1ZZBA

Crystal structure of coii hppe in complex with substrate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
193
structure length
181
Chain Sequence
b'TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 42
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zzbA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zzbA02
5JCTA 2WUSR 3H3ZA 2Z69A 2HINA 4YNIA 3TNQA 2OZ6A 3B02A 1DW9A 2AXVA 2OPKA 4IETA 4QGNA 5J7MA 4NDWA 3ZKCA 1RZRA 1B0NA 4PU4C 4PU3C 3CL1A 2UYAA 3E5XA 4Q29A 1LKNA 4X4DA 4WZCA 1YSEA 3BCWA 4E2SA 3JZVA 3KJXA 5BY5A 5KHIA 3C3VA 1QQAA 3H1WA 4KWJA 4AXOA 3EQEA 1GQGA 4LUMA 3SXWA 4MGYE 4AQ6A 1L3JA 1J3PA 5JSOA 1CAUA 4QMAA 2CV6A 1NZCA 3BDNA 2D40A 3SCHA 1QP0A 1U12A 4IEOA 1LQCA 1CX4A 5I8YA 4WBBA 4MH0E 4N9HA 2LYKA 3LZZA 3U10A 3IWZA 5KHGA 2LYSA 4BHPA 5A7LA 1OD5A 2D5VA 3H1YA 3JXDL 2R1JL 3SCFA 5CU1A 4GHJA 4QX5A 4JTOA 1QP7A 3CLCA 2IXLA 2Q0AA 4EWAA 5J3UA 2EVXA 4I02A 2CROA 4HVRA 4LEJA 2GRMA 1YFWA 4XF4A 3HZIB 2KXLA 4KU8A 2KEJA 5I8SA 2MQKA 1OMIA 3S7EA 1FT9A 1QXRA 1ZUGA 1CAWB 2HKXA 2XSDC 1BDIA 1YWKA 4YSFA 3MZHA 3MLFA 1Y9QA 2PUEA 5E1RA 1EY2A 4MX3A 4BH9A 4XFGA 1O4TA 4YRDA 5FCCA 2BNNA 5K98B 1J1LA 1RZRD 4XF0A 4GQMA 3OF1A 4Q0SA 1O3RA 3KZ3A 1HW5A 4FN3A 5LEJA 3RNSA 3U3WA 1O5LA 4I6RA 4QM9A 1LMB3 1ZZ7A 2ATFA 3H1MA 4PIYA 3RZZA 1RUNA 2OYZA 4Q0UA 2XCJA 2JVLA 4KWLA 4XEZA 1LCCA 2H0VA 2HJIA 2B5AA 1OFNA 2PTMA 4J1WA 4Q0PA 2PQQA 2KEKA 1ZNPA 2ZCWA 5FDBA 3L1PA 3E6CC 1CAUB 4QXKA 1CJGA 1QPZA 1AU7A 1LCDA 3FFQA 5EFUA 2ET1A 4MUVA 4X4CA 4IA8A 2PUDA 1UXDA 3O14A 3EJKA 4I2OA 1FXZA 4AQ2A 3N4MA 3OQMA 4HBNA 2E9QA 3ZHIA 1YFYA 3H5TA 4R52A 3M3IA 2IC1A 5FLJA 4HMZA 4B29A 5FLHA 4A2UA 2N7GA 3RYPA 4YBAA 3E6DA 1FI2A 1QP4A 3IIAA 2D93A 2EA7A 2KPJA 4KL1A 3FZ3A 3IDCB 3ST7A 4Z5DA 3BD1A 1NERA 1JUHA 2ET7A 3D0JA 3H7YA 4QGLA 1ZZCA 2GC2A 3S8QA 1IC8A 3ROUA 1ZRDA 2WC2A 2AXZA 1ZX5A 2Q1ZB 3LWCA 1PM7A 3UFDA 3FWEA 3QF3A 1LLIA 3NJZA 4XFFA 3HIFA 4JV4A 4EV0A 4I01A 1Q43A 2WFPA 1NEQA 1X2LA 5EZWA 1O5UA 2PHDA 2GH2A 5JSRA 3PLQA 1XE8A 3QOPA 1Y3TA 4IVZA 4Z5HA 4ORFA 2QDRA 3RDIA 1POUA 3ETQA 3SCGA 2XJ3A 2GC3A 2PUFA 3U11A 5LRSA 3HT1A 2VPVA 3F52A 5D1IA 2XIUA 3CROL 5KHKA 1EPZA 4XFIA 1O3SA 1I5ZA 1QXJA 2OR1L 3ACLA 3EBRA 1O4XA 1PNRA 3KMHA 1Q5OA 3LA2A 4OB4A 4XFAA 1UIKA 3CEWA 3OP9A 4X6QB 2K9ZA 4MGIE 3U0ZA 1J3QA 3ZHMA 4Z58A 4X4EA 3LISA 4Q0VA 3CJXA 3SHRA 1QWRA 4I8TA 4MCXA 3E5UA 1DZRA 1X57A 1WIZA 4LUKA 3H9AA 4PJYA 1EYBA 4X4BA 4O9GA 3JXCL 4IERA 3F6WA 3EUSA 3LAGA 4X4IA 4OFGA 2R63A 5I0UA 1ZPQA 3EHKA 4JTNA 1CAVA 1QQBA 2Q30A 2HSGA 1HF0A 4JCXA 1TQ5A 2PAKA 4IEPA 4ZU7A 2AXUA 1WH6A 1NE4A 5BPXA 5LEKA 4XETA 3UKTA 3DL3A 4RD7A 2ICPA 5HI0A 2BNMA 3VK0A 2JCGA 3LA7A 4YYOA 3BALA 1I6XA 4YG4A 2ZKLA 1NXMA 5FQ0A 2D5FA 3MYXA 2O4AA 4XFBA 2IVGA 2IVBA 2MNGA 1YLLA 1J58A 4Q0QA 3IBMA 2KZ8A 2PIJA 4MCTA 4JQDA 1CQTA 2GU9A 4Z82A 5I0RA 3BU7A 3B7HA 1YHFA 1ZVFA 2H6CA 3UKVA 4IEQA 4XFHA 3RPQA 4O8BA 1RC6A 2IXKA 1O3TA 3CLPA 2IU7A 3VHRA 1H1MA 2EAAA 1EFAA 2IUOA 4MZUA 2XGXA 4QGMA 2LYQA 3LOIA 2L8NA 2IXHA 2UYBA 3DV8A 2GAUA 1ZZ6A 3PNAA 5FPZA 2IV1A 4LA2A 3OMTA 4E2GA 4ONUA 3GN5A 1IPJA 3ES4A 1ZRCA 1RL3A 1O7FA 3NSTA 2XKOA 2UY8A 3CO2A 1YFXA 1SEFA 2VECA 3O9XA 4IEYA 4AVCA 1ZREA 1DGWA 1CAVB 3DKWA 5JR7B 3NKTA 4HN1A 5C8WA 4I6UA 1EP0A 5CADA 1X8MA 2MHFA 2Z2SB 1ZZBA 3E97A 1WH8A 2ETEA 1XRUA 4I0AA 3RYRA 2UY9A 3E5QA 4NVPA 2GC1A 2GZWA 1ZRFA 1VPWA 1UPIA 4Z07A 4FBIA 3KCCA 3FYAA 5FQ0B 1OI6A 4O9EA 3FMYA 2O1QA 2QCSB 3JXBC 2CGPA 3KGLA 3DN7A 4EWDA 1ADRA 3NL1A 3D82A 3TNPB 4MGZE 2AUWA 5I91A 2LYPA 3H3UA 4I3PA 4IEUA 3LFPA 2Y0OA 1SQ8A 3OQNA 2O8QA 2EBYA 1Y7YA 4X4HA 2PFWA 3D0SA 3PVBB 3EO6A 2PA7A 3ZDSA 3OCPA 4LA3A 4TLFA 2B8MA 1UD1A 1GQHA 3I54A 3H50A 3OGJA 4L2NA 1JFTA 2XLAA 3H8UA 5I0SA 2FQPA 2QNKA 2OZJA 4UBHA 4EWEA 1WETA 4HVOA 5C6CA 1VJ2A 3I59A 2CAVA 4XF9A 4EROA 3USSA 4KWKA 2K0GA 5I93A 5J48A 2BNOA 2Q4SA 3R1FA 1RPEL 2PHLA 1ZAYA 3SMHA 4HLTA 2B9UA 3OQOA 3QYXA 2AW6A 1O3QA 4E2QA 3GN5B 1RTVA 1UXCA 4K8FA 4MV2A 3D1NI 1E3OC 2PUAA 2PUGA 3ES1A 2FMYA 3FYMA 2BGCA 5KHHA 3R6SA 2KEIA 3MPBA 1PERL 4H7LA 3WW3A 1V70A 1ZVVA 4BIFA 4Y42A 3FHIB 4QM8A 1J3RA 2XI8A 3UKNA 3WW4A 1CGPA 3PXPA 1S7EA 4AVAA 1UW8A 3BS3A 1PRVA 4LULA 2IXCA 4GULA 3G5GA 4KU7A 5BXXA 1JFSA 2PUBA 3CF6E 5E16A 3RYKA 2IXJA 5K8SA 5I8TA 2CSFA 1IPKA 4UXAA 5JSPA 2A6CA 4YG1A 4OLLA 2GC0A 5BUVA 2MEZA 3QQ6A 1R63A 2FJRA 2XL7A 2PYTA 1XWRA 2PAEA 4YG7B 3I7DA 3KXAA 5F1RA 1PRUA 1NE6A 2IXIA 4P9GA 3IVPA 4YARA 1G6NA 3QWGA 2PUCA 4N9IA 4HZFA 2BYVE 3H7JA 1LRHA 4BYYA 3OD0A 4I6TA 4XF1A 2EWTA 2BEOA 1X82A 4MGKE 1ZS4A 4IEXA 2I45A 1PMIA 5BV6A 1SQ4A 5JAXA 3I59B 4I0BA 4FAHA 2ICTA 3NVCA 2QJVA 4I09A 4PU8A 4J1XA 1GT0C 2O38A 2GRLA 1UTXA 1LR5A 4D7SA 2DCTA 4XFCA 2PAMA 1ZZ9A 1R69A 1DGRA 1QY4A 3GBFA 4F7ZA 4HN0A 4HVQA 3LA3A 1JH9A 2XLFA 1VR3A 1DWKA 4HSJA 1RIOA 3FJSA 1L1MA 2H6BA 1CAXA 3E6BA 2XL9A 3KGZA 3G7DA 4PU7A 1H1IA 4FT8A 4FAGA 3OTFA 2V09A 4ZU5A 3FX3A 5LRRA 2XHKA 4IEVA 5FLIA 2VQAA 2P17A 1ZRRA 3S7IA 3HT2A 3L2HA 3MDPA 1RZSA 3S0MA 4L11A 1ZZ8A 3BPZA 3KSCA 1J59A 5AVPA 1SFNA 2XLGA 2LYLA 3M70A 2D5HA 3NW4A 2LCVA 2LYRA 1UCXA 1XE7A 1YFUA 2OA2A 4HSLA 5KBFA 4X4FA 1JWLA 2B5HA 4JCYA 2L49A 2CAUA 1UIJA 2EF8A 3DNVB 2BJCA 1WA4A 4UBGA 5I0TA 2WIUB 1DZTA 4ZU4A 3ELNA 3IDBB 2XKPA 3GYDA 4LLOA 4AVBA 3BB6A 4D7TA 4IWRA 4FBFA 4IESA 3CECA 1WLTA 1RUOA 4JVAA 2GZUA 1YUDA 1RGSA 4XF3A 4F8DA 1NYWA 3TRBA 3WW2A 4X4GA 1LB2A 2F4PA 1X7NA 1PRAA 2PPXA 1OSLA 4PIXA 1OCTC 4CYDA 4LTAA 4F8AA 3F51A 1Q3EA 2OFYA 5CVRA 3QACA 4Z5CA 2H8RA 2C0ZA 4X6RB 5FPXA 3FE5A 2PE5A 2O49A 4PIZA 4WVZA 1X8EA 4META 4R8HA 2MPFA 2LYJA 4IEZA 1BDHA 4IEWA 5T3NA 1VP6A 1CAWA 3WW1A 1WGPA 2QVSB 3HQXA 4Z59A 4DINB 5KHJA 2IVQA 2AWIA 1CAXB
