1ZZBA

Crystal structure of coii hppe in complex with substrate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
total genus 42
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zzbA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zzbA02
1RIOA 3KXAA 2GH2A 3MZHA 2ZCWA 3DV8A 2PUCA 1ZPQA 2I45A 1O5LA 5I8TA 5J3UA 2KEKA 2DCTA 1LCCA 4H7LA 4ORFA 3SCGA 3E5UA 4X6RB 5KBFA 4HN0A 4IEQA 1Q43A 2O1QA 1WH6A 2WUSR 2IC1A 3U11A 1CJGA 2PE5A 4HVQA 3RDIA 5I91A 2BNOA 3R6SA 2Q4SA 3FHIB 3OQOA 4BH9A 1O4TA 3KGZA 4FAHA 3QQ6A 4F8DA 3GN5B 1ZUGA 1J1LA 2PUEA 3BS3A 4WZCA 3H3ZA 4FT8A 1X57A 3DL3A 2WIUB 1EYBA 5FLIA 4XFHA 3G5GA 5KHKA 1ZZ8A 3U3WA 2CAUA 5T3NA 1X8MA 5FLHA 3WW4A 2H6BA 5FDBA 1G6NA 1RZSA 1VJ2A 2PAEA 4IEVA 4HBNA 4O9EA 3N4MA 2JVLA 2CROA 2AXUA 3E5QA 3VHRA 2D93A 1QP7A 3HT2A 4Z59A 3KGLA 1X8EA 2VECA 4XFAA 4JVAA 3BPZA 3JXDL 4I6RA 2BNNA 4KWKA 2PAMA 2GC0A 1YFXA 5C6CA 4OB4A 4PJYA 1QY4A 5KHHA 3H1MA 2GAUA 4IEUA 1ZRDA 2AUWA 2GU9A 1WA4A 1BDHA 1YFYA 4N9HA 2XKOA 3PLQA 3H7JA 4IWRA 3I59B 4MCTA 3ZHIA 2PAKA 4EROA 3KZ3A 4PIXA 3LA2A 5I0UA 2VQAA 1JUHA 1QQAA 1CGPA 3LZZA 1ZNPA 4LUKA 3FJSA 3TNQA 1CAUA 3WW3A 3EHKA 3GYDA 4MUVA 2LYJA 3QACA 3NL1A 4I01A 2OFYA 1X7NA 4IESA 4YRDA 2HSGA 2KPJA 2EF8A 1H1IA 4LA3A 4LULA 2EA7A 4XF0A 3EO6A 1UXDA 4E2QA 1R63A 4MCXA 2B9UA 4LUMA 1YFUA 3H8UA 3ST7A 2BYVE 4YSFA 2HINA 2ZKLA 3USSA 1JFTA 2PTMA 3LWCA 1DGWA 4L2NA 4X4IA 1ZZBA 4X4DA 2PUFA 3SHRA 4K8FA 3CECA 4AVAA 2XI8A 2PIJA 3F51A 4R8HA 1O3RA 2KXLA 2XL7A 1FI2A 2E9QA 3JXCL 4O9GA 3UKVA 4EV0A 3UFDA 2Z2SB 2PUAA 3LISA 4HZFA 4PU7A 4X4CA 3D82A 4YG1A 2R1JL 4X6QB 5EZWA 4MGYE 2O49A 1UTXA 4ZU5A 1Y7YA 1UW8A 5J7MA 1O3QA 1ZX5A 4ZU7A 4HMZA 2XGXA 3H3UA 1O3SA 1PRUA 4I0AA 2BEOA 3OMTA 1NERA 4F8AA 3FYMA 4O8BA 1LKNA 1NYWA 2XHKA 4BYYA 4AVBA 2ICTA 3DKWA 3H1WA 3LAGA 4LEJA 1BDIA 2H8RA 2GRMA 4A2UA 2O38A 1XE7A 4KU7A 5JSOA 4QM9A 5FPZA 1DGRA 1O3TA 2WC2A 4XF1A 5K98B 3I54A 2GRLA 1NE4A 2V09A 5D1IA 3WW2A 5CVRA 2GZWA 3QYXA 1QWRA 4Q29A 2JCGA 4WBBA 3C3VA 3RPQA 3IWZA 3HQXA 1CAVB 3ZKCA 1UXCA 2AW6A 1J3QA 1ZRRA 2PYTA 2Z69A 1VP6A 3LOIA 2LYLA 1OMIA 4Z5HA 4MV2A 3E6BA 5LEKA 4Z82A 3BD1A 3RYPA 5A7LA 4QGMA 3CROL 1NXMA 2EAAA 4WVZA 5F1RA 3ELNA 3NKTA 2PQQA 4HVOA 1RUNA 5LRRA 2IU7A 3L1PA 2MHFA 5HI0A 4JV4A 3FFQA 1CAUB 2C0ZA 2XL9A 2ICPA 5BPXA 4TLFA 4DINB 3BU7A 4LA2A 4Q0UA 3B7HA 4I6TA 2EVXA 2XSDC 4OLLA 2D40A 2B8MA 3CEWA 1UD1A 1SQ4A 1OD5A 4EWDA 1LB2A 2IV1A 4ONUA 4IA8A 4RD7A 1YLLA 1B0NA 3FX3A 2UY8A 3EJKA 1R69A 3ROUA 1LCDA 4IETA 4GQMA 3I7DA 4XEZA 4Z5DA 1IPJA 2ETEA 3ES4A 2QNKA 1Y9QA 1CX4A 4EWEA 1ZZCA 3E6DA 4LTAA 4QX5A 2CSFA 3H50A 3CLPA 4IEWA 3E5XA 4I09A 1J59A 2CAVA 4E2GA 1J3PA 4PU4C 4FBIA 1OSLA 5I8YA 4JTOA 2LYRA 5EFUA 1SQ8A 4YG4A 1CAWB 1DZRA 1HF0A 2IXHA 3OTFA 4XFFA 1UIKA 4OFGA 3U0ZA 2PHDA 2AWIA 4JCXA 2IVGA 5I0SA 1RPEL 1J3RA 4J1XA 1OI6A 3OCPA 2PHLA 3ACLA 2XLGA 5JR7B 4YYOA 4AQ2A 4I0BA 2VPVA 4JCYA 1X2LA 2B5AA 1OCTC 2IXCA 2PFWA 2GC2A 4KWLA 3H1YA 3TRBA 3HZIB 5BXXA 1DZTA 3BDNA 4IEYA 4X4EA 1YUDA 1ZVFA 1ZRFA 1LRHA 1RL3A 1ZZ9A 1PM7A 4GULA 4IEZA 1CQTA 4FN3A 1RGSA 2HJIA 1FT9A 3JZVA 2P17A 2BGCA 5AVPA 2LYKA 2L49A 1WGPA 3UKNA 5C8WA 4UBGA 3KJXA 3BB6A 3CJXA 1ZZ6A 5KHGA 3MPBA 5JSPA 1RZRA 3PXPA 3IDBB 4AVCA 4X4BA 1UCXA 2KZ8A 1CAXA 4XFBA 4J1WA 3ES1A 1ZAYA 3DN7A 4B29A 3GN5A 2MNGA 5I93A 4IEXA 4XFGA 4PU3C 2B5HA 1O4XA 4Y42A 2PUGA 4HVRA 5CADA 3UKTA 3CO2A 4R52A 5BV6A 1JWLA 4YARA 1ZRCA 5I0RA 1WETA 1XWRA 4AXOA 1FXZA 3KSCA 1I5ZA 4Z58A 4HSJA 1ZS4A 4IEOA 3RNSA 4X4HA 3DNVB 1E3OC 1HW5A 4X4FA 1DW9A 5BUVA 1RC6A 4I3PA 3RZZA 5KHIA 2Q0AA 2L8NA 1RZRD 3U10A 3FE5A 2MPFA 4XF4A 2KEJA 3E6CC 5I0TA 3SMHA 3S0MA 3IIAA 3FWEA 2XJ3A 1EPZA 2O4AA 4NVPA 5J48A 4MX3A 3SCFA 2QCSB 1PNRA 4MGIE 2IVQA 3D1NI 3VK0A 4PIZA 2PUDA 4Q0PA 1WH8A 4XFIA 3FMYA 2IXKA 2MQKA 3D0SA 1X82A 1QXJA 4BIFA 1Q3EA 1L3JA 3LA3A 3NVCA 1VPWA 1WIZA 4PU8A 1GT0C 4HSLA 1NEQA 2UY9A 3RYRA 2PUBA 1S7EA 4P9GA 1LR5A 4UBHA 4UXAA 1RTVA 1L1MA 1XE8A 5KHJA 2XCJA 1XRUA 2N7GA 4I2OA 4QM8A 3RYKA 1QP4A 1ZZ7A 4KU8A 3H7YA 4HLTA 4FAGA 2FQPA 4KL1A 4D7SA 1LMB3 2GC3A 2BJCA 4E2SA 2CV6A 1ZVVA 4Z07A 3B02A 3HT1A 2LYSA 2H0VA 3O9XA 2D5FA 3SCHA 1Y3TA 2F4PA 3OF1A 2GZUA 1QPZA 1NE6A 2OYZA 1EP0A 2XKPA 3M3IA 2EBYA 2UYBA 1O5UA 4JQDA 4I6UA 2A6CA 1QP0A 3CF6E 5FQ0B 2O8QA 4JTNA 3CLCA 4F7ZA 3BCWA 4LLOA 1NZCA 3S7EA 3F6WA 2LCVA 4META 3LA7A 2MEZA 2QJVA 3QWGA 3EUSA 3LFPA 3JXBC 1I6XA 2HKXA 3E97A 2K9ZA 5FQ0A 4IERA 5LEJA 2FJRA 2D5VA 2Q30A 4XF9A 1CAWA 2GC1A 3M70A 4Q0SA 4Z5CA 4I02A 5CU1A 5E16A 5JCTA 2OZJA 4XETA 2Q1ZB 3I59A 5JSRA 4KWJA 3HIFA 1Q5OA 1H1MA 4NDWA 1QQBA 1U12A 4MGZE 4XFCA 5LRSA 2IXIA 2PA7A 1PRVA 4L11A 2IXLA 2D5HA 1WLTA 5JAXA 3IBMA 1QXRA 2QDRA 4Q0QA 2PPXA 1V70A 1POUA 3EQEA 4EWAA 2XLFA 1TQ5A 2LYQA 4GHJA 2KEIA 1ADRA 1J58A 3GBFA 1YFWA 4I8TA 1SFNA 3BALA 3S8QA 3H5TA 3OQMA 1IC8A 2UYAA 4IEPA 1PMIA 4MGKE 1JH9A 4CYDA 3ZDSA 4X4GA 4D7TA 3PNAA 1YWKA 1GQGA 2ATFA 4YNIA 2XIUA 2EWTA 4YG7B 3NSTA 3PVBB 5K8SA 3R1FA 3H9AA 1EFAA 3L2HA 2IXJA 3IDCB 3QOPA 2AXZA 3NJZA 3KMHA 3TNPB 1EY2A 4YBAA 1AU7A 2Y0OA 4QMAA 3O14A 4Q0VA 3QF3A 3CL1A 5E1RA 3SXWA 2ET7A 1SEFA 5I8SA 4IVZA 2CGPA 3EBRA 1IPKA 2FMYA 4BHPA 4QXKA 3OGJA 3G7DA 3F52A 1LLIA 4AQ6A 2R63A 1CAVA 4N9IA 5FPXA 3OP9A 3ZHMA 1OFNA 1LQCA 5FLJA 3MDPA 1PERL 1O7FA 3ETQA 2QVSB 1DWKA 2AXVA 1JFSA 2WFPA 1UIJA 2OA2A 2LYPA 3S7IA 5BY5A 3WW1A 5FCCA 3IVPA 4QGLA 4FBFA 3KCCA 3MLFA 3OD0A 2BNMA 2ET1A 3FZ3A 3MYXA 2H6CA 1GQHA 4PIYA 1VR3A 1PRAA 3FYAA 4MH0E 2IVBA 4QGNA 2OPKA 3D0JA 3NW4A 4XF3A 2OR1L 1CAXB 2XLAA 1YHFA 3OQNA 1UPIA 1ZREA 4HN1A 2IUOA 1YSEA 1RUOA 2OZ6A 4MZUA 4ZU4A 2K0GA
