1ZZBA

Crystal structure of coii hppe in complex with substrate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 42
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zzbA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zzbA02
4P9GA 3CJXA 3BPZA 3HQXA 3OTFA 2IVGA 1L1MA 2ZKLA 3CEWA 4BIFA 1ZZBA 2PIJA 2Y0OA 1ZZ7A 1ZRRA 4FBFA 4XFHA 3HZIB 5I91A 4QGNA 4X4BA 2MHFA 2HSGA 2LCVA 2UY9A 2BNOA 3SCFA 5BUVA 3CL1A 1YFYA 1OSLA 2MPFA 3VK0A 2PUFA 3FX3A 2IXLA 4KWKA 4IA8A 3OQMA 5J48A 4QX5A 1E3OC 4FT8A 1CAWB 2WC2A 1LCCA 4N9HA 4MH0E 1EP0A 4WBBA 2LYPA 3UKVA 3SCGA 2GRMA 2BNMA 2XSDC 1PRVA 1QP0A 4MZUA 3H7JA 1CAUA 1UCXA 4KWJA 2B9UA 3HT2A 4JTOA 1Y9QA 1VJ2A 2EAAA 1PMIA 5HI0A 4XFGA 2MEZA 3IWZA 5J7MA 5K8SA 4MCTA 1NXMA 4I6UA 2XGXA 3OF1A 4XF1A 5CADA 2Q1ZB 3ZHIA 5JSPA 1ZZ8A 3JZVA 4NVPA 1UPIA 4IEOA 3BDNA 1J3PA 1R69A 3QF3A 1PNRA 2EWTA 1YFUA 4IEQA 5KHHA 5JAXA 3DN7A 3LAGA 2B8MA 4EWDA 1Q3EA 4KWLA 2QJVA 4YG4A 4XF9A 2PFWA 3WW2A 1OCTC 2PQQA 3BB6A 3ES4A 2O4AA 2OYZA 5EZWA 2H8RA 4QM8A 5F1RA 1YFWA 3IIAA 2XKPA 2LYRA 2A6CA 3SMHA 2XIUA 1X7NA 2QNKA 2F4PA 3BCWA 1CAUB 4HN0A 5JR7B 1RC6A 1YHFA 1NERA 3R1FA 3I54A 4IEPA 3FWEA 4AVCA 1CQTA 4MGIE 3ACLA 3GN5A 1XRUA 4META 4HVOA 1ZRDA 3JXCL 3FYMA 2AXUA 4I6TA 2XKOA 5I8YA 4PU3C 1WETA 4EV0A 2PYTA 4PU4C 1RZRD 2Q30A 4O9EA 5JSOA 4KL1A 5E1RA 4O9GA 3S7IA 1TQ5A 4XF0A 2AXVA 4ZU5A 3LWCA 4I6RA 4KU8A 3E6BA 2BGCA 4FAHA 1LB2A 1UW8A 1X8EA 1RUNA 1S7EA 3FFQA 4R8HA 3EHKA 2VQAA 4HMZA 4X4FA 3EQEA 1NEQA 2AUWA 2UYBA 3EBRA 4MX3A 4PJYA 1O4TA 4FBIA 2PUDA 1HW5A 5CVRA 1Y7YA 2V09A 2LYLA 3DKWA 4OB4A 3KCCA 1SEFA 3H7YA 2VPVA 1Q5OA 2IXJA 3LOIA 4D7SA 4JQDA 3FJSA 3IDCB 3ZDSA 1LLIA 2IC1A 1OI6A 5KHJA 4YYOA 4X6QB 2JVLA 2OA2A 3ROUA 1X57A 2GZWA 3NJZA 5I0UA 4HZFA 2CSFA 2KEJA 2KEKA 2BJCA 2B5HA 3E5UA 4XFAA 3OD0A 1GQHA 4RD7A 3SHRA 2O1QA 3QOPA 2CROA 4IEYA 4IEUA 1ZAYA 4ORFA 5BV6A 3RYKA 4Q0VA 2BYVE 3H1YA 2AWIA 4GHJA 1X2LA 1JH9A 1BDHA 1FI2A 4IVZA 4Z5HA 2K0GA 2D5VA 2PUAA 4KU7A 5BY5A 5FQ0A 2KZ8A 1LRHA 5FLIA 3NVCA 4HVRA 3OMTA 3M70A 1CX4A 4XFCA 1GT0C 3RDIA 5I8TA 4IEXA 2XL9A 3L2HA 4AVBA 3EJKA 2XHKA 1IC8A 3F51A 3H3ZA 4DINB 1QY4A 3CROL 1DZRA 1OD5A 3C3VA 3H3UA 1OMIA 2PHDA 4LA3A 5LRRA 5KHGA 1PRUA 1O3TA 1EFAA 1QXRA 2L49A 4YRDA 1XE7A 3E5QA 2QDRA 3OQNA 4OLLA 2XLFA 2GZUA 3U0ZA 1QP4A 3RYRA 3CF6E 2LYSA 4H7LA 4F7ZA 1BDIA 3CLCA 1J58A 5LEJA 3RNSA 3NKTA 4XFFA 5FQ0B 3KZ3A 4AQ2A 1DWKA 1RGSA 5JCTA 2GC0A 3VHRA 1EY2A 2LYQA 3PNAA 4ONUA 4QXKA 4TLFA 4X4HA 2Z2SB 3QWGA 1CJGA 2UYAA 2Z69A 3ES1A 2KPJA 3H1MA 2XCJA 4UBGA 3OP9A 3EO6A 4IERA 1R63A 5LRSA 2H6CA 3WW4A 2FMYA 3JXBC 3UKTA 4PU7A 1JFSA 1X8MA 2C0ZA 3QACA 1RL3A 1QP7A 1OFNA 2ET7A 3ELNA 2OPKA 2IXKA 1QQBA 1UD1A 4Q0QA 1L3JA 3BD1A 3PLQA 4XF3A 3R6SA 4LTAA 4HN1A 1NE6A 1YWKA 1FT9A 4QGMA 4LLOA 4QM9A 1UXCA 2ETEA 2GC2A 1VR3A 4X6RB 4E2SA 3WW1A 3U10A 1WH6A 1DGRA 1ZZ9A 3B02A 4LA2A 3FMYA 2K9ZA 3NSTA 5I0TA 1ZNPA 5FPZA 1G6NA 1ZPQA 3SXWA 4UBHA 3LA2A 1DZTA 2GC3A 3KXAA 3OCPA 4QGLA 1ZZ6A 1XE8A 1RTVA 3BALA 4IESA 5AVPA 3ZKCA 4FN3A 1YLLA 4B29A 4YARA 2GC1A 4A2UA 3WW3A 1J59A 2IXIA 1YFXA 4BHPA 1ZVVA 4JCXA 3D0SA 5E16A 3MYXA 1YSEA 4O8BA 4X4GA 3FHIB 1J3QA 4HBNA 3HT1A 2ICTA 4XETA 3LA7A 1ZREA 4X4CA 3RZZA 3F6WA 1NE4A 3GN5B 1YUDA 5K98B 1LKNA 1O3RA 1UXDA 3H5TA 3OQOA 2EA7A 2WFPA 1O3QA 4PIYA 1Q43A 4E2GA 5C6CA 4Z82A 5J3UA 2R1JL 2CAVA 1AU7A 5D1IA 4YNIA 1FXZA 4EROA 1NYWA 1Y3TA 4I0BA 5CU1A 4AQ6A 3TNPB 2AXZA 2EBYA 2WIUB 4PU8A 2MNGA 1SQ8A 2KXLA 1O5UA 5EFUA 1CGPA 4I01A 1RPEL 4X4EA 4L11A 4GQMA 1POUA 3LFPA 2PHLA 4JVAA 2UY8A 1EYBA 1LCDA 5C8WA 3KJXA 2IVQA 1IPKA 1UIJA 3CLPA 2BNNA 2ZCWA 4MGKE 4LUMA 3I7DA 1ZS4A 2HJIA 4R52A 3N4MA 3F52A 4F8DA 3SCHA 3IVPA 1U12A 1ZVFA 5FDBA 4PIZA 2ET1A 4Q0UA 1WIZA 1I6XA 1LQCA 4AXOA 3QQ6A 4Z58A 1CAVA 5I0SA 2R63A 1WH8A 2OR1L 3E6DA 2OZ6A 3TRBA 4Z5CA 3S8QA 2Q0AA 5FCCA 2PTMA 1O5LA 4IEVA 4MGYE 3S7EA 4Z5DA 2IXCA 1QPZA 2MQKA 2O49A 2CAUA 2OFYA 2JCGA 3KGLA 1ZUGA 3NW4A 3E5XA 1PERL 2B5AA 2IVBA 3USSA 4HVQA 1H1MA 1LR5A 1WLTA 2H6BA 2QVSB 3E97A 2BEOA 1RIOA 1SFNA 3DL3A 1RUOA 3ST7A 4XEZA 4HSLA 4YBAA 2I45A 4HSJA 4WVZA 3GYDA 2LYKA 1QXJA 1JWLA 3QYXA 5KHIA 2IU7A 3TNQA 4LULA 1XWRA 3FE5A 4CYDA 1DW9A 1CAVB 3IDBB 3EUSA 3KGZA 2ICPA 4I0AA 2L8NA 1H1IA 4LUKA 4XFBA 2PA7A 2XI8A 2HKXA 4I02A 2PUCA 1JUHA 3G5GA 5JSRA 3DNVB 4MGZE 4YG1A 5I0RA 2KEIA 5FPXA 2GAUA 3DV8A 3H9AA 3LA3A 4IEZA 3MLFA 3U3WA 3G7DA 1RZRA 4Q0PA 5I8SA 4X4DA 2WUSR 4QMAA 2P17A 3JXDL 1WA4A 2FJRA 4L2NA 3O14A 4UXAA 1NZCA 2HINA 2XLAA 4JV4A 1CAXA 2ATFA 2XL7A 2OZJA 1LMB3 2IV1A 5FLHA 1RZSA 4Y42A 1J1LA 3MZHA 1ADRA 4GULA 3FYAA 2Q4SA 5BXXA 1JFTA 3D0JA 5KHKA 5LEKA 3E6CC 3MPBA 4BH9A 4JCYA 4I8TA 4Z07A 2VECA 3CECA 1ZX5A 4AVAA 2H0VA 1J3RA 1DGWA 1I5ZA 4J1WA 2PAMA 3UFDA 3PXPA 1B0NA 2GU9A 3D1NI 2IUOA 4I09A 1ZRFA 4Q29A 4BYYA 3B7HA 3UKNA 2EVXA 1VPWA 4Q0SA 4WZCA 3BS3A 2D5FA 3PVBB 4MV2A 4MCXA 2XJ3A 1PM7A 3M3IA 1CAXB 3GBFA 4XF4A 3KMHA 3IBMA 4XFIA 5T3NA 2GRLA 3D82A 4FAGA 2PUBA 5I93A 2IXHA 4EWAA 3H8UA 2PUGA 3I59A 1X82A 4PIXA 3LISA 2DCTA 4IEWA 4MUVA 4OFGA 2O8QA 2PPXA 2CV6A 1UTXA 3U11A 2PAEA 4EWEA 1PRAA 3O9XA 2O38A 2PE5A 3ZHMA 1V70A 2D5HA 1QQAA 2E9QA 1HF0A 3MDPA 2N7GA 3L1PA 4IWRA 1GQGA 3BU7A 1ZZCA 4X4IA 4YG7B 3OGJA 4F8AA 1O3SA 2PAKA 4D7TA 4NDWA 4LEJA 4N9IA 3RYPA 2CGPA 4I2OA 5BPXA 2EF8A 3HIFA 2D40A 4K8FA 2GH2A 5KBFA 4YSFA 1WGPA 4IETA 1O4XA 3FZ3A 3NL1A 1O7FA 2D93A 3CO2A 4ZU4A 1VP6A 3RPQA 1ZRCA 3H50A 3KSCA 1SQ4A 2AW6A 1IPJA 1QWRA 3ETQA 3I59B 5A7LA 4Z59A 1UIKA 3LZZA 4HLTA 4JTNA 4E2QA 1CAWA 4I3PA 2FQPA 1EPZA 2QCSB 2PUEA 2XLGA 5FLJA 4ZU7A 4J1XA 2LYJA 3S0MA 3H1WA
