3GN5B

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
130
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
total genus 38
structure length 130
sequence length 131
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5B02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5B01
1PERL 2IV1A 1R69A 4YARA 1RZSA 3IVPA 2IU7A 2WUSR 1JFTA 2O49A 4JCYA 1S7EA 4YG7B 1RZRD 4Z5CA 3DNVB 1IC8A 2AXUA 3S8QA 1XWRA 1RPEL 1QPZA 2IVQA 3TRBA 2CROA 2PUGA 2L8NA 4I6UA 2ICPA 2EBYA 1UXDA 2IUOA 2XSDC 2IVGA 3F6WA 4MCTA 1R63A 2AXZA 3OQMA 4PU4C 2BNMA 4F8DA 1PRVA 3HZIB 2JCGA 3SCGA 1WETA 2PUFA 2OFYA 2R1JL 1QP4A 3PXPA 2KZ8A 1WH6A 2PIJA 1LQCA 1L1MA 3LFPA 1QP7A 2GRMA 2LYRA 1B0NA 2R63A 2PUAA 1Y9QA 2PUDA 3OMTA 4X4DA 3CLCA 3FYAA 2KPJA 1OCTC 4GHJA 4Z59A 1LLIA 1PRUA 4Y42A 3BDNA 3FMYA 1EFAA 2BNOA 1E3OC 3L1PA 2MEZA 1ZAYA 2LYLA 3R1FA 1LCCA 2HINA 2B5AA 2FJRA 1O4XA 2LYKA 2MQKA 3BD1A 3BS3A 4PU7A 1GT0C 1LMB3 4IWRA 1ADRA 1ZZBA 4YG1A 4I6RA 3KJXA 4X4FA 2LYQA 4X4EA 2A6CA 2L49A 3H5TA 3KXAA 1AU7A 1JFSA 3ZKCA 1QQAA 3GA8A 1ZUGA 2JVLA 3JXCL 4PU8A 1OSLA 1BDIA 1ZZ8A 1PRAA 2PUCA 3HI2A 4X4HA 3SCFA 3GN5A 2GZUA 2KEIA 1VPWA 2PUEA 1RIOA 1ZZCA 3GN5B 4X4BA 1Y7YA 2LYPA 2EWTA 1NEQA 4PU3C 4X4IA 2AWIA 3JXDL 3UFDA 1JH9A 1LCDA 2BJCA 4Z5DA 2PE5A 1HF0A 2AW6A 3QF3A 1ZZ9A 3OP9A 3QWGA 1PNRA 1X2LA 2AUWA 4X4CA 2PUBA 2GRLA 4Z5HA 3KZ3A 4FN3A 2XIUA 1POUA 3SCHA 4FBIA 1CQTA 1WH8A 2XCJA 1UTXA 3ZHIA 1ZVVA 1WIZA 3MLFA 4X4GA 2LYSA 2BNNA 1ZPQA 3RZZA 2H8RA 1YSEA 2O4AA 3ZHMA 2HSGA 4YG4A 4YBAA 1RZRA 4IA8A 1NERA 4NDWA 1QP0A 3CECA 2IVBA 3CROL 1X57A 3U3WA 2WIUB 1CJGA 5K98B 4I8TA 1DWKA 3OQOA 4GQMA 1DW9A 3JXBC 3GBFA 3QQ6A 1ZS4A 3F51A 4IVZA 3G5GA 2LYJA 3OQNA 4MCXA 4JQDA 1ZZ7A 3O9XA 2KEJA 2ICTA 3EUSA 2KEKA 1BDHA 3LISA 3QYXA 4O8BA 2XJ3A 4J1XA 4JCXA 4I6TA 2OR1L 2XI8A 1UXCA 2CSFA 3G7DA 2O38A 2AXVA 3VK0A 2PPXA 5A7LA 2D5VA 3FYMA 4Z58A 1QQBA 3B7HA 4OB4A 1SQ8A 4J1WA 3F52A 1ZZ6A 3D1NI 1JWLA 2LCVA 2EF8A
chains in the Genus database with same CATH superfamily
3ZKRA 5ABHA 2WCAA 2IU7A 1JFTA 4IDZA 1YKHB 4UVAB 3UQ4A 1QZXA 2LJLA 2F4VT 2LLYA 3RHWA 4DUZT 2EBYA 3P4WA 2KT9A 3DM5A 3HZIB 2IC9A 1YW0A 1HCIA 2ZM2A 3LK42 4X66T 1FEWA 3PURA 3CLCA 4JLEA 1PRUA 4XAXB 3P7IA 1MIYA 4LF7T 3I9WA 5HWYA 1SHZC 3BK9A 3UUMA 1D0ZA 2LYKA 3PUAA 3ZLIA 3AEBA 3VKGA 4I6RA 4IDOA 3AA7B 4L5GA 4HTEA 1N34T 4HWDA 2KSRA 4DE9A 3SCFA 1OEDB 2JPFA 4H9SE 3RF1A 5FXWA 1VPWA 2AE9A 2JMKA 2CEAA 1HX8A 1VRBA 1FIOA 4DBQA 3AE9A 3VR8A 4Z5HA 4EV6A 4CN6A 4YSXA 3ZHIA 5F3JA 3RIUA 2XQ5A 2X0HA 4P0BA 3FBLA 1HX1B 3AEFA 3MZKB 4Q2JA 4UV9B 4IDQA 4HN9A 2A9UA 4PFPA 1LRZA 1WR0A 1ZOYA 2Y6XA 5LHGB 1W9RA 1WYBA 1SUMB 2CSFA 2PXKA 5L3GB 2HN2A 5JQGE 4EB6E 4JBWF 1PERL 3N5LA 3IVPA 1QB2A 4A97A 3ZYKA 4AQYT 4EZ4A 4EIWA 3UU3A 2NP9A 3ZCJA 3SFDA 3P4QA 4EKGA 1IAPA 4LFCT 2Y8DA 3OVUA 2VQET 2L8KA 4B3MT 1YKEB 2LYRA 5L3CB 4U31A 4ER0A 3ZYLA 2PXEA 2CXLA 2WZIA 5IYZE 4IREA 5AQHB 5DQWA 3PTRB 2MQKA 1GQEA 3IF8B 3TLVA 4IL4A 3EI0A 4GK0E 3KBUA 4JEUB 3NRXA 2B1EA 1S94A 3RPUA 3F57A 4OYJA 4ER5A 3HL6A 1NEQA 3VKHA 3FZHB 4L0RA 2AW6A 1PNRA 2LLWA 4AQGA 1HF8A 2J47A 4EGWA 4H9OC 4U74A 4ZZBA 3E22E 3L09A 2CXDA 2X9WA 3I9YA 4UV8B 4OHFA 3O1JA 2IVBA 2XQ8A 3U3WA 5GONE 3N9MA 2E8IA 5AQRB 1VCTA 3PUSA 2NW7A 4HWFA 3OKQA 4QH5A 4MCXA 4PNIA 2W2UA 3LFMA 4A98A 4J1XA 5CGMA 4QHOA 4JI6T 4JI3T 2PPXA 1N36T 4P1NA 4Z58A 4QXHB 5GAHi 5BMVE 3PUQA 3D1NI 3C4WA 3PE0A 2DWKA 1R69A 3A9ZA 2K3WA 2XAFB 3PUYF 4YXDA 4YHHT 5L4HA 4COFA 1LKXA 1HNWT 1OWAA 3HKCE 4I43B 5EZYE 2VQFT 2W00A 2R1JL 5JR9C 1WH6A 2K24A 3LQXA 3OWQA 2GRMA 2PUAA 1Y9QA 5KX5E 3TKLB 3TLTA 2NTXA 3BDNA 3JAEA 2BNOA 4YJ3E 5J2UE 3HA4A 2HINA 2CCQA 2UXNB 1LMB3 4ZZCA 2WDQA 4E7ZA 4F6RC 3ME5A 1HS7A 1IBLT 4OFZA 4UF0A 5C3JA 1OSLA 1ZZ8A 4H63V 5ABFA 4X1KE 4ZEYA 4UR9A 2CHOA 4PAGA 1IBMT 4X4IA 3TELA 1G8XA 5KMGP 3S4UA 2YU1A 3EDVA 2CPTA 1POUA 4ER6A 2J7WA 1HFAA 4IIJE 1ZVVA 2I6HA 5FXVA 3MLFA 2BNNA 2M67A 3X1DA 2IUBA 4U2YA 5J2TE 1J1JA 4LF5T 3Q2MA 2HCSA 3QNUA 3EUSA 2KEKA 1CHUA 2H88A 3VRBA 3Q5WA 4IDNA 1N32T 4FJOA 2CWOA 2B76A 5AQJB 2V7IA 2UUCT 3B7HA 2BVLA 2LSJA 3KVAA 4AKIA 2WDVA 5J1GA 2VKJA 2BZBA 3ZMSB 5LHIB 2XSAA 2CROA 1E7PA 4P09A 1UXDA 3PUXF 4ADZA 5CJ5A 2XAJB 3OQMA 3C98B 4X20E 2PXLA 3JAFA 1QP4A 3PXPA 4FI5A 2WMOA 4TN7B 3DTOA 4JI4T 3RLFF 4ZS3A 4PJMA 4Y42A 1T7SA 2XQ3A 2ES0A 4U2ZA 4HKAA 1DU2A 1US7B 4IWRA 3RYCE 4TV8E 2BKOA 2JJ9A 4J2CA 4TNVA 2VL8A 4KP3C 3PU8A 2XASB 2NWBA 3FZLB 4EAHA 1XWMA 2FUPA 3RC3A 5FL0A 3KDSE 2C5JA 3CIRA 3U3IA 2IIUA 3F2EA 3QF3A 3RYFE 2D9DA 2PUBA 2LE8A 4JI2T 3I0OA 3ABVA 3NZPA 1LVFA 5JDHA 2CBIA 1ZP0A 1KF6A 2O4AA 1YSEA 1Y64B 5HCJA 4NDWA 5FVLA 1UX5A 5DQVA 2XTLA 4MFRA 5L47A 4OYKA 2X9HA 3AE7A 4PK5A 1WYCA 2C5KT 2PFVA 2CXFA 1UXCA 2JRKA 2LNMA 4G2AA 4AISA 5AQIB 5JUWA 2I0MA 4LMLA 3V5UA 3ZPXA 4EKIA 4WVLA 1RZRD 4EEDA 2ZM6T 1I94T 2FFHA 1KFYA 3AEDA 4BJMA 1HR0T 1HG5A 2JQHA 3GZDC 1HNXT 5HWXA 3SCGA 2RP4A 5TAOA 1L0VA 2KZ8A 1ZV4X 3GZCA 3PE5A 3GUUA 4O4IE 3IEEA 2FJAA 4DV4T 4DE8A 1YXRA 3WAKA 5HEUA 1ADRA 2QA7A 5LJNA 1YQ3A 2DNXA 5GAGi 3GA8A 3KINB 4ZOLE 5AQPB 4I4TE 3SOLA 1NEKA 1R8IA 2MAWA 2WQYA 2EWTA 3CMLA 2BJCA 2IC6A 4U33A 4Z8XA 4ZI2D 4FN3A 4TUYE 4ER7A 1WH8A 1Z8UA 3H3MA 3RZZA 3RYIE 4PFOA 2YOEA 2MOZA 4GQMA 3AEAA 3OPCA 3H37A 4AXPA 2ICTA 4WYVA 3LISA 5LB7B 4B3ST 2XJ3A 1HNZT 3Q5XA 5HYAA 4Z90A 4HFDA 3LDQB 1NW3A 1E2AA 2VL0A 3CVRA 2J4GA 4OB4A 1SQ8A 3AAIA 3D0TA 1OEDC 2JQKA 4WBNE 3LK3B 2O49A 2YKSA 2V26A 3VWSA 1S7EA 2AXUA 2D2SA 2IVGA 2PG8A 4F8DA 1I6ZA 2JCGA 3MACA 4BAYB 2Q9QD 1L1MA 4LMJA 2D5UA 3J7Yq 3A7MA 2EHOC 4PJLA 2GK9A 4GHJA 3B5MA 3RI5A 3KVBA 4IT4A 2VURA 2LYLA 4YSZA 2WP9A 1QUUA 4JI8T 5M4YA 5CFBA 3RQUA 3A5XA 5AQFB 1UURA 5E0OA 2QYWA 3HI2A 3VRAA 2LSYA 1VCSA 3N9LA 2LYPA 2PE5A 4L9IA 1X2LA 1OEDA 5IWAT 5FXXA 4NXMT 4QXBB 3RGLA 4YG4A 4YBAA 2PJQA 5AQSB 4G63A 2XQ7A 1NWMX 3OQOA 2LRLA 1N33T 3QQ6A 4JI1T 2YK0A 3PJAJ 2ZM0A 3L3PA 2XI8A 5JDGA 2LSIA 5LGNB 1MIVA 2DCFA 4DMWA 3EVYA 3Q5DA 5CB4E 3AE1A 4HFCA 1QSDA 3N9NA 4Z5CA 2PXUA 2LM9A 2L8NA 3SRZA 4YHJA 4C90A 1WR6A 4TZ4C 