chains in the Genus database with same CATH superfamily
1RXFA 2WL1A 2YU1A 3KXAA 1C8M1 2GH2A 3I2DA 5HXMA 3ZXKA 2WN2A 3NMBA 3AJZA 4RQPB 4C1XA 2GNTA 2VY0A 1BVVA 1YJKA 4BK4A 3J7MA 1Z0HA 5B4NA 3F95A 2YPJA 3AZWA 5FXWA 2R49A 4TN7A 1HQ1A 4GB32 3WF3A 1NA1A 5I8TA 4MHRA 4ARXA 4RA0A 1CJPA 1Q43A 1JZ4A 4Q2FA 4BISA 5J1XA 1CZTA 2VVDA 5EJ1B 3U11A 4Q4Y1 2Y6HA 3ZN5A 5IAXA 3I3MA 3RDIA 5I91A 2JE7A 2SLIA 5F3IA 3R6SA 5F3CA 3JXSA 2Q4SA 2JD9A 3FHIB 4Q4X1 1UYPA 2XPJA 1O4TA 2B39A 2R1BA 1SBFA 4FAHA 2PLV1 1W28A 3V0AB 4F8DA 2CDOA 2G9ZA 2WFF3 3T0AA 1YXWA 4AFMA 1K5MA 2VZTA 2RHPA 4AAPA 4Y1ZA 1IKPA 2Q8CA 3RQ0A 4M01A 3S57A 5LA1A 2R6QA 4FT8A 4B7KA 1W8TA 3R4SA 1Z7S1 1E57A 1R64A 3J8F3 5FLIA 4XFHA 4LHSA 3G5GA 1AZDA 2E33A 2CAUA 4Y22A 1X8MA 1AR63 2BERA 2XJRA 2ZHMA 1JZ6A 5FDBA 3AP7A 1DU3D 1G6NA 2BP6A 5DUUA 2WKKA 4A44A 1VBE3 4CDUA 2Z4FA 4HBNA 1DIWA 2LS6A 2JVLA 1OH3A 4CDWB 3A7QA 2RS32 1AYM1 3HT2A 1MACA 2R061 1C57A 3KGLA 4TYSA 1T6GC 4XJ8A 2VECA 2PXPA 3BPZA 4I6RA 2A3XA 2IFRA 2ARAA 1IZ3A 1PO21 4NHXA 2IVJA 2PAMA 3QH6A 4M3CA 3TFLA 2GC0A 4TSVA 1AHSA 4AHWA 1YFXA 5C6CA 4OB4A 4QX2A 1VMFA 4PBPA 2WSUA 3O1RA 5FZ8A 2RS12 2AUWA 3I3EA 3WF2A 2R041 3DECA 2XKOA 3PLQA 3AKQA 3RMYA 4RR3C 1ND3A 1SLAA 4UF0A 4CDXB 4HPKB 4FTSA 4PIXA 5D8AB 3ZN6B 2ZGNA 4DRVA 4UFLA 3L2YA 4QT6A 2RR11 1CGPA 1A3KA 2HWD1 1RMU3 3O5SA 3UYJA 1HRV1 5CB7A 2LYJA 5T5PA 1W6NA 4V2WA 5DDJ2 5SV8A 4UW4A 5HCFA 4IESA 1UZ0A 1X7NA 3W5MA 4YRDA 1K5MB 5F9TA 1SACA 2KPJA 2X53S 2JG9C 4LA3A 3VDDB 3POJA 4XF0A 5CNAA 4CP1A 3EO6A 4E2QA 4I0WB 1AL23 3CU7A 3ZFFB 3PTYA 2CNAA 1X9PA 1AXKA 4LUMA 1RUI1 3WF4A 1DQ5A 3NV2A 3GZDC 1LHOA 3ST7A 2X29A 4YSFA 5FO7B 3DYPA 1SMVA 1QGLA 5JZGA 2G19A 4BQ5A 1JMUB 2XG3A 5B4XA 3USSA 2PTMA 4FTBA 1C4RA 1DGWA 2BWAA 4X4IA 1C8NA 2HYXA 2PUFA 1WZXA 2W92A 1STMA 1UOJA 2VMHA 3ZPXA 2VMDA 4AYUA 2XI8A 1GICA 4AVAA 1RJ8A 3F51A 4R8HA 3O1UA 1O3RA 2D3RA 4LHKA 4QXHA 5H9PA 5D2AA 2WWJA 1QJU1 3UKVA 1UF2C 3UFDA 4WZFA 4YZ1A 1DYPA 3VBUC 3H8XA 4H3WA 3ILRA 4X4CA 1FMD1 3I3DA 3GZCA 5HXVA 4UFKA 4Y22B 2O49A 2FDKA 1OOPC 2HCSA 4MLOA 1UW8A 1NT0A 1MVEA 3G6JB 1O3QA 4B4QA 3K4ZA 1O3SA 4I0AA 4YFWA 4Z8BA 1Z7S2 2RJKA 2W08A 3MW4A 4HANA 1HQNA 3FYMA 4FFGA 1LKNA 4ZS3A 3WX5A 2XHKA 4Y1UA 4R9AA 1K12A 3DKWA 4DFSA 4GXLA 3GXUA 3CBNA 3JBG2 1UU5A 1BDIA 4IV1C 2GRMA 5KC6A 5CFCB 4KU7A 5LW9A 5JSOA 3IZOA 3MW2A 1AR72 2ZGQA 1DBNA 1DGRA 4QM9A 1UMIA 2WC2A 3MFAA 4XF1A 3I2JA 4BPZA 4RS5B 3CZUA 3I3BA 2V09A 2JXAA 5HBAA 1EUUA 5F32A 3DUIA 3IPVB 1WCQA 3QYXA 4M3CB 1TMF3 1V6KA 2AEZA 1OLMA 2XUEA 4XMAA 5AC91 5CFDC 1WMFA 2CU5A 3HQRA 5LK5A 1KGYA 1CAVB 3ZKCA 3LOIA 2C9AA 2X5IC 2EIBA 4OYUA 2YGMA 3E6BA 3VDDA 5EV7A 4Z82A 2LW8A 5ABJA 3RYPA 4AF9A 5A7LA 4XACA 4JDOA 4DUXA 3CROL 4WVZA 1W8WA 3POYA 4AE2A 3NKTA 4D6SA 2J7UA 1ASJ3 3VBRC 5A3LA 5LRRA 1FOD3 3RI9A 1DG6A 2V3CC 4YG6A 1JYTA 1Q8QA 3A0KA 5CZKA 2GSYA 2VZOA 2DCKA 5CKMA 4OI0A 2ARBA 3MIBA 3MUZ1 1XYPA 3K48A 5LBCA 1S2EA 2WZR2 1XB9A 5F3GA 5A6QA 1NKGA 1OD5A 5HV0A 1ZM1A 2C4XA 2R30A 2IV1A 2QQWA 2X09A 1Y4WA 3MHZA 2CGOA 2DVFA 4GMP1 3OG2A 4C0HA 2WA4A 1GMMA 3USUB 4CDUC 4W6WA 2UY8A 1D4M3 1LCDA 3ROUA 2G9GA 4Z5DA 1DQ4A 4FP2A 2YFUA 1Y9QA 5KWRA 4XXPA 1D2SA 4WVMA 3OKZA 2CSFA 2D6LX 2Y6LA 4IEWA 5C4WC 1SLCA 2OKXA 4D3WA 4E2GA 2R0HA 4JGZA 2C6SA 5I8YA 1W6MB 4JTOA 1SQ8A 2VMFA 3KT1A 2DFCA 4HOOA 2CGNA 3WNNA 4PLOA 2WZPP 1RUE1 2VTXA 2AWIA 1OC1A 1W9SA 2FMDA 1DYOA 1LESA 2ID4A 1J3RA 1XJAA 5IUQA 5I0SA 2JIGA 3AYCA 3OY8A 1FPN1 2Q8DA 4YYOA 1X33A 2DTWA 3AKRA 5FWEA 1HB2A 2HWF2 3VBHA 1H8VA 4JCYA 5ABJB 4HT1T 5L9VA 4EK9A 4Q4V2 4M4PA 4BXFA 4E9KA 3SEEA 1YNAA 2AZ5A 4QX7A 4WM8B 1W0PA 4KWLA 1VPHA 1RUI3 2UWAA 2NQYA 1OLME 1GZ9A 2HBTA 3DXUA 3H1YA 5FP9A 4AGGA 4B4PA 5BXXA 4LBQA 4FP3A 3D8CA 4X4EA 1HX6A 1YUDA 1LRHA 2AREA 2UU8A 1ZZ9A 1D2QA 3GCXA 4QPGB 3ZSEA 4D0QA 5I0DA 3WNOA 3ZN4A 1JN2P 1S1AA 1YRZA 1EAH2 4ZS2A 1K45A 1G9AA 5K4LA 1RMU2 4K9SA 2HJIA 2RM22 2VOVA 1W6OB 2ZTNA 3Q8AA 4CU8A 1R091 2RDRA 4AEDA 4NRPA 1ULCA 4UBGA 1WCKA 2CL2A 5CAZA 4PCRA 5ISLA 4OUMA 4PDWC 3VWSA 1H2KA 1ZZ6A 5G04L 2WT1A 4JGYA 5IVBA 1LOBA 2VUCA 4CEWC 1PZ8A 1PGW1 3JCIA 4YW5A 1QH7A 1DLCA 3HVDA 5DPNA 1CAXA 2W0XA 4GAZA 2QTWB 4OI1A 3GHMA 5JIAA 5GLWA 5I93A 4F83A 1GR3A 2RMU1 2ILMA 1DP0A 3LEKA 4GH4A 4P9IA 1RUG3 3UKTA 4RYDA 4QQPA 4AVSA 1QIQA 5BV6A 2IZWA 3OEBA 2QFEA 4YW3A 1SG3A 2GN3A 2ZGOA 4LBQD 5F37A 1WETA 3BIWE 1R1A3 1YCIA 1AR93 1VBD3 5FP4A 1VAMA 1QJU2 4ZZ8A 2JE9A 2XVLA 3T1LA 2Y8KA 5A3UA 3O0WA 5LBFA 4IEOA 5FZMA 4W6XA 3APBA 3LEGA 2R073 3BOWA 4NHLA 2I2SA 3AMPA 3PVNA 4EJRA 3INAA 4X4FA 1OUSA 5FMOL 1D4M2 2Y38A 1DW9A 2ZKNA 4UAPA 5LBEA 5JDBA 3IDAA 4I3PA 3RZZA 4KNCA 2L8NA 2MPFA 3HJRA 3BIEA 3V56A 