chains in the Genus database with same CATH superfamily
1VRH3 3AVRA 4X8NA 5FP8A 5JMCA 3BOWA 4RQPB 1LEDA 1PIV1 4LLFA 4DE8A 1WW5A 3R4DB 2H0BA 5H9PA 1L1MA 3OPTA 2ZMKA 4CCEA 4H14A 4CDXC 1W8FA 5FTTC 2QQOA 3RFRA 5BYNA 1KRIA 4BIFA 2BWAA 5DDJ3 1WUVA 2P5BA 3WHTA 2Y0OA 3AB0A 5LCWL 1JXNA 2J7MA 4RGGA 4LO6B 1NQDA 3VKLA 1LGCA 2VXRA 2A5ZA 3DYOA 1PIV3 5I91A 4PLOA 4X4BA 2ARCA 1AXKA 2LCVA 1NCQB 3SCFA 2D97A 4LITA 4P9WA 3WQ1A 2Y38A 3I2KA 2PHXA 1OSLA 2MPFA 2WO1A 5HXVA 2V5DA 3C7OA 1W6QA 4IXLA 4QX5A 1E3OC 5IUQA 3SNMA 3GBGA 4FXKB 1EP0A 4WBBA 4BLJA 1N3PA 3SCGA 2GRMA 3UKVA 2BNMA 3A0NA 1PRVA 4IW3A 2GMEA 4D0QA 2BGPA 2JECA 2RR11 3H7JA 2A6YA 2XONA 2RM21 5FREA 2XJPA 5BNPC 1WWYA 4DNYA 1VJ2A 2ZHLA 2LNMA 4PQQA 1UAIA 2VOTA 3KQRA 4RR3C 5K8SA 1B09A 1G86A 3ENRA 3OF1A 1UMZA 2ZEYA 4XF1A 2R041 5DT2A 3H42B 3IAQA 4FOYA 1O4ZA 4FPCA 4Y1YA 4NVPA 4RN5A 2RR13 1J3PA 5FZMA 4CUGA 1QH7A 1AYN3 2GNMA 1OVSA 2RM23 2EWTA 4IEQA 5FZAA 4DEQA 1OURA 2GN3A 1IGOA 2QBXA 2ZHMA 4ZS2A 1UQXA 5KXBA 2VZSA 2PXTA 4KWLA 2QJVA 2VZQA 1GWLA 4AZZA 2R043 3UJQA 5K7PA 1Y7BA 3ZOIA 2PFWA 1ZA7A 1OCTC 2ZX1A 3ES4A 2O4AA 1AYM1 1R083 5EZWA 3QLQA 5F1RA 4QU1A 1YFWA 2JICA 3ZO0B 3J8F1 4GXLA 1KDKA 2WFF3 2XIUA 1OUSA 1A6CA 1QGLA 3MBWA 2X09A 1YHFA 3C8XA 3R1FA 3D8CA 4QX8A 1JW6A 3PURA 4AVCA 3ST7A 2WZR2 2TNFA 3T2OA 3CIHA 4Q27A 4UF0A 2YU1A 5GAHi 1XNDA 1TNRA 1PZ9A 5H9RA 2XKOA 4PDWA 2Q8OA 4PU3C 3AMPA 4GMP1 3MIDA 2Y33A 1Q8PA 3A9XA 1ENRA 3GXUA 1UNBA 4PU4C 1E5RA 1RZRD 1WKYA 2O8OA 4FPJA 4CE8A 3O1SA 3S7IA 2FDJA 1OQEA 2BJSA 1Z7S3 1U5XA 1W9FA 1S2KA 4I6RA 2A6WA 5DUWA 4YZ3A 5HCHA 2RV9A 3VBOC 2RS31 2BGCA 4GMP3 3LPFA 2WBKA 4A7KA 1S7EA 4PLMA 3FFQA 4R8HA 4U36A 2AUYA 5F3EA 2ZZQA 4HMZA 5D21A 1NEQA 4CDXA 3AMMA 3AP5A 1ZBE1 4MX3A 5GLWA 4PJYA 4QHOA 1U5IA 4EYUA 1HW5A 2PHRA 2AREA 4UFMA 4V1PA 2LYLA 2RS33 4DFSA 4UF0B 2J22A 5FYCA 5JAXA 4LT5A 2G9ZA 3LOIA 1SACA 3F95A 1JYVA 4PDWB 2HWF1 3WZ1A 1OI6A 5FPBA 2G4IA 3MUZ1 4PI0A 1LHWA 1IHMA 1ZBE3 4LBMA 4GWMA 1JODA 3ROUA 4COVA 3ZSMA 4CEYA 1Y9MA 1NZIA 2ID4A 2CSFA 1MZ6A 4Y4YA 2W5FA 2NP0A 2F6BA 2WABA 2GNDA 4RD7A 3WG2A 5GLUA 3BTXA 1UO9A 4FI9A 4CEWA 3QOXA 1N1YA 5K4LA 3USUA 2WLPA 1ND3A 4PF5A 3ZN6A 5BV6A 3UGHA 5KC6A 2YXSA 5BNPA 2QQVA 4CDXB 2C9KA 4GHJA 4BE3A 5FPLA 1BBT1 1GANA 1UU6A 2VTXJ 4IVZA 4Z5HA 1UOBA 2JDZA 1FV3A 2RDSA 3LQCA 4JCKA 3VBUC 3WOGA 2ZGRA 5CKMA 5APAA 2MEV1 3IIIA 1AR82 3M70A 1UN1A 5GJ6A 4XFCA 4MLOA 1BBT3 3PUQA 5I8TA 1VALA 5JOXA 4YVSC 3EJKA 4LBJA 4XQDA 2XHKA 4OZOA 3VN4A 3CKHA 2MEV3 2Y0IA 3MEJA 4DINB 1DZRA 4CEWB 3C3VA 3H3UA 1OMIA 3AZVA 5LRRA 3USUB 3ZFEC 5J98B 1ND3B 4GAZA 1EFAA 2V4VA 3AKPA 2L49A 1W6OA 4LK6A 4LO4B 3ZN6B 2QDRA 4L0PA 3OQNA 1W3VA 2CGNA 1AUYA 4OLLA 2GZUA 3GF6A 3VD5A 2IFRA 1H4GA 3FBYA 4FO9A 3AC0A 1RMU2 2QQNA 2WO3A 3CLCA 4V2WA 4ES9A 4F7ZA 2DCJA 2UWBA 3NKTA 4K6BA 2FFHA 4DB5A 3KZ3A 4AEDA 4COZA 4DMIA 1IG0A 2M4HA 1RGSA 2YGLA 3D5OA 4XQWA 4YZ4A 3CZUA 3VHRA 4QPGC 4CUAA 1EY2A 4QXKA 3PTRB 1W8HA 2W47A 2QQPA 2NPIA 3I2IA 2DF7A 3QD6A 4UW4A 2WZEA 5FZDA 5IFPA 3K46A 2WS91 5IK7A 4UBGA 5C3PA 1IQDC 4N8MA 2PXFA 1BEV1 1BKZA 1DGRN 1UZZA 1YYNA 1APNA 3FLTA 3O0WA 3PUHA 4IERA 4WZFA 2WQZC 5FP4A 2DUPA 1S0BA 1W8TA 4QB1A 3NRUA 4NOTA 4N53C 2RJLA 1JFSA 4CCNA 4EJRA 5GAGi 1X8MA 2G9GA 1W6OB 4Q1PA 4B4RA 4ET7A 1Y4WA 3HWJA 3ELNA 3V64A 5D8AC 1BEV3 4CDUC 4FFIA 1L3JA 1BVVA 3VDDC 3J7HA 4ZPIA 4XF3A 2YHJA 5FMOL 4HN1A 4OI1A 4ASKA 4BLIA 2XBO1 4JQTA 1YWKA 4N43C 1MZFA 1OLRA 2HWD1 2ZEXA 4MHUA 1O6UA 5FZGA 1SBDA 1SZBA 5ANQA 5FY9A 3RZHA 4FQZA 3FL7A 1WA6X 4E2SA 1OF4A 3NNFA 3S5QA 5AVAA 3B02A 4LBQB 1VB4A 1I9RA 1W2NA 2XBO3 5FPZA 1G6NA 4MXWB 5H9QA 3ITQA 2QE3A 2D6NA 4GB31 4K8RB 3VZOA 1QHDA 2ZXQA 5AFBA 1GKBA 5H9SA 2OVUA 3KXAA 1Y9GA 4AF9A 4B4QA 4DO0A 1ZZ6A 1HXS1 3GGLA 2PXQA 1RTVA 1VBC1 4BQ3A 4LBLA 2ZMNA 1SDDB 1NG0A 2WNEA 3LFIA 2RMU3 4Q4Y2 1YLLA 3VBUA 4LQRA 1ST8A 2R062 4GB33 3GM8A 4YARA 2RS51 3AP4A 4DY5A 4ZHNA 4A2UA 1YFXA 1HXS3 1ZVVA 1U5YA 2J1VA 5IVYA 1VBC3 1OXCA 5E16A 1Q8VA 1UF2C 1YSEA 5FZ1A 3SH5A 4IGPA 4OMCA 3MIHA 2ARXA 3LIHA 1GOGA 3HT1A 3BTAA 4CUBA 2AACA 1JZ6A 3I3MA 3WNOA 3ZIXA 4X4CA 3D6EA 4XIOA 3GN5B 3M1HA 5K98B 1EAH2 1XSRA 1RUI1 2Z79A 3J7LA 3ZSEA 3OQOA 2EXHA 2D6KA 2EA7A 5F6KA 4PIYA 2ILMA 3PTYA 5L19A 4XJ9A 3ILFA 2DTYA 3INAA 1UY4A 5FV3A 1HRV2 3NMBA 3IN9A 1R1A1 4EROA 1PX3A 1Y3TA 3UT0A 2EIDA 4AQ6A 3MW4A 1XPWA 3ZKYA 1LGBA 5IK5A 1WBFA 3POEA 3VBUB 1QXPA 1COV2 1IPSA 2P6CA 2BOJA 2X8KA 5EFUA 2VR4A 3AKRA 1ULOA 2A3WA 4L11A 2RVAA 3KF5A 4TYSA 4QPGA 3AYCA 1POUA 3LFPA 2PHLA 2D44A 2XVLA 3ECQA 1R1A3 4ARXA 1YIFA 5DTRA 1EYBA 1F4AA 2VMDA 5JZGC 3KJXA 2EAKA 3MW3A 4NPRA 1VBD2 4NHKA 4O61A 5A7OA 5LA1A 3O1OA 4QX3A 2ZTNA 1OPMA 