1ZZBA

Crystal structure of coii hppe in complex with substrate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 42
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zzbA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zzbA02
4GULA 1RZRA 1OSLA 4DINB 3E6CC 4PU3C 4HVRA 4J1WA 3CLCA 1OMIA 1I5ZA 3B02A 4ZU5A 4HSLA 2CAVA 4ZU4A 3KXAA 1CGPA 1ZZ9A 1LRHA 4I0AA 3LFPA 4IEZA 3OQMA 3OP9A 2KEIA 1QP0A 1YWKA 1EYBA 1PRVA 1YFWA 4MGIE 2Z69A 3ZHMA 4LLOA 3FYAA 2JVLA 2AW6A 2GC2A 5KBFA 5LRSA 2OFYA 3TRBA 5BV6A 1B0NA 2OZJA 3OGJA 4JTNA 3GN5A 4EWDA 3RZZA 1Y3TA 1QQAA 1VR3A 3UFDA 1LLIA 1UCXA 3CL1A 5JSPA 3FHIB 4MX3A 5BUVA 3HQXA 1GQGA 1HW5A 2IUOA 4Q0SA 1SEFA 2BNMA 2IVQA 1UPIA 1LR5A 2GU9A 4IERA 2Q1ZB 1S7EA 2Z2SB 2XKOA 3LA7A 5FCCA 2XCJA 4E2SA 2QJVA 1UXCA 1CAWB 2H6BA 4FN3A 4F8AA 4L11A 2PYTA 4L2NA 1UIJA 4XF3A 2WFPA 3UKNA 4IEPA 5FLHA 3QWGA 3S8QA 1Q43A 2AUWA 1CAVA 5FDBA 1LCDA 3E6BA 3PLQA 3FZ3A 3OD0A 5D1IA 2B5AA 2IU7A 3TNQA 2BGCA 3KZ3A 5I8SA 1YUDA 2R1JL 3NW4A 3NSTA 3SXWA 1J58A 2FMYA 4N9IA 4GHJA 2EWTA 4O8BA 3IBMA 4HZFA 3ROUA 3N4MA 2OR1L 2FJRA 4HVQA 3H7YA 1CQTA 1O3SA 2D93A 4D7TA 3CJXA 5I8YA 2H0VA 2O8QA 4UBGA 5FQ0A 2ZKLA 1R63A 3MZHA 4X4FA 4X4IA 1J3RA 4IEQA 1ZZCA 2KZ8A 1WH8A 4Z5DA 4AVAA 4E2GA 5C8WA 2QNKA 1QQBA 4X4BA 4JCXA 2R63A 2GZWA 2GRLA 2O49A 1O3RA 4IEWA 1ZZ8A 4BIFA 3DKWA 3FX3A 1QWRA 2VQAA 3IDBB 4XFIA 1NZCA 2BYVE 4PIZA 4KWKA 4N9HA 3LA3A 2PUBA 4FBFA 2B5HA 4Q29A 5C6CA 3F51A 2FQPA 5KHGA 2Y0OA 5FPZA 1O3QA 3WW4A 4AXOA 5K98B 4QGMA 1QP7A 3EHKA 4QGLA 1RPEL 1JWLA 1NERA 1PMIA 3H50A 1NEQA 1O7FA 4META 4MCTA 1ZS4A 1PERL 4HVOA 4YG1A 3H7JA 2PUDA 4XFHA 4FBIA 1RTVA 2BEOA 4QXKA 1QP4A 4JVAA 4YSFA 3LZZA 3MYXA 4HSJA 3GYDA 1LQCA 4GQMA 2PUCA 3ETQA 4PIXA 3WW3A 4XF0A 4HLTA 2O4AA 3FYMA 2WC2A 1YFUA 1OCTC 5JR7B 1Q3EA 5I0TA 2D5VA 2H8RA 4JV4A 4LA2A 1O4TA 1CX4A 2E9QA 2O1QA 1RIOA 3GN5B 1X57A 1QPZA 2C0ZA 2XLFA 4HMZA 4MGKE 5F1RA 5JSRA 1PM7A 2HSGA 2LYSA 2PQQA 3PXPA 1DWKA 3QYXA 1G6NA 4EV0A 1X7NA 2EF8A 4F8DA 3IVPA 1OI6A 1NE4A 5KHKA 3CF6E 3I7DA 1WLTA 4BHPA 2EVXA 4CYDA 1CAUA 4NDWA 1XRUA 3HT2A 1ZRFA 1PRAA 5CVRA 3EO6A 3H5TA 3SCFA 4UXAA 5JSOA 3SCHA 4PIYA 3MPBA 5E16A 1RC6A 1OD5A 5BPXA 5EFUA 1XWRA 3EQEA 4XF4A 1CAXA 2XL7A 4I6TA 1J3PA 2B8MA 2KEKA 3KMHA 1CAVB 3BPZA 4IEOA 4LUKA 2LYKA 1ZNPA 4OLLA 2MPFA 3KJXA 3VK0A 4O9EA 4PJYA 3JXBC 1O3TA 1IPKA 2XLAA 3FWEA 1PNRA 3H3ZA 3B7HA 4ORFA 2WUSR 3NJZA 3QOPA 3KCCA 2PUFA 3NVCA 1WH6A 2ETEA 4MH0E 1X8EA 3CROL 3S7IA 4R52A 4I01A 3KGLA 4XFGA 1O5UA 4Z58A 3E6DA 2CAUA 3H1YA 1Y7YA 3PNAA 4E2QA 3FMYA 4P9GA 1RZSA 1RL3A 1EPZA 5LEJA 1EY2A 1WGPA 2PAMA 3RYRA 3MDPA 4Q0VA 4YNIA 5CADA 4YARA 2JCGA 4YG7B 3OCPA 4IVZA 5FLJA 1DZRA 1RUNA 3D0SA 3H3UA 3BDNA 5A7LA 1L1MA 2V09A 1GT0C 4LUMA 3VHRA 2K9ZA 2LYPA 2CSFA 3I54A 4FAHA 1ZZ7A 4KU8A 4Z07A 2IC1A 3H1MA 2IVGA 4QGNA 4J1XA 3LAGA 4PU8A 1ZRRA 2MQKA 1FT9A 1WA4A 2ET1A 2PUEA 4X6QB 4XEZA 5AVPA 3U10A 1ZAYA 1YFYA 3LOIA 2XHKA 1EFAA 2AXUA 2I45A 1JFTA 3SCGA 3G7DA 4IEYA 3QACA 2P17A 2PE5A 2PA7A 2IV1A 4IETA 2QCSB 3HT1A 2GC1A 4AVCA 1LKNA 4WZCA 4Z5HA 4IA8A 1QXRA 5J7MA 3RNSA 1LB2A 2D5FA 4BYYA 4X6RB 1UD1A 2UYBA 3E5UA 2KPJA 5J3UA 1RUOA 4EWEA 4FAGA 5FLIA 4OB4A 4X4DA 2EBYA 5I0RA 5HI0A 4KL1A 3CEWA 2EA7A 3DV8A 2IVBA 4MGYE 2IXIA 2PAEA 2MEZA 1ZVFA 4Q0PA 4XFBA 2Q4SA 1H1MA 4YYOA 2VECA 3H1WA 2ZCWA 3BU7A 3SHRA 1CAUB 4AVBA 5KHJA 3S7EA 3H9AA 2GRMA 3RDIA 2PTMA 4PU7A 1O4XA 2PIJA 3BS3A 1ZX5A 3RYPA 4AQ6A 3LWCA 1DGWA 3L2HA 2EAAA 4KWJA 2AXZA 3OQNA 1U12A 1ZVVA 4UBHA 2BNNA 3ZKCA 3F52A 1NE6A 1YLLA 3WW2A 2DCTA 1JUHA 3PVBB 1CAXB 1RGSA 2IXLA 4Q0QA 5T3NA 3IIAA 2PUGA 1L3JA 4IEXA 3R6SA 1CJGA 4JCYA 5BXXA 2AXVA 3KGZA 5KHIA 1SFNA 4EWAA 1ZZBA 1J59A 2HKXA 4PU4C 3E5XA 1VPWA 4HN1A 1O5LA 1WETA 4I3PA 4IWRA 1YHFA 3EBRA 2XI8A 4I0BA 4YG4A 5CU1A 3RPQA 4MCXA 4Z82A 3UKVA 2LYJA 1AU7A 4XFAA 4LA3A 1J3QA 1NYWA 1UXDA 4X4CA 3D1NI 3E5QA 5I93A 1H1IA 1IC8A 1QY4A 4HBNA 4I02A 1SQ4A 4Q0UA 2XJ3A 3DNVB 2PAKA 2QVSB 3I59A 4MGZE 2K0GA 3EUSA 2IXHA 3L1PA 2GZUA 5FPXA 3R1FA 4TLFA 2ICPA 2ET7A 3TNPB 