2HH7A 5DTRA 2D0TA 2OFYA 4IE0A 4HEAA 3PUWF 2BG9A 4YTMA 4DV2T 4I55E 3ANWA 3PUZF 4UEMA 3PUGA 1O4XA 1ZKEA 2WB5A 5LG4A 3ZSTA 1BR1A 3N2GE 2UU9T 4YJ2E 1HTJF 4HWCA 4KUMB 2BS3A 4PU8A 2LKGA 3LSVA 4JUYA 3RC8A 3QUJA 3NZQA 3MJXA 2KXPB 4PU3C 3KBTA 1HF0A 3C50A 3C51A 2GRLA 3AE3A 4MALA 2Z6EA 4GIWA 3LG7A 5FY0A 4O4HE 3KV4A 3AAEB 4ZI2C 2ZLYA 1O3XA 5J0ZA 3UFEA 1DW9A 4CI2B 3R6NA 4JI7T 3O9XA 4LFBT 2LSKA 3O1IA 5L3FB 1JNRA 1KK7A 2VWAA 1HG2A 2ZMAA 2AXVA 5ABFB 4N78D 2X9YA 2WDRA 5CA1E 2V8SV 1XNQT 2BKPA 4ZS2A 3SWHA 2QGSA 4H63H 4B3TT 4Q25A 3S8QA 3LJCA 3AVSA 2CM0A 4JI0T 1R63A 1CUNA 3GMIA 4ZI3C 1SA0E 4YTNA 2Y48B 4LFAT 3OKZA 3AE2A 3RYHE 3SR4A 2LSGA 3GZDA 2XAHB 2PXTA 3CPZA 3HKBE 1OCTC 5LP6E 2ODRD 5H6QB 3L1PA 3R1FA 4CZZB 3I0QA 2XM2A 3BQIA 5AQOB 4MBQA 1GT0C 1ZZBA 3KJXA 2A72A 4NUUA 2V7JA 4NPPA 4TWFA 4DR2T 5DTMA 3ONXA 5F8PA 1WFDA 4YFSA 3NXHA 2DL1A 4GYRA 3C4ZA 2KMFA 2ODUA 4ZI3D 5AQTB 4IE4A 4AQFC 3QK6A 5LMUT 1AJ3A 3SCHA 4FBIA 5AQKB 2XCJA 2XXAA 3UTKA 4LF9T 1XMQT 3P8CD 1MMAA 4X65T 5EK4A 2W61A 1T72A 4ILAA 2PXDA 1QP0A 2MTQA 3CECA 4IDPA 2WIUB 5FMNA 2M6BA 3NWIA 5EK3A 3JXBC 2V1DB 4OK0A 4ISSA 3T1YT 2UXXB 1KNPA 5FL1A 3QYXA 4ISTA 2LKHA 4EXTA 3A9YA 2WU2A 3CQXC 2X0YA 3ANWB 2WY2A 5JDQA 4U7IA 3RIAA 2E9XB 2AXDS 3BQKA 4GKKT 3AXJB 2MPKA 2IW5B 5DT2A 5LMNT 3FZMB 4JYAT 4CQIA 3UULA 4PJJA 1IZNB 3ZJ2A 1U5PA 3I1AA 3MEJA 3IHRA 3CX8B 4WW0A 2J62A 5JDLA 4QWNB 3LFPA 4YY3T 2PUDA 3OMTA 4UXNB 5L2LA 3OYZA 4TWHA 4AIUA 4X62T 3ONLC 2MEZA 1MMNA 2B5AA 5FY1A 5KDMC 3CQCB 1D1CA 1W0AA 4YLHA 3AE6A 3RX6A 3A9XA 4HFHA 3SX0A 1BDIA 4F8HA 3ZCIA 1PRAA 2VB6A 2V7KA 5HEHA 3A8YC 4X4BA 5C8YE 3WAJA 3FZKB 5A1LA 4TX5A 1JH9A 4HE8A 3R09A 1LCDA 2BG9B 3PJAA 1JNZA 3QWGA 2AUWA 4X4CA 2IAKA 4X1IE 2EHOB 2H89A 4IGUA 5JDMA 2XQ6A 1J5ET 1UCUA 3C4XA 4DR3T 2UXDT 3G06A 4I0UA 2C5IT 2EHOA 4DUYT 3KV9A 2LHRA 3OTOT 5AFUL 2O38A 4XZCA 2KLQA 2IV1A 2NW9A 3UU4A 3CKDA 3DP7A 3O4XE 4O8SA 2PXQA 2PUGA 3TRBA 3J9X1 4I6UA 3UUBA 1SE7A 3F6WA 4MCTA 4B3RT 4Z91A 5AQLB 2VK9A 4ILBA 3EHZA 4XBFB 3R84B 4HWIB 3MXZA 3ZJ1A 1LQCA 3ZMUB 3FXDB 2W4XA 3B57A 2UXBT 4CN1A 1B0NA 4EEBA 4X4DA 5ABGA 3ZYMA 2W63A 2M6IA 2VASA 2BG9C 2RA1A 4C91A 4OBMA 2XZEA 3L39A 5AQUB 2BS2A 3BS3A 3TFLA 3ZT6A 3N9QA 4ASKA 3DJBA 2A6CA 3AA0B 1QQAA 3PDYA 3HKEE 3Q5EA 3AECA 4X4HA 2LEHA 2HHHT 4BA9A 4AKGA 2L3LA 2UXCT 2CLYB 2AWIA 3K3OA 4Z5DA 1BR0A 2CMRA 5ETWA 5LGUB 3B13A 5AQNB 3AE4A 4GYSA 2WM9A 3PV0F 4JI5T 3K3QC 1ZPQA 5HCMA 4HRAA 4X64T 1XNRT 3CQGB 1NERA 3TLSA 2YDSA 3FXEB 1KNZA 2K48A 3KL4A 1HQ1A 2ACZA 5HXSA 3JC6C 2V6YA 3G5GA 3ZMTB 4AKLA 3UU5A 5JREA 3VR9A 5AQQB 2FBWA 2XPKA 2SPCA 2IHR1 4ER3A 2IDOB 2Q9QB 3P4PA 1QQBA 3PUVF 2CRBA 4DNDA 2MBGA 4DV3T 2XQ4A 3P50A 1NAFA 3M3ZB 5LXTE 3CWZB 4YG7B 1QPZA 5HXEA 2P9BA 4QH1A 2JQ9A 4A5XA 1X79A 2CBJA 2YBDA 3T8OA 2JQEA 1QP7A 3HR0A 4HFIA 1M7KA 3QOWA 2W66A 3RH3A 1EZ3A 2V7LA 5DJQC 4DV5T 3M9LA 3UU8A 1EFAA 3N9OA 5KXJA 5JTGA 1W09A 3BD1A 4YG1A 3H5TA 3CK6A 4WZXA 1JFSA 4TWDA 5IUXA 1ZUGA 3JXCL 3ZN1B 4DV6T 5HEJA 4GOUA 2A3DA 3UQ7A 4AKHA 5BR8T 2XIUA 2V3CC 1S35A 4DV1T 4ZI7E 5LJMA 2XY8B 1W0BA 5HEOA 2R6GF 4IA8A 2NW8A 3UU6A 4PK6A 5LA6E 2LOPA 2VKHA 1DWKA 4JQDA 1ZZ7A 1WRDA 1BDHA 4JCXA 4IHJE 3VK0A 3U78A 2D5VA 2WU5A 5CA0E 4J1WA 1ZZ6A 1IJ6A 2E5VA 3QB5K 3QOXA 4LF4T 4CXYA 2X67A 5AQGB 2G0UA 5LHHB 1RPEL 5IHYA 4U3CA 5DSXA 3AEEA 4QXCB 3ZMVB 2HFZA 2CHNA 1H7CA 4QX8B 3AA1B 2VVSA 5JH7E 4UELA 4AQFA 3AE5A 2HPJA 3JCFA 4AKRB 1KNRA 4NIQA 2FJBA 2J7UA 5H6RB 2WS3A 3HKDE 1LCCA 2PXBA 1WLXA 3RRCA 4EQZA 2OV9A 2V5CA 4M1PA 3QC9A 4MLKA 3UUNA 4QH4A 3PU3A 4GK5E 2CE7A 1AU7A 2V6YB 5EK2A 2VEOA 1RIOA 1Y7YA 3OYXA 4EZHA 5DTQA 1OEDE 4KHZF 4O4LE 4X5TA 4UF0B 4K0KT 5JDFA 2XM1A 5HAXA 3ZN0B 2PXFA 2W0GA 4K0UA 2NOXA 1UTXA 4X4GA 5FP3A 3TLUA 2H8RA 3AB3B 2HSGA 2N2NA 2MXDA 4U7YA 5K98B 2BBJA 2YDQA 3ETVA 3MK7C 3N2OA 2DI4A 2XXPA 1ZS4A 3OQNA 2X66A 5LYJE 3KFWX 2BS4A 3F31A 2PXPA 3K8PC 4I6TA 4DBRA 5L3EB 3G7DA 4A56A 1X9BA 3JADA 4EK9A 3UFGA 1ZEEA 3P4SA 4ILUA 4EYUA 2ZM8A 4TV9E 4CI3B 5LOVE 2LCVA 4HGAA 4YARA 2WUSR 4H9NC 3BQLA 3ZT7A 4O2AE 3ESLA 2YDRA 4H9QC 1BR4A 2LRKA 2BDEA 2AXZA 4PU4C 2PBIA 1PRVA 2XAGB 3K1SA 5LBQB 1D1BA 3IBPA 3NRYA 2XQAA 2R63A 2BKNA 4PK4A 3NKZA 1XZYA 2KWIB 3FBZA 2K5BB 2V7MA 4DR1T 5L4EA 3V5SA 1Y01A 2CLYC 2X68A 3OJAA 4X1YE 2QVAA 3T1HT 4HWHA 3ZKCA 5HXCA 2DWGA 3RKOA 4H9PC 5FNVE 2GZUA 2V6XA 3GN5B 3QFIA 4UVCB 1FMWA 3QB5A 2PTFA 4OX9T 3CX6B 4KX6A 1MMDA 2L1PA 5FVKA 4LF8T 1MIWA 4AI6A 2X51A 3AVRA 2IMLA 3ZHMA 1RZRA 2YINA 5DRTA 1FJGT 5DABA 2RPAA 1D1AA 3ZMZB 5ABEA 2XAQB 3G0TA 4LF6T 3JC6D 2X0LB 4WBOA 3ZT5A 5FY7A 3LBXA 2XHEB 4PJNA 2D0UA 4KMCA 2OR1L 2EF8A 3VHLA 2XJ7A 2H7VC 2WZHA 3KV5A 3ONJA 4JCYA 3M65A 3DNVB 3IA3A 5F5WA 2XSDC 1ZHCA 1UUSA 5ADXL 1D0YA 2BNMA 5HEGA 3RQWA 2JMHA 1WETA 2PUFA 2YN6A 2YU2A 1UX4A 4WNKA 3EDUA 2WAUA 3ZEFB 3FYAA 4Z59A 4BJNA 3MKDA 2NR4A 3FB2A 1XMOT 4EYYR 1IBKT 4U72A 3P4RA 5DRYA 4YTPA 1MFQC 3KV6A 4KBMB 5JDNA 3EAMA 3ZC1A 3OBVE 1YQ4A 2JVLA 4TNWA 3EABA 2Q9QC 4IE5A 4DR6T 1WCRA 3ZSSA 3NVOA 2V5DA 1NENA 4UVBB 5HXRA 5FKYA 2W62A 2DHRA 1CQTA 1V9DA 3UUXB 2L9QA 1WIZA 4ZHQE 4O2BE 5JR9A 2K9AA 2XQ9A 4I50E 3WI3A 1MNDA 2E9XD 3GBFA 2WMNA 3SFEA 1DULA 2LLVA 4YT0A 2LYJA 1UK5A 3MA9A 3K3NA 2KEJA 1XDOA 1G73A 2WBLA 2X9XA 3FHNA 4ZXLA 1E1HB 2E9XC 2HPLA 4NXNT 4DR4T 2A2FX 3N9PA 4DV7T 2N1GA 3AAAB 1JWLA 4HFVA 1XDPA 3CX7B 2Q9QA 3RRWA 4CN4A 4KHPT 4MHCA 4JEHB 2IVQA 2N9DA 2ICPA 1IJ5A 2LM2A 5LCYA 3RIUC 4DIDB 1MMGA 2KWHA 1J5WA 5JR9B 3TLWA 2E2AA 2KZ7B 3ETUA 2PIJA 2KNDA 2WWUA 2YEVC 3FZFB 4QX7B 3NZLA 1LLIA 2KINB 3NBXX 1T8BA 5AQMB 1E3OC 4QKNA 4O4JE 1UGOA 4PU7A 4HFEA 2BVMA 2LHNA 3AEGA 2HCNA 3GWHA 4X4EA 1B7TA 3N2KE 4NUVA 2DLRA 3C64A 3KXAA 2EHOD 2VVNA 2NTYA 2PUCA 2H7OA 4HFBA 1U2ZA 3GN5A 3QOFA 2PUEA 1ZZCA 4H9RC 3RKGA 3JXDL 3UFDA 3O1HA 2CWYA 3NROA 1BR2A 5LG3A 3KZ3A 5LBMA 1QLBA 5JVDE 2FJDA 5L3BB 2LYSA 4ANJA 4CXXA 3UWPA 2ODVA 2OA5A 3CROL 2FJEA 1X57A 1CJGA 5L3DB 3F51A 1YD8G 4EZIA 2XXQA 3ZPOA 3VU7H 4EOZB 1FMVA 5JRCB 2E9XA 4O8BA 2E5LT 4DR5T 2VKOA 5A7LA 4DMVA 1U4QA 2HN1A 3F52A 2C0SA 4B6XA 2PXVA 3AA6B 1RZSA 3ZC0A 2QRXA 4CI1B 3W15B 2H3RA 1IC8A 2XUEA 1XWRA 2IUOA 3E08A 2LOSA 2MYSA 3H3AA 3Q9DA 1KEYA 2BBHA 2WSSV 2XSBA 4DVDA 4DO0A 5LGTB 2I59A 3NDBB 2KPJA 3LBXB 3AXJA 2OLTA 3FMYA 3L8RA 4ILCA 1M62A 2W67A 4PW8A 1ZAYA 1MNEA 2ACXA 3LK2B 4DV0T 2FJRA 3AE8A 1Z0PA 4X4FA 2LYQA 4V1Av 2L49A 2J1DG 3E0ZA 4IL9A 2KEIA 4ERRA 4IE6A 1ZZ9A 3OP9A 3SS1A 5AQVB 1VOMA 2VKDA 3UT5E 5FXZA 5JRCA 4IE7A 3TEPA 4CXWA 2M4HA 1T98A 2CA5A 1LVKA 1OXZA 5LNKA 4I8TA 2XQYA 4KI0F 4UIGA 2UUBT 4IVZA 5C2TA 4DR7T 3EUHA 4JV5T 4GKJT 3RIFA 5FYMA 4LMKA 4YSYA 2JIWA 2JQQA 2LT3A 3FYMA 1D0XA 5HXHA 4P0AA 2UUAT 2WWVA 4E7SA 2BG9E