2QQNA 3NV4A 1NCRC 3GZTB 3IIAA 3FWEA 4BLIA 3SH5A 3VBHB 4A6SA 1RVF1 4CCEA 1JYXA 3GUUA 1OF3A 3J8F2 4CXYA 1TNFA 5FPUA 5F5IA 3WDYA 3VK0A 1LOGA 5DAPA 5FJHA 2MQKA 5GKAC 1E5RA 2C9KA 3K2OA 2L9LA 4LPLA 3MW3A 2A6YA 2ZJCA 1Q3EA 3GZUC 3P1IA 4ZY9A 3UJOA 1WIZA 3V0BB 4PU8A 2WNVB 5CBLA 4Z92B 4W65A 1LR5A 3HWJA 4UBHA 3V0AA 3GZAA 1OVPA 5KHJA 1XRUA 1HDKA 4JDNA 1OPOA 2JKXA 4NHKA 5FZAA 3PL0A 1RHI3 1ZZ7A 1JBCA 1PX4A 3H7YA 3I3QA 3IMMA 4HLTA 1W06A 5FXVA 1ACCA 1HRI3 1XNDA 2FBEA 3RWNA 1LJ7A 4A4AA 3VZKA 4E2SA 2D6KA 3B02A 4Y26A 4MGSA 2A3WA 2O0OA 2LYSA 2W39A 4IV3A 3CJIB 4RR3A 5FY1A 4GWJA 3RJ2X 1QPZA 2PHXA 2VD7A 4LORA 4MGTA 2ZEWA 3KQRA 4NUBA 1QNWA 2A5ZA 3I2FA 5C8CB 2UYBA 1O5UA 2QQUA 3SEPA 4L0PA 3I49A 4NWVA 1XNCA 3BN6A 4Y5Z0 1BK0A 3S7EA 1XOYA 3F6WA 4META 4Q4W2 4DNYA 1SBDA 1SHWB 2IWGB 3BODA 2MEZA 2QJVA 1HXS3 2HYKA 3T2PA 4LBLA 3QWGA 3JXBC 3LFPA 1NY72 4Q4Y2 4AEDB 5LEJA 1SPPA 5A7SA 2FJRA 1NQDA 3I97A 4FQZA 4LOTA 1X50A 5FYBA 3S5AA 3MEJA 2GC1A 5E16A 4OUEA 4XETA 1LOAA 3ZYGA 3I59A 4BWOA 1UXZA 1AR61 1OPMA 3HIFA 1U12A 3ON7A 3AVSA 2XR4A 2FCVA 1PRVA 4L11A 1SZBA 1WLTA 1TE1B 3MLJA 3ZFEA 2VUDA 1LHVA 1PM4A 2QDRA 4Q0QA 2WAAA 4JKKA 3O1OA 4OI2A 2WO3A 1FOD1 3WY6A 4QB1A 4Y5SA 5GZFA 2EXHA 4RS5A 5E8AA 1URXA 2X10A 2YC4A 1RUF1 2UYAA 2WT2A 5T54A 3IPVA 4XC9A 3EYPA 3ZDSA 3N3HA 3PNAA 1EV12 1VBD1 4M00A 1IG3A 4UFMA 4A3ZA 4DOUA 1GQGA 1LHNA 1Z78A 5JPMB 2NP0A 4YG7B 2JDZA 2HCNA 1AXZA 2UURA 3L2HA 5JOZA 1XYNA 5ERLA 4QKFA 3IDCB 3VL9A 4CDQA 4KGQA 1JZ7A 3DPRA 3TNPB 3GF6A 1TNRA 4ER7A 3LFMA 4QDRA 4B1MA 4YBAA 1WD4A 1DQ1A 2Y0OA 4TWTA 3UV9A 2D97A 4QMAA 3O14A 3VD5A 2J42A 3SXWA 1SEFA 5I8SA 3RZMA 1LTEA 4BZ4A 4YPJA 3QH7A 4R4ZA 2FMYA 5DN2A 2JIJA 4AQTA 5KC5A 1OOPA 3G7DA 2Y6KA 4QHBA 3QBQA 3B3QE 3POFA 4AQ6A 4LKEA 1CAVA 5D21A 3VHOA 2VULA 5FPXA 2WUHA 2AGSA 2GDFA 1KDKA 1UMHA 1OFNA 1ODMA 1W3VA 5FLJA 2GP5A 4FQ4A 1QMJA 4MSVA 3VZMA 4Q2JA 1O7FA 1UAIA 3HNMA 4FXGB 1HV1A 4KI5M 4LO8A 4NRMA 1DWKA 2OA2A 1LOFA 1UL9A 4K40A 2JDUA 4ZXKA 5L19A 3T4HB 1VMJA 3ZFEB 2VW1A 4QGLA 4FBFA 4Z2WA 1V6LA 2BNMA 3WF1A 3GZEA 4XCAA 3VBRA 3T1MA 3KHCA 1BBT3 3N9NA 3BTYA 5JUWA 2G4IA 3UWPA 3FYAA 4Y20B 3O1MA 1HQWA 2IVBA 4MH0E 5L9RA 5GZGA 1OSGA 2A75A 2OPKA 2QQJA 4PQQA 4ZKTB 1JOJA 4FPYA 1UN1A 4P14A 2XXAA 3TEPA 1UNBA 1UU4A 4XZPA 3AC0A 3D3AA 3VDDC 5AC92 2OZ6A 3BI3A 3JD71 5LCWL 2Y6JA 2SBAA 2ZGLA 2VC9A 3WUCA 5T55A 1V00A 5FZDA 2ZGMA 4ZPIA 1BCXA 3MZHA 3DV8A 1WKYA 2I45A 4R9CA 2FDIA 2ZGSA 4OCTA 1REDA 3AP5A 4JRAA 1PVC3 3NJYA 1B09A 5GZDA 5J3UA 2KEKA 3CKHA 5EYYA 1D7PM 4GALA 2JECA 4GQ7A 4ORFA 5IWFA 3GDBA 1UY0A 5KBFA 5FZ3A 1REEA 4NAOA 3D5OA 1UYYA 1I5PA 3B93A 5LWBA 2IC1A 2GALA 3ZXJA 4Q4X3 1CJGA 5ACA2 4FOYA 2BGOA 3USUA 2R072 4XURA 5C9AA 4LJHA 4RGGA 2BNOA 5FUNA 3PURA 3OQOA 4BH9A 3HMYA 1IS3A 3H0OA 5DQ0A 3UGFA 3KD4A 4YVSA 4IDZA 3C2UA 5IVJA 1HKDA 3NXHA 4IE5A 2PUEA 5IAVA 5FY7A 4BQ4A 2VNGA 3TEWA 5FPAA 4AGVA 2DVDA 4N90A 2QQPA 5FIXA 5IK4A 1TME3 4CPBD 1EYBA 3ZN6A 1J84A 3J4UH 3PMSA 4IV1B 3M9LA 1ZZ8A 1NLSA 2D43A 3NRUA 3VD4A 4QX8A 4XW3A 5FLHA 2JQEA 4XILA 4QPIB 1ENQA 1RZSA 2J1VA 3KL4A 2PAEA 4IEVA 1G9CA 3LFIA 1U2ZA 1GSLA 2EIGA 4CP9A 2CROA 1BJQA 1KDMA 5AVAA 5IK7A 3FLRA 4LLOA 1C5HA 1JW6A 2D93A 4MGQA 1QF3A 4URAA 2VCCA 2PHWA 1X8EA 3VLBB 1D0HA 3MF6A 5FZ4A 3JXDL 3L9JT 2DTYA 4DY3A 2BNNA 5FTTC 2XHNA 4YZ5A 4NR1A 3O12A 3A21A 3H8RA 2HWC3 2OIIA 4PJYA 1US3A 2QQIA 2VZSA 3M3EA 5DTMA 3FFZA 3H1MA 3I2IA 5KXEA 3PHMA 1SLBA 1PIV1 3TBDA 1RVF2 1CR7A 3H7JA 3OBZA 2VW2A 4H14A 3VZJA 4NHYA 3KZ3A 1VLNA 3M3OA 2QDNA 3MV11 3C7EA 3TN92 3TEYA 2VNRA 3MUY1 1QQAA 5C8CC 3FHAA 4QKNA 2JDYA 2VQTA 1IKQA 4LMFA 3TNQA 2BUKA 4CU9A 4MO3M 5FZ0A 3WW3A 3NJVA 5DAWA 4MUVA 4GH4C 4YGDA 1RITA 3QACA 4EZIA 1RUC1 3AKSA 3MICA 3I2KA 3OGVA 4AAXA 4DZGA 1X36A 2W1WA 2OFYA 3WD5A 1VBC1 1AYN1 3BUCA 2JDKA 2HSGA 2XJUA 2HWD2 5JI7A 4LLFA 4FSJA 2EF8A 4PDWA 3H8OA 3M3CA 2RJLA 2D3SA 2WIIB 4CEWA 2EA7A 3MFCA 2DF7A 3OJBA 5FREA 4QDQA 5G05L 1WLCA 2VUJA 3JB4C 1FATA 1GNHA 2BVVA 1UKRA 3PJYA 4LE4A 5GLTA 4TLGA 1N3QA 3J7HA 2RS51 4GKXA 3KV9A 5SV5A 3F2ZA 1KXGA 3DF0A 4AEMA 4CP9B 3THDA 3LWCA 4YM2A 3K3NA 5C4WB 4YGEA 3ENRA 3NQHA 3VZOA 1I9RA 3P3PA 4K8FA 3LE0A 1UY4A 2QE3A 3NWKA 3I2OA 2PIJA 3KLSA 4QU2A 1BEV2 3JXCL 2E9QA 2FDFA 1C1FA 2Z2SB 2PUAA 3BPSA 1NQJA 4YG1A 1X9TA 2R1JL 3C7OA 3WNLA 1DLLA 4CEYC 5J7MA 1ND2A 3OPTA 1ZX5A 4XQDA 1PRUA 3OMTA 1NERA 4N43B 5FAXA 3AM2A 3Q8CA 1RUD1 1GZTA 4O8BA 1EV13 1WW4A 2PLV3 3MPPG 1AX2A 4GJZA 1XXNA 4HK8A 1CN1A 2D7FA 3WQBA 1KEXA 3ITQA 4XVHA 1R1A1 5DG2A 4CRQA 5DAQA 3UK9A 1OH4A 3LQCA 3WP3A 1QOTA 3I54A 2VXJA 2HWF3 1XQNA 2GRLA 4HL0A 4IV3B 2ZAAA 1JH5A 1G9BA 1PO22 3AP4A 5L9BA 4R4XA 5FO8B 1JZ2A 2RR12 1GANA 2PXLA 3OPZA 1UZZA 1EAH1 1RHI1 1W8FA 4FPFA 3KWVA 4Q29A 2WDBA 1A78A 4WBBA 1AXYA 3IWZA 1ZA7A 3HQXA 2AW6A 5FKBA 2R042 3PIGA 4MV2A 3O0VA 2LYLA 1OMIA 2P3KA 3AXEA 3NZLA 4QQLA 3MIGA 1Y9GA 2OXBA 4CUCA 1AYM3 1JYIA 4GWIA 1A6CA 1GOFA 2WNVA 3AZZA 2J1TA 5LEKA 1XC6A 3BD1A 1VB4A 3K51A 4LBKA 1OA3A 3ASIA 3RSJA 3SQOA 2EAAA 3NNMA 5IVCA 2PXKA 2BFUS 2PQQA 4HVOA 3J7NA 4JKMA 2IU7A 3QCWA 1G9DA 3S30A 3MLKA 2MHFA 5BNNB 2P34A 4A7ZA 1BYHA 3LEIA 3JUUA 