA 4HEAA 3B57A 3F31A 3DJBA 4WW0A 4J1XA 4YLHA 2BZBA 1IAPA 2X9XA 3FB2A 4JLEA 5J2UE 1BR0A 2ZMAA 1L1MA 1U5PA 2W61A 4X4FA 5FYMA 3JC6D 1FEWA 3LFMA 3CROL 3KFWX 5IHYA 1QSDA 5JR9B 2JPFA 2X67A 1IC8A 4I43B 3AAEB 1B0NA 2WUSR 2O4AA 1YSEA 2AXVA 3PU3A 5JQGE 2HH7A 1GT0C 3U78A 1LVFA 1MMGA 1JWLA 4IHJE 3HA4A 1UTXA 1UXCA 3L1PA 3C4ZA 4Y42A 4JUYA 3WI3A 1IZNB 1ZZ7A 2FJRA 2NOXA 4H63V 4HFVA 1PERL 3ZC1A 5IYZE 3N9LA 4GYRA 4O8BA 5KMGP 2DHRA 4O4LE 1NEQA 5FY1A 3ZN0B 4PNIA 2LYJA 2A2FX 3AVSA 3F52A 1HF8A 1R69A 2XAGB 2CLYC 3RRCA 4PW8A 5EK2A 1SQ8A 1H7CA 1ZV4X 3BQIA 2XIUA 1MNEA 3HKEE 4ZOLE 1HG5A 3UUMA 4DBRA 3SCHA 1D0ZA 2CXLA 3MA9A 4PJMA 3AAAB 4J2CA 5LA6E 4ERRA 2JCGA 3I0OA 1US7B 4FJOA 3ZJ1A 3CVRA 3R1FA 3QF3A 4MCTA 4FN3A 2OR1L 3FXDB 3JXBC 2H7VC 5HAXA 1OXZA 4QKNA 4X4GA 5L3EB 5HXSA 2KT9A 4ILUA 3RYFE 3JXCL 1QQAA 4CI1B 1MIYA 4WBOA 3NRXA 3OMTA 3CECA 5F3JA 1PNRA 2LJLA 1E3OC 1WH8A 2XASB 1OSLA 5ETWA 5K98B 3P7IA 3C4WA 4UELA 3PDYA 1ZZBA 4I50E 1JH9A 2MYSA 1ZZ8A 5JVDE 3R6NA 5LGTB 2JRKA 4Z5HA 2WM9A 5FMNA 3FYMA 2LYRA 2DWGA 3J9X1 4G63A 2WBLA 2DI4A 3V5UA 1ZKEA 2J1DG 4FI5A 3WAKA 2MEZA 1G73A 2LYPA 2KWIB 2K48A 2CWYA 2KPJA 3T8OA 3PUSA 2EF8A 2HSGA 3PTRB 4MBQA 2Y8DA 1LCDA 3MZKB 3IVPA 1ZVVA 4B6XA 1LKXA 3MACA 2XSDC 4QWNB 2YU2A 3EVYA 3OKQA 5HXCA 3CMLA 4DBQA 3CX8B 2VKOA 2VKHA 4MCXA 2HINA 4X1IE 1JFTA 5GONE 2VL8A 2PIJA 5KDMC 2EWTA 2PG8A 3N2OA 2DCFA 3K3QC 5H6RB 4CI3B 1QP4A 5M4YA 4IA8A 2D5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7D A;  2CSF A;  4I6U A;  1WET A;  3H5T A;  4JQD A;  2R63 A;  3JXD L;  1Y7Y A;  2BNM A;  3KXA A;  4YAR A;  2L49 A;  1AU7 A;  4GQM A;  4X4B A;  1CQT A;  2LCV A;  2LYQ A;  3OQN A;  1RPE L;  3UFD A;  1NER A;  4Z5C A;  4X4E A;  2L8N A;  2KEI A;  3F6W A;  1VPW A;  3TRB A;  3F51 A;  4X4H A;  1XWR A;  1EFA A;  1QPZ A;  3S8Q A;  2BNO A;  3GN5 B;  4X4I A;  2EBY A;  3QQ6 A;  1RZS A;  3RZZ A;  4Z5D A;  4I6R A;  3LIS A;  3D1N I;  1ZAY A;  3B7H A;  2XJ3 A;  2PUD A;  1PRU A;  3QWG A;  4J1X A;  4YG4 A;  3MLF A;  1ZPQ A;  2JVL A;  1L1M A;  2CRO A;  4X4F A;  3OQO A;  4OB4 A;  3CRO L;  3ZKC A;  3G5G A;  2GRL A;  2PUE A;  1IC8 A;  4PU7 A;  1B0N A;  1DW9 A;  2WUS R;  4NDW A;  1LMB 3;  4I6T A;  4JCY A;  2O4A A;  1BDH A;  2PUC A;  1YSE A;  2AXZ A;  2AXV A;  2D5V A;  3VK0 A;  1GT0 C;  1Y9Q A;  4YBA A;  2IVQ A;  1JWL A;  2PUG A;  1RZR A;  4I8T A;  1PRA A;  1UTX A;  1UXC A;  2IU7 A;  3SCG A;  2LYK A;  3GN5 A;  3L1P A;  4Y42 A;  3O9X A;  1S7E A;  1ZS4 A;  4JCX A;  1ZZ7 A;  2FJR A;  1QP0 A;  1ZZC A;  1PER L;  2AXU A;  3OP9 A;  4PU8 A;  3LFP A;  4O8B A;  1WH6 A;  1LCC A;  3GA8 A;  1NEQ A;  1POU A;  1QP7 A;  2LYJ A;  2AUW A;  1O4X A;  3ZHM A;  1PRV A;  3F52 A;  1R69 A;  2ICT A;  1DWK A;  3FYA A;  4Z59 A;  1JFS A;  4PU3 C;  1SQ8 A;  1RIO A;  2PUF A;  1ADR A;  1ZUG A;  2XIU A;  1OCT C;  2O49 A;  2AWI A;  2O38 A;  4F8D A;  4YG7 B;  3SCH A;  1HF0 A;  2LYL A;  2PE5 A;  3EUS A;  1UXD A;  2WIU B;  1ZZ9 A;  2JCG A;  3R1F A;  3QF3 A;  2GRM A;  4FN3 A;  4MCT A;  4IVZ A;  4X4D A;  2OR1 L;  3JXB C;  2H8R A;  2KZ8 A;  1LLI A;  3HI2 A;  4FBI A;  4YG1 A;  4X4G A;  4GHJ A;  2PUB A;  2B5A A;  3CLC A;  2R1J L;  3JXC L;  1QQA A;  3KJX A;  3KZ3 A;  3OMT A;  4X4C A;  3CEC A;  1RZR D;  1PNR A;  2IVG A;  3QYX A;  4J1W A;  1E3O C;  1WH8 A;  2MQK A;  3OQM A;  1OSL A;  5K98 B;  3SCF A;  1QQB A;  1X57 A;  3ZHI A;  1ZZ6 A;  3DNV B;  1ZZB A;  3BS3 A;  3GBF A;  1ZZ8 A;  1JH9 A;  4Z5H A;  4IWR A;  3FMY A;  3BDN A;  3FYM A;  2LYR A;  3PXP A;  3U3W A;  1BDI A;  2LYS A;  2KEK A;  2MEZ A;  2BJC A;  2LYP A;  1LQC A;  4Z58 A;  2KPJ A;  2ICP A;  2KEJ A;  2EF8 A;  2HSG A;  2GZU A;  2XCJ A;  1LCD A;  3IVP A;  2A6C A;  1ZVV A;  2PPX A;  2PUA A;  2XSD C;  2BNN A;  1WIZ A;  2OFY A;  2IVB A;  2XI8 A;  3BD1 A;  3HZI B;  4MCX A;  2AW6 A;  2HIN A;  1JFT A;  2IV1 A;  2PIJ A;  2EWT A;  1CJG A;  1X2L A;  1QP4 A;  1R63 A;  5A7L A;  2IUO A;  4IA8 A;  4PU4 C; 