1JH9A 2AWIA 4IESA 3ZHIA 4XETA 5FQ0B 3WW1A 1LCCA 1NXMA 1X2LA 2OYZA 2B9UA 5I0SA 4LTAA 2BJCA 1V70A 1POUA 2A6CA 2KXLA 4BH9A 2WIUB 2GC3A 4YRDA 1VJ2A 5I8TA 2XLGA 3MLFA 4Z59A 1ADRA 1BDHA 1Y9QA 1UW8A 1ZZ6A 2UY8A 4X4HA 1GQHA 3CECA 1FXZA 3RYKA 1RZRD 4F7ZA 4X4EA 2O38A 1BDIA 3U0ZA 2F4PA 1JFSA 4XF9A 4Z5CA 3BB6A 3M70A 3FFQA 3NL1A 3FJSA 1ZUGA 2N7GA 3H8UA 4EROA 3BALA 2XKPA 4IEUA 2LYLA 1ZRDA 3KSCA 1XE7A 2XGXA 4WVZA 1XE8A 2GAUA 2MNGA 5I0UA 2L8NA 2MHFA 2OA2A 5J48A 3U3WA 4O9GA 3BD1A 2PHDA 4MZUA 4QX5A 4R8HA 3G5GA 5KHHA 2HJIA 4I2OA 3D82A 2ATFA 3JXCL 3DN7A 5K8SA 2XL9A 1HF0A 1R69A 4LULA 1DGRA 2VPVA 2HINA 2LCVA 3OMTA 4I8TA 1OFNA 2CV6A 1IPJA 3SMHA 3E97A 4ZU7A 4XFCA 3D0JA 1VP6A 2Q30A 4QM9A 1ZRCA 5LEKA 4AQ2A 1LMB3 3F6WA 3QQ6A 1UIKA 4D7SA 4RD7A 1CAWA 4X4GA 3IWZA 1FI2A 4ONUA 3S0MA 3ST7A 3GBFA 1E3OC 2CROA 1J1LA 2GH2A 2H6CA 2L49A 4OFGA 5E1RA 1YFXA 2OPKA 2PPXA 3ES1A 4I6RA 4K8FA 2IXKA 2PHLA 3QF3A 1TQ5A 3JZVA 2PFWA 2IXCA 3CLPA 4KU7A 5EZWA 4A2UA 2BNOA 2KEJA 3LISA 2Q0AA 1X8MA 3IDCB 3DL3A 2UYAA 1PRUA 4I6UA 3C3VA 2CGPA 2D40A 4NVPA 4XFFA 3O14A 3ZDSA 2D5HA 4I09A 3ES4A 1ZPQA 4FT8A 4QM8A 2PUAA 4QMAA 3I59B 2XSDC 1DW9A 3OTFA 3BCWA 3ELNA 2XIUA 3FE5A 1EP0A 5LRRA 3U11A 3ACLA 1Q5OA 4HN0A 3JXDL 2OZ6A 3LA2A 3NKTA 4MUVA 4LEJA 1X82A 1UTXA 3O9XA 2IXJA 4H7LA 3HZIB 4JQDA 4IEVA 4XF1A 5BY5A 4YBAA 1YSEA 1WIZA 3HIFA 1QXJA 4Y42A 2UY9A 5JCTA 1ZREA 3M3IA 3EJKA 3UKTA 1I6XA 4MV2A 3OF1A 2LYQA 2GC0A 4WBBA 2ICTA 5I91A 2QDRA 1DZTA 4JTOA 3OQOA 5JAXA 3USSA 2LYRA 1SQ8A 4KWLA 3CO2A 4B29A
chains in the Genus database with same CATH superfamily
4GULA 4EN7B 1CIYA 3BVCA 4ZONA 4S2HA 1CWPA 4J1WA 3CLCA 4FP3A 1C8M3 2ZGTA 4GKXA 4W6WA 1I5ZA 1A3KA 3USUB 4HSLA 2CAVA 3KXAA 2YBKA 4RS5B 4LO6B 2WT0A 1V6KA 3LFPA 1RUC1 1ZRIA 2P5BA 5GLWA 1YWKA 4UFJA 4LIUA 1F5FA 4A41A 2HWF3 1YFWA 4MGIE 2WYSA 4QB6A 3G0TA 4WVMA 4HONA 2JVLA 2AW6A 2R071 3VKOA 4RR3B 5LRSA 4LBOA 2IFRA 1OT5A 3SKJE 5AFBA 1PK6C 3P3PA 4OMDA 4JZRA 1DQ1A 1UMHA 2AGSA 1QOSA 1PNGA 4CDWC 1Y3TA 3RWNA 2XWBB 1LLIA 2AYHA 4BOWA 1COV3 4BE3A 2YB7A 4CP1A 4YGDA 4UI9L 1HQLA 3RI9A 1NXD1 2R7EB 5IVYA 4D3WA 1HRV2 5FP3A 1FV3A 1UPIA 1RUF2 2IVQA 1HXS3 1MS9A 4IERA 3POSA 4N53B 3T2PA 1VMFA 1N1TA 3O1VA 2HCNA 5FY7A 2AENA 1S7EA 2H0BA 3AMPA 5FIXA 2FMDA 2WNVB 1PVC1 5FK7A 2XKOA 1YIFA 3LA7A 3MW2A 2XCJA 2VXRA 4E2SA 4Q4Y1 1UYXA 2H6BA 5A7WB 4CU6A 2MEV1 3OEBA 4WVLA 2D6OX 1IOAA 1QJZA 2XWJB 3AZZA 1H2KA 1W6OA 3ZFFB 3QWGA 1TME1 3LEKA 2ORZA 4R9AA 3SKVA 1UMZA 3T2TA 1CAVA 1H8TB 1QH7A 2D6LX 3LFMA 4AEDC 5GKAC 3T0DA 5D1IA 2AC1A 2ZMNA 5A7PA 3HVDA 1NCQC 1NCRB 2DYCA 3CJIB 4YW4A 3O1OA 1QJY3 1SZBA 1GOHA 2EIDA 3DYMA 3JBG3 2LRPA 4MHUA 4HZFA 4RHV1 2WKKA 2E7QA 3ABZA 5LY2A 2OR1L 2FJRA 1FATA 4GA9A 4LKFA 4JQRA 4D94A 2D93A 2R043 4D7TA 5C8CC 2VMIA 3PUQA 1H9PA 2Y8KA 4NIIA 3HOBA 3C7OA 1NT0A 1UU6A 3OSDA 4MYEA 4QDQA 1K5MA 5F3CA 2VNRA 4YW1A 2BVBA 1KRIA 5DUWA 1QQBA 4JCXA 1GFF2 1US2A 4V2WA 4Y26A 4CU9A 2OX0A 5K9YA 4Y24A 4GMP1 1WD3A 4IEWA 4BQ4A 1CX1A 1O91A 2XJSA 4XUOA 3VDDA 3IDBB 4RA0A 4HRAA 2XQRA 2LW8A 3IAPA 3NO8A 4QX0A 4XFIA 5HPOA 4QU2A 4JKLA 4HETA 2DCKA 1VBD1 3MUZ1 4QKFA 4PIZA 3M3EA 3ZXJA 1LJ7A 4Y22A 1MS1A 1PGW1 4UT5A 3MV01 4FBFA 1GWLA 2EIEA 4CRQA 1JI6A 5C6CA 4LK6A 1RUC2 4NPRA 1A8DA 2X8KA 4YGBA 2VZQA 1V6IA 1YRZA 1LGNA 2R072 4HKOA 3IKWA 5K98B 3N9LA 4OCTA 4QGLA 4LITA 4ASMB 1RPEL 3VN4A 3HWJA 5IW0A 2IZWA 1NEQA 4META 3R05A 5GLVA 1ZS4A 1XNCA 1PERL 4Q26A 4UAPA 4WM7B 3B9IA 3V0BB 4XFHA 2AR6A 1RTVA 1S0GA 4ES9A 3D5OA 2W46A 3HPNA 4XOGA 3LZZA 3MYXA 5GJ6A 1N1YA 5C4WA 2QTWB 4OHXA 3WNNA 5FY8A 3LSEA 3ETQA 4FXGB 4HOOA 2GDFA 1FOD1 2WC2A 3J7NA 1YFUA 1Q8SA 4WVMB 5FUNA 4CDXB 2FDJA 4GWNA 1PVC2 4OVEA 3TBDA 1JYNA 4YVSA 1O4TA 1GR3A 3VHNA 1HX6A 4M4PA 4Q4Y2 3WP6A 1RIOA 2XJRA 4HMZA 1FX5A 1WZXA 2IVJA 2MEV2 2DCZA 2VVDA 4UFKA 4A6OA 2WR9A 2E6VA 3O7OA 1WLCA 3PXPA 2VW2A 3TB0A 4OUEA 5FWEA 1TME2 4B4PA 4TYSA 2RJKA 2WT2A 3WNXA 1REEA 3I7DA 5K0UA 3ZDVA 1SFYA 4FQ4A 1LOFC 1QEXA 2EVXA 5G04L 4CYDA 3ZXKA 1WCQA 1UX7A 1EAH1 1XRUA 1JOJA 4RHV2 2JE9A 