2PHTA 4HPKA 1ZS4A 3THDA 1JZ8A 2D6OX 4N53A 5F3GA 1OH4A 3F52A 3ZFEB 1ZVFA 1LHNA 1QZXA 4NE9A 1YI7A 5ACA3 1WIZA 1OQDA 4JKLA 3RG0A 4BQWA 3I2HA 1Q8QA 3LE0A 4AXOA 4DUXA 3BI3A 2R63A 1GZ9A 2HYXA 3E6DA 1W8OA 1DP0A 3VDDA 1L7LA 4NROA 4EE2A 4Z5CA 2LM3A 3LCPA 4RHV2 4M3CE 2PTMA 2WNUC 1N1VA 2W91A 2IXCA 1QPZA 4Q26A 2O49A 2OFYA 1YCIA 4QPGB 1JU3A 3ZXAC 4Q8KA 1PERL 4WM8C 2SLIA 2IVBA 1OD3A 3AKTA 2I74A 4JHZA 4HVQA 5GLTA 2YFZA 3KHCA 4A3ZA 4E4DX 2V72A 4UOJA 4BQ5A 1HJFA 4XOGA 1W6NA 2Y6FA 4EZ4A 1LESA 1IG3A 5T55A 5C71A 5LW9A 4HPKB 2PLV1 2ZPXA 5FZ0A 4N53B 2XOMA 4AEMA 2VAUA 2IU7A 4BWOA 1I1EA 4QX1A 4BXFA 3FE5A 3NNMA 3SITA 3H0OA 2VMCA 5D8AB 3OJBA 3SC7X 5FR3A 4I0AA 3A9YA 2L8NA 1H1IA 2W08A 3CJIC 4GA9A 5HCFA 3VDDB 1UYXA 2PA7A 4N43B 3I49A 5FYUA 4B1LA 3I2OA 1AR91 3AL6A 3JB4C 2B9VA 1REDA 2ZX3A 5B4XA 4FP3A 3G5GA 1HRI3 2VW0A 3B93A 3WNKA 4XJZA 3ME2A 5JSRA 5FZKA 5IVVA 3SEEA 4YG1A 1I5PA 4DPNA 2D7FA 3LDRA 3ZX7A 3OWQA 3ACIA 2VW2A 2BVVA 3K2OA 5DZEA 1W6NB 3U3WA 2OX0A 1H6XA 1G9AA 1RZRA 4Q4X3 1S0CA 2TEPA 2BVBA 1FPN2 5F3IA 3PMSA 5G04L 5ISLA 4Y24A 1ZBA2 1LHOA 2UURA 4D7YA 3GHMA 2NYYA 4KGQA 2P17A 3B94A 4XZPA 2Q8CA 3JXDL 1H8TC 2FJRA 1WA4A 3OGRA 3HEIA 4UAPA 4AI3A 4UXAA 1G9DA 1ASJ3 2X5IC 2WQ8A 2HINA 2XLAA 4JV4A 1HV0A 4CU7A 3B01A 2BQPA 1VBB1 2OZJA 1YQCA 4PQ9A 5IWFA 3WDYA 3LEKA 3AXDA 3HMYA 5GLZA 1SBFA 4OI4A 1J1LA 4K9SA 4GULA 3GZDC 4QPIC 3B5LB 1RUC1 3OKZA 4HG6B 2RS11 3M3OA 5FKBA 5BXXA 5T5PA 4CA9A 5LBFA 5KHKA 1W99A 1XNCA 4W6YA 3WCSA 3AFGA 2GNTA 4Z07A 1VBB3 4AVAA 2JENA 2VQ0A 1C28A 2CYFA 4LBNA 5FY4A 4NPMA 3VL8A 1S0EA 3ZXJA 4I09A 4AL9A 5IYYA 1RUC3 3OPWA 2RS13 4K1YA 3B7HA 2I07B 5FXZA 3VKNA 4HFSA 2EVXA 5LBEA 4LE3A 3BS3A 2D5FA 5EV7A 2C24A 2XJ3A 5ANNA 3MLLA 1TMF2 3GNEA 4Y26A 5F2SA 4BCUA 2R32A 2DURA 3BN6A 3JD72 4FAGA 3WF3A 1H9PA 2JE7A 1DIWA 3UNPA 4CP9A 4AW7A 2IXHA 4EWAA 1OT5A 5BNNC 4Y5Z0 3TN93 5I93A 5JZGB 3LISA 2PHFA 4BQXA 2WJSA 2HEYF 1HJGA 1HV1A 2YBKA 3N9PA 3S30A 1VBA2 3B9CA 5IAVA 1UTXA 5JOZA 5FY0A 1HIXA 3C7EA 5FIXA 5SV8A 2ZGKA 2PAEA 1NY71 1ENQA 2QQIA 2A6VA 3K48A 2ZS6B 1WW7A 1HX6A 3NO8A 4IWRA 1S0IA 1GQGA 2W95A 2VUDA 4X4IA 1IS6A 1W8UA 2C5DA 2WT0A 1RUG2 2OW4A 2PMWB 3Q8EA 4QQLA 5E89A 1C5HA 3O1VA 4LEJA 4I2OA 3SH3A 1SLBA 2HEWF 4J25A 4RL7A 1N3OA 2VNVA 4JGZC 3ZYPA 1FOD1 2RDRA 3R05A 2GH2A 1WGPA 4IETA 3RWNA 4BJ0A 1FOD2 1JOPA 1O7FA 4WM8B 1D4VB 1VP6A 1WCQA 2KR2A 4LE4A 3H50A 3RPQA 3ETQA 4COUA 4Z59A 1YI9A 1M4WA 1UIKA 4E2QA 2W1WA 1LOEA 1RXGA 1ALYA 1F15A 4HONA 4ASMB 2FQPA 4CDQC 1W0NA 4FOWA 3P1IA 3TRSB 5DRYA 5CAZA 1JZ3A 3I3BA 4YGDA 1RIRA 3W21A 3IAPA 3OTFA 1C8M1 2IVGA 1H8TA 4JX0A 1YJLA 3SR4A 2ZMLA 1OOPC 1QQP1 3I2DA 3ZDVA 4M3CA 5AC91 5IVFA 4FPHA 4XIKA 2PIJA 2R1BA 1HN0A 4ISQA 3IDAA 4L92A 4FBFA 4AE2A 3VHOA 5LWBA 5DAQA 4HETA 4P00B 2HSGA 1C8M3 3AXEA 3ABZA 2B42B 2BFUL 2YBSA 5BUVA 4LNVA 4BQYA 1YFYA 1QQP3 4WVMA 1RUH1 4RGAA 3VK0A 2P6HA 5AC93 5FK7A 3VBSC 4YFWA 4IA8A 2NMOA 2W39A 5J48A 1ENSA 2KA3A 2FDHA 5EXOA 4XAAA 4N9HA 1TME3 3A21A 3T1LA 2LYPA 1N1TA 1O8SA 1NCQC 4XUOA 3WUCA 2DVBA 3IDEA 3NNLA 1TEIA 1CAUA 3N9NA 3WP3A 1UCXA 4KWJA 2LRPA 3UESA 4DIQA 4F83A 2B4KA 1H8TB 4JTOA 4AHYA 4NAMA 4XFGA 2MEZA 2DVAA 2IWGB 4M3CB 5J7MA 1JZ4A 4MCTA 5DAWA 2X10A 5CADA 5IVJA 3ZHIA 3ASIA 3DPRA 4UT5A 4EN7B 1TNFA 5BNNA 3GZTB 4AAXA 1CJDA 1R69A 1YFUA 1PNRA 4YVWA 4Y3OA 5KHHA 3TN91 4DUVA 4A45A 1PNFA 3ACFA 2WYFA 4JDOA 5A3OA 2BGOA 5T5OA 3WDXA 1D2SA 1N3QA 2YC0A 4WVMB 1G9FA 1UZ0A 2VBDA 2X05A 1Q3EA 1OBNA 4AYUA 4UWDA 2Q1FA 1POV1 1LU2A 5FO7B 1F8VA 4XF9A 1PVC2 4BQ4A 3ILNA 2XJUA 1V6LA 4UW3A 2OYZA 2BOIA 3WW2A 4O65A 5JXIA 4QM8A 1URXA 4JGZA 1AX2A 3POBA 2WSVA 3IIAA 2HWB1 2VVEA 2LYRA 2A6CA 1H30A 2VTFA 3ON7A 4XCBA 1X7NA 3SMHA 3URFA 1CAUB 4HN0A 4NIHA 2V73A 1NERA 2HWB2 4IE5A 3J4UH 4CCOA 4YPJA 1POV3 2A70A 3FWEA 3IZOA 1RUJ1 4MGIE 4URTA 2RDNA 2VBBA 3TOJA 2BDRA 4HVOA 1ZRDA 1W05A 4I6TA 3KT7A 4DUWA 1JYXA 4E8DA 2DVGA 4QQPA 4WVLA 5F2WA 4EN9B 2A3YA 4YM2A 3TELA 1AXZA 5BNNB 1UL9A 4AFCA 5C4WC 4OULA 4CZSA 1RYYA 4XUTA 3PUAA 3PHMA 4TZDA 1RUJ3 3WQ0A 2SBAA 1F35A 4ZU5A 3RZMA 5DTQA 4KU8A 2QQUA 3VDAA 5A6ZA 2PXKA 2JKXA 3B9IA 4EN0A 3EMRA 4FAHA 1UW8A 3GUUA 3AX4A 5KXEA 1RUNA 1LJ7A 3ZM8A 4CCDA 4YG3A 1B35A 1AJOA 4DY3A 5JOYA 3I4IA 2AUWA 2W2IA 4FFGA 1OOPA 4YW7A 1PGL2 3EBRA 3QCWA 5CIRA 4CSWA 2PUDA 1O4TA 1UOFA 2XXZA 3F2ZA 1C4RA 1XYNA 3DCQA 1PMJX 3LSDA 4KGGA 4LHKA 4S2FA 1K5MC 2A1XA 4OB4A 5C33A 1QJX1 2CDOA 1SBEA 1UOJA 5CFDC 1K45A 1UYZA 1Q5OA 3DXUA 4D7SA 4QWNA 4UFHA 1LLIA 4NIGA 3HN3A 4GIQA 2Y34A 4Q4V3 5KHJA 2DDUA 1AHSA 2JDPA 3LDBA 1W39A 1WLCA 2R071 1VAMA 4HKWA 5A7WA 3W20A 5ABJC 2GZWA 1GSLA 3NJZA 5I0UA 3VBSA 1D4M3 3ZXEA 2EXJA 3G6JB 4Y5SA 1QJY1 3S57A 2KEKA 3E5UA 4FPKA 4MOAA 4XFAA 3OD0A 3QOPA 5IT6A 4FPYA 1FMD3 3WV6A 1VRH1 1DU3D 1ZAYA 2FMDA 4OHVA 5DAPA 3RRDA 2ORXA 5A32B 2XVKA 4CP2A 3M3CA 2R073 3RYKA 4ATFA 3TBDA 1JH5A 3H1YA 1BMV2 1OOPB 3HNMA 4KMQA 1JH9A 1BDHA 3OBTA 1X36A 5DMYA 4QU2A 3NXHA 2K0GA 1G9BA 4FFHA 4D3WA 2PUAA 5DDJ2 5BY5A 1Z0HA 5JUVA 1LRHA 3NVCA 3OGSA 4JGYA 3OMTA 1VB2A 3CDZB 1NA1C 4CCCA 3TEPA 1PIV2 1ZM1A 1KEXA 5A7WB 3RDIA 4DXZA 1HDKA 4IEXA 4XMIA 2JB4A 5E8AA 3VBSB 