chains in the Genus database with same CATH topology
4HGAA 4YARA 2IW5B 2IU7A 2WUSR 1JFTA 4IDZA 4H9NC 1RZRD 1YKHB 3BQLA 4UVAB 2LJLA 4CQIA 4O2AE 3ESLA 3UULA 4PJJA 4H9QC 1BR4A 2EBYA 2BDEA 4BJMA 1IZNB 2KT9A 2AXZA 3ZJ2A 1U5PA 4PU4C 2PBIA 3I1AA 1PRVA 1HG5A 3IHRA 5HWXA 3HZIB 2IC9A 3SCGA 1YW0A 2RP4A 5TAOA 2XAGB 1HCIA 2ZM2A 3LK42 5LBQB 2KZ8A 1D1BA 3CX8B 3IBPA 4WW0A 3NRYA 5JDLA 4QWNB 3LFPA 1ZV4X 2R63A 2PUDA 3OMTA 1FEWA 4PK4A 4UXNB 3PURA 3CLCA 5L2LA 4JLEA 2KWIB 3OYZA 1PRUA 3FBZA 4XAXB 3P7IA 1MIYA 4O4IE 2K5BB 2V7MA 3IEEA 3I9WA 5HWYA 2MEZA 1SHZC 3BK9A 1MMNA 3UUMA 3V5SA 3WAKA 2B5AA 1D0ZA 5FY1A 2CLYC 2X68A 2LYKA 3OJAA 1ADRA 3PUAA 3ZLIA 4X1YE 3CQCB 5KDMC 1D1CA 2QA7A 5LJNA 4I6RA 3VKGA 2DNXA 4YLHA 3AA7B 4L5GA 3RX6A 4HTEA 3ZKCA 3GA8A 3KINB 5HXCA 1BDIA 4ZOLE 4I4TE 2DWGA 3ZCIA 1PRAA 3RKOA 2VB6A 3SCFA 2JPFA 4H9SE 3SOLA 4H9PC 2V7KA 2GZUA 5FNVE 5FXWA 1VPWA 3GN5B 4X4BA 4UVCB 1FMWA 2JMKA 2CEAA 5C8YE 5A1LA 2EWTA 1HX8A 1JH9A 3CMLA 4HE8A 4TX5A 1LCDA 1VRBA 2BJCA 1FIOA 2IC6A 4DBQA 3CX6B 3QWGA 4Z8XA 4ZI2D 2AUWA 4X4CA 4Z5HA 1MMDA 4FN3A 2IAKA 4TUYE 4X1IE 1MIWA 1WH8A 2EHOB 4AI6A 4IGUA 3ZHIA 5F3JA 5JDMA 2X51A 3RZZA 3AVRA 1UCUA 3ZHMA 3C4XA 3RYIE 1RZRA 4PFOA 2YINA 4P0BA 3FBLA 3MZKB 2C5IT 2EHOA 4UV9B 2MOZA 4GQMA 5DABA 4HN9A 3H37A 4PFPA 1D1AA 2LHRA 3KV9A 3ZMZB 1LRZA 4AXPA 2ICTA 2XAQB 2Y6XA 3LISA 5LHGB 1WYBA 2XJ3A 3JC6D 2X0LB 3Q5XA 4WBOA 2CSFA 5AFUL 5HYAA 2O38A 5FY7A 3LBXA 5L3GB 5JQGE 4XZCA 4EB6E 2KLQA 3CVRA 2XHEB 4PJNA 4OB4A 2D0UA 1SQ8A 4KMCA 3AAIA 3D0TA 4WBNE 3LK3B 2OR1L 2EF8A 1PERL 3VHLA 2IV1A 2O49A 2H7VC 3N5LA 3IVPA 2V26A 3KV5A 2NW9A 4JCYA 1S7EA 3CKDA 3M65A 3DP7A 3DNVB 3O4XE 4O8SA 3ZYKA 2AXUA 2PUGA 3TRBA 3J9X1 2D2SA 4I6UA 4EZ4A 2XSDC 1ZHCA 4EIWA 2IVGA 2NP9A 3F6WA 4MCTA 3ZCJA 5ADXL 2PG8A 1D0YA 2VK9A 2BNMA 4F8DA 2JCGA 2JMHA 1WETA 2PUFA 3MACA 1IAPA 2YU2A 1UX4A 4WNKA 3R84B 4BAYB 3EDUA 2Q9QD 1L1MA 3MXZA 3ZJ1A 1LQCA 2Y8DA 3ZMUB 2L8KA 2WAUA 3FXDB 3ZEFB 2D5UA 1YKEB 3B57A 2LYRA 1B0NA 3J7Yq 4X4DA 2EHOC 3FYAA 4PJLA 5L3CB 2GK9A 3ZYMA 2W63A 4GHJA 4Z59A 2VASA 4BJNA 3MKDA 5LHIB 2RA1A 3KVBA 3ZYLA 4C91A 2CXLA 2LYLA 3FB2A 5IYZE 4EYYR 5DQWA 3PTRB 1QUUA 4U72A 2MQKA 3BS3A 5M4YA 3KV6A 3N9QA 3IF8B 3A5XA 4KBMB 5JDNA 4ASKA 3DJBA 3ZC1A 2A6CA 3AA0B 4GK0E 3KBUA 3OBVE 4JEUB 3NRXA 2B1EA 1QQAA 5E0OA 3PDYA 3HKEE 2JVLA 1S94A 3RPUA 3HI2A 4X4HA 2LEHA 3F57A 4OYJA 2Q9QC 4IE5A 2LSYA 4BA9A 3N9LA 4AKGA 2L3LA 2LYPA 2CLYB 3HL6A 1NEQA 3VKHA 2AWIA 3K3OA 4Z5DA 2PE5A 4L0RA 2AW6A 4UVBB 1BR0A 1PNRA 2CMRA 5HXRA 4AQGA 4L9IA 1X2LA 2W62A 5ETWA 1HF8A 5LGUB 3B13A 4H9OC 2DHRA 4GYSA 4U74A 1CQTA 2WM9A 1V9DA 3UUXB 3E22E 2L9QA 1WIZA 3L09A 2CXDA 4QXBB 4O2BE 5FXXA 2X9WA 3I9YA 2K9AA 3K3QC 1ZPQA 4I50E 5JR9A 4YG4A 4YBAA 4UV8B 4OHFA 2PJQA 3CQGB 1NERA 4G63A 3O1JA 3FXEB 2IVBA 3WI3A 1KNZA 1MNDA 3U3WA 2K48A 2E9XD 5GONE 3N9MA 2E8IA 1NWMX 3OQOA 3PUSA 5HXSA 3GBFA 3QQ6A 2NW7A 2WMNA 3JC6C 3G5GA 2LYJA 3MA9A 3OKQA 4MCXA 2YK0A 3ZMTB 4AKLA 3K3NA 2KEJA 5JREA 4PNIA 2ZM0A 1G73A 2WBLA 2X9XA 3L3PA 3LFMA 4J1XA 2SPCA 2XI8A 5JDGA 3FHNA 2Q9QB 2LSIA 5LGNB 1E1HB 2E9XC 2HPLA 1MIVA 4QHOA 2PPXA 4Z58A 4QXHB 1QQBA 3WAJA 2DCFA 4DMWA 2A2FX 3N9PA 4DNDA 2MBGA 5BMVE 1NAFA 3EVYA 3PUQA 3D1NI 2N1GA 3AAAB 1JWLA 3C4WA 3PE0A 4HFVA 2DWKA 3CX7B 2Q9QA 5CB4E 1R69A 3RRWA 5LXTE 1QSDA 3CWZB 3N9NA 4YG7B 2XAFB 4Z5CA 2LM9A 4MHCA 1QPZA 4JEHB 2IVQA 5HXEA 2L8NA 2P9BA 3SRZA 2N9DA 2ICPA 1IJ5A 1LKXA 5LCYA 4YHJA 4C90A 1WR6A 1OWAA 3HKCE 1MMGA 4TZ4C 2HH7A 2KWHA 4I43B 5EZYE 1X79A 2D0TA 2W00A 5JR9B 2OFYA 2R1JL 2KZ7B 3ETUA 4IE0A 3T8OA 5JR9C 1WH6A 2PIJA 2KNDA 2K24A 2WWUA 4HEAA 1QP7A 2GRMA 2YEVC 3HR0A 2PUAA 1Y9QA 5KX5E 3TKLB 4QX7B 2NTXA 3RH3A 1EZ3A 2V7LA 5DJQC 1LLIA 5FP3A 3BDNA 2KINB 4I55E 3ANWA 1EFAA 3N9OA 2BNOA 3NBXX 4YJ3E 1E3OC 5J2UE 4QKNA 4UEMA 4O4JE 3HA4A 2HINA 3PUGA 2CCQA 2UXNB 1O4XA 3BD1A 4PU7A 1LMB3 2BVMA 2LHNA 3GWHA 1ZKEA 4E7ZA 5LG4A 4YG1A 1BR1A 3N2GE 4X4EA 1B7TA 3N2KE 4F6RC 4NUVA 2DLRA 3H5TA 3C64A 3KXAA 2EHOD 4YJ2E 1HTJF 1JFSA 4KUMB 1HS7A 4OFZA 4UF0A 1ZUGA 3JXCL 4PU8A 1OSLA 2NTYA 3ZN1B 1ZZ8A 2PUCA 2H7OA 4H63V 4JUYA 3RC8A 4X1KE 3GN5A 3QUJA 2PUEA 3NZQA 1ZZCA 4H9RC 4PAGA 3MJXA 2KXPB 4PU3C 3JXDL 4X4IA 3KBTA 3UFDA 1G8XA 4GOUA 3O1HA 1HF0A 2CWYA 5KMGP 1BR2A 2A3DA 3C50A 3S4UA 4AKHA 2YU1A 3C51A 2GRLA 3KZ3A 3EDVA 2XIUA 2Z6EA 1POUA 4GIWA 4MALA 5LBMA 1HFAA 1S35A 5JVDE 3LG7A 4IIJE 4ZI7E 1ZVVA 5L3BB 5FXVA 5FY0A 3MLFA 4O4HE 5LJMA 2LYSA 2BNNA 4ANJA 3KV4A 2M67A 3AAEB 4IA8A 2NW8A 4CXXA 4ZI2C 2ZLYA 2ODVA 1O3XA 4ZHQE 5J2TE 4PK6A 2OA5A 3CROL 2LOPA 5LA6E 1X57A 1CJGA 3Q2MA 2VKHA 1DWKA 3UFEA 5L3DB 1DW9A 4CI2B 3F51A 1YD8G 3R6NA 4JQDA 1ZZ7A 3ZPOA 3O9XA 3VU7H 4EOZB 1WRDA 3EUSA 2KEKA 1BDHA 2LSKA 3O1IA 1FMVA 5JRCB 2E9XA 4O8BA 4JCXA 5L3FB 4IHJE 1KK7A 2VWAA 1HG2A 3VK0A 2ZMAA 2AXVA 3Q5WA 4FJOA 2CWOA 2VKOA 3U78A 5A7LA 2V7IA 2D5VA 4N78D 4DMVA 2X9YA 3B7HA 1U4QA 5CA0E 4J1WA 3F52A 2BVLA 1ZZ6A 2C0SA 1IJ6A 4B6XA 5CA1E 2LSJA 3AA6B 4ZS2A 3KVAA 4AKIA 1RZSA 2QGSA 3SWHA 4CXYA 5J1GA 2VKJA 2BZBA 3ZMSB 3ZC0A 4CI1B 3W15B 2H3RA 2X67A 1IC8A 2G0UA 2XUEA 4H63H 3S8QA 1RPEL 1XWRA 5IHYA 5LHHB 4XBFB 2CROA 4P09A 3LJCA 1UXDA 2IUOA 3AVSA 2CM0A 4ADZA 3E08A 2LOSA 2MYSA 2XAJB 1R63A 1CUNA 3GMIA 4QXCB 1SA0E 3H3AA 3OQMA 2Y48B 3C98B 3Q9DA 1H7CA 4X20E 4ZI3C 3ZMVB 4QX8B 4DVDA 2WSSV 1QP4A 3AA1B 3PXPA 4FI5A 5JH7E 4DO0A 4UELA 2WMOA 4AQFA 5LGTB 2HPJA 3RYHE 4TN7B 