3GN5B

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
130
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 38
structure length 130
sequence length 131
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5B02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5B01
2KZ8A 2LYKA 2PIJA 3LFPA 3BS3A 1Y9QA 4Z58A 4JCYA 4Z5HA 3QQ6A 3OQMA 3MLFA 1YSEA 3R1FA 2KEIA 2XSDC 1JFTA 1RIOA 1ZAYA 2PUGA 3UFDA 3S8QA 3VK0A 4PU7A 4YG1A 1ADRA 1ZVVA 1R69A 1PRVA 3F51A 3CLCA 3KZ3A 1BDHA 1QP0A 4MCXA 1WH6A 2B5AA 4PU8A 2XCJA 2O4AA 3GA8A 2O49A 1RZSA 2LYRA 5K98B 4X4GA 4J1XA 1ZS4A 4NDWA 3CROL 3HI2A 1Y7YA 4X4CA 2XJ3A 1PNRA 4Y42A 2PUEA 2LYJA 3FMYA 2PUFA 1R63A 4YG7B 2IVBA 4X4EA 3EUSA 2KPJA 3RZZA 3L1PA 1O4XA 2GRLA 4GHJA 3FYAA 2R63A 2IVQA 4YBAA 2OR1L 4F8DA 2AXZA 2LYPA 4X4HA 1QPZA 1UXDA 1WIZA 3GN5A 3OMTA 3B7HA 2LYSA 1OCTC 3F6WA 1VPWA 3ZHMA 3BD1A 2L8NA 3HZIB 1ZZCA 1WH8A 1RZRD 4Z5CA 1RPEL 1L1MA 1PRUA 1UTXA 3SCFA 1QP4A 2CSFA 3F52A 1LMB3 1EFAA 4FBIA 4O8BA 2ICPA 3GBFA 1LLIA 2R1JL 4X4BA 1ZZ9A 1XWRA 3H5TA 1ZZBA 4J1WA 4I8TA 4PU3C 3BDNA 2BJCA 1QQAA 1RZRA 1LCDA 2PUAA 2MEZA 4X4FA 2IV1A 2BNOA 2AXVA 3JXBC 1GT0C 3G7DA 1LQCA 1S7EA 4IA8A 2CROA 4X4IA 3LISA 2XI8A 1UXCA 2PE5A 3O9XA 1CQTA 4JCXA 2BNMA 1JH9A 3GN5B 2EF8A 3QF3A 4I6TA 2O38A 2GZUA 4I6RA 3QWGA 2AXUA 2AW6A 4FN3A 4YG4A 3U3WA 2L49A 1BDIA 2AUWA 1ZZ7A 2BNNA 2IUOA 1QQBA 3ZKCA 5A7LA 2LYLA 3D1NI 1OSLA 3IVPA 1B0NA 1X2LA 1AU7A 3KXAA 2H8RA 2PUDA 2PUCA 1POUA 2HSGA 4PU4C 4IWRA 1NEQA 1DW9A 2LYQA 3FYMA 2XIUA 4OB4A 4Z59A 1JWLA 2D5VA 2WIUB 1WETA 3KJXA 2AWIA 2OFYA 3PXPA 1ZZ6A 2ICTA 2IU7A 1ZZ8A 3SCHA 3DNVB 1LCCA 1DWKA 1QP7A 1CJGA 4Z5DA 4MCTA 3OQNA 2WUSR 1NERA 4I6UA 2PUBA 4GQMA 4IVZA 2HINA 2KEKA 4JQDA 2FJRA 2PPXA 1IC8A 2IVGA 3G5GA 3OQOA 4YARA 1E3OC 1HF0A 1JFSA 3SCGA 3QYXA 1X57A 3JXCL 2JCGA 2LCVA 1SQ8A 1PRAA 2EWTA 1ZPQA 4X4DA 2EBYA 2A6CA 2MQKA 2JVLA 3JXDL 2GRMA 3OP9A 3ZHIA 2KEJA 1PERL 1ZUGA 3TRBA 3CECA
chains in the Genus database with same CATH superfamily
3UUMA 2YINA 2EHOC 3ZT7A 2W00A 3BS3A 1Y9QA 1WFDA 2LLVA 1YSEA 3AECA 2ZM6T 1ZAYA 3MXZA 1WCRA 3VK0A 2E9XB 5GAGi 4IE7A 4CXYA 4DR5T 3RIUA 1PNRA 2YDRA 1W9RA 4O4HE 2PUFA 1X79A 3L1PA 5HWYA 1WIZA 3PTRB 3PJAA 3T1HT 1L1MA 3P4RA 2PXBA 5L3CB 2C0SA 1MMAA 2VQFT 3T1YT 3UU5A 3ETVA 4ZHQE 5HXHA 1RZRA 3UUBA 3AAIA 4JI7T 5JUWA 1IJ5A 4QX7B 2ZM0A 3VRAA 4WVLA 3Q5DA 3B57A 3Q5WA 3ZSSA 4C91A 3IHRA 3CPZA 4ZEYA 2E8IA 4ER3A 2UUBT 2IUOA 1UCUA 3ZYKA 3HKBE 2BS3A 2PXVA 3QFIA 1POUA 2X51A 3W15B 3O1HA 1MFQC 4ZI2D 4Z59A 2MTQA 3ZYLA 1HTJF 3OYXA 5AQRB 4FI5A 3DNVB 2X9HA 4JQDA 2L9QA 2BVLA 2HPJA 4YTNA 1D1BA 5LHIB 1VRBA 3EDUA 4DV4T 1S94A 5AQSB 4I0UA 4IREA 5A1LA 3ZT5A 3OKZA 3P50A 3AE9A 4QWNB 3CX6B 2XZEA 2C5JA 5EK4A 3NWIA 2JMHA 5LG4A 2PUGA 4DR6T 3S8QA 4J2CA 1QB2A 3N9OA 5HAXA 4LF9T 2V5DA 5FY0A 1E2AA 4AI6A 2WMNA 4HFDA 4H9NC 1J5ET 4P0BA 1Y01A 3I9YA 4IT4A 3RQWA 3FMYA 4H9PC 4JLEA 2W4XA 1NENA 4LF8T 1ZP0A 5EK2A 4LMJA 3P4QA 2V7MA 3BD1A 4O2BE 1UUSA 2VKDA 2CEAA 1QP4A 5AQNB 4TV8E 2M67A 5IWAT 2JQKA 2V1DB 3KVAA 4O4JE 1XDPA 5AQPB 3RKOA 5LA6E 2CCQA 2V6XA 2JQ9A 2D9DA 3ZJ2A 4I4TE 3KV6A 4PAGA 4IDPA 3G0TA 2VB6A 2AXUA 2W2UA 3NKZA 2EHOA 4ERRA 4KX6A 4ILCA 2LYLA 5AQHB 3HL6A 3DM5A 5JRCA 4WYVA 3EDVA 5BR8T 2EHOD 3QB5K 4N78D 1ZZ6A 2WS3A 4AKRB 4JI0T 5ETWA 4IVZA 1ZKEA 3L3PA 4GYSA 3UFGA 1ZEEA 2KXPB 3CK6A 3F57A 2UXNB 4I55E 1D1AA 2LM9A 2H7VC 3PUVF 3FZLB 5HEJA 3CECA 3K3NA 3C64A 4UELA 2Q9QC 5CB4E 1W0BA 5F8PA 4M1PA 2E5VA 2JJ9A 4ISSA 1RIOA 2XQ9A 4CN1A 2WMOA 2KLQA 5LMUT 1YQ3A 1WH6A 2LSJA 3GA8A 5K98B 1ZS4A 4DUZT 2XAJB 2BZBA 1HNWT 1CHUA 4LMLA 2IC6A 3UULA 4DMWA 3TLVA 2CXLA 1VPWA 3GUUA 4YHHT 3UQ7A 3PUGA 2VL0A 4PNIA 5AQUB 4ER7A 3QOWA 4X20E 2HFZA 3C51A 1XNQT 3SFDA 2LKGA 2YK0A 4QXBB 2I59A 2D5UA 2CM0A 4B3MT 2CROA 2ZM2A 2WU5A 4QHOA 2CLYB 3MK7C 2JPFA 2AXDS 2O38A 2GZUA 1HX8A 2L3LA 4EZIA 3EAMA 2BKNA 5ABFB 2PXKA 5HCMA 5L3BB 3FZKB 4FJOA 2H8RA 5LYJE 2D5VA 5LP6E 2PTFA 5CJ5A 4U33A 3BK9A 1CJGA 4ZI7E 4XBFB 3ZPXA 4X65T 5FVLA 4GQMA 4JI5T 4U7IA 1E3OC 2N9DA 2UUAT 2FFHA 1O3XA 4AQGA 2KMFA 3AE7A 3N9NA 2V7KA 3TLUA 4U2ZA 3ME5A 5LMNT 3QQ6A 1FEWA 3N5LA 2LT3A 1OXZA 1H7CA 2LRKA 4ILAA 3VR8A 5FMNA 4DR4T 4PJMA 2SPCA 3RPUA 3CQCB 3IF8B 2QVAA 2XJ3A 2X0YA 1YXRA 4QKNA 4YG7B 4IL4A 3DJBA 2LSIA 4Q2JA 1ZZCA 4PK5A 4OHFA 3M3ZB 4O8BA 5CGMA 2R1JL 2K9AA 3KFWX 4KHPT 4P0AA 4ER6A 3ZSTA 5JDMA 2AXVA 3JXBC 4MFRA 3RI5A 3ZEFB 2WCAA 2XXAA 3QC9A 4EYYR 4U2YA 3QK6A 4DNDA 4HFHA 2XM1A 4ADZA 1JH9A 4X1IE 4TUYE 2Q9QA 2WU2A 4KUMB 3ZYMA 5DSXA 1ZZ7A 3EI0A 4P1NA 3ZLIA 4GYRA 3FBZA 3UU8A 2Q9QD 4OB4A 4CQIA 3ZC1A 2AWIA 4HFEA 2IU7A 5DT2A 2D0TA 4UVBB 4C90A 2WUSR 2PUBA 3L09A 2FJRA 2YEVC 2NR4A 2LSGA 4PFPA 4HKAA 1SQ8A 4L5GA 2GRMA 4IHJE 2WWUA 3R6NA 3MLFA 2KNDA 2PIJA 4ISTA 4TWHA 2LM2A 3SRZA 2UU9T 4JYAT 4JI4T 3A8YC 1KK7A 1G73A 5FY7A 4J1XA 4HWCA 3N2GE 2X9XA 2ODVA 4UF0A 5L3EB 3RZZA 4TWDA 3K1SA 2DI4A 4U72A 3WAJA 2YBDA 5EK3A 2LYSA 1HF8A 2UXDT 3C4WA 1OEDC 1RPEL 4G2AA 5HEHA 4ZOLE 2CHNA 3OVUA 3LFMA 4NIQA 4A56A 4IDQA 2YN6A 2IV1A 1FMWA 2XSAA 3U78A 4IGUA 3FHNA 4JCXA 2J4GA 3QF3A 1QP0A 2XTLA 3ZMUB 2AW6A 4YG4A 4X62T 1I6ZA 3LDQB 3AVRA 3D1NI 4DV7T 3UTKA 2FJBA 2HN2A 2KWHA 3UUXB 3RYHE 3QB5A 5LCYA 2YKSA 3AA7B 2PBIA 4EV6A 2UXBT 4LF7T 4Z5DA 4MCTA 4LF5T 2HN1A 2IDOB 5JTGA 2V5CA 2WWVA 2MQKA 2JVLA 3O1JA 1WRDA 2KZ8A 1U2ZA 1WYBA 4H63V 5DABA 3AEBA 2NWBA 4AKGA 2XAFB 2XSDC 3AE4A 3NDBB 2ACZA 4KP3C 4PU8A 1R8IA 2JQHA 3CX8B 4Z90A 1CUNA 4U7YA 3AE1A 4UR9A 2IVBA 4GHJA 3FYAA 2R63A 2IVQA 1GQEA 4TN7B 1FIOA 5EZYE 4QXHB 3F6WA 4JI2T 3ZHMA 3HR0A 5L3GB 3SFEA 4CXXA 4JUYA 1HG5A 2K24A 1XNRT 1B7TA 2IMLA 4P09A 1OEDE 1LLIA 4AQFC 2CHOA 4QXCB 4J1WA 1DULA 5FYMA 2X67A 3I1AA 2MEZA 2BG9C 2VVNA 4DIDB 4CN4A 2VEOA 4X4IA 5LG3A 1KNZA 3NBXX 2QA7A 4WNKA 2BDEA 2JIWA 4DE9A 2BNNA 3AEAA 1U5PA 4E7ZA 2LYQA 4HWIB 2VWAA 1JWLA 2JQEA 2PXLA 3M65A 1HCIA 3VRBA 3WAKA 4PK4A 3SS1A 4PK6A 3ZJ1A 2V6YB 4IE5A 4YTPA 1JFSA 2NTYA 1QLBA 1OEDA 2XUEA 4DV2T 3C4XA 3PUAA 3ZC0A 1ZHCA 5DQWA 5HEOA 3H3AA 4JCYA 2XQ3A 2K5BB 4EKGA 3KV4A 