3GN5B

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
130
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 38
structure length 130
sequence length 131
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5B02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5B01
1NEQA 3MLFA 3SCHA 2EWTA 3SCFA 1R63A 2PUFA 3DNVB 3HI2A 4X4BA 4I6UA 1WIZA 1E3OC 2CSFA 4Z59A 1B0NA 4MCXA 3BD1A 2A6CA 1PERL 2WUSR 3SCGA 2LYJA 3JXDL 1HF0A 1SQ8A 1CQTA 4GQMA 3BDNA 3F6WA 2LYSA 1QP0A 1LQCA 1ZPQA 1OSLA 1RIOA 3H5TA 2IU7A 3KXAA 3O9XA 5A7LA 4FBIA 2KZ8A 2LYPA 2MQKA 4PU4C 1X57A 2LCVA 2GZUA 1WETA 4YG4A 3QF3A 2PUAA 3QYXA 3LISA 3G7DA 1ZZ7A 1UTXA 2KEIA 2O49A 4PU8A 4X4FA 4X4DA 1LMB3 4PU3C 1NERA 2WIUB 1X2LA 3R1FA 4Y42A 3GN5B 2AUWA 1ZZ6A 3UFDA 4JQDA 4I6TA 3ZHMA 2KEKA 4Z5CA 1RZRA 2LYRA 2PUGA 2ICPA 1L1MA 3CROL 3OP9A 4YBAA 5K98B 1PRAA 4YG7B 1R69A 2GRLA 4X4CA 1LCCA 3LFPA 3GBFA 2L49A 3FYAA 2IVQA 2HSGA 3F51A 3CLCA 3B7HA 2AXZA 1Y9QA 1QP4A 1WH8A 4Z5DA 2OFYA 1UXDA 1BDIA 3KJXA 2PUCA 2AXVA 4NDWA 4PU7A 2O38A 1PRVA 1ZVVA 4Z58A 1ZZCA 2BNOA 2D5VA 2JVLA 4IVZA 2PUDA 1PRUA 1ZAYA 2MEZA 4X4EA 2R1JL 3HZIB 3VK0A 1JFSA 3JXBC 1OCTC 2PUEA 1S7EA 1BDHA 3OMTA 2KPJA 4I6RA 1EFAA 4I8TA 3GN5A 3ZHIA 3QWGA 1DW9A 3D1NI 2B5AA 1DWKA 1ZZBA 2IV1A 2LYKA 3TRBA 3JXCL 1YSEA 2LYLA 1RPEL 3FYMA 3OQOA 2H8RA 1ADRA 2JCGA 2CROA 3QQ6A 4IA8A 1AU7A 3U3WA 1JH9A 3G5GA 2IVBA 2GRMA 4IWRA 3ZKCA 1ZZ9A 3FMYA 1Y7YA 3IVPA 1QQAA 1GT0C 2XI8A 4JCXA 3OQMA 1RZRD 4YG1A 4X4IA 4X4GA 1QPZA 2BNNA 1O4XA 2AW6A 1PNRA 2PE5A 2PUBA 1ZZ8A 1JFTA 2AWIA 1XWRA 3L1PA 3S8QA 1JWLA 1ZUGA 1LLIA 2PIJA 2O4AA 3KZ3A 2R63A 1CJGA 2FJRA 1RZSA 1ZS4A 3PXPA 4Z5HA 3OQNA 4O8BA 3EUSA 2XCJA 4FN3A 2AXUA 1LCDA 1QQBA 3CECA 2PPXA 4MCTA 2OR1L 2XJ3A 1WH6A 2IUOA 1POUA 2LYQA 4J1XA 3RZZA 2XIUA 3BS3A 4OB4A 2EF8A 3F52A 4GHJA 4J1WA 2IVGA 4YARA 4X4HA 1UXCA 4JCYA 2KEJA 1VPWA 4F8DA 1IC8A 2L8NA 2BJCA 1QP7A 3GA8A 2EBYA 2HINA 2XSDC 2BNMA 2ICTA
chains in the Genus database with same CATH superfamily
2ZM6T 3C98B 2LM2A 3AVSA 2V3CC 3SR4A 2IW5B 3KXAA 3TELA 1NW3A 5HXHA 4PU4C 2LM9A 3C4ZA 4TNWA 4MFRA 1QSDA 2LJLA 4AKRB 5LGTB 1LMB3 4X64T 4BA9A 4JQDA 3NRXA 2UUCT 4HFVA 5ABFA 2AE9A 1UCUA 2FUPA 4EXTA 1UXDA 1VRBA 3P7IA 4PW8A 3W15B 2D5VA 2JRKA 3Q5DA 2CRBA 2NWBA 1OEDB 2X0LB 3CX6B 4DE8A 4U7YA 3FYMA 5AQQB 2XM2A 5JREA 5FP3A 3N2GE 1Y7YA 3ONXA 2V1DB 2PXKA 4JCXA 3CPZA 5AQSB 1QPZA 4HKAA 4P0BA 3ZKRA 1HQ1A 3S8QA 1ZUGA 2O4AA 2JMKA 4U7IA 3PJAJ 3OQNA 2V7MA 2MPKA 2V7KA 1WRDA 3CECA 2OR1L 3N9MA 4NUVA 4DR1T 2DLRA 2BDEA 3KINB 3MA9A 2LRLA 1D0ZA 4PK4A 4X1YE 4ER0A 3H3MA 4YARA 4IDNA 3H3AA 2BJCA 4GOUA 4ILUA 5KDMC 4HWHA 4AXPA 3HI2A 3SCFA 1IAPA 2WU5A 2HHHT 1WR0A 3BD1A 3ZC0A 2HPLA 5AQHB 2QRXA 3H5TA 1T72A 2KZ7B 5HXCA 4EZIA 3JCFA 4JUYA 5JTGA 1W0BA 2CE7A 2X0YA 4JEUB 4TWFA 3RX6A 1WETA 3ZPXA 5IUXA 4OYJA 5LB7B 3G7DA 5L3DB 5AQOB 2BS2A 2X67A 2H7VC 5DTQA 3UFDA 3RQUA 2UU9T 3A8YC 4I6TA 1V9DA 1QLBA 5K98B 4YG7B 3RHWA 4IE4A 4JI1T 5HWYA 5TAOA 2BS4A 3LJCA 3E0ZA 1QP4A 5GAHi 2FJEA 1UK5A 2DCFA 3AXJA 1ZZCA 3TKLB 4TV9E 1E7PA 4X4EA 2PXBA 2UXNB 2IDOB 5L47A 3IA3A 3QWGA 2LYKA 3PE5A 1AU7A 2RA1A 2HFZA 2H7OA 3ZPOA 2EHOA 4QXCB 1MMAA 4EK9A 1LLIA 2PIJA 3KZ3A 1CJGA 3L09A 3PUYF 2KXPB 3UULA 4Z5HA 4ASKA 2BZBA 5IWAT 4UIGA 2AXUA 5HXRA 2LLVA 5HEOA 4J1XA 3Q5WA 4O2AE 2Q9QD 2HINA 5HYAA 3HKCE 4Q25A 3F2EA 2XQ5A 4QXHB 5HEGA 2EHOC 4AISA 3NDBB 4MCXA 2A6CA 4E7SA 2XUEA 3NRYA 3QFIA 4DMVA 2Z6EA 2I59A 2E9XA 1KNZA 3UU3A 3K3QC 3TLVA 3CX8B 2VB6A 4YG4A 3RI5A 3VKHA 5AQGB 4ER3A 4YFSA 4CN6A 1FMVA 4YHJA 2JIWA 5JDLA 3FZKB 1RZRA 2LSKA 2FJDA 2XJ7A 2LOSA 4PK6A 5FKYA 2IVQA 2LE8A 2HPJA 5L3FB 4DO0A 2LKHA 2YK0A 3N2OA 2PUCA 2E9XC 3AA6B 5DABA 3LFMA 4UF0B 3ZMVB 4JEHB 2MEZA 2C0SA 1XDOA 4U31A 4I43B 4L9IA 2PXUA 2YOEA 3IF8B 3TRBA 2J1DG 2H8RA 3QOFA 2CM0A 4X5TA 1WFDA 1FMWA 2X66A 2IVBA 4M1PA 3QB5A 1HNXT 2YDRA 4IDPA 3KBUA 3A9XA 3CMLA 2VEOA 3RKGA 3QC9A 3RH3A 4O4HE 2C5KT 3AA1B 3KDSE 3RKOA 2V26A 4EYUA 2VQFT 3CQXC 1D1AA 3EDUA 5KXJA 3N9QA 2UXDT 4ILCA 2XPKA 3MLFA 4ILBA 3OVUA 4OYKA 5E0OA 3KV9A 4F8HA 1U5PA 4HTEA 3L8RA 2WS3A 3U78A 5AQTB 1ZOYA 1XNQT 4X65T 2VURA 3JC6D 3EDVA 4IT4A 1MMDA 2L8KA 2A2FX 4ZS3A 4HFIA 4PNIA 3QF3A 5LGNB 3QYXA 4I50E 4NIQA 2W66A 3EHZA 4ZXLA 3QOXA 2CHNA 3ONJA 5H6QB 1SUMB 3OKZA 1WCRA 2MYSA 2PXEA 4YTPA 3TLSA 4O2BE 4O4LE 2VASA 2LYRA 3P4QA 4IE6A 3K3OA 3ZMZB 3RYIE 4B3MT 4EQZA 2V6YB 4EZHA 2V7LA 1OEDE 3UT5E 5JQGE 2PFVA 2JMHA 3M9LA 1LKXA 2X9YA 1JNRA 5FXWA 3P4WA 4CI3B 2PUDA 4TN7B 3VK0A 3P4SA 3KV5A 1OCTC 4DNDA 1NAFA 3CQGB 3IEEA 2IC6A 2LYLA 5JR9B 4EKIA 1ZEEA 3UU5A 3AAIA 3QUJA 2DWGA 2UXBT 3K8PC 5J0ZA 4YHHT 4I4TE 5JDFA 5L3BB 4OBMA 3QOWA 3L39A 2CHOA 4JI4T 1XWRA 2X68A 4YXDA 3PXPA 2Y8DA 1KFYA 3KV4A 2PXLA 3ZT7A 2ODRD 2XQ6A 1SE7A 2LOPA 3NROA 2MBGA 5LGUB 4WYVA 2W62A 1JNZA 3VRBA 2XQAA 4DR7T 3AE1A 2ZM0A 2ACXA 3VR8A 3ZCIA 4CXYA 2RPAA 2L9QA 4I6UA 4JI2T 4ZEYA 3AA7B 1QP0A 3RQWA 1IBMT 3FZHB 4HWCA 1AJ3A 3FZFB 5AQLB 3ANWA 1YXRA 5FY7A 2VL8A 2O49A 5JDMA 2Q9QA 4CI2B 5JVDE 4H9QC 4ZI2D 2WY2A 1O3XA 1N36T 2AUWA 4DV5T 2ZM2A 4KHZF 3CVRA 1HTJF 2HN1A 2LEHA 4TZ4C 1R69A 3GBFA 2HSGA 3CLCA 3AEBA 2LSJA 4H9RC 4UV9B 4AQFA 3PUSA 3D0TA 5JDNA 4O8SA 3B13A 2BG9B 2VWAA 2Q9QC 3OMTA 2PXDA 1KNRA 2FJAA 3FB2A 3QK6A 3CX7B 3L3PA 1Z8UA 1QUUA 2W0GA 1QZXA 3FBLA 1IBLT 4ER5A 4X4IA 2AWIA 2GK9A 3A7MA 2PXFA 1RZSA 2D9DA 2PXPA 3LQXA 1D1CA 4MCTA 2WU2A 3PUGA 2L3LA 4XZCA 3AXJB 4JI6T 2CCQA 3F52A 4HN9A 3VWSA 1UXCA 3ZT6A 3AEAA 1UUSA 4U3CA 5JRCB 3HL6A 2WQYA 4DV4T 5HEHA 2LNMA 3ZYKA 4J2CA 2Y6XA 5KX5E 2KZ8A 2XASB 1CUNA 5HCJA 3MEJA 4LF9T 2MXDA 3J7Yq 2WWVA 3ZHMA 3PDYA 3ZYMA 4PFPA 3S4UA 2BVLA 2GRLA 1OXZA 3PV0F 2VVSA 3FXDB 3ZC1A 2V5DA 1B7TA 4LFAT 3Q2MA 3UUBA 2J7UA 2OFYA 1BDIA 2X0HA 3ZN0B 4H9SE 5LA6E 2R1JL 2UXCT 1IJ6A 3ABVA 4Z91A 1HR0T 4QX8B 3AE6A 2XXQA 5LJNA 2CXFA 3G5GA 2C5IT 4OK0A 1ZZ9A 3AEGA 5LG4A 3R84B 3ZYLA 4LF4T 4IDQA 3PUAA 4AQYT 4X4GA 2LRKA 1ZZ8A 1J5ET 2XXAA 5FNVE 3JC6C 1G73A 4PJMA 4EV6A 1J1JA 3EUSA 3PUXF 3CK6A 1N33T 2PPXA 3MZKB 3K3NA 1MNEA 2XHEB 2BVMA 