3GN5B

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
130
Chain Sequence
b'MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAPHPSTIKLLRVLDKHPELLNEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 38
structure length 130
sequence length 131
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5B02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5B01
1QQBA 1QP4A 1BDHA 1PNRA 1RZSA 2OFYA 5A7LA 4X4BA 3OP9A 1X57A 3CECA 3CLCA 4X4FA 1EFAA 4J1WA 3ZKCA 1ZS4A 4Z59A 2XCJA 1VPWA 2PUFA 3SCHA 1JFTA 1AU7A 4I8TA 2O38A 1JWLA 1IC8A 4YG7B 2OR1L 3VK0A 3SCFA 2JCGA 4GQMA 4I6TA 3JXBC 1ZUGA 3QYXA 2AXUA 2EBYA 2GZUA 1BDIA 1WETA 2XSDC 4OB4A 3F52A 1NERA 1XWRA 2AXVA 4IA8A 3LFPA 4I6RA 4PU3C 4X4EA 3QWGA 3GA8A 1LQCA 2MEZA 2XJ3A 3H5TA 2PUDA 4X4DA 2KEIA 4MCTA 1B0NA 4J1XA 2IV1A 3QF3A 3OQNA 1RZRD 3BS3A 2AWIA 4Y42A 1GT0C 2O4AA 4Z5DA 4X4GA 3HZIB 2HINA 2BJCA 1OCTC 3BD1A 2H8RA 2PUEA 4X4CA 3QQ6A 4PU4C 3SCGA 1NEQA 3O9XA 2PUBA 3KXAA 2HSGA 5K98B 4IWRA 1PRVA 2GRMA 4O8BA 3DNVB 1LMB3 2L49A 3LISA 3HI2A 1ZPQA 1Y7YA 1POUA 1YSEA 3F6WA 2CROA 3F51A 2KEJA 4PU8A 1ZZ7A 1ZZ6A 1RPEL 3OMTA 2D5VA 3MLFA 1UXDA 4YARA 3ZHIA 2IVBA 1OSLA 4JQDA 3OQMA 3RZZA 2LYSA 1QP7A 2FJRA 2PUGA 2PIJA 2IUOA 3GBFA 3U3WA 1R69A 1CQTA 3ZHMA 3EUSA 1LCCA 2KEKA 2WIUB 2AUWA 2LYLA 2PUCA 1WH8A 2LYQA 1Y9QA 2IVGA 2JVLA 3FYMA 2PUAA 3S8QA 3TRBA 3KZ3A 4JCXA 1UTXA 2XIUA 1E3OC 3GN5B 2A6CA 2BNNA 3FMYA 4NDWA 4GHJA 1RZRA 1ZZ9A 1WIZA 2PE5A 2KPJA 4IVZA 1PRUA 2ICPA 1O4XA 1PERL 4YG4A 4X4HA 2LYRA 1QP0A 1WH6A 3IVPA 3R1FA 4MCXA 2CSFA 1LCDA 1ZZBA 3D1NI 2PPXA 4Z5HA 3GN5A 3BDNA 2BNMA 2GRLA 2R1JL 1LLIA 1CJGA 3JXCL 3JXDL 2R63A 3G7DA 4X4IA 4YG1A 4PU7A 1ZVVA 1ZZCA 2IVQA 2AXZA 4FBIA 3L1PA 4F8DA 1RIOA 1JFSA 2O49A 2XI8A 2LYKA 4YBAA 2EWTA 1QQAA 1SQ8A 1X2LA 1L1MA 1DWKA 3KJXA 1JH9A 1S7EA 2MQKA 2EF8A 3G5GA 4Z58A 3OQOA 1HF0A 1QPZA 1PRAA 2ICTA 3FYAA 2BNOA 1R63A 4I6UA 1ADRA 1DW9A 3UFDA 4JCYA 2LYJA 2WUSR 1ZZ8A 2LCVA 2B5AA 3CROL 2AW6A 2KZ8A 2L8NA 3PXPA 2IU7A 4FN3A 3B7HA 4Z5CA 1ZAYA 2LYPA 1UXCA
chains in the Genus database with same CATH superfamily
3K3QC 2V7IA 5LJNA 2CHOA 5J2TE 3NBXX 3EDVA 1KEYA 4PNIA 5AQJB 4AKRB 2CWOA 3LK42 2V3CC 3ZT5A 2LNMA 1SHZC 4EKIA 2GZUA 1WYCA 3KVBA 2CLYC 5ABEA 3PJAA 2DNXA 2LHNA 3UUXB 3TLTA 2YDQA 4H9QC 2AE9A 1OEDC 3L09A 4PU4C 4PJNA 1ZKEA 3KXAA 3ANWA 4EGWA 2YEVC 3R6NA 2GRMA 5FMNA 2ZM8A 3CX8B 3V5SA 3OMTA 2KWIB 5FY1A 3PUXF 3HKBE 2DWGA 3FBZA 1Y01A 2I6HA 2XM1A 3RQWA 4EOZB 4EEDA 4DUZT 2WSSV 3P50A 5HYAA 4DV3T 3RIFA 4UIGA 2K48A 3FMYA 2M4HA 3N9MA 3TLSA 3LBXA 2WCAA 1QP0A 3IVPA 4NXNT 2PPXA 4Z5HA 3EUHA 1E1HB 1HS7A 4ZS2A 3JXCL 4Z91A 1MMNA 4CZZB 4QXCB 2QA7A 4HTEA 4U72A 2J7UA 2D5UA 1N32T 4ILBA 1SQ8A 4ZHQE 5IHYA 2MXDA 2WY2A 5LCYA 4ILAA 3PXPA 3CQCB 3N2GE 2HH7A 1QQBA 5CA1E 3NWIA 3UU3A 3PV0F 4DNDA 1BDHA 5IWAT 2ES0A 3L3PA 3RRCA 2W63A 4WW0A 3VKHA 2XCJA 2C5IT 2JCGA 1SUMB 5LBQB 3CIRA 4PAGA 3K3NA 3OQNA 3QB5A 4Y42A 4AKHA 2CA5A 2BJCA 5FXVA 2MPKA 5DQVA 2X0LB 3NZPA 4QX8B 3P4SA 4A98A 3DP7A 1E7PA 2JQQA 5DTMA 1ZPQA 4HFIA 5FNVE 1U5PA 1M7KA 4H9NC 4QH4A 2C5JA 2KNDA 3RZZA 4DR3T 2EHOB 1Z8UA 2FJRA 3EUSA 3FZFB 4HFHA 4KBMB 1J1JA 5ABHA 1D0XA 2E9XD 2M6BA 3TLVA 2BBHA 5DABA 2CWYA 1PRUA 3V5UA 2JJ9A 4MBQA 1S35A 3ZMUB 4HE8A 3VRBA 5JR9B 2IMLA 2ZM6T 2ODVA 4IIJE 2X0HA 3ZYMA 3QOFA 2UXCT 3UTKA 5KXJA 2V5DA 3FXDB 2LSYA 5LOVE 1JH9A 1X2LA 5JDHA 3G5GA 1PRAA 4LMKA 3AE2A 2BNOA 3I9YA 5ABFB 2N9DA 3ZCJA 1XNRT 2V7MA 5JDNA 2WQYA 1HFAA 2L3LA 3ONXA 5AQRB 3C64A 1ZOYA 3EI0A 2H89A 1QB2A 1EFAA 2E5LT 2J1DG 3HKEE 2FJDA 3N2KE 2RA1A 2C5KT 3SR4A 3OBVE 2EBYA 2AXVA 3ABVA 3VKGA 4O8SA 4JUYA 2V26A 2CLYB 2PXLA 2VEOA 2H8RA 1D1BA 3A9XA 1J5ET 1T7SA 5L2LA 3OPCA 3O9XA 3H37A 5DTQA 2VURA 2XAGB 3SWHA 2MBGA 4UVCB 2KSRA 2A9UA 3GMIA 3F6WA 1ZZ7A 5JREA 3RYHE 4H9OC 2VQET 3PUGA 4DV4T 1KK7A 2X9YA 2PIJA 4X65T 3RRWA 1LVKA 2PXDA 1LCCA 2CE7A 4U7YA 1WH8A 1ZV4X 5AQIB 4LFCT 4EV6A 2XSBA 1MIWA 1OEDE 3PURA 5L3GB 2R6GF 3PU8A 3EHZA 2R1JL 4HFEA 3M65A 5FYMA 1KFYA 2MYSA 1QPZA 2LHRA 4WBOA 2B1EA 3ESLA 3OJAA 4Z5CA 2PXBA 2JQKA 2YDSA 4UF0B 3IBPA 4X4BA 5J2UE 3T8OA 1X57A 2XAJB 3PUYF 2QVAA 2VKDA 5HXCA 2UXXB 4HWCA 3ZMZB 2JQHA 4IDQA 2X9WA 3LFMA 1M62A 1WETA 4ZZBA 2VKOA 3WAJA 5L3BB 3TELA 1WR6A 5DRTA 1X79A 2PJQA 4LF7T 4YT0A 4EYYR 4IWRA 3CKDA 3J7Yq 3O1HA 5FL0A 3LISA 4QX7B 2HCSA 1RPEL 3ONJA 5HAXA 5AQTB 3MLFA 4JYAT 3NRXA 1MNDA 1QP7A 4DV1T 2NW8A 2XQ5A 3RF1A 1CQTA 2HCNA 5J0ZA 3LJCA 1D0YA 4HGAA 4DV7T 4QH5A 5C8YE 2LT3A 3PUQA 3KZ3A 1XDPA 4H63V 3SS1A 4GHJA 4F8HA 2KPJA 3VU7H 2BS4A 3ZCIA 2CSFA 1LCDA 2YK0A 4CXXA 5A1LA 3HKCE 4H63H 4PK5A 4JEHB 2NWBA 3G7DA 2XSAA 4NXMT 4DUYT 5JDLA 4TN7B 5LGUB 2E9XB 4EZIA 2MOZA 3ZC1A 1S7EA 2EF8A 4Q2JA 3FYAA 4P0AA 4I6UA 3CPZA 4OYJA 2CEAA 2FUPA 3PUWF 4TWDA 2AW6A 3EDUA 4U7IA 4UEMA 4ADZA 4U74A 4QXHB 3DM5A 3WAKA 4WBNE 4J1WA 3ZKCA 2ZM2A 1YKHB 2NOXA 2W00A 3OYZA 3I9WA 4DR5T 3R84B 3QOXA 2PBIA 2XSDC 3UUMA 3ZT7A 4X4EA 3AE6A 2M6IA 2KEIA 4JEUB 3BS3A 2XAQB 1YW0A 3RPUA 2Q9QD 2WZHA 5CA0E 4IDZA 5FL1A 4HWFA 3P4PA 2DHRA 4TNWA 4YARA 4HEAA 3EABA 3LSVA 5DJQC 1R69A 4L0RA 3W15B 3KV9A 5FXZA 3A5XA 2LYQA 3AAAB 4X5TA 4A56A 4I50E 5E0OA 3T1YT 2X66A 4Z8XA 1E2AA 1XZYA 2VVSA 5F3JA 3JC6C 2X9XA 3KBTA 3N9PA 2V5CA 3QOWA 4DO0A 5AQVB 2O49A 2A72A 4EIWA 4XAXB 3B13A 3VHLA 4DR7T 3UWPA 4FJOA 2XQ3A 5JR9C 4LMJA 1HR0T 4NIQA 3GZCA 4JCYA 1VRBA 2H88A 2V7LA 5FXWA 4I4TE 2WP9A 1VOMA 2YU2A 2XAFB 4QH1A 4QKNA 3FXEB 1RZSA 1IJ6A 4JI8T 3OP9A 3CECA 5EK2A 2PUFA 5GAGi 1UURA 3UU5A 3FZKB 3ZMSB 3Q2MA 4ER6A 2YBDA 1LKXA 4HFCA 3WI3A 3K8PC 4IT4A 3QWGA 2XQ6A 5M4YA 2MEZA 4DBQA 4DR6T 4MCTA 4YTMA 2IV1A 2XQYA 2LSJA 5BMVE 2BG9A 4AQYT 5K98B 3I0OA 1I94T 5HWXA 1W09A 1LMB3 3A8YC 5JDMA 3ME5A 5LXTE 4CXYA 3I0QA 2D5VA 1UXDA 1WLXA 3OQMA 4AQFA 3RX6A 2PUGA 4IE4A 3UT5E 1HNWT 3PUAA 4IE6A 3CQGB 2I59A 2Y48B 5LG3A 2OA5A 2YOEA 4JCXA 2NW9A 3U78A 3IF8B 1D0ZA 3K3OA 4JI0T 3AEBA 3OTOT 1BR1A 4BA9A 4LF9T 1H7CA 4MCXA 3RIUC 2LSKA 5L3CB 3D1NI 2XM2A 2AXZA 3L8RA 3ZN0B 4PJMA 5LNKA 5BR8T 2QRXA 3OQOA 1YQ3A 2IC6A 3UUNA 3FBLA 