1W0AA 4LF4T 5H6QB 3J7Yq 3PDYA 2B5AA 5LJMA 4LMKA 3KL4A 1HQ1A 2NTXA 5AQJB 4DR7T 5DTQA 3PJAJ 1R63A 4X4EA 2AXZA 2LYPA 2CRBA 3OWQA 5LXTE 4G63A 1YKEB 4UIGA 5JR9A 3O1IA 5C8YE 3RRCA 3AAAB 4NPPA 5FVKA 3BQLA 1DU2A 4MHCA 4O2AE 2M6BA 2BKPA 1ZZBA 4XAXB 2KZ7B 5E0OA 1N32T 4PU3C 1QQAA 2GK9A 3UU4A 2H3RA 3KDSE 4TNVA 2BG9E 3J9X1 5AFUL 4IIJE 4GKJT 3LJCA 3CX7B 3UU6A 3U3WA 3PUYF 4K0KT 2DWKA 1BDIA 2WDVA 2H7OA 4ZZCA 5FL1A 4OYKA 3JAFA 4QH4A 3SX0A 4JI6T 1WR6A 4IWRA 3ETUA 1DW9A 4JEHB 4ZXLA 2CBJA 1QP7A 1VOMA 2BVMA 3LQXA 4X64T 4OK0A 3D0TA 2J62A 3AXJB 3SWHA 2JCGA 2YDQA 4EXTA 3K3QC 4UVAB 1ZPQA 2NP9A 1ZUGA 3ABVA 4X5TA 4BA9A 1KNRA 3FZFB 2OLTA 2PFVA 2WY2A 4GK0E 2DNXA 5LJNA 4B3TT 3RYCE 3R1FA 2KEIA 2BG9A 3QUJA 2YU1A 4O4IE 2ODRD 3C50A 1R69A 3PE0A 3F51A 1IBMT 3I9WA 3KZ3A 1BDHA 4EB6E 5J2TE 4MCXA 4ZZBA 2PG8A 4A97A 3A9YA 4B6XA 2E9XC 1T72A 4KI0F 3C98B 3CQGB 3ZT6A 4LF6T 1LKXA 2ZMAA 3H37A 4F8DA 2RPAA 1JNZA 3GN5A 5FXXA 2UUCT 3TFLA 1OCTC 3IA3A 3KV9A 3A9XA 1XMQT 3B5MA 4TV9E 1PRUA 2CSFA 4FBIA 1L0VA 3H5TA 4YJ2E 2CA5A 5FXVA 1UK5A 2FJEA 3GZDC 3QNUA 5LNKA 3ESLA 1LQCA 3GMIA 2UXCT 5FKYA 2P9BA 1MNDA 5LGTB 2RA1A 2VVSA 3ZN0B 4I6RA 5F3JA 4O4LE 5GONE 5AQTB 1OSLA 3CQXC 2RP4A 1WLXA 3SR4A 3RF1A 2L1PA 4JBWF 1SA0E 3FYMA 4YTMA 2MPKA 1HS7A 2OFYA 2W61A 4TZ4C 1DWKA 3CIRA 1EZ3A 3G5GA 1KEYA 2LLYA 2MAWA 3ANWA 2WAUA 3NRXA 2MOZA 3PU8A 4DV3T 2ZLYA 3E08A 2YU2A 2XAQB 3LFPA 4Z58A 2X66A 1V9DA 4Z5HA 2X9WA 3MJXA 1J1JA 1UX4A 4PU7A 2LSKA 4EQZA 2K48A 2X0HA 2IW5B 1SUMB 2O49A 3FBLA 1N34T 4ANJA 1Y7YA 1E1HB 3VR9A 2PXUA 2WZIA 3VHLA 5KXJA 3Q2MA 4HFIA 2WDRA 4EOZB 4IE6A 2KINB 2NW9A 3KBUA 1T8BA 5JR9B 2ICPA 2V3CC 1HNXT 1IBKT 4ZS3A 5C3JA 2I6HA 2XAGB 3PU3A 3OKQA 3M9LA 5L4EA 4DBQA 4YXDA 2PXDA 4HN9A 4DUYT 1UXCA 2BNMA 5IUXA 4GOUA 4DR3T 4JEUB 3OYZA 5FY1A 4HGAA 1VCTA 1J5WA 2VKJA 3N9QA 1QQBA 3ZKCA 3LBXA 3QOFA 2JQQA 1BR1A 3KXAA 3F31A 2LEHA 1LRZA 3JAEA 3ZMSB 3F2EA 3TEPA 1UURA 3RYFE 3EABA 2E9XA 4DE8A 5LHHB 2OV9A 2NW7A 5HXRA 5LBQB 1T98A 2IC9A 2EHOB 1PRAA 2E9XD 4MALA 2J7UA 1KFYA 3AE6A 1AJ3A 4LFAT 5JRCB 4YY3T 4DMVA 3PUQA 1MIYA 3GZDA 5DTRA 3JADA 4AKHA 1ADRA 4HTEA 2WSSV 4HWHA 4DV0T 1XMOT 1MMGA 4X4GA 3OPCA 1HR0T 3VWSA 4KHZF 1E7PA 2KPJA 4AKIA 4YBAA 4JI3T 4ILUA 1QSDA 5FL0A 5ABHA 2L8NA 2G0UA 5ADXL 2A3DA 2W0GA 3RIAA 1EFAA 4ZS2A 4PJLA 1NW3A 5LHGB 4NXNT 2MXDA 1IAPA 3BQKA 4EK9A 3E0ZA 1S7EA 2WM9A 2WZHA 4EZ4A 2HCSA 4OX9T 3HKDE 3O9XA 1CQTA 4H9QC 4DV1T 3QWGA 1MIVA 2LHNA 2A2FX 4WW0A 2AUWA 1XWMA 2CLYC 2MYSA 2XQ4A 3ONXA 3KBTA 3UFEA 2CWYA 3FXEB 2LSYA 4JI1T 2WIUB 4OFZA 2ICTA 1ZV4X 3SCHA 3PUWF 2M6IA 3OQNA 5HXCA 1U4QA 3AE3A 3P8CD 2HHHT 4YSZA 2F4VT 2PPXA 3VKGA 3SCGA 3G06A 2LCVA 3P4SA 2IHR1 4YLHA 5JH7E 4UV9B 3R84B 2V7IA 2XQ7A 1D0YA 5LGNB 1YD8G 3MA9A 4NUUA 3ZCJA 3P7IA 2FUPA 4H9OC 1I94T 1HG2A 1QZXA 2BKOA 3AEEA 2JRKA 4NDWA 4AISA 4EGWA 3MACA 5IHYA 4X4CA 4GK5E 4WBNE 4I43B 5HWXA 5CA0E 5AQMB 2V8SV 2VKOA 3JCFA 3UUNA 3BQIA 4PJJA 1S35A 3B7HA 3GWHA 4YSXA 1WH8A 4DR2T 3UQ4A 2FBWA 2JMKA 1LMB3 3KV5A 1ZZ9A 4F8HA 3Q9DA 2X0LB 5AQOB 4HEAA 4H9SE 3G7DA 2LLWA 1M7KA 2C5KT 4PW8A 4Z91A 3N9PA 3PUZF 2PE5A 5FNVE 5DTMA 4I6TA 2K3WA 2L49A 5L2LA 1QUUA 5J1GA 4EIWA 4EEBA 5JDLA 3EVYA 5C2TA 1WR0A 5A7LA 3JC6D 5L3FB 2CE7A 1AU7A 4UXNB 3AA6B 2PUCA 4PU4C 3T8OA 1BR2A 2XIUA 3N9MA 4HFCA 1X9BA 3KJXA 2QYWA 4MLKA 2VL8A 1Z0PA 3VKHA 2KEKA 4ER5A 1MMNA 1IC8A 3OQOA 4DBRA 1FMVA 2Q9QB 5DJQC 2UXXB 1MNEA 3ZHIA 2OA5A 2W66A 4IDZA 3RYIE 2XQAA 3Q5XA 3FB2A 3OTOT 3N2OA 3KINB 4V1Av 3UFDA 4WBOA 3NXHA 2X9YA 2LJLA 4HE8A 2O4AA 4I50E 5KDMC 4DV6T 2IAKA 3LK42 3RX6A 5HEGA 3OMTA 2ODUA 2A9UA 4A98A 4UVCB 1RZRD 2VQET 4HFBA 5ABFA 3SCFA 1IBLT 3LK2B 3AEDA 3A7MA 3PV0F 1YQ4A 2DL1A 2N2NA 4XZCA 3ZMVB 3BDNA 4AXPA 4UV8B 2PUAA 4BJMA 4X4FA 2LKHA 3L8RA 3CVRA 5ABGA 4UF0B 3PUSA 4ILBA 1N36T 1SE7A 2QRXA 2XXQA 5H6RB 5ABEA 5DRYA 2XPKA 1HNZT 2CXFA 2XASB 5HCJA 3V5SA 4B3ST 2W62A 4JI8T 3N2KE 5HXSA 4QH1A 5FXWA 5CA1E 2PJQA 4OYJA 3PXPA 2PXPA 5J0ZA 2XAHB 1NERA 4DVDA 2J7WA 3ZMZB 2IVGA 3QYXA 4ER0A 2KT9A 2FJAA 2NW8A 2A6CA 2CBIA 3OP9A 2M4HA 3L39A 4YHJA 2A72A 1UX5A 4A5XA 3ONJA 2XY8B 4U74A 1JFTA 3O4XE 4YG1A 2WDQA 2B1EA 2XJ7A 4PFOA 1VCSA 3AA1B 4YJ3E 2DLRA 2XXPA 3KVBA 5JDFA 4Y42A 1D0ZA 1O4XA 3NROA 1N33T 3ZPOA 2OR1L 1QPZA 4AQFA 5HEUA 2NOXA 2CPTA 4HRAA 1D0XA 2W63A 5AQVB 3TKLB 3NVOA 4HFVA 3OBVE 2LE8A 5JREA 3X1DA 4X66T 5DRTA 3NZPA 4IA8A 4CXWA 4OBMA 5LGUB 2I0MA 5JVDE 1MIWA 4UEMA 2EF8A 2WBLA 3B13A 2IUBA 4NUVA 3TLWA 5AQFB 4CZZB 2V7LA 3DTOA 3FXDB 2HSGA 4AQYT 1NEQA 1T7SA 1W09A 3TLTA 1KNPA 4BAYB 3RC8A 4Z8XA 2BBHA 3LSVA 4BJNA 2XQ8A 3NZQA 4I6UA 4JV5T 2PXEA 3N9LA 2LOPA 4ZI3C 4E7SA 1X57A 3JXCL 3K8PC 2EWTA 1NEKA 1IJ6A 4PJNA 5IYZE 5FXZA 4CI1B 3P4PA 2LYKA 2Y6XA 3E22E 1WYCA 5LBMA 2PXTA 4X1YE 2Y8DA 3P4WA 1XDOA 3TELA 1MMDA 4U31A 1ZVVA 1PRVA 3ZKRA 4H63H 3Q5EA 1YKHB 3LG7A 3PUXF 1RZSA 2LYRA 2W67A 2XM2A 3AEFA 3HI2A 2D2SA 4X1KE 2KSRA 5L47A 4LFCT 1OEDB 2ES0A 3DP7A 4Q25A 4KBMB 2E2AA 4EAHA 3NRYA 1US7B 1LVFA 4ASKA 5DQVA 1YW0A 4IL9A 2CWOA 1HFAA 3AVSA 4TNWA 2BNOA 3CMLA 2XQYA 4DR1T 4CI3B 2AE9A 2XI8A 4IDOA 4MBQA 3WI3A 4IE4A 3AA0B 2HH7A 4X4BA 5LB7B 4IE0A 4FN3A 4IDNA 3VU7H 3AE5A 4GIWA 2YOEA 2MBGA 3IVPA 2XSBA 3RKGA 4DO0A 2V26A 5LOVE 5GAHi 1ZZ8A 4B3RT 2LHRA 4YSYA 2VK9A 5J2UE 2YDSA 3AAEB 3HKCE 1HF0A 4DV5T 5M4YA 4TWFA 3LK3B 2VKHA 3AB3B 3A5XA 3TRBA 3RC3A 5AQGB 3HA4A 5JDQA 2WQYA 2CXDA 5BMVE 3CLCA 1NAFA 1OWAA 1BR0A 3CROL 3JC6C 4EKIA 4WZXA 2LYJA 2HPLA 1UGOA 3H3MA 2LRLA 4YT0A 1UXDA 1KF6A 5JDGA 1IZNB 3RLFF 2V7JA 5L4HA 4CI2B 4Z5CA 1UTXA 5AQLB 3F52A 3ONLC 2BG9B 3GBFA 1Y64B 2VURA 1XWRA 2IIUA 1M62A 2DWGA 2BJCA 3RIFA 4HWDA 2VASA 3UT5E 4TX5A 1GT0C 3PURA 2LOSA 3LISA 3R09A 2V6YA 4LFBT 3I0OA 3NZLA 3GN5B 1LCDA 3RIUC 2J1DG 5L3DB 4ZI3D 1HX1B 4H9RC 3S4UA 2R6GF 2ZM8A 3QOXA 2CMRA 3U3IA 5JDHA 1WETA 2WB5A 3FZMB 1LCCA 3I0QA 2PXQA 2HINA 3CKDA 3MZKB 4QX8B 5AQKB 3TLSA 2X68A 2B76A 3EUHA 3JXDL 4YFSA 4AKLA 2LNMA 2KWIB 2KEJA 2XHEB 4X4DA 4AIUA 2BS2A 3V5UA 3RHWA 4ZI2C 4KMCA 3RGLA 4HWFA 3OQMA 5JQGE 3A9ZA 4F6RC 5AQIB 4EZHA 2H89A 3RRWA 1G8XA 3AEGA 3SOLA 2XCJA 5HXEA 2HCNA 2FJDA 2C5IT 4EEDA 2PUEA 3ZMTB 3ANWB 5HYAA 2H88A 3EUSA 2N1GA 2GRLA 4X4HA 3CWZB 5JDNA 3IBPA 1LVKA 3IEEA 2BS4A 2PXFA 3HZIB 2J47A 2Y48B 3UWPA 5FP3A 3K3OA 4NXMT 3RQUA 3ZN1B 1ZOYA 3UU3A 2D0UA 2Z6EA 3MEJA 3EHZA 3OJAA 4CN6A 5CFBA 3AE2A 4L9IA 4I8TA 1SHZC 4COFA 1Z8UA 5KX5E 5JR9C 2E5LT 1NWMX 5TAOA 3GZCA 2ACXA 3RH3A 2XQ5A 5F5WA 3AE8A 2XQ6A 4QH5A 2DCFA 3AXJA 2QGSA 4EYUA 3ZCIA 2DHRA 1D1CA 4K0UA 3C4ZA 1FJGT 3FZHB 1B0NA 1X2LA 2PUDA 2L8KA 4O8SA 3HKEE 2BBJA 1JNRA 3MKDA 2WP9A 5KMGP 1BR4A 4YARA 4U3CA 3PE5A 4GKKT 2EBYA 1XZYA 4L0RA 5AQQB 1PERL 3LBXB