1Y01A 5ABHA 1UX5A 5HXEA 3R6NA 4IDOA 3AEEA 1QP7A 2XAQB 5JR9C 2EBYA 2XSDC 2E8IA 2BNMA 4HFDA 1YQ3A 3DNVB 4X4BA 3DTOA 1HF0A 2LYJA 2M6BA 2BKNA 3PURA 1LQCA 1RIOA 3AE4A 5ETWA 3I9YA 2CA5A 2X51A 3O9XA 5AQNB 2MQKA 2FBWA 4EKGA 4IL4A 5DRYA 3SFEA 3VKGA 1ZZ7A 5FXZA 4X4DA 5L3CB 3GN5B 3NXHA 2KEKA 4Z5CA 2PUGA 4DV1T 1I94T 4CI1B 1PRAA 4IDZA 1LCCA 1OWAA 1D1BA 4P1NA 4Z8XA 4JV5T 3I0OA 2O38A 1NENA 4YJ2E 5IYZE 3K1SA 4IVZA 1ZAYA 2XQ3A 5HAXA 3LDQB 1S7EA 2PTFA 4I6RA 1M7KA 2IV1A 3EUHA 2CLYB 1YD8G 4MHCA 3V5UA 2XSAA 4IWRA 4C91A 5L4HA 2WB5A 2XI8A 2CMRA 2W4XA 3T1YT 2KINB 1JWLA 2WP9A 1DULA 5CJ5A 4WNKA 4DE9A 4TNVA 3UFGA 4YTNA 1XNRT 3R09A 1VCTA 3C64A 1WH6A 4ADZA 4KX6A 2IUOA 4ZI2C 4X1IE 2BG9C 2ZMAA 3CQCB 2OA5A 2B1EA 3AB3B 4GHJA 2L8NA 4H9PC 2VQET 3I9WA 1QB2A 2CXLA 4X62T 5AQPB 5FL1A 4LMJA 2LYSA 2CEAA 3ONLC 3KL4A 2CXDA 5AQRB 2VL0A 4EEDA 4DR2T 4N78D 4NXMT 3AECA 5J2TE 1Z0PA 5L4EA 4DR5T 2NTXA 3TEPA 1E1HB 1NWMX 2UUAT 4GIWA 3PTRB 4DUYT 2A9UA 2VKDA 4IL9A 4PAGA 3QB5K 1ZZ6A 4CN4A 4HGAA 5FXXA 2K3WA 4V1Av 2ICPA 3GZDC 3OP9A 1SA0E 2E5VA 4QKNA 4KBMB 3DJBA 1N34T 2LSYA 2A72A 2BG9E 4TX5A 3GMIA 4QHOA 2D0TA 4Z5DA 4JLEA 4EOZB 4QWNB 4X66T 1HG2A 3LK2B 2YKSA 4Z58A 2BNOA 2JVLA 4H63V 2DNXA 3H37A 4GYSA 2PUEA 1BDHA 3ZHIA 4Z90A 2M6IA 3NBXX 1N32T 1DWKA 3OQOA 5JH7E 4ISSA 3GUUA 2W63A 3RGLA 4DUZT 2BKPA 3UU6A 3GWHA 4KMCA 2LLWA 2IC9A 4I0UA 3OQMA 2YDQA 1UX4A 4JI5T 2PUBA 3RPUA 4AIUA 1D0XA 4DV6T 4IGUA 4PFOA 4U74A 1OEDA 3HKBE 4YSYA 3ESLA 3NKZA 4UXNB 2MTQA 2CWOA 4DV7T 4CXWA 4YJ3E 4WBNE 3O1IA 1S94A 2I6HA 2EWTA 4DV3T 1WIZA 2VKOA 4P09A 3SCGA 3LBXA 3BDNA 1ZPQA 1ZV4X 3TFLA 2IU7A 4X1KE 4TUYE 3C50A 1WLXA 3KV6A 5CA1E 4NXNT 3CIRA 1OEDC 3PUWF 2NR4A 4JI0T 2YDSA 2WIUB 1X2LA 3R1FA 4CN1A 2ODVA 4L0RA 5A1LA 2UXXB 2KWHA 3PUQA 2KLQA 5C2TA 3F51A 3ZMUB 1MMGA 1T7SA 3ZN1B 4L5GA 3P50A 5LYJE 2IHR1 3AAEB 4ZI3D 3JXBC 2XQ4A 1ZZBA 4IE5A 4UVCB 1IJ5A 4IA8A 3U3WA 1JH9A 2H89A 3N9LA 3FMYA 3EABA 2FJBA 5J2UE 2CBIA 5FVKA 4YSXA 1PNRA 1NEKA 2FJRA 3RIAA 3FZLB 3KBTA 1BR2A 1LVKA 5BMVE 2XJ3A 1D0YA 2LYQA 3O1JA 5LCYA 3BS3A 4ERRA 4EYYR 3BQLA 3MJXA 4JI7T 3A9ZA 2DWKA 4F8DA 2WBLA 3F31A 3IHRA 5ABFB 2CSFA 4Z59A 2V5CA 1HNWT 2WUSR 3UQ4A 2JJ9A 4DBQA 5ABEA 2NW9A 2WDQA 4ZOLE 2X9HA 4JI3T 5F8PA 3ZT5A 5GONE 4E7ZA 2YEVC 4DR6T 2WWUA 4IE0A 3B57A 3QNUA 1KEYA 2NW7A 3OPCA 4PU8A 5IHYA 2V7IA 4BAYB 1GQEA 2DI4A 2XQ9A 4P0AA 2L49A 2W00A 4UR9A 3UU4A 2KT9A 2LHRA 1WYBA 3NZPA 2WMNA 4QH5A 3DM5A 1H7CA 2X9WA 1IZNB 1ZVVA 4HWDA 1KF6A 2D5UA 1JFSA 1MIWA 3IBPA 5DSXA 2F4VT 4K0KT 1EFAA 2KMFA 1UURA 3AE8A 2B5AA 4DBRA 2CROA 3KVAA 3TLWA 3ZMTB 3J9X1 4JBWF 3IVPA 5LG3A 1GT0C 1X79A 5FY1A 3ETVA 4KUMB 2BNNA 5LMNT 2AW6A 2LSGA 3AA0B 2XCJA 2QVAA 4FN3A 1LCDA 2ACZA 4DV2T 4QXBB 1POUA 2WDRA 3EAMA 4C90A 3NZQA 2IAKA 4X4HA 1CHUA 4IIJE 3RIFA 5LHIB 2JQKA 3OJAA 2H3RA 1WYCA 3WAJA 5HCMA 3FZMB 2MAWA 4XAXB 3OTOT 2V6XA 5JUWA 4LF7T 2HCNA 2PG8A 3MACA 5F5WA 5LBMA 5EK3A 1HNZT 3LISA 2KEIA 3RRWA 2W2UA 1NERA 4Y42A 3RYHE 4QH1A 2XSBA 5L3GB 1HG5A 4IE7A 4ANJA 1ZHCA 2YBDA 4NUUA 2AXZA 3LSVA 2EHOB 2JQ9A 4HE8A 3TLUA 2XXPA 2HN2A 2OLTA 2QYWA 1YSEA 4UELA 3SOLA 3QQ6A 2WZHA 2WAUA 1RZRD 3AAAB 3T1HT 1JFTA 5L2LA 2N2NA 4AKLA 1XZYA 5LJMA 4O8BA 2E9XB 4OHFA 4CXXA 5CFBA 3WAKA 4MLKA 2H88A 1E2AA 2JQQA 4O4IE 3SX0A 5LBQB 3NWIA 3RZZA 4QX7B 3RIUC 5JR9A 4HWFA 2IVGA 2PXVA 2VK9A 2WSSV 4ZI7E 1NEQA 2FFHA 1MIYA 4ZZBA 2LSIA 3MXZA 3ZLIA 5KMGP 3NVOA 5C3JA 3JXDL 2LKGA 3ZSSA 3O1HA 3F6WA 3C51A 2K9AA 4DIDB 2PXTA 4MBQA 4EGWA 4ZI3C 1YW0A 4WZXA 2HCSA 3AE3A 1U4QA 4AKIA 2LCVA 5LP6E 3T8OA 3F57A 2XQYA 2QGSA 2G0UA 2I0MA 2JQEA 4U2ZA 3CROL 3ZJ1A 4AKHA 1HFAA 2CWYA 1HS7A 4HFCA 1J5WA 2Y48B 5EK4A 2J47A 3C4WA 2KWIB 4PU7A 2J4GA 2P9BA 2V7JA 3P8CD 3LBXB 1EZ3A 3LK3B 2A3DA 3CKDA 3CWZB 1ADRA 2MOZA 2XAGB 3HKDE 1QQAA 3SFDA 5AQKB 4YG1A 4XBFB 2BS3A 3L1PA 2YU1A 3ZSTA 5HWXA 4H9OC 2XQ7A 3UWPA 2BG9A 5DJQC 2WMOA 2CBJA 2IUBA 4AQGA 4HRAA 4WBOA 3PUZF 4O4JE 4U2YA 4COFA 4J1WA 3B5MA 3OKQA 5AQVB 5BR8T 4CZZB 3E22E 2W61A 4ZHQE 1R63A 3N2KE 4DMWA 4ZZCA 4AI6A 3P4RA 3OYXA 1OSLA 4TWHA 4F6RC 3MK7C 5HEUA 1I6ZA 4FI5A 1ZP0A 4K0UA 1UTXA 5JDQA 2IMLA 3GZDA 4YY3T 1VCSA 2WDVA 5DQVA 2QA7A 2D2SA 1XMQT 4HFHA 4PJJA 4EZ4A 4B3ST 5JRCA 1HX1B 4FJOA 2DL1A 2XZEA 1MIVA 3FYAA 3RLFF 3PU8A 3Q5XA 1SHZC 2M67A 2ODUA 3WI3A 3Q9DA 3N9PA 1XDPA 1W09A 3VR9A 3E08A 3I1AA 2YU2A 5GAGi 5HEJA 3MKDA 3D1NI 2IIUA 3JXCL 1BR1A 4UVBB 4ILAA 1YKEB 2LLYA 4PK5A 4YT0A 3ZMSB 5AQFB 1US7B 4OFZA 5H6RB 2BKOA 5LNKA 3PE0A 2ES0A 1WR6A 1O4XA 1XWMA 2NP9A 3N9OA 3BQKA 3PJAA 3UUMA 5J1GA 2R63A 4HFBA 5CB4E 1Y64B 3AE7A 5AQJB 3UUNA 1DU2A 3PUVF 4U33A 1T8BA 2WCAA 3ANWB 4HEAA 2OV9A 4OB4A 5L3EB 2Q9QB 5DTRA 2LHNA 1IC8A 4MALA 4LMKA 3EI0A 3SCHA 2PUFA 4H63H 2WZIA 4HWIB 4KP3C 3G06A 5C8YE 1B0NA 4KI0F 5LXTE 1SQ8A 1CQTA 4JYAT 2KSRA 4EIWA 4B3TT 4OX9T 2DHRA 2GZUA 4EEBA 1HX8A 4LFCT 2PUAA 1M62A 2K5BB 4YSZA 1X9BA 2YN6A 3LG7A 1IBKT 1YQ4A 5JDGA 1XMOT 2VVNA 4X4CA 3LFPA 3BK9A 3OWQA 2XAJB 2V8SV 3B7HA 1HCIA 1Y9QA 3KJXA 2HH7A 4TWDA 4BJMA 5LHHB 1U2ZA 3N9NA 2R6GF 4YLHA 5EZYE 5DT2A 1FEWA 1PRUA 4WW0A 2N1GA 1KNPA 2X9XA 2KPJA 2NW8A 4I8TA 3V5SA 3GN5A 1RPEL 4DVDA 3SWHA 3ZKCA 3JAEA 3HA4A 3FBZA 1LVFA 2PXQA 3AE9A 3KFWX 3RC3A 1S35A 2UUBT 2SPCA 3JADA 5F3JA 3AE2A 5LMUT 2N9DA 2XTLA 3HKEE 4B3RT 1W9RA 2XIUA 3C4XA 2E2AA 5DRTA 4QH4A 5FL0A 3FXEB 4YTMA 3UU8A 3A9YA 5LHGB 4U72A 2J7WA 3X1DA 2AXDS 3TLTA 3UTKA 5FY0A 3UUXB 4LF5T 4GK5E 4X20E 1E3OC 3ZJ2A 1FIOA 2XAFB 4GQMA 4NPPA 5AQUB 3SRZA 4KHPT 2XQ8A 2LYPA 1X57A 5FYMA 4G63A 2ZLYA 3GZCA 3G0TA 3AEFA 3P4PA 4LF8T 4DR3T 2CLYC 5LOVE 2JQHA 3UQ7A 5FXVA 1L1MA 4YBAA 5AQMB 3ZCJA 4AKGA 2CPTA 3M65A 3Q5EA 3RYFE 5DTMA 2BBHA 5HXSA 4CQIA 1WH8A 4Q2JA 2B76A 2K48A 1PRVA 3N5LA 5FVLA 4UV8B 3LK42 4ER7A 4LMLA 5ADXL 1MFQC 1LRZA 3ZEFB 2GRMA 5JDHA 2KNDA 1R8IA 1L0VA 2XAHB 2PE5A 3KVBA 1ZS4A 3EVYA 1FJGT 1YKHB 2NTYA 4GK0E 4ISTA 3PU3A 4DV0T 3ME5A 4BJNA 1UGOA 3NZLA 2VKHA 4GKJT 5EK2A 2EF8A 4WVLA 2ZM8A 1T98A 3SS1A 4JCYA 3OBVE 4GYRA 4IHJE 2KEJA 1VPWA 2LT3A 4PJNA 2XM1A 2J62A 5FMNA 3RYCE 4JI8T 3AEDA 2W67A 5M4YA 1W0AA 3BQIA 3FHNA 4HFEA 4UF0A 3I0QA 1PERL 3AE5A 2VKJA 1BR0A 3A5XA 1MNDA 1VOMA 2XY8B 4LF6T 2E5LT 1G8XA 5A7LA 2YINA 4FBIA 2PJQA 4EB6E 4H9NC 2WM9A 1ZKEA 3OYZA 4X4FA 4PJLA 5DQWA 4PU3C 3DP7A 1MMNA 3JAFA 3O4XE 5AQIB 4I55E 2PBIA 2NOXA 2BBJA 2EHOD 4G2AA 4A5XA 4B6XA 2D0UA 2AXVA 4NDWA 1BR4A 3AVRA 3M3ZB 3HR0A 4DR4T 4ER6A 3UFEA 3HZIB 4AQFC 2K24A 5CGMA 4A98A 3U3IA 1DW9A 5CA0E 3VU7H 4ZS2A 2JCGA 4IREA 4A56A 1HF8A 3VRAA 4TV8E 3RRCA 4LFBT 5AFUL 1KK7A 3RC8A 2RP4A 2C5JA 2JPFA 3RF1A 2M4HA 2E9XD 2L1PA 5ABGA 1QQBA 3RIUA 4GKKT 2V6YA 4A97A 3VHLA 4UEMA 4EAHA 3GA8A 4UVAB 2ICTA 3ETUA