2L8KA 2KXPB 3UFDA 1WR0A 2Q9QA 5EK3A 2XY8B 5LP6E 2KZ8A 2UXDT 2VVNA 2V7JA 1V9DA 2BG9E 3Q9DA 3G0TA 1QZXA 1QP4A 1XMOT 3RC3A 4IE7A 4KP3C 3F57A 5AQHB 5FVLA 2XAHB 3ETUA 3VR8A 2CXDA 3CMLA 2QGSA 5AQMB 2W4XA 3ANWB 2J47A 4Z5DA 5L3FB 5DSXA 2EHOA 4YHJA 1NEQA 2BS2A 4OBMA 2PUBA 4AKIA 4DBRA 2JMKA 2K9AA 2A3DA 4P1NA 2G0UA 1Y7YA 3TEPA 1YKEB 4ZS3A 5LHHB 3E08A 4JV5T 2UUCT 4LFBT 4YHHT 3JADA 3ZHMA 4BJNA 2HPJA 4U31A 4AKGA 2IAKA 1N34T 2KEKA 2HN2A 3UFEA 2W62A 5AQLB 3X1DA 1Y9QA 4O4IE 3J9X1 3ETVA 2JQ9A 5LMNT 4OK0A 4U2YA 3QB5K 3JAFA 3JCFA 3Q5EA 1R8IA 2PXFA 2PXKA 4LF6T 3O1JA 4O4JE 3CK6A 2E8IA 2VB6A 3F2EA 2CBJA 4YFSA 2X68A 3GZDC 1ZZ8A 1OWAA 3TKLB 4FN3A 2BKOA 4PJJA 5DTRA 2BS3A 5AQGB 3N9LA 2E9XC 2VWAA 3AE1A 2FBWA 4O2AE 2JMHA 3BQKA 1VPWA 2HHHT 2M67A 1SE7A 1WFDA 3CX6B 4YG7B 2OR1L 2CRBA 4K0UA 4A97A 4DV6T 4ILUA 3AE5A 5FY7A 4IA8A 2C0SA 1LQCA 1OEDA 2XQ8A 4MALA 3SFDA 2PUEA 4YTNA 4B3ST 3PDYA 3P7IA 3QNUA 2ACZA 3HI2A 2CCQA 2GK9A 4Q25A 4P0BA 2BKPA 4ERRA 1BR2A 5JRCB 4TV8E 3EAMA 2D2SA 3VRAA 4DMWA 3GBFA 3AXJA 3Q5WA 2XQ9A 2BBJA 2AUWA 4CN6A 3P4RA 5ADXL 2NTYA 2LKGA 4YLHA 2BNNA 1UX4A 3UFGA 2BVMA 1XMQT 3AA1B 1ZP0A 2R63A 3ZN1B 3RKOA 4PU7A 3RGLA 3SFEA 1W9RA 2PXTA 4EZHA 1B7TA 2LYKA 2PXQA 3KJXA 4ER0A 5LGNB 4Z58A 2I0MA 2V6YA 3CX7B 2RPAA 1MNEA 2B5AA 3I1AA 3AE4A 5C2TA 4HKAA 2ODRD 4KI0F 1HNZT 1PNRA 1HX1B 4YJ3E 4B6XA 3T1HT 1L0VA 4X4FA 1NAFA 2N2NA 4JI4T 5CGMA 2ZMAA 2UUAT 3O1IA 1VCSA 1IBLT 3ZJ2A 3S4UA 4DVDA 3LFPA 2HPLA 3MACA 4LF4T 2L1PA 4ASKA 5JDGA 1HX8A 2KT9A 1ZEEA 2IC9A 1YQ4A 5LJMA 5LA6E 1OCTC 3BD1A 4PJLA 3MEJA 3NRYA 5TAOA 3AECA 2WDQA 3N9QA 2Z6EA 2YINA 4JI7T 4PU8A 3HKDE 3Q5XA 2FFHA 3B5MA 5L3EB 4YSXA 1SA0E 2CXLA 4CXWA 5L4HA 1HNXT 3LDQB 4HN9A 2DL1A 2FJAA 4E7ZA 4WYVA 3TRBA 5DT2A 3IEEA 5FVKA 2XASB 4GKJT 2WMNA 1LVFA 1UGOA 2KZ7B 3AB3B 5EK4A 2LM2A 2J7WA 1FEWA 4AI6A 4IE0A 5IYZE 1JNRA 5LYJE 3RC8A 2FJEA 1GQEA 2ACXA 4UR9A 1HCIA 1ADRA 4BAYB 1HG5A 1AJ3A 3ZKRA 1WYBA 4AISA 3CROL 2IU7A 2HN1A 3OYXA 4TV9E 3B57A 3NKZA 2BVLA 3RYFE 1IAPA 1IBMT 2BZBA 5LGTB 5LG4A 2VKJA 4COFA 1Z0PA 3L39A 3CLCA 2PXUA 3UU8A 4G2AA 1JWLA 3AEEA 4GQMA 1HTJF 5CJ5A 3ZSTA 1BR4A 1CHUA 4HWDA 4ZZCA 4DMVA 3QYXA 4L5GA 5L3DB 2CXFA 2XJ3A 4KHZF 4UVAB 3QF3A 5KDMC 2SPCA 4G63A 2XUEA 5JUWA 5GONE 3AVRA 2NTXA 3O4XE 4GKKT 4GK0E 3AA6B 3DNVB 2XXPA 4ISTA 1POUA 2XTLA 2FJBA 3HR0A 1OSLA 3ZHIA 1U4QA 4CN4A 4DR2T 4KMCA 2K5BB 2WWUA 3PUVF 4C91A 4GYSA 2PUAA 4M1PA 4DV2T 2XHEB 2UXBT 3UUBA 4NUVA 5HXRA 1O4XA 1W0BA 3TLUA 2VL0A 5JDQA 3GN5A 4Z90A 2CM0A 5F5WA 5AQFB 3JXDL 3A9ZA 4AQGA 1WCRA 2D0UA 1RIOA 3IA3A 3SOLA 3ZT6A 4FI5A 1XDOA 4JLEA 4A5XA 1QQAA 3MJXA 1L1MA 3LG7A 1HF0A 2IDOB 2ICTA 2WWVA 2EHOD 1O3XA 3LK3B 3IHRA 4U2ZA 2D0TA 2WMOA 3PJAJ 2H3RA 1FMVA 3N9OA 1ZS4A 4EEBA 4I8TA 2JIWA 2V6XA 3P4WA 1BR0A 1KNRA 2LE8A 3KV5A 2K3WA 3BK9A 5ETWA 4I6TA 2CHNA 4QHOA 1NERA 1T72A 4I6RA 1UX5A 1I6ZA 3H3AA 3OVUA 4ISSA 5HCJA 3SX0A 3HL6A 2O4AA 1GT0C 5FY0A 3QK6A 2HINA 3VWSA 3KBUA 4ZI3D 4YY3T 3C4WA 5CB4E 4YXDA 4LF8T 2UXNB 2Y8DA 3CWZB 4V1Av 5HEJA 4O4HE 1QUUA 2PFVA 4NPPA 2LYSA 2JRKA 4ZI2C 2Y6XA 2XXQA 3C4ZA 5ABGA 3ZJ1A 3RIAA 5HXHA 2LYLA 3KL4A 2DWKA 4GK5E 3S8QA 1QSDA 2DCFA 4CI2B 5LHIB 4L9IA 2A6CA 1MMGA 1YD8G 5J1GA 1RZRA 3R09A 3ONLC 4X4HA 5HCMA 2QYWA 3G06A 3AA7B 1ZZBA 4CQIA 2GRLA 4DE8A 3A9YA 3PE5A 4DR4T 4YG1A 4ZOLE 1ZZCA 4PK4A 4IL9A 1UK5A 1G8XA 2LKHA 4HFVA 3RQUA 4TZ4C 1MMDA 2V1DB 2WU5A 2IHR1 3NVOA 2NW7A 2LLYA 3UULA 2LYJA 3KV6A 3C50A 3RHWA 4HFBA 3OKQA 3RKGA 4EZ4A 2LJLA 2NR4A 4IDOA 3SCHA 5JH7E 3GUUA 1JFTA 1AU7A 2XQAA 3LK2B 3SRZA 4OFZA 3JXBC 3M3ZB 3AE9A 3CVRA 2BG9B 4X4DA 1B0NA 2CMRA 4X4GA 1WRDA 5LMUT 4OYKA 4H9SE 3TFLA 5DRYA 1PRVA 1J5WA 3F51A 1NWMX 2VK9A 3F31A 2IVBA 4JQDA 2JPFA 2IUOA 5LHGB 2VASA 2W67A 3QC9A 4UV9B 4P09A 4MLKA 4KHPT 3HA4A 2JVLA 3AEAA 4DE9A 2RP4A 4WVLA 4TX5A 1UTXA 2XIUA 3AE8A 4ZEYA 3UQ4A 4NUUA 3FZLB 4IVZA 4ER3A 5AQUB 3NZLA 2VQFT 3ZYKA 1X9BA 1NENA 3AA0B 2XXAA 1ZVVA 4OHFA 4FBIA 1UUSA 3LBXB 4DIDB 5JR9A 2Q9QB 2EWTA 5AFUL 2MQKA 2DI4A 4DR1T 3C98B 3NZQA 2XPKA 1R63A 1T98A 2N1GA 4QWNB 3C51A 2LCVA 4B3TT 2KLQA 2UU9T 4DV5T 1ZAYA 4YSZA 2PTFA 4ER5A 3AEDA 3C4XA 5ABFA 3CQXC 3K1SA 2LSIA 4PW8A 4Z59A 2BKNA 2O38A 5IUXA 4PFOA 2BDEA 2AXUA 1BDIA 4O4LE 4X1IE 4B3MT 5CFBA 4EB6E 4CI1B 1U2ZA 3A7MA 4AKLA 4JI6T 2XQ7A 5GAHi 5JRCA 3HZIB 2ZM0A 4X66T 4QXBB 4UV8B 3QQ6A 1ZHCA 2V8SV 2YU1A 4HFDA 2J4GA 4JI2T 5FP3A 3KINB 4I55E 4MHCA 2CROA 2W61A 5AQQB 2IIUA 2MTQA 4IHJE 2H7OA 3ZMVB 5AQNB 3FHNA 3MZKB 2IVGA 3FYMA 4J2CA 4UELA 2DLRA 2PG8A 2J62A 4H9PC 5FKYA 3QFIA 2W0GA 3RIUA 2PE5A 2OV9A 2XJ7A 2ICPA 3E22E 3R1FA 4HWIB 4U3CA 3BDNA 2XZEA 4EK9A 4X4IA 1NEKA 2IVQA 1EZ3A 4EYUA 2X67A 2JQEA 5HEGA 1MIYA 4YTPA 3KV4A 2LSGA 1NW3A 2LLWA 3TLWA 4YJ2E 3N2OA 3VR9A 4I0UA 3MKDA 3GWHA 2LLVA 1N33T 3AEGA 2E2AA 3EVYA 2E5VA 4UF0A 1OEDB 3MXZA 3PU3A 3UU4A 4LMLA 3RI5A 4F6RC 4TNVA 1ZUGA 4WZXA 5AQKB 1G73A 1XWRA 3D0TA 5AQOB 1Y64B 3GA8A 3H5TA 4UVBB 2PXEA 4DV0T 2PXVA 3DJBA 4MFRA 4O2BE 3ZPOA 2WAUA 4X4CA 4O8BA 2D9DA 2XQ4A 4EQZA 2L49A 4X1KE 2X0YA 4X20E 3AXJB 3KVAA 2LRKA 1ZZ6A 5L47A 5AQSB 3RLFF 4PFPA 1XNQT 1VCTA 2WIUB 2LRLA 1KNPA 4IE5A 4N78D 2UUBT 4X64T 1MIVA 3RYIE 1E3OC 2WBLA 2LOPA 1D1AA 5JVDE 1D1CA 3LQXA 1HQ1A 3FZHB 2LYRA 2IW5B 4I43B 2VKHA 1LLIA 4PK6A 4ZXLA 5HXEA 2L9QA 2V6YB 2VL8A 3FZMB 3ZC0A 1JFSA 4XZCA 1DWKA 3ZEFB 1DU2A 3GZDA 2A2FX 5H6RB 4JI3T 4GYRA 4X1YE 2WUSR 3OWQA 2IUBA 1IZNB 2E9XA 3UU6A 2YKSA 3MA9A 1S94A 2OFYA 3AEFA 2X9HA 4UXNB 1UCUA 2ZLYA 3SCFA 3BQIA 3F52A 5AQPB 4JBWF 4TUYE 3PUSA 4GOUA 4K0KT 4X62T 4IDPA 2X51A 4J1XA 1RZRD 4AIUA 4CI3B 2AWIA 5HEOA 5C3JA 3ZPXA 3RH3A 2CBIA 4EKGA 2WDRA 3U3IA 2HSGA 3AVSA 3ZLIA 3KFWX 2HFZA 1KNZA 1YSEA 2BG9C 2KEJA 2H7VC 3AE7A 4LFAT 4CN1A 4B3RT 4ANJA 4AXPA 5HEUA 1OXZA 4YSYA 4AQFC 5KX5E 4H9RC 3DTOA 3NXHA 4KX6A 2YDRA 2F4VT 4NDWA 3AAIA 4GIWA 1WIZA 3N9NA 1PERL 4YG4A 3FB2A 1IBKT 2K24A 1WH6A 2WU2A 1QLBA 4IGUA 4LF5T 1LRZA 1CJGA 4BJMA 1FJGT 3P8CD 5DQWA 3Q5DA 4OX9T 5HXSA 1FMWA 3BQLA 4TWFA 2CPTA 4YBAA 1US7B 2KINB 1HF8A 2NP9A 4EAHA 1DW9A 3M9LA 4WNKA 3B7HA 2LYPA 4KUMB 1UXCA 1KF6A 4IREA 2Q9QC 5A7LA 3NDBB 1FIOA 5JTGA 1MMAA 2LM9A 5H6QB 4IDNA 2ODUA 3JAEA 5EZYE 1IC8A 4HRAA 3VK0A 5LBMA 3OKZA 4OB4A 4JI5T 2KMFA 2WB5A 4PU3C 2WS3A 2PUDA 2WZIA 3PE0A 5HWYA 4HWHA 3JC6D 3MK7C 3SCGA 2WDVA 3NROA 3E0ZA 1XWMA 5F8PA 2EHOC 4ILCA 4ZI7E 3N5LA 5KMGP 1N36T 2W2UA 3RYCE 2OLTA 1YXRA 1DULA 4E7SA 3ZMTB 2PXPA 3U3WA 2AXDS 3QUJA 2LEHA 1W0AA 5L4EA 2PUCA 2YN6A 2WM9A 1T8BA 4U33A 3GN5B 1ZZ9A 1MFQC 3P4QA 3PTRB 4IL4A 4ER7A 3KDSE 2V7KA 4EXTA 5JDFA 2KWHA 5JQGE 4XBFB 2MAWA 2BNMA 3AE3A 3ZYLA 1JNZA 4ZI2D 1HG2A 4ZI3C 3AAEB 3L1PA 5LB7B 4F8DA 2XI8A 5FXXA 3UQ7A 1IJ5A 2LOSA 1CUNA 3H3MA 2W66A 4TWHA 5HEHA 4JI1T 2P9BA 3ZSSA 2L8NA 4C90A 2B76A 3PUZF