chains in the Genus database with same CATH superfamily
1UYZA 1MS4A 3ASIA 2WUSR 2VMGA 3H3ZA 4OULA 4XXAA 2HINA 4IUGA 4ASKA 3JD71 1ZBA2 5B4NA 4AGRA 1NXD1 2L1PA 1T6BX 3ZKCA 1X9PA 3LEIA 5I0DA 3H8XA 3A23A 5C71A 4A42A 3ZXFA 3TOJA 4AR2A 4CCKA 4P5HA 1TME3 2VAUA 1AR81 4FPLA 5FIXA 1MQTC 1YJLA 1QQAA 3C3VA 3H1WA 3PL0A 1SCSA 1W6NB 4AXOA 1GQGA 5DAXA 3SXWA 4MGYE 4Q8KA 1L3JA 1SG3A 1WW7A 1GZWA 2CGOA 3IN9A 4FFIA 4ITCA 2QZ2A 3VL9A 1STMA 1S2KA 3BDNA 1QJZA 1JYWA 2D40A 3SCHA 2ZAHA 3AVSA 1WCKA 4K20A 4S2FA 4UF0B 3ORJA 4NHLA 3B9IA 4IEOA 1LQCA 5FY8A 3DKQA 2ZGRA 4WBBA 1K42A 4MGQA 5ANNA 3OOXA 1UKGA 2MEV3 2GNMA 2JG8C 1DIWA 1TME2 5EYYA 5D2AA 3U10A 5LW9A 1SFYA 3VBSA 1Q56A 2A3YA 3PHMA 2QQUA 3KHCA 4P9XA 2D5VA 1C1LA 2VJXA 3RSJA 1GQPA 3WV6A 2R1JL 3WDYA 1RUH1 4XILA 1RUD1 1BEV1 2PHTA 1NCRC 5CU1A 2VXJA 3GXUA 4YM2A 3CLCA 2IXLA 2X5IC 1J84A 4AEMA 5FTTC 3H8RA 4GB33 4I02A 4ZXKA 4B3NA 2MEV2 4LEJA 1YFWA 4JCKA 2EXHA 4CVUA 5I8SA 2MQKA 1F35A 1OMIA 4BQ1A 3S5QA 4ATEA 4CCJA 2RJLA 2WABA 3NO8A 2XSDC 3RZGA 3VD3A 2FCVA 3S6PA 1POQA 3RMYA 2YBPA 1RUC1 2RVAA 3I97A 3MZHA 3MLFA 2ENRA 4Q4V3 3WP6A 3GZTB 5SV5A 1Y9QA 2WRAA 2W0XA 4JDMA 4GB32 4WM7A 5EJ1B 3JB4C 2LALA 1O4TA 2FCTA 2TEPA 2BNNA 4XF0A 4PBPA 3OF1A 2XJUA 1O3RA 4QX2A 2ZX2A 4HT1T 4OVEA 3PUIA 2ZZJA 4BQXA 3RZZA 4OI0A 2OYZA 3CZUA 5FYYA 4N7UA 2D7FA 5IVEA 1LCCA 1S0BA 3QD6A 2HJIA 1JOBA 2B5AA 4GZ9A 4Q4V2 4XCBA 2PTMA 5CFDC 1VIWB 3X29B 5DAWA 4GD4A 2ILMA 2GMPA 2YDEA 2ARAA 2KEKA 2XVKA 4Q0PA 1OLME 2BGPA 2JIJA 2J1EA 1GZWB 1AX2A 1LHWA 2WIIB 3LB9A 1Q8PA 4TTGA 1NY72 2NN8A 1RVF1 2FDJA 2VOWA 1VBC3 3MV11 5TSWA 4X4CA 3PUQA 1B35A 2YG0A 3POBA 1UXDA 3O14A 2ZGPA 1JH5A 4OYUA 3C7EA 2A1XA 3OQMA 2E9QA 3ZHIA 3SH3A 1YFYA 2EF6A 4YPJA 3VBSB 3M3IA 3NKGA 3NXHA 1W28A 1VAVA 1YNAA 3T2QA 1R083 4HMZA 4A2UA 2N7GA 3BIWE 1T2XA 3ZYFA 4BQ3A 3RYPA 1PMHX 1UNBA 5IFTA 2WS93 1NW3A 4GJYA 1DGLA 1VBC2 2YBSA 1QP4A 5LA1A 3MLJA 1YQ6A 2EA7A 3M4FA 3NV3A 2W3JA 4KL1A 3ZR6A 3HPNA 3FZ3A 1K5MA 3IDCB 4AGVA 1LCLA 4EKGA 2C1FA 2GNTA 3OB8A 1NKGA 1QJY3 3PDQA 1IS4A 4YW6A 1R1ZA 1WLDA 1JZ7A 1F8VA 1A8DA 3N7KA 4JDNA 5FAXA 4XQ4A 4Y20A 4ET7A 5A3PA 1FV3A 1R082 3H8OA 1S0FA 4CSWA 2RR11 5JXHA 4EZIA 1JOJA 2HWE1 3LWCA 3O12A 3QF3A 2D3SA 2WO7A 2QQJA 1V9U1 1VRH3 2WS92 4XFFA 4W8JA 5FBZA 5JXIA 5GZCA 4RGAA 4WM7B 4JV4A 1CWPA 2BGOA 2FDFA 3LQCA 5JMOA 4EV0A 4I01A 1QJY2 1Q43A 2AEYA 4QPIA 4DXTA 1O5UA 2G9GA 3PLQA 1PIV1 4IL7A 3V0BA 1CIWA 5T5OA 4IVZA 4ORFA 3RDIA 3FBMA 4ZHNA 2QQVA 2E51A 2PUFA 2V4VA 3U11A 1VBE3 3HT1A 2DU0A 2D6PA 2VPVA 1VRH2 1N47A 3F2ZA 1VBD1 4UFMA 4XFIA 4Q4Y3 3OKZA 4PCRA 5FK8A 1I5ZA 2WNEA 1C28A 1O4XA 1LEDA 5T5JA 5DT2A 4CCDA 5JPNB 1CIYA 1UY4A 2WFF1 4OB4A 3V64A 5LZ6A 1V6JA 1B35B 2K9ZA 3ECQA 4GJZA 1RUE3 4MGIE 4PDWA 1J3QA 1ZM1A 1VBA1 3NV2A 5IW0A 1ND3A 3USUA 4K8RB 1VBE2 5FZ1A 3DYPA 4GKXA 1B35C 2NMNA 2X09A 4LUKA 4PJYA 1U5XA 4Q4Y2 4DOUA 4X4BA 4O9GA 4IERA 1TVGA 3F6WA 3S5AA 4X4IA 5LB6A 2R63A 5I0UA 3KLSA 1FNYA 4MGTA 4GWMA 4M4RA 3EHKA 1RUE2 5GALA 1CAVA 1K5MB 1LHNA 1JHNA 3PURA 2HSGA 2WWSA 1F31A 3BI3A 4IEPA 2XG3A 4FPHA 3KM5A 2AXUA 4Y20B 4INDA 2V5DA 2WSVA 5FYMA 2RM23 1PO11 4XDPA 3OD4A 4AYUA 5LEKA 2JE8A 4Y1XA 1GWLA 1Z7S3 4Z92B 3J7HA 1SBEA 2ORXA 1PO21 1SHWB 5HI0A 1OFSA 1XQNA 1OKQA 2D43A 2BTVC 3BALA 3I2IA 1NXMA 3WG3A 3LGRA 4QPIB 2WO2A 3T1MA 1ODNA 1RUJ3 2XH6A 1C57A 3UT0A 4WM8A 2IVGA 2IVBA 2MNGA 4UWDA 2BVBA 4EN6B 3WCSA 3V0BB 1YLLA 2A6ZA 2RM22 4L0PA 4R4XA 1C1FA 5JUVA 3AKQA 2KZ8A 3LDBA 1VB4A 5HBAA 1FOD3 4QPYA 1Z7S2 3AL6A 1XNDA 4FPKA 1XYPA 1Z78A 4M0HA 2F4LA 4I3GA 2E32A 3HN3A 1N1YA 3AP4A 4QQOA 4E9KA 1LJ7A 2Q1FA 1RUJ2 4XFHA 1FMD3 1W8HA 5GLZA 4O8BA 1RC6A 1UF2C 3WG4A 4IGQA 3DGTA 3WF1A 1O3TA 2IU7A 1BHGA 1N1SA 1K5JA 2CSGA 1RYYA 2FCUA 2PELA 4PDWB 4YZ5A 4IE6A 1H1MA 1Y4WA 1ND3B 1UPSA 4MZUA 4OQ9A 3USUB 2LYQA 2D3RA 3LOIA 4F3JA 4CUCA 2PLV1 1FOD2 3DV8A 1ZZ6A 1YIPA 2DF7A 4YG6A 4DRRA 2YGMA 5K4LA 5HCFA 1REEA 1E5IA 3OBAA 4FFHA 4L8QA 4QAWA 4E2GA 4ES9A 3VLBB 4ONUA 2RE9A 1IPJA 2C5DA 1ZRIA 2ZEXA 2ZOEB 3I2KA 4YW1A 2LLVA 1ND3C 4XW3A 5CFCA 3BU0A 5EJZB 1ZRCA 2VH9A 2XKOA 2UY8A 3LEKA 3AXDA 4XYXA 3TBDA 1FMD2 2OW4A 3ZN4A 4AG4A 1DQ0A 5KXCA 1CX1A 5FZAA 1SEFA 3HBKA 3AMMA 2WO3A 1VMJA 1CAVB 2Y6LA 1XSQA 3DKWA 4BCUA 2W52A 2CYFA 4HN1A 5C8WA 5LBBA 3AXEA 4I6UA 2P6CA 4FPGA 4LBKA 2LS6A 5C8CC 3MEPA 3U14A 1SDWA 3VGIA 5FP8A 5J96B 3O7OA 3NNJA 4FSJA 4WVMA 4GAZA 4JX0A 1WH8A 1FPN1 3LPFA 2WJSA 4I0AA 2UY9A 2GC1A 5LBFA 2KD7A 1ZRFA 3MFCA 5AC93 4LBMA 5FY4A 4BK5A 4JKLA 3DEMA 3IPVA 4UW6A 2D6KA 4RR3C 5JR2A 2R32A 2O1QA 4BE3A 1COV3 1GBGA 3BVCA 5J36A 1YEWA 3KQ4B 1LOFA 