chains in the Genus database with same CATH topology
3C98B 2EWTA 1R63A 3N2KE 4DMWA 2L9QA 4I6UA 1WIZA 2VKOA 3ZCIA 3AA7B 3SCGA 4P09A 3LBXA 4AI6A 3BDNA 1QP0A 3OYXA 1ZPQA 1OSLA 1ZV4X 3AVSA 2IU7A 4X1KE 4F6RC 4TUYE 3C50A 1WLXA 3KXAA 3KV6A 2IW5B 5CA1E 3MK7C 1AJ3A 5HXHA 4PU4C 4FI5A 3ANWA 2LM9A 3C4ZA 4MFRA 5FY7A 2VL8A 2O49A 1UTXA 4K0UA 1QSDA 2LJLA 2Q9QA 4AKRB 5JDMA 5JDQA 5LGTB 1LMB3 5JVDE 4CI2B 2WIUB 1X2LA 3R1FA 4H9QC 4BA9A 1O3XA 4ZI2D 2AUWA 5DQVA 4JQDA 3NRXA 2ODVA 4HFVA 4L0RA 2ZM2A 2QA7A 2D2SA 5A1LA 3CVRA 1HTJF 2UXXB 4EZ4A 4PJJA 5JRCA 2KWHA 2LEHA 4TZ4C 1R69A 3PUQA 4FJOA 3GBFA 1MIVA 3FYAA 1UCUA 2KLQA 2HSGA 3F51A 3CLCA 4EXTA 3PU8A 2LSJA 3ZMUB 1MMGA 3Q5XA 1UXDA 1VRBA 1SHZC 2M67A 3P7IA 4H9RC 4PW8A 4L5GA 4UV9B 3ZN1B 2ODUA 3WI3A 4AQFA 3W15B 2D5VA 2JRKA 3PUSA 3D0TA 5JDNA 5LYJE 4O8SA 3Q9DA 3B13A 3N9PA 3AAEB 4ZI3D 2NWBA 3JXBC 2VWAA 3E08A 2Q9QC 2X0LB 3I1AA 3OMTA 2YU2A 3MKDA 3CX6B 3D1NI 3JXCL 1ZZBA 1BR1A 3FB2A 4IE5A 4UVCB 3QK6A 4UVBB 3FYMA 1IJ5A 1YKEB 4IA8A 3U3WA 3CX7B 3L3PA 1JH9A 4PK5A 3ZMSB 5JREA 1QUUA 5FP3A 2W0GA 3FMYA 3N2GE 3N9LA 1US7B 1Y7YA 3ONXA 3FBLA 4OFZA 2V1DB 5J2UE 5H6RB 5LNKA 3PE0A 4JCXA 2ES0A 1WR6A 3CPZA 4X4IA 1QPZA 1O4XA 4HKAA 4P0BA 1PNRA 2NP9A 2AWIA 3S8QA 3N9OA 3BQKA 1ZUGA 2GK9A 2O4AA 3UUMA 5J1GA 2R63A 2FJRA 1RZSA 2JMKA 3OQNA 2V7MA 5CB4E 1Y64B 2V7KA 1WRDA 3KBTA 1BR2A 1D1CA 1LVKA 3CECA 4MCTA 2OR1L 3N9MA 5BMVE 2XJ3A 4NUVA 1D0YA 3UUNA 3PUGA 2L3LA 2DLRA 4XZCA 2BDEA 2LYQA 3ANWB 3KINB 3MA9A 3O1JA 2CCQA 4HEAA 1D0ZA 5LCYA 4PK4A 4X1YE 3BS3A 4OB4A 4ERRA 4EYYR 5L3EB 2Q9QB 3BQLA 3F52A 4YARA 3MJXA 4HN9A 1UXCA 2LHNA 2DWKA 4F8DA 3H3AA 1IC8A 2BJCA 4GOUA 2WBLA 3F31A 3IHRA 4ILUA 4MALA 5KDMC 4AXPA 3SCHA 3HI2A 3SCFA 2PUFA 4H63H 5JRCB 4KP3C 1IAPA 3HL6A 2CSFA 4Z59A 1B0NA 5C8YE 3BD1A 5LXTE 3ZC0A 2WUSR 2JJ9A 1SQ8A 1CQTA 4DBQA 2HPLA 2NW9A 3ZYKA 4J2CA 4EIWA 4ZOLE 3H5TA 2KZ7B 2X9HA 5HXCA 4JUYA 2Y6XA 5F8PA 5KX5E 5GONE 2CE7A 4E7ZA 2KZ8A 2YEVC 2XASB 2WWUA 4JEUB 2DHRA 4IE0A 2GZUA 3RX6A 3B57A 1WETA 1CUNA 1HX8A 4OYJA 2PUAA 3G7DA 2NW7A 5L3DB 2K5BB 4PU8A 2X67A 2H7VC 5IHYA 2V7IA 4BAYB 3J7Yq 3UFDA 4I6TA 3ZHMA 3LG7A 1V9DA 3PDYA 3ZYMA 5JDGA 5K98B 4PFPA 3S4UA 4YG7B 2DI4A 2BVLA 4IE4A 2GRLA 4X4CA 1OXZA 5HWYA 3LFPA 5TAOA 4P0AA 2L49A 3BK9A 2W00A 3FXDB 3ZC1A 2XAJB 3LJCA 3E0ZA 1B7TA 3B7HA 1HCIA 3Q2MA 2KT9A 2LHRA 1WYBA 3NZPA 1Y9QA 1QP4A 2WMNA 2OFYA 1BDIA 3KJXA 2HH7A 3ZN0B 2DCFA 4BJMA 5LHHB 3N9NA 1H7CA 2X9WA 1IZNB 1ZVVA 4H9SE 4YLHA 1ZZCA 3TKLB 5EZYE 4TV9E 1FEWA 1PRUA 4WW0A 5LA6E 2D5UA 4X4EA 2N1GA 2UXNB 2R1JL 1JFSA 1MIWA 3IBPA 2X9XA 1IJ6A 2KPJA 2NW8A 4I8TA 1EFAA 3V5SA 3GN5A 2KMFA 3QWGA 4QX8B 2B5AA 1RPEL 4DBRA 2LYKA 4DVDA 3SWHA 5LJNA 2CROA 1AU7A 2CXFA 3KVAA 3G5GA 2C5IT 2RA1A 3ZKCA 4OK0A 1ZZ9A 3J9X1 3ZMTB 5LG4A 3R84B 3IVPA 3ZYLA 1GT0C 2H7OA 3HA4A 1X79A 3ZPOA 3FBZA 5FY1A 3PUAA 1LVFA 3ETVA 2EHOA 4KUMB 4X4GA 2BNNA 4QXCB 1MMAA 2AW6A 2LSGA 3KFWX 1ZZ8A 3RC3A 1S35A 5FNVE 1LLIA 3JC6C 2PIJA 1G73A 3AA0B 3KZ3A 4PJMA 1CJGA 3L09A 2KXPB 2SPCA 3UULA 4Z5HA 4ASKA 5F3JA 3EUSA 2XCJA 2BZBA 2N9DA 4FN3A 2XTLA 3HKEE 4UIGA 2AXUA 1LCDA 5HXRA 2PPXA 3MZKB 3K3NA 1MNEA 2XHEB 4QXBB 2BVMA 1POUA 4J1XA 3Q5WA 2XIUA 3C4XA 1UX5A 4O2AE 2Q9QD 4C90A 3NZQA 3FXEB 2IAKA 5HXEA 4X4HA 5LHGB 4U72A 3R6NA 1QP7A 2XAQB 5JR9C 2EBYA 2HINA 5HYAA 2XSDC 4IIJE 2E8IA 2BNMA 5LHIB 3UTKA 3UUXB 5FY0A 3HKCE 3OJAA 2H3RA 3F2EA 4GK5E 3DNVB 1WYCA 4QXHB 4X4BA 2EHOC 4X20E 3WAJA 1E3OC 3ZJ2A 4MCXA 1FIOA 2A6CA 3DTOA 4E7SA 1HF0A 2LYJA 2XAFB 4GQMA 4XAXB 2XUEA 3NRYA 3PURA 1LQCA 4DMVA 1RIOA 2Z6EA 2I59A 2E9XA 5ETWA 1KNZA 3I9YA 3SRZA 2CA5A 2X51A 3K3QC 3O9XA 3CX8B 2LYPA 2MQKA 1X57A 2PG8A 3MACA 2VB6A 5FYMA 4G63A 4YG4A 5LBMA 3VKGA 5EK3A 2ZLYA 3VKHA 3LISA 4YFSA 1ZZ7A 2KEIA 3RRWA 5FXZA 1FMVA 4X4DA 4YHJA 1NERA 2CLYC 5L3CB 4Y42A 3RYHE 5LOVE 5JDLA 3GN5B 5JH7E 5L3GB 2KEKA 4Z5CA 1RZRA 2PUGA 2LSKA 5FXVA 1L1MA 1HG5A 4YBAA 4CI1B 4IE7A 4ANJA 1PRAA 4IDZA 2LOSA 4PK6A 3ZCJA 4AKGA 3M65A 1LCCA 1OWAA 1ZHCA 3RYFE 2IVQA 2LE8A 1D1BA 2HPJA 4Z8XA 4NUUA 2AXZA 4DO0A 2EHOB 5HXSA 4CQIA 1WH8A 2YK0A 5L3FB 3N2OA 2PUCA 2E9XC 3I0OA 4HE8A 2K48A 3AA6B 2O38A 1PRVA 5DABA 3LFMA 3N5LA 4UF0B 4YJ2E 5IYZE 3ZMVB 4IVZA 4JEHB 1ZAYA 2MEZA 2C0SA 5HAXA 1S7EA 4I43B 4L9IA 4I6RA 4UV8B 2IV1A 3IF8B 3EUHA 3LK42 3TRBA 4AKHA 2J1DG 1YSEA 4UELA 3SOLA 2H8RA 2CLYB 1YD8G 1LRZA 2CM0A 4MHCA 3ZEFB 3QQ6A 3V5UA 5ADXL 1FMWA 2X66A 2IVBA 2GRMA 4IWRA 5JDHA 2KNDA 4M1PA 4C91A 3KBUA 2XI8A 2WAUA 1RZRD 2CMRA 3CMLA 3AAAB 2XAHB 2PE5A 3KVBA 1JFTA 2KINB 1JWLA 5L2LA 2N2NA 3QC9A 3RH3A 4AKLA 1ZS4A 4WNKA 4O4HE 5LJMA 4O8BA 2E9XB 3EVYA 4OHFA 1YKHB 2C5KT 4CXXA 2NTYA 4GK0E 3AA1B 3KDSE 4ISTA 3WAKA 3PU3A 3C64A 4MLKA 2JQQA 4O4IE 1WH6A 4ADZA 4BJNA 2IUOA 4ZI2C 4X1IE 5LBQB 2ZMAA 3RZZA 2VKHA 3RKOA 4QX7B 2V26A 5EK2A 5JR9A 4EYUA 2EF8A 2OA5A 3CQXC 2B1EA 1D1AA 1T98A 2ZM8A 3AB3B 3CQCB 4GHJA 3EDUA 2IVGA 3SS1A 4JCYA 3OBVE 4GYRA 4IHJE 2KEJA 1VPWA 3N9QA 2LT3A 2L8NA 4PJNA 2VK9A 4H9PC 5FMNA 3RYCE 2WSSV 3I9WA 4ZI7E 2CXLA 1NEQA 3MLFA 1MIYA 5M4YA 2LSIA 3MXZA 3BQIA 4OYKA 5E0OA 3FHNA 3ZLIA 5KMGP 3KV9A 1U5PA 4UF0A 3I0QA 4HTEA 1PERL 3JXDL 2VKJA 1BR0A 3A5XA 1MNDA 3F6WA 2LYSA 1VOMA 3O1HA 2CEAA 3U78A 3C51A 2K9AA 2CXDA 1G8XA 4N78D 4MBQA 5J2TE 1Z0PA 1YW0A 5A7LA 2YINA 1MMDA 3EDVA 4FBIA 2L8KA 3JC6D 4ZI3C 2NTXA 2A2FX 1U4QA 2PJQA 4ZS3A 4AKIA 2LCVA 5LP6E 4EB6E 4H9NC 1E1HB 1NWMX 2WM9A 3T8OA 4PNIA 3QF3A 