2LSGA 4AKRB 3DTOA 2I59A 2XAHB 4ZS3A 2KPJA 3CPZA 3LBXB 3HKBE 1OCTC 4PJMA 5LP6E 4Y42A 3FMYA 5H6RB 4PW8A 5H6QB 3L1PA 2ES0A 1ZAYA 1MNEA 2ACXA 3LK2B 3HKDE 4HKAA 3R1FA 1LCCA 1WLXA 3RRCA 3I0QA 4CZZB 3BQIA 2FJRA 1US7B 4M1PA 4IWRA 1GT0C 3QC9A 4MBQA 3RYCE 4TV8E 4MLKA 1Z0PA 3UUNA 1ZZBA 3KJXA 4X4FA 2A72A 2LYQA 4NUUA 2JJ9A 2V7JA 4J2CA 2L49A 4V1Av 3PU3A 4GK5E 2CE7A 2VL8A 1AU7A 5EK2A 4KP3C 3ONXA 2J1DG 3PU8A 2XASB 3E0ZA 2NWBA 5F8PA 4YFSA 2KEIA 4EAHA 4GYRA 1RIOA 3RC3A 3KDSE 1Y7YA 2C5JA 3C4ZA 2KMFA 3U3IA 3OYXA 4ERRA 4EZHA 4IE6A 2ODUA 4O4LE 4ZI3D 4UF0B 3F2EA 4IE4A 3QK6A 4AQFC 3QF3A 1ZZ9A 3OP9A 3RYFE 1AJ3A 3SS1A 5JDFA 2PUBA 2LE8A 5HAXA 3I0OA 1VOMA 3ZN0B 2VKDA 3NZPA 2W0GA 1LVFA 3UT5E 3SCHA 4K0UA 5JDHA 4FBIA 2NOXA 2XCJA 3UTKA 5FXZA 1UTXA 5JRCA 4IE7A 3P8CD 4CXWA 4X4GA 1T98A 1MMAA 2H8RA 2O4AA 3AB3B 1YSEA 1Y64B 5EK4A 2HSGA 2W61A 2N2NA 2CA5A 4NDWA 1QP0A 1LVKA 2MTQA 3CECA 1OXZA 1UX5A 5DQVA 2XTLA 4MFRA 5LNKA 2WIUB 5K98B 4I8TA 3ETVA 3MK7C 4OYKA 2X9HA 5FMNA 3N2OA 5EK3A 2DI4A 3JXBC 2V1DB 2XQYA 4OK0A 4PK5A 1ZS4A 4UIGA 4IVZA 1WYCA 3OQNA 2C5KT 2X66A 4ISSA 2UXXB 3EUHA 5LYJE 3KFWX 2PFVA 3F31A 3K8PC 3QYXA 4ISTA 2CXFA 4I6TA 5FYMA 4DBRA 5L3EB 1UXCA 3G7DA 4EXTA 2JRKA 4A56A 2JQQA 2LT3A 3CQXC 3ANWB 1ZEEA 3FYMA 4ILUA 5JDQA 5HXHA 4G2AA 4EYUA 4P0AA 2ZM8A 4TV9E 4CI3B 5LOVE 2E9XB 1D0XA 4E7SA 3V5UA 2LCVA 3BQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PER L;  2IV1 A;  1R69 A;  4YAR A;  1RZS A;  3IVP A;  2IU7 A;  2WUS R;  1JFT A;  2O49 A;  4JCY A;  1S7E A;  4YG7 B;  1RZR D;  4Z5C A;  3DNV B;  1IC8 A;  2AXU A;  3S8Q A;  1XWR A;  1RPE L;  1QPZ A;  2IVQ A;  3TRB A;  2CRO A;  2PUG A;  2L8N A;  4I6U A;  2ICP A;  2EBY A;  1UXD A;  2IUO A;  2XSD C;  2IVG A;  3F6W A;  4MCT A;  1R63 A;  2AXZ A;  3OQM A;  4PU4 C;  2BNM A;  4F8D A;  1PRV A;  3HZI B;  2JCG A;  3SCG A;  1WET A;  2PUF A;  2OFY A;  2R1J L;  1QP4 A;  3PXP A;  2KZ8 A;  1WH6 A;  2PIJ A;  1LQC A;  1L1M A;  3LFP A;  1QP7 A;  2GRM A;  2LYR A;  1B0N A;  2R63 A;  2PUA A;  1Y9Q A;  2PUD A;  3OMT A;  4X4D A;  3CLC A;  3FYA A;  2KPJ A;  1OCT C;  4GHJ A;  4Z59 A;  1LLI A;  1PRU A;  4Y42 A;  3BDN A;  3FMY A;  1EFA A;  2BNO A;  1E3O C;  3L1P A;  2MEZ A;  1ZAY A;  2LYL A;  3R1F A;  1LCC A;  2HIN A;  2B5A A;  2FJR A;  1O4X A;  2LYK A;  2MQK A;  3BD1 A;  3BS3 A;  4PU7 A;  1GT0 C;  1LMB 3;  4IWR A;  1ADR A;  1ZZB A;  4YG1 A;  4I6R A;  3KJX A;  4X4F A;  2LYQ A;  4X4E A;  2A6C A;  2L49 A;  3H5T A;  3KXA A;  1AU7 A;  1JFS A;  3ZKC A;  1QQA A;  3GA8 A;  1ZUG A;  2JVL A;  3JXC L;  4PU8 A;  1OSL A;  1BDI A;  1ZZ8 A;  1PRA A;  2PUC A;  3HI2 A;  4X4H A;  3SCF A;  3GN5 A;  2GZU A;  2KEI A;  1VPW A;  2PUE A;  1RIO A;  1ZZC A;  3GN5 B;  4X4B A;  1Y7Y A;  2LYP A;  2EWT A;  1NEQ A;  4PU3 C;  4X4I A;  2AWI A;  3JXD L;  3UFD A;  1JH9 A;  1LCD A;  2BJC A;  4Z5D A;  2PE5 A;  1HF0 A;  2AW6 A;  3QF3 A;  1ZZ9 A;  3OP9 A;  3QWG A;  1PNR A;  1X2L A;  2AUW A;  4X4C A;  2PUB A;  2GRL A;  4Z5H A;  3KZ3 A;  4FN3 A;  2XIU A;  1POU A;  3SCH A;  4FBI A;  1CQT A;  1WH8 A;  2XCJ A;  1UTX A;  3ZHI A;  1ZVV A;  1WIZ A;  3MLF A;  4X4G A;  2LYS A;  2BNN A;  1ZPQ A;  3RZZ A;  2H8R A;  1YSE A;  2O4A A;  3ZHM A;  2HSG A;  4YG4 A;  4YBA A;  1RZR A;  4IA8 A;  1NER A;  4NDW A;  1QP0 A;  3CEC A;  2IVB A;  3CRO L;  1X57 A;  3U3W A;  2WIU B;  1CJG A;  5K98 B;  4I8T A;  1DWK A;  3OQO A;  4GQM A;  1DW9 A;  3JXB C;  3GBF A;  3QQ6 A;  1ZS4 A;  3F51 A;  4IVZ A;  3G5G A;  2LYJ A;  3OQN A;  4MCX A;  4JQD A;  1ZZ7 A;  3O9X A;  2KEJ A;  2ICT A;  3EUS A;  2KEK A;  1BDH A;  3LIS A;  3QYX A;  4O8B A;  2XJ3 A;  4J1X A;  4JCX A;  4I6T A;  2OR1 L;  2XI8 A;  1UXC A;  2CSF A;  3G7D A;  2O38 A;  2AXV A;  3VK0 A;  2PPX A;  5A7L A;  2D5V A;  3FYM A;  4Z58 A;  1QQB A;  3B7H A;  4OB4 A;  1SQ8 A;  4J1W A;  3F52 A;  1ZZ6 A;  3D1N I;  1JWL A;  2LCV A;  2EF8 A; 
#chains in the Genus database with same CATH topology
 3ZKR A;  5ABH A;  2WCA A;  2IU7 A;  1JFT A;  4IDZ A;  1YKH B;  4UVA B;  3UQ4 A;  1QZX A;  2LJL A;  2F4V T;  2LLY A;  3RHW A;  4DUZ T;  2EBY A;  3P4W A;  2KT9 A;  3DM5 A;  3HZI B;  2IC9 A;  1YW0 A;  1HCI A;  2ZM2 A;  3LK4 2;  4X66 T;  1FEW A;  3PUR A;  3CLC A;  4JLE A;  1PRU A;  4XAX B;  3P7I A;  1MIY A;  4LF7 T;  3I9W A;  5HWY A;  1SHZ C;  3BK9 A;  3UUM A;  1D0Z A;  2LYK A;  3PUA A;  3ZLI A;  3AEB A;  3VKG A;  4I6R A;  4IDO A;  3AA7 B;  4L5G A;  4HTE A;  1N34 T;  4HWD A;  2KSR A;  4DE9 A;  3SCF A;  1OED B;  2JPF A;  4H9S E;  3RF1 A;  5FXW A;  1VPW A;  2AE9 A;  2JMK A;  2CEA A;  1HX8 A;  1VRB A;  1FIO A;  4DBQ A;  3AE9 A;  3VR8 A;  4Z5H A;  4EV6 A;  4CN6 A;  4YSX A;  3ZHI A;  5F3J A;  3RIU A;  2XQ5 A;  2X0H A;  4P0B A;  3FBL A;  1HX1 B;  3AEF A;  3MZK B;  4Q2J A;  4UV9 B;  4IDQ A;  4HN9 A;  2A9U A;  4PFP A;  1LRZ A;  1WR0 A;  1ZOY A;  2Y6X A;  5LHG B;  1W9R A;  1WYB A;  1SUM B;  2CSF A;  2PXK A;  5L3G B;  2HN2 A;  5JQG E;  4EB6 E;  4JBW F;  1PER L;  3N5L A;  3IVP A;  1QB2 A;  4A97 A;  3ZYK A;  4AQY T;  4EZ4 A;  4EIW A;  3UU3 A;  2NP9 A;  3ZCJ A;  3SFD A;  3P4Q A;  4EKG A;  1IAP A;  4LFC T;  2Y8D A;  3OVU A;  2VQE T;  2L8K A;  4B3M T;  1YKE B;  2LYR A;  5L3C B;  4U31 A;  4ER0 A;  3ZYL A;  2PXE A;  2CXL A;  2WZI A;  5IYZ E;  4IRE A;  5AQH B;  5DQW A;  3PTR B;  2MQK A;  1GQE A;  3IF8 B;  3TLV A;  4IL4 A;  3EI0 A;  4GK0 E;  3KBU A;  4JEU B;  3NRX A;  2B1E A;  1S94 A;  3RPU A;  3F57 A;  4OYJ A;  4ER5 A;  3HL6 A;  1NEQ A;  3VKH A;  3FZH B;  4L0R A;  2AW6 A;  1PNR A;  2LLW A;  4AQG A;  1HF8 A;  2J47 A;  4EGW A;  4H9O C;  4U74 A;  4ZZB A;  3E22 E;  3L09 A;  2CXD A;  2X9W A;  3I9Y A;  4UV8 B;  4OHF A;  3O1J A;  2IVB A;  2XQ8 A;  3U3W A;  5GON E;  3N9M A;  2E8I A;  5AQR B;  1VCT A;  3PUS A;  2NW7 A;  4HWF A;  3OKQ A;  4QH5 A;  4MCX A;  4PNI A;  2W2U A;  3LFM A;  4A98 A;  4J1X A;  5CGM A;  4QHO A;  4JI6 T;  4JI3 T;  2PPX A;  1N36 T;  4P1N A;  4Z58 A;  4QXH B;  5GAH i;  5BMV E;  3PUQ A;  3D1N I;  