#chains in the Genus database with same CATH topology
 3G7D A;  4UEM A;  4DR5 T;  3ZT5 A;  4KHZ F;  4TNW A;  4QHO A;  1HG2 A;  2Q9Q C;  4OK0 A;  5LJM A;  4LF8 T;  3QWG A;  2MPK A;  2JIW A;  2UXN B;  5J0Z A;  3RQU A;  3ZKC A;  4P0A A;  2PUE A;  3AA7 B;  3AE2 A;  2PXB A;  3CWZ B;  2YIN A;  4GKK T;  4WZX A;  4I8T A;  1RZR A;  1ZP0 A;  5AQO B;  3LFP A;  4DMW A;  3N9Q A;  2IAK A;  3P4P A;  2VVN A;  3NZP A;  3O1H A;  2PUF A;  2X0H A;  4YXD A;  4NPP A;  2J7U A;  2O38 A;  2PE5 A;  4JI7 T;  1ZZ9 A;  2DNX A;  5CJ5 A;  2FJA A;  5E0O A;  1HS7 A;  4P09 A;  5HWY A;  2DL1 A;  3K8P C;  5L47 A;  3WAJ A;  4AKR B;  4AKL A;  2JQK A;  5L4E A;  2BG9 A;  5ADX L;  4DR2 T;  3AA6 B;  3N9O A;  4IT4 A;  3PUQ A;  3MJX A;  4J1W A;  1IBK T;  4QXC B;  3OQM A;  5JR9 C;  1X57 A;  1UGO A;  4X65 T;  4QH1 A;  2D9D A;  4IWR A;  4ZI7 E;  5IWA T;  3CPZ A;  4KX6 A;  4MLK A;  4AKI A;  2UXB T;  2EHO C;  2V6X A;  1SUM B;  2KEK A;  4GK5 E;  2H89 A;  2NR4 A;  4JI2 T;  3RQW A;  4CQI A;  1GQE A;  2W0G A;  3E08 A;  5KXJ A;  1DUL A;  3RPU A;  2IHR 1;  5LHH B;  2IUO A;  2BS4 A;  2IC9 A;  3H5T A;  3JXD L;  1Y7Y A;  4IST A;  4WYV A;  4X4B A;  4JBW F;  3CQC B;  1XZY A;  2LLY A;  4CZZ B;  2XAH B;  5FY0 A;  3VU7 H;  5HEO A;  1LVK A;  3KIN B;  1XWR A;  4IE4 A;  1B7T A;  5JDG A;  2VVS A;  3O4X E;  2YKS A;  3CQG B;  1NEK A;  1BR1 A;  1YQ4 A;  3B5M A;  2KXP B;  4YJ2 E;  2XY8 B;  4EOZ B;  4BAY B;  2FJE A;  3KV9 A;  4NDW A;  4UVA B;  4H9O C;  2XZE A;  1BDH A;  3H3A A;  2JMH A;  4KMC A;  5LBQ B;  4GIW A;  5AQF B;  2L3L A;  2V7K A;  3Q5X A;  4AIS A;  1ZZC A;  4KI0 F;  1LCC A;  3AE8 A;  1X79 A;  2XQ7 A;  2ZM6 T;  5L3F B;  4ILB A;  3UT5 E;  5J1G A;  2AWI A;  2F4V T;  2N9D A;  5JDN A;  2WIU B;  3F2E A;  2K24 A;  4DV3 T;  2H8R A;  5LG3 A;  3ZMU B;  4OBM A;  2PUB A;  3D0T A;  3SR4 A;  3EI0 A;  1W0A A;  3LBX A;  2E9X D;  3DNV B;  4EB6 E;  4ER3 A;  5EK3 A;  1KK7 A;  2BKP A;  2WAU A;  1OWA A;  2HPL A;  5JRC A;  3RC3 A;  4EK9 A;  4HE8 A;  3E0Z A;  1KF6 A;  2XI8 A;  1DU2 A;  4YJ3 E;  2VKJ A;  2FFH A;  2OA5 A;  3V5S A;  5A7L A;  3ZLI A;  2VKD A;  1VOM A;  4DR4 T;  2L49 A;  3ZMT B;  1G8X A;  2UXD T;  1T7S A;  1VPW A;  3AA1 B;  1W09 A;  3ETU A;  4TN7 B;  1D0X A;  4TWD A;  2LSI A;  2BNO A;  5L4H A;  5HYA A;  4K0U A;  5DSX A;  4DID B;  3PJA J;  2BBJ A;  4ZI3 C;  3AED A;  3EDV A;  4IGU A;  2AXZ A;  4PJN A;  4JYA T;  2YU1 A;  4V1A v;  2EHO A;  4X20 E;  1S94 A;  3AE6 A;  1YXR A;  4PFP A;  2FBW A;  2JMK A;  2V6Y B;  3FYA A;  5JR9 A;  1IBL T;  3C51 A;  2LT3 A;  2YN6 A;  2VL0 A;  4F8D A;  2MOZ A;  1L0V A;  5JH7 E;  4HFD A;  2CBJ A;  5DT2 A;  2BG9 C;  2ZM0 A;  1E1H B;  4H9S E;  3ZYL A;  3HI2 A;  3FBL A;  2Y6X A;  3J7Y q;  2PBI A;  3CLC A;  3TEP A;  3RX6 A;  4EYY R;  1WYC A;  2MBG A;  2XQ3 A;  4EED A;  4DV0 T;  2XXA A;  3HKC E;  2V7J A;  3L09 A;  1VCS A;  4X1Y E;  4IE6 A;  5F8P A;  3LG7 A;  3AAI A;  4N78 D;  4EXT A;  3DM5 A;  2LRL A;  2KZ7 B;  2PUA A;  2XPK A;  4EIW A;  3NBX X;  1T98 A;  3W15 B;  3ZPX A;  2DWK A;  2X51 A;  1X2L A;  1HX1 B;  3PV0 F;  1WFD A;  4F8H A;  5CGM A;  3PE5 A;  2Q9Q A;  4JQD A;  4IL4 A;  4Z5C A;  3HKB E;  3AE4 A;  3OBV E;  3TLV A;  3PU8 A;  3RKG A;  3LIS A;  3F31 A;  4YLH A;  4X4F A;  4HWD A;  5FYM A;  4DV4 T;  3LFM A;  3CRO L;  3GZC A;  3Q5D A;  2X67 A;  4B3S T;  1B0N A;  2AXV A;  1LVF A;  3P4R A;  4GKJ T;  1UTX A;  3L1P A;  2XSA A;  3C4Z A;  2LM2 A;  1PER L;  3ZC1 A;  4GYR A;  3P4S A;  2LYJ A;  3F52 A;  1ZV4 X;  3UU3 A;  3JCF A;  