1QOOA 1UYPA 4V2VA 4WM8B 5L73A 3POEA 2VZPA 1NQJA 3D82A 4MGZE 4E8CA 1WMXA 3A9ZA 3A7QA 5I91A 1V6NA 1D4M3 1HQLA 3AP5A 1R093 2EBYA 1Y7YA 2O8QA 2PFWA 2R061 2WINB 3SITA 3EO6A 4XJUA 5C9AA 4LA3A 3QOXA 1REFA 4K1YA 4AL9A 1UD1A 1GQHA 4KBBA 1POV1 4QB2A 1NZIA 5AC92 4L2NA 2Z79A 2XLAA 3H8UA 3ZXJA 4M0NA 4OHVA 3RWKX 1UOJA 2IWGB 1G7YA 3AYDA 4E4DX 4UBHA 1EV11 5FUNA 5CB7A 5IK5A 1COV2 4HG6B 2WA4A 3NV1A 2J1VA 4EROA 2BP6A 1DULA 2CU5A 4XABA 1M4WA 1I3HA 3OPWA 4COYA 4AI0A 3WR0A 1D4M2 2J1TA 2W87A 2CTVA 4CPBA 3VBOA 1R092 2PHLA 3C7OA 3U07A 5JXJA 4YM0A 2XMLA 3RJRA 1AR73 4N53C 2WL1A 3KV5A 3KVAA 5JZGA 5AVAA 5FP7A 1BQPA 4E2QA 4H55A 1AXYA 1AL21 1O4YA 3HWJA 5CFCB 3O1OA 2HWF3 1O6UA 3RZKA 2A70A 3ITQA 1UXXX 3ES1A 4Q4W1 3FYMA 5KHHA 3BYWA 3MPBA 3R6SA 5FMOL 3WW3A 3LIHA 1W0OA 2WAAA 5FY5A 4Y42A 5LATA 3WW4A 5CFCC 4CCEA 3PXPA 1S7EA 4AVAA 4ATFA 1AR72 4EZHA 4L99A 5FY7A 4QX3A 1GZ9A 1PRVA 4QB6A 3FN9A 4CEYA 5DSXA 3HJRA 4KU7A 5BXXA 2HYKA 4WVMB 4C8DA 1UX7A 3OJBA 2HWF2 2CSFA 2XQXA 4FCAA 4AFBA 1W8FA 2YY1A 3VDBA 2VCAA 2WSUA 1A34A 1AR93 4OLLA 2P3KA 3W9AA 2PYTA 3TWIA 3PJYA 3IPVB 4GALA 3A0KA 4YG7B 3I7DA 5L9BA 5H9SA 1IKQA 2FDKA 5L9RA 5F1RA 1PRUA 1GZTA 2XXQA 2YFZA 3ZFEA 2IXIA 1ZBE1 2PMWB 5DG1A 4DEVA 4O65A 4W6WA 3IVPA 4YARA 3ZDVA 2GN3A 3QWGA 1OSGA 4YLZA 2HWC3 2JG9C 3KZ4C 4M01A 4HZFA 4M4PA 5C9AB 1AR92 3OD0A 4PQ9A 4XF1A 4TLGA 2BEOA 1XSRA 5A32A 3C7FA 1JZ3A 3FL7A 3ZSMA 3RZMA 4BB3A 2BWAA 4LKDA 1OUSA 2BJSA 2ES3A 4UFKA 3T0DA 5BV6A 3ZXAC 4OBMA 1ULEA 4FAHA 3FUQA 3I2JA 3NVCA 1NA1A 2QJVA 4J1XA 3THTA 4FQZA 4GMP1 1C8M1 5C3QA 1UTXA 1SPPA 2ZMNA 3OG2A 3Q8FA 4CPBD 3VBOB 2HWC2 1PGSA 4RQPC 4Y26A 4ZZ8A 1HQWA 1QJX3 2XLFA 5JZGB 3N9MA 1DWKA 4QU1A 4TXWA 2RG4A 4XXPA 3TYJA 2I2SA 3AKSA 2XL9A 3G7DA 1OLRA 3VD9A 2DWRA 4FPOB 3QH7A 3ZFFC 4FAGA 5AFEA 3AP7A 2VU9A 5FOBB 2R041 2V09A 3VDDA 4BLIA 1W6PA 2VBBA 4IEVA 2OKXA 5CKMA 2XPJA 3RZJA 2W1WA 4LBJA 2CGNA 2DFCA 2QUOA 3FC0A 1V6IA 3B5LB 3HT2A 3MDPA 4GH4C 1QJX2 4LHLA 4X8PA 2RS11 2W94A 1FYUA 4Y1YA 4R9AA 5CBLA 1SFNA 4CEYB 2XLGA 4DMIA 3M70A 1GWMA 1H8VA 2CDOA 1LOGA 4QXBA 5FYHA 1DQ1A 2ZABA 2QQLA 1KEXA 2V3CC 1CN1A 2OA2A 5F5QA 5KBFA 2WZ8A 3VZLA 1JWLA 5FZFA 4EYUA 3VZNA 1ZBA1 2L49A 2ID4A 1NQDA 1QJU3 3VD5A 2EIEA 2Z42A 1F4AA 2E33A 2WUHA 1WWYA 5IVVA 1HB1A 2W92A 3ZFEB 4F83A 2VCMA 2DTWA 3BB6A 5K9YA 4D7TA 2PXLA 3HQUA 1VAKA 2VL4A 4IESA 1GMMA 5JUWA 4LBQD 3U37A 4CCOA 3R0RA 1H1AA 3WNOA 3ZMNA 4AW7A 2VNGA 4CU8A 3RZLA 1YUDA 1WW4A 1GP5A 4F8DA 1ULPA 2G4IA 4WV8A 5FZ4A 1MZEA 4GWNA 5GLUA 2VTXA 2ADEA 2SBAA 2W47A 4Y5TA 5A32B 1LTEA 2R6QA 1QHDA 4SLIA 1MACA 3RVHA 1QJU2 4LO5B 3KCYA 4JGYC 1W8OA 1QB2A 1JXNA 3ETPA 5FPXA 2AREA 3FE5A 1F5JA 2PE5A 1GNHA 1WMEA 1NA1B 3IT8A 3JB8A 1X8EA 4H3WA 5DUWA 4CUAA 1TME1 1SPPB 3WDTA 5K7PA 1NCQC 3WF4A 1D0GA 3WX5A 5EWSA 3WNLA 4HETA 5FPAA 3FLPA 4BXFA 5A7SA 2W91A 4YZ4A 1CAWA 3HNMA 1NA1C 4RYDA 5IWFA 3WW1A 1O8PA 2VBDA 1F5FA 1WBFA 4DINB 2IFWA 3AMQA 5IVCA 4YW4A 3I4IA 2MEV1 3VDDB 3M3QA 4PF1A 3WG2A 2AXVA 1W6PB 1IHMA 5J7MA 1FATA 4NN0A 1RZRA 1B0NA 1EUTA 4V1PA 1POV0 5FZDA 4A7ZA 2A3XA 2UYAA 3PVNA 4FP2A 1LKNA 1UOGA 3PUHA 4X4DA 1LOCA 3BCWA 1N1TA 4A41A 3JZVA 3KJXA 5A1FA 1UMIA 1HV0A 4RGKA 3TN93 2W9XA 4DUWA 4KWJA 4AAPA 3V56A 2BOIA 1ULFA 4LUMA 4GB31 4AQ6A 1J3PA 2JWPA 4W50A 1CAUA 1RUF3 1Q8VA 1NZCA 5A3WA 3HR9A 4B1MA 1QP0A 1REDA 2JE7A 2L9LA 3QLQA 4YZ1A 2Y6FA 1DG6A 1K12A 5GLWA 4Y4RA 3RI8A 2ZACA 4MH0E 1KS4A 3NZLA 2ZX1A 2DUQA 4CDUC 3BTAA 5ACA3 3GM8A 4Q4V1 2FD8A 3IWZA 3NNLA 5KHGA 2LYSA 3TN92 4BHPA 5A7LA 4OHWA 2DVBA 3AYCA 3M2MA 1OF3A 1NY71 1SLCA 2ARBA 1X36A 1RUF2 2YV8A 4Z1VA 5C7GA 5LA0A 3Q8AA 5FZ6A 4GHJA 2Y60A 4JHZA 4QX5A 4JTOA 1W04A 3KVBA 5FXWA 4P08A 1GNZA 3DUIA 4S2HA 3ZYGA 2WNVC 4S2DA 4RA0A 3ZIXA 3V0AA 3TAYA 1DGWX 4XF4A 4KU8A 2KXLA 5ACA2 4FTSA 2KEJA 1DGRN 1S1AA 4HXCA 1NLQA 1HXS3 1FT9A 1QXRA 1CAWB 1DLLA 5F2WA 5KXDA 3CBNA 3ZN5A 5FFOC 2VZRA 2RS33 3HNYM 4W6XA 3BTYA 3VKLA 4HRAA 1LESA 1G9AA 1VBC1 1F15A 2VZ1A 1TZOA 3LE0A 2PUEA 1S0IA 2BU9A 1EY2A 1SBDA 1O4ZA 4BH9A 5EJ3A 4XFGA 4FPYA 3T3YA 3OGRA 3O1UA 5K98B 4DQAA 5JI7A 1RZRD 4GQMA 2ZPXA 1LAJA 3O1PA 5H9PA 1C5IA 5LEJA 3G6JB 3U3WA 1AX0A 1O5LA 1HXS2 2JIGA 1R081 1ZZ7A 1GV9A 1SBFA 2ATFA 3H1MA 1H2NA 2I07B 4HKWA 4XUQA 1MS8A 3OBZA 4FPFA 1RUNA 1ZA4A 5FZBA 1CR7A 2RS32 2G9FA 3AZXA 3RWNA 3WDVA 4MHRA 2WS91 2IFRA 2ZEZA 4BWOA 1OLQA 1ZNPA 2ZCWA 4FXGB 4GMP0 5GAGi 2VQUA 2YUEA 2YU2A 1CAUB 2DCKA 1QJY1 4CP0A 1WA6X 1WLWA 1DCSA 3IZOA 4P00B 5FZ0A 1LCDA 1I9RA 1UYYA 1HLCA 2YMZA 4MUVA 4AEKA 5CA6A 4IA8A 3PMEA 1DQ4A 4NOTA 1UU6A 3EJKA 4P9YA 4D7YA 4NWWA 1GZCA 1UU4A 4DY3A 3AJZA 4R52A 4C1XA 1VRH1 3NNGA 3I3EA 1MVEA 4FTEA 5FLJA 2RDQA 5FLHA 2ZZQA 3AKTA 4C91A 1QH7A 2NQYA 4DE9A 4YBAA 2DU1A 4IGOA 4K40A 4AFAA 1FI2A 1BCXA 3IIAA 3GCXA 1D2QA 1PK6C 2D93A 4QPGC 3RGBA 1P8JA 5CG9A 5FXXA 2XBO3 4IV3C 2J7MA 4BMEA 3V0AB 2ZGKA 4LORA 3ST7A 1HQNA 3UNPA 1NERA 1VBE1 5FZHA 5FYZA 2YC2A 3OSDA 1UQXA 2WYSA 4FPJA 1W06A 1F4HA 2GC2A 3NQHA 4Q4Y1 3ROUA 3KHBA 3I2OA 1W9SA 1ZX5A 1RIRA 4CXWA 3H42B 1MEC3 5KC6A 3UFDA 3POIA 3KF5A 3NJZA 2O0OA 4YGEA 1RUE1 5APAA 2XBO2 2VUDA 5LBEA 1LEMA 5FPVA 5FJKA 3VZKA 4Q1RA 2J7UA 1LOBA 