chains in the Genus database with same CATH topology
2KNDA 3UUMA 2YU2A 2YINA 2PIJA 2XAQB 2EHOC 4ISTA 3LFPA 2W00A 3BS3A 1Y9QA 4Z58A 2X66A 1V9DA 2A72A 4Z5HA 1UX5A 4YHJA 2X9WA 3MJXA 3SRZA 1YSEA 4U74A 1JFTA 1ZAYA 3MXZA 1UX4A 2E9XB 3VK0A 3O4XE 4PU7A 4YG1A 2LSKA 4IE7A 4CXYA 2B1EA 2K48A 2IW5B 2O49A 1KK7A 1G73A 4PFOA 3FBLA 3AA1B 5FY7A 4YJ3E 4J1XA 2DLRA 4ANJA 3N2GE 2X9XA 3KVBA 1Y7YA 1PNRA 1E1HB 4Y42A 4O4HE 5JDFA 2ODVA 2PUFA 1O4XA 1D0ZA 1X79A 3L1PA 4UF0A 5L3EB 3RZZA 3ZPOA 3VHLA 2OR1L 5HWYA 1QPZA 4AQFA 1WIZA 2DI4A 4U72A 2NOXA 3Q2MA 3PTRB 3WAJA 4EOZB 5EK3A 2LYSA 1HF8A 4IE6A 2KINB 1D0XA 3C4WA 1RPEL 4G2AA 2NW9A 1L1MA 2W63A 3KBUA 4ZOLE 5JR9B 3TKLB 2ICPA 5L3CB 4HFVA 2C0SA 1MMAA 3OBVE 2LE8A 3LFMA 4ZS3A 4A56A 5JREA 3ETVA 4ZHQE 2XAGB 5HXHA 3PU3A 1RZRA 3OKQA 2IV1A 3AAIA 1IJ5A 4DBQA 3NZPA 4IA8A 4CXWA 4QX7B 4HN9A 1FMWA 3U78A 2ZM0A 5LGUB 3B57A 3Q5WA 5JVDE 1UXCA 1MIWA 4IGUA 3FHNA 4JCXA 2BNMA 4UEMA 3IHRA 4C91A 2EF8A 1QP0A 3QF3A 2XTLA 3CPZA 3ZMUB 2AW6A 4YG4A 4GOUA 2E8IA 2WBLA 3B13A 4JEUB 3OYZA 5FY1A 4HGAA 3AVRA 2IUOA 2VKJA 3N9QA 4NUVA 1QQBA 3ZKCA 3LBXA 1UCUA 3D1NI 2JQQA 3ZYKA 3HKBE 3UTKA 4CZZB 1BR1A 3KXAA 2V7LA 3F31A 2LEHA 1POUA 1LRZA 2KWHA 2HSGA 3DTOA 3FXDB 1NEQA 2X51A 3ZMSB 3W15B 3O1HA 4BAYB 4ZI2D 3F2EA 4Z59A 3UUXB 3RYHE 2MTQA 3ZYLA 3RC8A 4Z8XA 5LCYA 3RYFE 1HTJF 3AA7B 3OYXA 2E9XA 4FI5A 2PBIA 4BJNA 3DNVB 5LHHB 4Z5DA 4MCTA 2NW7A 2X9HA 3NZQA 4JQDA 4I6UA 2L9QA 2BVLA 2HPJA 5HXRA 3N9LA 1D1BA 2LOPA 4ZI3C 5LHIB 1VRBA 5LBQB 4E7SA 1T98A 1X57A 3JXCL 2IC9A 3K8PC 3EDUA 2EHOB 1S94A 1PRAA 2EWTA 2E9XD 4MALA 1IJ6A 2MQKA 2JVLA 3O1JA 4PJNA 5IYZE 5A1LA 5FXZA 4CI1B 1WRDA 1AJ3A 2KZ8A 1WYBA 2LYKA 2Y6XA 4H63V 5JRCB 5DABA 3E22E 1WYCA 5LBMA 2NWBA 4QWNB 4X1YE 4DMVA 2Y8DA 3PUQA 3CX6B 2C5JA 5EK4A 2JMHA 1MIYA 5LG4A 4AKGA 2XAFB 2XSDC 2PUGA 1MMDA 3S8QA 4J2CA 4AKHA 1ADRA 1ZVVA 4HTEA 1PRVA 2WSSV 4H63H 3N9OA 5HAXA 1YKHB 4KP3C 4PU8A 3LG7A 5FY0A 4AI6A 3CX8B 2WMNA 1MMGA 1RZSA 2LYRA 4X4GA 4H9NC 1CUNA 4P0BA 3HI2A 3I9YA 2D2SA 4X1KE 3FMYA 4H9PC 4JLEA 2IVBA 2KPJA 4AKIA 2ES0A 4GHJA 3DP7A 3FYAA 2R63A 2IVQA 4YBAA 4TN7B 1FIOA 5EK2A 5EZYE 4ILUA 1QSDA 4QXHB 3F6WA 4KBMB 3ZHMA 3HR0A 2V7MA 3BD1A 2L8NA 4O2BE 5L3GB 2G0UA 5ADXL 4EAHA 3NRYA 4CXXA 1US7B 4JUYA 1LVFA 2A3DA 2VKDA 1HG5A 2W0GA 5DQVA 2CEAA 1QP4A 1B7TA 2K24A 4ASKA 4P09A 1YW0A 4TV8E 1EFAA 1LLIA 2M67A 4AQFC 4ZS2A 2V1DB 2CWOA 3KVAA 4O4JE 4PJLA 4J1WA 4QXCB 5FYMA 2X67A 3RKOA 5LHGB 1IAPA 1HFAA 3AVSA 3BQKA 3I1AA 5LA6E 2MEZA 2CCQA 2BNOA 3CMLA 2XQYA 3E0ZA 1S7EA 3ZJ2A 2WM9A 4I4TE 4CI3B 3KV6A 4X4IA 3R6NA 4PAGA 4EZ4A 2XI8A 4MBQA 3WI3A 4IE4A 3HKDE 3O9XA 3AA0B 2HH7A 1CQTA 3NBXX 4H9QC 1KNZA 2QA7A 4WNKA 4X4BA 2VB6A 4IE0A 2BDEA 3QWGA 2AXUA 4FN3A 2EHOA 1MIVA 2LHNA 2A2FX 3VU7H 4WW0A 2AUWA 2BNNA 2CLYC 2MYSA 4ERRA 4GIWA 3ONXA 3KBTA 2LYLA 1U5PA 2MBGA 3UFEA 3IVPA 3HL6A 5JRCA 3EDVA 4E7ZA 2CWYA 3FXEB 4DO0A 2LYQA 2EHOD 2LSYA 2V26A 1JWLA 2VWAA 5LOVE 3M65A 2WIUB 4N78D 1ZZ6A 1HCIA 4OFZA 3WAKA 2ICTA 1ZV4X 1ZZ8A 3SCHA 4PK4A 4AKRB 2LHRA 3SS1A 3OQNA 4PK6A 3ZJ1A 5HXCA 5ETWA 1U4QA 2VK9A 4IE5A 4IVZA 1ZKEA 3P8CD 5J2UE 3L3PA 3AAEB 4GYSA 2PPXA 3VKGA 3HKCE 1ZEEA 1HF0A 1JFSA 3SCGA 2KXPB 2UXNB 3F57A 2NTYA 5M4YA 2LCVA 4I55E 1D1AA 2VKHA 3LK3B 2LM9A 2H7VC 3AB3B 3A5XA 2XUEA 3TRBA 3CECA 3K3NA 3C4XA 3C64A 3RC3A 4UELA 3PUAA 3ZC0A 2Q9QC 5CB4E 1ZHCA 4YLHA 5JH7E 4UV9B 5DQWA 3R84B 2V7IA 3H3AA 4JCYA 1D0YA 2K5BB 3KV4A 1YD8G 3HA4A 5JDQA 5LGNB 5F8PA 4M1PA 3MA9A 2JJ9A 4ISSA 4NUUA 1RIOA 3ZCJA 2CXDA 5BMVE 5H6QB 2WMOA 3P7IA 3J7Yq 3CLCA 2KLQA 1NAFA 4H9OC 3PDYA 1WH6A 2B5AA 1HG2A 5LJMA 2LSJA 3GA8A 5K98B 2JRKA 1OWAA 1ZS4A 1BR0A 4NDWA 2NTXA 2XAJB 3CROL 3MACA 3JC6C 5IHYA 4X4CA 4GK5E 2LYJA 4WBNE 1R63A 4X4EA 4I43B 2BZBA 2HPLA 5HWXA 5CA0E 2IC6A 2AXZA 2VKOA 2LYPA 3UULA 3UUNA 1UXDA 3BQIA 4DMWA 5LXTE 4G63A 4PJJA 1S35A 3B7HA 2CXLA 5JDGA 1IZNB 1VPWA 1YKEB 3GWHA 4UIGA 2V7JA 1WH8A 5JR9A 4CI2B 4Z5CA 3O1IA 3PUGA 4PNIA 3RRCA 5C8YE 1UTXA 3AAAB 3F52A 3BQLA 2JMKA 1LMB3 3GBFA 1Y64B 4MHCA 4O2AE 3KV5A 1ZZ9A 1XWRA 1ZZBA 4X20E 4XAXB 2KZ7B 3C51A 5E0OA 4PU3C 2DWGA 2BJCA 3Q9DA 1QQAA 2YK0A 4QXBB 2GK9A 2X0LB 2VASA 3UT5E 2I59A 2H3RA 2D5UA 4HEAA 2CM0A 4H9SE 4TX5A 1GT0C 3G7DA 3KDSE 2C5KT 4PW8A 2CROA 2ZM2A 3PURA 3J9X1 5AFUL 4IIJE 2LOSA 3LISA 3N9PA 2PE5A 5FNVE 4QHOA 2CLYB 3I0OA 3MK7C 2JPFA 3GN5B 3LJCA 1LCDA 4I6TA 2O38A 2GZUA 1HX8A 3U3WA 2J1DG 2L3LA 3CX7B 2L49A 5L2LA 1QUUA 2DWKA 4ZI3D 1BDIA 5L3DB 5J1GA 2H7OA 4H9RC 4EIWA 3S4UA 5JDLA 3EVYA 5L3BB 5A7LA 3JC6D 4OYKA 5L3FB 2CE7A 2ZM8A 4FJOA 1AU7A 2H8RA 4UXNB 1WR6A 2PUCA 3AA6B 4PU4C 4IWRA 2CMRA 3ETUA 1DW9A 4JEHB 3T8OA 1BR2A 3U3IA 5LYJE 2XIUA 3N9MA 2D5VA 5JDHA 5LP6E 1WETA 3KJXA 1LCCA 1QP7A 1VOMA 1CJGA 2BVMA 2VL8A 3BK9A 1Z0PA 3I0QA 4MLKA 4ZI7E 4XBFB 3VKHA 4OK0A 4GQMA 2KEKA 2HINA 3CKDA 3MZKB 4QX8B 3D0TA 1MMNA 1IC8A 1E3OC 3OQOA 4DBRA 2N9DA 1FMVA 2X68A 3SWHA 2JCGA 2Q9QB 5DJQC 4EXTA 3K3QC 4UVAB 1ZPQA 3EUHA 2NP9A 3JXDL 4YFSA 2UXXB 1O3XA 4AKLA 1MNEA 4AQGA 2KWIB 3ZHIA 2KEJA 2KMFA 1ZUGA 2XHEB 4X4DA 2OA5A 3N9NA 4IDZA 2V7KA 3RYIE 3V5UA 4BA9A 4ZI2C 3Q5XA 4KMCA 3FB2A 2PFVA 3QQ6A 4GK0E 2DNXA 3OQMA 5LJNA 1FEWA 3N5LA 2LT3A 3RYCE 3R1FA 2KEIA 3N2OA 1OXZA 3KINB 4V1Av 5JQGE 1H7CA 3QUJA 4F6RC 3UFDA 2YU1A 4O4IE 4WBOA 5FMNA 4PJMA 3C50A 4EZHA 1R69A 3PE0A 3F51A 3I9WA 2X9YA 3RRWA 3KZ3A 1BDHA 1G8XA 4EB6E 2SPCA 4MCXA 5J2TE 2LJLA 4HE8A 3SOLA 2XCJA 2O4AA 