3CK6 A;  4DBR A;  3TFL A;  4J2C A;  3SX0 A;  3I0O A;  2AXD S;  4MCT A;  4FN3 A;  3FXD B;  4JI6 T;  1XDO A;  4ILA A;  1QQA A;  1MIY A;  3NRX A;  3CEC A;  5F3J A;  2LJL A;  4Z91 A;  2XAS B;  5ETW A;  2YDR A;  3C4W A;  1N34 T;  4LF5 T;  3GUU A;  3PDY A;  4I50 E;  2MYS A;  1ZZ8 A;  4Z5H A;  5FMN A;  3FYM A;  2WBL A;  3ZKR A;  2PXF A;  2KPJ A;  2EF8 A;  4B6X A;  2Y8D A;  3MZK B;  3MAC A;  4AQY T;  4QWN B;  4ER7 A;  4DBQ A;  3CX8 B;  2HN1 A;  4MCX A;  4X1I E;  4LF6 T;  3K3Q C;  5H6R B;  4DV5 T;  4YHJ A;  3O1J A;  2CSF A;  4WBN E;  4HRA A;  3FHN A;  2R63 A;  5LNK A;  3EAM A;  4X4E A;  1OED B;  2BS3 A;  4EKI A;  2L1P A;  5AQS B;  2C5I T;  5AQH B;  4X4H A;  1D1B A;  2EBY A;  3QQ6 A;  3D1N I;  3PUR A;  4EYU A;  5DJQ C;  3B13 A;  4PK4 A;  3LK2 B;  5ABH A;  2BBH A;  3ZN1 B;  3AB3 B;  3PUG A;  4PU7 A;  1DW9 A;  4KHP T;  5FXV A;  4O4I E;  3SOL A;  3RLF F;  4ANJ A;  3GN5 A;  3LBX B;  3A7M A;  1IJ6 A;  2CXF A;  4ADZ A;  1DWK A;  2XQ9 A;  1ADR A;  2ES0 A;  3N9M A;  2V7M A;  2LLV A;  2D2S A;  1UXD A;  3ZMS B;  5AQP B;  4HFB A;  3SFE A;  4BJM A;  4X4D A;  2XQ4 A;  5AQI B;  5L2L A;  1UX4 A;  1KEY A;  3G0T A;  4YG1 A;  4I4T E;  1MIV A;  2LRK A;  3BQL A;  4ER0 A;  4HTE A;  4P1N A;  4PFO A;  1RZR D;  2ACZ A;  5JRC B;  3RF1 A;  2WS3 A;  4YHH T;  2OV9 A;  5JDL A;  4XZC A;  3ETV A;  5L3D B;  2XXQ A;  5ABE A;  5AFU L;  1LQC A;  2Z6E A;  3SWH A;  4A56 A;  2GZU A;  2A6C A;  3I1A A;  5FXW A;  3M3Z B;  4QXH B;  3TLW A;  2UUA T;  3Q2M A;  2D0U A;  2R1J L;  5EK4 A;  2BNM A;  1MND A;  3VR8 A;  4EAH A;  4LF7 T;  2JJ9 A;  5IUX A;  4ZI2 D;  1NAF A;  1RZS A;  4I6R A;  3NZQ A;  4AQF C;  1XDP A;  2PXE A;  2B76 A;  3OQO A;  3KV6 A;  1YD8 G;  3GMI A;  3N2G E;  4Z8X A;  1BR2 A;  4I0U A;  2XQA A;  3GZD A;  2IML A;  2NTX A;  4JI3 T;  2WMO A;  4UR9 A;  3CQX C;  2BVL A;  3LQX A;  3BK9 A;  2CPT A;  2PJQ A;  1QP7 A;  3ZHM A;  4ER5 A;  2WDV A;  3I9W A;  4DMV A;  2BS2 A;  5LYJ E;  3OJA A;  3MXZ A;  1OCT C;  3BQK A;  3QNU A;  5A1L A;  1U2Z A;  2YDQ A;  3NRO A;  5DTQ A;  4UIG A;  2ODU A;  5CB4 E;  3EHZ A;  5HCJ A;  2XAJ B;  5LP6 E;  2KLQ A;  5C8Y E;  2ODV A;  4C90 A;  1FMV A;  3UFE A;  2E8I A;  1QB2 A;  3FXE B;  2MQK A;  2LSJ A;  3IBP A;  2RP4 A;  1HNZ T;  1CHU A;  3NWI A;  3AE3 A;  3ZSS A;  1XWM A;  1J5E T;  4I55 E;  2CEA A;  2LEH A;  2WQY A;  2PPX A;  3VRA A;  1KNP A;  2BNN A;  1FIO A;  3BD1 A;  2W2U A;  1JNZ A;  2E9X A;  2WU5 A;  1V9D A;  2UXX B;  5AQG B;  5DQW A;  3QUJ A;  1HTJ F;  4AXP A;  2CHO A;  2VQE T;  2KEI A;  2W00 A;  3T1H T;  3S8Q A;  4Z5D A;  2E5L T;  2XJ3 A;  3AEC A;  4YG4 A;  3AA0 B;  2PTF A;  3MLF A;  1KNR A;  2WDQ A;  4UV9 B;  2CRB A;  2V7L A;  2XTL A;  3EUH A;  3RKO A;  4IDO A;  1LMB 3;  3RC8 A;  2LE8 A;  3IEE A;  2LM9 A;  5HWX A;  2IVQ A;  3RH3 A;  2PUG A;  3KBT A;  5LGN B;  2WDR A;  4O8S A;  4ZHQ E;  3LK3 B;  3RIU C;  2E9X B;  4DVD A;  1T8B A;  3A8Y C;  5ABG A;  2J47 A;  4YTM A;  2XUE A;  5LGU B;  3EAB A;  1JFS A;  2FJD A;  1RIO A;  4BJN A;  4JV5 T;  4IE5 A;  2LOP A;  1WCR A;  2C5J A;  1O3X A;  4GOU A;  3H3M A;  4IE7 A;  2VUR A;  4QH4 A;  4TV8 E;  3OPC A;  5LMN T;  4FBI A;  3A5X A;  4AKG A;  2HCS A;  4E7S A;  1WR6 A;  3U3I A;  2IVG A;  3QYX A;  4PK5 A;  3PUX F;  2X9W A;  4KP3 C;  1ZZ6 A;  1N33 T;  5CA0 E;  2D0T A;  4TWF A;  3FMY A;  3AEE A;  2VWA A;  2A72 A;  2IC6 A;  4EZH A;  1BDI A;  4Z58 A;  4YSZ A;  1X9B A;  3C50 A;  1WLX A;  2NP9 A;  3UFG A;  2XCJ A;  1D1A A;  4DR3 T;  3AEF A;  4O2B E;  1W0B A;  4U74 A;  2CE7 A;  5LHI B;  4LFA T;  2UUB T;  5AQU B;  3UU6 A;  4HWC A;  1HX8 A;  2XM2 A;  4PU4 C;  4TX5 A;  1VRB A;  4TUY E;  3I9Y A;  3AXJ B;  2SPC A;  4HFH A;  1YQ3 A;  2CMR A;  3VHL A;  1ZAY