3C4W A;  3PE0 A;  2DWK A;  1R69 A;  3A9Z A;  2K3W A;  2XAF B;  3PUY F;  4YXD A;  4YHH T;  5L4H A;  4COF A;  1LKX A;  1HNW T;  1OWA A;  3HKC E;  4I43 B;  5EZY E;  2VQF T;  2W00 A;  2R1J L;  5JR9 C;  1WH6 A;  2K24 A;  3LQX A;  3OWQ A;  2GRM A;  2PUA A;  1Y9Q A;  5KX5 E;  3TKL B;  3TLT A;  2NTX A;  3BDN A;  3JAE A;  2BNO A;  4YJ3 E;  5J2U E;  3HA4 A;  2HIN A;  2CCQ A;  2UXN B;  1LMB 3;  4ZZC A;  2WDQ A;  4E7Z A;  4F6R C;  3ME5 A;  1HS7 A;  1IBL T;  4OFZ A;  4UF0 A;  5C3J A;  1OSL A;  1ZZ8 A;  4H63 V;  5ABF A;  4X1K E;  4ZEY A;  4UR9 A;  2CHO A;  4PAG A;  1IBM T;  4X4I A;  3TEL A;  1G8X A;  5KMG P;  3S4U A;  2YU1 A;  3EDV A;  2CPT A;  1POU A;  4ER6 A;  2J7W A;  1HFA A;  4IIJ E;  1ZVV A;  2I6H A;  5FXV A;  3MLF A;  2BNN A;  2M67 A;  3X1D A;  2IUB A;  4U2Y A;  5J2T E;  1J1J A;  4LF5 T;  3Q2M A;  2HCS A;  3QNU A;  3EUS A;  2KEK A;  1CHU A;  2H88 A;  3VRB A;  3Q5W A;  4IDN A;  1N32 T;  4FJO A;  2CWO A;  2B76 A;  5AQJ B;  2V7I A;  2UUC T;  3B7H A;  2BVL A;  2LSJ A;  3KVA A;  4AKI A;  2WDV A;  5J1G A;  2VKJ A;  2BZB A;  3ZMS B;  5LHI B;  2XSA A;  2CRO A;  1E7P A;  4P09 A;  1UXD A;  3PUX F;  4ADZ A;  5CJ5 A;  2XAJ B;  3OQM A;  3C98 B;  4X20 E;  2PXL A;  3JAF A;  1QP4 A;  3PXP A;  4FI5 A;  2WMO A;  4TN7 B;  3DTO A;  4JI4 T;  3RLF F;  4ZS3 A;  4PJM A;  4Y42 A;  1T7S A;  2XQ3 A;  2ES0 A;  4U2Z A;  4HKA A;  1DU2 A;  1US7 B;  4IWR A;  3RYC E;  4TV8 E;  2BKO A;  2JJ9 A;  4J2C A;  4TNV A;  2VL8 A;  4KP3 C;  3PU8 A;  2XAS B;  2NWB A;  3FZL B;  4EAH A;  1XWM A;  2FUP A;  3RC3 A;  5FL0 A;  3KDS E;  2C5J A;  3CIR A;  3U3I A;  2IIU A;  3F2E A;  3QF3 A;  3RYF E;  2D9D A;  2PUB A;  2LE8 A;  4JI2 T;  3I0O A;  3ABV A;  3NZP A;  1LVF A;  5JDH A;  2CBI A;  1ZP0 A;  1KF6 A;  2O4A A;  1YSE A;  1Y64 B;  5HCJ A;  4NDW A;  5FVL A;  1UX5 A;  5DQV A;  2XTL A;  4MFR A;  5L47 A;  4OYK A;  2X9H A;  3AE7 A;  4PK5 A;  1WYC A;  2C5K T;  2PFV A;  2CXF A;  1UXC A;  2JRK A;  2LNM A;  4G2A A;  4AIS A;  5AQI B;  5JUW A;  2I0M A;  4LML A;  3V5U A;  3ZPX A;  4EKI A;  4WVL A;  1RZR D;  4EED A;  2ZM6 T;  1I94 T;  2FFH A;  1KFY A;  3AED A;  4BJM A;  1HR0 T;  1HG5 A;  2JQH A;  3GZD C;  1HNX T;  5HWX A;  3SCG A;  2RP4 A;  5TAO A;  1L0V A;  2KZ8 A;  1ZV4 X;  3GZC A;  3PE5 A;  3GUU A;  4O4I E;  3IEE A;  2FJA A;  4DV4 T;  4DE8 A;  1YXR A;  3WAK A;  5HEU A;  1ADR A;  2QA7 A;  5LJN A;  1YQ3 A;  2DNX A;  5GAG i;  3GA8 A;  3KIN B;  4ZOL E;  5AQP B;  4I4T E;  3SOL A;  1NEK A;  1R8I A;  2MAW A;  2WQY A;  2EWT A;  3CML A;  2BJC A;  2IC6 A;  4U33 A;  4Z8X A;  4ZI2 D;  4FN3 A;  4TUY E;  4ER7 A;  1WH8 A;  1Z8U A;  3H3M A;  3RZZ A;  3RYI E;  4PFO A;  2YOE A;  2MOZ A;  4GQM A;  3AEA A;  3OPC A;  3H37 A;  4AXP A;  2ICT A;  4WYV A;  3LIS A;  5LB7 B;  4B3S T;  2XJ3 A;  1HNZ T;  3Q5X A;  5HYA A;  4Z90 A;  4HFD A;  3LDQ B;  1NW3 A;  1E2A A;  2VL0 A;  3CVR A;  2J4G A;  4OB4 A;  1SQ8 A;  3AAI A;  3D0T A;  1OED C;  2JQK A;  4WBN E;  3LK3 B;  2O49 A;  2YKS A;  2V26 A;  3VWS A;  1S7E A;  2AXU A;  2D2S A;  2IVG A;  2PG8 A;  4F8D A;  1I6Z A;  2JCG A;  3MAC A;  4BAY B;  2Q9Q D;  1L1M A;  4LMJ A;  2D5U A;  3J7Y q;  3A7M A;  2EHO C;  4PJL A;  2GK9 A;  4GHJ A;  3B5M A;  3RI5 A;  3KVB A;  4IT4 A;  2VUR A;  2LYL A;  4YSZ A;  2WP9 A;  1QUU A;  4JI8 T;  5M4Y A;  5CFB A;  3RQU A;  3A5X A;  5AQF B;  1UUR A;  5E0O A;  2QYW A;  3HI2 A;  3VRA A;  2LSY A;  1VCS A;  3N9L A;  2LYP A;  2PE5 A;  4L9I A;  1X2L A;  1OED A;  5IWA T;  5FXX A;  4NXM T;  4QXB B;  3RGL A;  4YG4 A;  4YBA A;  2PJQ A;  5AQS B;  4G63 A;  2XQ7 A;  1NWM X;  3OQO A;  2LRL A;  1N33 T;  3QQ6 A;  4JI1 T;  2YK0 A;  3PJA J;  2ZM0 A;  3L3P A;  2XI8 A;  5JDG A;  2LSI A;  5LGN B;  1MIV A;  2DCF A;  4DMW A;  3EVY A;  3Q5D A;  5CB4 E;  3AE1 A;  4HFC A;  1QSD A;  3N9N A;  4Z5C A;  2PXU A;  2LM9 A;  2L8N A;  3SRZ A;  4YHJ A;  4C90 A;  1WR6 A;  4TZ4 C;  2HH7 A;  5DTR A;  2D0T A;  2OFY A;  4IE0 A;  4HEA A;  3PUW F;  2BG9 A;  4YTM A;  4DV2 T;  4I55 E;  3ANW A;  3PUZ F;  4UEM A;  3PUG A;  1O4X A;  1ZKE A;  2WB5 A;  5LG4 A;  3ZST A;  1BR1 A;  3N2G E;  2UU9 T;  4YJ2 E;  1HTJ F;  4HWC A;  4KUM B;  2BS3 A;  4PU8 A;  2LKG A;  3LSV A;  4JUY A;  3RC8 A;  3QUJ A;  3NZQ A;  3MJX A;  2KXP B;  4PU3 C;  3KBT A;  1HF0 A;  3C50 A;  3C51 A;  2GRL A;  3AE3 A;  4MAL A;  2Z6E A;  4GIW A;  3LG7 A;  5FY0 A;  4O4H E;  3KV4 A;  3AAE B;  4ZI2 C;  2ZLY A;  1O3X A;  5J0Z A;  3UFE A;  1DW9 A;  4CI2 B;  3R6N A;  4JI7 T;  3O9X A;  4LFB T;  2LSK A;  3O1I A;  5L3F B;  1JNR A;  1KK7 A;  2VWA A;  1HG2 A;  2ZMA A;  2AXV A;  5ABF B;  4N78 D;  2X9Y A;  2WDR A;  5CA1 E;  2V8S V;  1XNQ T;  2BKP A;  4ZS2 A;  3SWH A;  2QGS A;  4H63 H;  4B3T T;  4Q25 A;  3S8Q A;  3LJC A;  3AVS A;  2CM0 A;  4JI0 T;  1R63 A;  1CUN A;  3GMI A;  4ZI3 C;  1SA0 E;  4YTN A;  2Y48 B;  4LFA T;  3OKZ A;  3AE2 A;  3RYH E;  3SR4 A;  2LSG A;  3GZD A;  2XAH B;  2PXT A;  3CPZ A;  3HKB E;  1OCT C;  5LP6 E;  2ODR D;  5H6Q B;  3L1P A;  3R1F A;  4CZZ B;  3I0Q A;  2XM2 A;  3BQI A;  5AQO B;  4MBQ A;  1GT0 C;  1ZZB A;  3KJX A;  2A72 A;  4NUU A;  2V7J A;  4NPP A;  4TWF A;  4DR2 T;  5DTM A;  3ONX A;  5F8P A;  1WFD A;  4YFS A;  3NXH A;  2DL1 A;  4GYR A;  3C4Z A;  2KMF A;  2ODU A;  4ZI3 D;  5AQT B;  4IE4 A;  4AQF C;  3QK6 A;  5LMU T;  1AJ3 A;  3SCH A;  4FBI A;  5AQK B;  2XCJ A;  2XXA A;  3UTK A;  4LF9 T;  1XMQ T;  3P8C D;  1MMA A;  4X65 T;  5EK4 A;  2W61 A;  1T72 A;  4ILA A;  2PXD A;  1QP0 A;  2MTQ A;  3CEC A;  4IDP A;  2WIU B;  5FMN A;  2M6B A;  3NWI A;  5EK3 A;  3JXB C;  2V1D B;  4OK0 A;  4ISS A;  3T1Y T;  2UXX B;  1KNP A;  5FL1 A;  3QYX A;  4IST A;  2LKH A;  4EXT A;  3A9Y A;  2WU2 A;  3CQX C;  2X0Y A;  3ANW B;  2WY2 A;  5JDQ A;  4U7I A;  3RIA A;  2E9X B;  2AXD S;  3BQK A;  4GKK T;  3AXJ B;  2MPK A;  2IW5 B;  5DT2 A;  5LMN T;  3FZM B;  4JYA T;  4CQI A;  3UUL A;  4PJJ A;  1IZN B;  3ZJ2 A;  1U5P A;  3I1A A;  3MEJ A;  3IHR A;  3CX8 B;  4WW0 A;  2J62 