3MIHA 4OMCA 1X2LA 3SQOA 3UJQA 1XU1A 2GH2A 2YB7A 1D7PM 1WD3A 3MF6A 2AEZA 2ZX3A 2Q8OA 4FVVA 3WF0A 3MIDA 4Z5HA 2JX9A 1JYVA 2CY6A 3SH4A 3PIJA 3ZPXA 3B69A 3HNBM 1IPSA 3PUAA 1MEC2 2D3PA 5DAVA 1MPXA 1G9BA 4EK9A 4ZPIA 5T5LA 5IK4A 1JYIA 4GQ7A 4HFSA 4C90A 4JC1A 1W3XA 4K6BA 5D1IA 5KHKA 5DUXA 3LCPA 2OS2A 1AYN3 3O0WA 3ACLA 3EBRA 1YO8A 2VE1A 2VOTA 1H4HA 1CVNA 2XXZA 2RS53 4COZA 2PXUA 1UIKA 4UFLA 3OP9A 1DBNA 2RM21 4X6QB 2HBUA 5BYNA 4OHYA 3O1SA 1K3IA 1WCDJ 2JDYA 3ZHMA 4Z58A 2HWB3 3BN6A 5EIYB 3LISA 1IOAA 4Q0VA 4XMIA 4W65A 1Z7S1 3CJXA 5IK7A 4CXYA 3MIGA 1GOGA 2P2KA 4Y4YA 4AHXA 3Q8EA 4AE2A 1W9TA 1Y43B 4Q27A 1AYN2 5K0UA 4EN9B 3JXCL 2FDGA 4JRLA 1RUJ1 3LAGA 1SDDB 4XAEA 1CONA 2RS52 4LPLA 2XJSA 5LBCA 3UV9A 4KGGA 4IE5A 2VR4A 5G04L 4M3CF 4LJHA 4P9IA 2HWB2 2XWBB 4NHXA 1HF0A 4R9DA 4MADA 1FOD1 2PAKA 3AJYA 5E88A 1AR63 1W90A 1MS0A 2B7YA 3EMRA 2F17A 4A44A 3BTXA 4B4RA 1W2AX 1LODA 3POYA 2VZVA 3VBUA 4KMQA 1NE4A 2GMEA 4LK6A 5BPXA 4XETA 1XNTA 3VD4A 1FMD1 1GSLA 1AL0G 1UZWA 2WN2A 4LO7A 3HD8B 2ICPA 2VCBA 5EYXA 4AF9A 2R0HA 2JCGA 4P9WA 4YYOA 3M9LA 2QZ3A 4URTA 3RJ2X 4AI1A 4LIUA 4AAXA 4HOOA 1G8WA 1H8TA 2BZDA 3P3NA 1AR62 4XFBA 4PLOA 5J98B 2G19A 2HEWF 4Q0QA 3IBMA 1H9PA 3DCQA 2QQNA 5DUVA 3CHXA 2PIJA 4MCTA 2W1SA 4JQDA 1XNBA 2AENA 2JICA 2Y6HA 1NUKA 2YROA 3PTRB 2EALA 5I0RA 3LDRA 3MW4A 3B7HA 1ALYA 1BKZA 1W2TA 3I3BA 3J8F3 1CZVA 1OF4A 3VHOA 4KGQA 4RFT0 3BOWA 3POGA 4CUBA 3UKVA 2ZGLA 2JENA 3ABZA 2PXVA 1R1A2 3ACFA 1A6CA 3IMMA 2WWJA 2D44A 1ND2A 4Y22A 1BZWA 3PUSA 3ZVXA 2Y33A 5C33A 4N8MA 3L2YA 4CTEA 2OVUA 4R9CA 3HMYA 2WQZC 5FPZA 5AC91 1W9YA 4LA2A 4NE9A 1JZ2A 4IGPA 1U0AA 3ES4A 3WSOA 3J8F2 5K0UB 3OUHA 3I3MA 3RFRA 3WVJA 1COV1 5FZ8A 1QU0A 4YM3A 1SLLA 1Z0HA 1XNCA 1YFXA 2TNFA 4PHZA 1RUI3 4IEYA 5A7PA 3RMXA 1ZREA 1D4M1 5GZFA 5FO8B 3NKTA 3TEZA 1R091 3VBSC 2ZGSA 2D6NA 4PI0A 2I74A 4C0BA 3H0OA 2XJVA 4MGSA 1JZ6A 1BYHA 3VBUB 4A4AA 2ERFA 3E97A 3OPTA 1HV1A 1ASJ3 1XRUA 3CZJA 3JXSA 3O5SA 4BPZA 3AMHA 1CPMA 1YJKA 4NVPA 2GZWA 4XJAA 3WNXA 5C3SA 1VPWA 1LNSA 1U5YA 1UPIA 2UWBA 1RUI2 4YWAA 2R0FA 3ZSEA 3ZYRA 3NAPA 4YFZA 1FNZA 4Z07A 1AXKA 5DQ0A 3KCCA 1Y7BA 4B7EA 5F2SA 3ON7A 4E4HA 2BOJA 1QNYA 2QCSB 4PQQA 3JXBC 1AR71 1H8TB 2E63A 2Y34A 4FI9A 2QQWA 3DN7A 3UGHA 1ADRA 2YGLA 5A3NA 3NL1A 5KXBA 3IDEA 3TNPB 5C5UA 3H3UA 3KCXA 4PLMA 3LFPA 1KS5A 2HWF1 2Y0OA 1JYNA 1ASJ2 1LU2A 1GFF2 2VW1A 2XJTA 3PVBB 4QU2A 5JPMB 1H8TC 3OCPA 4IE4A 4TLFA 4BISA 3I54A 4WM7C 3QOWA 3H50A 3F95A 1G86A 3MLLA 3W58A 1GOFA 1MR5A 2VMCA 4FP3A 1MZFA 4HVOA 4A7KA 1VJ2A 3I59A 2CAVA 2FHRA 4KWKA 2VZQA 3NNFA 4Y22B 1ND2B 3WF2A 2VQTA 3MLKA 1PZ7A 4BZ4A 5IK8A 2A73B 3R1FA 4UYBA 1ZAYA 3ZSLA 1AR91 2WNUA 4OUMA 1NLSA 1MS3A 2XVLA 3QCWA 3OQOA 2DFBA 3QYXA 1O3QA 2W1UA 2A71A 1RTVA 3MPPG 3T2OA 2RV9A 2JDUA 1UZYA 2HH9A 4AEDA 5DRTA 1NOVA 3DECA 3P5BA 5C4WA 2PUAA 3HQRA 2FMYA 2ZX4A 2BGCA 3KF3A 3OBRA 2KEIA 2DYCA 1PERL 2JDHA 4IQPA 4ASMB 2VO5A 5D21A 2X05A 3SH5A 2XI8A 1JOPA 1H2MA 2HWC1 1MVQA 3K75B 5DABA 3SEPA 1UOBA 3ZYPA 4AK3A 3RZHA 1UW8A 2GDFA 3WUCA 2W95A 4LULA 1PX4A 3CNAA 4HKOA 2XQRA 2ZS6B 4YFWA 1JZ5A 3SX0A 2QQPA 4XZPA 2BDRA 5IVFA 2IXJA 4KQ7A 5K8SA 4CU6A 1IPKA 4UXAA 5JSPA 4LT5A 2M4HA 1OPOA 3RI9A 2WZR3 5AFBA 1R63A 2FJRA 1K5MC 1ST8A 3NAPB 4E8DA 5A3MA 2VOXA 5HV4A 1XWRA 4UFJA 5HPOA 4LQRA 2IUWA 4ISRA 4LNVA 4XHXA 1QJX1 4LITA 4XVHA 2CNAA 2NLRA 1ZA7A 5DPNA 5GZEA 2YPDA 2DUOA 4XTMA 1G6NA 3VHNA 1XXNA 3ZX7A 3SISA 3AZYA 5BNOA 2BYVE 2Y38A 2H0BA 2VZSA 2ADDA 2WZR2 1XBFA 2UWAA 3N3HA 4ER0A 5EV7A 2PXEA 4QPIC 3ILFA 1RXFA 1HJGA 3UYJA 2RDRA 4IXLA 5JAXA 3IIIA 4CCNA 2R30A 3I59B 2BV4A 3K3OA 4R9BA 5ABJA 5FPUA 5HCHA 1TNRA 1UX6A 1GT0C 5F5CA 4NAMA 1WCUA 5L36A 2DCTA 4D94A 2PAMA 1ULDA 1R69A 4OHXA 3GBFA 5KR7A 2WNUB 4ISQA 4QD2A 1US3A 5E89A 4BXSV 4DIQA 1PZ8A 2B4KA 2X29A 3LA3A 5LY1A 1QJU1 4OHZA 4U2AA 4XZUG 3E6BA 2CL2A 1QMJA 3A21A 3KGZA 1LGCA 4YW3A 4AEDB 3WNNA 3GDBA 3E1F1 4B4QA 5C4WB 4Y3OA 1H1IA 3PJQA 5H9RA 5IFPA 4PDWC 1OQEA 1H6YA 2VZOA 3FX3A 3DM5A 2YC4A 2P17A 3KWVA 3DXTA 1TE1B 1ZRRA 1GR3A 3S7IA 3VKFC 2W68A 3VD7A 3VWSA 3LPGA 2Q5TA 2W2IA 1PM4A 4DZGA 1RMU3 4L11A 3KSCA 1J59A 4LIVA 4ZONA 1VBB3 3GBWA 2D5HA 3NW4A 4NMIA 2LYRA 1PX3A 1XE7A 2E7TA 1QJFA 2W08A 2LW8A 1W03A 5ISLA 3MEJA 1SLIA 4QDSA 4D6RA 2WZEA 1UIJA 2EF8A 2JDNA 4FOYA 4MYEA 5B4XA 4BOWA 2OPWA 1HQ1A 4FFGA 2DCYA 4ZU4A 2FBEA 3IDBB 1RMU2 1W0NA 2DVAA 2ZAAA 4Z2AA 1UMHA 4FBFA 2B46X 1VBB2 2J1SA 4B8EA 4JVAA 4CE8A 5BNOB 4I0WB 1NYWA 1C5HA 3TRBA 1XU2A 2P3YA 2JEMA 4X4GA 2PHRA 1U5IA 2F4PA 1PRAA 3TEXA 5A7QA 4PIXA 4CYDA 1W8TA 4LTAA 4KG0A 5CVRA 5LCWL 1Q8QA 3TEWA 4UW3A 1OURA 4WM8C 3WZ1A 2FMDA 4LBLA 5ABJB 1WLCA 2YBDA 3IAPA 1JHJA 2MPFA 5FMDA 1W3VA 3J7MA 1H9WA 1L7RA 1PVC3 3TN91 1WMDA 5JIUA 1BDHA 1YYNA 4ER3A 1WCQA 3IM0A 1LENA 3WQ1A 2W5FA 3T2TA 3NJYA 2PN5A 1WGPA 1RUF1 3QBQA 2QVSB 5KC5A 4Z59A 5KHJA 1RITA 2WLQA 2E7QA 3OPZA 4A45A 5JCTA 4FFFA 4E27A 3HOBA 2Z69A 4M3CA 4YNIA 5F8PA 2OZ6A 4XJWA 4YG3A 3U4XA 5ACA1 1V6KA 1BLZA 1OC1A 2OPKA 4NDWA 1PVC2 4QGNA 1UO9A 3WXPA 4CDXB 4PU4C 3HBZA 1GP6A 5A3OA 4BQ5A 3KD4A 3OEAA 4TN7A 3E5XA 4Q29A 5A70A 1LHOA 4WZCA 2RHPA 2VOKA 1XE0A 5IUQA 1PHMA 