1ZKEA 3PTRB 4GIWA 5LGNB 3QYXA 4I50E 3F57A 3OYZA 2XQYA 4X4FA 2QGSA 4PJLA 5DQWA 5H6QB 4PU3C 2G0UA 2VKDA 2MYSA 4PAGA 1ZZ6A 3DP7A 4HGAA 5FXXA 4O2BE 2VASA 2LYRA 4IE6A 1MMNA 4O4LE 2ICPA 3CROL 3K3OA 3OP9A 4V1Av 3ZMZB 1SA0E 4QKNA 3O4XE 4KBMB 3RYIE 3DJBA 4I55E 3ZJ1A 4EZHA 2LSYA 2A72A 1HFAA 2PBIA 2CWYA 2V7LA 3UT5E 4TX5A 5JQGE 1HS7A 3GMIA 2PFVA 2JMHA 2NOXA 2Y48B 1LKXA 2EHOD 4G2AA 2D0TA 4QHOA 4Z5DA 4JLEA 5EK4A 4B6XA 4EOZB 2D0UA 4QWNB 2X9YA 2AXVA 3C4WA 2KWIB 4NDWA 1BR4A 1HG2A 5FXWA 4PU7A 3AVRA 2P9BA 3LK2B 4Z58A 2V7JA 2BNOA 3HR0A 3P8CD 2JVLA 3LBXB 2PUDA 2DNXA 4H63V 4TN7B 4CI3B 1EZ3A 3UFEA 3HZIB 4AQFC 3VK0A 3H37A 1OCTC 3KV5A 4GYSA 2PUEA 4DNDA 2K24A 3LK3B 1BDHA 3U3IA 3ZHIA 1NAFA 2A3DA 1DW9A 3CQGB 3IEEA 1DWKA 2IC6A 3NBXX 3VU7H 5CA0E 2LYLA 5JR9B 3OQOA 3CKDA 3CWZB 4ISSA 1ZEEA 1ADRA 2JCGA 2W63A 2MOZA 3AAIA 4ZS2A 3QUJA 2XAGB 4A56A 1HF8A 2DWGA 3HKDE 3GWHA 1QQAA 3K8PC 4KMCA 2IC9A 3OQMA 4I4TE 4TV8E 4YG1A 5JDFA 5L3BB 1UX4A 3RRCA 4XBFB 2PUBA 5AFUL 1KK7A 3RC8A 3L1PA 1XWRA 2C5JA 2RP4A 2JPFA 2YU1A 3RPUA 1D0XA 2X68A 5HWXA 4H9OC 3PXPA 2E9XD 2Y8DA 4IGUA 4PFOA 3KV4A 1QQBA 4U74A 3HKBE 5DJQC 2WMOA 3ESLA 4UXNB 2MTQA 4AQGA 2CWOA 4WBOA 2LOPA 4O4JE 4CXWA 2MBGA 5LGUB 4YJ3E 4J1WA 2W62A 4WBNE 3OKQA 3VHLA 4CZZB 4UEMA 3O1IA 4EAHA 3GA8A 2ZM0A 4UVAB 3E22E 1S94A 2ACXA 2ICTA 3ETUA 4CXYA 2W61A 4ZHQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEQ A;  3MLF A;  3SCH A;  2EWT A;  3SCF A;  1R63 A;  2PUF A;  3DNV B;  3HI2 A;  4X4B A;  4I6U A;  1WIZ A;  1E3O C;  2CSF A;  4Z59 A;  1B0N A;  4MCX A;  3BD1 A;  2A6C A;  1PER L;  2WUS R;  3SCG A;  2LYJ A;  3JXD L;  1HF0 A;  1SQ8 A;  1CQT A;  4GQM A;  3BDN A;  3F6W A;  2LYS A;  1QP0 A;  1LQC A;  1ZPQ A;  1OSL A;  1RIO A;  3H5T A;  2IU7 A;  3KXA A;  3O9X A;  5A7L A;  4FBI A;  2KZ8 A;  2LYP A;  2MQK A;  4PU4 C;  1X57 A;  2LCV A;  2GZU A;  1WET A;  4YG4 A;  3QF3 A;  2PUA A;  3QYX A;  3LIS A;  3G7D A;  1ZZ7 A;  1UTX A;  2KEI A;  2O49 A;  4PU8 A;  4X4F A;  4X4D A;  1LMB 3;  4PU3 C;  1NER A;  2WIU B;  1X2L A;  3R1F A;  4Y42 A;  3GN5 B;  2AUW A;  1ZZ6 A;  3UFD A;  4JQD A;  4I6T A;  3ZHM A;  2KEK A;  4Z5C A;  1RZR A;  2LYR A;  2PUG A;  2ICP A;  1L1M A;  3CRO L;  3OP9 A;  4YBA A;  5K98 B;  1PRA A;  4YG7 B;  1R69 A;  2GRL A;  4X4C A;  1LCC A;  3LFP A;  3GBF A;  2L49 A;  3FYA A;  2IVQ A;  2HSG A;  3F51 A;  3CLC A;  3B7H A;  2AXZ A;  1Y9Q A;  1QP4 A;  1WH8 A;  4Z5D A;  2OFY A;  1UXD A;  1BDI A;  3KJX A;  2PUC A;  2AXV A;  4NDW A;  4PU7 A;  2O38 A;  1PRV A;  1ZVV A;  4Z58 A;  1ZZC A;  2BNO A;  2D5V A;  2JVL A;  4IVZ A;  2PUD A;  1PRU A;  1ZAY A;  2MEZ A;  4X4E A;  2R1J L;  3HZI B;  3VK0 A;  1JFS A;  3JXB C;  1OCT C;  2PUE A;  1S7E A;  1BDH A;  3OMT A;  2KPJ A;  4I6R A;  1EFA A;  4I8T A;  3GN5 A;  3ZHI A;  3QWG A;  1DW9 A;  3D1N I;  2B5A A;  1DWK A;  1ZZB A;  2IV1 A;  2LYK A;  3TRB A;  3JXC L;  1YSE A;  2LYL A;  1RPE L;  3FYM A;  3OQO A;  2H8R A;  1ADR A;  2JCG A;  2CRO A;  3QQ6 A;  4IA8 A;  1AU7 A;  3U3W A;  1JH9 A;  3G5G A;  2IVB A;  2GRM A;  4IWR A;  3ZKC A;  1ZZ9 A;  3FMY A;  1Y7Y A;  3IVP A;  1QQA A;  1GT0 C;  2XI8 A;  4JCX A;  3OQM A;  1RZR D;  4YG1 A;  4X4I A;  4X4G A;  1QPZ A;  2BNN A;  1O4X A;  2AW6 A;  1PNR A;  2PE5 A;  2PUB A;  1ZZ8 A;  1JFT A;  2AWI A;  1XWR A;  3L1P A;  3S8Q A;  1JWL A;  1ZUG A;  1LLI A;  2PIJ A;  2O4A A;  3KZ3 A;  2R63 A;  1CJG A;  2FJR A;  1RZS A;  1ZS4 A;  3PXP A;  4Z5H A;  3OQN A;  4O8B A;  3EUS A;  2XCJ A;  4FN3 A;  2AXU A;  1LCD A;  1QQB A;  3CEC A;  2PPX A;  4MCT A;  2OR1 L;  2XJ3 A;  1WH6 A;  2IUO A;  1POU A;  2LYQ A;  4J1X A;  3RZZ A;  2XIU A;  3BS3 A;  4OB4 A;  2EF8 A;  3F52 A;  4GHJ A;  4J1W A;  2IVG A;  4YAR A;  4X4H A;  1UXC A;  4JCY A;  2KEJ A;  1VPW A;  4F8D A;  1IC8 A;  2L8N A;  2BJC A;  1QP7 A;  3GA8 A;  2EBY A;  2HIN A;  2XSD C;  2BNM A;  2ICT A; 
#chains in the Genus database with same CATH topology
 2ZM6 T;  3C98 B;  2LM2 A;  3AVS A;  2V3C C;  3SR4 A;  2IW5 B;  3KXA A;  3TEL A;  1NW3 A;  5HXH A;  4PU4 C;  2LM9 A;  3C4Z A;  4TNW A;  4MFR A;  1QSD A;  2LJL A;  4AKR B;  5LGT B;  1LMB 3;  4X64 T;  4BA9 A;  4JQD A;  3NRX A;  2UUC T;  4HFV A;  5ABF A;  2AE9 A;  1UCU A;  2FUP A;  4EXT A;  1UXD A;  1VRB A;  3P7I A;  4PW8 A;  3W15 B;  2D5V A;  2JRK A;  3Q5D A;  2CRB A;  2NWB A;  1OED B;  2X0L B;  3CX6 B;  4DE8 A;  4U7Y A;  3FYM A;  5AQQ B;  2XM2 A;  5JRE A;  5FP3 A;  3N2G E;  1Y7Y A;  3ONX A;  2V1D B;  2PXK A;  4JCX A;  3CPZ A;  5AQS B;  1QPZ A;  4HKA A;  4P0B A;  3ZKR A;  1HQ1 A;  3S8Q A;  1ZUG A;  2O4A A;  2JMK A;  4U7I A;  3PJA J;  3OQN A;  2V7M A;  2MPK A;  2V7K A;  1WRD A;  3CEC A;  2OR1 L;  3N9M A;  4NUV A;  4DR1 T;  2DLR A;  2BDE A;  3KIN B;  3MA9 A;  2LRL A;  1D0Z A;  4PK4 A;  4X1Y E;  4ER0 A;  3H3M A;  4YAR A;  4IDN A;  3H3A A;  2BJC A;  4GOU A;  4ILU A;  5KDM C;  4HWH A;  4AXP A;  3HI2 A;  3SCF A;  1IAP A;  2WU5 A;  2HHH T;  1WR0 A;  3BD1 A;  3ZC0 A;  2HPL A;  5AQH B;  2QRX A;  3H5T A;  1T72 A;  2KZ7 B;  5HXC A;  4EZI A;  3JCF A;  4JUY A;  5JTG A;  1W0B A;  2CE7 A;  2X0Y A;  4JEU B;  4TWF A;  3RX6 A;  1WET A;  3ZPX A;  5IUX A;  4OYJ A;  5LB7 B;  3G7D A;  5L3D B;  5AQO B;  2BS2 A;  2X67 A;  2H7V C;  5DTQ A;  3UFD A;  3RQU A;  2UU9 T;  3A8Y C;  4I6T A;  1V9D A;  1QLB A;  5K98 B;  4YG7 B;  3RHW A;  4IE4 A;  4JI1 T;  5HWY A;  5TAO A;  2BS4 A;  3LJC A;  3E0Z A;  1QP4 A;  5GAH i;  2FJE A;  1UK5 A;  2DCF A;  3AXJ A;  1ZZC A;  3TKL B;  4TV9 E;  1E7P A;  4X4E A;  2PXB A;  2UXN B;  2IDO B;  5L47 A;  3IA3 A;  3QWG A;  2LYK A;  3PE5 A;  1AU7 A;  2RA1 A;  2HFZ A;  2H7O A;  3ZPO A;  2EHO A;  4QXC B;  1MMA A;  4EK9 A;  1LLI A;  2PIJ A;  3KZ3 A;  1CJG A;  3L09 A;  3PUY F;  2KXP B;  3UUL A;  4Z5H A;  4ASK A;  2BZB A;  5IWA T;  4UIG A;  2AXU A;  5HXR A;  2LLV A;  5HEO A;  4J1X A;  3Q5W A;  4O2A E;  2Q9Q D;  2HIN A;  5HYA A;  3HKC E;  4Q25 A;  3F2E A;  2XQ5 A;  4QXH B;  5HEG A;  2EHO C;  4AIS A;  3NDB B;  