chains in the Genus database with same CATH topology
3K3QC 4HKAA 4QXHB 3WAKA 3C4XA 2V7IA 1PNRA 3CQXC 5LJNA 5J2TE 4YJ3E 3NBXX 3EDVA 2LSIA 4PNIA 4X4FA 4PW8A 4B6XA 4J1WA 3ZKCA 4WBNE 4Z59A 1NAFA 2CWOA 2ZM2A 3LK42 2N2NA 4AKRB 1YKHB 2NOXA 2O38A 2W00A 3OYZA 2ZMAA 1SHZC 3I9WA 4PFOA 2BDEA 3R84B 3O1IA 3ZJ2A 2AXUA 2GZUA 1BDIA 1WYCA 2CLYC 2PBIA 2XSDC 3KVBA 4O4LE 4X1IE 3S4UA 3UUMA 4DVDA 3LFPA 2DNXA 2HPLA 3MACA 4X4EA 2LHNA 3UUXB 4ASKA 4EB6E 4CI1B 5JDGA 2KEIA 1HX8A 4JEUB 3BS3A 2KT9A 4AKLA 1ZEEA 4H9QC 2IC9A 5LJMA 5JRCA 3HZIB 2XAQB 2ZM0A 1OCTC 5LA6E 3BD1A 1YW0A 4PJLA 4QXBB 3RPUA 2Q9QD 3L09A 4UV8B 3QQ6A 4PU4C 3NRYA 4PJNA 1ZKEA 1ZHCA 2YU1A 5TAOA 3KXAA 3ANWA 5CA0E 4IDZA 2YEVC 3R6NA 2GRMA 5FMNA 3N9QA 2Z6EA 2YINA 2ZM8A 3KINB 5FP3A 4I55E 4MHCA 2CROA 3CX8B 4PU8A 3HKDE 2W61A 3OMTA 3Q5XA 3V5SA 2DHRA 2KWIB 5FY1A 4YARA 3HKBE 2MTQA 4HEAA 4IHJE 2DWGA 3FBZA 5L3EB 5DJQC 1SA0E 2CXLA 4CXWA 1R69A 4L0RA 4EOZB 2H7OA 3W15B 3ZMVB 3KV9A 5FXZA 3A5XA 3FHNA 4HN9A 3MZKB 2LYQA 3AAAB 2IVGA 3FYMA 4J2CA 4UELA 4A56A 4E7ZA 2DLRA 2PG8A 4I50E 3TRBA 5E0OA 2WSSV 5HYAA 4H9PC 4UIGA 2X66A 2K48A 3FMYA 4Z8XA 3IEEA 2XASB 2W0GA 2WMNA 3N9MA 2PE5A 2ICPA 3LBXA 1LVFA 2KZ7B 3E22E 1QP0A 3IVPA 3R1FA 3AB3B 5EK4A 2PPXA 4Z5HA 3BDNA 1E1HB 3EUHA 1HS7A 4ZS2A 5F3JA 3JXCL 3JC6C 4X4IA 1MMNA 2X9XA 3KBTA 4CZZB 3N9PA 4QXCB 1FEWA 2IVQA 4AI6A 1EZ3A 4IE0A 5IYZE 4EYUA 2QA7A 4HTEA 4DO0A 2O49A 4U72A 2A72A 2D5UA 4XAXB 3B13A 4EIWA 2X67A 5LYJE 3VHLA 1MIYA 3RC8A 1SQ8A 4FJOA 4ZHQE 5JR9C 2ACXA 1HCIA 1ADRA 4BAYB 5IHYA 3KV4A 1HG5A 1AJ3A 2LSGA 4JCYA 1VRBA 1WYBA 2V7LA 5FXWA 4I4TE 5LCYA 3CROL 3PXPA 2IU7A 1VOMA 2YU2A 3CQCB 3N2GE 3OYXA 4TV9E 2XAFB 2HH7A 3B57A 2BVLA 1QQBA 1IAPA 3RYFE 4QKNA 5CA1E 2BZBA 5LGTB 5LG4A 4DNDA 4YJ2E 3N2OA 1BDHA 2VKJA 1RZSA 1IJ6A 3FXEB 3OP9A 1Z0PA 2ES0A 3MKDA 3L3PA 3CECA 3CLCA 2W63A 4WW0A 3RRCA 5EK2A 3VKHA 2XCJA 2PUFA 3GWHA 4G2AA 1JWLA 3EVYA 2C5IT 4UF0A 3MXZA 3PU3A 2JCGA 4GQMA 1HTJF 3ZMSB 1BR4A 3Q2MA 5LBQB 4F6RC 4DMVA 3QYXA 1ZUGA 4L5GA 1LKXA 1G73A 5L3DB 1XWRA 3WI3A 3D0TA 3K8PC 2CXFA 1Y64B 3QWGA 3GA8A 4PAGA 5M4YA 2MEZA 2XJ3A 3H5TA 4DBQA 3K3NA 4UVAB 4MCTA 3OQNA 2IV1A 3QF3A 5KDMC 2SPCA 4Y42A 4UVBB 2XQYA 2LSJA 4G63A 4AKHA 2CA5A 2BJCA 5FXVA 2XUEA 3DJBA 4MFRA 4O2BE 3ZPOA 2WAUA 4X4CA 5DQVA 5BMVE 2X0LB 5GONE 3AVRA 3NZPA 4QX8B 2NTXA 5K98B 3O4XE 3I0OA 4GK0E 3AA6B 4O8BA 3DNVB 5HWXA 1LMB3 3DP7A 2L49A 4X1KE 2JQQA 4X20E 1ZPQA 4ISTA 5FNVE 1POUA 2XTLA 3HR0A 3KVAA 5JDMA 5LXTE 4CXYA 3I0QA 1ZZ6A 1U5PA 4H9NC 2D5VA 1UXDA 1OSLA 3ZHIA 1U4QA 1WLXA 2C5JA 2KNDA 3OQMA 3RZZA 4KMCA 2EHOB 4AQFA 3RX6A 2FJRA 2PUGA 4IE4A 3UT5E 2K5BB 4PFPA 2WWUA 3EUSA 3PUAA 4C91A 4IE6A 2WIUB 3CQGB 4GYSA 2I59A 2Y48B 4KBMB 2PUAA 1D0XA 2OA5A 4M1PA 4IE5A 4N78D 2E9XD 4ADZA 4JCXA 1MIVA 2NW9A 3IF8B 1E3OC 1D0ZA 2WBLA 2XHEB 3K3OA 3RYIE 3U78A 1BR1A 2LOPA 4BA9A 1D1AA 4NUVA 5HXRA 5JVDE 5DABA 1D1CA 2CWYA 1PRUA 1O4XA 3V5UA 1H7CA 2JJ9A 4MBQA 2LYRA 1S35A 3ZMUB 4HE8A 2IW5B 4MCXA 2LSKA 5JR9B 5L3CB 5JDQA 3D1NI 4I43B 2VKHA 3GN5A 2ODVA 2CM0A 4IIJE 1LLIA 3JXDL 4PK6A 5HXEA 2L9QA 4AQGA 3ZYMA 2VL8A 2AXZA 3ZC0A 2D0UA 3UTKA 1RIOA 1JFSA 3ZN0B 3SOLA 4PJMA 3FXDB 5LNKA 2LSYA 4FI5A 4JLEA 4XZCA 1QQAA 5LOVE 3MJXA 1X2LA 1L1MA 1DWKA 1JH9A 3LG7A 3ZEFB 5JDHA 3G5GA 3OQOA 1HF0A 2A2FX 5H6RB 1PRAA 2ICTA 2IC6A 2BNOA 3I9YA 3FBLA 2L8KA 3UUNA 4GYRA 4X1YE 2N9DA 2KXPB 3UFDA 3ZCJA 2WUSR 2EHOD 1O3XA 3LK3B 3IHRA 2Q9QA 5EK3A 5LP6E 2KZ8A 1IZNB 2E9XA 2V7JA 2V7MA 1V9DA 5JDNA 1HFAA 3Q9DA 2D0TA 1QP4A 2L3LA 2WMOA 3MA9A 1S94A 3ONXA 2OFYA 3RC3A 3C64A 2H3RA 4IE7A 2X9HA 4KP3C 3F57A 1FMVA 3N9OA 1EFAA 1ZS4A 2XAHB 4UXNB 2J1DG 4I8TA 3HKEE 3N2KE 1BR0A 1UCUA 2LE8A 3KV5A 2RA1A 2ZLYA 3SCFA 3BK9A 2C5KT 3ETUA 5ETWA 4I6TA 4QHOA 3OBVE 2CXDA 2EBYA 3CMLA 2QGSA 3BQIA 3F52A 1NERA 2AXVA 4TUYE 4I6RA 1UX5A 3H3AA 3PUSA 4GOUA 4ISSA 3VKGA 3ANWB 4O8SA 2X51A 4JUYA 2V26A 3HL6A 4J1XA 1RZRD 2O4AA 2CLYB 1GT0C 2AWIA 4CI3B 5FY0A 4Z5DA 3QK6A 2HINA 2H8RA 1D1BA 5L3FB 3KBUA 3RH3A 2EHOA 5L2LA 4YHJA 1NEQA 3O9XA 3H37A 2PUBA 4ZI3D 4AKIA 3U3IA 2JMKA 4DBRA 2HSGA 3AVSA 2K9AA 2XAGB 3SWHA 3C4WA 2MBGA 3ZLIA 2A3DA 3KFWX 4UVCB 5CB4E 1KNZA 2G0UA 1Y7YA 1YSEA 3GMIA 3F6WA 2KEJA 2H7VC 2UXNB 2Y8DA 1ZZ7A 3CWZB 4V1Av 1YKEB 4O4HE 3RYHE 1QUUA 2PFVA 4H9OC 4ZS3A 4ANJA 5LHHB 5JREA 3PUGA 3E08A 2LYSA 4AXPA 1KK7A 2X9YA 2JRKA 2PIJA 4ZI2C 3ZHMA 4BJNA 2Y6XA 3RRWA 3C4ZA 1OXZA 1LVKA 1LCCA 2HPJA 2CE7A 3ZJ1A 4AKGA 4AQFC 2IAKA 5HXHA 2KEKA 3UFEA 5KX5E 4H9RC 2W62A 2LYLA 2DWKA 1WH8A 1Y9QA 3DTOA 4GK5E 3S8QA 4O4IE 1QSDA 1ZV4X 2DCFA 4CI2B 5LHIB 3J9X1 4L9IA 3ETVA 2A6CA 1MMGA 4NDWA 1MIWA 1YD8G 3AAIA 5J1GA 4GIWA 1RZRA 1WIZA 4OK0A 3N9NA 3PURA 1PERL 4YG4A 4X4HA 3FB2A 2K24A 1WH6A 3AA7B 1ZZBA 4CQIA 5L3GB 3PU8A 4IGUA 2GRLA 2R1JL 1LRZA 1CJGA 3M65A 4BJMA 4YG1A 4ZOLE 1ZZCA 3P8CD 5DQWA 4PK4A 1G8XA 5HXSA 3O1JA 1FMWA 3BQLA 4HFVA 5FYMA 2MYSA 4O4JE 4TZ4C 1MMDA 4YBAA 1US7B 2V1DB 2KINB 2E8IA 1HF8A 1QPZA 2NP9A 2NW7A 2LHRA 4EAHA 2VB6A 4WBOA 3F2EA 3UULA 1DW9A 4YFSA 2LYJA 2X68A 3C50A 2B1EA 3KV6A 1ZZ8A 3ESLA 1OWAA 3OJAA 3TKLB 4WNKA 4FN3A 3OKQA 3B7HA 4Z5CA 2LYPA 4KUMB 1UXCA 4UF0B 4PJJA 2Q9QC 3IBPA 4EZ4A 3N9LA 5A7LA 4X4BA 2E9XC 2LJLA 2VWAA 3T8OA 5J2UE 1X57A 1FIOA 2XAJB 2JMHA 4O2AE 3BQKA 1VPWA 1MMAA 2LM9A 2VKDA 5HXCA 3SCHA 5H6QB 1JFTA 1AU7A 2M67A 2UXXB 2ODUA 5JH7E 5EZYE 1IC8A 