1KGYA 2DCZA 2OUHA 4MVTA 2TUNA 4E4SA 2Y26A 5C5TA 5JSOA 2R16A 5HCBA 1CZSA 4QMAA 3AC0A 4GKYA 1RJ8A 1GYKA 1W6OA 2VMFA 4BK4A 2WQ4A 1YXWA 3VDAA 2UURA 3AZVA 3OY8A 4OI1A 1HXS1 5I8YA 1CX4A 3UESA 4P9LA 2D98A 2DBNA 2YHJA 1R64A 1QQP3 4M00A 2LYKA 2RS31 3D4KA 3LZZA 4N9HA 5FYVA 3RQ0A 3LFMA 3W20A 1TNFA 5FXZA 4D6SA 1JZ4A 2R073 1EUUA 2DVDA 3HN1A 3ZYHA 3JUUA 1WBLA 2WKKA 4NUBA 1OD5A 4JKKA 5LY2A 3JXDL 2AR6A 1RUG3 4LBQA 2JB4A 2WWUA 1HB4A 2A6WA 1YQ2A 2Y8KA 3GCWA 2Q0AA 1LOFC 4K9SA 2RDSA 1OH3A 3FHAA 4HPKA 1W0PA 3CQOA 4D8MA 4EWAA 5J3UA 2LRPA 2EVXA 2XUMA 1QQP2 3UJOA 2CROA 4HVRA 2GRMA 3WEZA 3HZIB 2R072 5C9AC 3RG0A 1SLTA 3JU9A 3S7EA 2LUWA 4O7XA 1K45A 2VVDA 5FKCA 1RUG2 4YVSA 3BKZA 5IAXA 1WUVA 2ZBJA 2C6SA 3OYWA 5GKAC 1NT0A 3CDZB 2LTNA 4M3CB 4EQZA 2QQIA 4W4ZA 4AI9A 1ACCA 4YRDA 3POWA 5FCCA 2NZ9A 3MI8A 1J1LA 4EJRA 1DLCA 3VBOC 5G05L 3KZ3A 1W8UA 4FN3A 1W2OA 1XPWA 3RNSA 2X8KA 4Q4X3 1LMB3 1A78A 5JZGC 2PXDA 4PIYA 1SLBA 4L92A 4ZS3A 3O1MA 4ZZ5A 4Q0UA 4BQ2A 2XCJA 3WINE 2JVLA 1FV2A 3MIFA 2H0VA 3O0VA 4XEZA 2D6OX 3ZYBA 4C1WA 3ZFGA 3O1TA 3GHNA 3POSA 3LEMA 2WBKA 1W6MA 1HRI3 5F5IA 5FDBA 2XBO1 3ZIWA 4FOQA 5GZGA 3TFLA 1LOEA 1CJGA 2OQ6A 3ACHA 1W6OB 4IW3A 4KWUA 1QPZA 4RN5A 1VRBA 3MF9A 1AU7A 3W21A 5DUUA 3N35A 3WHUA 3A9YA 3OY8B 2ET1A 2JDZA 4Q4X2 2V4AA 4XE9A 4H14A 1N3QA 4CEYC 4OZXA 4DB5A 2PUDA 4AQ2A 3J26N 4HBNA 3N4MA 3KT4A 2XJPA 4UFIA 1MEC1 3H5TA 1GP4A 3S57A 2C26A 2ARXA 1UY1A 2IC1A 4BM8A 3I2DA 1HRI2 3PU3A 2Q1MA 4JZRA 4B29A 4FOVA 3D5OA 2VZUA 2YYOA 1W39A 2GMMA 3DYOA 4LBQB 5F37A 1EAH3 1MZ6A 1DU3D 1JI6A 4OCTA 5FZ9A 3ZFEC 4HPKB 3DYMA 4AHWA 1O91A 4LO6B 5FO7B 3SC7X 5FY1A 4Z5DA 3BD1A 3SR4A 2G9ZA 2JDMA 4XQDA 4KNCA 1JUHA 5IVBA 3D0JA 4N90A 1VALA 4ES8A 3MIBA 3S8QA 4LXLA 1OA3A 4K1ZA 1ENQA 4YVSB 3WUDA 1AYN1 4CEWA 2WC2A 3OGSA 2JKBA 1HRV3 4RHV3 4DEQA 2Q1ZB 5FP4A 3FWEA 1EAH2 2AH2A 5FYSA 3NRUA 1BK1A 2RS51 3OYWB 1MS1A 4R4ZA 4EN0A 5FZ3A 3A22A 3PVEA 4YVSC 2VEOA 2HWB1 2A6YA 2WFPA 3AZZA 1NEQA 5EZWA 4A6SA 1ODMA 1HKDA 2PHDA 5JSRA 3SLIA 5F6KA 1Y3TA 4P14A 3VBRA 3VBFA 2QDRA 1POUA 3SCGA 1HRV2 4NAOA 4RHV2 2DV9A 5JVVA 5LRSA 1OUXA 4NPRA 2ZHMA 1LGBA 3WP3A 3ZFGB 3R4SA 3F52A 1D0HA 4XCAA 4DUVA 1W6MB 3DPRA 5ANQA 1KDMA 3SNMA 3VDDC 5C70A 3MBWA 3M3OA 4MLOA 5DAQA 1HDKA 5GLVA 4AFMA 1QXJA 1O3SA 3B3QE 2OR1L 4HL0A 4ZS2A 5EP9A 4ZY9A 5A7OA 1KQRA 4Q2JA 4DXRA 2WT2A 1AR61 3BGAA 1OQDA 4XFAA 4ER6A 2JD9A 2ZHNA 4CCCA 5DTRA 4M3CE 4OMDA 5FOJB 3U0ZA 4H7MA 4ARXA 4V2WA 2C9KA 1L7LA 1A8MA 3THDA 2VVFA 1QWRA 1TEIA 4MCXA 3E5UA 1QH6A 4XUNA 1DZRA 3ZSKA 3AYAA 1X57A 1WIZA 2ZEWA 2XJRA 3H9AA 4N43A 3WDXA 1F9KA 4B1LA 4IE0A 1S0EA 5FMCA 2EAKA 2XUEA 3GZCA 4ASLA 2ZGUA 1PNFA 2B45X 3AKRA 5L7OA 3B94A 1S2BA 5BNPA 3A4UA 1X50A 1IQAA 3ZR5A 2Y6JA 4AI2A 1ZPQA 5FZKA 1R1A1 3SKVA 4BLJA 4NO4A 3GJAA 1LHVA 3GHMA 1KXGA 1A3KA 4JTNA 4TWTA 5C3OA 3NJXA 3I3QA 2WN3A 3Q9OA 4NIDA 4JCXA 3CJIA 4XOGA 1GNYA 1J83A 1US2A 5HXVA 2BBAA 2WO1A 4MSVA 4ZU7A 2AC1A 1Y9GA 4QQHA 3WNPA 3WNKA 3N9LA 1AUYA 3U75A 3JQXA 4CEWB 3J8F1 4CP2A 4LBOA 3UKTA 3K3NA 2XXPA 1CQ9A 4LHKA 4RD7A 4CDQA 3I2FA 5T52A 3LA7A 1DDLA 4UW4A 1BK0A 1I6XA 1FAYA 2VW2A 3DXUA 3J7LA 3PMSA 5EHDA 3WQBA 4CEWC 5FQ0A 5JI9A 3K51A 1QIQA 1MS5A 3MFAA 1OPMA 2J22A 5FYUA 3VKMA 5JOWA 3AMNA 3VBRB 1J58A 3VBFB 4CU9A 1BBT3 5EPAA 1KDKA 2AGSA 2GP5A 4YW7A 2GSYA 2XOMA 4XHBA 2VD7A 1L7QA 1CQTA 2GU9A 4G9SB 3WDWA 2DVFA 3DPRB 1RUI1 5HXMA 4LR4A 1DYOA 4AEJA 3BU7A 3K46A 2FZ2A 1X9TA 1MS9A 2F6BA 1AVBA 4LHNA 3VV1A 5CG8A 3V65A 1W99A 2P4EA 5A3LA 2B9VA 4IEQA 5FYCA 1PGW2 2IXKA 2RDNA 1UY3A 3LOBA 2CHHA 2HBTA 1BBT2 5LA2A 1EFAA 2EIDA 4QGMA 1ASJ1 1AJKA 4KG8A 2UYBA 1IG0A 2GAUA 2IV1A 1XB9A 3AB0A 3OMTA 4N43B 2VZTA 3BTZA 1RB8G 2J7WA 3GN5A 4ER7A 2PHWA 4BQYA 1UZZA 4EQVA 4AZZA 1RL3A 5IATA 1IGOA 5L7OB 1H30A 1MQTA 1OVSA 2CWSA 4DS0A 5BNPB 4BIOA 2WDBA 3CO2A 1SLAA 1W05A 5FP9A 2YZ4A 2VECA 1DGWA 1GANA 2ZXQA 5JR7B 1G9DA 2BFUS 3T2PA 4Y1UA 3CJIB 4DXZA 5L7OC 2VG9A 1EP0A 5FUIA 5CADA 1X8MA 2JDPA 3ZXKA 3W5MA 4JDOA 4K21A 2Z2SB 5CEHA 3RRDA 1ZZBA 2VMEA 3KL4A 2VM9A 1QJEA 2J42A 1PNGA 2HFZA 2JG8A 3BPSA 2ETEA 3GGLA 2DUPA 3RYRA 3GZDA 1OA4A 3H3LA 4YGDA 4AHZA 4LHSA 4UAPA 4CDQB 3N9PA 2PQSA 4YW5A 4NRMA 4PI2A 4MXWA 3T09A 5IYYA 4FBIA 1YQ5A 3FYAA 3ZN6A 5FQ0B 1OI6A 1NCRA 5FV3A 3ZYJB 2Y0IA 2CGPA 2J1RA 2X5IA 1VPHA 4EWDA 1IS3A 5JDBA 4NIHA 1LHUA 5IAVA 2AUWA 1PZ9A 4OZOA 5FKBA 4IEUA 4I3PA 3BIEA 2XB6C 2QBXA 4DPNA 3VBHA 1WMFA 4YVWA 4X4HA 3ZDSA 2PA7A 3THCA 2NYYA 2B8MA 3Q8BA 1NX9A 3B9CA 2ZGTA 1Q8SA 1JZ8A 3FLTA 4XJ9A 2KM2A 4PLNA 4NWVA 4JHTA 4EWEA 1WETA 5T55A 3KB5A 5DG2A 5DDJ3 5C6CA 4XF9A 4K7JA 2ORZA 3R4DB 5SV8A 4Q8LA 1YI7A 3USSA 2K0GA 4CDWA 4FQ4A 5I93A 2ZEYA 2NM1A 3L9JT 4DFSA 2VTXJ 4NRQA 4A6OA 4AVVA 2Q4SA 1RPEL 4NHMA 4CRQA 2XDVA 2YPJA 3SMHA 3EB7A 3U4SA 5FY9A 3UL2A 2WZR1 4HLTA 2B9UA 2AW6A 2AACA 1OQ1A 5C3PA 3GN5B 1IG3A 5FYBA 5KWRA 1UXCA 4PBOA 4XUTA 4K8FA 2R1BA 2VMHA 4MV2A 1MQTB 5JLVA 2HWD3 5DDJ2 5CFDA 1CJPA 4LO8A 1ULGA 4LLFA 1EPWA 4H7LA 4QX1A 3VKNA 4CA9A 3M8LA 4KH9A 3R09A 1ZVVA 4DRVA 4BIFA 2VQ0A 3FHIB 2VOVA 3UKNA 4HONA 4LOSA 1SCRA 2DVGA 1QNWA 1QOTA 3T0BA 2VXRA 3BS3A 1TMF3 2IXCA 4QHBA 1JFSA 2PUBA 3OEBA 