4MCX A;  2A6C A;  4E7S A;  2XUE A;  3NRY A;  3QFI A;  4DMV A;  2Z6E A;  2I59 A;  2E9X A;  1KNZ A;  3UU3 A;  3K3Q C;  3TLV A;  3CX8 B;  2VB6 A;  4YG4 A;  3RI5 A;  3VKH A;  5AQG B;  4ER3 A;  4YFS A;  4CN6 A;  1FMV A;  4YHJ A;  2JIW A;  5JDL A;  3FZK B;  1RZR A;  2LSK A;  2FJD A;  2XJ7 A;  2LOS A;  4PK6 A;  5FKY A;  2IVQ A;  2LE8 A;  2HPJ A;  5L3F B;  4DO0 A;  2LKH A;  2YK0 A;  3N2O A;  2PUC A;  2E9X C;  3AA6 B;  5DAB A;  3LFM A;  4UF0 B;  3ZMV B;  4JEH B;  2MEZ A;  2C0S A;  1XDO A;  4U31 A;  4I43 B;  4L9I A;  2PXU A;  2YOE A;  3IF8 B;  3TRB A;  2J1D G;  2H8R A;  3QOF A;  2CM0 A;  4X5T A;  1WFD A;  1FMW A;  2X66 A;  2IVB A;  4M1P A;  3QB5 A;  1HNX T;  2YDR A;  4IDP A;  3KBU A;  3A9X A;  3CML A;  2VEO A;  3RKG A;  3QC9 A;  3RH3 A;  4O4H E;  2C5K T;  3AA1 B;  3KDS E;  3RKO A;  2V26 A;  4EYU A;  2VQF T;  3CQX C;  1D1A A;  3EDU A;  5KXJ A;  3N9Q A;  2UXD T;  4ILC A;  2XPK A;  3MLF A;  4ILB A;  3OVU A;  4OYK A;  5E0O A;  3KV9 A;  4F8H A;  1U5P A;  4HTE A;  3L8R A;  2WS3 A;  3U78 A;  5AQT B;  1ZOY A;  1XNQ T;  4X65 T;  2VUR A;  3JC6 D;  3EDV A;  4IT4 A;  1MMD A;  2L8K A;  2A2F X;  4ZS3 A;  4HFI A;  4PNI A;  3QF3 A;  5LGN B;  3QYX A;  4I50 E;  4NIQ A;  2W66 A;  3EHZ A;  4ZXL A;  3QOX A;  2CHN A;  3ONJ A;  5H6Q B;  1SUM B;  3OKZ A;  1WCR A;  2MYS A;  2PXE A;  4YTP A;  3TLS A;  4O2B E;  4O4L E;  2VAS A;  2LYR A;  3P4Q A;  4IE6 A;  3K3O A;  3ZMZ B;  3RYI E;  4B3M T;  4EQZ A;  2V6Y B;  4EZH A;  2V7L A;  1OED E;  3UT5 E;  5JQG E;  2PFV A;  2JMH A;  3M9L A;  1LKX A;  2X9Y A;  1JNR A;  5FXW A;  3P4W A;  4CI3 B;  2PUD A;  4TN7 B;  3VK0 A;  3P4S A;  3KV5 A;  1OCT C;  4DND A;  1NAF A;  3CQG B;  3IEE A;  2IC6 A;  2LYL A;  5JR9 B;  4EKI A;  1ZEE A;  3UU5 A;  3AAI A;  3QUJ A;  2DWG A;  2UXB T;  3K8P C;  5J0Z A;  4YHH T;  4I4T E;  5JDF A;  5L3B B;  4OBM A;  3QOW A;  3L39 A;  2CHO A;  4JI4 T;  1XWR A;  2X68 A;  4YXD A;  3PXP A;  2Y8D A;  1KFY A;  3KV4 A;  2PXL A;  3ZT7 A;  2ODR D;  2XQ6 A;  1SE7 A;  2LOP A;  3NRO A;  2MBG A;  5LGU B;  4WYV A;  2W62 A;  1JNZ A;  3VRB A;  2XQA A;  4DR7 T;  3AE1 A;  2ZM0 A;  2ACX A;  3VR8 A;  3ZCI A;  4CXY A;  2RPA A;  2L9Q A;  4I6U A;  4JI2 T;  4ZEY A;  3AA7 B;  1QP0 A;  3RQW A;  1IBM T;  3FZH B;  4HWC A;  1AJ3 A;  3FZF B;  5AQL B;  3ANW A;  1YXR A;  5FY7 A;  2VL8 A;  2O49 A;  5JDM A;  2Q9Q A;  4CI2 B;  5JVD E;  4H9Q C;  4ZI2 D;  2WY2 A;  1O3X A;  1N36 T;  2AUW A;  4DV5 T;  2ZM2 A;  4KHZ F;  3CVR A;  1HTJ F;  2HN1 A;  2LEH A;  4TZ4 C;  1R69 A;  3GBF A;  2HSG A;  3CLC A;  3AEB A;  2LSJ A;  4H9R C;  4UV9 B;  4AQF A;  3PUS A;  3D0T A;  5JDN A;  4O8S A;  3B13 A;  2BG9 B;  2VWA A;  2Q9Q C;  3OMT A;  2PXD A;  1KNR A;  2FJA A;  3FB2 A;  3QK6 A;  3CX7 B;  3L3P A;  1Z8U A;  1QUU A;  2W0G A;  1QZX A;  3FBL A;  1IBL T;  4ER5 A;  4X4I A;  2AWI A;  2GK9 A;  3A7M A;  2PXF A;  1RZS A;  2D9D A;  2PXP A;  3LQX A;  1D1C A;  4MCT A;  2WU2 A;  3PUG A;  2L3L A;  4XZC A;  3AXJ B;  4JI6 T;  2CCQ A;  3F52 A;  4HN9 A;  3VWS A;  1UXC A;  3ZT6 A;  3AEA A;  1UUS A;  4U3C A;  5JRC B;  3HL6 A;  2WQY A;  4DV4 T;  5HEH A;  2LNM A;  3ZYK A;  4J2C A;  2Y6X A;  5KX5 E;  2KZ8 A;  2XAS B;  1CUN A;  5HCJ A;  3MEJ A;  4LF9 T;  2MXD A;  3J7Y q;  2WWV A;  3ZHM A;  3PDY A;  3ZYM A;  4PFP A;  3S4U A;  2BVL A;  2GRL A;  1OXZ A;  3PV0 F;  2VVS A;  3FXD B;  3ZC1 A;  2V5D A;  1B7T A;  4LFA T;  3Q2M A;  3UUB A;  2J7U A;  2OFY A;  1BDI A;  2X0H A;  3ZN0 B;  4H9S E;  5LA6 E;  2R1J L;  2UXC T;  1IJ6 A;  3ABV A;  4Z91 A;  1HR0 T;  4QX8 B;  3AE6 A;  2XXQ A;  5LJN A;  2CXF A;  3G5G A;  2C5I T;  4OK0 A;  1ZZ9 A;  3AEG A;  5LG4 A;  3R84 B;  3ZYL A;  4LF4 T;  4IDQ A;  3PUA A;  4AQY T;  4X4G A;  2LRK A;  1ZZ8 A;  1J5E T;  2XXA A;  5FNV E;  3JC6 C;  1G73 A;  4PJM A;  4EV6 A;  1J1J A;  3EUS A;  3PUX F;  3CK6 A;  1N33 T;  2PPX A;  3MZK B;  3K3N A;  1MNE A;  2XHE B;  2BVM A;  1Y01 A;  5ABH A;  1UX5 A;  5HXE A;  3R6N A;  4IDO A;  3AEE A;  1QP7 A;  2XAQ B;  5JR9 C;  2EBY A;  2XSD C;  2E8I A;  2BNM A;  4HFD A;  1YQ3 A;  3DNV B;  4X4B A;  3DTO A;  1HF0 A;  2LYJ A;  2M6B A;  2BKN A;  3PUR A;  1LQC A;  1RIO A;  3AE4 A;  5ETW A;  3I9Y A;  2CA5 A;  2X51 A;  3O9X A;  5AQN B;  2MQK A;  2FBW A;  4EKG A;  4IL4 A;  5DRY A;  3SFE A;  3VKG A;  1ZZ7 A;  5FXZ A;  4X4D A;  5L3C B;  3GN5 B;  3NXH A;  2KEK A;  4Z5C A;  2PUG A;  4DV1 T;  1I94 T;  4CI1 B;  1PRA A;  4IDZ A;  1LCC A;  1OWA A;  1D1B A;  4P1N A;  4Z8X A;  4JV5 T;  3I0O A;  2O38 A;  1NEN A;  4YJ2 E;  5IYZ E;  3K1S A;  4IVZ A;  1ZAY A;  2XQ3 A;  5HAX A;  3LDQ B;  1S7E A;  2PTF A;  4I6R A;  1M7K A;  2IV1 A;  3EUH A;  2CLY B;  1YD8 G;  4MHC A;  3V5U A;  2XSA A;  4IWR A;  4C91 A;  5L4H A;  2WB5 A;  2XI8 A;  2CMR A;  2W4X A;  3T1Y T;  2KIN B;  1JWL A;  2WP9 A;  1DUL A;  5CJ5 A;  4WNK A;  4DE9 A;  4TNV A;  3UFG A;  4YTN A;  1XNR T;  3R09 A;  1VCT A;  3C64 A;  1WH6 A;  4ADZ A;  4KX6 A;  2IUO A;  4ZI2 C;  4X1I E;  2BG9 C;  2ZMA A;  3CQC B;  2OA5 A;  2B1E A;  3AB3 B;  4GHJ A;  2L8N A;  4H9P C;  2VQE T;  3I9W A;  1QB2 A;  2CXL A;  4X62 T;  5AQP B;  5FL1 A;  4LMJ A;  2LYS A;  2CEA A;  3ONL C;  3KL4 A;  2CXD A;  5AQR B;  2VL0 A;  4EED A;  4DR2 T;  4N78 D;  4NXM T;  3AEC A;  5J2T E;  1Z0P A;  5L4E A;  4DR5 T;  2NTX A;  3TEP A;  1E1H B;  1NWM X;  2UUA T;  4GIW A;  3PTR B;  4DUY T;  2A9U A;  2VKD A;  4IL9 A;  4PAG A;  3QB5 K;  1ZZ6 A;  4CN4 A;  4HGA A;  5FXX A;  2K3W A;  4V1A v;  2ICP A;  3GZD C;  3OP9 A;  1SA0 E;  2E5V A;  4QKN A;  4KBM B;  3DJB A;  1N34 T;  2LSY A;  2A72 A;  2BG9 E;  4TX5 A;  3GMI A;  4QHO A;  2D0T A;  4Z5D A;  4JLE A;  4EOZ B;  4QWN B;  4X66 T;  1HG2 A;  3LK2 B;  2YKS A;  4Z58 A;  2BNO A;  2JVL A;  4H63 V;  2DNX A;  3H37 A;  4GYS A;  2PUE A;  1BDH A;  3ZHI A;  4Z90 A;  2M6I A;  3NBX X;  1N32 T;  1DWK A;  3OQO A;  5JH7 E;  4ISS A;  3GUU A;  2W63 A;  3RGL A;  4DUZ T;  2BKP A;  3UU6 A;  3GWH A;  4KMC A;  2LLW A;  2IC9 A;  4I0U A;  