3ZMZB 3CX6B 4YG7B 2OR1L 3VK0A 4K0UA 3LK2B 3SRZA 4OFZA 5LBMA 3JXBC 2X9WA 3LFMA 1WETA 4ILUA 4OB4A 5FY7A 4IA8A 2VKOA 2KMFA 3WAJA 3CVRA 4PU3C 2C0SA 1LQCA 5L3BB 2PUDA 4X4DA 1B0NA 2CMRA 4MALA 1WR6A 1X79A 3PE0A 4X4GA 1WRDA 5HWYA 4OYKA 2PUEA 2PJQA 4H9SE 3JC6D 3MK7C 3SCGA 4EYYR 4IWRA 3CKDA 1PRVA 3J7Yq 3O1HA 3E0ZA 3PDYA 5F8PA 3P7IA 3LISA 2EHOC 4QX7B 3HI2A 4ZI7E 2CCQA 2GK9A 3N5LA 3F51A 4P0BA 4ERRA 1RPEL 1BR2A 1NWMX 5HAXA 5KMGP 4TV8E 5JRCB 2VK9A 3F31A 3MLFA 2D2SA 2IVBA 4JQDA 3NRXA 3RYCE 1MNDA 1QP7A 4E7SA 2NW8A 3ZMTB 2JPFA 4DMWA 2IUOA 3GBFA 3U3WA 1CQTA 5LHGB 2VASA 3Q5WA 3QUJA 2LEHA 3LJCA 1D0YA 3QC9A 4P09A 4UV9B 2AUWA 4MLKA 2PUCA 3HA4A 2WM9A 4HGAA 2JVLA 2RP4A 5C8YE 2LT3A 3PUQA 3KZ3A 5ADXL 4TX5A 2NTYA 1UTXA 2XIUA 3GN5B 4H63V 4YLHA 2BNNA 3SS1A 4NUUA 4GHJA 1ZZ9A 1UX4A 2KPJA 4IVZA 3PTRB 3VU7H 3KDSE 2BVMA 2V7KA 4EXTA 5JDFA 2KWHA 3ZCIA 5JQGE 2CSFA 1LCDA 2YK0A 3AA1B 4XBFB 4CXXA 5A1LA 2BNMA 3HKCE 3ZYKA 3AA0B 4H63H 4PK5A 3ZYLA 2R63A 2NWBA 3G7DA 4JEHB 3ZN1B 3RKOA 4ZI2D 4PU7A 1ZVVA 1HG2A 4ZI3C 4OHFA 4FBIA 3AAEB 3L1PA 3LBXB 4EZHA 4F8DA 5JDLA 2XI8A 4TN7B 1B7TA 5JR9A 2Q9QB 5FXXA 2LYKA 1IJ5A 2LOSA 2E9XB 2EWTA 5LGUB 5AFUL 3KJXA 2MOZA 3ZC1A 5LGNB 1S7EA 2MQKA 2EF8A 4Z58A 1CUNA 2DI4A 3C98B 3FYAA 3NZQA 4P0AA 4I6UA 1R63A 3CPZA 3CX7B 1T98A 2N1GA 4OYJA 3C51A 4QWNB 2CEAA 2P9BA 1MNEA 2LCVA 2KLQA 2B5AA 2AW6A 2L8NA 3EDUA 1ZAYA 4C90A 3I1AA 4UEMA 4U74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQB A;  1QP4 A;  1BDH A;  1PNR A;  1RZS A;  2OFY A;  5A7L A;  4X4B A;  3OP9 A;  1X57 A;  3CEC A;  3CLC A;  4X4F A;  1EFA A;  4J1W A;  3ZKC A;  1ZS4 A;  4Z59 A;  2XCJ A;  1VPW A;  2PUF A;  3SCH A;  1JFT A;  1AU7 A;  4I8T A;  2O38 A;  1JWL A;  1IC8 A;  4YG7 B;  2OR1 L;  3VK0 A;  3SCF A;  2JCG A;  4GQM A;  4I6T A;  3JXB C;  1ZUG A;  3QYX A;  2AXU A;  2EBY A;  2GZU A;  1BDI A;  1WET A;  2XSD C;  4OB4 A;  3F52 A;  1NER A;  1XWR A;  2AXV A;  4IA8 A;  3LFP A;  4I6R A;  4PU3 C;  4X4E A;  3QWG A;  3GA8 A;  1LQC A;  2MEZ A;  2XJ3 A;  3H5T A;  2PUD A;  4X4D A;  2KEI A;  4MCT A;  1B0N A;  4J1X A;  2IV1 A;  3QF3 A;  3OQN A;  1RZR D;  3BS3 A;  2AWI A;  4Y42 A;  1GT0 C;  2O4A A;  4Z5D A;  4X4G A;  3HZI B;  2HIN A;  2BJC A;  1OCT C;  3BD1 A;  2H8R A;  2PUE A;  4X4C A;  3QQ6 A;  4PU4 C;  3SCG A;  1NEQ A;  3O9X A;  2PUB A;  3KXA A;  2HSG A;  5K98 B;  4IWR A;  1PRV A;  2GRM A;  4O8B A;  3DNV B;  1LMB 3;  2L49 A;  3LIS A;  3HI2 A;  1ZPQ A;  1Y7Y A;  1POU A;  1YSE A;  3F6W A;  2CRO A;  3F51 A;  2KEJ A;  4PU8 A;  1ZZ7 A;  1ZZ6 A;  1RPE L;  3OMT A;  2D5V A;  3MLF A;  1UXD A;  4YAR A;  3ZHI A;  2IVB A;  1OSL A;  4JQD A;  3OQM A;  3RZZ A;  2LYS A;  1QP7 A;  2FJR A;  2PUG A;  2PIJ A;  2IUO A;  3GBF A;  3U3W A;  1R69 A;  1CQT A;  3ZHM A;  3EUS A;  1LCC A;  2KEK A;  2WIU B;  2AUW A;  2LYL A;  2PUC A;  1WH8 A;  2LYQ A;  1Y9Q A;  2IVG A;  2JVL A;  3FYM A;  2PUA A;  3S8Q A;  3TRB A;  3KZ3 A;  4JCX A;  1UTX A;  2XIU A;  1E3O C;  3GN5 B;  2A6C A;  2BNN A;  3FMY A;  4NDW A;  4GHJ A;  1RZR A;  1ZZ9 A;  1WIZ A;  2PE5 A;  2KPJ A;  4IVZ A;  1PRU A;  2ICP A;  1O4X A;  1PER L;  4YG4 A;  4X4H A;  2LYR A;  1QP0 A;  1WH6 A;  3IVP A;  3R1F A;  4MCX A;  2CSF A;  1LCD A;  1ZZB A;  3D1N I;  2PPX A;  4Z5H A;  3GN5 A;  3BDN A;  2BNM A;  2GRL A;  2R1J L;  1LLI A;  1CJG A;  3JXC L;  3JXD L;  2R63 A;  3G7D A;  4X4I A;  4YG1 A;  4PU7 A;  1ZVV A;  1ZZC A;  2IVQ A;  2AXZ A;  4FBI A;  3L1P A;  4F8D A;  1RIO A;  1JFS A;  2O49 A;  2XI8 A;  2LYK A;  4YBA A;  2EWT A;  1QQA A;  1SQ8 A;  1X2L A;  1L1M A;  1DWK A;  3KJX A;  1JH9 A;  1S7E A;  2MQK A;  2EF8 A;  3G5G A;  4Z58 A;  3OQO A;  1HF0 A;  1QPZ A;  1PRA A;  2ICT A;  3FYA A;  2BNO A;  1R63 A;  4I6U A;  1ADR A;  1DW9 A;  3UFD A;  4JCY A;  2LYJ A;  2WUS R;  1ZZ8 A;  2LCV A;  2B5A A;  3CRO L;  2AW6 A;  2KZ8 A;  2L8N A;  3PXP A;  2IU7 A;  4FN3 A;  3B7H A;  4Z5C A;  1ZAY A;  2LYP A;  1UXC A; 
#chains in the Genus database with same CATH topology
 3K3Q C;  2V7I A;  5LJN A;  2CHO A;  5J2T E;  3NBX X;  3EDV A;  1KEY A;  4PNI A;  5AQJ B;  4AKR B;  2CWO A;  3LK4 2;  2V3C C;  3ZT5 A;  2LNM A;  1SHZ C;  4EKI A;  2GZU A;  1WYC A;  3KVB A;  2CLY C;  5ABE A;  3PJA A;  2DNX A;  2LHN A;  3UUX B;  3TLT A;  2YDQ A;  4H9Q C;  2AE9 A;  1OED C;  3L09 A;  4PU4 C;  4PJN A;  1ZKE A;  3KXA A;  3ANW A;  4EGW A;  2YEV C;  3R6N A;  2GRM A;  5FMN A;  2ZM8 A;  3CX8 B;  3V5S A;  3OMT A;  2KWI B;  5FY1 A;  3PUX F;  3HKB E;  2DWG A;  3FBZ A;  1Y01 A;  2I6H A;  2XM1 A;  3RQW A;  4EOZ B;  4EED A;  4DUZ T;  2WSS V;  3P50 A;  5HYA A;  4DV3 T;  3RIF A;  4UIG A;  2K48 A;  3FMY A;  2M4H A;  3N9M A;  3TLS A;  3LBX A;  2WCA A;  1QP0 A;  3IVP A;  4NXN T;  2PPX A;  4Z5H A;  3EUH A;  1E1H B;  1HS7 A;  4ZS2 A;  3JXC L;  4Z91 A;  1MMN A;  4CZZ B;  4QXC B;  2QA7 A;  4HTE A;  4U72 A;  2J7U A;  2D5U A;  1N32 T;  4ILB A;  1SQ8 A;  4ZHQ E;  5IHY A;  2MXD A;  2WY2 A;  5LCY A;  4ILA A;  3PXP A;  3CQC B;  3N2G E;  2HH7 A;  1QQB A;  5CA1 E;  3NWI A;  3UU3 A;  3PV0 F;  4DND A;  1BDH A;  5IWA T;  2ES0 A;  3L3P A;  3RRC A;  2W63 A;  4WW0 A;  3VKH A;  2XCJ A;  2C5I T;  2JCG A;  1SUM B;  5LBQ B;  3CIR A;  4PAG A;  3K3N A;  3OQN A;  3QB5 A;  4Y42 A;  4AKH A;  2CA5 A;  2BJC A;  5FXV A;  2MPK A;  5DQV A;  2X0L B;  3NZP A;  4QX8 B;  3P4S A;  4A98 A;  3DP7 A;  1E7P A;  2JQQ A;  5DTM A;  1ZPQ A;  4HFI A;  5FNV E;  1U5P A;  1M7K A;  4H9N C;  4QH4 A;  2C5J A;  2KND A;  3RZZ A;  4DR3 T;  2EHO B;  1Z8U A;  2FJR A;  3EUS A;  3FZF B;  4HFH A;  4KBM B;  1J1J A;  5ABH A;  1D0X A;  2E9X D;  2M6B A;  3TLV A;  2BBH A;  5DAB A;  2CWY A;  1PRU A;  3V5U A;  2JJ9 A;  4MBQ A;  1S35 A;  3ZMU B;  4HE8 A;  3VRB A;  5JR9 B;  2IML A;  2ZM6 T;  2ODV A;  4IIJ E;  2X0H A;  3ZYM A;  3QOF A;  2UXC T;  3UTK A;  5KXJ A;  2V5D A;  3FXD B;  2LSY A;  5LOV E;  1JH9 A;  1X2L A;  5JDH A;  3G5G A;  1PRA A;  4LMK A;  3AE2 A;  2BNO A;  3I9Y A;  5ABF B;  2N9D A;  3ZCJ A;  1XNR T;  2V7M