A;  5JDL A;  4QWN B;  3LFP A;  4YY3 T;  2PUD A;  3OMT A;  4UXN B;  5L2L A;  3OYZ A;  4TWH A;  4AIU A;  4X62 T;  3ONL C;  2MEZ A;  1MMN A;  2B5A A;  5FY1 A;  5KDM C;  3CQC B;  1D1C A;  1W0A A;  4YLH A;  3AE6 A;  3RX6 A;  3A9X A;  4HFH A;  3SX0 A;  1BDI A;  4F8H A;  3ZCI A;  1PRA A;  2VB6 A;  2V7K A;  5HEH A;  3A8Y C;  4X4B A;  5C8Y E;  3WAJ A;  3FZK B;  5A1L A;  4TX5 A;  1JH9 A;  4HE8 A;  3R09 A;  1LCD A;  2BG9 B;  3PJA A;  1JNZ A;  3QWG A;  2AUW A;  4X4C A;  2IAK A;  4X1I E;  2EHO B;  2H89 A;  4IGU A;  5JDM A;  2XQ6 A;  1J5E T;  1UCU A;  3C4X A;  4DR3 T;  2UXD T;  3G06 A;  4I0U A;  2C5I T;  2EHO A;  4DUY T;  3KV9 A;  2LHR A;  3OTO T;  5AFU L;  2O38 A;  4XZC A;  2KLQ A;  2IV1 A;  2NW9 A;  3UU4 A;  3CKD A;  3DP7 A;  3O4X E;  4O8S A;  2PXQ A;  2PUG A;  3TRB A;  3J9X 1;  4I6U A;  3UUB A;  1SE7 A;  3F6W A;  4MCT A;  4B3R T;  4Z91 A;  5AQL B;  2VK9 A;  4ILB A;  3EHZ A;  4XBF B;  3R84 B;  4HWI B;  3MXZ A;  3ZJ1 A;  1LQC A;  3ZMU B;  3FXD B;  2W4X A;  3B57 A;  2UXB T;  4CN1 A;  1B0N A;  4EEB A;  4X4D A;  5ABG A;  3ZYM A;  2W63 A;  2M6I A;  2VAS A;  2BG9 C;  2RA1 A;  4C91 A;  4OBM A;  2XZE A;  3L39 A;  5AQU B;  2BS2 A;  3BS3 A;  3TFL A;  3ZT6 A;  3N9Q A;  4ASK A;  3DJB A;  2A6C A;  3AA0 B;  1QQA A;  3PDY A;  3HKE E;  3Q5E A;  3AEC A;  4X4H A;  2LEH A;  2HHH T;  4BA9 A;  4AKG A;  2L3L A;  2UXC T;  2CLY B;  2AWI A;  3K3O A;  4Z5D A;  1BR0 A;  2CMR A;  5ETW A;  5LGU B;  3B13 A;  5AQN B;  3AE4 A;  4GYS A;  2WM9 A;  3PV0 F;  4JI5 T;  3K3Q C;  1ZPQ A;  5HCM A;  4HRA A;  4X64 T;  1XNR T;  3CQG B;  1NER A;  3TLS A;  2YDS A;  3FXE B;  1KNZ A;  2K48 A;  3KL4 A;  1HQ1 A;  2ACZ A;  5HXS A;  3JC6 C;  2V6Y A;  3G5G A;  3ZMT B;  4AKL A;  3UU5 A;  5JRE A;  3VR9 A;  5AQQ B;  2FBW A;  2XPK A;  2SPC A;  2IHR 1;  4ER3 A;  2IDO B;  2Q9Q B;  3P4P A;  1QQB A;  3PUV F;  2CRB A;  4DND A;  2MBG A;  4DV3 T;  2XQ4 A;  3P50 A;  1NAF A;  3M3Z B;  5LXT E;  3CWZ B;  4YG7 B;  1QPZ A;  5HXE A;  2P9B A;  4QH1 A;  2JQ9 A;  4A5X A;  1X79 A;  2CBJ A;  2YBD A;  3T8O A;  2JQE A;  1QP7 A;  3HR0 A;  4HFI A;  1M7K A;  3QOW A;  2W66 A;  3RH3 A;  1EZ3 A;  2V7L A;  5DJQ C;  4DV5 T;  3M9L A;  3UU8 A;  1EFA A;  3N9O A;  5KXJ A;  5JTG A;  1W09 A;  3BD1 A;  4YG1 A;  3H5T A;  3CK6 A;  4WZX A;  1JFS A;  4TWD A;  5IUX A;  1ZUG A;  3JXC L;  3ZN1 B;  4DV6 T;  5HEJ A;  4GOU A;  2A3D A;  3UQ7 A;  4AKH A;  5BR8 T;  2XIU A;  2V3C C;  1S35 A;  4DV1 T;  4ZI7 E;  5LJM A;  2XY8 B;  1W0B A;  5HEO A;  2R6G F;  4IA8 A;  2NW8 A;  3UU6 A;  4PK6 A;  5LA6 E;  2LOP A;  2VKH A;  1DWK A;  4JQD A;  1ZZ7 A;  1WRD A;  1BDH A;  4JCX A;  4IHJ E;  3VK0 A;  3U78 A;  2D5V A;  2WU5 A;  5CA0 E;  4J1W A;  1ZZ6 A;  1IJ6 A;  2E5V A;  3QB5 K;  3QOX A;  4LF4 T;  4CXY A;  2X67 A;  5AQG B;  2G0U A;  5LHH B;  1RPE L;  5IHY A;  4U3C A;  5DSX A;  3AEE A;  4QXC B;  3ZMV B;  2HFZ A;  2CHN A;  1H7C A;  4QX8 B;  3AA1 B;  2VVS A;  5JH7 E;  4UEL A;  4AQF A;  3AE5 A;  2HPJ A;  3JCF A;  4AKR B;  1KNR A;  4NIQ A;  2FJB A;  2J7U A;  5H6R B;  2WS3 A;  3HKD E;  1LCC A;  2PXB A;  1WLX A;  3RRC A;  4EQZ A;  2OV9 A;  2V5C A;  4M1P A;  3QC9 A;  4MLK A;  3UUN A;  4QH4 A;  3PU3 A;  4GK5 E;  2CE7 A;  1AU7 A;  2V6Y B;  5EK2 A;  2VEO A;  1RIO A;  1Y7Y A;  3OYX A;  4EZH A;  5DTQ A;  1OED E;  4KHZ F;  4O4L E;  4X5T A;  4UF0 B;  4K0K T;  5JDF A;  2XM1 A;  5HAX A;  3ZN0 B;  2PXF A;  2W0G A;  4K0U A;  2NOX A;  1UTX A;  4X4G A;  5FP3 A;  3TLU A;  2H8R A;  3AB3 B;  2HSG A;  2N2N A;  2MXD A;  4U7Y A;  5K98 B;  2BBJ A;  2YDQ A;  3ETV A;  3MK7 C;  3N2O A;  2DI4 A;  2XXP A;  1ZS4 A;  3OQN A;  2X66 A;  5LYJ E;  3KFW X;  2BS4 A;  3F31 A;  2PXP A;  3K8P C;  4I6T A;  4DBR A;  5L3E B;  3G7D A;  4A56 A;  1X9B A;  3JAD A;  4EK9 A;  3UFG A;  1ZEE A;  3P4S A;  4ILU A;  4EYU A;  2ZM8 A;  4TV9 E;  4CI3 B;  5LOV E;  2LCV A;  4HGA A;  4YAR A;  2WUS R;  4H9N C;  3BQL A;  3ZT7 A;  4O2A E;  3ESL A;  2YDR A;  4H9Q C;  1BR4 A;  2LRK A;  2BDE A;  2AXZ A;  4PU4 C;  2PBI A;  1PRV A;  2XAG B;  3K1S A;  5LBQ B;  1D1B A;  3IBP A;  3NRY A;  2XQA A;  2R63 A;  2BKN A;  4PK4 A;  3NKZ A;  1XZY A;  2KWI B;  3FBZ A;  2K5B B;  2V7M A;  4DR1 T;  5L4E A;  3V5S A;  1Y01 A;  2CLY C;  2X68 A;  3OJA A;  4X1Y E;  2QVA A;  3T1H T;  4HWH A;  3ZKC A;  5HXC A;  2DWG A;  3RKO A;  4H9P C;  5FNV E;  2GZU A;  2V6X A;  3GN5 B;  3QFI A;  4UVC B;  1FMW A;  3QB5 A;  2PTF A;  4OX9 T;  3CX6 B;  4KX6 A;  1MMD A;  2L1P A;  5FVK A;  4LF8 T;  1MIW A;  4AI6 A;  2X51 A;  3AVR A;  2IML A;  3ZHM A;  1RZR A;  2YIN A;  5DRT A;  1FJG T;  5DAB A;  2RPA A;  1D1A A;  3ZMZ B;  5ABE A;  2XAQ B;  3G0T A;  4LF6 T;  3JC6 D;  2X0L B;  4WBO A;  3ZT5 A;  5FY7 A;  3LBX A;  2XHE B;  4PJN A;  2D0U A;  4KMC A;  2OR1 L;  2EF8 A;  3VHL A;  2XJ7 A;  2H7V C;  2WZH A;  3KV5 A;  3ONJ A;  4JCY A;  3M65 A;  3DNV B;  3IA3 A;  5F5W A;  2XSD C;  1ZHC A;  1UUS A;  5ADX L;  1D0Y A;  2BNM A;  5HEG A;  3RQW A;  2JMH A;  1WET A;  2PUF A;  2YN6 A;  2YU2 A;  1UX4 A;  4WNK A;  3EDU A;  2WAU A;  3ZEF B;  3FYA A;  4Z59 A;  4BJN A;  3MKD A;  2NR4 A;  3FB2 A;  1XMO T;  4EYY R;  1IBK T;  4U72 A;  3P4R A;  5DRY A;  4YTP A;  1MFQ C;  3KV6 A;  4KBM B;  5JDN A;  3EAM A;  3ZC1 A;  3OBV E;  1YQ4 A;  2JVL A;  4TNW A;  3EAB A;  2Q9Q C;  4IE5 A;  4DR6 T;  1WCR A;  3ZSS A;  3NVO A;  2V5D A;  1NEN A;  4UVB B;  5HXR A;  5FKY A;  2W62 A;  2DHR A;  1CQT A;  1V9D A;  3UUX B;  2L9Q A;  1WIZ A;  4ZHQ E;  4O2B E;  5JR9 A;  2K9A A;  2XQ9 A;  4I50 E;  3WI3 A;  1MND A;  2E9X D;  3GBF A;  2WMN A;  3SFE A;  1DUL A;  2LLV A;  4YT0 A;  2LYJ A;  1UK5 A;  3MA9 A;  3K3N A;  2KEJ A;  1XDO A;  1G73 A;  2WBL A;  2X9X A;  3FHN A;  4ZXL A;  1E1H B;  2E9X C;  2HPL A;  4NXN T;  4DR4 T;  2A2F X;  3N9P A;  4DV7 T;  2N1G A;  3AAA B;  1JWL A;  4HFV A;  1XDP A;  3CX7 B;  2Q9Q A;  3RRW A;  4CN4 A;  4KHP T;  4MHC A;  4JEH B;  2IVQ A;  2N9D A;  2ICP A;  1IJ5 A;  2LM2 A;  5LCY A;  3RIU C;  4DID