2JG8B 3GF6A 3SKJE 3ACGA 3NDBB 2BQPA 2HWD2 4YG1A 2ZTNA 4QKBA 4OUSA 4BU2A 4TZDA 1VMFA 1AZDA 2MEZA 3ALQA 2XL7A 3WCRA 2RMU3 4MXWB 3N9QA 1BMV2 4OI2A 3ZN6B 1KD7A 1NCRB 4EN7B 4RSUA 1C3HA 3VZMA 4RL7A 1UWWA 3GZDC 2X5IB 4WVLA 1TMF2 2BUKA 2MXDA 5KXEA 3J4UH 5LK5A 2V73A 4NROA 1T6GC 3VBHB 3W59A 4YVWB 2PUCA 4N9IA 2Y6KA 4FPEA 1RHI3 4HANA 4QX0A 2HCNA 1LRHA 2FFHA 3H7JA 5D8AC 4I6TA 1JMUB 1R1A3 5GLTA 2FDHA 2EWTA 1YC61 3ZMOA 1X82A 4MGKE 4XTPA 1OHFA 2RMU2 3K4ZA 4YM1A 4IEXA 3OUJA 1PMIA 4QHZA 3VBHC 4YVWC 5CIRA 5FMOS 1OBNA 3ATGA 1RMU1 1WW5A 3IMNA 1E57A 5T50A 4CDWB 3GZAA 1VBB1 1AF9A 3BUCA 3LEGA 4G3YC 1UKRA 2P3IA 1DGRA 4F7ZA 1RHI2 4HN0A 1I5PA 1HJFA 1HN1A 3ZM8A 4AWDA 4BA6A 5F39A 4CDWC 4HSJA 3SEEA 4CU7A 3ZXEA 1RIOA 5FREA 3LDKA 1L1MA 2Q8CA 3N9NA 1C4RA 1OA2A 3WP4A 3HVDA 5CFDB 1YQ8A 3OBTA 4ZU5A 2VNVA 5A6XA 5IT6A 3QFIA 2XHKA 1JYTA 2VQAA 3MUZ1 1XJAA 2OQ7A 3L2HA 4XDQA 1RZSA 3UWPA 3S0MA 4K3UA 1GICA 3BPZA 2E7AA 3TB0A 2WNOA 3RS6A 1ULCA 1SZBA 2BBVA 2E6VA 2LYLA 5K0UC 3AL5A 3URFA 1AYM3 2LCVA 2A3WA 3W5NA 1YFUA 2UWCA 3WY6A 2JXAA 1C8NA 3R4UA 4HSLA 1W8NA 2LLWA 2VNRA 5F32A 2CAUA 2XXAA 3ZXLA 5CYYA 4OQ8A 3DNVB 1WA4A 2ZHLA 1PVC1 4UBGA 5FPLA 3JCIA 5FY0A 3ZLIA 2WIUB 5IVYA 2D97A 4BJ0A 2Y6GA 3KT7A 1OH4A 1DZTA 3AKPA 3ELNA 2JE9A 4LLOA 1QEXA 3GUUA 2WYFA 3VBUC 1DQ2A 1YCIA 4IWRA 2BERA 5JOYA 4ER5A 1PMJX 3AZWA 5FZOA 1KJLA 2R49A 4CUGA 5FO9B 1AYM2 5FUPA 2GZUA 4FOWA 1RGSA 4XF3A 2P6HA 3O1VA 4MXVA 4OI4A 1O59A 1LB2A 2D6LX 1X7NA 2QFEA 2PPXA 2Q8DA 2OX0A 4QDQA 1OCTC 1XC6A 4CXXA 4F8AA 1Q3EA 3NWKA 2OFYA 3VKOA 3WHTA 2IVIB 1PGL2 4IE7A 3P1IA 3ZPOA 5J09A 3UK9A 4Z5CA 2H8RA 2C0ZA 2R7EB 1YI9A 5CISA 4PIZA 1FX5A 2W1QA 4JRAA 3J9SA 4META 4RFRB 4QXCA 2ZGQA 3P3PA 2LYJA 4WVZA 5F6LB 3WOGA 2VTFA 4XPVA 5EQUA 4QT6A 3AP9A 3FUOA 4IEWA 1CJDA 3I8TA 3WP5A 2R1DA 3JBG3 4DXSA 1GLHA 3ZXDA 1IS6A 1QKQA 3FLRA 3HQXA 2GP3A 3K77A 4QQPA 1ENRA 2DURA 4YW2A 2C9AA 1JW6A 1S0CA 5H9QA 1QGLA 2YC0A 1QQP1 1ND2C 2O14A 1DW9A 3B02A 3MGUA 3ZPYA 1I1EA 2WQ8A 2QQKA 4IETA 2R071 5A1LA 4D0QA 1OXCA 2BVVA 4PU3C 3CL1A 4Q2FA 2HCSA 4DUXA 3JBG2 1RUG1 4E4ZA 4A3XA 2BWCA 2VMIA 1QF3A 1YSEA 5IHRA 2DTYA 4UFHA 4YZ3A 4E2SA 1URXA 5KHIA 5A7WA 4BQWA 3EQEA 2RJKA 3GZEA 2OIIA 2IVJA 2X10A 5DXDA 4Q5OA 3VUOA 2CV6A 4QDRA 4COVA 4NIGA 1DHKB 2ODRD 3U1XA 1V6MA 4KBZA 3VDCA 4AFDA 1U12A 2A5ZA 2ZMKA 3JQWA 1VE0A 5FYIA 3VHPA 1CESA 4AQSA 4JKMA 2EIGA 3JD73 3T4HB 2E31A 3K4DA 1MFQC 5FZOB 5BNNA 4H2AA 5FWJA 5J37A 4Y1VA 4EN8B 3C7HA 3Q8CA 4QKNA 4YGBA 4Y5SA 5C8CA 1JUIA 3AP6A 3H1YA 1W9FA 2JDKA 3NAPC 1W6QA 3OWQA 2PXKA 1S55A 1S0DA 2AYHA 2OT7A 1KJRA 1O8SA 3SCFA 4NHKA 4Q26A 1AR83 3OGVA 4LE4A 1QP7A 4Q4X1 1HX6A 2VUCA 4COUA 5GZDA 3JD72 2ZKNA 4Y24A 1DF0A 4JGZA 4RR3A 2EXJA 2JJ6A 3ZO0B 4N7IA 3ZYIB 4SBVA 1HRI1 3ILNA 1ZUGA 3OGGA 2HKXA 5F3CA 5E8AA 2ZGMA 1LECA 1BDIA 1W2UA 1YWKA 2JECA 4YSFA 3NROA 3GJBA 1AR82 1JODA 1H0BA 2BFUL 4UT5A 5E1RA 4MX3A 2EICA 4A7YA 1RXGA 1J1TA 1RUH3 1VLNA 1RUD3 1BEV3 3C2UA 4Q0SA 3D8CA 2GNDA 2WNUC 4BQ4A 3A9XA 1HW5A 3MV01 4I6RA 3P6BA 4FPCA 4C0HA 5FWEA 2P1BA 4D69A 4CDXA 4KWLA 4AEDC 1EAH1 4XDOA 2A6VA 2PXBA 1W2NA 5FYTA 1OFNA 5A7WB 5C4WC 4J1WA 2JKXA 1HB3A 5CNAA 5BNQA 2YFUA 2PQQA 5A6QA 4N53A 5FZIA 3L1PA 3E6CC 4NIAA 4QXKA 4XBNA 1RUH2 1RUD2 1BEV2 1RUC3 3FFQA 5FR3A 1S4CA 2NMOA 2ZMLA 5EFUA 1UXZA 4XMAA 5FPBA 3ZSJA 4I2OA 1FXZA 3T0AA 1HRV1 4RHV1 1QXPA 2EXKA 3FFZA 5BNNB 2P5BA 3LF7A 4WVWA 2EIBA 3AFGA 1SMVA 1UMZA 5A3UA 5C8CB 5DZFA 3K2OA 3K4AA 4G4FA 5E6HA 1W6QB 3M7AA 3M1HA 2NPIA 5DZEA 1RUC2 5BNNC 4D3WA 3E6DA 4XURA 5FZ7A 5A33A 2WLPA 2KPJA 2X53S 1WCSA 2ZHKA 4AHYA 5GAHi 1VB2A 2NP0A 1XNKA 4XJZA 4YGCA 4JGZB 1RVF3 3ZOIA 4RR3B 5BNOC 1YRZA 3H7YA 2ET7A 3PVOA 4QGLA 4Y33A 4COWA 2EXIA 1ZZCA 2ZJCA 4UOJA 4LBNA 3INAA 1NAEA 2GH8A 1IC8A 1ZRDA 2B39A 2AXZA 4LOTA 3CU7A 4P02B 3O0XA 3AYEA 2D6MA 2PHFA 1LGNA 1N3PA 2AUYA 1PM7A 2QDNA 3OUIA 4JGZC 3LQXA 4QKFA 2JG9A 5FP3A 4Z8BA 1LLIA 4HK9A 4LKSA 5ABJC 1GKBA 3HIFA 1E5RA 2ZA9A 2BRTA 3FMGA 4NR1A 2LNMA 1RVF2 1MZ5A 3LSDA 5J1XA 3NMBA 1XE8A 3QOPA 2OXBA 3LKJA 5IVJA 1OD3A 3ETQA 2XJ3A 1JS9A 2GC3A 2QKDA 4QHOA 3U78A 2PXTA 2PHUA 3ILRA 4RQPA 3AK0A 2C24A 2XIUA 3CROL 4N53B 1EPZA 1Q8OA 4CDXC 2VUAA 5JOXA 1PNRA 2RR13 3KMHA 2HWE3 1Q5OA 2DBIA 4GWIA 2VNOA 5LK7B 3LA2A 1V9U3 3CKHA 3KV9A 5FZCA 3CEWA 3ZFFA 1RJ7A 5LASA 4BDVB 5DTMA 5A7NA 1ENSA 3MO4A 4HKLA 1XNAA 3MW3A 4X4EA 1HN0A 4MO3M 3SHRA 4AI3A 4I8TA 1UOFA 4GH4A 4W6YA 3WT3A 1PIV3 1DFQA 2PXQA 1ENXA 1OT5A 1UYXA 4RS5A 5F5AA 2W39A 1EYBA 3BOPA 3G0TA 2P3JA 4AI8A 5HCAA 1JYXA 4GA9A 4PT6A 3AMPA 2RR12 2SLIA 3EUSA 2HWE2 3GBGA 4OFGA 1JU4A 3J7NA 4CCMA 5A33B 1PGW1 1V9U2 3ZXGA 4O61A 1VBD3 4B7KA 1BBT1 1RINA 1QQBA 4GIQA 2Q30A 3TELA 4QX8A 3B01A 4XUOA 3POFA 1TQ5A 1ULOA 5FZMA 2UU8A 2WFF3 2WA3A 2VUJA 4XAAA 3WLUA 1HIXA 1PIV2 1JYCA 2ARCA 3LFIA 1WH6A 2WT1A 2XVGA 3CIHA 1VBA3 1H4GA 2PHXA 2JG9B 3KS7A 3DL3A 1APNA 2BNMA 3VK0A 1VBD2 1XYNA 4Q1PA 3B00A 4QB1A 3M3EA 4XQWA 5FK7A 1KRIA 3TRSB 3WNMA 4YG4A 2ZKLA 5LWBA 3UGGA 2D5FA 4JGYA 3WDUA 4EZ4A 3MYXA 2O4AA 2J1UA 3T4VA 4LKFA 2WFF2 1IS5A 3ENRA 4LO4B 5A6YA 5FZGA 2BW8A 1CZTA 2ZGNA 1VBA2 4D6QA 1SFPA 1NCQA 2QQMA 1DZQA 