A;  5JDN A;  2WQY A;  1HFA A;  2L3L A;  3ONX A;  5AQR B;  3C64 A;  1ZOY A;  3EI0 A;  2H89 A;  1QB2 A;  1EFA A;  2E5L T;  2J1D G;  3HKE E;  2FJD A;  3N2K E;  2RA1 A;  2C5K T;  3SR4 A;  3OBV E;  2EBY A;  2AXV A;  3ABV A;  3VKG A;  4O8S A;  4JUY A;  2V26 A;  2CLY B;  2PXL A;  2VEO A;  2H8R A;  1D1B A;  3A9X A;  1J5E T;  1T7S A;  5L2L A;  3OPC A;  3O9X A;  3H37 A;  5DTQ A;  2VUR A;  2XAG B;  3SWH A;  2MBG A;  4UVC B;  2KSR A;  2A9U A;  3GMI A;  3F6W A;  1ZZ7 A;  5JRE A;  3RYH E;  4H9O C;  2VQE T;  3PUG A;  4DV4 T;  1KK7 A;  2X9Y A;  2PIJ A;  4X65 T;  3RRW A;  1LVK A;  2PXD A;  1LCC A;  2CE7 A;  4U7Y A;  1WH8 A;  1ZV4 X;  5AQI B;  4LFC T;  4EV6 A;  2XSB A;  1MIW A;  1OED E;  3PUR A;  5L3G B;  2R6G F;  3PU8 A;  3EHZ A;  2R1J L;  4HFE A;  3M65 A;  5FYM A;  1KFY A;  2MYS A;  1QPZ A;  2LHR A;  4WBO A;  2B1E A;  3ESL A;  3OJA A;  4Z5C A;  2PXB A;  2JQK A;  2YDS A;  4UF0 B;  3IBP A;  4X4B A;  5J2U E;  3T8O A;  1X57 A;  2XAJ B;  3PUY F;  2QVA A;  2VKD A;  5HXC A;  2UXX B;  4HWC A;  3ZMZ B;  2JQH A;  4IDQ A;  2X9W A;  3LFM A;  1M62 A;  1WET A;  4ZZB A;  2VKO A;  3WAJ A;  5L3B B;  3TEL A;  1WR6 A;  5DRT A;  1X79 A;  2PJQ A;  4LF7 T;  4YT0 A;  4EYY R;  4IWR A;  3CKD A;  3J7Y q;  3O1H A;  5FL0 A;  3LIS A;  4QX7 B;  2HCS A;  1RPE L;  3ONJ A;  5HAX A;  5AQT B;  3MLF A;  4JYA T;  3NRX A;  1MND A;  1QP7 A;  4DV1 T;  2NW8 A;  2XQ5 A;  3RF1 A;  1CQT A;  2HCN A;  5J0Z A;  3LJC A;  1D0Y A;  4HGA A;  4DV7 T;  4QH5 A;  5C8Y E;  2LT3 A;  3PUQ A;  3KZ3 A;  1XDP A;  4H63 V;  3SS1 A;  4GHJ A;  4F8H A;  2KPJ A;  3VU7 H;  2BS4 A;  3ZCI A;  2CSF A;  1LCD A;  2YK0 A;  4CXX A;  5A1L A;  3HKC E;  4H63 H;  4PK5 A;  4JEH B;  2NWB A;  3G7D A;  2XSA A;  4NXM T;  4DUY T;  5JDL A;  4TN7 B;  5LGU B;  2E9X B;  4EZI A;  2MOZ A;  3ZC1 A;  1S7E A;  2EF8 A;  4Q2J A;  3FYA A;  4P0A A;  4I6U A;  3CPZ A;  4OYJ A;  2CEA A;  2FUP A;  3PUW F;  4TWD A;  2AW6 A;  3EDU A;  4U7I A;  4UEM A;  4ADZ A;  4U74 A;  4QXH B;  3DM5 A;  3WAK A;  4WBN E;  4J1W A;  3ZKC A;  2ZM2 A;  1YKH B;  2NOX A;  2W00 A;  3OYZ A;  3I9W A;  4DR5 T;  3R84 B;  3QOX A;  2PBI A;  2XSD C;  3UUM A;  3ZT7 A;  4X4E A;  3AE6 A;  2M6I A;  2KEI A;  4JEU B;  3BS3 A;  2XAQ B;  1YW0 A;  3RPU A;  2Q9Q D;  2WZH A;  5CA0 E;  4IDZ A;  5FL1 A;  4HWF A;  3P4P A;  2DHR A;  4TNW A;  4YAR A;  4HEA A;  3EAB A;  3LSV A;  5DJQ C;  1R69 A;  4L0R A;  3W15 B;  3KV9 A;  5FXZ A;  3A5X A;  2LYQ A;  3AAA B;  4X5T A;  4A56 A;  4I50 E;  5E0O A;  3T1Y T;  2X66 A;  4Z8X A;  1E2A A;  1XZY A;  2VVS A;  5F3J A;  3JC6 C;  2X9X A;  3KBT A;  3N9P A;  2V5C A;  3QOW A;  4DO0 A;  5AQV B;  2O49 A;  2A72 A;  4EIW A;  4XAX B;  3B13 A;  3VHL A;  4DR7 T;  3UWP A;  4FJO A;  2XQ3 A;  5JR9 C;  4LMJ A;  1HR0 T;  4NIQ A;  3GZC A;  4JCY A;  1VRB A;  2H88 A;  2V7L A;  5FXW A;  4I4T E;  2WP9 A;  1VOM A;  2YU2 A;  2XAF B;  4QH1 A;  4QKN A;  3FXE B;  1RZS A;  1IJ6 A;  4JI8 T;  3OP9 A;  3CEC A;  5EK2 A;  2PUF A;  5GAG i;  1UUR A;  3UU5 A;  3FZK B;  3ZMS B;  3Q2M A;  4ER6 A;  2YBD A;  1LKX A;  4HFC A;  3WI3 A;  3K8P C;  4IT4 A;  3QWG A;  2XQ6 A;  5M4Y A;  2MEZ A;  4DBQ A;  4DR6 T;  4MCT A;  4YTM A;  2IV1 A;  2XQY A;  2LSJ A;  5BMV E;  2BG9 A;  4AQY T;  5K98 B;  3I0O A;  1I94 T;  5HWX A;  1W09 A;  1LMB 3;  3A8Y C;  5JDM A;  3ME5 A;  5LXT E;  4CXY A;  3I0Q A;  2D5V A;  1UXD A;  1WLX A;  3OQM A;  4AQF A;  3RX6 A;  2PUG A;  4IE4 A;  3UT5 E;  1HNW T;  3PUA A;  4IE6 A;  3CQG B;  2I59 A;  2Y48 B;  5LG3 A;  2OA5 A;  2YOE A;  4JCX A;  2NW9 A;  3U78 A;  3IF8 B;  1D0Z A;  3K3O A;  4JI0 T;  3AEB A;  3OTO T;  1BR1 A;  4BA9 A;  4LF9 T;  1H7C A;  4MCX A;  3RIU C;  2LSK A;  5L3C B;  3D1N I;  2XM2 A;  2AXZ A;  3L8R A;  3ZN0 B;  4PJM A;  5LNK A;  5BR8 T;  2QRX A;  3OQO A;  1YQ3 A;  2IC6 A;  3UUN A;  3FBL A;  2L8K A;  2KXP B;  3UFD A;  1WR0 A;  2Q9Q A;  5EK3 A;  2XY8 B;  5LP6 E;  2KZ8 A;  2UXD T;  2VVN A;  2V7J A;  1V9D A;  2BG9 E;  3Q9D A;  3G0T A;  1QZX A;  1QP4 A;  1XMO T;  3RC3 A;  4IE7 A;  4KP3 C;  3F57 A;  5AQH B;  5FVL A;  2XAH B;  3ETU A;  3VR8 A;  2CXD A;  3CML A;  2QGS A;  5AQM B;  2W4X A;  3ANW B;  2J47 A;  4Z5D A;  5L3F B;  5DSX A;  2EHO A;  4YHJ A;  1NEQ A;  2BS2 A;  4OBM A;  2PUB A;  4AKI A;  4DBR A;  2JMK A;  2K9A A;  2A3D A;  4P1N A;  2G0U A;  1Y7Y A;  3TEP A;  1YKE B;  4ZS3 A;  5LHH B;  3E08 A;  4JV5 T;  2UUC T;  4LFB T;  4YHH T;  3JAD A;  3ZHM A;  4BJN A;  2HPJ A;  4U31 A;  4AKG A;  2IAK A;  1N34 T;  2KEK A;  2HN2 A;  3UFE A;  2W62 A;  5AQL B;  3X1D A;  1Y9Q A;  4O4I E;  3J9X 1;  3ETV A;  2JQ9 A;  5LMN T;  4OK0 A;  4U2Y A;  3QB5 K;  3JAF A;  3JCF A;  3Q5E A;  1R8I A;  2PXF A;  2PXK A;  4LF6 T;  3O1J A;  4O4J E;  3CK6 A;  2E8I A;  2VB6 A;  3F2E A;  2CBJ A;  4YFS A;  2X68 A;  3GZD C;  1ZZ8 A;  1OWA A;  3TKL B;  4FN3 A;  2BKO A;  4PJJ A;  5DTR A;  2BS3 A;  5AQG B;  3N9L A;  2E9X C;  2VWA A;  3AE1 A;  2FBW A;  4O2A E;  2JMH A;  3BQK A;  1VPW A;  2HHH T;  2M67 A;  1SE7 A;  1WFD A;  3CX6 B;  4YG7 B;  2OR1 L;  2CRB A;  4K0U A;  4A97 A;  4DV6 T;  4ILU A;  3AE5 A;  5FY7 A;  4IA8 A;  2C0S A;  1LQC A;  1OED A;  2XQ8 A;  4MAL A;  3SFD A;  2PUE A;  4YTN A;  4B3S T;  3PDY A;  3P7I A;  3QNU A;  2ACZ A;  3HI2 A;  2CCQ A;  2GK9 A;  4Q25 A;  4P0B A;  2BKP A;  4ERR A;  1BR2 A;  5JRC B;  4TV8 E;  3EAM A;  2D2S A;  3VRA A;  4DMW A;  3GBF A;  3AXJ A;  3Q5W A;  2XQ9 A;  2BBJ A;  2AUW A;  4CN6 A;  3P4R A;  5ADX L;  2NTY A;  2LKG A;  4YLH A;  2BNN A;  1UX4 A;  3UFG A;  2BVM A;  1XMQ T;  3AA1 B;  1ZP0 A;  2R63 A;  3ZN1 B;  3RKO A;  4PU7 A;  3RGL A;  3SFE A;  1W9R A;  2PXT A;  4EZH A;  1B7T A;  2LYK A;  2PXQ A;  3KJX A;  4ER0 A;  5LGN B;  4Z58 A;  2I0M A;  2V6Y A;  3CX7 B;  2RPA A;  1MNE A;  2B5A A;  3I1A A;  3AE4 A;  5C2T A;  4HKA A;  2ODR D;  4KI0 F;  1HNZ T;  1PNR A;  1HX1 B;  4YJ3 E;  4B6X A;  3T1H T;  1L0V A;  4X4F A;  1NAF A;  2N2N A;  4JI4 T;  5CGM A;  2ZMA A;  2UUA T;  3O1I A;  1VCS A;  1IBL T;  