2PG8A 4I50E 5HXEA 5KDMC 4B6XA 3RPUA 2IAKA 3CQCB 2E9XC 3IF8B 3C98B 3CQGB 2XJ3A 2C5IT 2PUEA 3LK42 3ZMTB 3ANWB 4QKNA 5HYAA 4YG7B 1LKXA 3RX6A 3EUSA 2ZMAA 2N1GA 2GRLA 3H37A 3DJBA 4F8DA 4X4HA 3CWZB 3GN5A 5FXXA 3OMTA 2ODUA 3IBPA 5JDNA 1LVKA 2LSIA 1OCTC 3IEEA 3KV9A 3HZIB 1ZZCA 4UVCB 1RZRD 2Y48B 4TV9E 5FP3A 3K3OA 4PK5A 1PRUA 3SCFA 4OHFA 3ZN1B 2CSFA 2D0UA 2Z6EA 3LK2B 4FBIA 4O8BA 3OJAA 2R1JL 2K9AA 3KFWX 3H5TA 4YJ2E 4L9IA 4P0AA 2CA5A 2N2NA 4I8TA 5FXVA 1SHZC 4XZCA 3ZMVB 3BDNA 4AXPA 5KX5E 4UV8B 2PUAA 5JDMA 5JR9C 4BJMA 4X4FA 1NWMX 5TAOA 2AXVA 3JXBC 4MFRA 3ZEFB 3CVRA 5LNKA 3ESLA 1LQCA 3GMIA 2ACXA 3QC9A 2P9BA 4EYYR 3RH3A 3QK6A 1MNDA 4DNDA 5LGTB 4UF0B 2RA1A 3PUSA 4ADZA 2DCFA 3ZN0B 1JH9A 2QGSA 5H6RB 4I6RA 4X1IE 4EYUA 5F3JA 4TUYE 2Q9QA 4KUMB 4O4LE 2DHRA 1D1CA 4K0UA 3ZCIA 3ZYMA 2CXFA 1ZZ7A 3C4ZA 5GONE 2XASB 3V5SA 1OSLA 3CQXC 2RP4A 1B0NA 1X2LA 2PUDA 3ZLIA 1WLXA 2W62A 4GYRA 3FBZA 3N2KE 2L8KA 5HXSA 1SA0E 3FYMA 2Q9QD 4OB4A 5FXWA 4O8SA 2PJQA 5CA1E 4CQIA 3ZC1A 4OYJA 1HS7A 3PXPA 2AWIA 2OFYA 3HKEE 2W61A 4TZ4C 2IU7A 2XAHB 1DWKA 2D0TA 3MKDA 4UVBB 4C90A 2WUSR 1NERA 2PUBA 4DVDA 5KMGP 3L09A 2FJRA 1EZ3A 3ZMZB 2IVGA 1BR4A 3G5GA 4YARA 2YEVC 3QYXA 2KT9A 2LSGA 4PFPA 4HKAA 1SQ8A 3ANWA 2NW8A 2EBYA 2A6CA 2WAUA 4L0RA 2GRMA 4L5GA 3NRXA 3OP9A 4IHJE 2WWUA 2MOZA 3PU8A 1PERL 3MLFA 2ZLYA 3E08A 3LBXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ8 A;  2LYK A;  2PIJ A;  3LFP A;  3BS3 A;  1Y9Q A;  4Z58 A;  4JCY A;  4Z5H A;  3QQ6 A;  3OQM A;  3MLF A;  1YSE A;  3R1F A;  2KEI A;  2XSD C;  1JFT A;  1RIO A;  1ZAY A;  2PUG A;  3UFD A;  3S8Q A;  3VK0 A;  4PU7 A;  4YG1 A;  1ADR A;  1ZVV A;  1R69 A;  1PRV A;  3F51 A;  3CLC A;  3KZ3 A;  1BDH A;  1QP0 A;  4MCX A;  1WH6 A;  2B5A A;  4PU8 A;  2XCJ A;  2O4A A;  3GA8 A;  2O49 A;  1RZS A;  2LYR A;  5K98 B;  4X4G A;  4J1X A;  1ZS4 A;  4NDW A;  3CRO L;  3HI2 A;  1Y7Y A;  4X4C A;  2XJ3 A;  1PNR A;  4Y42 A;  2PUE A;  2LYJ A;  3FMY A;  2PUF A;  1R63 A;  4YG7 B;  2IVB A;  4X4E A;  3EUS A;  2KPJ A;  3RZZ A;  3L1P A;  1O4X A;  2GRL A;  4GHJ A;  3FYA A;  2R63 A;  2IVQ A;  4YBA A;  2OR1 L;  4F8D A;  2AXZ A;  2LYP A;  4X4H A;  1QPZ A;  1UXD A;  1WIZ A;  3GN5 A;  3OMT A;  3B7H A;  2LYS A;  1OCT C;  3F6W A;  1VPW A;  3ZHM A;  3BD1 A;  2L8N A;  3HZI B;  1ZZC A;  1WH8 A;  1RZR D;  4Z5C A;  1RPE L;  1L1M A;  1PRU A;  1UTX A;  3SCF A;  1QP4 A;  2CSF A;  3F52 A;  1LMB 3;  1EFA A;  4FBI A;  4O8B A;  2ICP A;  3GBF A;  1LLI A;  2R1J L;  4X4B A;  1ZZ9 A;  1XWR A;  3H5T A;  1ZZB A;  4J1W A;  4I8T A;  4PU3 C;  3BDN A;  2BJC A;  1QQA A;  1RZR A;  1LCD A;  2PUA A;  2MEZ A;  4X4F A;  2IV1 A;  2BNO A;  2AXV A;  3JXB C;  1GT0 C;  3G7D A;  1LQC A;  1S7E A;  4IA8 A;  2CRO A;  4X4I A;  3LIS A;  2XI8 A;  1UXC A;  2PE5 A;  3O9X A;  1CQT A;  4JCX A;  2BNM A;  1JH9 A;  3GN5 B;  2EF8 A;  3QF3 A;  4I6T A;  2O38 A;  2GZU A;  4I6R A;  3QWG A;  2AXU A;  2AW6 A;  4FN3 A;  4YG4 A;  3U3W A;  2L49 A;  1BDI A;  2AUW A;  1ZZ7 A;  2BNN A;  2IUO A;  1QQB A;  3ZKC A;  5A7L A;  2LYL A;  3D1N I;  1OSL A;  3IVP A;  1B0N A;  1X2L A;  1AU7 A;  3KXA A;  2H8R A;  2PUD A;  2PUC A;  1POU A;  2HSG A;  4PU4 C;  4IWR A;  1NEQ A;  1DW9 A;  2LYQ A;  3FYM A;  2XIU A;  4OB4 A;  4Z59 A;  1JWL A;  2D5V A;  2WIU B;  1WET A;  3KJX A;  2AWI A;  2OFY A;  3PXP A;  1ZZ6 A;  2ICT A;  2IU7 A;  1ZZ8 A;  3SCH A;  3DNV B;  1LCC A;  1DWK A;  1QP7 A;  1CJG A;  4Z5D A;  4MCT A;  3OQN A;  2WUS R;  1NER A;  4I6U A;  2PUB A;  4GQM A;  4IVZ A;  2HIN A;  2KEK A;  4JQD A;  2FJR A;  2PPX A;  1IC8 A;  2IVG A;  3G5G A;  3OQO A;  4YAR A;  1E3O C;  1HF0 A;  1JFS A;  3SCG A;  3QYX A;  1X57 A;  3JXC L;  2JCG A;  2LCV A;  1SQ8 A;  1PRA A;  2EWT A;  1ZPQ A;  4X4D A;  2EBY A;  2A6C A;  2MQK A;  2JVL A;  3JXD L;  2GRM A;  3OP9 A;  3ZHI A;  2KEJ A;  1PER L;  1ZUG A;  3TRB A;  3CEC A; 
#chains in the Genus database with same CATH topology
 3UUM A;  2YIN A;  2EHO C;  3ZT7 A;  2W00 A;  3BS3 A;  1Y9Q A;  1WFD A;  2LLV A;  1YSE A;  3AEC A;  2ZM6 T;  1ZAY A;  3MXZ A;  1WCR A;  3VK0 A;  2E9X B;  5GAG i;  4IE7 A;  4CXY A;  4DR5 T;  3RIU A;  1PNR A;  2YDR A;  1W9R A;  4O4H E;  2PUF A;  1X79 A;  3L1P A;  5HWY A;  1WIZ A;  3PTR B;  3PJA A;  3T1H T;  1L1M A;  3P4R A;  2PXB A;  5L3C B;  2C0S A;  1MMA A;  2VQF T;  3T1Y T;  3UU5 A;  3ETV A;  4ZHQ E;  5HXH A;  1RZR A;  3UUB A;  3AAI A;  4JI7 T;  5JUW A;  1IJ5 A;  4QX7 B;  2ZM0 A;  3VRA A;  4WVL A;  3Q5D A;  3B57 A;  3Q5W A;  3ZSS A;  4C91 A;  3IHR A;  3CPZ A;  4ZEY A;  2E8I A;  4ER3 A;  2UUB T;  2IUO A;  1UCU A;  3ZYK A;  3HKB E;  2BS3 A;  2PXV A;  3QFI A;  1POU A;  2X51 A;  3W15 B;  3O1H A;  1MFQ C;  4ZI2 D;  4Z59 A;  2MTQ A;  3ZYL A;  1HTJ F;  3OYX A;  5AQR B;  4FI5 A;  3DNV B;  2X9H A;  4JQD A;  2L9Q A;  2BVL A;  2HPJ A;  4YTN A;  1D1B A;  5LHI B;  1VRB A;  3EDU A;  4DV4 T;  1S94 A;  5AQS B;  4I0U A;  4IRE A;  5A1L A;  3ZT5 A;  3OKZ A;  3P50 A;  3AE9 A;  4QWN B;  3CX6 B;  2XZE A;  2C5J A;  5EK4 A;  3NWI A;  2JMH A;  5LG4 A;  2PUG A;  4DR6 T;  3S8Q A;  4J2C A;  1QB2 A;  3N9O A;  5HAX A;  4LF9 T;  2V5D A;  5FY0 A;  1E2A A;  4AI6 A;  2WMN A;  4HFD A;  4H9N C;  1J5E T;  4P0B A;  1Y01 A;  3I9Y A;  4IT4 A;  3RQW A;  3FMY A;  4H9P C;  4JLE A;  2W4X A;  1NEN A;  4LF8 T;  1ZP0 A;  5EK2 A;  4LMJ A;  3P4Q A;  2V7M A;  3BD1 A;  4O2B E;  1UUS A;  2VKD A;  2CEA A;  1QP4 A;  5AQN B;  4TV8 E;  2M67 A;  5IWA T;  2JQK A;  2V1D B;  3KVA A;  4O4J E;  1XDP A;  5AQP B;  3RKO A;  5LA6 E;  2CCQ A;  2V6X A;  2JQ9 A;  2D9D A;  3ZJ2 A;  4I4T E;  3KV6 A;  4PAG A;  4IDP A;  3G0T A;  2VB6 A;  2AXU A;  2W2U A;  3NKZ A;  2EHO A;  4ERR A;  4KX6 A;  4ILC A;  2LYL A;  5AQH B;  3HL6 A;  3DM5 A;  5JRC A;  4WYV A;  3EDV A;  5BR8 T;  2EHO D;  3QB5 K;  4N78 D;  1ZZ6 A;  2WS3 A;  4AKR B;  4JI0 T;  5ETW A;  4IVZ A;  1ZKE A;  3L3P A;  4GYS A;  3UFG A;  1ZEE A;  2KXP B;  3CK6 A;  3F57 A;  2UXN B;  4I55 E;  1D1A A;  2LM9 A;  2H7V C;  