2C0ZA 3P5BA 4KQ7A 3HAGA 4TLFA 1LAJA 4LA2A 1GWKA 2EXKA 2LLVA 2WNUB 2NM1A 5GZCA 3VHNA 4COYA 3B7HA 4I6TA 3JU9A 1V6NA 1KS5A 2XSDC 1O4ZA 5J09A 5JXJA 1XNAA 2B8MA 2DYCA 3PU3A 1B35A 1UD1A 1SQ4A 1ULEA 2I07B 1C1LA 2PXVA 5CYYA 5F7UA 1VBB2 2ZHNA 4BE3A 3UL2A 4XOGA 5C4WA 4IA8A 2DV9A 2HWD3 4RD7A 2DBNA 5C5TA 1B0NA 2FD8A 4WV8A 5F2WA 1S0DA 3POWA 2A7AA 2BOIA 4NIAA 1LGNA 2WBKA 1W39A 1J83A 3OGGA 5F6KA 5GLUA 3IDEA 3KT7A 4XEZA 1IPJA 2ETEA 1OOPB 2QNKA 1CX4A 1WW6A 2PXUA 2YZ4A 2DU0A 3E6DA 1OQEA 3NNLA 2CDPA 4EN0A 2AH2A 2QUOA 3ZYFA 3O1VA 2NPIA 2ZGUA 3E5XA 2YV8A 2CAVA 2VE1A 4N53B 4NIIA 3VBHC 5C3SA 5CKNA 1W9FA 3A9YA 1W2NA 1QJX3 1TZOA 4PU4C 3AL5A 4Y3OA 5APAA 2CSGA 3ZPYA 1COV1 2OT7A 3VD7A 3WDTA 4YG4A 1CAWB 4FPJA 4PLNA 4QQOA 5LA0A 2W2IA 1JI6A 4XFFA 3WNMA 4JQTA 4SBVA 4P5YA 4OHXA 3TN91 1Q56A 1W9WA 2YUEA 3UETA 5E89A 4CCJA 5BNPA 1JYWA 5C8CA 2OQ6A 1RPEL 5EYXA 4J1XA 2XUMA 3WP4A 2PHLA 3WF0A 3OYWA 1MEC3 2W47A 3AK0A 2E32A 4QXCA 2VPVA 4DO0A 5FMBA 1DFQA 1X2LA 1Q8SA 1S55A 1H4HA 3T4VA 3WQ0A 3ZVXA 3BU0A 4K1ZA 4CVUA 5C5UA 2PFWA 3CMGA 2VNVA 2GP3A 4XJUA 2WINB 2NLRA 3QOWA 1OLRA 2C1FA 3TRBA 3HZIB 3KVBA 1R1ZA 2C26A 5KR7A 1DZTA 3CJIC 5K7PA 3BDNA 1V9U1 1ZVFA 1FAYA 2J7MA 2A3YA 4KG8A 4YW7A 3RZLA 1ZRFA 4OZOA 4M0NA 3AP6A 1QOSA 1NCQB 4LO6B 4Z2AA 2AYHA 1RHI2 2R0FA 2V4VA 4R9BA 4ASKA 4AI3A 4IEZA 4BXSV 1RGSA 1R081 4EN7B 4CCCA 4LBQB 3QLQA 1H8TC 1UOFA 2VO5A 5FFOC 5AVPA 3O1SA 3W59A 3HBZA 3BB6A 5DZFA 3QOXA 1FPN3 1XNTA 3ZX7A 1RJ7A 1U5ZA 2W52A 1CZSA 1EAH3 2VNOA 1RZRA 4FI9A 4I30A 2LNMA 2QQMA 4ZONA 2KZ8A 4XFBA 1GNYA 3T2OA 3VBOC 4BA6A 4BMBA 3I2HA 4Y1VA 2YDEA 1ZAYA 3DN7A 3FHQA 4B29A 2D3PA 1O8PA 2CTVA 3GN5A 2MNGA 4CUAA 2VMCA 2W91A 4IEXA 4NWWA 4PU3C 4XFGA 1CX1A 4DE9A 2B5HA 1C28A 4MADA 2ZPXA 4OULA 4D6RA 1ODNA 3THCA 2V5YA 4FOWA 4LO4B 3A23A 1W9YA 1YQ5A 2IVIB 1UX7A 4K1YA 4YVSB 1H0BA 1XWRA 3KSCA 3AX4A 4ARYA 1GP5A 4LIUA 3UGHA 2P37A 2ZMKA 4C91A 4HSJA 1ZS4A 1UU6A 3MO4A 3GCWA 1QJEA 4UWDA 4X4HA 1E3OC 3RS6A 5C3QA 2WJSA 1F5JA 1HW5A 2XONA 5FZOB 1PVXA 4M3CE 3T2QA 5FY4A 4OHVA 1AR71 1R1A2 2VQ0A 5FZ1A 1VBD2 5L7OC 4XJZA 2OW4A 1RZRD 3FE5A 5F8PA 5JXGA 4YG0A 1OLQA 4DMIA 2FDHA 2KEJA 2GNMA 5A70A 5HPOA 1OBNA 1W0NA 5FUPA 3S0MA 1BBT1 4AI1A 3WNPA 2PXQA 1EPZA 4YG3A 2TEPA 2WQZC 4G3YC 3UGGA 4AGRA 5J48A 2E63A 2VZ1A 2ZHLA 3GM8A 3WVJA 3T0DA 4YVWC 3SCFA 1AVBA 3FMYA 1CJDA 1ASJ1 2IXKA 2TUNA 2HWB3 3D0SA 4EE2A 3VBSA 2AEYA 2WWUA 5D8AC 2P6CA 3J8F1 1L3JA 3KHBA 3PDQA 4GWMA 4N53A 1QU0A 1XSQA 2UY9A 3RYRA 3RZHA 3JBG3 5FK8A 1O4YA 3LGRA 5A7WA 3RFRA 1K5JA 1RTVA 1L1MA 1VBA1 1XE8A 2MEV1 3MGUA 2N7GA 3AMQA 3WNXA 3NAPC 4Y1XA 3TN93 4QM8A 1W9TA 1JS9A 1HB3A 3RYKA 2JG8B 4KU8A 4YW6A 2D6OX 3ZXGA 2ZHKA 3POEA 2Y26A 1HIXA 1HXS1 4FAGA 5A80A 1QXPA 2P6HA 1QQP2 3OOXA 3TWIA 2CV6A 2I74A 3ACIA 4CZSA 3MLLA 4D7YA 2W1SA 5T5OA 3O9XA 1CQ9A 3FLPA 3N9OA 1Y3TA 2F4PA 2JD4A 3MIFA 3CZJA 5JMOA 1NA1B 1XU1A 3R4UA 3DKQA 2VCBA 3R09A 3AJYA 5FZ7A 3LD8A 5CEHA 2WNEA 4DUWA 3M3IA 1LHUA 5IK8A 2P4EA 3WCRA 1OKOA 3LPGA 5DDJ1 2OQ7A 4I6UA 1RUC2 3CF6E 1SPPB 2O8QA 3QFIA 2Q1FA 3D4KA 3WP5A 4AFCA 1PZ9A 1NLRA 1YQ8A 3LA7A 1ND2B 1RUJ1 4FPOB 2HKXA 1I6XA 3AMHA 3X29B 1RUNA 1LOEA 3E97A 4IERA 2BJSA 1AF9A 1D0GA 3KZ4C 4XYXA 4HFSA 4Z5CA 4I02A 1L7LA 1WUVA 2OZJA 4GZ9A 5A7QA 4CDQB 4PF1A 3B9IA 1APNA 4UW3A 5FYVA 4D94A 4Q8LA 2ENRA 2ZGPA 2A6ZA 4XBQA 1AJOA 1Q8PA 4Q4Y3 1VBB3 2ZEYA 2QZ3A 5JAXA 2KD7A 1R092 1WCDJ 1QXRA 3IBMA 4Q4X2 5ACA3 2CY6A 2PPXA 1NAEA 1IOAA 1JU3A 3EQEA 1PMJX 1TQ5A 4IW3A 5CKQA 4EYUA 4GHJA 2KEIA 3GBFA 4QQHA 4I8TA 1O8SA 3BALA 4R9DA 1N47A 4COVA 3OEAA 2ZXQA 1PMIA 4U2AA 4IXLA 4D7TA 4L97A 5IFPA 1SBEA 5IVEA 2HWE3 1PIV3 2ATFA 2ZMNA 2RS33 4XDOA 2XIUA 3TYJA 4BU2A 5C33A 1JYNA 3NSTA 4OZXA 1FMD3 1MEC2 4NPLA 1UO9A 3ZYHA 2F6BA 2L1PA 1H8TA 1EFAA 3K75B 2IXJA 4RHV2 4DXTA 1QJY2 1G9FA 1MS1A 3KMHA 1EY2A 1MS4A 2HWC2 1VIWB 1K5MC 4S2HA 4ASMB 1AYN3 4MXWA 1W8ZA 4J25A 2NMNA 4Q0VA 3IT8A 3QF3A 1XNBA 4CCKA 5E1RA 5IVYA 1MQTB 2LROA 1QJX2 2VZ3A 1QH6A 3HNBM 1IPKA 1ND3B 4UF0B 2VEOA 3A0NA 4XUQA 5FMCA 4BJ0A 4CEYA 3VN4A 1L7RA 1CZVA 1LLIA 4CPBA 3KT4A 1PO11 4COUA 2B46X 1YI9A 1PGSA 3OP9A 4YW2A 3SLIA 5DRTA 2W87A 2DCJA 5FP7A 1QNYA 1S0IA 1PERL 1XBFA 3ETQA 1DHKB 2XJTA 4DPNA 3WHUA 2VBPA 5CG9A 5C9AB 2WFPA 1QDCA 1UIJA 1GKBA 5BY5A 2E7TA 2PHFA 2DVBA 2WSVA 2YBKA 2PHTA 3WW1A 2YPDA 4MYEA 4AI9A 3IVPA 1XU2A 1H1AA 4CXWA 3VUOA 4Q1PA 1RMU1 3MLFA 3OD0A 4Q4V3 4XBLA 5FYMA 3FZ3A 2P3YA 4PQ9A 3IKWA 1WLWA 5FYTA 5IHRA 1MS0A 2OPWA 3N9LA 4ES8A 1GQHA 4PIYA 1D4VB 5CG8A 1VR3A 5F5CA 1GZCA 1RUE2 4WM7A 3NDBB 3WXPA 1W6QA 4LOSA 1GZWA 5JMCA 4XF3A 1CAXB 4DS0A 2TNFA 4P00B 2XOMA 1YHFA 2BOJA 4K20A 4K6BA 1AR92 2BWCA 1ZREA 1RUD3 4X8NA 2RMU3 1JHJA 1G7YA 2Y64A 5FXZA 1OD3A 2CWMA 4Y4RA 1RIOA 3UESA 3B00A 1DF0A 3TEXA 4LITA 3ZKUA 3KV5A 2WN3A 4HPKA 4IGQA 3VBSC 4A3XA 2PUCA 2ZEZA 1ZPQA 2P3IA 3PUSA 1GU3A 3GNEA 4P9YA 3THPA 4ATEA 4YVSC 4DIQA 1ZBA1 5C7GA 1QJZA 5JXIA 1WLDA 2DCTA 3EXUA 2Q8EA 4AI0A 2FZ2A 4CU6A 3SCGA 1OQ1A 4AK3A 4AZZA 3NAPA 4EZHA 2O1QA 2BZDA 4IE7A 5CFCA 2WUSR 2ORXA 2X5IB 4P9XA 4HVQA 1JOPA 2A70A 2W68A 3EB7A 3SC7X 5KXDA 2OVUA 3ACHA 3I2GA 3O1PA 1KS4A 5FP8A 