A;  4HEA A;  4WW0 A;  1JNR A;  2BZB A;  3FB2 A;  4JLE A;  5J2U E;  5F5W A;  3RGL A;  1U5P A;  4K0K T;  5IHY A;  4DV6 T;  1R8I A;  4U3C A;  2O4A A;  1ZOY A;  2HH7 A;  3U78 A;  1MMG A;  2PXD A;  1UXC A;  4JUY A;  2HHH T;  2NOX A;  4H63 V;  5IYZ E;  3L39 A;  2PXU A;  4O4L E;  2DHR A;  2IIU A;  4PNI A;  1HF8 A;  2XAG B;  4COF A;  3A9X A;  1H7C A;  3BQI A;  3SCH A;  1D0Z A;  2CXL A;  4PJM A;  5LA6 E;  2XM1 A;  3ZJ1 A;  3CVR A;  5AQK B;  2H7V C;  5HAX A;  1OXZ A;  4QKN A;  1IBM T;  5L3E B;  4ILU A;  3RYF E;  3NXH A;  1XMQ T;  3OMT A;  2KSR A;  1PNR A;  1ZZB A;  2JRK A;  2WM9 A;  2DWG A;  4X66 T;  1ZKE A;  2K48 A;  4WVL A;  2JQE A;  2HSG A;  4MBQ A;  3PTR B;  1LCD A;  3IVP A;  1LKX A;  3CML A;  1HNX T;  3NVO A;  2VKO A;  2HIN A;  1JFT A;  2EWT A;  2PG8 A;  1XNR T;  5M4Y A;  1QP4 A;  4IA8 A;  3G06 A;  3RYI E;  5LG4 A;  3N9N A;  2XXP A;  2A3D A;  2LSK A;  4PK6 A;  3AE9 A;  3C98 B;  4ZS2 A;  2W67 A;  4ZI3 D;  2KIN B;  5KX5 E;  1D1C A;  5JUW A;  1XNQ T;  1IJ5 A;  4LFB T;  1PRU A;  2IDO B;  3PUW F;  4IL9 A;  4WNK A;  2YEV C;  1ZEE A;  3KBU A;  3IF8 B;  2W63 A;  3ONL C;  4I6T A;  2R6G F;  2WWU A;  2CHN A;  3Q5W A;  4OX9 T;  5AQR B;  1ZS4 A;  2XQY A;  2ZM2 A;  4JI5 T;  2OLT A;  2K5B B;  2AXU A;  3CX6 B;  2V3C C;  1LRZ A;  3QOW A;  4F6R C;  3QOF A;  4PU3 C;  4U7Y A;  1Z0P A;  1ZUG A;  2Q9Q D;  1UX5 A;  1HF0 A;  2LYL A;  3P4Q A;  2LHN A;  3PUA A;  4U33 A;  1Y01 A;  3K1S A;  4TV9 E;  2LSY A;  2EHO D;  2E9X C;  3L8R A;  2V1D B;  1FJG T;  3ANW B;  4GHJ A;  5AQJ B;  1SE7 A;  5JDM A;  3K3N A;  4HFE A;  2HPJ A;  4NUU A;  4NUV A;  4QX7 B;  3ZST A;  2M4H A;  3CKD A;  4B3T T;  3UU4 A;  3BDN A;  4HFC A;  1UCU A;  5LCY A;  3ZCI A;  5LMU T;  2VEO A;  3ME5 A;  5DRY A;  2CWO A;  5DQV A;  2OFY A;  4L0R A;  2BDE A;  1R63 A;  3ONJ A;  3ZCJ A;  3R09 A;  4QX8 B;  4TNV A;  3SRZ A;  3VR9 A;  2BG9 B;  5J2T E;  2ODR D;  3I0Q A;  4HGA A;  2PXP A;  3PE0 A;  5FY7 A;  2Y48 B;  2LKH A;  1ZPQ A;  4OFZ A;  2E2A A;  2NW9 A;  4EZ4 A;  2VB6 A;  4IDP A;  2PUC A;  2I0M A;  1MIW A;  1PRA A;  2IU7 A;  4AQF A;  1S7E A;  1EZ3 A;  3S4U A;  1QP0 A;  3H37 A;  1U4Q A;  2AUW A;  3P8C D;  1MMD A;  3ZC0 A;  3A9Y A;  2CBI A;  3FZK B;  3QC9 A;  4YG7 B;  4DR6 T;  3EUS A;  3HL6 A;  2NTY A;  4C91 A;  2MTQ A;  4IVZ A;  2KZ8 A;  4DR1 T;  4UVB B;  2J7W A;  1FMW A;  2B5A A;  3KJX A;  2PFV A;  2N2N A;  1QQB A;  4HKA A;  4IIJ E;  5HEU A;  1MMA A;  4DND A;  3FZL B;  2X0Y A;  1YKE B;  2XQ8 A;  3OWQ A;  2G0U A;  2QYW A;  4XAX B;  3U3W A;  2BJC A;  2ICP A;  3RIF A;  4B3R T;  4MHC A;  4O4H E;  4HWF A;  3OTO T;  1WIZ A;  4P0B A;  3EDU A;  4U72 A;  3LK4 2;  2YDS A;  3FZF B;  5H6Q B;  3AVR A;  3UUL A;  2LOS A;  4I6U A;  3MK7 C;  5BMV E;  4CN6 A;  2LYQ A;  3L3P A;  2KMF A;  5LHG B;  5LJN A;  4E7Z A;  1NER A;  4ZXL A;  3PUZ F;  2QVA A;  3UQ7 A;  1EFA A;  1HQ1 A;  2PUD A;  1QZX A;  2WZI A;  3ANW A;  1MFQ C;  4LF4 T;  5FXZ A;  4UV8 B;  2WY2 A;  5TAO A;  2X0L B;  4Q2J A;  1QUU A;  5HXR A;  4UF0 A;  3TLT A;  4IDN A;  1Y9Q A;  4YBA A;  3HKD E;  3JAF A;  4ZZB A;  3UTK A;  4JCX A;  4IDZ A;  3GA8 A;  2V26 A;  3ZJ2 A;  2X9H A;  5AQL B;  3ZMV B;  2XAQ B;  2UU9 T;  3UU8 A;  1E7P A;  5FKY A;  1HFA A;  3RYH E;  4CXY A;  2B1E A;  3ESL A;  4EKG A;  4ZI2 C;  3AEB A;  3KVB A;  1OED A;  4OHF A;  4ASK A;  3ZT7 A;  4JI1 T;  4GYS A;  2HFZ A;  5JRE A;  3K3O A;  5FL1 A;  3BS3 A;  4DO0 A;  4H9P C;  4HWI B;  3PUY F;  4G2A A;  4DE9 A;  3VKG A;  4A97 A;  4U2Y A;  2C0S A;  3ONX A;  2KEJ A;  3MKD A;  2LKG A;  2FUP A;  4AI6 A;  2VAS A;  1XMO T;  3IA3 A;  2IV1 A;  2IW5 B;  3Q5E A;  5HEJ A;  4X62 T;  2M67 A;  3PJA A;  3RHW A;  3MEJ A;  2V5D A;  4KUM B;  1CQT A;  4BA9 A;  1RPE