3PUV F;  3FZL B;  5HEJ A;  3CEC A;  3K3N A;  3C64 A;  4UEL A;  2Q9Q C;  5CB4 E;  1W0B A;  5F8P A;  4M1P A;  2E5V A;  2JJ9 A;  4ISS A;  1RIO A;  2XQ9 A;  4CN1 A;  2WMO A;  2KLQ A;  5LMU T;  1YQ3 A;  1WH6 A;  2LSJ A;  3GA8 A;  5K98 B;  1ZS4 A;  4DUZ T;  2XAJ B;  2BZB A;  1HNW T;  1CHU A;  4LML A;  2IC6 A;  3UUL A;  4DMW A;  3TLV A;  2CXL A;  1VPW A;  3GUU A;  4YHH T;  3UQ7 A;  3PUG A;  2VL0 A;  4PNI A;  5AQU B;  4ER7 A;  3QOW A;  4X20 E;  2HFZ A;  3C51 A;  1XNQ T;  3SFD A;  2LKG A;  2YK0 A;  4QXB B;  2I59 A;  2D5U A;  2CM0 A;  4B3M T;  2CRO A;  2ZM2 A;  2WU5 A;  4QHO A;  2CLY B;  3MK7 C;  2JPF A;  2AXD S;  2O38 A;  2GZU A;  1HX8 A;  2L3L A;  4EZI A;  3EAM A;  2BKN A;  5ABF B;  2PXK A;  5HCM A;  5L3B B;  3FZK B;  4FJO A;  2H8R A;  5LYJ E;  2D5V A;  5LP6 E;  2PTF A;  5CJ5 A;  4U33 A;  3BK9 A;  1CJG A;  4ZI7 E;  4XBF B;  3ZPX A;  4X65 T;  5FVL A;  4GQM A;  4JI5 T;  4U7I A;  1E3O C;  2N9D A;  2UUA T;  2FFH A;  1O3X A;  4AQG A;  2KMF A;  3AE7 A;  3N9N A;  2V7K A;  3TLU A;  4U2Z A;  3ME5 A;  5LMN T;  3QQ6 A;  1FEW A;  3N5L A;  2LT3 A;  1OXZ A;  1H7C A;  2LRK A;  4ILA A;  3VR8 A;  5FMN A;  4DR4 T;  4PJM A;  2SPC A;  3RPU A;  3CQC B;  3IF8 B;  2QVA A;  2XJ3 A;  2X0Y A;  1YXR A;  4QKN A;  4YG7 B;  4IL4 A;  3DJB A;  2LSI A;  4Q2J A;  1ZZC A;  4PK5 A;  4OHF A;  3M3Z B;  4O8B A;  5CGM A;  2R1J L;  2K9A A;  3KFW X;  4KHP T;  4P0A A;  4ER6 A;  3ZST A;  5JDM A;  2AXV A;  3JXB C;  4MFR A;  3RI5 A;  3ZEF B;  2WCA A;  2XXA A;  3QC9 A;  4EYY R;  4U2Y A;  3QK6 A;  4DND A;  4HFH A;  2XM1 A;  4ADZ A;  1JH9 A;  4X1I E;  4TUY E;  2Q9Q A;  2WU2 A;  4KUM B;  3ZYM A;  5DSX A;  1ZZ7 A;  3EI0 A;  4P1N A;  3ZLI A;  4GYR A;  3FBZ A;  3UU8 A;  2Q9Q D;  4OB4 A;  4CQI A;  3ZC1 A;  2AWI A;  4HFE A;  2IU7 A;  5DT2 A;  2D0T A;  4UVB B;  4C90 A;  2WUS R;  2PUB A;  3L09 A;  2FJR A;  2YEV C;  2NR4 A;  2LSG A;  4PFP A;  4HKA A;  1SQ8 A;  4L5G A;  2GRM A;  4IHJ E;  2WWU A;  3R6N A;  3MLF A;  2KND A;  2PIJ A;  4IST A;  4TWH A;  2LM2 A;  3SRZ A;  2UU9 T;  4JYA T;  4JI4 T;  3A8Y C;  1KK7 A;  1G73 A;  5FY7 A;  4J1X A;  4HWC A;  3N2G E;  2X9X A;  2ODV A;  4UF0 A;  5L3E B;  3RZZ A;  4TWD A;  3K1S A;  2DI4 A;  4U72 A;  3WAJ A;  2YBD A;  5EK3 A;  2LYS A;  1HF8 A;  2UXD T;  3C4W A;  1OED C;  1RPE L;  4G2A A;  5HEH A;  4ZOL E;  2CHN A;  3OVU A;  3LFM A;  4NIQ A;  4A56 A;  4IDQ A;  2YN6 A;  2IV1 A;  1FMW A;  2XSA A;  3U78 A;  4IGU A;  3FHN A;  4JCX A;  2J4G A;  3QF3 A;  1QP0 A;  2XTL A;  3ZMU B;  2AW6 A;  4YG4 A;  4X62 T;  1I6Z A;  3LDQ B;  3AVR A;  3D1N I;  4DV7 T;  3UTK A;  2FJB A;  2HN2 A;  2KWH A;  3UUX B;  3RYH E;  3QB5 A;  5LCY A;  2YKS A;  3AA7 B;  2PBI A;  4EV6 A;  2UXB T;  4LF7 T;  4Z5D A;  4MCT A;  4LF5 T;  2HN1 A;  2IDO B;  5JTG A;  2V5C A;  2WWV A;  2MQK A;  2JVL A;  3O1J A;  1WRD A;  2KZ8 A;  1U2Z A;  1WYB A;  4H63 V;  5DAB A;  3AEB A;  2NWB A;  4AKG A;  2XAF B;  2XSD C;  3AE4 A;  3NDB B;  2ACZ A;  4KP3 C;  4PU8 A;  1R8I A;  2JQH A;  3CX8 B;  4Z90 A;  1CUN A;  4U7Y A;  3AE1 A;  4UR9 A;  2IVB A;  4GHJ A;  3FYA A;  2R63 A;  2IVQ A;  1GQE A;  4TN7 B;  1FIO A;  5EZY E;  4QXH B;  3F6W A;  4JI2 T;  3ZHM A;  3HR0 A;  5L3G B;  3SFE A;  4CXX A;  4JUY A;  1HG5 A;  2K24 A;  1XNR T;  1B7T A;  2IML A;  4P09 A;  1OED E;  1LLI A;  4AQF C;  2CHO A;  4QXC B;  4J1W A;  1DUL A;  5FYM A;  2X67 A;  3I1A A;  2MEZ A;  2BG9 C;  2VVN A;  4DID B;  4CN4 A;  2VEO A;  4X4I A;  5LG3 A;  1KNZ A;  3NBX X;  2QA7 A;  4WNK A;  2BDE A;  2JIW A;  4DE9 A;  2BNN A;  3AEA A;  1U5P A;  4E7Z A;  2LYQ A;  4HWI B;  2VWA A;  1JWL A;  2JQE A;  2PXL A;  3M65 A;  1HCI A;  3VRB A;  3WAK A;  4PK4 A;  3SS1 A;  4PK6 A;  3ZJ1 A;  2V6Y B;  4IE5 A;  4YTP A;  1JFS A;  2NTY A;  1QLB A;  1OED A;  2XUE A;  4DV2 T;  3C4X A;  3PUA A;  3ZC0 A;  1ZHC A;  5DQW A;  5HEO A;  3H3A A;  4JCY A;  2XQ3 A;  2K5B B;  4EKG A;  3KV4 A;  1W0A A;  4LF4 T;  5H6Q B;  3J7Y q;  3PDY A;  2B5A A;  5LJM A;  4LMK A;  3KL4 A;  1HQ1 A;  2NTX A;  5AQJ B;  4DR7 T;  5DTQ A;  3PJA J;  1R63 A;  4X4E A;  2AXZ A;  2LYP A;  2CRB A;  3OWQ A;  5LXT E;  4G63 A;  1YKE B;  4UIG A;  5JR9 A;  3O1I A;  5C8Y E;  3RRC A;  3AAA B;  4NPP A;  5FVK A;  3BQL A;  1DU2 A;  4MHC A;  4O2A E;  2M6B A;  2BKP A;  1ZZB A;  4XAX B;  2KZ7 B;  5E0O A;  1N32 T;  4PU3 C;  1QQA A;  2GK9 A;  3UU4 A;  2H3R A;  3KDS E;  4TNV A;  2BG9 E;  3J9X 1;  5AFU L;  4IIJ E;  4GKJ T;  3LJC A;  3CX7 B;  3UU6 A;  3U3W A;  3PUY F;  4K0K T;  2DWK A;  1BDI A;  2WDV A;  2H7O A;  4ZZC A;  5FL1 A;  4OYK A;  3JAF A;  4QH4 A;  3SX0 A;  4JI6 T;  1WR6 A;  4IWR A;  3ETU A;  1DW9 A;  4JEH B;  4ZXL A;  2CBJ A;  1QP7 A;  1VOM A;  2BVM A;  3LQX A;  4X64 T;  4OK0 A;  3D0T A;  2J62 A;  3AXJ B;  3SWH A;  2JCG A;  2YDQ A;  4EXT A;  3K3Q C;  4UVA B;  1ZPQ A;  2NP9 A;  1ZUG A;  3ABV A;  4X5T A;  4BA9 A;  1KNR A;  3FZF B;  2OLT A;  2PFV A;  2WY2 A;  4GK0 E;  2DNX A;  5LJN A;  4B3T T;  3RYC E;  3R1F A;  2KEI A;  2BG9 A;  3QUJ A;  2YU1 A;  4O4I E;  2ODR D;  3C50 A;  1R69 A;  3PE0 A;  3F51 A;  1IBM T;  3I9W A;  3KZ3 A;  1BDH A;  4EB6 E;  5J2T E;  4MCX A;  4ZZB A;  2PG8 A;  4A97 A;  3A9Y A;  4B6X A;  2E9X C;  1T72 A;  4KI0 F;  3C98 B;  3CQG B;  3ZT6 A;  4LF6 T;  1LKX A;  2ZMA A;  3H37 A;  4F8D A;  2RPA A;  1JNZ A;  3GN5 A;  5FXX A;  2UUC T;  3TFL A;  1OCT C;  3IA3 A;  3KV9 A;  3A9X A;  1XMQ T;  3B5M A;  4TV9 E;  1PRU A;  2CSF A;  4FBI A;  1L0V A;  3H5T A;  4YJ2 E;  2CA5 A;  5FXV A;  1UK5 A;  2FJE A;  3GZD C;  3QNU A;  5LNK A;  3ESL A;  1LQC A;  3GMI A;  2UXC T;  5FKY A;  2P9B A;  1MND A;  5LGT B;  2RA1 A;  2VVS A;  3ZN0 B;  4I6R A;  5F3J A;  4O4L E;  5GON E;  5AQT B;  1OSL A;  3CQX C;  2RP4 A;  1WLX A;  3SR4 A;  3RF1 A;  2L1P A;  4JBW F;  1SA0 E;  3FYM A;  4YTM A;  2MPK A;  1HS7 A;  2OFY A;  2W61 A;  4TZ4 C;  1DWK A;  3CIR A;  1EZ3 A;  3G5G A;  1KEY A;  2LLY A;  2MAW A;  3ANW A;  2WAU A;  3NRX A;  2MOZ A;  3PU8 A;  4DV3 T;  