3KGZA 3FBYA 3POIA 3QQ6A 1MPXA 3GJAA 4IGPA 1ULOA 2B7YA 1J1LA 2RDNA 5FZBA 4BB3A 3M8LA 4N43C 4QHZA 2HWE2 2YYOA 3O1TA 1RINA 3BS3A 4WZCA 5BNPC 1NG0A 4XJ9A 1COV3 5FYCA 1KQRA 2FFHA 1X57A 5EWSA 1O59A 3AYDA 5LBBA 3HPNA 3W21A 1HRI1 3S5QA 3BTZA 3U3WA 4TXWA 4QPGC 5E88A 4E4HA 3J7LA 2VZRA 4JCKA 5FPBA 1W6QB 5GJ6A 3WW4A 4AEDC 5K9YA 1VJ2A 4LO7A 1F9KA 2NZ9A 4W50A 4MOAA 5BNOA 2DUPA 2WNOA 3E5QA 1NCQA 2D44A 2RS13 4XMIA 3WDVA 3CJIA 4Z59A 3K46A 4LBJA 4YM3A 4LO5B 2YBPA 4YZ3A 4KWKA 2JDPA 4Q27A 5IYYA 3ME2A 4O7XA 5FP3A 2AACA 3LF7A 1OUXA 4DEVA 5DUVA 5FKCA 1QY4A 1QZXA 2XQRA 2DVAA 3K3OA 4FPGA 4RSUA 5FZCA 5KHHA 3AZVA 3RZGA 2GAUA 2RR13 1ZRDA 1WA4A 3DM5A 2BBAA 1YFYA 2LRPA 5LASA 3BTAA 3I59B 5A7OA 4MCTA 4FTEA 2PAKA 5ANNA 1W2OA 4EROA 2R043 2VQAA 2VMIA 1O91A 1JUHA 1PGL2 1ZNPA 3M7AA 4LUKA 4CU7A 1WBFA 4COZA 1CAUA 4DY5A 5DT2A 3KF3A 3WHTA 3DPRB 3EHKA 1WMEA 4AI8A 3ZYPA 4W6YA 4HETA 4HXCA 1ASJ2 1GYKA 1QEXA 1UYXA 1ND2C 1R093 2B42B 3AKTA 3CIHA 4P9JA 2CHHA 5FR3A 2PELA 4IE6A 1FX5A 5LATA 4EN9B 4WM7B 5FXXA 1M4WA 4S2GA 3SITA 4CDXA 1OXCA 2WZR3 3LDRA 1PO13 2X5IA 2ZGKA 3R4DB 2GMEA 1REFA 1R63A 1PHMA 4KBZA 2B9UA 5EJZB 1W0OA 1YQ2A 1KJLA 5FZEA 5IT6A 1UKGA 1HXS2 1NCRB 5A6ZA 4L8QA 4AEJA 3HEIA 2YMZA 1OT5A 3SKJE 2Y0IA 4FO9A 5BNOB 1UOBA 1H6XA 4M0HA 2XH6A 3DCQA 4X4DA 1V0AA 1QJY3 5H9RA 2BFUL 3SHRA 3CECA 1PVC1 1Q8OA 3KV4A 1S0EA 3RMXA 2WYFA 2XL7A 4O9GA 4LNVA 1AX1A 4RQPA 4EV0A 4DRRA 1BKZA 2VXRA 1ZRIA 4PU7A 3C8XA 3D82A 4HZFA 4XJWA 4XUOA 2WNVC 1YI7A 4YWAA 2IUWA 2J1AA 3Q8EA 4XDQA 5FZ9A 3WLUA 1UTXA 4OUSA 4ZU5A 5IW0A 1R082 3NO8A 4G9SB 2XJPA 4BQWA 2DUOA 5GAGi 4ZU7A 5AFBA 3H3UA 1C3HA 1PGL1 2MEV2 3ACGA 2BEOA 1WCUA 5DABA 1H4GA 2JDNA 4NRQA 4Q5OA 4BK5A 1P8JA 2RJ2A 4XUNA 3AL6A 2XJQA 4JGYB 1NLQA 2YB7A 1JXNA 4BYYA 1PIV2 4AVBA 3H1WA 4LEJA 3VZNA 5FO9B 2H8RA 4IQPA 4A2UA 4XUPA 3MV01 3TB0A 5FPZA 3BGAA 2P3JA 3VZLA 5FPLA 1RUH2 2G1MA 4JGZC 3VBUB 3WW2A 3KS7A 3RJRA 1VRBA 1Y43B 4PI2A 1QWRA 2M4HA 4CUGA 3JQXA 1VB2A 2Y34A 3ECQA 2JCGA 4XJAA 2TBVA 3C3VA 3Q8FA 3RPQA 1AUYA 3VKFC 4WVVA 1UXCA 1ZRRA 2PYTA 4P08A 4CSWA 3W5NA 3NV1A 4BQ1A 1DGLA 4XTMA 5FOBB 5HV4A 5JIUA 3B01A 2Z5WA 4CDUB 3ZYJB 3HD8B 5AC93 1JZ3A 4Z1VA 3HOBA 1NXMA 5J37A 4LBMA 3ELNA 2RM23 2XB6C 3JB8A 1UY1A 1N3OA 3HNYM 4BMEA 1JHNA 3L1PA 3ACFA 5HI0A 3V0BA 4JV4A 4I2OA 1CAUB 3ME5A 4RS5C 2ICPA 5BPXA 4DINB 1ENXA 3BU7A 3AVRA 3BVCA 1DQ6A 3NNJA 4FXKB 4N43A 2HH9A 4Q0UA 5DG1A 4HONA 1AL22 4CA9A 1ULGA 1MS9A 2D40A 4GMP3 4QWNA 1MVQA 1E5SA 4EWDA 1PNGA 2GN7A 1LB2A 1LNSA 3ETPA 2KA3A 2A1XA 5IJRA 3DYOA 3N7LA 1YLLA 4EKGA 4QPIC 1VBA3 4MVTA 4CCDA 4E4ZA 5LZ6A 4QKBA 3FX3A 2XWBB 1R69A 2VMGA 3KQ4B 2ORZA 1ZBA2 3ES4A 4CEYB 1IGOA 1PMHX 1SDDB 1YO8A 2FDJA 2RE9A 3WR0A 4EWEA 1ZZCA 1LODA 1RUF3 3H50A 4QX5A 2C24A 5EP9A 3AYAA 1K42A 3WP6A 2RM21 3WNKA 1JU4A 1BZWA 2EIDA 1I3HA 3IN9A 2EIEA 2LLWA 3ZKYA 1SLIA 4FBIA 2E6VA 5H9SA 2LYRA 1AR91 1UOGA 5EFUA 5JWPA 3OTFA 3SKVA 1Z7S3 5T5LA 5A3WA 3GALA 1JZ8A 4KMQA 2QQKA 4JCXA 4NJ4A 1BMV2 1COV2 1L7QA 4ISQA 1H9WA 3S6PA 3T30A 4A6OA 4JHZA 1OI6A 3OCPA 4ET7A 3ACLA 1R083 2Q1MA 2XLGA 4AQ2A 5CIRA 1F31A 4I0BA 5FV3A 2BDRA 2ERFA 3GHNA 4XIOA 2B5AA 1IG0A 1JOBA 1W2TA 3LIHA 1OCTC 1N1SA 4FOQA 2IXCA 5LA2A 2EALA 4OHZA 4DUVA 5K0UC 1UXXX 2GC2A 1SDWA 3RZJA 1S0GA 1UY2A 1W6PA 4Y5TA 1RVF3 2B9VA 2W94A 3ZFFC 2PHRA 2JDMA 5JUVA 4PIZA 2WA3A 3LKJA 4TTGA 1RL3A 4UW5A 3KF5A 3VDCA 4QPYA 3HN3A 4HKOA 4P5HA 3VBOA 5FMDA 1UY3A 3G0TA 3WG1A 4K3UA 4KWUA 3KB5A 2WNUC 3PU8A 1CQTA 2PQSA 1Q8VA 3VKLA 2ADDA 3JZVA 5JOWA 2P17A 1Y9MA 1ULFA 4F3JA 3UKNA 2L49A 1WGPA 1CPMA 2YG0A 3WDUA 1POV3 2W1UA 5C8WA 5L7OA 3KJXA 2K2SA 1YIPA 2B45X 1OQDA 1XSRA 1WCSA 1MR5A 1Y7BA 3CJXA 4FPLA 4L99A 1UPSA 2WZEA 2DUQA 3SX0A 2W1QA 3MPBA 1BLZA 2JENA 4ATFA 4NMIA 4CCNA 3C7GA 4LKSA 5FY8A 3WG3A 4X4BA 2VAUA 2WAOA 1RUD2 3AFKA 3ES1A 2WZ8A 1ST8A 1AR81 1LCLA 5FYUA 2PXBA 2EAKA 4NE9A 4Q4W3 5FPVA 3JD73 2VZQA 3AZXA 2OUHA 1V9U3 4HVRA 4QKDA 5CADA 5JCTA 1AL21 4R52A 5FBZA 4WM7C 5A6XA 1ZRCA 4LIVA 5I0RA 2WO2A 3LSDA 4AXOA 1FXZA 3WV6A 1W8HA 1W99A 3BYWA 5DUWA 1I5ZA 1PK6A 2VM9A 4RR3B 4Z58A 4P02B 5FYYA 5A3PA 1M06G 1SFYA 5A7WB 1EPWA 3ZFEC 1POV1 2XXZA 4WM8A 3RWKX 2HEVF 2P5BA 5FYHA 1RC6A 3LQXA 1S0CA 2JG8A 5EJ3A 1VRH2 2VZVA 1OA2A 1CIYA 2Z79A 4HK9A 5KHIA 4JDMA 4XQWA 4EQVA 1IQAA 2AUYA 3U10A 5FZHA 3MIEA 1W90A 4D8MA 2WFF2 2Y6GA 3IB3A 3E6CC 1VBE2 4LHLA 5FMOS 4DXZA 2PMWB 2XJ3A 3AKPA 4FFIA 1QHDA 3AZYA 3ATGA 2VH9A 4NVPA 2B4KA 4Q4W1 1LU1A 1VBC2 1PNRA 4XTPA 5LA9A 3D1NI 5C70A 2BW8A 1T2XA 4XFIA 2QQOA 5DZGA 4XE9A 1W6MA 2Q8OA 1GUIA 1MS3A 1X82A 2E51A 2PN5A 4DXRA 3I8TA 4LK7A 3LA3A 3ZIXA 3NVCA 5JOYA 1GT0C 4HSLA 1NEQA 4JGYC 1DZQA 1O6UA 2PUBA 1BBT2 4UXAA 3UNPA 1JODA 1SCSA 2XCJA 5DSXA 5J98B 3ZXLA 4COWA 2ZX0A 1QP4A 2RS52 4ZHNA 1IS6A 4WVLA 1DCSA 1VRH1 1RUJ3 3TELA 4PLMA 1G86A 1KFUL 2FQPA 4NPMA 4D7SA 1RUH3 2BU9A 1LU2A 1OFSA 2GC3A 2ZACA 4GA9A 2CWSA 3FC0A 1TMF2 2WWSA 3FLTA 3HT1A 3POGA 2H0VA 2XJSA 4W4ZA 2ZZJA 5F6LB 2XXQA 2D5FA 1BEV1 2LALA 3KM5A 2W46A 2XDVA 1PK6B 4PBOA 5J36A 2GZUA 3N7JA 1NE6A 5FBJA 3VDAA 1SFPA 2A6XA 1CONA 1EP0A 1AYM2 5IVVA 4DQAA 2XKPA 4ZZ5A 3GGLA 1PZ7A 3RI8A 