3ZJ2 A;  3S4U A;  4DVD A;  3LFP A;  2HPL A;  3MAC A;  4LF4 T;  2L1P A;  4ASK A;  5JDG A;  1HX8 A;  2KT9 A;  1ZEE A;  2IC9 A;  1YQ4 A;  5LJM A;  5LA6 E;  1OCT C;  3BD1 A;  4PJL A;  3MEJ A;  3NRY A;  5TAO A;  3AEC A;  2WDQ A;  3N9Q A;  2Z6E A;  2YIN A;  4JI7 T;  4PU8 A;  3HKD E;  3Q5X A;  2FFH A;  3B5M A;  5L3E B;  4YSX A;  1SA0 E;  2CXL A;  4CXW A;  5L4H A;  1HNX T;  3LDQ B;  4HN9 A;  2DL1 A;  2FJA A;  4E7Z A;  4WYV A;  3TRB A;  5DT2 A;  3IEE A;  5FVK A;  2XAS B;  4GKJ T;  2WMN A;  1LVF A;  1UGO A;  2KZ7 B;  3AB3 B;  5EK4 A;  2LM2 A;  2J7W A;  1FEW A;  4AI6 A;  4IE0 A;  5IYZ E;  1JNR A;  5LYJ E;  3RC8 A;  2FJE A;  1GQE A;  2ACX A;  4UR9 A;  1HCI A;  1ADR A;  4BAY B;  1HG5 A;  1AJ3 A;  3ZKR A;  1WYB A;  4AIS A;  3CRO L;  2IU7 A;  2HN1 A;  3OYX A;  4TV9 E;  3B57 A;  3NKZ A;  2BVL A;  3RYF E;  1IAP A;  1IBM T;  2BZB A;  5LGT B;  5LG4 A;  2VKJ A;  4COF A;  1Z0P A;  3L39 A;  3CLC A;  2PXU A;  3UU8 A;  4G2A A;  1JWL A;  3AEE A;  4GQM A;  1HTJ F;  5CJ5 A;  3ZST A;  1BR4 A;  1CHU A;  4HWD A;  4ZZC A;  4DMV A;  3QYX A;  4L5G A;  5L3D B;  2CXF A;  2XJ3 A;  4KHZ F;  4UVA B;  3QF3 A;  5KDM C;  2SPC A;  4G63 A;  2XUE A;  5JUW A;  5GON E;  3AVR A;  2NTX A;  3O4X E;  4GKK T;  4GK0 E;  3AA6 B;  3DNV B;  2XXP A;  4IST A;  1POU A;  2XTL A;  2FJB A;  3HR0 A;  1OSL A;  3ZHI A;  1U4Q A;  4CN4 A;  4DR2 T;  4KMC A;  2K5B B;  2WWU A;  3PUV F;  4C91 A;  4GYS A;  2PUA A;  4M1P A;  4DV2 T;  2XHE B;  2UXB T;  3UUB A;  4NUV A;  5HXR A;  1O4X A;  1W0B A;  3TLU A;  2VL0 A;  5JDQ A;  3GN5 A;  4Z90 A;  2CM0 A;  5F5W A;  5AQF B;  3JXD L;  3A9Z A;  4AQG A;  1WCR A;  2D0U A;  1RIO A;  3IA3 A;  3SOL A;  3ZT6 A;  4FI5 A;  1XDO A;  4JLE A;  4A5X A;  1QQA A;  3MJX A;  1L1M A;  3LG7 A;  1HF0 A;  2IDO B;  2ICT A;  2WWV A;  2EHO D;  1O3X A;  3LK3 B;  3IHR A;  4U2Z A;  2D0T A;  2WMO A;  3PJA J;  2H3R A;  1FMV A;  3N9O A;  1ZS4 A;  4EEB A;  4I8T A;  2JIW A;  2V6X A;  3P4W A;  1BR0 A;  1KNR A;  2LE8 A;  3KV5 A;  2K3W A;  3BK9 A;  5ETW A;  4I6T A;  2CHN A;  4QHO A;  1NER A;  1T72 A;  4I6R A;  1UX5 A;  1I6Z A;  3H3A A;  3OVU A;  4ISS A;  5HCJ A;  3SX0 A;  3HL6 A;  2O4A A;  1GT0 C;  5FY0 A;  3QK6 A;  2HIN A;  3VWS A;  3KBU A;  4ZI3 D;  4YY3 T;  3C4W A;  5CB4 E;  4YXD A;  4LF8 T;  2UXN B;  2Y8D A;  3CWZ B;  4V1A v;  5HEJ A;  4O4H E;  1QUU A;  2PFV A;  4NPP A;  2LYS A;  2JRK A;  4ZI2 C;  2Y6X A;  2XXQ A;  3C4Z A;  5ABG A;  3ZJ1 A;  3RIA A;  5HXH A;  2LYL A;  3KL4 A;  2DWK A;  4GK5 E;  3S8Q A;  1QSD A;  2DCF A;  4CI2 B;  5LHI B;  4L9I A;  2A6C A;  1MMG A;  1YD8 G;  5J1G A;  1RZR A;  3R09 A;  3ONL C;  4X4H A;  5HCM A;  2QYW A;  3G06 A;  3AA7 B;  1ZZB A;  4CQI A;  2GRL A;  4DE8 A;  3A9Y A;  3PE5 A;  4DR4 T;  4YG1 A;  4ZOL E;  1ZZC A;  4PK4 A;  4IL9 A;  1UK5 A;  1G8X A;  2LKH A;  4HFV A;  3RQU A;  4TZ4 C;  1MMD A;  2V1D B;  2WU5 A;  2IHR 1;  3NVO A;  2NW7 A;  2LLY A;  3UUL A;  2LYJ A;  3KV6 A;  3C50 A;  3RHW A;  4HFB A;  3OKQ A;  3RKG A;  4EZ4 A;  2LJL A;  2NR4 A;  4IDO A;  3SCH A;  5JH7 E;  3GUU A;  1JFT A;  1AU7 A;  2XQA A;  3LK2 B;  3SRZ A;  4OFZ A;  3JXB C;  3M3Z B;  3AE9 A;  3CVR A;  2BG9 B;  4X4D A;  1B0N A;  2CMR A;  4X4G A;  1WRD A;  5LMU T;  4OYK A;  4H9S E;  3TFL A;  5DRY A;  1PRV A;  1J5W A;  3F51 A;  1NWM X;  2VK9 A;  3F31 A;  2IVB A;  4JQD A;  2JPF A;  2IUO A;  5LHG B;  2VAS A;  2W67 A;  3QC9 A;  4UV9 B;  4P09 A;  4MLK A;  4KHP T;  3HA4 A;  2JVL A;  3AEA A;  4DE9 A;  2RP4 A;  4WVL A;  4TX5 A;  1UTX A;  2XIU A;  3AE8 A;  4ZEY A;  3UQ4 A;  4NUU A;  3FZL B;  4IVZ A;  4ER3 A;  5AQU B;  3NZL A;  2VQF T;  3ZYK A;  1X9B A;  1NEN A;  3AA0 B;  2XXA A;  1ZVV A;  4OHF A;  4FBI A;  1UUS A;  3LBX B;  4DID B;  5JR9 A;  2Q9Q B;  2EWT A;  5AFU L;  2MQK A;  2DI4 A;  4DR1 T;  3C98 B;  3NZQ A;  2XPK A;  1R63 A;  1T98 A;  2N1G A;  4QWN B;  3C51 A;  2LCV A;  4B3T T;  2KLQ A;  2UU9 T;  4DV5 T;  1ZAY A;  4YSZ A;  2PTF A;  4ER5 A;  3AED A;  3C4X A;  5ABF A;  3CQX C;  3K1S A;  2LSI A;  4PW8 A;  4Z59 A;  2BKN A;  2O38 A;  5IUX A;  4PFO A;  2BDE A;  2AXU A;  1BDI A;  4O4L E;  4X1I E;  4B3M T;  5CFB A;  4EB6 E;  4CI1 B;  1U2Z A;  3A7M A;  4AKL A;  4JI6 T;  2XQ7 A;  5GAH i;  5JRC A;  3HZI B;  2ZM0 A;  4X66 T;  4QXB B;  4UV8 B;  3QQ6 A;  1ZHC A;  2V8S V;  2YU1 A;  4HFD A;  2J4G A;  4JI2 T;  5FP3 A;  3KIN B;  4I55 E;  4MHC A;  2CRO A;  2W61 A;  5AQQ B;  2IIU A;  2MTQ A;  4IHJ E;  2H7O A;  3ZMV B;  5AQN B;  3FHN A;  3MZK B;  2IVG A;  3FYM A;  4J2C A;  4UEL A;  2DLR A;  2PG8 A;  2J62 A;  4H9P C;  5FKY A;  3QFI A;  2W0G A;  3RIU A;  2PE5 A;  2OV9 A;  2XJ7 A;  2ICP A;  3E22 E;  3R1F A;  4HWI B;  4U3C A;  3BDN A;  2XZE A;  4EK9 A;  4X4I A;  1NEK A;  2IVQ A;  1EZ3 A;  4EYU A;  2X67 A;  2JQE A;  5HEG A;  1MIY A;  4YTP A;  3KV4 A;  2LSG A;  1NW3 A;  2LLW A;  3TLW A;  4YJ2 E;  3N2O A;  3VR9 A;  4I0U A;  3MKD A;  3GWH A;  2LLV A;  1N33 T;  3AEG A;  2E2A A;  3EVY A;  2E5V A;  4UF0 A;  1OED B;  3MXZ A;  3PU3 A;  3UU4 A;  4LML A;  3RI5 A;  4F6R C;  4TNV A;  1ZUG A;  4WZX A;  5AQK B;  1G73 A;  1XWR A;  3D0T A;  5AQO B;  1Y64 B;  3GA8 A;  3H5T A;  4UVB B;  2PXE A;  4DV0 T;  2PXV A;  3DJB A;  4MFR A;  4O2B E;  3ZPO A;  2WAU A;  4X4C A;  4O8B A;  2D9D A;  2XQ4 A;  4EQZ A;  2L49 A;  4X1K E;  2X0Y A;  4X20 E;  3AXJ B;  3KVA A;  2LRK A;  1ZZ6 A;  5L47 A;  5AQS B;  3RLF F;  4PFP A;  1XNQ T;  1VCT A;  2WIU B;  2LRL A;  1KNP A;  4IE5 A;  4N78 D;  2UUB T;  4X64 T;  1MIV A;  3RYI E;  1E3O C;  2WBL A;  2LOP A;  1D1A A;  5JVD E;  1D1C A;  3LQX A;  1HQ1 A;  3FZH B;  2LYR A;  2IW5 B;  4I43 B;  2VKH A;  1LLI A;  4PK6 A;  4ZXL A;  5HXE A;  2L9Q A;  2V6Y B;  2VL8 A;  3FZM B;  3ZC0 A;  1JFS A;  4XZC A;  1DWK A;  3ZEF B;  1DU2 A;  3GZD A;  2A2F X;  5H6R B;  4JI3 T;  4GYR A;  4X1Y E;  2WUS R;  3OWQ A;  2IUB A;  1IZN B;  2E9X A;  3UU6 A;  2YKS A;  3MA9 A;  1S94 A;  2OFY A;  3AEF A;  2X9H A;  4UXN B;  1UCU A;  2ZLY A;  3SCF A;  3BQI A;  