2ZLY A;  3E08 A;  2YU2 A;  2XAQ B;  3LFP A;  4Z58 A;  2X66 A;  1V9D A;  4Z5H A;  2X9W A;  3MJX A;  1J1J A;  1UX4 A;  4PU7 A;  2LSK A;  4EQZ A;  2K48 A;  2X0H A;  2IW5 B;  1SUM B;  2O49 A;  3FBL A;  1N34 T;  4ANJ A;  1Y7Y A;  1E1H B;  3VR9 A;  2PXU A;  2WZI A;  3VHL A;  5KXJ A;  3Q2M A;  4HFI A;  2WDR A;  4EOZ B;  4IE6 A;  2KIN B;  2NW9 A;  3KBU A;  1T8B A;  5JR9 B;  2ICP A;  2V3C C;  1HNX T;  1IBK T;  4ZS3 A;  5C3J A;  2I6H A;  2XAG B;  3PU3 A;  3OKQ A;  3M9L A;  5L4E A;  4DBQ A;  4YXD A;  2PXD A;  4HN9 A;  4DUY T;  1UXC A;  2BNM A;  5IUX A;  4GOU A;  4DR3 T;  4JEU B;  3OYZ A;  5FY1 A;  4HGA A;  1VCT A;  1J5W A;  2VKJ A;  3N9Q A;  1QQB A;  3ZKC A;  3LBX A;  3QOF A;  2JQQ A;  1BR1 A;  3KXA A;  3F31 A;  2LEH A;  1LRZ A;  3JAE A;  3ZMS B;  3F2E A;  3TEP A;  1UUR A;  3RYF E;  3EAB A;  2E9X A;  4DE8 A;  5LHH B;  2OV9 A;  2NW7 A;  5HXR A;  5LBQ B;  1T98 A;  2IC9 A;  2EHO B;  1PRA A;  2E9X D;  4MAL A;  2J7U A;  1KFY A;  3AE6 A;  1AJ3 A;  4LFA T;  5JRC B;  4YY3 T;  4DMV A;  3PUQ A;  1MIY A;  3GZD A;  5DTR A;  3JAD A;  4AKH A;  1ADR A;  4HTE A;  2WSS V;  4HWH A;  4DV0 T;  1XMO T;  1MMG A;  4X4G A;  3OPC A;  1HR0 T;  3VWS A;  4KHZ F;  1E7P A;  2KPJ A;  4AKI A;  4YBA A;  4JI3 T;  4ILU A;  1QSD A;  5FL0 A;  5ABH A;  2L8N A;  2G0U A;  5ADX L;  2A3D A;  2W0G A;  3RIA A;  1EFA A;  4ZS2 A;  4PJL A;  1NW3 A;  5LHG B;  4NXN T;  2MXD A;  1IAP A;  3BQK A;  4EK9 A;  3E0Z A;  1S7E A;  2WM9 A;  2WZH A;  4EZ4 A;  2HCS A;  4OX9 T;  3HKD E;  3O9X A;  1CQT A;  4H9Q C;  4DV1 T;  3QWG A;  1MIV A;  2LHN A;  2A2F X;  4WW0 A;  2AUW A;  1XWM A;  2CLY C;  2MYS A;  2XQ4 A;  3ONX A;  3KBT A;  3UFE A;  2CWY A;  3FXE B;  2LSY A;  4JI1 T;  2WIU B;  4OFZ A;  2ICT A;  1ZV4 X;  3SCH A;  3PUW F;  2M6I A;  3OQN A;  5HXC A;  1U4Q A;  3AE3 A;  3P8C D;  2HHH T;  4YSZ A;  2F4V T;  2PPX A;  3VKG A;  3SCG A;  3G06 A;  2LCV A;  3P4S A;  2IHR 1;  4YLH A;  5JH7 E;  4UV9 B;  3R84 B;  2V7I A;  2XQ7 A;  1D0Y A;  5LGN B;  1YD8 G;  3MA9 A;  4NUU A;  3ZCJ A;  3P7I A;  2FUP A;  4H9O C;  1I94 T;  1HG2 A;  1QZX A;  2BKO A;  3AEE A;  2JRK A;  4NDW A;  4AIS A;  4EGW A;  3MAC A;  5IHY A;  4X4C A;  4GK5 E;  4WBN E;  4I43 B;  5HWX A;  5CA0 E;  5AQM B;  2V8S V;  2VKO A;  3JCF A;  3UUN A;  3BQI A;  4PJJ A;  1S35 A;  3B7H A;  3GWH A;  4YSX A;  1WH8 A;  4DR2 T;  3UQ4 A;  2FBW A;  2JMK A;  1LMB 3;  3KV5 A;  1ZZ9 A;  4F8H A;  3Q9D A;  2X0L B;  5AQO B;  4HEA A;  4H9S E;  3G7D A;  2LLW A;  1M7K A;  2C5K T;  4PW8 A;  4Z91 A;  3N9P A;  3PUZ F;  2PE5 A;  5FNV E;  5DTM A;  4I6T A;  2K3W A;  2L49 A;  5L2L A;  1QUU A;  5J1G A;  4EIW A;  4EEB A;  5JDL A;  3EVY A;  5C2T A;  1WR0 A;  5A7L A;  3JC6 D;  5L3F B;  2CE7 A;  1AU7 A;  4UXN B;  3AA6 B;  2PUC A;  4PU4 C;  3T8O A;  1BR2 A;  2XIU A;  3N9M A;  4HFC A;  1X9B A;  3KJX A;  2QYW A;  4MLK A;  2VL8 A;  1Z0P A;  3VKH A;  2KEK A;  4ER5 A;  1MMN A;  1IC8 A;  3OQO A;  4DBR A;  1FMV A;  2Q9Q B;  5DJQ C;  2UXX B;  1MNE A;  3ZHI A;  2OA5 A;  2W66 A;  4IDZ A;  3RYI E;  2XQA A;  3Q5X A;  3FB2 A;  3OTO T;  3N2O A;  3KIN B;  4V1A v;  3UFD A;  4WBO A;  3NXH A;  2X9Y A;  2LJL A;  4HE8 A;  2O4A A;  4I50 E;  5KDM C;  4DV6 T;  2IAK A;  3LK4 2;  3RX6 A;  5HEG A;  3OMT A;  2ODU A;  2A9U A;  4A98 A;  4UVC B;  1RZR D;  2VQE T;  4HFB A;  5ABF A;  3SCF A;  1IBL T;  3LK2 B;  3AED A;  3A7M A;  3PV0 F;  1YQ4 A;  2DL1 A;  2N2N A;  4XZC A;  3ZMV B;  3BDN A;  4AXP A;  4UV8 B;  2PUA A;  4BJM A;  4X4F A;  2LKH A;  3L8R A;  3CVR A;  5ABG A;  4UF0 B;  3PUS A;  4ILB A;  1N36 T;  1SE7 A;  2QRX A;  2XXQ A;  5H6R B;  5ABE A;  5DRY A;  2XPK A;  1HNZ T;  2CXF A;  2XAS B;  5HCJ A;  3V5S A;  4B3S T;  2W62 A;  4JI8 T;  3N2K E;  5HXS A;  4QH1 A;  5FXW A;  5CA1 E;  2PJQ A;  4OYJ A;  3PXP A;  2PXP A;  5J0Z A;  2XAH B;  1NER A;  4DVD A;  2J7W A;  3ZMZ B;  2IVG A;  3QYX A;  4ER0 A;  2KT9 A;  2FJA A;  2NW8 A;  2A6C A;  2CBI A;  3OP9 A;  2M4H A;  3L39 A;  4YHJ A;  2A72 A;  1UX5 A;  4A5X A;  3ONJ A;  2XY8 B;  4U74 A;  1JFT A;  3O4X E;  4YG1 A;  2WDQ A;  2B1E A;  2XJ7 A;  4PFO A;  1VCS A;  3AA1 B;  4YJ3 E;  2DLR A;  2XXP A;  3KVB A;  5JDF A;  4Y42 A;  1D0Z A;  1O4X A;  3NRO A;  1N33 T;  3ZPO A;  2OR1 L;  1QPZ A;  4AQF A;  5HEU A;  2NOX A;  2CPT A;  4HRA A;  1D0X A;  2W63 A;  5AQV B;  3TKL B;  3NVO A;  4HFV A;  3OBV E;  2LE8 A;  5JRE A;  3X1D A;  4X66 T;  5DRT A;  3NZP A;  4IA8 A;  4CXW A;  4OBM A;  5LGU B;  2I0M A;  5JVD E;  1MIW A;  4UEM A;  2EF8 A;  2WBL A;  3B13 A;  2IUB A;  4NUV A;  3TLW A;  5AQF B;  4CZZ B;  2V7L A;  3DTO A;  3FXD B;  2HSG A;  4AQY T;  1NEQ A;  1T7S A;  1W09 A;  3TLT A;  1KNP A;  4BAY B;  3RC8 A;  4Z8X A;  2BBH A;  3LSV A;  4BJN A;  2XQ8 A;  3NZQ A;  4I6U A;  4JV5 T;  2PXE A;  3N9L A;  2LOP A;  4ZI3 C;  4E7S A;  1X57 A;  3JXC L;  3K8P C;  2EWT A;  1NEK A;  1IJ6 A;  4PJN A;  5IYZ E;  5FXZ A;  4CI1 B;  3P4P A;  2LYK A;  2Y6X A;  3E22 E;  1WYC A;  5LBM A;  2PXT A;  4X1Y E;  2Y8D A;  3P4W A;  1XDO A;  3TEL A;  1MMD A;  4U31 A;  1ZVV A;  1PRV A;  3ZKR A;  4H63 H;  3Q5E A;  1YKH B;  3LG7 A;  3PUX F;  1RZS A;  2LYR A;  2W67 A;  2XM2 A;  3AEF A;  3HI2 A;  2D2S A;  4X1K E;  2KSR A;  5L47 A;  4LFC T;  1OED B;  2ES0 A;  3DP7 A;  4Q25 A;  4KBM B;  2E2A A;  4EAH A;  3NRY A;  1US7 B;  1LVF A;  4ASK A;  5DQV A;  1YW0 A;  4IL9 A;  2CWO A;  1HFA A;  3AVS A;  4TNW A;  2BNO A;  3CML A;  2XQY A;  4DR1 T;  4CI3 B;  2AE9 A;  2XI8 A;  4IDO A;  4MBQ A;  3WI3 A;  4IE4 A;  3AA0 B;  2HH7 A;  4X4B A;  5LB7 B;  4IE0 A;  4FN3 A;  4IDN A;  3VU7 H;  3AE5 A;  4GIW A;  2YOE A;  2MBG A;  3IVP A;  2XSB A;  3RKG A;  4DO0 A;  2V26 A;  5LOV E;  5GAH i;  1ZZ8 A;  4B3R T;  2LHR A;  4YSY A;  2VK9 A;  5J2U E;  2YDS A;  3AAE B;  3HKC E;  1HF0 A;  4DV5 T;  5M4Y A;  4TWF A;  3LK3 B;  2VKH A;  3AB3 B;  3A5X A;  3TRB A;  3RC3 A;  5AQG B;  3HA4 A;  5JDQ A;  2WQY A;  2CXD A;  5BMV E;  3CLC A;  1NAF A;  1OWA A;  1BR0 A;  3CRO L;  