4YG3A 2AZ5A 3S5QA 2XXQA 1JHNA 1PO21 3EO6A 3H5TA 1QNYA 4IV1A 2EALA 3MPBA 5FYCA 5DT2A 1RC6A 3R4SA 5E16A 1UAIA 2W2IA 3EQEA 3R4DB 4OZOA 4XIOA 4ATEA 1W9TA 1OQ1A 1W6OB 2KEKA 3ZFEA 1CAVB 3GCWA 3PTRB 2VD7A 2GMMA 5F5IA 1R083 1POV3 2ARXA 4N43B 5FXVA 4OI1A 1MQTB 2J22A 4O9EA 3VZOA 5DRYA 4CPBD 2JD4A 1O59A 1IPKA 2P3YA 1UX6A 1W04A 1PNRA 1AR83 2XLAA 3FWEA 3W9AA 4YFZA 2ARAA 1VBD2 5EXOA 3AVRA 1JZ4A 1T6GC 1PGW2 1Q8PA 2PUFA 2GMEA 2WFF3 2ETEA 2LLVA 2SBAA 2VULA 5F6LB 1J84A 3MPPG 3POJA 1X8EA 4Y4RA 2BW8A 2F17A 4I01A 2ZGPA 2DWRA 3KGLA 1LHUA 5J96B 1BEV3 2X05A 1RZSA 3QOWA 2E33A 2VZRA 5C9AB 1WCKA 1Y9MA 5JLVA 5IK7A 1PIV1 2ERFA 1FV2A 2PAMA 1LNSA 3I3EA 3VDDB 3W59A 4Q0VA 3AMMA 4XUNA 3ZXAC 5CADA 1ULDA 1F9KA 2LM3A 3OCPA 4GH4A 1UNBA 2X09A 2VC9A 5GAHi 4Q4W3 1VBA3 1RUNA 4Y22B 3H3UA 5HXMA 2NLRA 4FPJA 1FPN3 4RFT0 2EIBA 2TUNA 1NLSA 1FOD2 2UWCA 2E63A 3SEPA 2FCTA 4URTA 1W3VA 1M4WA 3I54A 4IE5A 3H42B 2O14A 4FAHA 3UESA 4KU8A 3HR9A 4O65A 2IC1A 3VUOA 5DDJ1 3I3BA 3POGA 4QQ2A 1K5JA 2MQKA 4X6QB 1SDWA 1WA4A 3U10A 3AKPA 4NHLA 1ZAYA 4NHYA 1EFAA 2I45A 1JFTA 1OD3A 3VBUA 2BVVA 5C3PA 3QACA 1RINA 3M1HA 2IV1A 1DIWA 1W0NA 1CN1A 3PURA 5CB7A 2JDZA 2LROA 1EAH2 4WZCA 5LCWL 4EZ4A 1SLIA 1S2BA 3HMYA 4YVSB 4BYYA 1LB2A 4YVWA 1PO22 1UD1A 3E5UA 4QB2A 3MHZA 3AKTA 3BTAA 4WVVA 4FAGA 5FLIA 1JZ6A 4OB4A 5A3OA 4XJZA 5FP8A 3UL2A 5I0RA 2RG4A 5IVJA 2EA7A 2PMWB 3GNEA 2A3YA 2PAEA 4AQSA 1ONAA 4Q8LA 2WNOA 2Q4SA 4CZSA 1H1MA 4YYOA 2VECA 3H1WA 2ZCWA 4ZY9A 4AFAA 3SHRA 5K0UB 4S2FA 1RJ8A 4NHXA 4NWWA 2J7WA 4WM8A 3S7EA 2A1XA 2ZX1A 1O4XA 3AFGA 1N47A 1R1A3 4CDQC 3WQ7A 3CZUA 3LWCA 1DGWA 1ZA7A 2EAAA 3B9CA 2AXZA 3CDZB 1LHOA 2D44A 4KBZA 4UBHA 5BNNC 4IV1B 5IHRA 2Y64A 3F52A 1YLLA 2X29A 1WMXA 2CWMA 5HCBA 3TWIA 5KC5A 1NAEA 4I3GA 2R6QA 3PVBB 3WR0A 1XOYA 2GNDA 4P5YA 2IXLA 3ZFEB 2JDPA 3IIAA 3UNPA 4FTEA 1K42A 1NUKA 1PIV2 3RQ0A 3SLIA 3RJRA 2Q8OA 4Y4YA 1QNWA 1C57A 3TN91 1RXFA 1WWYA 2VQUA 2QQKA 5BXXA 4CPBA 2AXVA 1URXA 4KBBA 1ODMA 1ENSA 3KGZA 4TSVA 3ZIWA 3C2UA 4A3ZA 4JQTA 1TVGA 4M3CE 3VZMA 1BXHA 1VLNA 4D7YA 1J59A 4OHYA 1PZ9A 4NAOA 1W6QA 4HN1A 4LE3A 2ZMLA 3WF0A 3IAQA 5FMCA 1O5LA 4MGTA 5LATA 1Y9GA 4GB31 4HKWA 4IWRA 4Q8KA 1YHFA 2A6VA 1DQ6A 1DLCA 2XI8A 3OBRA 3MW3A 5DDJ2 5CU1A 4EJRA 3NZLA 4MCXA 2XR4A 4FOVA 3WF2A 4O61A 3ZXGA 4YZ5A 4CEWA 5A6XA 3D1NI 3KCXA 1AYN1 1C8NA 2VXJA 5FPVA 4GH4B 5B2GB 5KWRA 2W08A 5IK8A 1PMJX 3K3NA 3I3QA 3DNVB 4XE9A 2FDKA 2ZOEB 4MGZE 3WQ1A 4QPIA 4FPOB 3EUSA 1FMD1 4P9XA 3WQBA 3HNYM 2W5FA 2CGOA 4AFMA 4TLFA 3VDAA 5FK8A 2RHPA 2VZVA 1ST8A 2G4IA 3VZKA 3ZR5A 4GWIA 1JN2P 1G9FA 5FZ6A 3U07A 4K9SA 4IW3A 4XETA 3BGAA 1W8WA 5FQ0B 1LCCA 1HB4A 1J1TA 4DRVA 3RZHA 2EIGA 2KR2A 3OUIA 4IUGA 1X2LA 4P00B 1HN0A 1QQP3 2B9UA 2OYZA 5I0SA 1OHFA 5A32A 3ZPXA 2ZEWA 3B69A 1IPSA 1V70A 4LTAA 3BI3A 2WIUB 1VJ2A 4AG4A 1ADRA 3VBSC 2FZ2A 1X36A 4G4FA 5FZ3A 5DQ0A 1UYYA 2RMU1 2FCUA 1AUYA 5H9QA 3RYKA 4Z2WA 1H8VA 2VEOA 1RZRD 4JCKA 4L97A 1MS8A 5FAXA 3VBRA 1WBLA 3C8XA 3ETPA 4AFBA 4XDQA 4GWMA 3IMNA 5FYVA 5GZEA 3BB6A 3TRSB 4FPHA 4W65A 2N7GA 5K4LA 4FFIA 3BALA 2XKPA 4IEUA 2PLV3 5ISLA 2ZGMA 5F7UA 3KSCA 1VBE1 2GSYA 1ENRA 1RITA 2EICA 4WVWA 4RS5C 4FO9A 4CVUA 1RVF3 5CKNA 1LODA 3GBGA 1TMF2 5F5AA 3AYEA 4AVVA 5J37A 4O9GA 4NRQA 1IQAA 3ZPYA 4RR3C 3TN92 4YZ1A 3TEYA 1OC1A 2ZHLA 1UN1A 4XIKA 3JXCL 1UOBA 4PLMA 1YCIA 2VW0A 2ZEZA 1DYOA 4XZUG 2WZR3 4D0QA 1JHJA 1R69A 1BKZA 2DF7A 2VPVA 1GV9A 1W8ZA 2OVUA 3AM2A 4LBJA 3OMTA 3THCA 3I49A 2NM1A 1RUJ1 2PXBA 3T0BA 3HNMA 1F15A 2FDFA 1VMJA 2JWPA 3D0JA 2Q30A 4GMP0 4QKDA 5IT6A 4GB32 4YM3A 2ZX4A 1LMB3 3F6WA 4XMAA 3QQ6A 2VUJA 4AHZA 2PHUA 4D7SA 2R0HA 2WNVC 4OQ8A 1S4CA 1DF0A 2PHXA 1AYN2 3ST7A 3S0MA 3GBFA 1LHNA 1NX9A 5GZFA 1F31A 1QIQA 2CROA 2OPWA 1S1AA 5L19A 2HWD3 4ZXKA 3KQ4B 4CDXA 1S2KA 3ZM8A 1FMD2 3M4FA 3ZFFC 3ES1A 1O6UA 1SCSA 2IXKA 4FOWA 3QF3A 3QLQA 2ODRD 3DEMA 1XYOA 1ZM1A 2IXCA 3O1SA 1XNKA 1NCRC 2QQWA 3CJIC 5A7QA 4A2UA 3KHBA 1VRH3 2ZEXA 2Q0AA 2VNVA 3IDCB 4NIGA 1UZVA 2BOJA 3DL3A 1PRUA 5F3GA 3SNMA 4CEWB 3A0KA 2DURA 1XNDA 4CSWA 