3F52 A;  5AQP B;  4JBW F;  4TUY E;  3PUS A;  4GOU A;  4K0K T;  4X62 T;  4IDP A;  2X51 A;  4J1X A;  1RZR D;  4AIU A;  4CI3 B;  2AWI A;  5HEO A;  5C3J A;  3ZPX A;  3RH3 A;  2CBI A;  4EKG A;  2WDR A;  3U3I A;  2HSG A;  3AVS A;  3ZLI A;  3KFW X;  2HFZ A;  1KNZ A;  1YSE A;  2BG9 C;  2KEJ A;  2H7V C;  3AE7 A;  4LFA T;  4CN1 A;  4B3R T;  4ANJ A;  4AXP A;  5HEU A;  1OXZ A;  4YSY A;  4AQF C;  5KX5 E;  4H9R C;  3DTO A;  3NXH A;  4KX6 A;  2YDR A;  2F4V T;  4NDW A;  3AAI A;  4GIW A;  1WIZ A;  3N9N A;  1PER L;  4YG4 A;  3FB2 A;  1IBK T;  2K24 A;  1WH6 A;  2WU2 A;  1QLB A;  4IGU A;  4LF5 T;  1LRZ A;  1CJG A;  4BJM A;  1FJG T;  3P8C D;  5DQW A;  3Q5D A;  4OX9 T;  5HXS A;  1FMW A;  3BQL A;  4TWF A;  2CPT A;  4YBA A;  1US7 B;  2KIN B;  1HF8 A;  2NP9 A;  4EAH A;  1DW9 A;  3M9L A;  4WNK A;  3B7H A;  2LYP A;  4KUM B;  1UXC A;  1KF6 A;  4IRE A;  2Q9Q C;  5A7L A;  3NDB B;  1FIO A;  5JTG A;  1MMA A;  2LM9 A;  5H6Q B;  4IDN A;  2ODU A;  3JAE A;  5EZY E;  1IC8 A;  4HRA A;  3VK0 A;  5LBM A;  3OKZ A;  4OB4 A;  4JI5 T;  2KMF A;  2WB5 A;  4PU3 C;  2WS3 A;  2PUD A;  2WZI A;  3PE0 A;  5HWY A;  4HWH A;  3JC6 D;  3MK7 C;  3SCG A;  2WDV A;  3NRO A;  3E0Z A;  1XWM A;  5F8P A;  2EHO C;  4ILC A;  4ZI7 E;  3N5L A;  5KMG P;  1N36 T;  2W2U A;  3RYC E;  2OLT A;  1YXR A;  1DUL A;  4E7S A;  3ZMT B;  2PXP A;  3U3W A;  2AXD S;  3QUJ A;  2LEH A;  1W0A A;  5L4E A;  2PUC A;  2YN6 A;  2WM9 A;  1T8B A;  4U33 A;  3GN5 B;  1ZZ9 A;  1MFQ C;  3P4Q A;  3PTR B;  4IL4 A;  4ER7 A;  3KDS E;  2V7K A;  4EXT A;  5JDF A;  2KWH A;  5JQG E;  4XBF B;  2MAW A;  2BNM A;  3AE3 A;  3ZYL A;  1JNZ A;  4ZI2 D;  1HG2 A;  4ZI3 C;  3AAE B;  3L1P A;  5LB7 B;  4F8D A;  2XI8 A;  5FXX A;  3UQ7 A;  1IJ5 A;  2LOS A;  1CUN A;  3H3M A;  2W66 A;  4TWH A;  5HEH A;  4JI1 T;  2P9B A;  3ZSS A;  2L8N A;  4C90 A;  2B76 A;  3PUZ F; 
#chains in the Genus database with same CATH homology
 3K3Q C;  4HKA A;  4QXH B;  3WAK A;  3C4X A;  2V7I A;  1PNR A;  3CQX C;  5LJN A;  5J2T E;  4YJ3 E;  3NBX X;  3EDV A;  2LSI A;  4PNI A;  4X4F A;  4PW8 A;  4B6X A;  4J1W A;  3ZKC A;  4WBN E;  4Z59 A;  1NAF A;  2CWO A;  2ZM2 A;  3LK4 2;  2N2N A;  4AKR B;  1YKH B;  2NOX A;  2O38 A;  2W00 A;  3OYZ A;  2ZMA A;  1SHZ C;  3I9W A;  4PFO A;  2BDE A;  3R84 B;  3O1I A;  3ZJ2 A;  2AXU A;  2GZU A;  1BDI A;  1WYC A;  2CLY C;  2PBI A;  2XSD C;  3KVB A;  4O4L E;  4X1I E;  3S4U A;  3UUM A;  4DVD A;  3LFP A;  2DNX A;  2HPL A;  3MAC A;  4X4E A;  2LHN A;  3UUX B;  4ASK A;  4EB6 E;  4CI1 B;  5JDG A;  2KEI A;  1HX8 A;  4JEU B;  3BS3 A;  2KT9 A;  4AKL A;  1ZEE A;  4H9Q C;  2IC9 A;  5LJM A;  5JRC A;  3HZI B;  2XAQ B;  2ZM0 A;  1OCT C;  5LA6 E;  3BD1 A;  1YW0 A;  4PJL A;  4QXB B;  3RPU A;  2Q9Q D;  3L09 A;  4UV8 B;  3QQ6 A;  4PU4 C;  3NRY A;  4PJN A;  1ZKE A;  1ZHC A;  2YU1 A;  5TAO A;  3KXA A;  3ANW A;  5CA0 E;  4IDZ A;  2YEV C;  3R6N A;  2GRM A;  5FMN A;  3N9Q A;  2Z6E A;  2YIN A;  2ZM8 A;  3KIN B;  5FP3 A;  4I55 E;  4MHC A;  2CRO A;  3CX8 B;  4PU8 A;  3HKD E;  2W61 A;  3OMT A;  3Q5X A;  3V5S A;  2DHR A;  2KWI B;  5FY1 A;  4YAR A;  3HKB E;  2MTQ A;  4HEA A;  4IHJ E;  2DWG A;  3FBZ A;  5L3E B;  5DJQ C;  1SA0 E;  2CXL A;  4CXW A;  1R69 A;  4L0R A;  4EOZ B;  2H7O A;  3W15 B;  3ZMV B;  3KV9 A;  5FXZ A;  3A5X A;  3FHN A;  4HN9 A;  3MZK B;  2LYQ A;  3AAA B;  2IVG A;  3FYM A;  4J2C A;  4UEL A;  4A56 A;  4E7Z A;  2DLR A;  2PG8 A;  4I50 E;  3TRB A;  5E0O A;  2WSS V;  5HYA A;  4H9P C;  4UIG A;  2X66 A;  2K48 A;  3FMY A;  4Z8X A;  3IEE A;  2XAS B;  2W0G A;  2WMN A;  3N9M A;  2PE5 A;  2ICP A;  3LBX A;  1LVF A;  2KZ7 B;  3E22 E;  1QP0 A;  3IVP A;  3R1F A;  3AB3 B;  5EK4 A;  2PPX A;  4Z5H A;  3BDN A;  1E1H B;  3EUH A;  1HS7 A;  4ZS2 A;  5F3J A;  3JXC L;  3JC6 C;  4X4I A;  1MMN A;  2X9X A;  3KBT A;  4CZZ B;  3N9P A;  4QXC B;  1FEW A;  2IVQ A;  4AI6 A;  1EZ3 A;  4IE0 A;  5IYZ E;  4EYU A;  2QA7 A;  4HTE A;  4DO0 A;  2O49 A;  4U72 A;  2A72 A;  2D5U A;  4XAX B;  3B13 A;  4EIW A;  2X67 A;  5LYJ E;  3VHL A;  1MIY A;  3RC8 A;  1SQ8 A;  4FJO A;  4ZHQ E;  5JR9 C;  2ACX A;  1HCI A;  1ADR A;  4BAY B;  5IHY A;  3KV4 A;  1HG5 A;  1AJ3 A;  2LSG A;  4JCY A;  1VRB A;  1WYB A;  2V7L A;  5FXW A;  4I4T E;  5LCY A;  3CRO L;  3PXP A;  2IU7 A;  1VOM A;  2YU2 A;  3CQC B;  3N2G E;  3OYX A;  4TV9 E;  2XAF B;  2HH7 A;  3B57 A;  2BVL A;  1QQB A;  1IAP A;  3RYF E;  4QKN A;  5CA1 E;  2BZB A;  5LGT B;  5LG4 A;  4DND A;  4YJ2 E;  3N2O A;  1BDH A;  2VKJ A;  1RZS A;  1IJ6 A;  3FXE B;  3OP9 A;  1Z0P A;  2ES0 A;  3MKD A;  3L3P A;  3CEC A;  3CLC A;  2W63 A;  4WW0 A;  3RRC A;  5EK2 A;  3VKH A;  2XCJ A;  2PUF A;  3GWH A;  4G2A A;  1JWL A;  3EVY A;  2C5I T;  4UF0 A;  3MXZ A;  3PU3 A;  2JCG A;  4GQM A;  1HTJ F;  3ZMS B;  1BR4 A;  3Q2M A;  5LBQ B;  4F6R C;  4DMV A;  3QYX A;  1ZUG A;  4L5G A;  1LKX A;  1G73 A;  5L3D B;  1XWR A;  3WI3 A;  3D0T A;  3K8P C;  2CXF A;  1Y64 B;  3QWG A;  3GA8 A;  4PAG A;  5M4Y A;  2MEZ A;  2XJ3 A;  3H5T A;  4DBQ A;  3K3N A;  4UVA B;  4MCT A;  3OQN A;  2IV1 A;  3QF3 A;  5KDM C;  2SPC A;  4Y42 A;  4UVB B;  2XQY A;  2LSJ A;  4G63 A;  4AKH A;  2CA5 A;  2BJC A;  5FXV A;  2XUE A;  3DJB A;  4MFR A;  4O2B E;  3ZPO A;  2WAU A;  4X4C A;  5DQV A;  5BMV E;  2X0L B;  5GON E;  3AVR A;  3NZP A;  4QX8 B;  2NTX A;  5K98 B;  3O4X E;  3I0O A;  4GK0 E;  3AA6 B;  4O8B A;  3DNV B;  5HWX A;  1LMB 3;  3DP7 A;  2L49 A;  4X1K E;  2JQQ A;  4X20 E;  1ZPQ A;  4IST A;  5FNV E;  1POU A;  2XTL A;  3HR0 A;  3KVA A;  5JDM A;  5LXT E;  4CXY A;  3I0Q A;  1ZZ6 A;  1U5P A;  4H9N C;  2D5V A;  1UXD A;  1OSL A;  3ZHI A;  1U4Q A;  1WLX A;  2C5J A;  2KND A;  3OQM A;  3RZZ A;  4KMC A;  2EHO B;  4AQF A;  3RX6 A;  2FJR A;  2PUG A;  4IE4 A;  3UT5 E;  2K5B B;  4PFP A;  2WWU A;  3EUS A;  3PUA A;  4C91 A;  4IE6 A;  2WIU B;  3CQG B;  4GYS A;  2I59 A;  2Y48 B;  4KBM B;  2PUA A;  1D0X A;  2OA5 A;  4M1P A;  4IE5 A;  4N78 D;  2E9X D;  4ADZ A;  4JCX