2X29A 2CY6A 1SFPA 4AVBA 4D8MA 4P14A 2R1DA 3V56A 1RJ7A 1IC8A 1ULCA 3MW2A 1AX0A 1ONAA 5JLVA 4LA3A 3CROL 1WCSA 3WP6A 2VL4A 1S2BA 1YQ2A 4R9AA 1H6YA 2RJKA 3AYAA 5FZ3A 3TEWA 1O3TA 2YYOA 4NHLA 3AYEA 3PU3A 1XE7A 4FVVA 4NO4A 2OPWA 4CCJA 4CEYC 2VULA 2XLFA 3U0ZA 1QP4A 1S55A 3RYRA 1H2KA 1OHFA 3CF6E 3GHNA 3ZXKA 2V4AA 2ODRD 1BDIA 2P37A 3OBAA 3AM2A 3MV11 4DE9A 2IUWA 3FMGA 3RNSA 1VBE3 2CHHA 3VZMA 1ND3C 5C4WA 3U1XA 1AYN1 1W2AX 4JGYB 3T08A 2FBEA 5C7GA 4YW5A 5J96B 2RR12 3PNAA 4TLFA 1MS3A 3JQXA 5DAXA 2Z2SB 2K46A 3WG4A 1AYN2 2RM22 3PUSA 4CRQA 4XAEA 2EIBA 2Z69A 3RI9A 1R091 2KPJA 2QQWA 2XCJA 1SG3A 3N9OA 3K75B 3N9QA 2P4EA 1HB4A 4B7EA 4P9XA 5GALA 5LRSA 1R081 2R042 2FMYA 2J1TA 2XQXA 3POFA 4H2AA 1DGWX 3DYPA 4S2HA 2G9FA 2HBTA 5FY8A 3UKTA 5FOJB 2WYSA 3MPPG 3ZFFC 1SDWA 1V00A 2WFF1 4NN0A 5I0DA 3NZLA 2C0ZA 1R093 1RL3A 1GV9A 3OYWA 1K5MA 3AZYA 4XCAA 1LEMA 1W6QB 2OPKA 3JB8A 2OQ7A 5FAXA 5CFDA 4D6QA 2VVDA 3TEZA 1RVF1 2Q1MA 4A6SA 2UWAA 3KT4A 3N7JA 1NE6A 4XZUG 3MFAA 1AYM2 2W52A 2W0XA 2ETEA 3C7GA 2Q8EA 2GC2A 1SLCA 1XU1A 2PXBA 1VR3A 3J8F2 5ABJA 5FWJA 3OUJA 1WMEA 5IVBA 1WH6A 1KDMA 1DGRA 1LHUA 4ISRA 1ZZ9A 1Z7S1 4I3GA 3FMYA 3NAPC 4QT6A 1RVF3 3NSTA 3Q8AA 4YZ5A 3HNYM 4UBHA 4AEDC 5EJ1B 3OG2A 2DTWA 2ZBJA 5F5IA 2C9AA 2GC3A 2KD7A 1XU2A 1A3KA 4QGLA 1Z78A 2ZGPA 2J1RA 5B2GB 3VGIA 3NJVA 1REFA 1W03A 3BALA 2GN7A 1LOFC 2VOWA 1JYCA 4IESA 4M01A 2EXKA 5AVPA 3NNJA 1VIWB 1K5MB 2VJXA 3WDUA 3WNLA 1PM4A 3W5NA 1EUTA 1S4CA 1V6OA 1H0BA 2BFUS 1ND2A 2JIJA 5CFDB 1OSGA 2RS32 2W68A 4W65A 1KJRA 1NA1A 3AP7A 4JHTA 3VD7A 4BHPA 3D0SA 1MS9A 3MYXA 1PZ7A 2PELA 1J3QA 1GLHA 3POSA 4XETA 5ABJB 1ZBE2 3PE5A 3BTYA 2WZR3 3SEPA 2RJ2A 4CU9A 3RZZA 3F6WA 1NE4A 1XE0A 2JE8A 5A80A 1O3RA 1UXDA 4XC9A 3VKMA 4GJZA 2WFPA 2TBVA 4K1ZA 3U07A 1OA3A 4BA6A 1Q43A 5FXWA 1DULA 1JI6A 2ZOEB 2R1JL 4Z82A 4ARYA 2VNOA 3O5SA 4A42A 2HWF2 1PO23 1BZWA 5A7NA 3NDBB 4YNIA 1NYWA 2VTXA 1LGNA 3I2FA 1AR61 2Y64A 4Y1UA 5GKAC 4LORA 2JQEA 1DYKA 2AXZA 4Y4RA 2EIEA 2WIUB 4PU8A 2AEZA 2MNGA 4E4SA 4AFBA 4I01A 1ND2B 1NX9A 1Q56A 3CHXA 3PJQA 4FFFA 2QZ3A 4GQMA 2XH6A 1NA1B 2WSUA 4OUMA 2WO7A 5LK7B 1DG6A 1AR63 1IPKA 3KF3A 4P02B 4LO7A 3U75A 3I8TA 3POYA 1V6NA 3POWA 5JXGA 3DKQA 1TVGA 1JMUB 1BBT2 1F5JA 1XYOA 4PCRA 4LUMA 3I7DA 4RSUA 1WZXA 1C5IA 3ZFFA 2OIIA 2PXJA 3SCHA 1U12A 2MEV2 2ZHKA 1H2LA 3C7FA 4PIZA 4Q0UA 4OI2A 4XPVA 5DUVA 4CEYB 1HLCA 5I0SA 4C8DA 3TFLA 2D43A 1GICA 1C1LA 1W9SA 4PBPA 5EP9A 1O8PA 3EXUA 2Q0AA 3A7QA 5FCCA 4C90A 1O5LA 2PN5A 1YQ5A 3RVHA 5KXDA 4Z5DA 1W6PA 2R0HA 2WN3A 3B69A 2ZGMA 3LIGA 2CAUA 3MICA 3N36A 4PHZA 3AFKA 3KGLA 3M4FA 3R4SA 4KBZA 5J1XA 4LIVA 2B5AA 1QMJA 1CVNA 1LOCA 1RUF1 3USSA 1RUE1 2NZ9A 4JKMA 5JI7A 1MPXA 4JC1A 3N7KA 3NAPA 4Y1XA 1MS5A 5FZ6A 1R1ZA 4BDVB 1NOVA 3E97A 1E5HA 3NV1A 1RIOA 3L2YA 1RUOA 4BZ4A 3T4HB 2DBNA 3KV5A 1MS0A 2ZGOA 2B39A 2JDAA 5IHRA 4HSJA 3THTA 1U2ZA 3ZFFB 1RUF3 4FSJA 1RUE3 2HBUA 1K42A 1LOFA 4CTEA 1A78A 2GMPA 1JYNA 4CYDA 1DW9A 2C4XA 2Q8DA 3FN9A 4R4XA 1QU0A 2BZDA 3MF6A 4GZ9A 2BRTA 2WS92 1WW6A 1QDOA 2PQSA 3GCXA 3LEGA 4XFBA 4XXPA 1BEV2 4MG2A 4I02A 4ZZ8A 4QB6A 3DGTA 2D6PA 3SH4A 1W6PB 3OYWB 3CZJA 4QXHA 1HN1A 3AMNA 3WP4A 4HXCA 3DNVB 2VZVA 4MGZE 3HVDA 3NAPB 5K9YA 2JG8A 3BVCA 3DV8A 5DUUA 3LA3A 1JZ5A 3WG1A 1UY0A 2Y60A 5F7UA 5C3SA 3G7DA 5C4WB 1QKQA 5JVVA 4AEDB 2XBO2 3D4KA 4Q0PA 4BK4A 2FDFA 2HWD2 4SBVA 3VBHA 2P1BA 3AK0A 1RHI1 2XXPA 4QKFA 4Y1VA 4AI2A 4B4PA 2WUSR 4ER0A 4C1XA 1MVEA 1KQRA 1GP6A 2RMU1 3IMNA 2VGDA 1JYWA 2LS6A 2GH8A 1SCSA 2EXIA 2RMU2 2IV1A 4JRAA 4N90A 1UOGA 2WKKA 3N3HA 4GB32 4WM7C 1RHI3 5E6HA 5FLHA 4Y42A 3K4ZA 5FZ4A 4AVVA 1ADRA 1GZTA 3LF7A 4OHXA 2XPJA 2KM2A 3CMGA 3MZHA 4KG0A 1HXS2 1YEWA 1VBC2 3M7AA 5LEKA 1UYPA 3MPBA 1O59A 3RZJA 2YC4A 1GZWA 3K77A 5ERLA 1UX6A 2YUEA 4IE0A 2VECA 4D6RA 2J7UA 2H0VA 1BXHA 1I5ZA 4R9DA 2JG8B 2JJ6A 2ZGQA 4S2GA 4DRVA 2RS52 1B0NA 4QX0A 2FHRA 2ZGNA 4AVTA 2IUOA 2IVIB 4Q29A 3RZKA 4MYEA 2V5YA 3VBHB 4E4ZA 1VPWA 1U5ZA 2X53S 4EN6B 1MS4A 4JKKA 1LOAA 4MCXA 1PM7A 2HEVF 4FQ4A 3M2MA 3M3IA 2W92A 5CZKA 1RUI2 1PX4A 3GJBA 1ACCA 3AVSA 1HB2A 1VMFA 2W94A 4XFIA 5T3NA 3D82A 2LLVA 1JOJA 3BU0A 3M8LA 3H8UA 4K20A 1O91A 4IEWA 4PI2A 3JU9A 1R1A2 1F9KA 2F4LA 1PHMA 4OFGA 3RQ0A 1GZWB 5F37A 2YU2A 5JXJA 3KCYA 2PPXA 2CV6A 5GM0A 2P3IA 3HOBA 3WINE 1SLTA 1ZRIA 4ER5A 4EWEA 5L73A 2O38A 1T6GC 2D5HA 1QQAA 1C3HA 1XNKA 2QZ2A 4EQVA 5ACA1 1IS5A 3MDPA 4XURA 1TG7A 3WDTA 4FPFA 4Q4W1 3ZYRA 1W04A 2YY1A 4GKYA 2PAKA 1CR7A 2GSYA 5F5QA 4D7TA 1EAH3 2CGPA 1V6KA 4P9LA 5BPXA 3IKWA 5DG2A 2VO5A 5FXXA 2BU9A 4NR1A 5KBFA 2AENA 2ZGLA 2QUOA 2DFCA 1O4XA 2Y26A 2ZHNA 1T2XA 3SQOA 1PK6C 1R64A 2D93A 4CU8A 1FX5A 2A6XA 4Q4W3 4RFRB 1ZRCA 3KSCA 1IPJA 1QWRA 1W8WA 2ZGSA 1AR71 4YGCA 1C1FA 3ATGA 4XW3A 1MACA 3MLJA 1L7QA 2HWC1 3PL0A 2JG9C 4XUQA 1CAWA 2JDNA 4IDZA 5FLJA 2RHPA 1ULDA 4J1XA 3MHZA 1OPOA 3NV2A 3HN1A 3AYDA 3S0MA 2BTVC 3WF2A 4LKDA 2FCVA 1DZQA 3ZXFA 1JYIA 4YW6A 1PO11 5FZ9A 4AEJA 1WMFA 5FO9B 2JWPA 3WQBA 1AR73 1UPSA 4W8JA 5BNOC 5K0UC 2VD7A 3RZLA 2HWC3 2ZKLA 2WN2A 3LEIA 1KS4A 3D3AA 1ZRRA 2OT7A 4XFHA 4WM7A 3IM0A 3POIA 1PO13 1BYHA 2PLV2 2MHFA 1QNYA 2Y6KA 