5F9TA 5LBCA 1Y7BA 4Q1PA 5SV8A 4QM8A 5CFCA 4QPIB 4GJYA 3TYJA 4GD4A 4KG0A 2RMU2 2WAAA 2YPJA 1DW9A 5A6QA 2BJSA 2XMLA 2LS6A 3ELNA 5LRRA 2QQUA 1HB2A 1Q5OA 2XUMA 4QPGA 4HANA 3LA2A 2A75A 3NKTA 4MUVA 4ER0A 2JXAA 4LEJA 3LKJA 1X82A 3O9XA 3HZIB 1OKQA 4IEVA 5FPAA 5FZ8A 3I2KA 4ZS3A 3D4KA 4Y42A 1HJFA 1DU3D 2ZA9A 1V6NA 3FMGA 5KC6A 3VL9A 4LKDA 5A32B 3CIHA 1VBE2 1I6XA 3U4XA 3BTYA 3IDEA 4CTEA 3KM5A 3VHOA 2GC0A 1MZFA 2QDRA 1DZTA 3WP4A 3AX4A 3MEPA 1GWKA 4RL7A 3GUUA 2AREA 4BQXA 2RM21 4KWLA 1MZ5A 2IWGB 3CO2A 5FREA 1RIRA 1RZRA 3VBRB 2HH9A 4DINB 2VNOA 2QZ2A 1NKGA 3B5LB 4BM8A 4IGOA 2E32A 4FFGA 1XQNA 5SV5A 1OUSA 1Z7S3 3EXUA 1UY2A 3O12A 4QX3A 4WM7C 3ZKYA 1LRHA 1POQA 3GJBA 1RUJ2 2XDVA 1WD4A 3DXUA 3OQMA 2KEIA 1SBFA 4FOYA 1H0BA 4BZ4A 1PRVA 4CP0A 1W06A 4AEKA 1PGL1 5E89A 2WS91 3VZLA 3FL7A 1PNFA 1B0NA 3RZMA 3K3OA 3RMYA 4S2DA 4JTNA 5IATA 3GN5A 1W2OA 3THDA 1AR91 3IB3A 1F35A 2JENA 1UY4A 4EWDA 1QQAA 1VR3A 3UFDA 1U5IA 3MLJA 5DPNA 3OWQA 3CL1A 2VNGA 5FYZA 5H9PA 5JSPA 3OY8B 3WOGA 3HNBM 5BUVA 2NPIA 3S30A 4DEQA 2PXJA 3KZ4C 1U5YA 3QCWA 2IUOA 2D3RA 3SEEA 2EAKA 3DXTA 1SEFA 1UZZA 4XC9A 3HN1A 2GU9A 1JOBA 2M4HA 2VZPA 4P9IA 5A3LA 5FZAA 5C5UA 2BPA2 5CBLA 2HFZA 2ZXQA 4CCEA 3P1IA 3N7LA 3PTYA 4CCDA 2VMEA 2ARCA 5GAGi 2FCVA 2PHWA 2C9AA 1REFA 4Q4X3 4BXSV 2NP0A 2XB6C 2FZ1A 2Y38A 5CKQA 1QOTA 3HBKA 3M3OA 4F8AA 4L11A 4OQ9A 1PO11 1SLLA 1UZYA 4L2NA 2VZSA 2Q8DA 4XF3A 5JXGA 3UKNA 2HCSA 5C5TA 4JGZA 1Q43A 1AYM1 1GZWA 4CDQB 5FDBA 1LCDA 1TNRA 4IGQA 1REDA 1QHDA 2ZEYA 3E6BA 1QJEA 3G6JB 4H7MA 3OD0A 4N8MA 4XUTA 3ZVXA 3AXDA 1U2ZA 3ENRA 2BGCA 3TNQA 3KZ3A 3Q8BA 3OD4A 2R1JL 2LLWA 3GZDA 2B42B 4QX7A 1J58A 2ZZJA 4N43C 1KJLA 4N9IA 3IBMA 2EWTA 1MQTC 1K45A 2W9XA 2ILMA 3F2ZA 2WYFA 4HVQA 3V65A 3VD4A 1CQTA 3WF3A 2RDNA 5FZEA 4CUGA 3W5NA 1JODA 1AR61 3CJXA 3OYWA 3U4SA 1JYCA 3VDCA 2ZKLA 1RHI1 1R63A 5CG8A 1AVBA 3OPZA 4X4FA 3CKHA 1BVVA 3D3AA 4X4IA 1J3RA 4IEQA 4KWUA 2KZ8A 2ADDA 4JC1A 2TEPA 4XVHA 5FYSA 4E2GA 5C3SA 5C8WA 4X4BA 3PU8A 2GRLA 2O49A 3IN9A 3JU9A 1K5MC 1ZZ8A 2RM22 1UYZA 2XJUA 3DKWA 2DFCA 4QPGB 1ODNA 2A3XA 3AMQA 1E5RA 2D98A 2Y34A 4IE4A 4MXVA 4AQ6A 1O4YA 3BODA 3VDDC 4Z2AA 3J4UH 4KWKA 4OMCA 4N9HA 2PUBA 3I2FA 3LEGA 4MXWA 2I74A 2DCJA 1AR73 3F51A 1XSRA 2FQPA 1PGL2 2WS92 2XBO1 4QXHA 5FOJB 2PXUA 4I0WB 4QGMA 1QP7A 3EHKA 5A3MA 3IMMA 1JWLA 1HRI3 1NERA 5FR3A 5LZ6A 1AR92 1PMIA 4UW6A 1DGLA 5FYYA 2PHRA 4ER6A 3H50A 1JYTA 4E27A 1H2NA 1R091 2QQVA 5DAWA 3N35A 4GIQA 5FO7B 2PXPA 2PUDA 3ZIXA 2VMHA 3CHXA 4HPKB 4UFMA 3W20A 1H1AA 1D4M3 3AFKA 2BWCA 1LQCA 2C4XA 4P5HA 3N7KA 1IG3A 2SLIA 1ZBA3 5LBBA 4HLTA 2O4AA 2DUOA 3FYMA 2JDMA 2VUCA 4YZ3A 1LOAA 5C4WC 1G9BA 3VBFA 2RS51 4INDA 4OZXA 5I0TA 2BFUS 3PVEA 4NOTA 1QOOA 1BBT1 2RS31 1CX4A 3N36A 1FYUA 3GN5B 1QPZA 1MACA 2C0ZA 4MGKE 4FPFA 1Q56A 5D2AA 3GBWA 3VKMA 5KXDA 3BIEA 1AX0A 4YVSC 2ZS6B 5JSRA 1PO12 1PM7A 2WJSA 1HQ1A 1DWKA 2VVFA 2EF6A 3OEAA 3WX5A 3WXPA 1ZBE3 1AYM2 5HCFA 3WLUA 4TWTA 1X7NA 2PXVA 1OI6A 3GZUC 4K3UA 3WY6A 3SISA 2VTXA 3CF6E 1WLTA 4QAWA 4QHOA 5FZOA 4CU8A 3O1TA 2X5IA 3AB0A 3HT2A 2O8OA 5K0UC 1DG6A 3J8F1 1PRAA 4NIHA 2GN7A 4NRMA 1W8TA 4LE4A 3C7FA 5GZGA 1AR62 1OD5A 1XWRA 1RHI2 1W0OA 2A5ZA 4IV1C 2AH2A 3EB7A 3ILFA 4JGZB 5DUVA 4AI9A 1GZWB 3LOBA 3KMHA 2HYKA 4FVVA 1ZNPA 4K6BA 5L9RA 4AEJA 3C7GA 3SQOA 1QGLA 5GLZA 3ZFEC 1C5HA 2BZDA 2YBSA 5JUWA 2JKXA 3KJXA 4PJYA 4D6RA 4DXSA 3GZCA 2YU1A 3RVHA 3WF1A 1O3TA 3NV2A 2A6WA 3B7HA 1XU2A 5LK7B 1K12A 1P8JA 2DCYA 3OYWB 4WV8A 2JB8A 3CROL 3WDYA 3ZKUA 3N9NA 4LOSA 4XFGA 5DAXA 4Z58A 1G9DA 1VBA2 4UW5A 4QXCA 4E2QA 2XBO2 2E31A 4P9GA 3K51A 3MIHA 4ZZ8A 1RL3A 4XTMA 4SBVA 2VJXA 2PHTA 5CNAA 2ZABA 5FKBA 1EY2A 4JKMA 1SG3A 4Q4V3 3RYRA 4TZDA 3MDPA 4Q2JA 3KHCA 2YU2A 3AP6A 4YARA 1R092 4YG7B 2RR13 2VCCA 3POIA 2I07B 3WP3A 4K40A 5FLJA 4B1LA 3FBMA 3VKFC 1DZRA 1LOGA 4QQHA 5A6ZA 3WNOA 5GZCA 1WLDA 2ES3A 2HWE3 5C71A 4GH4C 2DVBA 4MXWB 3T1MA 1R1ZA 1IKPA 2J1UA 2K9ZA 3LEIA 1V9U1 1Y43B 2B7YA 2RS52 3O1UA 4LBLA 1H4GA 3H8XA 3SH5A 4Z07A 4L0PA 2JDUA 2IVGA 1BBT2 1OURA 2RS32 