3OQM A;  2YDQ A;  1UX4 A;  4JI5 T;  2PUB A;  3RPU A;  4AIU A;  1D0X A;  4DV6 T;  4IGU A;  4PFO A;  4U74 A;  1OED A;  3HKB E;  4YSY A;  3ESL A;  3NKZ A;  4UXN B;  2MTQ A;  2CWO A;  4DV7 T;  4CXW A;  4YJ3 E;  4WBN E;  3O1I A;  1S94 A;  2I6H A;  2EWT A;  4DV3 T;  1WIZ A;  2VKO A;  4P09 A;  3SCG A;  3LBX A;  3BDN A;  1ZPQ A;  1ZV4 X;  3TFL A;  2IU7 A;  4X1K E;  4TUY E;  3C50 A;  1WLX A;  3KV6 A;  5CA1 E;  4NXN T;  3CIR A;  1OED C;  3PUW F;  2NR4 A;  4JI0 T;  2YDS A;  2WIU B;  1X2L A;  3R1F A;  4CN1 A;  2ODV A;  4L0R A;  5A1L A;  2UXX B;  2KWH A;  3PUQ A;  2KLQ A;  5C2T A;  3F51 A;  3ZMU B;  1MMG A;  1T7S A;  3ZN1 B;  4L5G A;  3P50 A;  5LYJ E;  2IHR 1;  3AAE B;  4ZI3 D;  3JXB C;  2XQ4 A;  1ZZB A;  4IE5 A;  4UVC B;  1IJ5 A;  4IA8 A;  3U3W A;  1JH9 A;  2H89 A;  3N9L A;  3FMY A;  3EAB A;  2FJB A;  5J2U E;  2CBI A;  5FVK A;  4YSX A;  1PNR A;  1NEK A;  2FJR A;  3RIA A;  3FZL B;  3KBT A;  1BR2 A;  1LVK A;  5BMV E;  2XJ3 A;  1D0Y A;  2LYQ A;  3O1J A;  5LCY A;  3BS3 A;  4ERR A;  4EYY R;  3BQL A;  3MJX A;  4JI7 T;  3A9Z A;  2DWK A;  4F8D A;  2WBL A;  3F31 A;  3IHR A;  5ABF B;  2CSF A;  4Z59 A;  2V5C A;  1HNW T;  2WUS R;  3UQ4 A;  2JJ9 A;  4DBQ A;  5ABE A;  2NW9 A;  2WDQ A;  4ZOL E;  2X9H A;  4JI3 T;  5F8P A;  3ZT5 A;  5GON E;  4E7Z A;  2YEV C;  4DR6 T;  2WWU A;  4IE0 A;  3B57 A;  3QNU A;  1KEY A;  2NW7 A;  3OPC A;  4PU8 A;  5IHY A;  2V7I A;  4BAY B;  1GQE A;  2DI4 A;  2XQ9 A;  4P0A A;  2L49 A;  2W00 A;  4UR9 A;  3UU4 A;  2KT9 A;  2LHR A;  1WYB A;  3NZP A;  2WMN A;  4QH5 A;  3DM5 A;  1H7C A;  2X9W A;  1IZN B;  1ZVV A;  4HWD A;  1KF6 A;  2D5U A;  1JFS A;  1MIW A;  3IBP A;  5DSX A;  2F4V T;  4K0K T;  1EFA A;  2KMF A;  1UUR A;  3AE8 A;  2B5A A;  4DBR A;  2CRO A;  3KVA A;  3TLW A;  3ZMT B;  3J9X 1;  4JBW F;  3IVP A;  5LG3 A;  1GT0 C;  1X79 A;  5FY1 A;  3ETV A;  4KUM B;  2BNN A;  5LMN T;  2AW6 A;  2LSG A;  3AA0 B;  2XCJ A;  2QVA A;  4FN3 A;  1LCD A;  2ACZ A;  4DV2 T;  4QXB B;  1POU A;  2WDR A;  3EAM A;  4C90 A;  3NZQ A;  2IAK A;  4X4H A;  1CHU A;  4IIJ E;  3RIF A;  5LHI B;  2JQK A;  3OJA A;  2H3R A;  1WYC A;  3WAJ A;  5HCM A;  3FZM B;  2MAW A;  4XAX B;  3OTO T;  2V6X A;  5JUW A;  4LF7 T;  2HCN A;  2PG8 A;  3MAC A;  5F5W A;  5LBM A;  5EK3 A;  1HNZ T;  3LIS A;  2KEI A;  3RRW A;  2W2U A;  1NER A;  4Y42 A;  3RYH E;  4QH1 A;  2XSB A;  5L3G B;  1HG5 A;  4IE7 A;  4ANJ A;  1ZHC A;  2YBD A;  4NUU A;  2AXZ A;  3LSV A;  2EHO B;  2JQ9 A;  4HE8 A;  3TLU A;  2XXP A;  2HN2 A;  2OLT A;  2QYW A;  1YSE A;  4UEL A;  3SOL A;  3QQ6 A;  2WZH A;  2WAU A;  1RZR D;  3AAA B;  3T1H T;  1JFT A;  5L2L A;  2N2N A;  4AKL A;  1XZY A;  5LJM A;  4O8B A;  2E9X B;  4OHF A;  4CXX A;  5CFB A;  3WAK A;  4MLK A;  2H88 A;  1E2A A;  2JQQ A;  4O4I E;  3SX0 A;  5LBQ B;  3NWI A;  3RZZ A;  4QX7 B;  3RIU C;  5JR9 A;  4HWF A;  2IVG A;  2PXV A;  2VK9 A;  2WSS V;  4ZI7 E;  1NEQ A;  2FFH A;  1MIY A;  4ZZB A;  2LSI A;  3MXZ A;  3ZLI A;  5KMG P;  3NVO A;  5C3J A;  3JXD L;  2LKG A;  3ZSS A;  3O1H A;  3F6W A;  3C51 A;  2K9A A;  4DID B;  2PXT A;  4MBQ A;  4EGW A;  4ZI3 C;  1YW0 A;  4WZX A;  2HCS A;  3AE3 A;  1U4Q A;  4AKI A;  2LCV A;  5LP6 E;  3T8O A;  3F57 A;  2XQY A;  2QGS A;  2G0U A;  2I0M A;  2JQE A;  4U2Z A;  3CRO L;  3ZJ1 A;  4AKH A;  1HFA A;  2CWY A;  1HS7 A;  4HFC A;  1J5W A;  2Y48 B;  5EK4 A;  2J47 A;  3C4W A;  2KWI B;  4PU7 A;  2J4G A;  2P9B A;  2V7J A;  3P8C D;  3LBX B;  1EZ3 A;  3LK3 B;  2A3D A;  3CKD A;  3CWZ B;  1ADR A;  2MOZ A;  2XAG B;  3HKD E;  1QQA A;  3SFD A;  5AQK B;  4YG1 A;  4XBF B;  2BS3 A;  3L1P A;  2YU1 A;  3ZST A;  5HWX A;  4H9O C;  2XQ7 A;  3UWP A;  2BG9 A;  5DJQ C;  2WMO A;  2CBJ A;  2IUB A;  4AQG A;  4HRA A;  4WBO A;  3PUZ F;  4O4J E;  4U2Y A;  4COF A;  4J1W A;  3B5M A;  3OKQ A;  5AQV B;  5BR8 T;  4CZZ B;  3E22 E;  2W61 A;  4ZHQ E;  1R63 A;  3N2K E;  4DMW A;  4ZZC A;  4AI6 A;  3P4R A;  3OYX A;  1OSL A;  4TWH A;  4F6R C;  3MK7 C;  5HEU A;  1I6Z A;  4FI5 A;  1ZP0 A;  4K0U A;  1UTX A;  5JDQ A;  2IML A;  3GZD A;  4YY3 T;  1VCS A;  2WDV A;  5DQV A;  2QA7 A;  2D2S A;  1XMQ T;  4HFH A;  4PJJ A;  4EZ4 A;  4B3S T;  5JRC A;  1HX1 B;  4FJO A;  2DL1 A;  2XZE A;  1MIV A;  3FYA A;  3RLF F;  3PU8 A;  3Q5X A;  1SHZ C;  2M67 A;  2ODU A;  3WI3 A;  3Q9D A;  3N9P A;  1XDP A;  1W09 A;  3VR9 A;  3E08 A;  3I1A A;  2YU2 A;  5GAG i;  5HEJ A;  3MKD A;  3D1N I;  2IIU A;  3JXC L;  1BR1 A;  4UVB B;  4ILA A;  1YKE B;  2LLY A;  4PK5 A;  4YT0 A;  3ZMS B;  5AQF B;  1US7 B;  4OFZ A;  5H6R B;  2BKO A;  5LNK A;  3PE0 A;  2ES0 A;  1WR6 A;  1O4X A;  1XWM A;  2NP9 A;  3N9O A;  3BQK A;  3PJA A;  3UUM A;  5J1G A;  2R63 A;  4HFB A;  5CB4 E;  1Y64 B;  3AE7 A;  5AQJ B;  3UUN A;  1DU2 A;  3PUV F;  4U33 A;  1T8B A;  2WCA A;  3ANW B;  4HEA A;  2OV9 A;  4OB4 A;  5L3E B;  2Q9Q B;  5DTR A;  2LHN A;  1IC8 A;  4MAL A;  4LMK A;  3EI0 A;  3SCH A;  2PUF A;  4H63 H;  2WZI A;  4HWI B;  4KP3 C;  3G06 A;  5C8Y E;  1B0N A;  4KI0 F;  5LXT E;  1SQ8 A;  1CQT A;  4JYA T;  2KSR A;  4EIW A;  4B3T T;  4OX9 T;  2DHR A;  2GZU A;  4EEB A;  1HX8 A;  4LFC T;  2PUA A;  1M62 A;  2K5B B;  4YSZ A;  1X9B A;  2YN6 A;  3LG7 A;  1IBK T;  1YQ4 A;  5JDG A;  1XMO T;  2VVN A;  4X4C A;  3LFP A;  3BK9 A;  3OWQ A;  2XAJ B;  2V8S V;  3B7H A;  1HCI A;  1Y9Q A;  3KJX A;  2HH7 A;  4TWD A;  4BJM A;  5LHH B;  1U2Z A;  3N9N A;  2R6G F;  4YLH A;  5EZY E;  5DT2 A;  1FEW A;  1PRU A;  4WW0 A;  2N1G A;  1KNP A;  2X9X A;  2KPJ A;  2NW8 A;  4I8T A;  3V5S A;  3GN5 A;  1RPE L;  4DVD A;  3SWH A;  3ZKC A;  3JAE A;  3HA4 A;  3FBZ A;  1LVF A;  2PXQ A;  3AE9 A;  3KFW X;  3RC3 A;  1S35 A;  2UUB T;  2SPC A;  3JAD A;  5F3J A;  3AE2 A;  5LMU T;  2N9D A;  2XTL A;  3HKE E;  4B3R T;  1W9R A;  2XIU A;  3C4X A;  2E2A A;  5DRT A;  4QH4 A;  5FL0 A;  3FXE B;  4YTM A;  3UU8 A;  3A9Y A;  5LHG B;  4U72 A;  2J7W A;  3X1D A;  2AXD S;  3TLT A;  3UTK A;  5FY0 A;  3UUX B;  4LF5 T;  4GK5 E;  