B;  1MMG A;  2KWH A;  1J5W A;  5JR9 B;  3TLW A;  2E2A A;  2KZ7 B;  3ETU A;  2PIJ A;  2KND A;  2WWU A;  2YEV C;  3FZF B;  4QX7 B;  3NZL A;  1LLI A;  2KIN B;  3NBX X;  1T8B A;  5AQM B;  1E3O C;  4QKN A;  4O4J E;  1UGO A;  4PU7 A;  4HFE A;  2BVM A;  2LHN A;  3AEG A;  2HCN A;  3GWH A;  4X4E A;  1B7T A;  3N2K E;  4NUV A;  2DLR A;  3C64 A;  3KXA A;  2EHO D;  2VVN A;  2NTY A;  2PUC A;  2H7O A;  4HFB A;  1U2Z A;  3GN5 A;  3QOF A;  2PUE A;  1ZZC A;  4H9R C;  3RKG A;  3JXD L;  3UFD A;  3O1H A;  2CWY A;  3NRO A;  1BR2 A;  5LG3 A;  3KZ3 A;  5LBM A;  1QLB A;  5JVD E;  2FJD A;  5L3B B;  2LYS A;  4ANJ A;  4CXX A;  3UWP A;  2ODV A;  2OA5 A;  3CRO L;  2FJE A;  1X57 A;  1CJG A;  5L3D B;  3F51 A;  1YD8 G;  4EZI A;  2XXQ A;  3ZPO A;  3VU7 H;  4EOZ B;  1FMV A;  5JRC B;  2E9X A;  4O8B A;  2E5L T;  4DR5 T;  2VKO A;  5A7L A;  4DMV A;  1U4Q A;  2HN1 A;  3F52 A;  2C0S A;  4B6X A;  2PXV A;  3AA6 B;  1RZS A;  3ZC0 A;  2QRX A;  4CI1 B;  3W15 B;  2H3R A;  1IC8 A;  2XUE A;  1XWR A;  2IUO A;  3E08 A;  2LOS A;  2MYS A;  3H3A A;  3Q9D A;  1KEY A;  2BBH A;  2WSS V;  2XSB A;  4DVD A;  4DO0 A;  5LGT B;  2I59 A;  3NDB B;  2KPJ A;  3LBX B;  3AXJ A;  2OLT A;  3FMY A;  3L8R A;  4ILC A;  1M62 A;  2W67 A;  4PW8 A;  1ZAY A;  1MNE A;  2ACX A;  3LK2 B;  4DV0 T;  2FJR A;  3AE8 A;  1Z0P A;  4X4F A;  2LYQ A;  4V1A v;  2L49 A;  2J1D G;  3E0Z A;  4IL9 A;  2KEI A;  4ERR A;  4IE6 A;  1ZZ9 A;  3OP9 A;  3SS1 A;  5AQV B;  1VOM A;  2VKD A;  3UT5 E;  5FXZ A;  5JRC A;  4IE7 A;  3TEP A;  4CXW A;  2M4H A;  1T98 A;  2CA5 A;  1LVK A;  1OXZ A;  5LNK A;  4I8T A;  2XQY A;  4KI0 F;  4UIG A;  2UUB T;  4IVZ A;  5C2T A;  4DR7 T;  3EUH A;  4JV5 T;  4GKJ T;  3RIF A;  5FYM A;  4LMK A;  4YSY A;  2JIW A;  2JQQ A;  2LT3 A;  3FYM A;  1D0X A;  5HXH A;  4P0A A;  2UUA T;  2WWV A;  4E7S A;  2BG9 E; 
#chains in the Genus database with same CATH homology
 4HGA A;  4YAR A;  2IW5 B;  2IU7 A;  2WUS R;  1JFT A;  4IDZ A;  4H9N C;  1RZR D;  1YKH B;  3BQL A;  4UVA B;  2LJL A;  4CQI A;  4O2A E;  3ESL A;  3UUL A;  4PJJ A;  4H9Q C;  1BR4 A;  2EBY A;  2BDE A;  4BJM A;  1IZN B;  2KT9 A;  2AXZ A;  3ZJ2 A;  1U5P A;  4PU4 C;  2PBI A;  3I1A A;  1PRV A;  1HG5 A;  3IHR A;  5HWX A;  3HZI B;  2IC9 A;  3SCG A;  1YW0 A;  2RP4 A;  5TAO A;  2XAG B;  1HCI A;  2ZM2 A;  3LK4 2;  5LBQ B;  2KZ8 A;  1D1B A;  3CX8 B;  3IBP A;  4WW0 A;  3NRY A;  5JDL A;  4QWN B;  3LFP A;  1ZV4 X;  2R63 A;  2PUD A;  3OMT A;  1FEW A;  4PK4 A;  4UXN B;  3PUR A;  3CLC A;  5L2L A;  4JLE A;  2KWI B;  3OYZ A;  1PRU A;  3FBZ A;  4XAX B;  3P7I A;  1MIY A;  4O4I E;  2K5B B;  2V7M A;  3IEE A;  3I9W A;  5HWY A;  2MEZ A;  1SHZ C;  3BK9 A;  1MMN A;  3UUM A;  3V5S A;  3WAK A;  2B5A A;  1D0Z A;  5FY1 A;  2CLY C;  2X68 A;  2LYK A;  3OJA A;  1ADR A;  3PUA A;  3ZLI A;  4X1Y E;  3CQC B;  5KDM C;  1D1C A;  2QA7 A;  5LJN A;  4I6R A;  3VKG A;  2DNX A;  4YLH A;  3AA7 B;  4L5G A;  3RX6 A;  4HTE A;  3ZKC A;  3GA8 A;  3KIN B;  5HXC A;  1BDI A;  4ZOL E;  4I4T E;  2DWG A;  3ZCI A;  1PRA A;  3RKO A;  2VB6 A;  3SCF A;  2JPF A;  4H9S E;  3SOL A;  4H9P C;  2V7K A;  2GZU A;  5FNV E;  5FXW A;  1VPW A;  3GN5 B;  4X4B A;  4UVC B;  1FMW A;  2JMK A;  2CEA A;  5C8Y E;  5A1L A;  2EWT A;  1HX8 A;  1JH9 A;  3CML A;  4HE8 A;  4TX5 A;  1LCD A;  1VRB A;  2BJC A;  1FIO A;  2IC6 A;  4DBQ A;  3CX6 B;  3QWG A;  4Z8X A;  4ZI2 D;  2AUW A;  4X4C A;  4Z5H A;  1MMD A;  4FN3 A;  2IAK A;  4TUY E;  4X1I E;  1MIW A;  1WH8 A;  2EHO B;  4AI6 A;  4IGU A;  3ZHI A;  5F3J A;  5JDM A;  2X51 A;  3RZZ A;  3AVR A;  1UCU A;  3ZHM A;  3C4X A;  3RYI E;  1RZR A;  4PFO A;  2YIN A;  4P0B A;  3FBL A;  3MZK B;  2C5I T;  2EHO A;  4UV9 B;  2MOZ A;  4GQM A;  5DAB A;  4HN9 A;  3H37 A;  4PFP A;  1D1A A;  2LHR A;  3KV9 A;  3ZMZ B;  1LRZ A;  4AXP A;  2ICT A;  2XAQ B;  2Y6X A;  3LIS A;  5LHG B;  1WYB A;  2XJ3 A;  3JC6 D;  2X0L B;  3Q5X A;  4WBO A;  2CSF A;  5AFU L;  5HYA A;  2O38 A;  5FY7 A;  3LBX A;  5L3G B;  5JQG E;  4XZC A;  4EB6 E;  2KLQ A;  3CVR A;  2XHE B;  4PJN A;  4OB4 A;  2D0U A;  1SQ8 A;  4KMC A;  3AAI A;  3D0T A;  4WBN E;  3LK3 B;  2OR1 L;  2EF8 A;  1PER L;  3VHL A;  2IV1 A;  2O49 A;  2H7V C;  3N5L A;  3IVP A;  2V26 A;  3KV5 A;  2NW9 A;  4JCY A;  1S7E A;  3CKD A;  3M65 A;  3DP7 A;  3DNV B;  3O4X E;  4O8S A;  3ZYK A;  2AXU A;  2PUG A;  3TRB A;  3J9X 1;  2D2S A;  4I6U A;  4EZ4 A;  2XSD C;  1ZHC A;  4EIW A;  2IVG A;  2NP9 A;  3F6W A;  4MCT A;  3ZCJ A;  5ADX L;  2PG8 A;  1D0Y A;  2VK9 A;  2BNM A;  4F8D A;  2JCG A;  2JMH A;  1WET A;  2PUF A;  3MAC A;  1IAP A;  2YU2 A;  1UX4 A;  4WNK A;  3R84 B;  4BAY B;  3EDU A;  2Q9Q D;  1L1M A;  3MXZ A;  3ZJ1 A;  1LQC A;  2Y8D A;  3ZMU B;  2L8K A;  2WAU A;  3FXD B;  3ZEF B;  2D5U A;  1YKE B;  3B57 A;  2LYR A;  1B0N A;  3J7Y q;  4X4D A;  2EHO C;  3FYA A;  4PJL A;  5L3C B;  2GK9 A;  3ZYM A;  2W63 A;  4GHJ A;  4Z59 A;  2VAS A;  4BJN A;  3MKD A;  5LHI B;  2RA1 A;  3KVB A;  3ZYL A;  4C91 A;  2CXL A;  2LYL A;  3FB2 A;  5IYZ E;  4EYY R;  5DQW A;  3PTR B;  1QUU A;  4U72 A;  2MQK A;  3BS3 A;  5M4Y A;  3KV6 A;  3N9Q A;  3IF8 B;  3A5X A;  4KBM B;  5JDN A;  4ASK A;  3DJB A;  3ZC1 A;  2A6C A;  3AA0 B;  4GK0 E;  3KBU A;  3OBV E;  4JEU B;  3NRX A;  2B1E A;  1QQA A;  5E0O A;  3PDY A;  3HKE E;  2JVL A;  1S94 A;  3RPU A;  3HI2 A;  4X4H A;  2LEH A;  3F57 A;  4OYJ A;  2Q9Q C;  4IE5 A;  2LSY A;  4BA9 A;  3N9L A;  4AKG A;  2L3L A;  2LYP A;  2CLY B;  3HL6 A;  1NEQ A;  3VKH A;  2AWI A;  3K3O A;  4Z5D A;  2PE5 A;  4L0R A;  2AW6 A;  4UVB B;  1BR0 A;  1PNR A;  2CMR A;  5HXR A;  4AQG A;  4L9I A;  1X2L A;  2W62 A;  5ETW A;  1HF8 A;  5LGU B;  3B13 A;  4H9O C;  2DHR A;  4GYS A;  4U74 A;  1CQT A;  2WM9 A;  1V9D A;  3UUX B;  3E22 E;  2L9Q A;  1WIZ A;  3L09 A;  2CXD A;  4QXB B;  4O2B E;  5FXX A;  2X9W A;  3I9Y A;  2K9A A;  3K3Q C;  1ZPQ A;  4I50 E;  5JR9 A;  4YG4 A;  4YBA A;  4UV8 B;  4OHF A;  2PJQ A;  3CQG B;  1NER A;  4G63 