2YBSA 1U5XA 4B3NA 4JQDA 1MZEA 4XHBA 1QQP1 2G9FA 1LOCA 4JTNA 4YZ4A 3CLCA 4CCMA 4F7ZA 3ZIWA 4JC1A 2DWRA 3Q8BA 4K8RB 4XCBA 2ARXA 5T5JA 3U4SA 4JHTA 4MXWB 1VBA2 1RUE3 2K9ZA 4QX3A 2WRAA 5FQ0A 3PVEA 3GJBA 2D5VA 2ZX3A 2UWCA 5CU1A 4Q0SA 4XZUG 1LGBA 4BQXA 4MG2A 1YJLA 5JSRA 3DXTA 3K4AA 1LOFC 2BVBA 3CDZB 4KWJA 4PI0A 1Q5OA 1H1MA 4NDWA 1QQBA 3H42B 4FOVA 4MGZE 3ZYRA 4B1LA 1NXD1 2JE8A 3MIHA 5FZKA 2VVFA 2PA7A 5ABJC 4HG6B 1IPSA 1F35A 2D5HA 1ENSA 2IXLA 2ZMLA 4BQYA 4DXSA 4EWAA 1POUA 2VOWA 2HBUA 5C3PA 4E4DX 3RRDA 4BDVB 5EHDA 1J58A 1GQPA 1YFWA 2R062 1JYVA 2XVKA 3AB0A 1SFNA 4AW7A 2WFF1 3S8QA 1MS5A 5FY0A 2GNBA 1IC8A 1U5YA 3PJQA 4FPEA 4JQRA 4MGKE 3VBFA 3ZFFA 4CDXC 1WA6X 4YFZA 4RQPC 1LEMA 1NCRA 3OYWB 4X4GA 4IUGA 5KXBA 5LY1A 1YWKA 3LDBA 5LY2A 1N1TA 1ZBE2 3LDKA 5BNPB 4BCUA 2WNUA 4UFJA 4OBMA 4ES9A 5K8SA 1AR73 3R1FA 4XABA 4RFRB 3QOPA 2AXZA 4PDWB 4E4SA 3NJZA 3OBRA 4IV3C 3N7MA 4QDSA 4N8MA 2RS31 1VALA 3TOJA 1GBGA 1T6BX 4S2DA 4CE8A 5A7NA 1HB4A 3IAPA 4NIHA 3CL1A 4BIOA 1PNFA 4BM8A 2QQVA 2CGPA 1OA4A 4RHV3 1SLTA 3RZKA 2FCUA 2ADEA 3EBRA 2RVAA 5JOXA 2J22A 2NN8A 4V2VA 3V64A 4BHPA 3NJXA 3OGJA 3PE5A 1AR82 2C5DA 3NROA 2W9XA 4FCAA 4LBNA 2ZZQA 4O65A 5DAXA 3NNGA 2R63A 3ZFGB 1OHFA 2P2KA 4OMCA 5K0UB 3ZHMA 2VL4A 4NAMA 1H9PA 1LQCA 5EXOA 5FRAA 4Q26A 3ZXEA 4GB31 2YY1A 3VHPA 3S7IA 3M2MA 2NYYA 2WQ8A 3RGBA 2WS91 4B7EA 2VBBA 1QJY1 3HQUA 1H6YA 1W05A 5BYNA 1F4HA 1PO12 2ET1A 4RHV1 4WM8C 5A1AA 1AJKA 3N9MA 3MYXA 2GMPA 2ODRD 2H6CA 1BMV1 5FYSA 3A9XA 1S2KA 4IL7A 1ZBE1 4QGNA 2YGLA 1OF4A 1W2UA 3VD3A 3D0JA 4FFFA 3LSEA 1YEWA 2XLAA 4A7YA 4DB5A 1BQPA 4A41A 5JXHA 1U0AA 2V5DA 1UPIA 3VKOA 2A71A 5JI9A 2F4LA 2IUOA 1YSEA 4GB33 4HN1A 5F39A 4AL9A 1RUOA 1FV2A 4ZU4A 2K0GA 4QHOA 1JTZX 1FOD2 2Y60A 2AR6A 3T2TA 3WCSA 5LB6A 1FPN2 4NPRA 3WT3A 2ZCWA 4OVEA 2YFZA 4LE3A 2XVGA 1O5LA 2R7EB 2YXSA 3VBFB 2WR9A 4XDPA 2XMLA 1LCCA 2LM3A 2VOKA 4H7LA 3W9AA 4WVWA 3E5UA 3NAPB 4X6RB 1RUF2 2D6MA 4HN0A 4IEQA 1WH6A 4AVTA 5FZOA 1C5IA 1XE0A 2PE5A 4CUBA 1CVNA 2QBXA 5A32B 1DGRN 4W8JA 1WMDA 1F8VA 1ULPA 2EXJA 4OMDA 1RUH1 2AC1A 4PHZA 4QPIA 3B7MA 5CISA 1GV9A 1VRH3 3WUDA 2WZR1 3MEPA 3GN5B 1NA1C 5BNNC 1ZUGA 2XWJB 4BLJA 3PTRB 1AR62 3ZXDA 4CP0A 4DE8A 1CIWA 2ZABA 2R1DA 1HV0A 3H3ZA 1K3IA 3DL3A 3H3LA 2WIUB 5IATA 3UJQA 2J1RA 1WD3A 4UYBA 4AQSA 5L36A 1NY71 1HN1A 1V6OA 4Y24A 2ZEXA 5KHKA 1W03A 1W3XA 2FHRA 4AI2A 2DCYA 5T3NA 2F17A 1QJX1 1VAKA 4H2AA 3ZMOA 3VL8A 1HRV3 2H6BA 3LCPA 3ZMNA 4MHUA 2E7QA 4O9EA 3N4MA 2AXUA 3QD6A 3VBOB 1GWLA 1WW7A 3VHRA 1QP7A 2D6PA 2YROA 2A6WA 4RN5A 4JVAA 1VBC3 4XFAA 4MXVA 1BK1A 5E6HA 5JPNB 4U36A 2W3JA 1MEC1 4E8CA 5JZGB 1UZWA 3SR4A 4FFHA 4HKWA 3M4FA 3OBTA 1RUG1 4NHMA 4AHYA 1PO23 2A73B 3OUJA 3PUAA 1UWWA 5FK7A 4YM1A 3B9CA 5BNQA 3HR9A 4AR2A 2VMEA 1ZA4A 4IEUA 1RUI2 2A6VA 2GU9A 4ITCA 1BDHA 4UFHA 4N9HA 3FBMA 5K0UA 2XJVA 3SH4A 4IWRA 4CCOA 3ZHIA 3ILNA 3WSOA 4Y1YA 1VBE1 3VDBA 3LA2A 5I0UA 3SNMA 3KVAA 3VGIA 4XHXA 3ZXAC 3PVOA 5EPAA 1TG7A 3LZZA 3WINE 3FJSA 2DBIA 5A33B 5L73A 2VOTA 2OX0A 1UX6A 3GYDA 1OKQA 2PXTA 3NL1A 1S0BA 2BRTA 1HJFA 4I01A 2XQXA 5FOJB 4XAAA 4JX0A 5A7PA 4BOWA 5ANQA 3DEMA 1H1IA 2J1EA 4ASLA 1N3PA 4LULA 3ZSJA 5L7OB 4LK6A 3VBRB 1UXDA 1DYKA 4IE0A 4QXBA 2DURA 3VKNA 3ZOIA 1J1TA 4MCXA 5A32A 3ZXFA 1F2NA 3URFA 4LR4A 4QQ2A 1FNYA 5EIYB 3THTA 3OUHA 1YFUA 3H8UA 4NOTA 2BYVE 4EN8B 3WG2A 3P3NA 2HINA 1TME1 2ZKLA 4K7JA 1JFTA 2PXFA 4D69A 1W8OA 5IVFA 4L2NA 4ER6A 1ZZBA 2EXIA 3LIGA 5A3TA 1OVSA 4PF5A 5FZGA 1ZBA3 2DU1A 2X8KA 4AFDA 2KXLA 5IK5A 1FI2A 4CEWB 4CTEA 3OSDA 1QB2A 3LISA 1KITA 1ZBE3 3NV3A 1B35C 5HCHA 4X8PA 2PLV2 5T52A 1TVGA 3ABZA 4X6QB 1RYYA 4ISRA 5DAVA 4MGYE 5EZWA 1GZWB 4ZXEA 3KCYA 5FY5A 4C0BA 1Y7YA 4N7UA 4KGGA 2FZ1A 3C7HA 2XGXA 1BHGA 1S2BA 1HRI2 1WBLA 2JG8C 4HMZA 3WEZA 4F8AA 2OUJA 2XBO1 2HFZA 2VBDA 2ZBJA 4A7KA 2V72A 1GOGA 3OUIA 4S2FA 3ZM8A 4SLIA 5DZEA 1NYWA 1TEIA 1NW3A 5IFTA 2ICTA 4OI4A 3LAGA 4NIGA 1PGW2 2JWPA 2YC0A 2ZGRA 3N9PA 3WZ1A 2O38A 1XE7A 1LENA 1UMZA 2JDAA 4A42A 1O3TA 2YBDA 2VZUA 1GP4A 3P6BA 5K98B 5LK7B 4Q4V1 5FJKA 1HRV2 1H2LA 4GMP0 1NE4A 3AYEA 5FYZA 4D6QA 5D1IA 3ZFGC 5CVRA 2GZWA 1YIFA 1C8M2 4CDWC 4AWDA 4YM0A 1QJFA 4CDQC 3MF9A 4TZDA 2PHUA 2BGPA 3SISA 2J1UA 3DPRC 5C3RA 1A8DA 3HN1A 3LB9A 1LEDA 5C3OA 1J3QA 1PX3A 3WOGA 4Q8KA 2Z69A 3AFGA 1VP6A 2E26A 4Z5HA 3B69A 3VBUA 5DUXA 4OHYA 2VTFA 2RS11 5EQUA 4XQ4A 2LTNA 1D4M1 2HEWF 2ZX1A 2RMU2 4QGMA 3IIIA 4RFT0 5F1RA 5F2SA 4I3GA 4YVWB 1A34A 1N1VA 2HLEA 5JLVA 4FPKA 4E8DA 3ILFA 1POQA 3FFQA 4QPWA 3JD72 2XL9A 2HEYF 4YZ2A 3U1XA 1VMHA 1NUKA 1MZFA 1MS8A 3A22A 4XPVA 4LT5A 3M3QA 2EVXA 2EF6A 4OLLA 2RV9A 4QU1A 3A9ZA 3WQ1A 4DEQA 3CEWA 4QX1A 5GM0A 2QZ2A 3ZSKA 4AFAA 4LBOA 5GLVA 2VCAA 2R071 4H55A 3T3YA 4ONUA 1NX9A 3J26N 1GP6A 2JG9B 2V4AA 3EJKA 2R063 3HBKA 4LXLA 4OQ9A 3ALQA 2WS92 4IETA 4GQMA 3I7DA 5CFDA 2DFBA 4LHNA 2D98A 3O0XA 3W58A 1F4AA 3BKZA 3IAQA 2W5FA 4LTAA 3ORJA 4UOJA 3NKGA 1KJRA 3J9SA 3CLPA 2HWC1 4L9BA 1KFXL 2BV4A 5DXDA 4I09A 1J59A 3T09A 5GLZA 2GMMA 4KBBA 3U07A 2O8OA 1J3PA 1IS5A 1MQTC 2WLQA 2ZGTA 3AP9A 5ACA1 2XXPA 3ZSLA 1OSLA 2Z42A 3U4XA 3OY8B 5H9QA 3RG0A 1DZRA 4RGAA 2IXHA 1HF0A 