L;  2CXD A;  5L3C B;  3UFD A;  2WWV A;  2PXL A;  5JDQ A;  2NWB A;  3TRB A;  3DTO A;  1YW0 A;  2BKO A;  4HWH A;  4X5T A;  2JQQ A;  1IAP A;  1L1M A;  4NXM T;  3JC6 D;  5JR9 B;  1T72 A;  1HR0 T;  2PXV A;  4DV2 T;  4YT0 A;  3PU3 A;  1GT0 C;  1JWL A;  3HA4 A;  4Y42 A;  3AE5 A;  1IZN B;  3FZH B;  2XQ5 A;  1E2A A;  3N9L A;  4O8B A;  5FY1 A;  3ZN0 B;  2H88 A;  3AVS A;  1R69 A;  4YSY A;  3RRC A;  3QB5 A;  4PW8 A;  5EK2 A;  4ZOL E;  2XIU A;  1MNE A;  3HKE E;  3TLS A;  3AEG A;  5FVL A;  2JCG A;  4FJO A;  3R1F A;  1M62 A;  2LNM A;  4X4G A;  2KT9 A;  2WU2 A;  2E5V A;  2J4G A;  4WBO A;  1NW3 A;  1OSL A;  5K98 B;  4A5X A;  4UEL A;  1N32 T;  1M7K A;  5LGT B;  3R6N A;  3RIU A;  4LF9 T;  2DI4 A;  3V5U A;  2WCA A;  4Z90 A;  1J1J A;  2KWI B;  2CWY A;  3T8O A;  1ZVV A;  2YU2 A;  3EVY A;  2I6H A;  5GON E;  2PIJ A;  5KDM C;  3JAE A;  2DCF A;  4CI3 B;  3KDS E;  3OYX A;  3P4W A;  4EQZ A;  2ZM8 A;  3A9Z A;  4OYJ A;  3ZPO A;  1OED C;  2AE9 A;  4HN9 A;  3RZZ A;  3O1I A;  2V7I A;  3JC6 C;  4DE8 A;  1VCT A;  3NZL A;  4ISS A;  3F57 A;  2ACX A;  5L3G B;  3G5G A;  2GRL A;  3RIA A;  5LB7 B;  4DV1 T;  5DTM A;  1MMN A;  2NW8 A;  2D5V A;  3IHR A;  2QGS A;  4IDQ A;  2M6B A;  5DAB A;  3TKL B;  3SCG A;  3O9X A;  2X66 A;  3GWH A;  3OP9 A;  4U31 A;  3VRB A;  2ZLY A;  3UUX B;  4PAG A;  2O49 A;  4H9R C;  4H9Q C;  4OYK A;  1WYB A;  3RYC E;  4CXW A;  3HR0 A;  2K3W A;  2GRM A;  4IE0 A;  2UXC T;  5FVK A;  4B3M T;  4A98 A;  3OKZ A;  1HCI A;  5HCM A;  4JI0 T;  5C3J A;  5CFB A;  4JI4 T;  4ER6 A;  3CX7 B;  1WR0 A;  3AEA A;  3SCF A;  3T1Y T;  2WMN A;  4EZI A;  2CM0 A;  1NEN A;  4NXN T;  3GBF A;  3QFI A;  4GK0 E;  2XSB A;  4X1K E;  3QK6 A;  4O4J E;  4TWH A;  3C4X A;  3GZD C;  2BKN A;  1NWM X;  2BVM A;  1UK5 A;  5L3B B;  2HN2 A;  3X1D A;  3LDQ B;  2QA7 A;  4AQG A;  3ZYM A;  3RI5 A;  1WET A;  4H63 H;  3FBZ A;  1AU7 A;  3VWS A;  3AE7 A;  5GAH i;  5LBM A;  2LLW A;  3N5L A;  2X9Y A;  4ILC A;  2W62 A;  1QPZ A;  4X4I A;  1HNW T;  4UF0 B;  1YKH B;  2JVL A;  4OB4 A;  1ZHC A;  4ZS3 A;  1S35 A;  2WP9 A;  4JCY A;  3NKZ A;  5HXE A;  3VK0 A;  1SHZ C;  4O2A E;  4LMJ A;  3SFD A;  5DTR A;  2YOE A;  3ZYK A;  4PU8 A;  1WH6 A;  1POU A;  2P9B A;  1O4X A;  5JTG A;  1CUN A;  2ICT A;  2YK0 A;  4Z59 A;  4CN1 A;  3ZEF B;  5HXH A;  4XBF B;  5HEH A;  3M9L A;  3SS1 A;  5JDF A;  3JAD A;  4UVC B;  2XHE B;  2WZH A;  1LLI A;  4MAL A;  5FP3 A;  1BR4 A;  2VK9 A;  4DV7 T;  4X64 T;  3LSV A;  2CLY B;  4X4C A;  1OED E;  3TLU A;  1WRD A;  3FZM B;  3ZHI A;  2DLR A;  3OYZ A;  5C2T A;  4TZ4 C;  2LYS A;  4IRE A;  2KWH A;  4LML A;  3TEL A;  2K9A A;  4PJL A;  2V6Y A;  3UU5 A;  2V8S V;  3UUB A;  3HZI B;  2YBD A;  4EGW A;  4DUZ T;  4JEU B;  5DRT A;  2HCN A;  1KNZ A;  3KV4 A;  1CJG A;  3QOX A;  4UXN B;  3DP7 A;  4YAR A;  4ZEY A;  4GQM A;  2RA1 A;  5CA1 E;  4U2Z A;  5FNV E;  2L8N A;  3F6W A;  2NW7 A;  4ZZC A;  5AQN B;  5AQM B;  3B7H A;  5LOV E;  3N2K E;  3CIR A;  3R84 B;  2N1G A;  3AE1 A;  2CRO A;  2KND A;  3OVU A;  2W66 A;  4CN4 A;  4QXB B;  5AQV B;  1SA0 E;  2X68 A;  4NIQ A;  4PJJ A;  1I94 T;  4L9I A;  4YSX A;  2LYK A;  2Q9Q B;  3RRW A;  1N36 T;  1UUR A;  2L8K A;  3E22 E;  3C64 A;  4M1P A;  2L9Q A;  1PRV A;  4CXX A;  4L5G A;  3UWP A;  3KV5 A;  3KL4 A;  2FJB A;  2H3R A;  2MXD A;  5HEG A;  4CI2 B;  5JDH A;  3NDB B;  1UUS A;  3KVA A;  5BR8 T;  2C5K T;  2XQ6 A;  2WSS V;  4YTN A;  2QRX A;  3N9P A;  4AIU A;  2XAF B;  3KZ3 A;  2CA5 A;  3UUN A;  3ABV A;  1J5W A;  2PXK A;  3QB5 K;  4AKH A;  5FXX A;  3PUV F;  3PXP A;  5EZY E;  3NRY A;  5LXT E;  2H7O A;  3Q9D A;  2M6I A;  2GK9 A;  2WB5 A;  4LMK A;  4LFC T;  4MFR A;  2IVB A;  2CCQ A;  3ZMZ B;  2AW6 A;  2A9U A;  4YY3 T;  