4X20 E;  1E3O C;  3ZJ2 A;  1FIO A;  2XAF B;  4GQM A;  4NPP A;  5AQU B;  3SRZ A;  4KHP T;  2XQ8 A;  2LYP A;  1X57 A;  5FYM A;  4G63 A;  2ZLY A;  3GZC A;  3G0T A;  3AEF A;  3P4P A;  4LF8 T;  4DR3 T;  2CLY C;  5LOV E;  2JQH A;  3UQ7 A;  5FXV A;  1L1M A;  4YBA A;  5AQM B;  3ZCJ A;  4AKG A;  2CPT A;  3M65 A;  3Q5E A;  3RYF E;  5DTM A;  2BBH A;  5HXS A;  4CQI A;  1WH8 A;  4Q2J A;  2B76 A;  2K48 A;  1PRV A;  3N5L A;  5FVL A;  4UV8 B;  3LK4 2;  4ER7 A;  4LML A;  5ADX L;  1MFQ C;  1LRZ A;  3ZEF B;  2GRM A;  5JDH A;  2KND A;  1R8I A;  1L0V A;  2XAH B;  2PE5 A;  3KVB A;  1ZS4 A;  3EVY A;  1FJG T;  1YKH B;  2NTY A;  4GK0 E;  4IST A;  3PU3 A;  4DV0 T;  3ME5 A;  4BJN A;  1UGO A;  3NZL A;  2VKH A;  4GKJ T;  5EK2 A;  2EF8 A;  4WVL A;  2ZM8 A;  1T98 A;  3SS1 A;  4JCY A;  3OBV E;  4GYR A;  4IHJ E;  2KEJ A;  1VPW A;  2LT3 A;  4PJN A;  2XM1 A;  2J62 A;  5FMN A;  3RYC E;  4JI8 T;  3AED A;  2W67 A;  5M4Y A;  1W0A A;  3BQI A;  3FHN A;  4HFE A;  4UF0 A;  3I0Q A;  1PER L;  3AE5 A;  2VKJ A;  1BR0 A;  3A5X A;  1MND A;  1VOM A;  2XY8 B;  4LF6 T;  2E5L T;  1G8X A;  5A7L A;  2YIN A;  4FBI A;  2PJQ A;  4EB6 E;  4H9N C;  2WM9 A;  1ZKE A;  3OYZ A;  4X4F A;  4PJL A;  5DQW A;  4PU3 C;  3DP7 A;  1MMN A;  3JAF A;  3O4X E;  5AQI B;  4I55 E;  2PBI A;  2NOX A;  2BBJ A;  2EHO D;  4G2A A;  4A5X A;  4B6X A;  2D0U A;  2AXV A;  4NDW A;  1BR4 A;  3AVR A;  3M3Z B;  3HR0 A;  4DR4 T;  4ER6 A;  3UFE A;  3HZI B;  4AQF C;  2K24 A;  5CGM A;  4A98 A;  3U3I A;  1DW9 A;  5CA0 E;  3VU7 H;  4ZS2 A;  2JCG A;  4IRE A;  4A56 A;  1HF8 A;  3VRA A;  4TV8 E;  3RRC A;  4LFB T;  5AFU L;  1KK7 A;  3RC8 A;  2RP4 A;  2C5J A;  2JPF A;  3RF1 A;  2M4H A;  2E9X D;  2L1P A;  5ABG A;  1QQB A;  3RIU A;  4GKK T;  2V6Y A;  4A97 A;  3VHL A;  4UEM A;  4EAH A;  3GA8 A;  4UVA B;  2ICT A;  3ETU A; 
#chains in the Genus database with same CATH homology
 3C98 B;  2EWT A;  1R63 A;  3N2K E;  4DMW A;  2L9Q A;  4I6U A;  1WIZ A;  2VKO A;  3ZCI A;  3AA7 B;  3SCG A;  4P09 A;  3LBX A;  4AI6 A;  3BDN A;  1QP0 A;  3OYX A;  1ZPQ A;  1OSL A;  1ZV4 X;  3AVS A;  2IU7 A;  4X1K E;  4F6R C;  4TUY E;  3C50 A;  1WLX A;  3KXA A;  3KV6 A;  2IW5 B;  5CA1 E;  3MK7 C;  1AJ3 A;  5HXH A;  4PU4 C;  4FI5 A;  3ANW A;  2LM9 A;  3C4Z A;  4MFR A;  5FY7 A;  2VL8 A;  2O49 A;  1UTX A;  4K0U A;  1QSD A;  2LJL A;  2Q9Q A;  4AKR B;  5JDM A;  5JDQ A;  5LGT B;  1LMB 3;  5JVD E;  4CI2 B;  2WIU B;  1X2L A;  3R1F A;  4H9Q C;  4BA9 A;  1O3X A;  4ZI2 D;  2AUW A;  5DQV A;  4JQD A;  3NRX A;  2ODV A;  4HFV A;  4L0R A;  2ZM2 A;  2QA7 A;  2D2S A;  5A1L A;  3CVR A;  1HTJ F;  2UXX B;  4EZ4 A;  4PJJ A;  5JRC A;  2KWH A;  2LEH A;  4TZ4 C;  1R69 A;  3PUQ A;  4FJO A;  3GBF A;  1MIV A;  3FYA A;  1UCU A;  2KLQ A;  2HSG A;  3F51 A;  3CLC A;  4EXT A;  3PU8 A;  2LSJ A;  3ZMU B;  1MMG A;  3Q5X A;  1UXD A;  1VRB A;  1SHZ C;  2M67 A;  3P7I A;  4H9R C;  4PW8 A;  4L5G A;  4UV9 B;  3ZN1 B;  2ODU A;  3WI3 A;  4AQF A;  3W15 B;  2D5V A;  2JRK A;  3PUS A;  3D0T A;  5JDN A;  5LYJ E;  4O8S A;  3Q9D A;  3B13 A;  3N9P A;  3AAE B;  4ZI3 D;  2NWB A;  3JXB C;  2VWA A;  3E08 A;  2Q9Q C;  2X0L B;  3I1A A;  3OMT A;  2YU2 A;  3MKD A;  3CX6 B;  3D1N I;  3JXC L;  1ZZB A;  1BR1 A;  3FB2 A;  4IE5 A;  4UVC B;  3QK6 A;  4UVB B;  3FYM A;  1IJ5 A;  1YKE B;  4IA8 A;  3U3W A;  3CX7 B;  3L3P A;  1JH9 A;  4PK5 A;  3ZMS B;  5JRE A;  1QUU A;  5FP3 A;  2W0G A;  3FMY A;  3N2G E;  3N9L A;  1US7 B;  1Y7Y A;  3ONX A;  3FBL A;  4OFZ A;  2V1D B;  5J2U E;  5H6R B;  5LNK A;  3PE0 A;  4JCX A;  2ES0 A;  1WR6 A;  3CPZ A;  4X4I A;  1QPZ A;  1O4X A;  4HKA A;  4P0B A;  1PNR A;  2NP9 A;  2AWI A;  3S8Q A;  3N9O A;  3BQK A;  1ZUG A;  2GK9 A;  2O4A A;  3UUM A;  5J1G A;  2R63 A;  2FJR A;  1RZS A;  2JMK A;  3OQN A;  2V7M A;  5CB4 E;  1Y64 B;  2V7K A;  1WRD A;  3KBT A;  1BR2 A;  1D1C A;  1LVK A;  3CEC A;  4MCT A;  2OR1 L;  3N9M A;  5BMV E;  2XJ3 A;  4NUV A;  1D0Y A;  3UUN A;  3PUG A;  2L3L A;  2DLR A;  4XZC A;  2BDE A;  2LYQ A;  3ANW B;  3KIN B;  3MA9 A;  3O1J A;  2CCQ A;  4HEA A;  1D0Z A;  5LCY A;  4PK4 A;  4X1Y E;  3BS3 A;  4OB4 A;  4ERR A;  4EYY R;  5L3E B;  2Q9Q B;  3BQL A;  3F52 A;  4YAR A;  3MJX A;  4HN9 A;  1UXC A;  2LHN A;  2DWK A;  4F8D A;  3H3A A;  1IC8 A;  2BJC A;  4GOU A;  2WBL A;  3F31 A;  3IHR A;  4ILU A;  4MAL A;  5KDM C;  4AXP A;  3SCH A;  3HI2 A;  3SCF A;  2PUF A;  4H63 H;  5JRC B;  4KP3 C;  1IAP A;  3HL6 A;  2CSF A;  4Z59 A;  1B0N A;  5C8Y E;  3BD1 A;  5LXT E;  3ZC0 A;  2WUS R;  2JJ9 A;  1SQ8 A;  1CQT A;  4DBQ A;  2HPL A;  2NW9 A;  3ZYK A;  4J2C A;  4EIW A;  4ZOL E;  3H5T A;  2KZ7 B;  2X9H A;  5HXC A;  4JUY A;  2Y6X A;  5F8P A;  5KX5 E;  5GON E;  2CE7 A;  4E7Z A;  2KZ8 A;  2YEV C;  2XAS B;  2WWU A;  4JEU B;  2DHR A;  4IE0 A;  2GZU A;  3RX6 A;  3B57 A;  1WET A;  1CUN A;  1HX8 A;  4OYJ A;  2PUA A;  3G7D A;  2NW7 A;  5L3D B;  2K5B B;  4PU8 A;  2X67 A;  2H7V C;  5IHY A;  2V7I A;  4BAY B;  3J7Y q;  3UFD A;  4I6T A;  3ZHM A;  3LG7 A;  1V9D A;  3PDY A;  3ZYM A;  5JDG A;  5K98 B;  4PFP A;  3S4U A;  4YG7 B;  2DI4 A;  2BVL A;  4IE4 A;  2GRL A;  4X4C A;  1OXZ A;  5HWY A;  3LFP A;  5TAO A;  4P0A A;  2L49 A;  3BK9 A;  2W00 A;  3FXD B;  3ZC1 A;  2XAJ B;  3LJC A;  3E0Z A;  1B7T A;  3B7H A;  1HCI A;  3Q2M A;  2KT9 A;  2LHR A;  1WYB A;  3NZP A;  1Y9Q A;  1QP4 A;  2WMN A;  2OFY A;  1BDI A;  3KJX A;  2HH7 A;  3ZN0 B;  2DCF A;  4BJM A;  5LHH B;  3N9N A;  1H7C A;  2X9W A;  1IZN B;  1ZVV A;  4H9S E;  4YLH A;  1ZZC A;  3TKL B;  5EZY E;  4TV9 E;  1FEW A;  1PRU A;  4WW0 A;  5LA6 E;  2D5U A;  4X4E A;  2N1G A;  2UXN B;  2R1J L;  1JFS A;  1MIW A;  3IBP A;  2X9X A;  1IJ6 A;  2KPJ A;  2NW8 A;  4I8T A;  1EFA A;  3V5S A;  3GN5 A;  2KMF A;  3QWG A;  4QX8 B;  2B5A A;  1RPE L;  4DBR A;  2LYK A;  4DVD A;  3SWH A;  5LJN A;  2CRO A;  1AU7 A;  2CXF A;  3KVA A;  3G5G A;  2C5I T;  2RA1 A;  3ZKC A;  4OK0 A;  1ZZ9 A;  3J9X 1;  3ZMT B;  5LG4 