A;  1MIV A;  2NW9 A;  3IF8 B;  1E3O C;  1D0Z A;  2WBL A;  2XHE B;  3K3O A;  3RYI E;  3U78 A;  1BR1 A;  2LOP A;  4BA9 A;  1D1A A;  4NUV A;  5HXR A;  5JVD E;  5DAB A;  1D1C A;  2CWY A;  1PRU A;  1O4X A;  3V5U A;  1H7C A;  2JJ9 A;  4MBQ A;  2LYR A;  1S35 A;  3ZMU B;  4HE8 A;  2IW5 B;  4MCX A;  2LSK A;  5JR9 B;  5L3C B;  5JDQ A;  3D1N I;  4I43 B;  2VKH A;  3GN5 A;  2ODV A;  2CM0 A;  4IIJ E;  1LLI A;  3JXD L;  4PK6 A;  5HXE A;  2L9Q A;  4AQG A;  3ZYM A;  2VL8 A;  2AXZ A;  3ZC0 A;  2D0U A;  3UTK A;  1RIO A;  1JFS A;  3ZN0 B;  3SOL A;  4PJM A;  3FXD B;  5LNK A;  2LSY A;  4FI5 A;  4JLE A;  4XZC A;  1QQA A;  5LOV E;  3MJX A;  1X2L A;  1L1M A;  1DWK A;  1JH9 A;  3LG7 A;  3ZEF B;  5JDH A;  3G5G A;  3OQO A;  1HF0 A;  2A2F X;  5H6R B;  1PRA A;  2ICT A;  2IC6 A;  2BNO A;  3I9Y A;  3FBL A;  2L8K A;  3UUN A;  4GYR A;  4X1Y E;  2N9D A;  2KXP B;  3UFD A;  3ZCJ A;  2WUS R;  2EHO D;  1O3X A;  3LK3 B;  3IHR A;  2Q9Q A;  5EK3 A;  5LP6 E;  2KZ8 A;  1IZN B;  2E9X A;  2V7J A;  2V7M A;  1V9D A;  5JDN A;  1HFA A;  3Q9D A;  2D0T A;  1QP4 A;  2L3L A;  2WMO A;  3MA9 A;  1S94 A;  3ONX A;  2OFY A;  3RC3 A;  3C64 A;  2H3R A;  4IE7 A;  2X9H A;  4KP3 C;  3F57 A;  1FMV A;  3N9O A;  1EFA A;  1ZS4 A;  2XAH B;  4UXN B;  2J1D G;  4I8T A;  3HKE E;  3N2K E;  1BR0 A;  1UCU A;  2LE8 A;  3KV5 A;  2RA1 A;  2ZLY A;  3SCF A;  3BK9 A;  2C5K T;  3ETU A;  5ETW A;  4I6T A;  4QHO A;  3OBV E;  2CXD A;  2EBY A;  3CML A;  2QGS A;  3BQI A;  3F52 A;  1NER A;  2AXV A;  4TUY E;  4I6R A;  1UX5 A;  3H3A A;  3PUS A;  4GOU A;  4ISS A;  3VKG A;  3ANW B;  4O8S A;  2X51 A;  4JUY A;  2V26 A;  3HL6 A;  4J1X A;  1RZR D;  2O4A A;  2CLY B;  1GT0 C;  2AWI A;  4CI3 B;  5FY0 A;  4Z5D A;  3QK6 A;  2HIN A;  2H8R A;  1D1B A;  5L3F B;  3KBU A;  3RH3 A;  2EHO A;  5L2L A;  4YHJ A;  1NEQ A;  3O9X A;  3H37 A;  2PUB A;  4ZI3 D;  4AKI A;  3U3I A;  2JMK A;  4DBR A;  2HSG A;  3AVS A;  2K9A A;  2XAG B;  3SWH A;  3C4W A;  2MBG A;  3ZLI A;  2A3D A;  3KFW X;  4UVC B;  5CB4 E;  1KNZ A;  2G0U A;  1Y7Y A;  1YSE A;  3GMI A;  3F6W A;  2KEJ A;  2H7V C;  2UXN B;  2Y8D A;  1ZZ7 A;  3CWZ B;  4V1A v;  1YKE B;  4O4H E;  3RYH E;  1QUU A;  2PFV A;  4H9O C;  4ZS3 A;  4ANJ A;  5LHH B;  5JRE A;  3PUG A;  3E08 A;  2LYS A;  4AXP A;  1KK7 A;  2X9Y A;  2JRK A;  2PIJ A;  4ZI2 C;  3ZHM A;  4BJN A;  2Y6X A;  3RRW A;  3C4Z A;  1OXZ A;  1LVK A;  1LCC A;  2HPJ A;  2CE7 A;  3ZJ1 A;  4AKG A;  4AQF C;  2IAK A;  5HXH A;  2KEK A;  3UFE A;  5KX5 E;  4H9R C;  2W62 A;  2LYL A;  2DWK A;  1WH8 A;  1Y9Q A;  3DTO A;  4GK5 E;  3S8Q A;  4O4I E;  1QSD A;  1ZV4 X;  2DCF A;  4CI2 B;  5LHI B;  3J9X 1;  4L9I A;  3ETV A;  2A6C A;  1MMG A;  4NDW A;  1MIW A;  1YD8 G;  3AAI A;  5J1G A;  4GIW A;  1RZR A;  1WIZ A;  4OK0 A;  3N9N A;  3PUR A;  1PER L;  4YG4 A;  4X4H A;  3FB2 A;  2K24 A;  1WH6 A;  3AA7 B;  1ZZB A;  4CQI A;  5L3G B;  3PU8 A;  4IGU A;  2GRL A;  2R1J L;  1LRZ A;  1CJG A;  3M65 A;  4BJM A;  4YG1 A;  4ZOL E;  1ZZC A;  3P8C D;  5DQW A;  4PK4 A;  1G8X A;  5HXS A;  3O1J A;  1FMW A;  3BQL A;  4HFV A;  5FYM A;  2MYS A;  4O4J E;  4TZ4 C;  1MMD A;  4YBA A;  1US7 B;  2V1D B;  2KIN B;  2E8I A;  1HF8 A;  1QPZ A;  2NP9 A;  2NW7 A;  2LHR A;  4EAH A;  2VB6 A;  4WBO A;  3F2E A;  3UUL A;  1DW9 A;  4YFS A;  2LYJ A;  2X68 A;  3C50 A;  2B1E A;  3KV6 A;  1ZZ8 A;  3ESL A;  1OWA A;  3OJA A;  3TKL B;  4WNK A;  4FN3 A;  3OKQ A;  3B7H A;  4Z5C A;  2LYP A;  4KUM B;  1UXC A;  4UF0 B;  4PJJ A;  2Q9Q C;  3IBP A;  4EZ4 A;  3N9L A;  5A7L A;  4X4B A;  2E9X C;  2LJL A;  2VWA A;  3T8O A;  5J2U E;  1X57 A;  1FIO A;  2XAJ B;  2JMH A;  4O2A E;  3BQK A;  1VPW A;  1MMA A;  2LM9 A;  2VKD A;  5HXC A;  3SCH A;  5H6Q B;  1JFT A;  1AU7 A;  2M67 A;  2UXX B;  2ODU A;  5JH7 E;  5EZY E;  1IC8 A;  3ZMZ B;  3CX6 B;  4YG7 B;  2OR1 L;  3VK0 A;  4K0U A;  3LK2 B;  3SRZ A;  4OFZ A;  5LBM A;  3JXB C;  2X9W A;  3LFM A;  1WET A;  4ILU A;  4OB4 A;  5FY7 A;  4IA8 A;  2VKO A;  2KMF A;  3WAJ A;  3CVR A;  4PU3 C;  2C0S A;  1LQC A;  5L3B B;  2PUD A;  4X4D A;  1B0N A;  2CMR A;  4MAL A;  1WR6 A;  1X79 A;  3PE0 A;  4X4G A;  1WRD A;  5HWY A;  4OYK A;  2PUE A;  2PJQ A;  4H9S E;  3JC6 D;  3MK7 C;  3SCG A;  4EYY R;  4IWR A;  3CKD A;  1PRV A;  3J7Y q;  3O1H A;  3E0Z A;  3PDY A;  5F8P A;  3P7I A;  3LIS A;  2EHO C;  4QX7 B;  3HI2 A;  4ZI7 E;  2CCQ A;  2GK9 A;  3N5L A;  3F51 A;  4P0B A;  4ERR A;  1RPE L;  1BR2 A;  1NWM X;  5HAX A;  5KMG P;  4TV8 E;  5JRC B;  2VK9 A;  3F31 A;  3MLF A;  2D2S A;  2IVB A;  4JQD A;  3NRX A;  3RYC E;  1MND A;  1QP7 A;  4E7S A;  2NW8 A;  3ZMT B;  2JPF A;  4DMW A;  2IUO A;  3GBF A;  3U3W A;  1CQT A;  5LHG B;  2VAS A;  3Q5W A;  3QUJ A;  2LEH A;  3LJC A;  1D0Y A;  3QC9 A;  4P09 A;  4UV9 B;  2AUW A;  4MLK A;  2PUC A;  3HA4 A;  2WM9 A;  4HGA A;  2JVL A;  2RP4 A;  5C8Y E;  2LT3 A;  3PUQ A;  3KZ3 A;  5ADX L;  4TX5 A;  2NTY A;  1UTX A;  2XIU A;  3GN5 B;  4H63 V;  4YLH A;  2BNN A;  3SS1 A;  4NUU A;  4GHJ A;  1ZZ9 A;  1UX4 A;  2KPJ A;  4IVZ A;  3PTR B;  3VU7 H;  3KDS E;  2BVM A;  2V7K A;  4EXT A;  5JDF A;  2KWH A;  3ZCI A;  5JQG E;  2CSF A;  1LCD A;  2YK0 A;  3AA1 B;  4XBF B;  4CXX A;  5A1L A;  2BNM A;  3HKC E;  3ZYK A;  3AA0 B;  4H63 H;  4PK5 A;  3ZYL A;  2R63 A;  2NWB A;  3G7D A;  4JEH B;  3ZN1 B;  3RKO A;  4ZI2 D;  4PU7 A;  1ZVV A;  1HG2 A;  4ZI3 C;  4OHF A;  4FBI A;  3AAE B;  3L1P A;  3LBX B;  4EZH A;  4F8D A;  5JDL A;  2XI8 A;  4TN7 B;  1B7T A;  5JR9 A;  2Q9Q B;  5FXX A;  2LYK A;  1IJ5 A;  2LOS A;  2E9X B;  2EWT A;  5LGU B;  5AFU L;  3KJX A;  2MOZ A;  3ZC1 A;  5LGN B;  1S7E A;  2MQK A;  2EF8 A;  4Z58 A;  1CUN A;  2DI4 A;  3C98 B;  3FYA A;  3NZQ A;  4P0A A;  4I6U A;  1R63 A;  3CPZ A;  3CX7 B;  1T98 A;  2N1G A;  4OYJ A;  3C51 A;  4QWN B;  2CEA A;  2P9B A;  1MNE A;  2LCV A;  2KLQ A;  2B5A A;  2AW6 A;  2L8N A;  3EDU A;  1ZAY A;  4C90 A;  3I1A A;  4UEM A;  4U74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...