3JC6 C;  4EKI A;  4WZX A;  2LYJ A;  2HPL A;  1UGO A;  3H3M A;  2LRL A;  4YT0 A;  1UXD A;  1KF6 A;  5JDG A;  1IZN B;  3RLF F;  2V7J A;  5L4H A;  4CI2 B;  4Z5C A;  1UTX A;  5AQL B;  3F52 A;  3ONL C;  2BG9 B;  3GBF A;  1Y64 B;  2VUR A;  1XWR A;  2IIU A;  1M62 A;  2DWG A;  2BJC A;  3RIF A;  4HWD A;  2VAS A;  3UT5 E;  4TX5 A;  1GT0 C;  3PUR A;  2LOS A;  3LIS A;  3R09 A;  2V6Y A;  4LFB T;  3I0O A;  3NZL A;  3GN5 B;  1LCD A;  3RIU C;  2J1D G;  5L3D B;  4ZI3 D;  1HX1 B;  4H9R C;  3S4U A;  2R6G F;  2ZM8 A;  3QOX A;  2CMR A;  3U3I A;  5JDH A;  1WET A;  2WB5 A;  3FZM B;  1LCC A;  3I0Q A;  2PXQ A;  2HIN A;  3CKD A;  3MZK B;  4QX8 B;  5AQK B;  3TLS A;  2X68 A;  2B76 A;  3EUH A;  3JXD L;  4YFS A;  4AKL A;  2LNM A;  2KWI B;  2KEJ A;  2XHE B;  4X4D A;  4AIU A;  2BS2 A;  3V5U A;  3RHW A;  4ZI2 C;  4KMC A;  3RGL A;  4HWF A;  3OQM A;  5JQG E;  3A9Z A;  4F6R C;  5AQI B;  4EZH A;  2H89 A;  3RRW A;  1G8X A;  3AEG A;  3SOL A;  2XCJ A;  5HXE A;  2HCN A;  2FJD A;  2C5I T;  4EED A;  2PUE A;  3ZMT B;  3ANW B;  5HYA A;  2H88 A;  3EUS A;  2N1G A;  2GRL A;  4X4H A;  3CWZ B;  5JDN A;  3IBP A;  1LVK A;  3IEE A;  2BS4 A;  2PXF A;  3HZI B;  2J47 A;  2Y48 B;  3UWP A;  5FP3 A;  3K3O A;  4NXM T;  3RQU A;  3ZN1 B;  1ZOY A;  3UU3 A;  2D0U A;  2Z6E A;  3MEJ A;  3EHZ A;  3OJA A;  4CN6 A;  5CFB A;  3AE2 A;  4L9I A;  4I8T A;  1SHZ C;  4COF A;  1Z8U A;  5KX5 E;  5JR9 C;  2E5L T;  1NWM X;  5TAO A;  3GZC A;  2ACX A;  3RH3 A;  2XQ5 A;  5F5W A;  3AE8 A;  2XQ6 A;  4QH5 A;  2DCF A;  3AXJ A;  2QGS A;  4EYU A;  3ZCI A;  2DHR A;  1D1C A;  4K0U A;  3C4Z A;  1FJG T;  3FZH B;  1B0N A;  1X2L A;  2PUD A;  2L8K A;  4O8S A;  3HKE E;  2BBJ A;  1JNR A;  3MKD A;  2WP9 A;  5KMG P;  1BR4 A;  4YAR A;  4U3C A;  3PE5 A;  4GKK T;  2EBY A;  1XZY A;  4L0R A;  5AQQ B;  1PER L;  3LBX B; 
#chains in the Genus database with same CATH homology
 2KND A;  3UUM A;  2YU2 A;  2YIN A;  2PIJ A;  2XAQ B;  2EHO C;  4IST A;  3LFP A;  2W00 A;  3BS3 A;  1Y9Q A;  4Z58 A;  2X66 A;  1V9D A;  2A72 A;  4Z5H A;  1UX5 A;  4YHJ A;  2X9W A;  3MJX A;  3SRZ A;  1YSE A;  4U74 A;  1JFT A;  1ZAY A;  3MXZ A;  1UX4 A;  2E9X B;  3VK0 A;  3O4X E;  4PU7 A;  4YG1 A;  2LSK A;  4IE7 A;  4CXY A;  2B1E A;  2K48 A;  2IW5 B;  2O49 A;  1KK7 A;  1G73 A;  4PFO A;  3FBL A;  3AA1 B;  5FY7 A;  4YJ3 E;  4J1X A;  2DLR A;  4ANJ A;  3N2G E;  2X9X A;  3KVB A;  1Y7Y A;  1PNR A;  1E1H B;  4Y42 A;  4O4H E;  5JDF A;  2ODV A;  2PUF A;  1O4X A;  1D0Z A;  1X79 A;  3L1P A;  4UF0 A;  5L3E B;  3RZZ A;  3ZPO A;  3VHL A;  2OR1 L;  5HWY A;  1QPZ A;  4AQF A;  1WIZ A;  2DI4 A;  4U72 A;  2NOX A;  3Q2M A;  3PTR B;  3WAJ A;  4EOZ B;  5EK3 A;  2LYS A;  1HF8 A;  4IE6 A;  2KIN B;  1D0X A;  3C4W A;  1RPE L;  4G2A A;  2NW9 A;  1L1M A;  2W63 A;  3KBU A;  4ZOL E;  5JR9 B;  3TKL B;  2ICP A;  5L3C B;  4HFV A;  2C0S A;  1MMA A;  3OBV E;  2LE8 A;  3LFM A;  4ZS3 A;  4A56 A;  5JRE A;  3ETV A;  4ZHQ E;  2XAG B;  5HXH A;  3PU3 A;  1RZR A;  3OKQ A;  2IV1 A;  3AAI A;  1IJ5 A;  4DBQ A;  3NZP A;  4IA8 A;  4CXW A;  4QX7 B;  4HN9 A;  1FMW A;  3U78 A;  2ZM0 A;  5LGU B;  3B57 A;  3Q5W A;  5JVD E;  1UXC A;  1MIW A;  4IGU A;  3FHN A;  4JCX A;  2BNM A;  4UEM A;  3IHR A;  4C91 A;  2EF8 A;  1QP0 A;  3QF3 A;  2XTL A;  3CPZ A;  3ZMU B;  2AW6 A;  4YG4 A;  4GOU A;  2E8I A;  2WBL A;  3B13 A;  4JEU B;  3OYZ A;  5FY1 A;  4HGA A;  3AVR A;  2IUO A;  2VKJ A;  3N9Q A;  4NUV A;  1QQB A;  3ZKC A;  3LBX A;  1UCU A;  3D1N I;  2JQQ A;  3ZYK A;  3HKB E;  3UTK A;  4CZZ B;  1BR1 A;  3KXA A;  2V7L A;  3F31 A;  2LEH A;  1POU A;  1LRZ A;  2KWH A;  2HSG A;  3DTO A;  3FXD B;  1NEQ A;  2X51 A;  3ZMS B;  3W15 B;  3O1H A;  4BAY B;  4ZI2 D;  3F2E A;  4Z59 A;  3UUX B;  3RYH E;  2MTQ A;  3ZYL A;  3RC8 A;  4Z8X A;  5LCY A;  3RYF E;  1HTJ F;  3AA7 B;  3OYX A;  2E9X A;  4FI5 A;  2PBI A;  4BJN A;  3DNV B;  5LHH B;  4Z5D A;  4MCT A;  2NW7 A;  2X9H A;  3NZQ A;  4JQD A;  4I6U A;  2L9Q A;  2BVL A;  2HPJ A;  5HXR A;  3N9L A;  1D1B A;  2LOP A;  4ZI3 C;  5LHI B;  1VRB A;  5LBQ B;  4E7S A;  1T98 A;  1X57 A;  3JXC L;  2IC9 A;  3K8P C;  3EDU A;  2EHO B;  1S94 A;  1PRA A;  2EWT A;  2E9X D;  4MAL A;  1IJ6 A;  2MQK A;  2JVL A;  3O1J A;  4PJN A;  5IYZ E;  5A1L A;  5FXZ A;  4CI1 B;  1WRD A;  1AJ3 A;  2KZ8 A;  1WYB A;  2LYK A;  2Y6X A;  4H63 V;  5JRC B;  5DAB A;  3E22 E;  1WYC A;  5LBM A;  2NWB A;  4QWN B;  4X1Y E;  4DMV A;  2Y8D A;  3PUQ A;  3CX6 B;  2C5J A;  5EK4 A;  2JMH A;  1MIY A;  5LG4 A;  4AKG A;  2XAF B;  2XSD C;  2PUG A;  1MMD A;  3S8Q A;  4J2C A;  4AKH A;  1ADR A;  1ZVV A;  4HTE A;  1PRV A;  2WSS V;  4H63 H;  3N9O A;  5HAX A;  1YKH B;  4KP3 C;  4PU8 A;  3LG7 A;  5FY0 A;  4AI6 A;  3CX8 B;  2WMN A;  1MMG A;  1RZS A;  2LYR A;  4X4G A;  4H9N C;  1CUN A;  4P0B A;  3HI2 A;  3I9Y A;  2D2S A;  4X1K E;  3FMY A;  4H9P C;  4JLE A;  2IVB A;  2KPJ A;  4AKI A;  2ES0 A;  4GHJ A;  3DP7 A;  3FYA A;  2R63 A;  2IVQ A;  4YBA A;  4TN7 B;  1FIO A;  5EK2 A;  5EZY E;  4ILU A;  1QSD A;  4QXH B;  3F6W A;  4KBM B;  3ZHM A;  3HR0 A;  2V7M A;  3BD1 A;  2L8N A;  4O2B E;  5L3G B;  2G0U A;  5ADX L;  4EAH A;  3NRY A;  4CXX A;  1US7 B;  4JUY A;  1LVF A;  2A3D A;  2VKD A;  1HG5 A;  2W0G A;  5DQV A;  2CEA A;  1QP4 A;  1B7T A;  2K24 A;  4ASK A;  4P09 A;  1YW0 A;  4TV8 E;  1EFA A;  1LLI A;  2M67 A;  4AQF C;  4ZS2 A;  2V1D B;  2CWO A;  3KVA A;  4O4J E;  4PJL A;  4J1W A;  4QXC B;  5FYM A;  2X67 A;  3RKO A;  5LHG B;  1IAP A;  1HFA A;  3AVS A;  3BQK A;  3I1A A;  5LA6 E;  2MEZ A;  2CCQ A;  2BNO A;  3CML A;  2XQY A;  3E0Z A;  1S7E A;  3ZJ2 A;  2WM9 A;  4I4T E;  4CI3 B;  3KV6 A;  4X4I A;  3R6N A;  4PAG A;  4EZ4 A;  2XI8 A;  4MBQ A;  3WI3 A;  4IE4 A;  3HKD E;  3O9X A;  3AA0 B;  2HH7 A;  1CQT A;  3NBX X;  4H9Q C;  1KNZ A;  2QA7 A;  4WNK A;  4X4B A;  2VB6 A;  4IE0 A;  2BDE A;  3QWG A;  2AXU A;  4FN3 A;  2EHO A;  1MIV A;  2LHN A;  2A2F X;  3VU7 H;  4WW0 A;  2AUW A;  2BNN