1X50A 4M0HA 3FFZA 3OUIA 1DBNA 2BNOA 1HRI1 1FNZA 5A3PA 1WCUA 5FYBA 4AFDA 1PNGA 3FX3A 1OKQA 4AWDA 2ZABA 1REEA 3PVOA 4KWKA 4ZS3A 4SLIA 4XJWA 5JWPA 4FT8A 1CAWB 2ZA9A 4MH0E 4Q4X1 5LZ6A 2OUHA 4O7XA 3KVAA 2XSDC 4Y33A 4BB3A 4BPZA 2V3CC 1AR92 2VQUA 4HKLA 4AI0A 3FLRA 1HQNA 2EIGA 3KV9A 2WA3A 2G1MA 2B9UA 2VUJA 1ULGA 2VE1A 3ZYJB 5C3QA 3RWKX 1PMIA 2P2KA 5JPMB 1ASJ1 3PVEA 4UW5A 1KJLA 4IQPA 5BNQA 3IWZA 5HI0A 3O1RA 2LTNA 5JSPA 2DFBA 3RZGA 1NW3A 3JZVA 2E31A 4WM7B 1JHNA 3BDNA 1QH6A 3QF3A 4E4HA 2NQYA 3GDBA 3TEXA 5BNPB 2RG4A 1DQ5A 1H2MA 5EJZB 5FYHA 3THCA 4EWDA 4TLGA 4C1WA 1MS1A 4YG4A 1GP4A 3P5BA 2R49A 1VBB2 2PQQA 1SFYA 3WUDA 4RS5C 2E33A 3AJYA 3T0BA 3SX0A 3VLBB 4LO8A 3MIFA 3WNXA 2QNKA 4PLNA 5JR7B 3WF4A 1RC6A 1RUC2 2RS12 4GKXA 2ZX2A 5JPNB 1IZ3A 1CQTA 1ODMA 4TSVA 5FMOS 1XRUA 3WCRA 4META 5KWRA 1G7YA 2J1UA 4G4FA 4NAOA 5FBJA 2QQMA 4AG4A 3J7MA 5IK8A 3FLPA 5A6XA 1PK6A 2Z42A 1WETA 2W46A 4EV0A 4P5HA 2PYTA 3T09A 3U37A 4O9EA 2Q30A 5E1RA 1NT0A 2PHUA 4O9GA 4EN8B 4CXXA 4P9JA 1MQTA 2JG9A 4XABA 2WZPP 3DM5A 3LGRA 1OLQA 2AXVA 4MHRA 4XF0A 2VNRA 4ZXEA 1WCKA 4AVSA 3LWCA 4OYUA 2OKXA 3E6BA 5A3LA 3DPRC 3WNMA 2FDIA 4IV1A 4Y20A 5BNOA 4OI0A 3A22A 4XUNA 4X4FA 1S0FA 3EQEA 4YVWC 3VBFA 4Z2WA 1XYPA 3BIEA 3GZUC 4K21A 2UYBA 2LW8A 3Q8CA 2Y6LA 4FBIA 2A3XA 4HK8A 2P3KA 4LK7A 4GMP0 2V09A 5CVRA 3H8OA 5DZGA 3DKWA 3ZYHA 1RUD1 2E32A 2WA4A 3NWKA 3H7YA 1VAKA 1MEC1 2VPVA 3GBWA 5K0UA 2IXJA 4JQDA 3VWSA 1GU3A 1NY72 1SLLA 2MXDA 1PK6B 2HCNA 2VZTA 3MUY1 2J1SA 4X6QB 4YYOA 3RMYA 5DPNA 4OQ9A 4V2VA 1ZYBA 1BVP1 1X33A 4QQ2A 2D3PA 1A34A 2VG9A 3G0TA 1LU1A 4YZ2A 4HZFA 1MQTB 1RUD3 2JG9B 4G9SB 2KEJA 2BJCA 2HYKA 4FPEA 4QDRA 3ZYIB 1MEC3 2D3RA 5FMBA 2O1QA 1W9WA 1XB9A 2DVFA 2NN8A 5C3OA 4MGQA 2C26A 4FP2A 4IEUA 1C8NA 4ORFA 4XTMA 4CP9B 4Y20B 1KITA 4A6OA 5BNOB 3FC0A 1YO8A 3DECA 2BYVE 4Q0VA 5G05L 3UYJA 3VBFB 3WF1A 3O0XA 3GJAA 1SCRA 3KWVA 5FXVA 3QH6A 1FI2A 1LNSA 4QX7A 4YW2A 2A6ZA 4AGVA 5JDBA 5LA2A 2O0OA 5A33A 4KU7A 2VMFA 2KZ8A 2YZ4A 5J36A 5FLIA 1KD7A 4W50A 5K0UB 1B35C 3NKGA 3LB9A 2DWRA 2VBPA 2VZ3A 2VMGA 3NROA 3HQRA 4LMFA 5L9BA 2E7TA 1C8M2 2R30A 1GT0C 2JD4A 2PXUA 2CGOA 1GZCA 3BGAA 3OBRA 4QPYA 2YFUA 1W2UA 1CZSA 1QQP2 3KL4A 2JIGA 1WMXA 2XL9A 3LDKA 3NNGA 4DS0A 5AC92 5C5TA 3LEMA 4YGBA 5KC5A 2XJVA 4RS5A 3VZKA 5HCAA 1TME1 3F51A 2JXAA 1QY4A 1OD5A 5CFCA 2PHDA 2GMMA 1NLSA 1QXRA 1OC1A 4YRDA 3E5QA 3POGA 4C0HA 1RUH2 1S2EA 2VZRA 4AI8A 1HB3A 1WCDJ 5F32A 2LYSA 3OEBA 4H7LA 5LEJA 2JKBA 2P34A 4XFFA 3GZCA 1LOBA 2J42A 3LD8A 4AQ2A 2E6VA 4Z1VA 5KR7A 2AYHA 2LYQA 4DXRA 3KVBA 3QWGA 1CJGA 4F3JA 1QJU1 3WLUA 3ES1A 2WWUA 1KXGA 1K12A 5F5AA 3ZN5A 1A8DA 3HQUA 4GWJA 2DU1A 3EO6A 2FDKA 2CWSA 1R63A 4ZONA 4RS5B 2G19A 5GZFA 3JXBC 4IE7A 4JGYC 5A7SA 1OUXA 5C8CC 3UETA 2WT1A 5CFCB 1MR5A 1UY1A 1IS4A 5EJ3A 1QJU3 3ZXLA 3QACA 2FCUA 3TN92 3T4VA 1QP7A 1OFNA 2B7YA 3CBNA 2FZ1A 2ET7A 3IPVA 3ZKUA 1XC6A 2WL1A 1U0AA 1DQ4A 1SHWB 2Y8KA 3WQ7A 1QQBA 1DFQA 5EHDA 3BD1A 1JHJA 1XJAA 2HLEA 2W1SA 3QH7A 3R6SA 4EKIA 3LPGA 3PDQA 5EPAA 2WUHA 2XQRA 4QGMA 4IL7A 1WLWA 4LLOA 4YM3A 3FUQA 4YM1A 4JZRA 1UXCA 1NUKA 3KM5A 3MIGA 3SKJE 4I30A 5FRAA 3KQ4B 1P8JA 4B1MA 5HV0A 3U10A 1OA4A 2BWCA 2QFEA 1UZWA 5HBAA 1F2NA 5E88A 1V9U1 2XWBB 2K9ZA 5I0TA 1RUJ2 4XDQA 1ZNPA 2J1EA 3DPRB 5FPAA 5FUNA 2W3JA 4LBQD 4XDOA 4HL0A 1DZTA 4TTGA 4YVWB 1CONA 4HT1T 1UKGA 2WT2A 3M3EA 1XXNA 5IFTA 4N7UA 1POQA 1LHVA 2GP3A 1V9U3 4FPLA 3ZKCA 2J7WA 2YV8A 3A0KA 4FN3A 2E51A 3IPVB 4CXWA 4OBMA 1PVC3 1H8VA 4B29A 1EV13 3NQHA 2GC1A 4JGZB 4QDQA 3UL2A 3ZXDA 2JE9A 4Q4V1 1KGYA 3RMXA 3RS6A 4O8BA 1UU4A 3FHIB 4ER7A 4HBNA 3EB7A 4AEKA 3H8XA 2XXQA 5A3UA 2ICTA 1DLLA 1F5FA 2JDYA 5GZGA 1D4M1 1WD4A 5FUPA 3V65A 1PVXA 1ZREA 1YUDA 3MFCA 3AMHA 1LKNA 4S2DA 1D4M2 2VCCA 3N7LA 1QJX2 3JBG1 1QF3A 3H3LA 3I2GA 1FMD1 5LY2A 1O3QA 1W8ZA 3OEAA 1CWPA 5J3UA 1CQ9A 1T6BX 5A3MA 5C70A 3GCWA 1L7RA 2CAVA 2HWE1 5FZOA 5D1IA 5T54A 1J1TA 1FXZA 3IT8A 4BM8A 2VCBA 5FZ7A 2VZOA 2R072 5CU1A 1CZTA 3WY6A 1VMJA 4AFAA 3KZ4C 4ASLA 3UGFA 4QAWA 1QJY2 3JBG3 3OOXA 1SQ8A 1XNTA 3NJYA 1O5UA 1RINA 2VM9A 3OB8A 3WSOA 4FXGB 5A7QA 2ZGUA 1CGPA 2YPDA 1G9CA 1RPEL 3GZAA 3WDWA 2HWE3 3VBRA 1B35B 1VRH2 5LASA 3SLIA 2LALA 1FYUA 1AL21 4RQPA 2VOVA 2UY8A 3OPZA 1LCDA 4JVAA 4YW4A 5FO8B 2IVQA 3M3QA 4QKBA 5LBCA 3RJ2X 1UIJA 2GALA 2E63A 5HPOA 2ZCWA 5D2AA 1ZA4A 3WNNA 5EQUA 5IJRA 1ND2C 4WVVA 5FPVA 5FZCA 1JOBA 3O1TA 4OUSA 5C8CA 1AL23 2K2SA 3O1UA 2HJIA 5LA9A 4R52A 2AGSA 3TAYA 3N4MA 2VCMA 3IVPA 4NRPA 1LECA 2XJTA 2ET1A 4PBOA 1I6XA 2C6SA 5FZFA 2TUNA 2WZ8A 4ZZ5A 1JBCA 2OZ6A 4BISA 3S8QA 1EUUA 3ZPXA 4OHZA 2Z5WA 1VBE1 4IEVA 4UFJA 3S7EA 4XQ4A 2FDGA 1QNWA 4DRRA 5A3NA 1VBE2 3J7NA 2JCGA 3BOPA 1ZUGA 3NW4A 2NLRA 1D7PM 4OMDA 4AHWA 2LUWA 1MFQC 3TEYA 5DRTA 5J37A 3T2QA 3ZMOA 4CCKA 4W4ZA 3QBQA 5C5UA 1NAEA 4NHXA 1WLTA 2CL2A 1CN1A 2BEOA 3MEPA 3DL3A 1SFNA 1ENXA 3R0RA 5FP7A 3WG3A 3K4DA 1LODA 4Q5OA 3ZR6A 5DTMA 2P3JA 1G8WA 3BIWE 3GALA 3UV9A 5C8CB 4WVZA 3GYDA 3KD4A 3PU8A 1QXJA 2VC9A 2R16A 3CU7A 3QYXA 2NM1A 5KHIA 1GOFA 3TNQA 1XQNA 1XWRA 2VMHA 4TN7A 1YRZA 5FYZA 2HH9A 1R092 2BP6A 2ICPA 1AF9A 1AXYA 1NLQA 3I3DA 5JXHA 2ZACA 