2P37A 4RQPB 4Z82A 4MOAA 5GM0A 2VZ3A 1RUOA 3MICA 1YHFA 1PO13 2XHNA 5F7UA 2FZ1A 4XUPA 4URAA 5JIAA 1ZVFA 3MW2A 2AZ5A 3IB3A 2H6CA 4X8NA 3RPQA 3ZFFB 2JD4A 1PO23 3CLPA 4BYYA 3O1RA 3IKWA 3VHRA 2EAAA 3KT1A 2IUOA 2XGXA 1S0GA 1XOYA 1Y9MA 1AXZA 2L8NA 2IXHA 2VGDA 3MHZA 3PNAA 2HEYF 4GH4B 1N3OA 2HLEA 1DYPA 4RS5B 4XACA 1QZXA 1IQDC 1PO12 4AVTA 1V6OA 4Y5Z0 1O7FA 1YQCA 2C4XA 3NSTA 3N9OA 5JWPA 3ME5A 5IJRA 4UW5A 1PO22 4QQLA 3O9XA 1SACA 4AVCA 3LD8A 4RS5C 5HV0A 1JU3A 3T1LA 2LM3A 3VBFC 4EE2A 4QPWA 3A0NA 4FO9A 5F3EA 3VB9A 2MHFA 1CPNA 1WW6A 1N1VA 2YXSA 4J6GA 1LU1A 1GU3A 4I30A 4QXHA 5DN2A 5L19A 3LSEA 3LIGA 1UY0A 3N7LA 1D4VB 2CDPA 5DAPA 3FHQA 1X33A 3IAQA 3ME2A 2O8OA 1VMHA 5DDJ1 4CDUA 5CAZA 1UU5A 2PLV3 3B93A 3E5QA 3GNEA 3N7JA 1E5SA 2OUJA 5EXOA 3THPA 3ZKUA 1DP0A 5FJHA 3PIGA 4P5YA 3HAGA 2A7AA 1W8WA 3GALA 3I49A 2B42B 4JGYB 4O9EA 1DYKA 3T08A 3FMYA 3BODA 4B4PA 2K46A 5A6ZA 5B2GB 3KGLA 2VBPA 2WAOA 2LYPA 2WNVA 4TYSA 5CKNA 2V5YA 4XC9A 1WZXA 3C7GA 4ZXEA 1SQ8A 3OQNA 1U2ZA 1NCQB 3D0SA 1BXHA 2HWD1 5F3GA 4YZ2A 2PLV2 1IZ3A 1KITA 4A3ZA 2J1AA 2HEVF 4AQTA 3OGJA 5I0SA 1JFTA 2VCCA 1WD4A 2FQPA 2QNKA 1BMV1 2OZJA 2DCJA 1FPN3 2KR2A 2QE3A 4NIIA 2WT0A 1TMF1 1UZ0A 4NJ4A 4MG2A 3EXUA 3EYPA 4GXLA 5J48A 1H2LA 2BNOA 2A6XA 4UI9L 3CMGA 3ZFGC 1AX1A 1WKYA 3I2GA 3VN4A 3D6EA 5CZKA 3VZJA 1UL9A 3TEYA 3KV4A 1DQ5A 5D8AA 2RMU1 4CCLA 2PXFA 2Y64A 1FPN2 2A75A 2R063 1JBCA 3D1NI 1E3OC 2PUGA 1V00A 4LMFA 3IDAA 3TNQA 1OOPA 4FTBA 1POV3 1V70A 5CKQA 1ZYBA 1AHSA 4QM8A 1J3RA 1CGPA 1OVPA 3UGFA 3WD5A 1RHI1 1U5ZA 1EV13 1NG0A 5FBJA 2XONA 2E53A 4GULA 3G5GA 3KQRA 2XJQA 2Q8EA 5M0TA 4KI5M 2KA3A 2GALA 3C8XA 2YBKA 3CF6E 5E16A 3KV6A 5T5PA 3RYKA 4CDUB 5I8TA 2R062 2GNBA 2A6CA 1B09A 2GC0A 5BUVA 3FBYA 3QQ6A 3WQ7A 3WQ0A 3DF0A 1JN2P 1AL23 2PAEA 3MIEA 2Z5WA 4JAAA 3AVRA 3TEPA 5JXGA 3KXAA 1EV12 1QDCA 3N36A 2WZPP 1YIFA 2YU1A 3VZOA 1NE6A 4Q4W3 1UN1A 3ZKYA 3AFKA 2VY0A 1W8ZA 2XR4A 1PK6A 3I2HA 4QPGA 4IV1A 2CWMA 2WNVB 2TBVA 4P9GA 2HYXA 4QM9A 3WG1A 4IV3A 4EKIA 1LOAA 4ZKTB 5DMYA 2VC9A 3AM2A 3AX4A 2JB8A 1JTZX 1W9WA 3NV4A 1GOHA 4PF5A 1G9CA 1ZS4A 4IDZA 4BMBA 1AL22 2I45A 3PTYA 3M3CA 1GUIA 4QQ2A 3T30A 5C3RA 4Y1ZA 1SQ4A 2QTWB 4CP9A 4DY5A 4Q4W2 4I0BA 4XJ8A 2ICTA 1V6LA 3VBRC 1UZVA 2K2SA 4PU8A 1KFUL 2PXJA 2VMDA 2VULA 1CD3G 4I09A 2O38A 1S2EA 4NPLA 2E26A 2GRLA 1LR5A 2QQOA 2GN7A 4RGGA 4AVSA 1QDOA 1AYM1 4D7SA 1UY2A 4XFCA 1ZZ9A 4Z2WA 5DTQA 1QY4A 2FDIA 5FRAA 3DPRC 4HVQA 1OLMA 3UETA 1JH9A 1ZBE3 3WF3A 1VR3A 5D8AB 5FXVA 4P9JA 1QOSA 3FJSA 3K48A 4AFCA 1BVVA 1CAXA 2H6BA 2WR9A 3HEIA 4J25A 5FZLA 3S30A 5L9VA 1PGL1 4PU7A 2JQEA 4FT8A 4L97A 1OOPB 1VAMA 2JDAA 4L9BA 4LK7A 3OTFA 4HK8A 5LRRA 5FLIA 4DO0A 4AOCA 3N7MA 5A80A 1OKOA 3PU8A 1UAIA 5LA9A 4N43C 1OOPC 1ZZ8A 1XYOA 1ZBE2 4S2GA 1GWKA 2IZWA 4XIOA 5AVPA 1V0AA 4FXKB 3I3DA 4GMP3 3NNMA 1C8M3 2W46A 2VVEA 4WVVA 2Z4FA 1UCXA 5BNPC 1W6NA 5T54A 5JMCA 5GJ6A 1BVP1 1BJQA 5A1AA 5F9TA 3MUY1 4MHUA 4JQTA 4NHYA 4NPMA 1TG7A 4X4FA 3B7MA 4XIKA 4DNYA 2B5HA 4JCYA 4QWNA 4U36A 3GZUC 5JOZA 4XBQA 4GWJA 2BJCA 5I0TA 3CJIC 1S0JA 2BPA2 1NLRA 4UF0A 1M06G 2V72A 2P34A 4AGGA 2XKPA 3GYDA 2VW0A 3JBG1 1PK6B 4NRPA 4QPGB 1IKPA 4AVBA 4QX7A 2R043 3D3AA 4IV1B 4CP1A 3CECA 4IV3B 1C8M2 1WLTA 5F3IA 5A3TA 1ONAA 3PE5A 1G9FA 1HB2A 3R05A 4OUEA 4YG0A 2XWJB 1KFXL 5ERLA 3NJVA 4WZFA 3WW2A 4CDQC 2G1MA 3ACIA 5BY5A 2RS13 1OSLA 1D2SA 4IV1C 4QKDA 1H6XA 1E5HA 5FZEA 3F51A 1PVXA 3QACA 4JQRA 2ZGOA 4X6RB 4CP9B 5DRYA 2PXPA 1LULA 4XBLA 2O49A 3APBA 4LKEA 4TSVA 1H2KA 4R8HA 2R042 3VL8A 1DQ6A 1ZBA3 2LROA 4IEZA 4ARYA 2DDUA 1AJOA 4DE8A 2ZX0A 1F2NA 1VP6A 2RJ2A 5T3NA 3QH6A 4CZSA 2RS12 3POJA 5FMBA 5DZGA 4LE3A 2IVQA 2AWIA 1CAXB
chains in the Genus database with same CATH topology
1MS4A 3ASIA 2WUSR 2VMGA 3H3ZA 4OULA 4XXAA 2HINA 3JD71 1ZBA2 4AGRA 1NXD1 3ZKCA 3ZXFA 3TOJA 4P5HA 1TME3 4FPLA 1AR81 5BY5A 1MQTC 1YJLA 1QQAA 3C3VA 3H1WA 4AXOA 1SCSA 1W6NB 1GQGA 3SXWA 4Q8KA 4MGYE 1L3JA 1WW7A 2CGOA 1GZWA 4ITCA 3IN9A 3VL9A 2QZ2A 1S2KA 3BDNA 1QJZA 2D40A 3SCHA 2ZAHA 1WCKA 4K20A 4S2FA 4NHLA 3B9IA 4IEOA 1LQCA 2ZGRA 4WBBA 1UKGA 2MEV3 2GNMA 2JG8C 1DIWA 1TME2 5EYYA 3U10A 1SFYA 3VBSA 1Q56A 2A3YA 3PHMA 4P9XA 2D5VA 1C1LA 3RSJA 3WV6A 2R1JL 3WDYA 1RUH1 4XILA 1RUD1 1BEV1 2PHTA 1NCRC 5CU1A 4YM2A 3CLCA 2IXLA 2X5IC 4AEMA 5FTTC 4GB33 4I02A 4ZXKA 4B3NA 2MEV2 4LEJA 1YFWA 4JCKA 2EXHA 5I8SA 2MQKA 4BQ1A 1OMIA 4ATEA 2RJLA 3NO8A 2XSDC 3S6PA 3RMYA 1RUC1 3MZHA 3MLFA 2ENRA 4Q4V3 3WP6A 3GZTB 5SV5A 1Y9QA 2W0XA 4JDMA 4GB32 4WM7A 3JB4C 2LALA 1O4TA 2TEPA 2BNNA 4XF0A 4PBPA 3OF1A 2XJUA 1O3RA 2ZX2A 4HT1T 4OVEA 2ZZJA 3RZZA 4OI0A 2OYZA 4N7UA 2D7FA 1LCCA 1S0BA 3QD6A 2HJIA 2B5AA 4Q4V2 2PTMA 5CFDC 1VIWB 3X29B 4Q0PA 2ILMA 2GMPA 2YDEA 2KEKA 2XVKA 4COUA 2WIIB 3LB9A 1GZWB 1AX2A 1LHWA 1Q8PA 1NY72 2NN8A 1RVF1 2VOWA 1VBC3 5TSWA 4X4CA 1B35A 1UXDA 3O14A 2ZGPA 1JH5A 3OQMA 2E9QA 3ZHIA 3SH3A 1YFYA 2EF6A 3VBSB 3M3IA 3NKGA 1VAVA 1YNAA 1R083 4HMZA 4A2UA 2N7GA 3BIWE 3RYPA 2WS93 1DGLA 1VBC2 1QP4A 3MLJA 2EA7A 3M4FA 3NV3A 4KL1A 3FZ3A 1K5MA 3IDCB 4AGVA 1LCLA 2C1FA 2GNTA 1QJY3 1IS4A 1R1ZA 1WLDA 1F8VA 1A8DA 3N7KA 4JDNA 5FAXA 4XQ4A 4Y20A 1FV3A 