A;  2CLY C;  2MYS A;  4ERR A;  4GIW A;  3ONX A;  3KBT A;  2LYL A;  1U5P A;  2MBG A;  3UFE A;  3IVP A;  3HL6 A;  5JRC A;  3EDV A;  4E7Z A;  2CWY A;  3FXE B;  4DO0 A;  2LYQ A;  2EHO D;  2LSY A;  2V26 A;  1JWL A;  2VWA A;  5LOV E;  3M65 A;  2WIU B;  4N78 D;  1ZZ6 A;  1HCI A;  4OFZ A;  3WAK A;  2ICT A;  1ZV4 X;  1ZZ8 A;  3SCH A;  4PK4 A;  4AKR B;  2LHR A;  3SS1 A;  3OQN A;  4PK6 A;  3ZJ1 A;  5HXC A;  5ETW A;  1U4Q A;  2VK9 A;  4IE5 A;  4IVZ A;  1ZKE A;  3P8C D;  5J2U E;  3L3P A;  3AAE B;  4GYS A;  2PPX A;  3VKG A;  3HKC E;  1ZEE A;  1HF0 A;  1JFS A;  3SCG A;  2KXP B;  2UXN B;  3F57 A;  2NTY A;  5M4Y A;  2LCV A;  4I55 E;  1D1A A;  2VKH A;  3LK3 B;  2LM9 A;  2H7V C;  3AB3 B;  3A5X A;  2XUE A;  3TRB A;  3CEC A;  3K3N A;  3C4X A;  3C64 A;  3RC3 A;  4UEL A;  3PUA A;  3ZC0 A;  2Q9Q C;  5CB4 E;  1ZHC A;  4YLH A;  5JH7 E;  4UV9 B;  5DQW A;  3R84 B;  2V7I A;  3H3A A;  4JCY A;  1D0Y A;  2K5B B;  3KV4 A;  1YD8 G;  3HA4 A;  5JDQ A;  5LGN B;  5F8P A;  4M1P A;  3MA9 A;  2JJ9 A;  4ISS A;  4NUU A;  1RIO A;  3ZCJ A;  2CXD A;  5BMV E;  5H6Q B;  2WMO A;  3P7I A;  3J7Y q;  3CLC A;  2KLQ A;  1NAF A;  4H9O C;  3PDY A;  1WH6 A;  2B5A A;  1HG2 A;  5LJM A;  2LSJ A;  3GA8 A;  5K98 B;  2JRK A;  1OWA A;  1ZS4 A;  1BR0 A;  4NDW A;  2NTX A;  2XAJ B;  3CRO L;  3MAC A;  3JC6 C;  5IHY A;  4X4C A;  4GK5 E;  2LYJ A;  4WBN E;  1R63 A;  4X4E A;  4I43 B;  2BZB A;  2HPL A;  5HWX A;  5CA0 E;  2IC6 A;  2AXZ A;  2VKO A;  2LYP A;  3UUL A;  3UUN A;  1UXD A;  3BQI A;  4DMW A;  5LXT E;  4G63 A;  4PJJ A;  1S35 A;  3B7H A;  2CXL A;  5JDG A;  1IZN B;  1VPW A;  1YKE B;  3GWH A;  4UIG A;  2V7J A;  1WH8 A;  5JR9 A;  4CI2 B;  4Z5C A;  3O1I A;  3PUG A;  4PNI A;  3RRC A;  5C8Y E;  1UTX A;  3AAA B;  3F52 A;  3BQL A;  2JMK A;  1LMB 3;  3GBF A;  1Y64 B;  4MHC A;  4O2A E;  3KV5 A;  1ZZ9 A;  1XWR A;  1ZZB A;  4X20 E;  4XAX B;  2KZ7 B;  3C51 A;  5E0O A;  4PU3 C;  2DWG A;  2BJC A;  3Q9D A;  1QQA A;  2YK0 A;  4QXB B;  2GK9 A;  2X0L B;  2VAS A;  3UT5 E;  2I59 A;  2H3R A;  2D5U A;  4HEA A;  2CM0 A;  4H9S E;  4TX5 A;  1GT0 C;  3G7D A;  3KDS E;  2C5K T;  4PW8 A;  2CRO A;  2ZM2 A;  3PUR A;  3J9X 1;  5AFU L;  4IIJ E;  2LOS A;  3LIS A;  3N9P A;  2PE5 A;  5FNV E;  4QHO A;  2CLY B;  3I0O A;  3MK7 C;  2JPF A;  3GN5 B;  3LJC A;  1LCD A;  4I6T A;  2O38 A;  2GZU A;  1HX8 A;  3U3W A;  2J1D G;  2L3L A;  3CX7 B;  2L49 A;  5L2L A;  1QUU A;  2DWK A;  4ZI3 D;  1BDI A;  5L3D B;  5J1G A;  2H7O A;  4H9R C;  4EIW A;  3S4U A;  5JDL A;  3EVY A;  5L3B B;  5A7L A;  3JC6 D;  4OYK A;  5L3F B;  2CE7 A;  2ZM8 A;  4FJO A;  1AU7 A;  2H8R A;  4UXN B;  1WR6 A;  2PUC A;  3AA6 B;  4PU4 C;  4IWR A;  2CMR A;  3ETU A;  1DW9 A;  4JEH B;  3T8O A;  1BR2 A;  3U3I A;  5LYJ E;  2XIU A;  3N9M A;  2D5V A;  5JDH A;  5LP6 E;  1WET A;  3KJX A;  1LCC A;  1QP7 A;  1VOM A;  1CJG A;  2BVM A;  2VL8 A;  3BK9 A;  1Z0P A;  3I0Q A;  4MLK A;  4ZI7 E;  4XBF B;  3VKH A;  4OK0 A;  4GQM A;  2KEK A;  2HIN A;  3CKD A;  3MZK B;  4QX8 B;  3D0T A;  1MMN A;  1IC8 A;  1E3O C;  3OQO A;  4DBR A;  2N9D A;  1FMV A;  2X68 A;  3SWH A;  2JCG A;  2Q9Q B;  5DJQ C;  4EXT A;  3K3Q C;  4UVA B;  1ZPQ A;  3EUH A;  2NP9 A;  3JXD L;  4YFS A;  2UXX B;  1O3X A;  4AKL A;  1MNE A;  4AQG A;  2KWI B;  3ZHI A;  2KEJ A;  2KMF A;  1ZUG A;  2XHE B;  4X4D A;  2OA5 A;  3N9N A;  4IDZ A;  2V7K A;  3RYI E;  3V5U A;  4BA9 A;  4ZI2 C;  3Q5X A;  4KMC A;  3FB2 A;  2PFV A;  3QQ6 A;  4GK0 E;  2DNX A;  3OQM A;  5LJN A;  1FEW A;  3N5L A;  2LT3 A;  3RYC E;  3R1F A;  2KEI A;  3N2O A;  1OXZ A;  3KIN B;  4V1A v;  5JQG E;  1H7C A;  3QUJ A;  4F6R C;  3UFD A;  2YU1 A;  4O4I E;  4WBO A;  5FMN A;  4PJM A;  3C50 A;  4EZH A;  1R69 A;  3PE0 A;  3F51 A;  3I9W A;  2X9Y A;  3RRW A;  3KZ3 A;  1BDH A;  1G8X A;  4EB6 E;  2SPC A;  4MCX A;  5J2T E;  2LJL A;  4HE8 A;  3SOL A;  2XCJ A;  2O4A A;  2PG8 A;  4I50 E;  5HXE A;  5KDM C;  4B6X A;  3RPU A;  2IAK A;  3CQC B;  2E9X C;  3IF8 B;  3C98 B;  3CQG B;  2XJ3 A;  2C5I T;  2PUE A;  3LK4 2;  3ZMT B;  3ANW B;  4QKN A;  5HYA A;  4YG7 B;  1LKX A;  3RX6 A;  3EUS A;  2ZMA A;  2N1G A;  2GRL A;  3H37 A;  3DJB A;  4F8D A;  4X4H A;  3CWZ B;  3GN5 A;  5FXX A;  3OMT A;  2ODU A;  3IBP A;  5JDN A;  1LVK A;  2LSI A;  1OCT C;  3IEE A;  3KV9 A;  3HZI B;  1ZZC A;  4UVC B;  1RZR D;  2Y48 B;  4TV9 E;  5FP3 A;  3K3O A;  4PK5 A;  1PRU A;  3SCF A;  4OHF A;  3ZN1 B;  2CSF A;  2D0U A;  2Z6E A;  3LK2 B;  4FBI A;  4O8B A;  3OJA A;  2R1J L;  2K9A A;  3KFW X;  3H5T A;  4YJ2 E;  4L9I A;  4P0A A;  2CA5 A;  2N2N A;  4I8T A;  5FXV A;  1SHZ C;  4XZC A;  3ZMV B;  3BDN A;  4AXP A;  5KX5 E;  4UV8 B;  2PUA A;  5JDM A;  5JR9 C;  4BJM A;  4X4F A;  1NWM X;  5TAO A;  2AXV A;  3JXB C;  4MFR A;  3ZEF B;  3CVR A;  5LNK A;  3ESL A;  1LQC A;  3GMI A;  2ACX A;  3QC9 A;  2P9B A;  4EYY R;  3RH3 A;  3QK6 A;  1MND A;  4DND A;  5LGT B;  4UF0 B;  2RA1 A;  3PUS A;  4ADZ A;  2DCF A;  3ZN0 B;  1JH9 A;  2QGS A;  5H6R B;  4I6R A;  4X1I E;  4EYU A;  5F3J A;  4TUY E;  2Q9Q A;  4KUM B;  4O4L E;  2DHR A;  1D1C A;  4K0U A;  3ZCI A;  3ZYM A;  2CXF A;  1ZZ7 A;  3C4Z A;  5GON E;  2XAS B;  3V5S A;  1OSL A;  3CQX C;  2RP4 A;  1B0N A;  1X2L A;  2PUD A;  3ZLI A;  1WLX A;  2W62 A;  4GYR A;  3FBZ A;  3N2K E;  2L8K A;  5HXS A;  1SA0 E;  3FYM A;  2Q9Q D;  4OB4 A;  5FXW A;  4O8S A;  2PJQ A;  5CA1 E;  4CQI A;  3ZC1 A;  4OYJ A;  1HS7 A;  3PXP A;  2AWI A;  2OFY A;  3HKE E;  2W61 A;  4TZ4 C;  2IU7 A;  2XAH B;  1DWK A;  2D0T A;  3MKD A;  4UVB B;  4C90 A;  2WUS R;  1NER A;  2PUB A;  4DVD A;  5KMG P;  3L09 A;  2FJR A;  1EZ3 A;  3ZMZ B;  2IVG A;  1BR4 A;  3G5G A;  4YAR A;  2YEV C;  3QYX A;  2KT9 A;  2LSG A;  4PFP A;  4HKA A;  1SQ8 A;  3ANW A;  2NW8 A;  2EBY A;  2A6C A;  2WAU A;  4L0R A;  2GRM A;  4L5G A;  3NRX A;  3OP9 A;  4IHJ E;  2WWU A;  2MOZ A;  3PU8 A;  1PER L;  3MLF A;  2ZLY A;  3E08 A;  3LBX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...