1W0PA 2D6LX 5FZEA 1YQ8A 5T5JA 1K3IA 1MZEA 3R4UA 2XI8A 3HBKA 5JIUA 2PXVA 2AEYA 1R082 1CPNA 3PJYA 3BKZA 2WIIB 1GNZA 4RFT0 1AVBA 1W3XA 1LOGA 2WFF2 1ODNA 4LKFA 1XSQA 4P9IA 4ES8A 2XUMA 2ZAHA 3PMEA 4KQ7A 4LHNA 3H9AA 1LENA 3LQXA 1LTEA 1OH3A 3HNBM 5FZIA 1BQPA 2BBVA 1RVF2 4EK9A 2WNOA 3APBA 2XUEA 5I8SA 1ULEA 1DQ6A 4W6XA 1S1AA 1XBFA 1CESA 1H4HA 2ZJCA 1BCXA 3PIJA 4QD2A 4QMAA 1W9YA 4COWA 4LOSA 4NJ4A 3UWPA 1Z7S2 1NZCA 1S0DA 2ATFA 2XL7A 4M0NA 1QOOA 4MADA 2UWCA 2VW1A 5FK8A 2B46X 4AQSA 4DQAA 2XG3A 3TWIA 1KFXL 3B7MA 3MIBA 4N7IA 3OGGA 4XJUA 4OHWA 3TB0A 5GZEA 1JZ7A 4BXSV 2PHWA 1FV2A 2R7EB 2L9LA 1JFTA 2VQTA 3D0JA 3K51A 4GALA 5A6QA 4BH9A 2WZR1 4JCYA 4I8TA 5A1LA 4QX2A 1ZX5A 1DGWA 3NV3A 1IOAA 4J1WA 3I3QA 2PAMA 1DYOA 3PUIA 4DXSA 3PXPA 1AYM3 4Y22A 3D1NI 1ULFA 4XACA 4JRLA 1DCSA 2QQLA 3WT3A 1PO21 3J8F3 4BYYA 3UKNA 2GDFA 4XXAA 2XXAA 5CNAA 3BUCA 2GNBA 1DYPA 3LFMA 4R9BA 1PO22 1D0HA 1MVQA 2WR9A 4GJYA 4WZCA 3PVBB 4MV2A 3X29B 2AZ5A 1QEXA 3VUOA 2JG8C 1VMHA 4NWWA 2JD9A 5TSWA 5JOWA 2GRLA 3VBHC 2PUBA 4MGSA 1OQ1A 3ZSJA 3QOWA 1QB2A 4AOCA 1X82A 3VZNA 3FBMA 4FCAA 1AR62 3ZSKA 4MUVA 3N9LA 1BJQA 3MV01 4HRAA 3GZEA 3N7MA 2O8QA 5FZ8A 1E5IA 4FTSA 1A8MA 1TZOA 2XMLA 2ORZA 3Q8FA 1D2QA 3KCXA 1JN2P 2A7AA 2R6QA 3KT1A 5DQ0A 2CWMA 4CXYA 2PE5A 3ZHMA 1V70A 4Y22B 3ALQA 2E9QA 4CDWC 2YBDA 2N7GA 4D69A 3AZXA 3BPSA 3OGJA 5C9AC 4IGQA 3OUHA 4L99A 3RYPA 1UKRA 3HIFA 1WLDA 3S6PA 4DZGA 5FY1A 3LOBA 3U14A 2D40A 4URAA 4YSFA 2E7AA 1NXD1 2HWF3 3O0VA 1M06G 4L8QA 4ZU4A 3K3NA 1H1AA 4JDNA 5EYXA 4CPBD 4CU6A 2JDHA 2AW6A 2RE9A 5IATA 3VD9A 3T1MA 5A7LA 1GQPA 4Q8LA 1QOSA 2D98A 3KHBA 3PVNA 2IVJA 4AAPA 2QCSB 4RR3A 2XLGA 2XJSA 1CPMA 1YNAA 2LYJA 4FPOB 3J9SA 2XWJB 3CJXA 1AR81 4P9GA 4XHBA 3BPZA 1RITA 2JDKA 3HQXA 3VZLA 1RB8G 1V6JA 2WQ4A 1RUF2 5LA0A 1RUE2 2FCTA 3CEWA 5LK5A 2BW8A 2CDPA 3AP9A 1O4YA 5FP3A 3Q9OA 1ZZBA 1ZZ7A 4ZY9A 1AR83 3HZIB 1Q8OA 5CBLA 4QGNA 2UY9A 5FWEA 1I3HA 2ZZJA 3K4AA 3CL1A 1EPWA 4WV8A 3U4SA 3CNAA 1GUIA 2PUFA 4R4ZA 2YBPA 5AFEA 3U78A 2IXLA 1RMU1 3HD8B 3OQMA 5F5CA 3WVJA 2YGMA 4YM0A 2WC2A 5FOBB 1LCCA 4RR3B 3HPNA 4AK3A 2PXDA 1JZ2A 3UK9A 4K3UA 1QP0A 4MZUA 4NUBA 4IE4A 2VCAA 4OVEA 1YJKA 2WWJA 1AL0G 1UYYA 1UY3A 1YC61 4LBOA 4XVHA 3HT2A 1RMU3 1Y9QA 1PMHX 2YG0A 2EAAA 5M0TA 5IVCA 4LBQA 4LIUA 4RA0A 1NXMA 4AI9A 4I6UA 2WWSA 2XGXA 3VBOA 4AHZA 2Q1ZB 4EZIA 4MXWA 1ZZ8A 3NJXA 1UPIA 4IEOA 2JX9A 3VDCA 5F3CA 3P3NA 3VB9A 1W28A 2FZ2A 4K40A 1RHI2 3OD4A 3DN7A 3LAGA 5FKCA 2B8MA 4X8PA 1E5SA 3ZPOA 3NV4A 4BQ2A 2WS93 4NHMA 2AC1A 3BB6A 2DCZA 3Q8BA 1QJEA 1BLZA 2H8RA 5IK4A 2PXLA 4CDWA 2XKPA 1DDLA 5EWSA 3RSJA 3BCWA 2F4PA 5C9AA 4YG6A 3I54A 4YW3A 2CTVA 3P3PA 4TXWA 3AZWA 1QDCA 1QJFA 2WLQA 4IEPA 2ZAAA 4B7KA 4CCLA 5C3RA 3ACLA 3GN5A 4PF1A 5A6YA 1J83A 4XHXA 3JXCL 4A44A 2EALA 4ER3A 3FYMA 2AXUA 1GWKA 2W1UA 4H55A 5CKQA 3VBOB 2HWD3 4YG0A 4A7ZA 1GBGA 5I8YA 1POV0 2VZPA 5A1FA 3BYWA 4LKSA 4IV3C 2W9XA 4KL1A 5JSOA 3H8RA 2LLWA 1TQ5A 4Q4Y1 4Z2AA 4Y1ZA 4OZXA 4YLZA 5FBZA 3M9LA 3CQOA 4LOTA 5FP9A 2R061 5FYVA 5T5LA 3VKFC 1HQWA 1TE1B 4OQ8A 4ATEA 1GFF2 3KV4A 4A3XA 1LB2A 1X8EA 4J6GA 4KG8A 4MO3M 1JTZX 3EHKA 2VQAA 5DUXA 3J26N 3ZYFA 1JS9A 4CDWB 1UU5A 3BODA 4Q4Y3 5L7OC 5C9AB 3I2JA 4TWTA 4EZHA 3ACHA 2ZEZA 2R063 1Y7YA 3WEZA 4YFZA 1EAH1 4AGGA 4YVSA 1UZYA 4PT6A 2NMNA 3ETPA 4WVWA 3KCCA 5GZCA 1GMMA 1SEFA 3ACGA 2RS53 1VAVA 3FJSA 1AZDA 2AR6A 3IDCB 4UFKA 2IC1A 5JIAA 3ZDSA 2BPA2 3ZFEA 2XB6C 2JVLA 1HRV1 1UZVA 2OA2A 3FUOA 5CYYA 1S0JA 5FUIA 5ACA2 5LY1A 1OF3A 2DUOA 1X57A 4Q4W2 4D6SA 2CSGA 2VH9A 2YROA 2B5HA 5L9VA 2Y6HA 3W59A 1HQ1A 1COV1 1GQHA 1RUI3 3HBZA 3SHRA 4D94A 4ZKTB 4MGTA 3HR9A 3R09A 2CROA 1XNAA 4IEYA 4A4AA 1HRV3 2ZEWA 4KI5M 4GWNA 3VZJA 1WMDA 3VL9A 3WP5A 5JUWA 2AWIA 2CU5A 1VBD1 4NRQA 1X2LA 1AR72 1MQTC 4LHSA 4MXVA 5A7PA 2JDUA 1COV3 4MSVA 2HWC2 3MO4A 2ZX0A 4YVSB 5FY5A 3T30A 2D5VA 2YC2A 3I3EA 5GLVA 3VHNA 3T0DA 4OHYA 5FQ0A 4KNCA 2YB7A 2EICA 4HVRA 2ENRA 3N35A 4IV1C 5LATA 1JU4A 1UWWA 1CX4A 2DVDA 3VBFC 1PO12 1VRBA 5FMDA 1VBD3 2XVGA 1Q8SA 3RJRA 3POJA 5D8AA 2XJRA 4CDUA 2YMZA 3L2HA 5DZFA 3OBZA 4RHV1 1Y43B 2QDNA 5FYSA 4NIAA 2A75A 4P08A 1YIPA 3VKOA 3ZFGC 4C0BA 5KXCA 3H3ZA 4N43A 4LJHA 4NWVA 2WAAA 4GH4C 4I0WB 4BU2A 3FHAA 3TYJA 5KHGA 4R9CA 2W1QA 1DQ0A 2F17A 3EYPA 1PRUA 3DXTA 2D6MA 5FMCA 1IS3A 1N47A 1HRI2 4NMIA 1GYKA 3T0AA 3WNPA 4AR2A 3VDBA 3MI8A 1F4HA 5JR2A 4RHV3 4B3NA 4CEWC 5DXDA 3DUIA 4KWUA 2E7QA 3HAGA 1PZ8A 3L9JT 3ILRA 5HCBA 1J58A 2VUCA 2OQ6A 1IKPA 3N9MA 1SMVA 5FQ0B 3B3QE 2Z4FA 4Q4X2 1DWKA 4K7JA 2GC0A 3FHQA 5IVEA 4IV3A 5FY7A 1VLNA 2BUKA 4L97A 4ONUA 4P9YA 5A1AA 1GNHA 4X4HA 1V0AA 4YZ1A 2VEOA 1SLIA 3ZYBA 1DHKB 1W0OA 2UYAA 3O12A 4QKNA 5FPUA 2DBIA 2W87A 3QFIA 3H1MA 1ASJ2 1GR3A 2XR4A 3OP9A 2Y6JA 1DGLA 2WAOA 4BOWA 2UU8A 4CDUB 3E1F1 3B00A 4QQHA 5IAXA 2H6CA 3WW4A 4JAAA 5L36A 2PLV3 3O1MA 3O1PA 1YQ6A 4PU7A 2I2SA 4QB2A 4XJ8A 5L7OA 2JDMA 1V6IA 1LULA 1UMIA 4YWAA 3W58A 2WINB 4JDMA 3WD5A 2IXKA 1UD1A 4Q0QA 3PLQA 5F39A 4L9BA 4LTAA 4ER6A 5CG8A 1FT9A 4ITCA 1HB1A 4Q2FA 1FPN1 4M4PA 2BBAA 4QM9A 4E8CA 1W9TA 5CFCC 1AR93 1ULPA 1ZBA1 3MIEA 2ZKNA 3JCIA 2Y6GA 4IV3B 2YDEA 4X6RB 2FD8A 