4K21A 1N1YA 2BTVC 4GWNA 1IS4A 1QQP3 2JB8A 4UFIA 1UIKA 2RG4A 2JKBA 1XYOA 4OFGA 4ER3A 3U0ZA 2PHDA 1A8MA 2WYSA 4JRLA 2IVGA 3W20A 4G4FA 2W95A 4QB6A 2DVGA 2ZS6B 3R0RA 4ER5A 5JR7B 2JX9A 4YVWA 1CWPA 1JUIA 1QKQA 3K77A 2E53A 3FUQA 4GJYA 4YW4A 1UZVA 5C9AC 3IMNA 1E5IA 3IM0A 5D8AA 5A3MA 4N53C 3FUOA 1EV11 3WG4A 1WMXA 1W6OA 4AVVA 2QQLA 1US2A 4IEYA 1PK6C 3ZDVA 4AG4A 4NO4A 5A3OA 4C90A 2UWBA 2OS2A 1KRIA 2RS53 2XBO2 1PM7A 4QX0A 1YC61 1C8M3 4GULA 1RUJ2 1S4CA 1POV0 3PUQA 4FN3A 5DMYA 5DRYA 1FT9A 1DQ2A 4XBNA 2BGCA 2LYKA 4AEKA 4A45A 5CFDB 3VKMA 1YQ6A 5F5AA 1IHMA 1W2AX 1ONAA 2JG9A 2IFWA 4RGKA 5KHGA 5JSPA 3VBSB 5FZLA 2H0BA 2VUAA 3PXPA 2VZPA 3IDBB 2WT0A 4XIKA 1UCXA 1WWYA 3ZSMA 4AVCA 4N7IA 4FPHA 3LOBA 1CESA 4LKDA 1PVC2 5F5QA 3MI8A 4J1WA 3POSA 4ER0A 1RUC3 3AMNA 4P9LA 4AHZA 2FDGA 4BQ3A 1H30A 3BOPA 4M3CF 4UW6A 1WW5A 4J6GA 2E7AA 2ZAHA 1O4XA 4Y42A 2PUGA 4URTA 4Y4YA 3D6EA 3OWQA 3UT0A 3CO2A 3OPWA 1RB8G 1JWLA 3CQOA 4YARA 1LECA 1FMD2 1V6JA 3FMGA 3U14A 3NNFA 1FV3A 1V6IA 4IGOA 2WO7A 2VQUA 3U78A 4LQRA 3TEZA 2WABA 3V65A 2NMOA 5A1LA 1SCRA 3OD4A 1BXHA 1AYN2 4PT6A 3DNVB 3RNSA 4KH9A 5FZIA 4QAWA 4QPGA 1TMF1 3ZPOA 3ZFGA 1TME2 2ES3A 3PUHA 5BUVA 3N35A 5JVVA 3POBA 2Q0AA 3VB9A 1AR83 3MIDA 3N7KA 2VW0A 2WO1A 4XF4A 2HWB2 4L92A 1W04A 3B5LB 2P1BA 2HWB1 2VOXA 4FVVA 4HKLA 5I0TA 3SMHA 3ZR5A 3N36A 4NN0A 2O4AA 1B35B 2JB4A 5M0TA 4MX3A 3DGTA 2R32A 2QCSB 1H2NA 2PXEA 1XPWA 2IVQA 2ARCA 4MGIE 2PUDA 2CYFA 2LUWA 1WH8A 1UZYA 4Q0PA 2MEV3 1BVP1 2VR4A 2RDQA 4OQ8A 1QXJA 4KG0A 3JBG1 4BIFA 4IE4A 4OHWA 1VPWA 3OGSA 5B2GB 2O14A 1W8NA 5BNNA 1H2MA 1S7EA 4P9GA 2DDUA 2ZX4A 4YGBA 3U75A 5KXCA 3K4DA 4WVMB 4LKFA 4AHXA 1W8UA 3OB8A 4JAAA 4V1PA 5AFEA 2JICA 3KV6A 3O7OA 4KL1A 1LMB3 2BQPA 2BJCA 4UT5A 1ZVVA 4Z07A 4JKLA 4QB2A 2GH8A 2JEMA 2WQ4A 5GZEA 4YW1A 3SCHA 3U37A 4EQZA 5HCAA 1HN0A 2VU9A 3OF1A 1DGWX 1GNZA 5TSWA 2E31A 2VJXA 1KD7A 2JJ6A 3OGRA 2OYZA 4EN6B 4YLZA 1MZ5A 3ZYBA 2FCTA 2BBVA 2EBYA 1YYNA 1GOHA 2A6CA 1QP0A 1QOOA 3FN9A 4Y33A 5FQ0B 3VD9A 2VG9A 4P9WA 1RIRA 2YC2A 1NZCA 2Y33A 3BCWA 1E5HA 1JYCA 3Q9OA 2LCVA 1MQTA 5A3NA 5DDJ3 4O61A 2X05A 1UYZA 3LPFA 3EUSA 1GFF2 3MBWA 1DDLA 1F5FA 2JDHA 3TAYA 2Q30A 4XF9A 1CAWA 3M70A 4QD2A 4YGCA 5GAHi 2VGDA 2WS93 5FUIA 3WDWA 4EZ4A 1QJU3 3T0BA 2Q1ZB 3VBFC 5HCBA 2Q5TA 5A1FA 1NZIA 4NIDA 1SLLA 4XFCA 5LRSA 1RUG2 1BEV3 1RXGA 2DCZA 1ULDA 2IXIA 4CXXA 1W6PB 5F3EA 1V70A 4UI9L 1S0FA 2XLFA 4FPCA 2LYQA 4E27A 1ADRA 2EICA 4JZRA 5T50A 2ZX2A 3PMEA 2YHJA 1ND3C 3H5TA 3OQMA 3WDXA 3LEMA 2VCMA 4IEPA 1NOVA 4AOCA 5JR2A 1JH9A 3PUIA 1MFQC 2YU2A 3EMRA 3ZO0B 4CYDA 3AMMA 2Y6FA 2K46A 2RDSA 1MZ6A 3C7FA 1ALYA 4YNIA 1JZ5A 2EWTA 5FYIA 2WLPA 3PVBB 1S0JA 4GH4B 3H9AA 3ZR6A 4CCLA 5FZ6A 5DTQA 5FY9A 1G8WA 1GLHA 1QDOA 3SH3A 2HWE1 3GBGA 4C8DA 1IQDC 3TRSB 1EUTA 3CNAA 5C71A 1UQXA 4JGZB 4B8EA 1VAVA 1AU7A 2VTXJ 1GWMA 3B94A 2AENA 4RL7A 5FZFA 2KM2A 3T08A 2ET7A 3R05A 3ZLIA 4BQ2A 4IVZA 1I1EA 3DYMA 5CFCC 5A33A 1VE0A 4EKIA 4GKYA 1AL0G 4CP2A 1XNKA 4HRAA 1CD3G 4QXKA 3GBWA 2R16A 3GZDA 1V6MA 3F52A 4INDA 5GALA 4GD4A 5JZGC 2V73A 3WQ7A 4N9IA 2KR2A 1DULA 5BNOC 5FWJA 3VV1A 1HQLA 1F15A 2ZA9A 3MDPA 5CA6A 2J7WA 1ENRA 1OURA 2QKDA 4GIQA 2QVSB 4XUTA 2AXVA 1JFSA 3AXDA 2LYPA 1HLCA 2D6NA 3I4IA 3FL7A 5FCCA 4AFBA 1LULA 4NROA 5A6YA 5DTRA 2PXDA 3KCCA 2BPA2 1FNZA 2HWF1 4Q1RA 1LHWA 1CPNA 3N9QA 1FYUA 4M4RA 3CHXA 1YQCA 1ZYBA 1U5IA 3A4UA 3JQWA 3ZYIB 1AX0A 4CDWA 1VBB1 2GNDA 3RVHA 3BTXA 1PRAA 1V9U2 2ZOEB 4XAEA 3M1HA 2PXJA 4B4RA 2J1SA 3PIJA 1NCQC 3NW4A 3OBAA 2OR1L 1LGCA 2MXDA 3E1F1 2XBO3 4XXAA 3OQNA 1W6NB 1HJGA 1HB1A 4C1WA 5J96B 4IV1A 4Y20A 3KCXA 2VVEA 1H8TB 4H7MA 1DQ0A 4MZUA
chains in the Genus database with same CATH topology
2WL1A 3KXAA 1C8M1 2GH2A 3I2DA 3ZXKA 4C1XA 3AJZA 4RQPB 2GNTA 2VY0A 1BVVA 1YJKA 1Z0HA 2YPJA 3AZWA 2R49A 4GB32 1NA1A 5I8TA 4RA0A 1CJPA 1Q43A 4Q2FA 3U11A 2VVDA 4Q4Y1 3ZN5A 3RDIA 5I91A 2JE7A 2SLIA 3R6SA 2Q4SA 3FHIB 4Q4X1 2XPJA 1O4TA 2B39A 2R1BA 1SBFA 4FAHA 2PLV1 3V0AB 4F8DA 2WFF3 1YXWA 4AFMA 1K5MA 2RHPA 4Y1ZA 1IKPA 3RQ0A 4M01A 2R6QA 4FT8A 4B7KA 3R4SA 1Z7S1 1E57A 3J8F3 5FLIA 4XFHA 3G5GA 1AZDA 2CAUA 4Y22A 1X8MA 1AR63 2XJRA 2ZHMA 5FDBA 3AP7A 1DU3D 1G6NA 4CDUA 5DUUA 2WKKA 1VBE3 4HBNA 1DIWA 2JVLA 4CDWB 2RS32 1AYM1 3HT2A 1MACA 2R061 1C57A 3KGLA 4TYSA 1T6GC 4XJ8A 2VECA 3BPZA 4I6RA 2A3XA 2IFRA 5EYYA 1IZ3A 1PO21 4TSVA 2PAMA 3QH6A 4M3CA 2GC0A 4AHWA 1AHSA 1YFXA 5C6CA 4OB4A 4PBPA 2WSUA 2RS12 2AUWA 2R041 2XKOA 3PLQA 3AKQA 3RMYA 4RR3C 1ND3A 1SLAA 4CDXB 4HPKB 4FTSA 4PIXA 5D8AB 3ZN6B 2ZGNA 4DRVA 3L2YA 4QT6A 2RR11 1CGPA 1A3KA 2HWD1 1RMU3 3O5SA 1HRV1 5CB7A 2LYJA 5T5PA 1W6NA 5DDJ2 5SV8A 4UW4A 5HCFA 4IESA 1X7NA 4YRDA 1K5MB 5F9TA 1SACA 2KPJA 2X53S 2JG9C 4LA3A 3VDDB 4XF0A 5CNAA 4CP1A 3EO6A 4E2QA 4I0WB 1AL23 3CU7A 3ZFFB 3PTYA 2CNAA 1AXKA 4LUMA 1RUI1 1DQ5A 3NV2A 1LHOA 3ST7A 2X29A 4YSFA 5FO7B 1SMVA 1QGLA 5JZGA 4FTBA 2XG3A 3USSA 2PTMA 1C4RA 1DGWA 2BWAA 4X4IA 1C8NA 2PUFA 2VMHA 4AYUA 4AVAA 2XI8A 1GICA 1RJ8A 3F51A 4R8HA 1O3RA 2D3RA 4LHKA 5H9PA 3UKVA 1QJU1 1UF2C 3UFDA 4WZFA 4YZ1A 1DYPA 3VBUC 4H3WA 3ILRA 4X4CA 1FMD1 5HXVA 4Y22B 2O49A 1OOPC 4MLOA 