3H1MA 2MXDA 4RGKA 4YM1A 5FZCA 5IJRA 1RB8G 3OJBA 3CBNA 5AVPA 4PI2A 5A3PA 2XHKA 3M7AA 3AJYA 4EN8B 2D7FA 3O1PA 5LA9A 4XJWA 2ARBA 5DAQA 2Y26A 5A1LA 1ND3A 1SMVA 4IEYA 2PE5A 3GCXA 3VBUC 1GMMA 4LO5B 1O4ZA 3H8RA 3UWPA 2XVLA 3ILNA 2GC1A 1UOFA 3MIBA 1OQDA 4B4QA 1LKNA 1ASJ1 3VBFB 5ACA3 1WMEA 2J1TA 1Z78A 4EE2A 5J7MA 3B3QE 3J8F2 3AJZA 4X6RB 3VZNA 2VOWA 3KT7A 3LGRA 4MGQA 5DZFA 5J3UA 3MFAA 3NXHA 1UYPA 3AL6A 3M8LA 4AAXA 1GNHA 1F4HA 2WSVA 2Y0IA 1A6CA 3AYAA 4P9LA 4PT6A 3J7LA 4YPJA 4K7JA 2VCAA 1N3OA 3CEWA 5FPLA 2GH8A 5H9SA 3T30A 3MFCA 4XFBA 5FP4A 2WWJA 5EJ3A 2HWB1 2W3JA 4XURA 2XPJA 2QQNA 5FZOB 4U2AA 2RV9A 2X5IB 5KHJA 3UGGA 5FO9B 1H9WA 2BOIA 4PU7A 2JG9A 4LLFA 3WCSA 2PIJA 3QH7A 4Q5OA 1TZOA 1DQ2A 5E88A 3SH4A 3OB8A 4WM8C 3OQNA 2PXLA 1ZVVA 1CIWA 1V6LA 2J7MA 1NE6A 2A70A 2ADEA 4NPMA 3SR4A 1XSQA 5FYHA 4M4RA 1AL21 1RGSA 4AYUA 2PXFA 3VBOA 4Q0QA 1VBC1 5LY1A 5T3NA 2YY1A 4JGYA 1RUI3 1RUH3 4OI0A 4F83A 1Q8QA 1UPSA 2YC0A 3J7HA 4W50A 1RUE3 1CJGA 1SDDB 1YNAA 3ZR6A 3N9PA 5LA1A 2R061 4A7ZA 1WUVA 2AEYA 2VAUA 4OI2A 3R09A 1LESA 3NNLA 2YMZA 1W6NA 5CIRA 1X50A 4AFDA 5KHIA 4HK9A 4AW7A 2W95A 4EWAA 1DBNA 1LOEA 5JXIA 1ENXA 1C1FA 4DE8A 2Y60A 2HKXA 4PU4C 2DVGA 2WO7A 2RJLA 3KT4A 4M0NA 4NROA 3ORJA 4AF9A 5EJZB 1IZ3A 1GNYA 1WETA 2B45X 3PJQA 4I3PA 2JDKA 1V9U2 4PLNA 2WDBA 3I3DA 3EBRA 1HQNA 5I0DA 4C91A 1LOCA 3AZWA 3RWKX 2Y6KA 4YG4A 1RUG1 4D6SA 1NA1A 1H2MA 4Z82A 3UKVA 3ZYPA 1AU7A 2BERA 4XFAA 1KGYA 1J3QA 3KV5A 3FHAA 4OYUA 1NYWA 1XE0A 5AC91 1C28A 3GHMA 1JTZX 4S2GA 3U14A 2ZTNA 2WZEA 2WZ8A 2ZGNA 4LO8A 4HBNA 4CEWC 1SQ4A 2XJ3A 3I59A 5C33A 2C9KA 2I2SA 2R0FA 2AUYA 4N7IA 1VAMA 1OA4A 3R1FA 1YI9A 5FYUA 4QPIC 4LMFA 5FZLA 4FOQA 1ASJ2 1MEC1 1RMU3 2V4AA 3K4DA 1S0JA 2W94A 3DECA 3WF4A 2JB4A 1JYXA 1RUD3 3O5SA 3AKRA 3BTXA 1Z0HA 1YYNA 5FZ7A 2YC4A 2ZBJA 4I30A 3LCPA 1SLTA 1K5MB 2HLEA 3ON7A 1YXWA 2KXLA 2Q1FA 2A6CA 3PMEA 3I2OA 3KL4A 1GLHA 1ND3B 1UKRA 4FPEA 5I8TA 2HEWF 3MLFA 3VD3A 4Z59A 5KR7A 2D6NA 1BDHA 1BYHA 1UW8A 1XPWA 2HWB2 3ASIA 3GXUA 2UY8A 3WHTA 4XW3A 1GQHA 3ZN4A 3P3NA 3AZYA 2OUJA 2P37A 2RE9A 4X4EA 1A78A 1LCLA 4FP2A 1HKDA 4HG6B 4IXLA 3TEXA 4CXYA 5GM0A 1BDIA 1V0AA 2RS11 4LJHA 1VMHA 3U0ZA 2TBVA 4Z5CA 3VBRC 2CHHA 2L1PA 2DFBA 2B39A 3FJSA 3H8UA 2PELA 3WINE 4AGVA 4CXXA 3PUSA 2XONA 1ZRDA 1C5IA 1AL22 1XE7A 2XGXA 5EQUA 4EN0A 1XE8A 4B8EA 3E1F1 2FDGA 1GBGA 2GAUA 1VBC2 4AEDA 1HRV3 5I0UA 4UFLA 5EP9A 2L8NA 1RUF3 4NJ4A 4DS0A 3NV4A 5J48A 2ZGKA 3BD1A 2E51A 3VB9A 1PHMA 2KD7A 3GALA 1GU3A 3G5GA 2V4VA 3N3HA 4I2OA 2Q8CA 2P3IA 2JG9B 2R062 2PN5A 3D82A 1W3XA 2WQ4A 3OBTA 5BYNA 1HF0A 4FCAA 4RQPA 5C4WB 5F5QA 5DUUA 2HINA 4JDMA 1GQPA 5EYXA 2LCVA 4LO7A 5FYIA 3OGRA 3ZXEA 5C8CA 1U5XA 1JZ2A 2CV6A 1IPJA 5DAPA 3SMHA 2QZ3A 4XFCA 4CCOA 1T2XA 1VP6A 4XHXA 5HBAA 2W92A 1OSGA 2E26A 4JGYB 1GKBA 4QM9A 4IQPA 4AQ2A 1GZ9A 5LEKA 2WNUA 2HWC1 1RUG2 1D4VB 1SHWB 2UWAA 1CQ9A 4Y1UA 4RD7A 1CAWA 3WDVA 3B94A 2JG8A 5AC92 3I2DA 1W6NB 1E3OC 5FXXA 1KDKA 3EMRA 3FHQA 2YBDA 2GH2A 4XYXA 1YQ6A 5E1RA 4AGGA 1YFXA 4LKSA 2WN2A 3LDRA 3HJRA 3WCRA 4CE8A 5LBFA 5FKCA 4XQWA 4GQ7A 4CDXC 1N3PA 1MEC2 2PFWA 3DPRA 3JD71 5CA6A 3Q9OA 3CLPA 3RJ2X 3ZYJB 2YFZA 2WUHA 3FLRA 4KU7A 3F95A 2BNOA 3MW4A 1X8MA 3GZAA 1UY3A 1V6MA 1JZ5A 4I6UA 1QF3A 2WA3A 2CGPA 2BFUL 1PM4A 5A3NA 1QJU1 5HCHA 1TMF1 1L7LA 3WEZA 1SFPA 2D5HA 5BNPC 4FT8A 2JEMA 1RUC3 2PUAA 4LXLA 3I59B 4AHWA 1MZ6A 2HYXA 2XXPA 3LEMA 4QKNA 4AHYA 5DTMA 4DFSA 2XIUA 2R073 1EP0A 3ME2A 3ACLA 2CWSA 2OQ7A 1VB2A 1ENQA 1VBB1 5DXDA 3ZLIA 1EV11 2DVFA 3GGLA 4K21A 2B4KA 4N7UA 2RS12 5IFTA 4QPGC 5BY5A 1HLCA 4BLJA 1QXJA 5B4XA 2YPDA 2UY9A 2DTYA 4MLOA 4CUCA 4Y3OA 5FO8B 3M3IA 1KXGA 2WT1A 3MLKA 3EJKA 4ER5A 3UKTA 4DZGA 4ES8A 2QQJA 5BNPA 3U78A 2GNTA 3WNMA 2ICTA 2FHRA 3I97A 3OQOA 4PBPA 4W6YA 4AZZA 4QX8A 3RZGA 5FMOS 3IZOA 4B29A 1PVC3 1KS5A 4ZPIA 1QZXA 5GZDA 5B4NA 2OIIA 1OSLA 4Y20A 3JUUA 5FPBA 4Q4Y3 4AI2A 3E6CC 4HVRA 1AHSA 3HQRA 1UQXA 2MEV3 5AVAA 5FMDA 3MV11 1SLAA 1B35A 3LDBA 4ZU5A 5FWJA 1CGPA 1AJOA 1ZZ9A 3NJYA 1SBDA 3RMXA 2VZUA 5A7OA 1LULA 