1D0Y A;  1AJ3 A;  4H9N C;  4JI8 T;  2J62 A;  5ABF A;  2EHO B;  1Y64 B;  3KXA A;  4QH5 A;  3ZT6 A;  2LCV A;  4YFS A;  3OQN A;  2V5C A;  3M65 A;  2LHR A;  2BG9 E;  2I59 A;  3F51 A;  4KBM B;  5AQT B;  4JEH B;  3LJC A;  3GN5 B;  1W9R A;  3VKH A;  2LSG A;  3B57 A;  3DJB A;  4J1X A;  2X9X A;  1BR0 A;  2ZMA A;  2IUB A;  2W61 A;  5GAG i;  1FEW A;  3KFW X;  1QSD A;  2JPF A;  1IC8 A;  4I43 B;  3AAE B;  2WUS R;  2JQ9 A;  5AQQ B;  2PXT A;  2RPA A;  1YSE A;  5JQG E;  4HFI A;  4IHJ E;  1KFY A;  4YTP A;  3WI3 A;  1ZZ7 A;  2FJR A;  4HFV A;  3AXJ A;  4EEB A;  5KMG P;  1NEQ A;  2W4X A;  1Z8U A;  2PXQ A;  2A2F X;  2VQF T;  2CLY C;  1SQ8 A;  4EV6 A;  1HG5 A;  3UUM A;  1QLB A;  3MA9 A;  3UQ4 A;  3AAA B;  4ERR A;  1US7 B;  3QF3 A;  5FL0 A;  2OR1 L;  3JXB C;  2UUC T;  4DUY T;  1I6Z A;  5HXS A;  3JXC L;  4CI1 B;  1E3O C;  1WH8 A;  3P7I A;  2JQH A;  1JH9 A;  5JVD E;  4DR7 T;  2LYR A;  3J9X 1;  4G63 A;  4U7I A;  5ABF B;  3P50 A;  2J1D G;  4FI5 A;  3WAK A;  2MEZ A;  2MAW A;  1G73 A;  2LYP A;  3PUS A;  4Q25 A;  2XJ7 A;  2XSD C;  3OKQ A;  5HXC A;  2VKH A;  2VL8 A;  3N2O A;  2D5U A; 
#chains in the Genus database with same CATH homology
 4YHJ A;  3O1J A;  3G7D A;  3RYI E;  2CSF A;  3KDS E;  3FHN A;  3OYX A;  4UEM A;  4WBN E;  2R63 A;  3N9N A;  5LG4 A;  2A3D A;  2LSK A;  5LNK A;  4PK6 A;  3C98 B;  4ZS2 A;  4ZI3 D;  4X4E A;  2ZM8 A;  2KIN B;  4OYJ A;  5KX5 E;  1D1C A;  4QHO A;  3ZPO A;  1HG2 A;  2C5I T;  4X4H A;  1D1B A;  1IJ5 A;  2Q9Q C;  4OK0 A;  4HN9 A;  2EBY A;  3QQ6 A;  3RZZ A;  3D1N I;  5LJM A;  3O1I A;  3PUR A;  2V7I A;  3JC6 C;  1PRU A;  3QWG A;  4WNK A;  4EYU A;  5DJQ C;  3B13 A;  4PK4 A;  3LK2 B;  2YEV C;  2UXN B;  3ZN1 B;  1ZEE A;  3AB3 B;  4ISS A;  3KBU A;  3ZKC A;  3F57 A;  2ACX A;  3IF8 B;  5L3G B;  3G5G A;  2GRL A;  2PUE A;  3AA7 B;  4P0A A;  3PUG A;  4PU7 A;  1DW9 A;  2W63 A;  3CWZ B;  4I6T A;  5FXV A;  4O4I E;  1MMN A;  2NW8 A;  2D5V A;  3IHR A;  2WWU A;  2YIN A;  2QGS A;  3SOL A;  5DAB A;  4I8T A;  1RZR A;  3Q5W A;  3SCG A;  3TKL B;  3O9X A;  4ANJ A;  2X66 A;  3GN5 A;  1ZS4 A;  3GWH A;  3LBX B;  2XQY A;  2ZM2 A;  2K5B B;  2AXU A;  3OP9 A;  1IJ6 A;  3LFP A;  3CX6 B;  1LRZ A;  4F6R C;  4DMW A;  3N9Q A;  2CXF A;  2IAK A;  4ADZ A;  1DWK A;  4PU3 C;  3NZP A;  3O1H A;  2PUF A;  1ADR A;  1Z0P A;  1ZUG A;  2ES0 A;  2Q9Q D;  2ZLY A;  3UUX B;  4PAG A;  2O49 A;  3N9M A;  4H9R C;  2O38 A;  2V7M A;  1UX5 A;  4H9Q C;  1HF0 A;  2LYL A;  2PE5 A;  4OYK A;  2D2S A;  1UXD A;  2LHN A;  1ZZ9 A;  1WYB A;  2DNX A;  3RYC E;  3ZMS B;  4CXW A;  3PUA A;  3HR0 A;  2GRM A;  4X4D A;  4IE0 A;  4BJM A;  5L2L A;  4TV9 E;  5E0O A;  1HS7 A;  2LSY A;  1UX4 A;  2EHO D;  4P09 A;  2E9X C;  3K8P C;  5HWY A;  3WAJ A;  4AKR B;  2V1D B;  4AKL A;  1HCI A;  4YG1 A;  3ANW B;  4GHJ A;  4I4T E;  5ADX L;  1MIV A;  3AA6 B;  3N9O A;  3BQL A;  4HTE A;  4PFO A;  1RZR D;  3CX7 B;  3K3N A;  3PUQ A;  2HPJ A;  3MJX A;  5JDM A;  4J1W A;  5JRC B;  4QXC B;  3OQM A;  4NUU A;  5JR9 C;  3SCF A;  1X57 A;  4NUV A;  4QX7 B;  2WMN A;  3CKD A;  2CM0 A;  3GBF A;  4GK0 E;  4IWR A;  4ZI7 E;  5JDL A;  3BDN A;  4XZC A;  3CPZ A;  3ETV A;  5L3D B;  1UCU A;  4MLK A;  4AKI A;  5LCY A;  2EHO C;  3ZCI A;  2KEK A;  5AFU L;  1LQC A;  4X1K E;  2Z6E A;  3QK6 A;  4O4J E;  3SWH A;  4A56 A;  2GZU A;  2A6C A;  3C4X A;  4GK5 E;  3I1A A;  2CWO A;  5DQV A;  2OFY A;  5FXW A;  1NWM X;  2BVM A;  4L0R A;  5L3B B;  4CQI A;  2W0G A;  4QXH B;  2BDE A;  2QA7 A;  3E08 A;  3RPU A;  3Q2M A;  1R63 A;  5LHH B;  2IUO A;  2D0U A;  3ZYM A;  2R1J L;  2IC9 A;  3ZCJ A;  4AQG A;  5EK4 A;  1WET A;  3H5T A;  4QX8 B;  4H63 H;  3JXD L;  1Y7Y A;  2BNM A;  1MND A;  4IST A;  3FBZ A;  4EAH