1UW8A 1O3QA 1MVEA 3G6JB 4B4QA 1O3SA 4I0AA 4YFWA 4Z8BA 1Z7S2 2RJKA 2W08A 3MW4A 4HANA 1HQNA 3FYMA 3WX5A 1LKNA 2XHKA 4Y1UA 4R9AA 4DFSA 3DKWA 4GXLA 3JBG2 5KC6A 1UU5A 1BDIA 4IV1C 2GRMA 5CFCB 4KU7A 5JSOA 3MW2A 1AR72 2ZGQA 1DBNA 1DGRA 4QM9A 2WC2A 3MFAA 4XF1A 4BPZA 4RS5B 2V09A 2JXAA 5HBAA 3DUIA 3IPVB 3QYXA 4M3CB 1TMF3 1V6KA 4XMAA 5AC91 5CFDC 1WMFA 5LK5A 1CAVB 3ZKCA 3LOIA 2C9AA 2X5IC 2YGMA 3E6BA 3VDDA 5EV7A 4Z82A 5ABJA 3RYPA 4AF9A 5A7LA 4JDOA 3CROL 4WVZA 3POYA 4Q8KA 4AE2A 3NKTA 5A3LA 1ASJ3 3VBRC 5LRRA 1FOD3 3RI9A 1DG6A 4YG6A 1Q8QA 3A0KA 2GSYA 2DCKA 4OI0A 2ARBA 3MIBA 1XYPA 3K48A 2WZR2 1OD5A 1ZM1A 2R30A 2IV1A 2CGOA 2DVFA 4GMP1 4C0HA 2WA4A 3USUB 4CDUC 4W6WA 2UY8A 1D4M3 1LCDA 3ROUA 2G9GA 4Z5DA 1DQ4A 4FP2A 1Y9QA 5KWRA 4XXPA 1D2SA 4WVMA 2CSFA 2D6LX 4IEWA 5C4WC 1SLCA 4D3WA 4E2GA 2R0HA 4JGZA 5I8YA 1W6MB 4JTOA 1SQ8A 3KT1A 2DFCA 2CGNA 4PLOA 2WZPP 1RUE1 2AWIA 2FMDA 1LESA 5IUQA 1J3RA 5I0SA 3AYCA 3OY8A 1FPN1 4YYOA 1X33A 2DTWA 3AKRA 3VBHA 2HWF2 1H8VA 4JCYA 5ABJB 4HT1T 4Q4V2 4E9KA 1YNAA 2AZ5A 3TYJA 4WM8B 1W0PA 4KWLA 1RUI3 2UWAA 2NQYA 4AGGA 1GZ9A 3H1YA 4B4PA 5BXXA 4LBQA 4FP3A 3D8CA 4X4EA 1HX6A 1YUDA 1LRHA 2AREA 2UU8A 1ZZ9A 1D2QA 4QPGB 3ZSEA 3ZN4A 1JN2P 1S1AA 1YRZA 1EAH2 1G9AA 1RMU2 4K9SA 2HJIA 2RM22 2VOVA 1W6OB 2ZTNA 1R091 4AEDA 4UBGA 1ULCA 1WCKA 2CL2A 5CAZA 4PCRA 4OUMA 4PDWC 1H2KA 1ZZ6A 2WT1A 4JGYA 1LOBA 4CEWC 1PZ8A 1PGW1 3JCIA 4YW5A 1QH7A 1CAXA 2W0XA 4OI1A 3GHMA 5JIAA 5GLWA 5I93A 4F83A 1GR3A 2RMU1 2ILMA 4GH4A 4P9IA 1RUG3 3UKTA 4QQPA 4AVSA 5BV6A 2IZWA 2QFEA 4YW3A 4LBQD 2GN3A 2ZGOA 1WETA 3BIWE 1R1A3 1YCIA 1AR93 1VBD3 1VAMA 1QJU2 2JE9A 2XVLA 3T1LA 3O0WA 4IEOA 4W6XA 3APBA 2R073 3BOWA 4NHLA 2I2SA 3AMPA 3PVNA 4EJRA 3INAA 4X4FA 5FMOL 1D4M2 2Y38A 1DW9A 2ZKNA 5JDBA 4I3PA 3RZZA 4KNCA 2L8NA 2MPFA 3V56A 3NV4A 1NCRC 3GZTB 3IIAA 3FWEA 4BLIA 3SH5A 3VBHB 1RVF1 3J8F2 1TNFA 3WDYA 3VK0A 1LOGA 2MQKA 5GKAC 3MW3A 2A6YA 2ZJCA 1Q3EA 3GZUC 3UJOA 1WIZA 3V0BB 4PU8A 2WNVB 5CBLA 4Z92B 4W65A 1LR5A 3HWJA 4UBHA 3V0AA 3GZAA 5KHJA 1XRUA 1HDKA 4JDNA 1OPOA 4NHKA 1RHI3 1ZZ7A 1JBCA 3H7YA 4HLTA 2FBEA 1HRI3 1XNDA 3RWNA 1LJ7A 3VZKA 4E2SA 2D6KA 3B02A 4Y26A 2A3WA 2O0OA 2LYSA 2W39A 4IV3A 3CJIB 4RR3A 3RJ2X 1QPZA 2PHXA 3KQRA 1QNWA 2A5ZA 5C8CB 2UYBA 1O5UA 4NWVA 1XNCA 4Y5Z0 3S7EA 3F6WA 4META 4Q4W2 4DNYA 1SBDA 2IWGB 3BODA 2MEZA 2QJVA 1HXS3 2HYKA 4LBLA 3QWGA 3JXBC 3LFPA 1NY72 4Q4Y2 4AEDB 5LEJA 2FJRA 1NQDA 4FQZA 1X50A 2GC1A 5E16A 4XETA 1LOAA 3ZYGA 3I59A 4BWOA 1AR61 1OPMA 3HIFA 1U12A 1PRVA 4L11A 1WLTA 1TE1B 3MLJA 3ZFEA 4Q0QA 1LHVA 2QDRA 4OI2A 1FOD1 3WY6A 5GZFA 2EXHA 4RS5A 5E8AA 1URXA 1RUF1 2UYAA 2WT2A 5T54A 3IPVA 3ZDSA 3N3HA 3PNAA 1EV12 1VBD1 4M00A 4DOUA 1GQGA 1LHNA 1Z78A 5JPMB 2NP0A 4YG7B 2JDZA 1AXZA 2UURA 3L2HA 5JOZA 1XYNA 3IDCB 3VL9A 4CDQA 4KGQA 3DPRA 3TNPB 3GF6A 1TNRA 4YBAA 1WD4A 1DQ1A 2Y0OA 4TWTA 3UV9A 2D97A 4QMAA 3O14A 3SXWA 1SEFA 5I8SA 1LTEA 4BZ4A 3QH7A 4R4ZA 2FMYA 5KC5A 1OOPA 3G7DA 4QHBA 3QBQA 3B3QE 4AQ6A 1CAVA 3VHOA 2VULA 5FPXA 2AGSA 2GDFA 1KDKA 1OFNA 5FLJA 4FQ4A 1QMJA 4MSVA 3VZMA 1O7FA 1UAIA 4FXGB 1HV1A 4LO8A 1DWKA 2OA2A 1LOFA 1UL9A 4K40A 4ZXKA 5L19A 3ZFEB 2VW1A 4QGLA 4FBFA 4Z2WA 1V6LA 2BNMA 3VBRA 3T1MA 1BBT3 2G4IA 4Y20B 3FYAA 1HQWA 2IVBA 4MH0E 5GZGA 1OSGA 2A75A 2OPKA 4ZKTB 1JOJA 4FPYA 1UN1A 4P14A 3VDDC 1UU4A 4XZPA 5AC92 2OZ6A 3JD71 2SBAA 2ZGLA 3WUCA 5T55A 1V00A 2ZGMA 1BCXA 3MZHA 3DV8A 2I45A 4R9CA 2ZGSA 1REDA 3AP5A 4JRAA 1PVC3 5GZDA 1B09A 5J3UA 2KEKA 4GQ7A 4GALA 2JECA 4ORFA 5KBFA 1REEA 3D5OA 3B93A 2IC1A 2GALA 3ZXJA 4Q4X3 1CJGA 5ACA2 4FOYA 3USUA 2R072 5C9AA 4RGGA 2BNOA 3OQOA 4BH9A 3HMYA 1IS3A 3H0OA 3KD4A 4YVSA 3C2UA 1HKDA 2PUEA 2VNGA 4AGVA 2DVDA 4N90A 2QQPA 5IK4A 1TME3 1EYBA 3ZN6A 4IV1B 3J4UH 3PMSA 1NLSA 1ZZ8A 2D43A 4XW3A 5FLHA 4XILA 4QPIB 1ENQA 1RZSA 2PAEA 4IEVA 1G9CA 1GSLA 2EIGA 2CROA 1BJQA 1KDMA 5AVAA 5IK7A 3FLRA 1C5HA 1JW6A 2D93A 1QF3A 2PHWA 1X8EA 3VLBB 1D0HA 3MF6A 4DY3A 3JXDL 3L9JT 2DTYA 2BNNA 5FTTC 4YZ5A 4NR1A 3O12A 2HWC3 2OIIA 4PJYA 3M3EA 3FFZA 3H1MA 5KXEA 3PHMA 1SLBA 1PIV1 3TBDA 1RVF2 1CR7A 3H7JA 4H14A 2VW2A 3VZJA 3KZ3A 1VLNA 3M3OA 2QDNA 2VNRA 1QQAA 5C8CC 1IKQA 3TNQA 2BUKA 3WW3A 4MUVA 4GH4C 4YGDA 1RITA 3QACA 1RUC1 3AKSA 3MICA 5T50A 4DZGA 1X36A 2OFYA 3WD5A 1VBC1 1AYN1 5JI7A 2HSGA 2XJUA 2HWD2 4FSJA 4LLFA 2EF8A 4PDWA 3M3CA 2RJLA 2D3SA 2WIIB 4CEWA 2EA7A 3MFCA 2DF7A 3OJBA 5FREA 1WLCA 2VUJA 3JB4C 1FATA 1GNHA 2BVVA 1UKRA 3PJYA 4LE4A 5GLTA 1N3QA 4GKXA 2RS51 5SV5A 1KXGA 3DF0A 3LWCA 4YM2A 5C4WB 4YGEA 3ENRA 3VZOA 1I9RA 3P3PA 4K8FA 2QE3A 3NWKA 2PIJA 3KLSA 4QU2A 1BEV2 3JXCL 2E9QA 1C1FA 2Z2SB 2PUAA 1NQJA 4YG1A 2R1JL 1DLLA 4CEYC 5J7MA 1ND2A 1ZX5A 4XQDA 1PRUA 3OMTA 1NERA 4N43B 5FAXA 3AM2A 1RUD1 4O8BA 1EV13 1WW4A 2PLV3 3MPPG 1AX2A 4HK8A 1XXNA 1CN1A 2D7FA 1R1A1 5DG2A 3UK9A 3WP3A 1QOTA 3I54A 2HWF3 1XQNA 2GRLA 4HL0A 4IV3B 2ZAAA 1JH5A 1G9BA 1PO22 3AP4A 4R4XA 5FO8B 2RR12 1GANA 3OPZA 1UZZA 1EAH1 1RHI1 4FPFA 4Q29A 4WBBA 1A78A 1AXYA 3IWZA 3HQXA 2AW6A 2R042 4MV2A 3TN92 3O0VA 2LYLA 1OMIA 2P3KA 3AXEA 4QQLA 3MIGA 1AYM3 1JYIA 1A6CA 3AZZA 2WNVA 5LEKA 3BD1A 1VB4A 3K51A 4LBKA 1OA3