1TME3 4IEZA 3OP9A 4LR4A 1QP0A 2CGNA 4QU1A 4AR2A 5JXJA 5LBEA 4LLOA 3ZHMA 1GP4A 2YGMA 3NNFA 2JX9A 2GC2A 1FNYA 3RRDA 4XZPA 4AGRA 5CAZA 3KV4A 3MIDA 3LFIA 4EYUA 3MLLA 3BPSA 2HWC2 1JH5A 3NV3A 5BV6A 2XXZA 1W39A 5TSWA 3PMSA 3VBUB 4OHVA 4RHV3 1QXPA 1V00A 4BMBA 4LHSA 4DXZA 2JQEA 4E4DX 5JMCA 1UCXA 2DVDA 2ZGRA 3VLBB 1W9YA 4MX3A 1BMV1 4RQPB 3WDTA 4QB1A 1G7YA 1DDLA 3CMGA 4NAMA 4Y1XA 3WG3A 3WG1A 4IV3A 4FPYA 1LGBA 1HV1A 2BNMA 1QJX1 1LR5A 1MZEA 5FXZA 3RZLA 2BGOA 4YVWB 3JD72 1H30A 2K2SA 2V5YA 1YQ8A 1G9CA 5DMYA 4GMP3 1X9TA 4FPCA 3MF6A 2WNUB 3AZVA 5D8AA 3ZSJA 4YM2A 4AOCA 1UY0A 2BBVA 4DIQA 1CAWB 2WSUA 3K2OA 3Q8CA 4FN3A 2JG8B 1C8M1 1KS4A 4DUXA 2PYTA 4C8DA 2DU0A 3ACFA 5L7OC 1VBD3 5F39A 1UIJA 1QJU2 3AYCA 3T1LA 1JYWA 5FLHA 2VBBA 3S8QA 4XMIA 1W0PA 4MVTA 4ER3A 2QQLA 3WDXA 2HWF1 2P2KA 4COZA 4XJ8A 4WM8B 4ISRA 4JGZC 2B5AA 4Z1VA 4JHZA 5FY1A 2W68A 3DPRB 3NSTA 5CG9A 3SXWA 1E5SA 1VBB2 2FMYA 5H9RA 4GHJA 4O8BA 1EV12 2PXQA 2JDYA 3N4MA 3GZDC 4PDWA 4YW7A 1S2EA 3H7YA 1COV1 4IL7A 5E6HA 2W87A 1O3SA 1WKYA 4URAA 1E5HA 1OVPA 4W4ZA 5F2WA 3ATGA 5I8YA 2H0VA 2O8QA 3R0RA 2DTWA 4OI4A 5HV0A 1OH4A 1H4HA 5F5CA 3BIWE 4E4SA 2Y6LA 2W47A 1HXS1 1ZZCA 4XJ9A 1WH8A 4IGPA 5JIUA 1W28A 4LOTA 1WCUA 1D7PM 2R63A 2YFUA 1FOD3 5C3QA 1O3RA 2VCMA 3PVNA 1H6XA 4BIFA 4XBLA 3FX3A 1QWRA 2VQAA 2ZX2A 3BUCA 4K20A 5LA2A 4FSJA 2VZOA 2WRAA 3LPFA 1WCSA 1NZCA 1W6QB 2BYVE 4DRRA 3A9XA 1YC61 3LA3A 5T5LA 1AXYA 4C1WA 4AFCA 2B5HA 4Q29A 3ZYGA 1XYPA 2P6CA 3TEZA 1WCDJ 1PZ8A 2Y0OA 5FPZA 1O3QA 5BNPB 2WNEA 5FYMA 4AXOA 1TNFA 2HBTA 4BISA 2E7TA 1QJY1 1AF9A 2CDPA 5FY9A 5K7PA 5KBFA 5L36A 1DP0A 1EAH3 2YROA 4AE2A 4AVSA 5FZ0A 1O7FA 2D6PA 1PO23 1N1VA 3BKZA 2R041 4W6XA 2A3WA 4YG1A 1HN1A 1BMV2 4P9JA 2WBKA 4RGAA 4CXWA 1B35B 2WAOA 5JVVA 1O8SA 4HSJA 4P02B 3M3QA 4QQPA 3GYDA 3WVJA 4YSFA 1MS5A 4GQMA 1QJX2 2PUCA 3UV9A 3WW3A 4KMQA 5F32A 4QHZA 1OBNA 4BDVB 1OOPA 1W2AX 2D5VA 3LE0A 2H8RA 4JV4A 2V5DA 5LB6A 4EQZA 2E9QA 2FBEA 2O1QA 1W8UA 3VBFC 1X57A 2Y6HA 2Q8EA 4GZ9A 3JB8A 4E8DA 4YZ2A 1C8M2 5IVFA 5F1RA 3WP5A 2PQQA 4J25A 1WW7A 3QYXA 1G6NA 1W9SA 2VL4A 5J1XA 1TG7A 4UYBA 3NDBB 1JMUB 1BLZA 4EV0A 1L7RA 3B00A 2HWF2 5J36A 1APNA 1LU2A 2EF8A 4F8DA 4IV3B 3IVPA 3KVAA 1F5JA 4B1MA 4YM0A 5KHKA 1UXZA 1LGCA 2Z4FA 3DCQA 5L9VA 2ZX3A 4DO0A 2B9VA 3AKQA 4NDWA 2D6MA 1BK0A 3GZTB 2GP5A 1TEIA 4NRPA 1PIV3 3RFRA 4YZ4A 1LHVA 4Q27A 5D8AB 1ZRFA 4NR1A 5FZFA 2X5IC 3RI8A 1C3HA 1COV2 3SCFA 1MFQC 4PF1A 4UXAA 3SCHA 4YG0A 4UF0A 4CUBA 5JSOA 4V2VA 2W0XA 5BPXA 4BQ5A 1PX3A 2A7AA 3CZJA 1CAXA 2XL7A 1J3PA 4XCAA 1HXS2 1LENA 3N7MA 3BPZA 4IEOA 4LUKA 2LYKA 4GAZA 2V73A 4NHMA 4OLLA 5FZMA 4CEYA 2F6BA 2OW4A 3WNKA 2MPFA 3VK0A 1A8MA 2W1WA 4COUA 4Z8BA 3JXBC 1HB3A 2BRTA 1DCSA 3KVBA 3NQHA 5DDJ3 2FD8A 1N3QA 2HEVF 3H3ZA 3LPGA 3NJZA 4YW3A 4A6SA 2EXIA 3QOPA 4OHZA 3AP7A 2X53S 3KCCA 3RZJA 2JKBA 1QB2A 3NVCA 1BK1A 2J42A 5GLUA 2VG9A 3BU0A 4MH0E 3I3MA 3J7MA 3S7IA 1WMDA 3POFA 1XC6A 4HK8A 4R52A 5A6YA 3OG2A 3ZFGA 1O5UA 4Y5SA 2CAUA 4LO4B 3UETA 3H1YA 4K1YA 1Y7YA 2DVAA 3PNAA 2GNMA 5J09A 3FMYA 1QJY2 1Q8OA 4QQOA 3VD9A 1BVP1 3JBG2 4L92A 1NW3A 1WGPA 5HV4A 2JIGA 4YNIA 2GNBA 5IUQA 2GN3A 2HEYF 2R042 4CP9A 3OGGA 4ITCA 3UK9A 1I1EA 5IWFA 4FXKB 4XJUA 4B4RA 2LNMA 3D0SA 1D2QA 3AK0A 1MVQA 2V09A 5A7LA 5C3RA 1GT0C 2Z79A 1GP6A 1NG0A 3ALQA 2VQ0A 4LUMA 5DRTA 4FQZA 1R081 2CY6A 1POV1 2LYPA 2CSFA 1PGSA 1VALA 2CYFA 4BLIA 4ER7A 5FJKA 4G3YC 4QGNA 5FUPA 4J1XA 3RG0A 4PU8A 2ENRA 1AR81 1NLRA 1IKQA 2ET1A 2GP3A 4LIVA 2PUEA 4NHKA 4QDSA 4IE6A 4QD2A 4RR3A 5T5PA 3WUCA 5FOBB 5IYYA 5LWBA 2C24A 3MO4A 2WFF1 5CFCB 3SH3A 2WQZC 1M06G 3G7DA 2WINB 4RSUA 4LHKA 1W2UA 2P17A 2PA7A 1BEV1 3KF3A 4IETA 2QCSB 1ND3C 1QDCA 1IS3A 3R4UA 1OLMA 3ZN5A 3ILRA 1TMF3 5LW9A 3JB4C 1FNZA 1OOPB 1W05A 3A7QA 4ZHNA 4IA8A 1QXRA 3I2IA 5A1FA 4N53A 5F8PA 4P9WA 2D5FA 2VGDA 4DY5A 5ERLA 3TN93 4C90A 1RUOA 2A71A 4LT5A 1CPMA 4R9CA 4DXTA 2E7AA 4EWEA 5A1AA 3UJOA 4Q4W1 4KGQA 1VBA1 2X10A 4X4DA 2YYOA 3T4VA 3DV8A 2IVBA 4NMIA 1FPN1 2YDEA 2WWUA 4Q0PA 5M0TA 5JDBA 3ME5A 5A3TA 3PIGA 