A;  1AU7 A;  3SRZ A;  4X4B A;  3CQC B;  5J2T E;  2JJ9 A;  3I0Q A;  5LBM A;  4HGA A;  3N5L A;  2X9Y A;  4CZZ B;  2W62 A;  2XAH B;  5FY0 A;  3VU7 H;  4ZI2 D;  1LVK A;  3PE0 A;  1NAF A;  1XWR A;  1QPZ A;  3KIN B;  4IE4 A;  5FY7 A;  1B7T A;  4X4I A;  5JDG A;  1RZS A;  4I6R A;  3NZQ A;  2Y48 B;  3O4X E;  4AQF C;  4UF0 B;  1YKH B;  1ZPQ A;  3CQG B;  2JVL A;  3OQO A;  1BR1 A;  4OB4 A;  2KXP B;  3KV6 A;  1ZHC A;  4OFZ A;  4YJ2 E;  1YD8 G;  4ZS3 A;  4EOZ B;  4BAY B;  3GMI A;  1S35 A;  3KV9 A;  3N2G E;  4Z8X A;  4NDW A;  1BR2 A;  4UVA B;  2NW9 A;  2VB6 A;  4H9O C;  4EZ4 A;  4JCY A;  2NTX A;  1BDH A;  2PUC A;  3H3A A;  2JMH A;  2WMO A;  4KMC A;  3VK0 A;  1MIW A;  5HXE A;  5LBQ B;  1SHZ C;  4O2A E;  3CQX C;  2BVL A;  1PRA A;  3BK9 A;  2IU7 A;  4GIW A;  4AQF A;  1S7E A;  2L3L A;  1EZ3 A;  2V7K A;  3Q5X A;  3S4U A;  1QP0 A;  1ZZC A;  3H37 A;  1U4Q A;  3ZYK A;  4PU8 A;  1LCC A;  1WH6 A;  1X79 A;  2PJQ A;  1POU A;  1QP7 A;  2P9B A;  3ZHM A;  2AUW A;  1O4X A;  3I9W A;  5L3F B;  1CUN A;  2ICT A;  4DMV A;  2YK0 A;  4Z59 A;  5LYJ E;  3OJA A;  3UT5 E;  3MXZ A;  3P8C D;  1MMD A;  1OCT C;  5J1G A;  3ZC0 A;  3BQK A;  3QC9 A;  2AWI A;  3ZEF B;  5HXH A;  4XBF B;  4YG7 B;  3EUS A;  3HL6 A;  2NTY A;  2N9D A;  5JDN A;  2WIU B;  4C91 A;  5A1L A;  3F2E A;  3SS1 A;  2K24 A;  5JDF A;  4UVC B;  2MTQ A;  4IVZ A;  2XHE B;  2H8R A;  4UIG A;  2KZ8 A;  1LLI A;  3ZMU B;  2ODU A;  4MAL A;  4UVB B;  5FP3 A;  1BR4 A;  1FMW A;  2VK9 A;  5CB4 E;  2PUB A;  3D0T A;  2B5A A;  2XAJ B;  5LP6 E;  3KJX A;  2KLQ A;  5C8Y E;  2CLY B;  2ODV A;  2PFV A;  1FMV A;  3UFE A;  4X4C A;  4C90 A;  2E8I A;  3FXE B;  3LBX A;  1WRD A;  2N2N A;  2MQK A;  1QQB A;  2E9X D;  4HKA A;  4IIJ E;  2LSJ A;  3ZHI A;  2DLR A;  3DNV B;  1MMA A;  3IBP A;  4EB6 E;  4DND A;  3OYZ A;  2RP4 A;  5EK3 A;  1KK7 A;  1YKE B;  2G0U A;  2WAU A;  1OWA A;  4XAX B;  3U3W A;  4TZ4 C;  2HPL A;  5JRC A;  2LYS A;  2KWH A;  2BJC A;  4I55 E;  2ICP A;  3RC3 A;  2CEA A;  4HE8 A;  2K9A A;  4MHC A;  2LEH A;  4O4H E;  3E0Z A;  4PJL A;  2PPX A;  2BNN A;  1FIO A;  1WIZ A;  2XI8 A;  3BD1 A;  3HZI B;  4P0B A;  3EDU A;  4U72 A;  3LK4 2;  4JEU B;  2E9X A;  1KNZ A;  4YJ3 E;  2VKJ A;  3KV4 A;  1CJG A;  5H6Q B;  2OA5 A;  3AVR A;  3V5S A;  5A7L A;  3UUL A;  3ZLI A;  1V9D A;  2UXX B;  2LOS A;  4I6U A;  4UXN B;  2VKD A;  3MK7 C;  3DP7 A;  1VOM A;  4YAR A;  2L49 A;  5DQW A;  3ZMT B;  5BMV E;  4GQM A;  1G8X A;  3QUJ A;  2LYQ A;  2RA1 A;  3L3P A;  5CA1 E;  1HTJ F;  2KMF A;  5LHG B;  5LJN A;  4AXP A;  1NER A;  5FNV E;  4E7Z A;  2L8N A;  2KEI A;  3F6W A;  1VPW A;  2NW7 A;  3AA1 B;  2W00 A;  3ETU A;  4TN7 B;  1EFA A;  1D0X A;  2LSI A;  3S8Q A;  2BNO A;  4Z5D A;  5HYA A;  2PUD A;  4K0U A;  3B7H A;  2XJ3 A;  5LOV E;  4YG4 A;  3AA0 B;  3N2K E;  3ANW A;  3MLF A;  3R84 B;  2N1G A;  2CRO A;  4UV9 B;  4ZI3 C;  2KND A;  2V7L A;  2XTL A;  5FXZ A;  3EUH A;  4UV8 B;  3RKO A;  4QXB B;  1LMB 3;  3EDV A;  5TAO A;  1SA0 E;  4IGU A;  2X68 A;  2LE8 A;  1QUU A;  2X0L B;  3IEE A;  5HXR A;  3RC8 A;  2AXZ A;  4PJJ A;  4PJN A;  4UF0 A;  2LM9 A;  1Y9Q A;  4YBA A;  5HWX A;  2IVQ A;  4L9I A;  3RH3 A;  2PUG A;  2YU1 A;  3HKD E;  3KBT A;  4V1A v;  2LYK A;  5LGN B;  2EHO A;  2Q9Q B;  4X20 E;  3RRW A;  4O8S A;  4JCX A;  2L8K A;  3LK3 B;  3UTK A;  2E9X B;  4DVD A;  4ZHQ E;  1S94 A;  3E22 E;  3C64 A;  4M1P A;  4IDZ A;  3GA8 A;  2XUE A;  4PFP A;  2L9Q A;  1PRV A;  2JMK A;  5LGU B;  4CXX A;  1JFS A;  2V26 A;  3FYA A;  4L5G A;  5JR9 A;  3C51 A;  2X9H A;  3ZJ2 A;  1RIO A;  3KV5 A;  4BJN A;  2LT3 A;  3ZMV B;  2H3R A;  4CI2 B;  2XAQ B;  4F8D A;  2MOZ A;  5JDH A;  2LOP A;  4IE5 A;  5JH7 E;  2C5J A;  1O3X A;  2ZM0 A;  