1R082 1S0FA 2RR11 1JOJA 2HWE1 3LWCA 3O12A 3QF3A 2D3SA 2WS92 5FBZA 1V9U1 1VRH3 4XFFA 5GZCA 4RGAA 4WM7B 4JV4A 4EV0A 4I01A 1QJY2 1Q43A 4QPIA 1O5UA 2G9GA 3PLQA 1PIV1 4IL7A 3V0BA 1CIWA 5T5OA 4IVZA 4ORFA 3RDIA 3FBMA 2E51A 2PUFA 3U11A 1VBE3 3HT1A 2DU0A 2D6PA 2VPVA 1VRH2 1N47A 1VBD1 4XFIA 4Q4Y3 4PCRA 1I5ZA 2WNEA 1C28A 1O4XA 1LEDA 5T5JA 5JPNB 2WFF1 4OB4A 3V64A 1V6JA 1B35B 2K9ZA 3ECQA 4MGIE 1RUE3 4PDWA 1J3QA 1ZM1A 1VBA1 3NV2A 1ND3A 3USUA 1VBE2 4GKXA 1B35C 2NMNA 4LUKA 4PJYA 1U5XA 4Q4Y2 4DOUA 4X4BA 4O9GA 4IERA 3F6WA 4X4IA 2R63A 5I0UA 3KLSA 1FNYA 4GWMA 3EHKA 1RUE2 1CAVA 1K5MB 1LHNA 1JHNA 2HSGA 2WWSA 1F31A 4IEPA 2XG3A 4FPHA 3KM5A 2AXUA 4Y20B 4INDA 2WSVA 2RM23 1PO11 3OD4A 4AYUA 5LEKA 4Y1XA 1Z7S3 4Z92B 1SBEA 1PO21 5HI0A 1OFSA 1XQNA 1OKQA 2D43A 2BTVC 3BALA 1NXMA 3WG3A 3LGRA 4QPIB 3T1MA 1RUJ3 2XH6A 1C57A 4WM8A 2IVGA 2IVBA 2MNGA 2BVBA 4EN6B 3V0BB 1YLLA 2A6ZA 2RM22 4R4XA 1C1FA 3AKQA 2KZ8A 1VB4A 5HBAA 1FOD3 4QPYA 1Z7S2 1XNDA 4FPKA 1XYPA 1Z78A 4M0HA 4I3GA 1N1YA 3AP4A 4QQOA 4E9KA 1LJ7A 1RUJ2 4XFHA 1FMD3 5GLZA 4O8BA 1RC6A 1UF2C 3WG4A 3DGTA 1O3TA 2IU7A 1N1SA 2PELA 4PDWB 4YZ5A 1H1MA 1ND3B 1UPSA 4MZUA 3USUB 2LYQA 2D3RA 3LOIA 4F3JA 2PLV1 1FOD2 3DV8A 1ZZ6A 1YIPA 2DF7A 4YG6A 4DRRA 2YGMA 5HCFA 1REEA 4L8QA 4ES9A 4E2GA 3VLBB 4ONUA 2RE9A 1IPJA 2C5DA 2ZOEB 5CFCA 4YW1A 1ZRCA 1ND3C 4XW3A 2VH9A 2XKOA 2UY8A 4XYXA 3AXDA 3TBDA 3ZN4A 1FMD2 2OW4A 4AG4A 1DQ0A 5KXCA 1SEFA 3AMMA 4BCUA 1CAVB 3DKWA 2W52A 2CYFA 4HN1A 5C8WA 3AXEA 4I6UA 4FPGA 4LBKA 5C8CC 3MEPA 1SDWA 3VGIA 5J96B 3O7OA 4FSJA 4WVMA 1WH8A 1FPN1 2WJSA 4I0AA 2UY9A 2GC1A 1ZRFA 3MFCA 5AC93 4LBMA 4UW6A 3IPVA 2D6KA 4RR3C 2R32A 2O1QA 4BE3A 1COV3 1GBGA 5J36A 1LOFA 1QOOA 4WM8B 5L73A 4TZDA 1NQJA 3D82A 4MGZE 5I91A 1V6NA 1D4M3 1HQLA 3AP5A 1R093 2EBYA 1Y7YA 2O8QA 2PFWA 2R061 2WINB 3SITA 3EO6A 4XJUA 5C9AA 4LA3A 1REFA 4K1YA 1UD1A 1GQHA 4KBBA 1POV1 5AC92 4L2NA 2Z79A 2XLAA 3H8UA 3ZXJA 4M0NA 4OHVA 2IWGB 1G7YA 3AYDA 4E4DX 4UBHA 1EV11 5CB7A 5IK5A 1COV2 2WA4A 3NV1A 4EROA 1M4WA 1I3HA 4COYA 4AI0A 3WR0A 1D4M2 2CTVA 3VBOA 1R092 2PHLA 3U07A 4YM0A 3RJRA 1AR73 4N53C 2WL1A 5JZGA 5AVAA 1BQPA 4E2QA 4H55A 1AXYA 1AL21 1O4YA 3HWJA 5CFCB 2HWF3 2A70A 3ES1A 4Q4W1 3FYMA 5KHHA 3R6SA 3MPBA 5FMOL 3WW3A 1W0OA 4Y42A 3WW4A 5CFCC 3PXPA 1S7EA 4AVAA 4ATFA 1AR72 4L99A 1GZ9A 1PRVA 4CEYA 4KU7A 5BXXA 2HYKA 4WVMB 3OJBA 2HWF2 2CSFA 4FCAA 4AFBA 2YY1A 2WSUA 1AR93 4OLLA 2P3KA 3W9AA 2PYTA 3TWIA 3PJYA 3IPVB 4GALA 3A0KA 4YG7B 3I7DA 5H9SA 1IKQA 5F1RA 1PRUA 3ZFEA 2IXIA 1ZBE1 5DG1A 4W6WA 3IVPA 4YARA 2GN3A 3QWGA 1OSGA 4YLZA 2HWC3 2JG9C 3KZ4C 4M01A 4HZFA 5C9AB 1AR92 3OD0A 4PQ9A 4XF1A 2BEOA 5A32A 3ZSMA 2BWAA 2ES3A 5BV6A 3ZXAC 1ULEA 4FAHA 3FUQA 3NVCA 1NA1A 2QJVA 4J1XA 3THTA 4FQZA 4GMP1 1C8M1 1UTXA 2ZMNA 3VBOB 2HWC2 1PGSA 4RQPC 4Y26A 1HQWA 1QJX3 2XLFA 5JZGB 1DWKA 4XXPA 3TYJA 2I2SA 3AKSA 2XL9A 3G7DA 1OLRA 2DWRA 4FPOB 3QH7A 3ZFFC 4FAGA 5AFEA 3AP7A 2VU9A 5FOBB 2R041 2V09A 3VDDA 4BLIA 1W6PA 4IEVA 2XPJA 4LBJA 2CGNA 2DFCA 2QUOA 3FC0A 1V6IA 3B5LB 3HT2A 3MDPA 4GH4C 1QJX2 4LHLA 4X8PA 2RS11 5CBLA 1FYUA 4Y1YA 4R9AA 1SFNA 4CEYB 2XLGA 4DMIA 3M70A 1H8VA 1LOGA 1DQ1A 2ZABA 5F5QA 1CN1A 2OA2A 5KBFA 3VZLA 1JWLA 3VZNA 1ZBA1 2L49A 1NQDA 1QJU3 2Z42A 3ZFEB 4F83A 2DTWA 3BB6A 5K9YA 4D7TA 1VAKA 4IESA 4LBQD 3R0RA 1H1AA 3ZMNA 4AW7A 2VNGA 1YUDA 1WW4A 4F8DA 2G4IA 4WV8A 1MZEA 4GWNA 5GLUA 2SBAA 5A32B 1LTEA 2R6QA 1QHDA 4SLIA 1MACA 1QJU2 4LO5B 3KCYA 4JGYC 1JXNA 5FPXA 2AREA 3FE5A 1F5JA 2PE5A 1GNHA 1WMEA 1NA1B 3IT8A 3JB8A 1X8EA 4H3WA 5DUWA 1TME1 3WDTA 5K7PA 1NCQC 3WX5A 1D0GA 5EWSA 4HETA 3FLPA 4YZ4A 1CAWA 1NA1C 3WW1A 1F5FA 1WBFA 4DINB 2IFWA 3AMQA 4YW4A 3I4IA 2MEV1 3VDDB 3M3QA 3WG2A 2AXVA 1W6PB 1IHMA 5J7MA 1FATA 4NN0A 1RZRA 1B0NA 4V1PA 1POV0 4A7ZA 2A3XA 2UYAA 3PVNA 4FP2A 1LKNA 4X4DA 1LOCA 3BCWA 1N1TA 3JZVA 3KJXA 1HV0A 3TN93 4KWJA 3V56A 1ULFA 4LUMA 4GB31 4AQ6A 1J3PA 1CAUA 1RUF3 1Q8VA 1NZCA 3HR9A 1QP0A 1REDA 2JE7A 3QLQA 4YZ1A 1DG6A 5GLWA 3RI8A 2ZACA 4MH0E 1KS4A 2ZX1A 2DUQA 4CDUC 3BTAA 5ACA3 4Q4V1 3IWZA 5KHGA 2LYSA 3TN92 4BHPA 5A7LA 4OHWA 2DVBA 3AYCA 3M2MA 1NY71 1SLCA 2ARBA 1X36A 1RUF2 2YV8A 4Z1VA 4GHJA 4QX5A 4JTOA 1GNZA 3DUIA 4S2HA 3ZYGA 2WNVC 4S2DA 4RA0A 3ZIXA 3V0AA 3TAYA 1DGWX 4XF4A 4KU8A 2KXLA 5ACA2 4FTSA 2KEJA 1DGRN 1S1AA 1HXS3 1FT9A 1QXRA 1CAWB 1DLLA 5KXDA 3ZN5A 5FFOC 2RS33 4W6XA 3VKLA 1LESA 1G9AA 1VBC1 2PUEA 1S0IA 1EY2A 1SBDA 1O4ZA 4BH9A 5EJ3A 4XFGA 4FPYA 5K98B 4DQAA 5JI7A 1RZRD 4GQMA 2ZPXA 5H9PA 1C5IA 5LEJA 3G6JB 3U3WA 1AX0A 1O5LA 1HXS2 4QM9A 1R081 1ZZ7A 1GV9A 1SBFA 2ATFA 3H1MA 1H2NA 2I07B 4HKWA 5D8AC 1MS8A 4FPFA 5GALA 1RUNA 1ZA4A 1CR7A 2RS32 2G9FA 3AZXA 3RWNA 3WDVA 2WS91 2IFRA 4BWOA 1OLQA 1ZNPA 2ZCWA 4FXGB 4GMP0 2YUEA 1CAUB 2DCKA 1QJY1 4CP0A 1WLWA 1LCDA 1I9RA 1HLCA 2YMZA 4MUVA 4AEKA 5CA6A 4IA8A 3PMEA 1DQ4A 4NOTA 1UU6A 3EJKA 4P9YA 4D7YA 4NWWA 1GZCA 1UU4A 4DY3A 3AJZA 4R52A 4C1XA 1VRH1 4FTEA 1MVEA 5FLJA 5FLHA 4C91A 2ZZQA 3AKTA 1QH7A 2NQYA 4AFAA 4YBAA 2DU1A 4K40A 1FI2A 1BCXA 3IIAA 1D2QA 1PK6C 2D93A 4QPGC 5CG9A 2XBO3 4IV3C 4BMEA 3V0AB 2ZGKA 3ST7A 1HQNA 1NERA 1VBE1 4FPJA 2GC2A 4Q4Y1 3ROUA 1ZX5A