4GB33 1H8TA 1MPXA 2YXSA 2VOXA 2XJTA 2GRMA 3H9AA 3PL0A 3A9ZA 1RUH2 3RDIA 3BS3A 1ZX5A 2TNFA 3RYPA 2JIJA 5DTRA 3VBHA 3PIJA 3L2HA 1W6MA 1C1LA 3N9OA 4KWJA 4YW2A 3AP4A 4GXLA 4A7KA 1U12A 2VBPA 3TEPA 2JG9C 2W1QA 2G9FA 4L99A 2JDAA 3ACHA 4UF0B 1KFUL 1AYN3 3AP9A 3B93A 2DCTA 1WW4A 4ARXA 4QPWA 3VKLA 2VH9A 1U5ZA 3O0WA 2RVAA 1CAXB 1FMD3 5FZDA 1W8NA 2PUGA 4NN0A 5FZBA 4IEXA 3R6SA 4CEYB 1CVNA 3IM0A 5JZGA 1W99A 4R9DA 3SC7X 1G9AA 2W1UA 4JGYC 1NOVA 1OKOA 3THTA 5IAXA 4JCYA 2O0OA 2Q5TA 3M9LA 3FLTA 4N90A 3KD4A 1SFNA 4HKLA 5FMOL 2D43A 1ZZBA 5JOXA 1LEDA 1WLWA 4P08A 3WSOA 4MO3M 4C0BA 3E5XA 1X9PA 1PZ7A 1KITA 1UF2C 4R4ZA 1VPWA 4V1PA 1J83A 1ULPA 4DNYA 3QOXA 1R082 3RGBA 3ZFGB 3HD8B 1ACCA 4KH9A 4XCBA 1ZRCA 4PBOA 1GNZA 2RMU3 3Q8AA 4LQRA 2QQIA 5JPNB 4XTPA 5A33A 4KG8A 1R1A1 1JXNA 1AR82 4KQ7A 3RPQA 5C3OA 2VMGA 2RDRA 1QMJA 1UXDA 1AXZA 5DTQA 3E5QA 1NA1C 1YO8A 1H1IA 2WFF2 1D2SA 1QY4A 3Q8FA 4CP9B 1R64A 3OUHA 4ZKTB 4I02A 1DQ4A 4Q0UA 2PAKA 4WM7A 3DKQA 4DUWA 3DM5A 3A0NA 1HB1A 1VBE3 3N9MA 1BEV2 1OF3A 2IXHA 3TAYA 3L1PA 2IUWA 2GZUA 3TOJA 4Y1VA 1W90A 1GUIA 2RJ2A 5IVCA 2ET7A 4DMIA 1JH9A 3HEIA 2CNAA 1OLRA 5CKMA 4BB3A 3ZHIA 4X8PA 3VGIA 4NIAA 3WW1A 2J7UA 3NNGA 2YZ4A 3AL5A 4RN5A 4XHBA 1NXMA 3QBQA 4Q4W2 1CZVA 2XJQA 3LF7A 4YW5A 3WG4A 2BJCA 1POUA 1YQCA 3BOWA 3ZSLA 4BH9A 1FPN2 3D6EA 2C6SA 1UO9A 1L7QA 1RUJ3 1XB9A 2XLGA 4M3CF 1UMIA 2K46A 4C1XA 5JIAA 3KT1A 2XHNA 3AKSA 3FUOA 1ZZ6A 4XILA 4X4HA 3NAPA 2YC2A 3ZYHA 1H6YA 5LA0A 3CECA 3DGTA 1FXZA 3A21A 3WG2A 2WO3A 4F7ZA 5LASA 2VU9A 2WL1A 3S6PA 1LHWA 1KQRA 3VV1A 3AMHA 3ZYBA 4EKGA 4P9YA 4EROA 1ND2A 2ZZQA 1WBFA 3FC0A 5FXWA 2CL2A 5A80A 4ATFA 4AI1A 1KEXA 4XACA 1OPOA 3MGUA 5BNOA 3GDBA 2FDIA 2Z5WA 2BGPA 2MHFA 3T4HB 3U3WA 2JD9A 5JOWA 1LEMA 2PHDA 1NY71 3AP5A 4G9SB 3SX0A 1CZTA 1KFXL 4LHNA 4QX5A 5KHHA 2HJIA 5CEHA 4IDZA 3MIFA 3A22A 2P6HA 4N43A 2ATFA 5K8SA 2J1VA 1MQTA 2XL9A 3VBHB 1W6MB 1YIPA 1QQP1 1ULGA 4LULA 4XUPA 4A44A 1DGRA 3C7HA 3ZYRA 1I9RA 4C0HA 5EYYA 2DV9A 5FJHA 1EPWA 4RQPC 4NO4A 4UW4A 5FZKA 2NMOA 3E97A 3NRUA 3LD8A 1JOPA 1VIWB 4IE0A 1GP5A 3U75A 4ASLA 5FZ4A 5FPUA 3JQWA 1UIKA 1CZSA 5JZGB 4YVWC 1R1A2 4BWOA 5T52A 3ACIA 4X4GA 4XJAA 3IWZA 4FPGA 2EXHA 3MBWA 4NWVA 5C9AA 2WNUC 5AFEA 4BQ3A 1KJRA 2JG8C 2PLV1 4DEVA 5FZ1A 1OQEA 2KM2A 2ZGSA 2H6CA 3APBA 5CFDA 2LTNA 3QH6A 2BDRA 1RVF1 4I6RA 4K8FA 1VB4A 3WT3A 3PUIA 2VTFA 5EWSA 3DUIA 5F37A 1DZQA 1ULCA 2R49A 2XH6A 4ARYA 3FUQA 5JXHA 2P34A 3VL8A 1IS6A 3HN3A 2RM23 5A33B 1VRBA 1UXXX 2G9GA 3DPRC 2R32A 4O7XA 3B7MA 2WZR1 2VTXJ 3BYWA 1AZDA 1OA2A 3C3VA 1D0HA 2D40A 2R1DA 4MG2A 1K3IA 4U36A 3WZ1A 1N1SA 2Q1MA 2PXEA 3O14A 2R16A 2VUDA 4KI5M 3UGHA 4COWA 4QMAA 5ABJA 4HT1T 4JDNA 1IS5A 3OTFA 3PDQA 3BCWA 5EPAA 2WS93 3AC0A 3FE5A 3ZN6A 5KXEA 4DB5A 1JU3A 1JZ8A 3OBZA 4CDUA 1AR93 1UTXA 2IXJA 3NJVA 5FZHA 1W2NA 4JQDA 3DF0A 3AMNA 1YSEA 3HIFA 4GJZA 4E8CA 4M0HA 4YW6A 4COVA 5CISA 2EXKA 2HWD1 5A7SA 5JCTA 1ZREA 2ZHMA 5T5JA 4FFFA 3LIHA 4MV2A 4TN7A 3W5MA 3I2GA 4QT6A 4H3WA 4TLGA 4YFWA 5L7OA 1LU1A 1GYKA 4JTOA 4ET7A 5JAXA 2WWSA 3USSA 2IVIB 3NAPB 1SQ8A 3TELA 1JS9A 1NY72 2A6YA 2G19A 4BK4A 4IE7A 4EQVA 1VRH1 4CU7A 1Y4WA 3UT0A 4PU3C 2ZAHA 4JDOA 4LK7A 1QQP2 1OMIA 4A7YA 2GMPA 3KLSA 4FFHA 1PO13 3B02A 4GWJA 4ZU4A 3W58A 4QHBA 1NQJA 3PE5A 5A7NA 1ND2B 2RDSA 1W2TA 4I0AA 3ZO0B 1AYM3 1B35C 1EYBA 4OBMA 1LECA 1PK6A 2Z69A 5BNOB 3FYAA 2W1SA 2OFYA 5FUIA 4DQAA 3TRBA 1NZIA 4ZXEA 4CDWA 1D0GA 2OZJA 5L9BA 3K46A 3OGJA 4D8MA 2ZGLA 4BQ2A 4CP2A 1UOJA 2VZTA 3RZZA 2HBUA 3MIGA 3I8TA 5HCAA 3K48A 4XBQA 1S0DA 1X33A 3FHIB 3POEA 4GALA 5LK5A 3ZOIA 2PLV2 5DN2A 2QQPA 3HQXA 1AR63 1GQGA 1HW5A 1ULFA 1RHI3 4Q0SA 3PJYA 1RVF2 4AQTA 3P5BA 1CJDA 1AL0G 1QU0A 1S0BA 1JBCA 4B3NA 2VE1A 1CPNA 4IV3C 2Q1ZB 1MS0A 1AX2A 5DSXA 2Z2SB 1JUIA 2DUQA 1E5IA 2ZHNA 3V56A 2VM9A 2PXTA 2Z42A 1IS4A 5FCCA 3I2JA 5DG2A 2QJVA 1UXCA 4M01A 2VY0A 2WZR2 2D3SA 3PU3A 3KB5A 3UJQA 5D8AC 1Z7S1 5F3EA 2GALA 5JPMB 2PXDA 1UL9A 2WFPA 2ZACA 4IEPA 4QQLA 4BQYA 5A70A 2YUEA 2WZPP 3NJXA 2AUWA 3OKZA 1DYPA 1RXGA 1NCQA 1POV0 