3O7OA 3WW1A 5CA6A 4OUEA 5T50A 4A41A 4LA2A 2ARAA 4COYA 1GOHA 3C2UA 5EIYB 1J84A 4DXTA 1CIWA 1ZPQA 2HFZA 2PXEA 1FPN3 1GWMA 1IQAA 1US2A 3SXWA 4P5YA 3VHPA 5A3TA 3LA2A 3ORJA 1ZBA3 4JQRA 4M3CF 3SKVA 4QPWA 2DCKA 3OCPA 4XILA 1XE8A 2VMIA 4UFLA 4FTEA 3OY8A 5L7OB 5JZGA 1UX7A 5FFOC 1H9WA 3OSDA 1BK0A 3HJRA 1CIYA 3ZIWA 1PGW1 2RDQA 4IUGA 5FYMA 4QDSA 2ES3A 1PGW2 3DEMA 4IE6A 4G3YC 4NRMA 3WW3A 1J59A 2IXIA 4JCXA 3P6BA 1NCRC 3THPA 4X4GA 1FNYA 1OA2A 4RYDA 1W8NA 4U2AA 4LR4A 1K5JA 4QKDA 3LA7A 1VE0A 1VPHA 4Z92B 2R0FA 1UXZA 1KS5A 1TMF1 3H5TA 4LPLA 5CB7A 3ZFGA 1RUD2 4BK5A 3KV6A 4FOVA 2WNUA 4GH4A 5L9RA 3VV1A 1MEC2 3JD71 4CPBA 4E2GA 5C6CA 3JQWA 3WR0A 2IZWA 1NQJA 2VVFA 1AU7A 2XHNA 3SISA 1XNBA 4WM8A 5T52A 3JXSA 3OY8B 4I0BA 4LXLA 4NPLA 3TNPB 3DF0A 1BHGA 4QXCA 2PXPA 1TMF3 2EBYA 3IB3A 1VBA1 4UYBA 5SV5A 2KXLA 1W2TA 3JD73 5CKNA 4LKEA 1OLME 5DABA 4Q2JA 4X4EA 4IV1B 3A9ZA 2D3SA 3RGBA 3ZVXA 1E57A 2WNVC 5C8WA 4NHYA 1LAJA 4ZXKA 1RUG1 2ADEA 1X9PA 1VBA3 3C7HA 3CLPA 4XBNA 2BNNA 3OGVA 3A23A 3CJIA 4MGKE 5FYTA 1US3A 1YXWA 3ZFGB 3T3YA 1IKQA 4AFMA 2VXJA 2ZGTA 4A7YA 3V0BA 4GH4B 2WNUB 2VNGA 2E53A 4H3WA 4YW1A 1CJPA 2OXBA 4INDA 3W9AA 4F8DA 5FYIA 3VD4A 4Y5TA 2XDVA 1RUG3 5FDBA 3DYMA 1LQCA 3QQ6A 4Z58A 2CNAA 1CAVA 1W06A 3I97A 4NIDA 4Q1RA 4XTPA 1WH8A 2OR1L 1XOYA 5HV4A 3W5MA 3TRBA 4HANA 5FZHA 1MS8A 2DCYA 4GQ7A 1H2NA 3VD3A 2OS2A 3WDVA 3LSEA 5B4NA 2ZX4A 1FOD3 4MGYE 4NIIA 1UY2A 3ZR5A 1TME2 4FTBA 1X9TA 3A4UA 2MQKA 4XMAA 5CG9A 2E26A 1W2OA 3E5XA 4MVTA 3MF9A 2O14A 4LBKA 1DQ1A 4HOOA 2BERA 2BV4A 1H1MA 3AP6A 2WO2A 4XBLA 1LR5A 1OFSA 2H6BA 2QVSB 2X5IA 5A33B 2VZ1A 2AH2A 4W6WA 3CJIB 3V0AA 1QOTA 1S0GA 3AJZA 4HSLA 4XEZA 4YBAA 2HCSA 2JEMA 4XE9A 5DAVA 3UGGA 3VBRC 2B45X 2I45A 3V0BB 3ZLIA 4RQPC 1SPPA 2LYKA 3GZDA 1JWLA 4QPIA 5FJKA 3ZYGA 4LULA 4QHZA 4AGRA 1QJU2 1CAVB 3IDBB 5A70A 3EUSA 2L1PA 3KGZA 1DQ2A 1OKOA 4OCTA 4UI9L 4LUKA 3ZN4A 5F9TA 3AZZA 3JUUA 5IW0A 1PGSA 1GP5A 3PIGA 3ZSLA 4Z8BA 5JMOA 2HKXA 3T2TA 2PUCA 1NCRA 1QJZA 1UXXX 1JUHA 4E27A 3ZMNA 1HQLA 3AKQA 1MZ5A 4E9KA 1JUIA 5DSXA 3IMMA 3UJOA 1RUH3 4XUPA 2VUAA 3K3OA 4HK9A 5FJHA 5I0RA 4KH9A 4LHLA 2KEIA 2ADDA 4BQ1A 5FPXA 2DU0A 2GAUA 4IEZA 2X5IB 3MLFA 1LCLA 2DV9A 5J09A 1DLCA 5FYYA 2GP5A 4XJAA 3V0AB 2ERFA 5LBBA 4GD4A 3U4XA 4QQOA 3KB5A 4KBBA 4X4DA 1SPPB 4BIOA 4QPIB 2QQJA 4LO5B 4L2NA 1FATA 5GZDA 3O14A 3LKJA 4YGEA 4AHXA 1CAXA 1PVC1 1V9U2 1WBLA 1DF0A 1LMB3 1EV11 2Q5TA 2VMEA 2WDBA 5F6LB 5FZBA 5CISA 1OVPA 1RZSA 1EV12 2WNVA 2EF6A 4XBQA 1CZVA 1NCRB 2P3YA 3FYAA 1STMA 2Q4SA 2QKDA 5DG1A 4DOUA 2YPJA 5LB6A 1HKDA 4RGKA 5CEHA 1AJKA 3E6CC 3ME5A 1WW4A 3CECA 2VZUA 5A3WA 1C57A 5FZLA 4FOQA 1J3RA 4CUCA 4IGOA 4C91A 3UFDA 2LROA 4BMEA 2QTWB 2GU9A 3BTZA 1CX1A 1ZRFA 4EKGA 2HWB3 5JI9A 4Q4V2 5EYYA 2C1FA 4QXBA 4CP0A 2JB8A 1RJ8A 4Q0SA 3AL5A 1F31A 3MGUA 3WXPA 1W6MA 1AX1A 4GWIA 1FAYA 1WD3A 4CDQA 2VOKA 1NKGA 1CAXB 2QQKA 1SLAA 3AMQA 3GBFA 4UFIA 3JBG2 4XF4A 3KMHA 1GNYA 1W90A 2VU9A 3IBMA 3AKSA 1FMD2 5F8PA 3ZXGA 2VY0A 4EQZA 5A32A 2WNVB 1KFUL 2HWE2 1PGL1 4B8EA 4DEVA 2PUGA 1D0GA 3I59A 3RI8A 4CVUA 4PIXA 5JCTA 2DCTA 2ARBA 4M4RA 2A73B 4XYXA 2XJQA 3S5AA 4BMBA 2WRAA 3WHUA 3KS7A 3T2PA 5HXMA 3U11A 2IFWA 3WF0A 1PRAA 4HKOA 3O9XA 3WX5A 3MLKA 5DN2A 1HF0A 1AL22 1V6MA 3L1PA 3BU7A 4XDPA 1ZZCA 4YG7B 4UW6A 4CCMA 4F8AA 2VOXA 1O3SA 3KLSA 4CP1A 4NDWA 4N9IA 1OLMA 4M00A 2J1AA 1BK1A 2EF8A 1QJX3 1N1SA 1CD3G 1W6MB 4CDQB 1JYTA 2OUJA 4K8FA 1NLRA 1NCQA 3FZ3A 4AI1A 3NL1A 1RXFA 3CO2A 4PDWC 5FZOB 1BMV1 1SQ4A 3I59B 1UMHA 4QHBA 1QIQA 3ZPYA 2A71A 3LZZA 4HLTA 4JTNA 1QJY3 2DUQA 4I3PA 5DDJ1 1EPZA 4ZU7A 2PUEA 2DYCA 4H7MA 4AQTA 4FPGA 3H1WA 3VBRB
chains in the Genus database with same CATH topology
1VRH3 4X8NA 5JMCA 3BOWA 4RQPB 1LEDA 1PIV1 4LLFA 1WW5A 3R4DB 2H0BA 5H9PA 1L1MA 2ZMKA 5BYNA 4H14A 4CDXC 5FTTC 1KRIA 4BIFA 2BWAA 5DDJ3 1WUVA 3WHTA 2Y0OA 3AB0A 1JXNA 4RGGA 3VKLA 4LO6B 1NQDA 5I91A 1LGCA 2VXRA 2A5ZA 1PIV3 4PLOA 4X4BA 1AXKA 2LCVA 1NCQB 3SCFA 2D97A 4P9WA 3WQ1A 2Y38A 2PHXA 1OSLA 2MPFA 5HXVA 1W6QA 4IXLA 4QX5A 1E3OC 5IUQA 3SNMA 3GBGA 4FXKB 1EP0A 4WBBA 4BLJA 1N3PA 3SCGA 2GRMA 3UKVA 2BNMA 3A0NA 1PRVA 4CEWC 2GMEA 2JECA 2RR11 3H7JA 2A6YA 2RM21 5FREA 2XJPA 5BNPC 1VJ2A 2ZHLA 1UAIA 3KQRA 4RR3C 5K8SA 1B09A 1G86A 3ENRA 3OF1A 1UMZA 4XF1A 2R041 4FPCA 4FOYA 4Y1YA 1O4ZA 4NVPA 2RR13 1J3PA 1QH7A 1AYN3 2GNMA 2RM23 2EWTA 4IEQA 2GN3A 1IGOA 2ZHMA 5KXBA 4KWLA 2QJVA 2R043 3UJQA 1Y7BA 2PFWA 1OCTC 2ZX1A 3ES4A 2O4AA 1AYM1 1R083 5EZWA 3QLQA 5F1RA 1YFWA 2JICA 3ZO0B 3J8F1 4GXLA 1KDKA 2WFF3 2XIUA 1QGLA 1A6CA 1YHFA 3R1FA 3D8CA 1JW6A 4AVCA 2WZR2 2TNFA 4Q27A 1XNDA 1TNRA 1PZ9A 5H9RA 2XKOA 4PDWA 2Q8OA 4PU3C 3AMPA 4GMP1 3MIDA 1Q8PA 1ENRA 4PU4C 2O8OA 1RZRD 4FPJA 3S7IA 1OQEA 1Z7S3 1U5XA 1S2KA 4I6RA 2A6WA 5DUWA 4YZ3A 3VBOC 2RS31 2BGCA 4GMP3 4A7KA 1S7EA 4PLMA 3FFQA 4R8HA 4U36A 2AUYA 2ZZQA 4HMZA 1NEQA 4CDXA 3AMMA 3AP5A 1ZBE1 4MX3A 5GLWA 4PJYA 1U5IA 1HW5A 2PHRA 2AREA 4V1PA 2LYLA 2RS33 4DFSA 4LT5A 3LOIA 1SACA 4PDWB 2HWF1 3WZ1A 1OI6A 2G4IA 1LHWA 1IHMA 1ZBE3 4LBMA 4GWMA 4COVA 3ROUA 3ZSMA 4CEYA 2CSFA 1MZ6A 4Y4YA 2NP0A 2F6BA 2GNDA 4RD7A 3WG2A 