4GOU A;  4IE7 A;  1HFA A;  3KVA A;  2C5K T;  3RYH E;  4CXY A;  2WSS V;  1E1H B;  4H9S E;  3ZYL A;  2B1E A;  4TV8 E;  3ESL A;  3HI2 A;  4FBI A;  3FBL A;  3A5X A;  2Y6X A;  4ZI2 C;  3J7Y q;  4AKG A;  2PBI A;  3N9P A;  3CLC A;  3KVB A;  4OHF A;  3RX6 A;  2XAF B;  4ASK A;  4EYY R;  1WYC A;  3KZ3 A;  2MBG A;  4E7S A;  1WR6 A;  2CA5 A;  3UUN A;  3U3I A;  2IVG A;  3QYX A;  4GYS A;  4PK5 A;  2X9W A;  4KP3 C;  1ZZ6 A;  5JRE A;  3HKC E;  3K3O A;  5CA0 E;  4AKH A;  3BS3 A;  2D0T A;  5FXX A;  2V7J A;  3L09 A;  3FMY A;  4H9P C;  4DO0 A;  3PXP A;  5EZY E;  2VWA A;  3NRY A;  2A72 A;  2IC6 A;  4EZH A;  4G2A A;  1BDI A;  5LXT E;  3VKG A;  4X1Y E;  2H7O A;  4IE6 A;  5F8P A;  3LG7 A;  3AAI A;  4Z58 A;  3Q9D A;  2C0S A;  3ONX A;  2KEJ A;  2GK9 A;  3C50 A;  1WLX A;  3MKD A;  2NP9 A;  4N78 D;  4EXT A;  2XCJ A;  1D1A A;  2KZ7 B;  2PUA A;  4MFR A;  4EIW A;  4O2B E;  4U74 A;  2CE7 A;  3NBX X;  2IVB A;  4AI6 A;  2VAS A;  2CCQ A;  5LHI B;  1T98 A;  3ZMZ B;  2AW6 A;  3W15 B;  2DWK A;  2IV1 A;  2X51 A;  2IW5 B;  1HX8 A;  1X2L A;  1D0Y A;  4H9N C;  1AJ3 A;  4PU4 C;  4TX5 A;  2EHO B;  2Q9Q A;  4JQD A;  2M67 A;  1Y64 B;  3KXA A;  1VRB A;  4TUY E;  3I9Y A;  4KUM B;  1CQT A;  2LCV A;  4BA9 A;  4YFS A;  3OQN A;  1RPE L;  2CXD A;  5L3C B;  3UFD A;  2SPC A;  3M65 A;  2LHR A;  4Z5C A;  3HKB E;  3OBV E;  5JDQ A;  2NWB A;  2I59 A;  3TRB A;  2CMR A;  3DTO A;  3F51 A;  4KBM B;  3VHL A;  4JEH B;  1YW0 A;  3LJC A;  3PU8 A;  3GN5 B;  2JQQ A;  3VKH A;  1ZAY A;  2LSG A;  3LIS A;  4HEA A;  3B57 A;  3F31 A;  3DJB A;  4WW0 A;  4J1X A;  4YLH A;  2BZB A;  1IAP A;  2X9X A;  3FB2 A;  4JLE A;  5J2U E;  1BR0 A;  2ZMA A;  1L1M A;  1U5P A;  2W61 A;  4X4F A;  5FYM A;  3JC6 D;  1FEW A;  3LFM A;  3CRO L;  3KFW X;  5IHY A;  1QSD A;  5JR9 B;  2JPF A;  2X67 A;  1IC8 A;  4I43 B;  3AAE B;  1B0N A;  2WUS R;  2O4A A;  1YSE A;  2AXV A;  3PU3 A;  5JQG E;  2HH7 A;  1GT0 C;  3U78 A;  1LVF A;  1MMG A;  1JWL A;  4IHJ E;  3HA4 A;  1UTX A;  1UXC A;  3L1P A;  3C4Z A;  4Y42 A;  4JUY A;  3WI3 A;  1IZN B;  1ZZ7 A;  2FJR A;  2NOX A;  4H63 V;  4HFV A;  1PER L;  3ZC1 A;  5IYZ E;  3N9L A;  4GYR A;  4O8B A;  5KMG P;  2DHR A;  4O4L E;  1NEQ A;  5FY1 A;  3ZN0 B;  4PNI A;  2LYJ A;  2A2F X;  3AVS A;  3F52 A;  1HF8 A;  1R69 A;  2XAG B;  2CLY C;  3RRC A;  4PW8 A;  5EK2 A;  1SQ8 A;  1H7C A;  1ZV4 X;  3BQI A;  2XIU A;  1MNE A;  3HKE E;  4ZOL E;  1HG5 A;  3UUM A;  4DBR A;  3SCH A;  1D0Z A;  2CXL A;  3MA9 A;  4PJM A;  3AAA B;  4J2C A;  5LA6 E;  4ERR A;  2JCG A;  3I0O A;  1US7 B;  4FJO A;  3ZJ1 A;  3CVR A;  3R1F A;  3QF3 A;  4MCT A;  4FN3 A;  2OR1 L;  3FXD B;  3JXB C;  2H7V C;  5HAX A;  1OXZ A;  4QKN A;  4X4G A;  5L3E B;  5HXS A;  2KT9 A;  4ILU A;  3RYF E;  3JXC L;  1QQA A;  4CI1 B;  1MIY A;  4WBO A;  3NRX A;  3OMT A;  3CEC A;  5F3J A;  1PNR A;  2LJL A;  1E3O C;  1WH8 A;  2XAS B;  1OSL A;  5ETW A;  5K98 B;  3P7I A;  3C4W A;  4UEL A;  3PDY A;  1ZZB A;  4I50 E;  1JH9 A;  2MYS A;  1ZZ8 A;  5JVD E;  3R6N A;  5LGT B;  2JRK A;  4Z5H A;  2WM9 A;  5FMN A;  3FYM A;  2LYR A;  2DWG A;  3J9X 1;  4G63 A;  2WBL A;  2DI4 A;  3V5U A;  1ZKE A;  2J1D G;  4FI5 A;  3WAK A;  2MEZ A;  1G73 A;  2LYP A;  2KWI B;  2K48 A;  2CWY A;  2KPJ A;  3T8O A;  3PUS A;  2EF8 A;  2HSG A;  3PTR B;  4MBQ A;  2Y8D A;  1LCD A;  3MZK B;  3IVP A;  1ZVV A;  4B6X A;  1LKX A;  3MAC A;  2XSD C;  4QWN B;  2YU2 A;  3EVY A;  3OKQ A;  5HXC A;  3CML A;  4DBQ A;  3CX8 B;  2VKO A;  2VKH A;  4MCX A;  2HIN A;  4X1I E;  1JFT A;  5GON E;  2VL8 A;  2PIJ A;  5KDM C;  2EWT A;  2PG8 A;  3N2O A;  2DCF A;  3K3Q C;  5H6R B;  4CI3 B;  1QP4 A;  5M4Y A;  4IA8 A;  2D5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...