A;  3R84 B;  3IVP A;  3ZYL A;  1GT0 C;  2H7O A;  3HA4 A;  1X79 A;  3ZPO A;  3FBZ A;  5FY1 A;  3PUA A;  1LVF A;  3ETV A;  2EHO A;  4KUM B;  4X4G A;  2BNN A;  4QXC B;  1MMA A;  2AW6 A;  2LSG A;  3KFW X;  1ZZ8 A;  3RC3 A;  1S35 A;  5FNV E;  1LLI A;  3JC6 C;  2PIJ A;  1G73 A;  3AA0 B;  3KZ3 A;  4PJM A;  1CJG A;  3L09 A;  2KXP B;  2SPC A;  3UUL A;  4Z5H A;  4ASK A;  5F3J A;  3EUS A;  2XCJ A;  2BZB A;  2N9D A;  4FN3 A;  2XTL A;  3HKE E;  4UIG A;  2AXU A;  1LCD A;  5HXR A;  2PPX A;  3MZK B;  3K3N A;  1MNE A;  2XHE B;  4QXB B;  2BVM A;  1POU A;  4J1X A;  3Q5W A;  2XIU A;  3C4X A;  1UX5 A;  4O2A E;  2Q9Q D;  4C90 A;  3NZQ A;  3FXE B;  2IAK A;  5HXE A;  4X4H A;  5LHG B;  4U72 A;  3R6N A;  1QP7 A;  2XAQ B;  5JR9 C;  2EBY A;  2HIN A;  5HYA A;  2XSD C;  4IIJ E;  2E8I A;  2BNM A;  5LHI B;  3UTK A;  3UUX B;  5FY0 A;  3HKC E;  3OJA A;  2H3R A;  3F2E A;  4GK5 E;  3DNV B;  1WYC A;  4QXH B;  4X4B A;  2EHO C;  4X20 E;  3WAJ A;  1E3O C;  3ZJ2 A;  4MCX A;  1FIO A;  2A6C A;  3DTO A;  4E7S A;  1HF0 A;  2LYJ A;  2XAF B;  4GQM A;  4XAX B;  2XUE A;  3NRY A;  3PUR A;  1LQC A;  4DMV A;  1RIO A;  2Z6E A;  2I59 A;  2E9X A;  5ETW A;  1KNZ A;  3I9Y A;  3SRZ A;  2CA5 A;  2X51 A;  3K3Q C;  3O9X A;  3CX8 B;  2LYP A;  2MQK A;  1X57 A;  2PG8 A;  3MAC A;  2VB6 A;  5FYM A;  4G63 A;  4YG4 A;  5LBM A;  3VKG A;  5EK3 A;  2ZLY A;  3VKH A;  3LIS A;  4YFS A;  1ZZ7 A;  2KEI A;  3RRW A;  5FXZ A;  1FMV A;  4X4D A;  4YHJ A;  1NER A;  2CLY C;  5L3C B;  4Y42 A;  3RYH E;  5LOV E;  5JDL A;  3GN5 B;  5JH7 E;  5L3G B;  2KEK A;  4Z5C A;  1RZR A;  2PUG A;  2LSK A;  5FXV A;  1L1M A;  1HG5 A;  4YBA A;  4CI1 B;  4IE7 A;  4ANJ A;  1PRA A;  4IDZ A;  2LOS A;  4PK6 A;  3ZCJ A;  4AKG A;  3M65 A;  1LCC A;  1OWA A;  1ZHC A;  3RYF E;  2IVQ A;  2LE8 A;  1D1B A;  2HPJ A;  4Z8X A;  4NUU A;  2AXZ A;  4DO0 A;  2EHO B;  5HXS A;  4CQI A;  1WH8 A;  2YK0 A;  5L3F B;  3N2O A;  2PUC A;  2E9X C;  3I0O A;  4HE8 A;  2K48 A;  3AA6 B;  2O38 A;  1PRV A;  5DAB A;  3LFM A;  3N5L A;  4UF0 B;  4YJ2 E;  5IYZ E;  3ZMV B;  4IVZ A;  4JEH B;  1ZAY A;  2MEZ A;  2C0S A;  5HAX A;  1S7E A;  4I43 B;  4L9I A;  4I6R A;  4UV8 B;  2IV1 A;  3IF8 B;  3EUH A;  3LK4 2;  3TRB A;  4AKH A;  2J1D G;  1YSE A;  4UEL A;  3SOL A;  2H8R A;  2CLY B;  1YD8 G;  1LRZ A;  2CM0 A;  4MHC A;  3ZEF B;  3QQ6 A;  3V5U A;  5ADX L;  1FMW A;  2X66 A;  2IVB A;  2GRM A;  4IWR A;  5JDH A;  2KND A;  4M1P A;  4C91 A;  3KBU A;  2XI8 A;  2WAU A;  1RZR D;  2CMR A;  3CML A;  3AAA B;  2XAH B;  2PE5 A;  3KVB A;  1JFT A;  2KIN B;  1JWL A;  5L2L A;  2N2N A;  3QC9 A;  3RH3 A;  4AKL A;  1ZS4 A;  4WNK A;  4O4H E;  5LJM A;  4O8B A;  2E9X B;  3EVY A;  4OHF A;  1YKH B;  2C5K T;  4CXX A;  2NTY A;  4GK0 E;  3AA1 B;  3KDS E;  4IST A;  3WAK A;  3PU3 A;  3C64 A;  4MLK A;  2JQQ A;  4O4I E;  1WH6 A;  4ADZ A;  4BJN A;  2IUO A;  4ZI2 C;  4X1I E;  5LBQ B;  2ZMA A;  3RZZ A;  2VKH A;  3RKO A;  4QX7 B;  2V26 A;  5EK2 A;  5JR9 A;  4EYU A;  2EF8 A;  2OA5 A;  3CQX C;  2B1E A;  1D1A A;  1T98 A;  2ZM8 A;  3AB3 B;  3CQC B;  4GHJ A;  3EDU A;  2IVG A;  3SS1 A;  4JCY A;  3OBV E;  4GYR A;  4IHJ E;  2KEJ A;  1VPW A;  3N9Q A;  2LT3 A;  2L8N A;  4PJN A;  2VK9 A;  4H9P C;  5FMN A;  3RYC E;  2WSS V;  3I9W A;  4ZI7 E;  2CXL A;  1NEQ A;  3MLF A;  1MIY A;  5M4Y A;  2LSI A;  3MXZ A;  3BQI A;  4OYK A;  5E0O A;  3FHN A;  3ZLI A;  5KMG P;  3KV9 A;  1U5P A;  4UF0 A;  3I0Q A;  4HTE A;  1PER L;  3JXD L;  2VKJ A;  1BR0 A;  3A5X A;  1MND A;  3F6W A;  2LYS A;  1VOM A;  3O1H A;  2CEA A;  3U78 A;  3C51 A;  2K9A A;  2CXD A;  1G8X A;  4N78 D;  4MBQ A;  5J2T E;  1Z0P A;  1YW0 A;  5A7L A;  2YIN A;  1MMD A;  3EDV A;  4FBI A;  2L8K A;  3JC6 D;  4ZI3 C;  2NTX A;  2A2F X;  1U4Q A;  2PJQ A;  4ZS3 A;  4AKI A;  2LCV A;  5LP6 E;  4EB6 E;  4H9N C;  1E1H B;  1NWM X;  2WM9 A;  3T8O A;  4PNI A;  3QF3 A;  1ZKE A;  3PTR B;  4GIW A;  5LGN B;  3QYX A;  4I50 E;  3F57 A;  3OYZ A;  2XQY A;  4X4F A;  2QGS A;  4PJL A;  5DQW A;  5H6Q B;  4PU3 C;  2G0U A;  2VKD A;  2MYS A;  4PAG A;  1ZZ6 A;  3DP7 A;  4HGA A;  5FXX A;  4O2B E;  2VAS A;  2LYR A;  4IE6 A;  1MMN A;  4O4L E;  2ICP A;  3CRO L;  3K3O A;  3OP9 A;  4V1A v;  3ZMZ B;  1SA0 E;  4QKN A;  3O4X E;  4KBM B;  3RYI E;  3DJB A;  4I55 E;  3ZJ1 A;  4EZH A;  2LSY A;  2A72 A;  1HFA A;  2PBI A;  2CWY A;  2V7L A;  3UT5 E;  4TX5 A;  5JQG E;  1HS7 A;  3GMI A;  2PFV A;  2JMH A;  2NOX A;  2Y48 B;  1LKX A;  2EHO D;  4G2A A;  2D0T A;  4QHO A;  4Z5D A;  4JLE A;  5EK4 A;  4B6X A;  4EOZ B;  2D0U A;  4QWN B;  2X9Y A;  2AXV A;  3C4W A;  2KWI B;  4NDW A;  1BR4 A;  1HG2 A;  5FXW A;  4PU7 A;  3AVR A;  2P9B A;  3LK2 B;  4Z58 A;  2V7J A;  2BNO A;  3HR0 A;  3P8C D;  2JVL A;  3LBX B;  2PUD A;  2DNX A;  4H63 V;  4TN7 B;  4CI3 B;  1EZ3 A;  3UFE A;  3HZI B;  4AQF C;  3VK0 A;  3H37 A;  1OCT C;  3KV5 A;  4GYS A;  2PUE A;  4DND A;  2K24 A;  3LK3 B;  1BDH A;  3U3I A;  3ZHI A;  1NAF A;  2A3D A;  1DW9 A;  3CQG B;  3IEE A;  1DWK A;  2IC6 A;  3NBX X;  3VU7 H;  5CA0 E;  2LYL A;  5JR9 B;  3OQO A;  3CKD A;  3CWZ B;  4ISS A;  1ZEE A;  1ADR A;  2JCG A;  2W63 A;  2MOZ A;  3AAI A;  4ZS2 A;  3QUJ A;  2XAG B;  4A56 A;  1HF8 A;  2DWG A;  3HKD E;  3GWH A;  1QQA A;  3K8P C;  4KMC A;  2IC9 A;  3OQM A;  4I4T E;  4TV8 E;  4YG1 A;  5JDF A;  5L3B B;  1UX4 A;  3RRC A;  4XBF B;  2PUB A;  5AFU L;  1KK7 A;  3RC8 A;  3L1P A;  1XWR A;  2C5J A;  2RP4 A;  2JPF A;  2YU1 A;  3RPU A;  1D0X A;  2X68 A;  5HWX A;  4H9O C;  3PXP A;  2E9X D;  2Y8D A;  4IGU A;  4PFO A;  3KV4 A;  1QQB A;  4U74 A;  3HKB E;  5DJQ C;  2WMO A;  3ESL A;  4UXN B;  2MTQ A;  4AQG A;  2CWO A;  4WBO A;  2LOP A;  4O4J E;  4CXW A;  2MBG A;  5LGU B;  4YJ3 E;  4J1W A;  2W62 A;  4WBN E;  3OKQ A;  3VHL A;  4CZZ B;  4UEM A;  3O1I A;  4EAH A;  3GA8 A;  2ZM0 A;  4UVA B;  3E22 E;  1S94 A;  2ACX A;  2ICT A;  3ETU A;  4CXY A;  2W61 A;  4ZHQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...