5GLUA 4CEWA 1N1YA 3USUA 2WLPA 1ND3A 4PF5A 3ZN6A 5BV6A 5KC6A 2YXSA 5BNPA 4CDXB 4GHJA 4BE3A 1BBT1 1GANA 1UU6A 4IVZA 4Z5HA 2JDZA 1FV3A 4JCKA 3VBUC 3WOGA 2ZGRA 2MEV1 1AR82 3M70A 1UN1A 5GJ6A 4XFCA 4MLOA 1BBT3 5I8TA 1VALA 5JOXA 4YVSC 3EJKA 4LBJA 4XQDA 2XHKA 3VN4A 2MEV3 2Y0IA 4DINB 1DZRA 4CEWB 3C3VA 3H3UA 1OMIA 3AZVA 5LRRA 3USUB 3ZFEC 5J98B 1ND3B 3ZN6B 1EFAA 3AKPA 4DNYA 2L49A 1W6OA 4LO4B 2QDRA 5BNPB 3OQNA 2CGNA 4OLLA 1AUYA 2GZUA 3GF6A 2IFRA 1H4GA 3FBYA 4FO9A 1RMU2 4F7ZA 3CLCA 4ES9A 2DCJA 2UWBA 3NKTA 4K6BA 4DB5A 3KZ3A 4AEDA 4COZA 4DMIA 1RGSA 2YGLA 4XQWA 4YZ4A 3D5OA 4YZ5A 3VHRA 4QPGC 1EY2A 4QXKA 2QQPA 2NPIA 2DF7A 3QD6A 4UW4A 2WS91 5IK7A 4UBGA 1BEV1 1BKZA 1UZZA 1DGRN 1YYNA 3FLTA 1APNA 3O0WA 4IERA 4WZFA 2WQZC 2DUPA 1S0BA 4NOTA 4N53C 2RJLA 1JFSA 4EJRA 1X8MA 2G9GA 1W6OB 4Q1PA 4B4RA 3HWJA 3ELNA 3V64A 5D8AC 1BEV3 4CDUC 1L3JA 1BVVA 3VDDC 4XF3A 2YHJA 4OI1A 4HN1A 4BLIA 2XBO1 1YWKA 4N43C 1MZFA 1OLRA 2HWD1 1SBDA 4FQZA 4E2SA 5AVAA 3B02A 4LBQB 1VB4A 1I9RA 2XBO3 5FPZA 1G6NA 4MXWB 5H9QA 2QE3A 2D6NA 4GB31 3VZOA 1QHDA 5AFBA 1GKBA 5H9SA 2OVUA 3KXAA 4AF9A 4B4QA 1ZZ6A 1HXS1 1RTVA 1VBC1 4LBLA 2ZMNA 1NG0A 2WNEA 4Q4Y2 2RMU3 1YLLA 3VBUA 2R062 4GB33 4YARA 2RS51 3AP4A 4DY5A 4A2UA 1YFXA 1HXS3 1ZVVA 1U5YA 1VBC3 5E16A 1Q8VA 1UF2C 1YSEA 3SH5A 3MIHA 2ARXA 3HT1A 3BTAA 3ZIXA 4X4CA 3D6EA 4XIOA 3GN5B 3M1HA 5K98B 1EAH2 2Z79A 1RUI1 3ZSEA 3OQOA 2EXHA 2D6KA 2EA7A 5F6KA 4PIYA 2ILMA 3PTYA 5L19A 4XJ9A 3ILFA 2DTYA 3INAA 4EROA 1HRV2 3IN9A 1R1A1 1Y3TA 4AQ6A 3MW4A 5IK5A 1LGBA 1WBFA 3VBUB 1QXPA 1COV2 5EFUA 2X8KA 3AKRA 2A3WA 4L11A 4TYSA 4QPGA 3AYCA 1POUA 3LFPA 2PHLA 2D44A 2XVLA 3ECQA 1R1A3 1YIFA 1EYBA 5JZGC 3KJXA 2EAKA 3MW3A 4NPRA 1VBD2 4NHKA 2ZTNA 1OPMA 2PHTA 4HPKA 1ZS4A 2D6OX 4N53A 3F52A 3ZFEB 1ZVFA 1LHNA 1YI7A 5ACA3 1WIZA 1OQDA 3RG0A 4AXOA 1Q8QA 2R63A 1GZ9A 3E6DA 3VDDA 4Z5CA 2LM3A 3LCPA 4RHV2 4M3CE 2PTMA 2WNUC 1N1VA 2IXCA 1QPZA 4Q26A 2O49A 2OFYA 1YCIA 4QPGB 3ZXAC 4Q8KA 1PERL 4WM8C 2SLIA 2IVBA 3AKTA 2I74A 4HVQA 5GLTA 4E4DX 4XOGA 1W6NA 1LESA 5T55A 4HPKB 2PLV1 2ZPXA 4N53B 4AEMA 2IU7A 4BWOA 1I1EA 3FE5A 3SITA 5D8AB 3OJBA 4I0AA 2W08A 2L8NA 1H1IA 3CJIC 4GA9A 5HCFA 3VDDB 2PA7A 4N43B 1AR91 3JB4C 1REDA 2ZX3A 4FP3A 3G5GA 1HRI3 2VW0A 3B93A 5JSRA 4XJZA 3ME2A 4YG1A 4DPNA 2D7FA 3ZX7A 2VW2A 2BVVA 5DZEA 1W6NB 3U3WA 1G9AA 1RZRA 4Q4X3 1S0CA 2TEPA 2BVBA 1FPN2 3PMSA 4Y24A 1ZBA2 1LHOA 2UURA 4D7YA 3GHMA 2NYYA 4KGQA 2P17A 3B94A 4XZPA 3JXDL 1H8TC 2FJRA 1WA4A 4AI3A 4UXAA 1G9DA 1ASJ3 2X5IC 2HINA 2XLAA 4JV4A 1HV0A 3B01A 2BQPA 1VBB1 2OZJA 4PQ9A 3WDYA 3AXDA 3HMYA 5GLZA 1SBFA 4OI4A 1J1LA 4K9SA 4GULA 4QPIC 3B5LB 1RUC1 5T5PA 2RS11 3M3OA 5BXXA 5KHKA 1XNCA 4W6YA 3WCSA 3AFGA 2GNTA 4Z07A 1VBB3 4AVAA 2JENA 2VQ0A 1C28A 2CYFA 4LBNA 3VL8A 1S0EA 3ZXJA 4I09A 1RUC3 2RS13 4K1YA 3B7HA 2I07B 3VKNA 4HFSA 2EVXA 4LE3A 3BS3A 2D5FA 5EV7A 2XJ3A 3MLLA 1TMF2 3GNEA 4Y26A 4BCUA 2R32A 2DURA 3JD72 4FAGA 1H9PA 2JE7A 1DIWA 4AW7A 2IXHA 4EWAA 5BNNC 5I93A 4Y5Z0 5JZGB 3LISA 2PHFA 2WJSA 2HEYF 1HV1A 3S30A 1VBA2 3B9CA 1UTXA 5JOZA 1HIXA 5SV8A 2ZGKA 2PAEA 1NY71 1ENQA 2A6VA 3K48A 2ZS6B 1WW7A 1HX6A 3NO8A 4IWRA 1S0IA 1GQGA 2WT0A 3H0OA 4X4IA 1IS6A 2C5DA 4QQLA 5E89A 1RUG2 2OW4A 1C5HA 4LEJA 4I2OA 3SH3A 1SLBA 2HEWF 4RL7A 1N3OA 3ZYPA 1FOD1 3R05A 2GH2A 1WGPA 4IETA 3RWNA 1FOD2 1O7FA 4WM8B 1D4VB 1VP6A 4LE4A 3RPQA 3H50A 3ETQA 4COUA 4Z59A 1YI9A 1M4WA 1UIKA 4E2QA 1LOEA 1ALYA 4ASMB 4CDQC 2FQPA 4FOWA 3TRSB 5CAZA 4YGDA 1RIRA 3OTFA 1C8M1 2IVGA 1H8TA 1YJLA 2ZMLA 1OOPC 1QQP1 3I2DA 4M3CA 5AC91 4FPHA 4XIKA 2PIJA 2R1BA 4ISQA 4L92A 4FBFA 4AE2A 3VHOA 4HETA 2HSGA 1C8M3 3AXEA 2B42B 2BFUL 5BUVA 4LNVA 1YFYA 1QQP3 4WVMA 1RUH1 4RGAA 3VK0A 5AC93 3VBSC 4YFWA 4IA8A 2NMOA 2W39A 5J48A 1ENSA 2KA3A 5EXOA 4N9HA 1TME3 3T1LA 2LYPA 1N1TA 1NCQC 3WUCA 2DVBA 3IDEA 1TEIA 1CAUA 3WP3A 1UCXA 4KWJA 4F83A 1H8TB 4JTOA 4AHYA 4XFGA 2MEZA 2DVAA 2IWGB 4M3CB 5J7MA 4MCTA 5CADA 3ZHIA 3ASIA 3DPRA 4EN7B 1TNFA 5BNNA 3GZTB 1CJDA 1R69A 1YFUA 1PNRA 4YVWA 5KHHA 3TN91 5JAXA 4B3NA 1PNFA 4C1WA 4JDOA 5T5OA 3WDXA 1D2SA 1N3QA 2YC0A 4WVMB 1G9FA 1Q3EA 4AYUA 1POV1 1LU2A 5FO7B 1F8VA 4XF9A 1PVC2 3ILNA 2XJUA 1V6LA 4UW3A 2OYZA 3WW2A 4QM8A 1URXA 4JGZA 1AX2A 2WSVA 3IIAA 2HWB1 2VVEA 2LYRA 2A6CA 1H30A 3SMHA 3TN93 1X7NA 3URFA 1CAUB 4HN0A 2V73A 1NERA 2HWB2 3J4UH 1POV3 2A70A 3FWEA 1RUJ1 4MGIE 4URTA 3TOJA 4HVOA 1ZRDA 4I6TA 3KT7A 2DVGA 4QQPA 4EN9B 2A3YA 4YM2A 1AXZA 5BNNB 1UL9A 4AFCA 5C4WC 4OULA 4CZSA 3PHMA 4TZDA 1RUJ3 3WQ0A 2SBAA 4ZU5A 4KU8A 4EN0A 3B9IA 4FAHA 1UW8A 3AX4A 5KXEA 1RUNA 1LJ7A 4YG3A 1B35A 1AJOA 4DY3A 3I4IA 2AUWA 1OOPA 1PGL2 3EBRA 3QCWA 5CIRA 2PUDA 1O4TA 4KGGA 4S2FA 1C4RA 1XYNA 3LSDA 4LHKA 5C33A 1K5MC 4OB4A 1QJX1 1SBEA 5CFDC 1Q5OA 4D7SA 1LLIA 4GIQA 5KHJA 4Q4V3 1AHSA 1W39A 1WLCA 2R071 1VAMA 4HKWA 5ABJC 2GZWA 1GSLA 3NJZA 5I0UA 3VBSA 1D4M3 3ZXEA 2EXJA 3G6JB 1QJY1 2KEKA 3E5UA 4FPKA 4XFAA 3OD0A 3QOPA 5IT6A 4FPYA 1FMD3 3WV6A 1VRH1 1DU3D 1ZAYA 2FMDA 4OHVA 3RRDA 5A32B 2XVKA 4CP2A 3M3CA 2R073 3RYKA 4ATFA 3TBDA 1JH5A 3H1YA 1BMV2 1OOPB 1JH9A 1BDHA 3OBTA 1X36A 4QU2A 2K0GA 1G9BA 4D3WA 2PUAA 5DDJ2 5BY5A