A;  3O1J A;  3FXE B;  2IVB A;  3WI3 A;  1KNZ A;  1MND A;  3U3W A;  2K48 A;  2E9X D;  5GON E;  3N9M A;  2E8I A;  1NWM X;  3OQO A;  3PUS A;  5HXS A;  3GBF A;  3QQ6 A;  2NW7 A;  2WMN A;  3JC6 C;  3G5G A;  2LYJ A;  3MA9 A;  3OKQ A;  4MCX A;  2YK0 A;  3ZMT B;  4AKL A;  3K3N A;  2KEJ A;  5JRE A;  4PNI A;  2ZM0 A;  1G73 A;  2WBL A;  2X9X A;  3L3P A;  3LFM A;  4J1X A;  2SPC A;  2XI8 A;  5JDG A;  3FHN A;  2Q9Q B;  2LSI A;  5LGN B;  1E1H B;  2E9X C;  2HPL A;  1MIV A;  4QHO A;  2PPX A;  4Z58 A;  4QXH B;  1QQB A;  3WAJ A;  2DCF A;  4DMW A;  2A2F X;  3N9P A;  4DND A;  2MBG A;  5BMV E;  1NAF A;  3EVY A;  3PUQ A;  3D1N I;  2N1G A;  3AAA B;  1JWL A;  3C4W A;  3PE0 A;  4HFV A;  2DWK A;  3CX7 B;  2Q9Q A;  5CB4 E;  1R69 A;  3RRW A;  5LXT E;  1QSD A;  3CWZ B;  3N9N A;  4YG7 B;  2XAF B;  4Z5C A;  2LM9 A;  4MHC A;  1QPZ A;  4JEH B;  2IVQ A;  5HXE A;  2L8N A;  2P9B A;  3SRZ A;  2N9D A;  2ICP A;  1IJ5 A;  1LKX A;  5LCY A;  4YHJ A;  4C90 A;  1WR6 A;  1OWA A;  3HKC E;  1MMG A;  4TZ4 C;  2HH7 A;  2KWH A;  4I43 B;  5EZY E;  1X79 A;  2D0T A;  2W00 A;  5JR9 B;  2OFY A;  2R1J L;  2KZ7 B;  3ETU A;  4IE0 A;  3T8O A;  5JR9 C;  1WH6 A;  2PIJ A;  2KND A;  2K24 A;  2WWU A;  4HEA A;  1QP7 A;  2GRM A;  2YEV C;  3HR0 A;  2PUA A;  1Y9Q A;  5KX5 E;  3TKL B;  4QX7 B;  2NTX A;  3RH3 A;  1EZ3 A;  2V7L A;  5DJQ C;  1LLI A;  5FP3 A;  3BDN A;  2KIN B;  4I55 E;  3ANW A;  1EFA A;  3N9O A;  2BNO A;  3NBX X;  4YJ3 E;  1E3O C;  5J2U E;  4QKN A;  4UEM A;  4O4J E;  3HA4 A;  2HIN A;  3PUG A;  2CCQ A;  2UXN B;  1O4X A;  3BD1 A;  4PU7 A;  1LMB 3;  2BVM A;  2LHN A;  3GWH A;  1ZKE A;  4E7Z A;  5LG4 A;  4YG1 A;  1BR1 A;  3N2G E;  4X4E A;  1B7T A;  3N2K E;  4F6R C;  4NUV A;  2DLR A;  3H5T A;  3C64 A;  3KXA A;  2EHO D;  4YJ2 E;  1HTJ F;  1JFS A;  4KUM B;  1HS7 A;  4OFZ A;  4UF0 A;  1ZUG A;  3JXC L;  4PU8 A;  1OSL A;  2NTY A;  3ZN1 B;  1ZZ8 A;  2PUC A;  2H7O A;  4H63 V;  4JUY A;  3RC8 A;  4X1K E;  3GN5 A;  3QUJ A;  2PUE A;  3NZQ A;  1ZZC A;  4H9R C;  4PAG A;  3MJX A;  2KXP B;  4PU3 C;  3JXD L;  4X4I A;  3KBT A;  3UFD A;  1G8X A;  4GOU A;  3O1H A;  1HF0 A;  2CWY A;  5KMG P;  1BR2 A;  2A3D A;  3C50 A;  3S4U A;  4AKH A;  2YU1 A;  3C51 A;  2GRL A;  3KZ3 A;  3EDV A;  2XIU A;  2Z6E A;  1POU A;  4GIW A;  4MAL A;  5LBM A;  1HFA A;  1S35 A;  5JVD E;  3LG7 A;  4IIJ E;  4ZI7 E;  1ZVV A;  5L3B B;  5FXV A;  5FY0 A;  3MLF A;  4O4H E;  5LJM A;  2LYS A;  2BNN A;  4ANJ A;  3KV4 A;  2M67 A;  3AAE B;  4IA8 A;  2NW8 A;  4CXX A;  4ZI2 C;  2ZLY A;  2ODV A;  1O3X A;  4ZHQ E;  5J2T E;  4PK6 A;  2OA5 A;  3CRO L;  2LOP A;  5LA6 E;  1X57 A;  1CJG A;  3Q2M A;  2VKH A;  1DWK A;  3UFE A;  5L3D B;  1DW9 A;  4CI2 B;  3F51 A;  1YD8 G;  3R6N A;  4JQD A;  1ZZ7 A;  3ZPO A;  3O9X A;  3VU7 H;  4EOZ B;  1WRD A;  3EUS A;  2KEK A;  1BDH A;  2LSK A;  3O1I A;  1FMV A;  5JRC B;  2E9X A;  4O8B A;  4JCX A;  5L3F B;  4IHJ E;  1KK7 A;  2VWA A;  1HG2 A;  3VK0 A;  2ZMA A;  2AXV A;  3Q5W A;  4FJO A;  2CWO A;  2VKO A;  3U78 A;  5A7L A;  2V7I A;  2D5V A;  4N78 D;  4DMV A;  2X9Y A;  3B7H A;  1U4Q A;  5CA0 E;  4J1W A;  3F52 A;  2BVL A;  1ZZ6 A;  2C0S A;  1IJ6 A;  4B6X A;  5CA1 E;  2LSJ A;  3AA6 B;  4ZS2 A;  3KVA A;  4AKI A;  1RZS A;  2QGS A;  3SWH A;  4CXY A;  5J1G A;  2VKJ A;  2BZB A;  3ZMS B;  3ZC0 A;  4CI1 B;  3W15 B;  2H3R A;  2X67 A;  1IC8 A;  2G0U A;  2XUE A;  4H63 H;  3S8Q A;  1RPE L;  1XWR A;  5IHY A;  5LHH B;  4XBF B;  2CRO A;  4P09 A;  3LJC A;  1UXD A;  2IUO A;  3AVS A;  2CM0 A;  4ADZ A;  3E08 A;  2LOS A;  2MYS A;  2XAJ B;  1R63 A;  1CUN A;  3GMI A;  4QXC B;  1SA0 E;  3H3A A;  3OQM A;  2Y48 B;  3C98 B;  3Q9D A;  1H7C A;  4X20 E;  4ZI3 C;  3ZMV B;  4QX8 B;  4DVD A;  2WSS V;  1QP4 A;  3AA1 B;  3PXP A;  4FI5 A;  5JH7 E;  4DO0 A;  4UEL A;  2WMO A;  4AQF A;  5LGT B;  2HPJ A;  3RYH E;  4TN7 B;  2LSG A;  4AKR B;  3DTO A;  2I59 A;  2XAH B;  4ZS3 A;  2KPJ A;  3CPZ A;  3LBX B;  3HKB E;  1OCT C;  4PJM A;  5LP6 E;  4Y42 A;  3FMY A;  5H6R B;  4PW8 A;  5H6Q B;  3L1P A;  2ES0 A;  1ZAY A;  1MNE A;  2ACX A;  3LK2 B;  3HKD E;  4HKA A;  3R1F A;  1LCC A;  1WLX A;  3RRC A;  3I0Q A;  4CZZ B;  3BQI A;  2FJR A;  1US7 B;  4M1P A;  4IWR A;  1GT0 C;  3QC9 A;  4MBQ A;  3RYC E;  4TV8 E;  4MLK A;  1Z0P A;  3UUN A;  1ZZB A;  3KJX A;  4X4F A;  2A72 A;  2LYQ A;  4NUU A;  2JJ9 A;  2V7J A;  4J2C A;  2L49 A;  4V1A v;  3PU3 A;  4GK5 E;  2CE7 A;  2VL8 A;  1AU7 A;  5EK2 A;  4KP3 C;  3ONX A;  2J1D G;  3PU8 A;  2XAS B;  3E0Z A;  2NWB A;  5F8P A;  4YFS A;  2KEI A;  4EAH A;  4GYR A;  1RIO A;  3RC3 A;  3KDS E;  1Y7Y A;  2C5J A;  3C4Z A;  2KMF A;  3U3I A;  3OYX A;  4ERR A;  4EZH A;  4IE6 A;  2ODU A;  4O4L E;  4ZI3 D;  4UF0 B;  3F2E A;  4IE4 A;  3QK6 A;  4AQF C;  3QF3 A;  1ZZ9 A;  3OP9 A;  3RYF E;  1AJ3 A;  3SS1 A;  5JDF A;  2PUB A;  2LE8 A;  5HAX A;  3I0O A;  1VOM A;  3ZN0 B;  2VKD A;  3NZP A;  2W0G A;  1LVF A;  3UT5 E;  3SCH A;  4K0U A;  5JDH A;  4FBI A;  2NOX A;  2XCJ A;  3UTK A;  5FXZ A;  1UTX A;  5JRC A;  4IE7 A;  3P8C D;  4CXW A;  4X4G A;  1T98 A;  1MMA A;  2H8R A;  2O4A A;  3AB3 B;  1YSE A;  1Y64 B;  5EK4 A;  2HSG A;  2W61 A;  2N2N A;  2CA5 A;  4NDW A;  1QP0 A;  1LVK A;  2MTQ A;  3CEC A;  1OXZ A;  1UX5 A;  5DQV A;  2XTL A;  4MFR A;  5LNK A;  2WIU B;  5K98 B;  4I8T A;  3ETV A;  3MK7 C;  4OYK A;  2X9H A;  5FMN A;  3N2O A;  5EK3 A;  2DI4 A;  3JXB C;  2V1D B;  2XQY A;  4OK0 A;  4PK5 A;  1ZS4 A;  4UIG A;  4IVZ A;  1WYC A;  3OQN A;  2C5K T;  2X66 A;  4ISS A;  2UXX B;  3EUH A;  5LYJ E;  3KFW X;  2PFV A;  3F31 A;  3K8P C;  3QYX A;  4IST A;  2CXF A;  4I6T A;  5FYM A;  4DBR A;  5L3E B;  1UXC A;  3G7D A;  4EXT A;  2JRK A;  4A56 A;  2JQQ A;  2LT3 A;  3CQX C;  3ANW B;  1ZEE A;  3FYM A;  4ILU A;  5JDQ A;  5HXH A;  4G2A A;  4EYU A;  4P0A A;  2ZM8 A;  4TV9 E;  4CI3 B;  5LOV E;  2E9X B;  1D0X A;  4E7S A;  3V5U A;  2LCV A;  3BQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...