4K8RB 5GLTA 3U1XA 3U37A 5CFDB 2DBNA 1U0AA 4MGSA 5IK4A 3LQCA 3PLQA 3B01A 3FZ3A 1WW5A 3BTZA 2IU7A 5I8SA 5T55A 1OFSA 1YUDA 4AI3A 2XBO3 3NW4A 4J6GA 5JWPA 1CESA 3LDKA 4FPLA 3S5AA 1CJPA 3K4ZA 3ROUA 5JI7A 2QQOA 4GKYA 4XXAA 2OUHA 1WMFA 1S0EA 2BQPA 2ZPXA 1R093 3KF5A 1JYVA 4Q1RA 4TXWA 3VBOB 2HWD2 4UBGA 1SLBA 1XNAA 4PDWC 5FQ0A 5DZGA 1DYKA 3Q8EA 4Y1ZA 3MZHA 2WQ8A 3HAGA 2ZJCA 4JRAA 5T54A 4AVAA 4DXRA 4Z5DA 1V6JA 2QNKA 4W8JA 2Y6FA 2JJ6A 2BWAA 3ZSEA 5ABJB 2QUOA 2GZWA 2VZ1A 1MS3A 4XUQA 5F6KA 2VOKA 2RS53 4YGEA 3GZEA 4Q4X1 2XG3A 1VRH2 4OUSA 5APAA 2ZGUA 3ZN6B 5GALA 3FLPA 1BBT3 1XNBA 2RS33 2P4EA 2XOMA 4CDUB 2QE3A 3POBA 2VW1A 4BXFA 2R30A 4EZIA 4KGGA 4DUVA 3KV6A 5D21A 2WA4A 3WHUA 1SLCA 4EZHA 2JDHA 3KCYA 3T08A 1QKQA 5KHGA 4OULA 1HJGA 4XDOA 3WW4A 2VOTA 2EXJA 3THPA 4CCKA 1NA1B 5L7OB 2YGLA 2JICA 4JKKA 3MF9A 5JI9A 3KWVA 3V0BA 2BUKA 5HXVA 5A3UA 2QDNA 2VQTA 3J8F3 3JQXA 4A3XA 2J1RA 4MCTA 1TE1B 2VUAA 2C1FA 2JDNA 4LBQD 4R4XA 4RYDA 4K1ZA 5JOZA 4NIDA 4HVOA 3H7JA 1YI7A 4JAAA 4FBIA 4DOUA 2BEOA 4MOAA 4QXKA 1QP4A 4LORA 5FZGA 4JVAA 1GSLA 2VZ3A 3WV6A 5CFCC 5IVVA 4KNCA 4M3CA 2E53A 3TEWA 4LKEA 3T2QA 4PIXA 4SLIA 3I4IA 4XF0A 1PK6B 3QFIA 1OCTC 5JR7B 1Q3EA 4X8NA 1OVSA 3J26N 4BPZA 1W9FA 4LA2A 1XBFA 4LBKA 4CDWB 1OOPC 2WN3A 2XLFA 4YG6A 4JRLA 5FZIA 3UYJA 3V0AA 4OUMA 3I2HA 4XABA 1Z7S2 3RSJA 2HSGA 2LYSA 2BTVC 2VVEA 3O0XA 4AL9A 2P3JA 1VPHA 2CTVA 1AR71 4WZFA 5IFPA 1IGOA 1LOFA 5FBJA 2PQSA 3VD7A 2D3PA 1NE4A 4Y33A 1US3A 5IVEA 2PXKA 1V6OA 1BQPA 5EV7A 4BHPA 1OH3A 1CAUA 2QBXA 1HRI1 2AACA 3SITA 5FRAA 3T2OA 3ZPOA 2NMNA 4UW3A 5CVRA 1OLQA 5KXCA 4B7KA 1JZ7A 1JYIA 5CZKA 1YJKA 4MSVA 4PIYA 4EN9B 1DULA 4AEDB 1PVXA 5EFUA 4XF4A 4ZS2A 1D4M1 4I6TA 2OKXA 2B8MA 3AXEA 1NCQB 1ZBA1 4AEMA 5FY0A 3M2MA 3ZXFA 4BA6A 1F4AA 3KV9A 2LUWA 4PLOA 1V9U3 4OHWA 1KDMA 4Q4X2 1G86A 1PMHX 2XVKA 4AHXA 1OF4A 4CEYC 1T6BX 5C8CB 4ORFA 2WUSR 3OGSA 4P14A 3RS6A 1XJAA 1ZBE1 1WH6A 3MEJA 5A3WA 3M3CA 4EKIA 2VBDA 4YLZA 4E4HA 2WIIB 3VHPA 3E6DA 4D69A 1GOGA 2D97A 2XJVA 4L9BA 4AK3A 4PCRA 3MI8A 3ZFGC 4EN6B 1EPZA 4PHZA 5DZEA 5LEJA 2WO2A 1ASJ3 5JMOA 3VKNA 1GZTA 3C7EA 3PUHA 1QDOA 2JCGA 4UFIA 4IVZA 4XDPA 1W03A 2ZHKA 4XQDA 1W9WA 3H3LA 3LSDA 3J9SA 4MADA 3BDNA 4QKBA 1L1MA 5FTTC 3DYPA 3BN6A 3HQUA 3N9QA 4LPLA 3VHRA 3OBAA 2LALA 2P1BA 4E4ZA 2J1AA 2HWB3 1UY1A 4HFSA 3INAA 5G05L 1ZZ7A 3A4UA 3RZKA 1S0FA 3LAGA 3NNJA 1ZRRA 2YV8A 2VR4A 1FT9A 1EUUA 2YBPA 3NWKA 4XEZA 3ZYFA 2BU9A 3EYPA 5JOYA 1G8WA 1YFYA 3LOIA 2AXUA 1HDKA 1SACA 4LBQA 3ZXDA 2JE8A 3SCGA 1AR72 3URFA 1OXCA 3PVOA 3OY8A 1YQ5A 1AL23 2L9LA 2QQMA 4M3CB 3CQOA 1LAJA 3A9YA 1VBC3 2Y6JA 4H2AA 3HT1A 3ZXLA 4FTBA 4B7EA 2A6XA 4AVCA 1HRI2 4BJ0A 4Q4V1 4Z5HA 3IPVA 1XXNA 1YQ2A 4ZZ5A 3RNSA 2YHJA 4XBNA 2UYBA 1XU1A 2KPJA 2R063 2RR11 2WLQA 1CONA 2F4LA 3ZMNA 1RJ7A 3V0AB 4N53C 4A4AA 4ISQA 1A34A 4CUAA 3LB9A 2HWE1 2BV4A 2NZ9A 3DYOA 2EBYA 4L8QA 5HI0A 1YJLA 1D4M2 4KL1A 1UWWA 1GOFA 3LQXA 4QX1A 3JBG1 1ZBA2 4RFRB 4MGYE 2VOVA 4CA9A 2IXIA 2MEZA 1ZVFA 4DE9A 5FP9A 2V72A 4QDRA 3O1MA 4Y20B 2FFHA 1S0IA 3BU7A 4CDQA 5IK5A 1CAUB 1WW6A 4AVBA 1KD7A 2XXAA 2WABA 2OXBA 2PTMA 3X29B 3ACGA 4BMEA 1QH6A 1RUG3 5BNNA 4JX0A 4CCJA 4DY3A 1XNTA 3CU7A 1H8TC 1FAYA 1DQ0A 1MVEA 2DUPA 1XYNA 2W39A 3O0VA 4FPKA 4E9KA 4D6QA 2BNNA 3ZKCA 1BHGA 4A42A 4AI8A 3WDUA 5AC93 1ZBE2 3VBHC 3WW2A 4Y5Z0 3H0OA 1JUHA 2RDQA 1C4RA 3IIIA 3GHNA 3JXSA 3GM8A 3HBZA 2ZAAA 2G1MA 4BK5A 3N7JA 1ZYBA 1GANA 1HIXA 5JUVA 2CSGA 1L3JA 3POWA 5ACA1 1AJKA 1DHKB 2UU8A 2VMFA 5FMBA 1VAKA 1MEC3 2Y6GA 3ECQA 1UU4A 1H2LA 3IT8A 4XXPA 1LOBA 3VWSA 1AXKA 4PQQA 3NMBA 4QXBA 4COYA 5JZGC 3T09A 2DBIA 2ORXA 3MICA 3OUJA 4AVTA 3IDAA 1OA3A 4ASKA 1HV0A 2IFWA 2ZKNA 2CDOA 4TTGA 5FYTA 1S55A 5L73A 4YGCA 3GF6A 3POYA 2WLPA 4I0BA 1F2NA 3FBYA 5DUXA 3QD6A 4R9BA 3LIGA 4AAPA 2LYJA 3ZSMA 4Y1YA 4LA3A 2UURA 3TFLA 2YG0A 3L9JT 1HQWA 2RS13 4LHLA 1UZ0A 4XAAA 4X4CA 5I93A 1MR5A 2CU5A 1IC8A 1SPPA 1DQ5A 1S0CA 2ID4A 5FV3A 4DPNA 1BZWA 2QVSB 3PUAA 1W6PA 2K0GA 3VD5A 1WA6X 3W21A 1RUH1 1RUI1 1ALYA 5KXBA 3K4AA 2PHFA 4HPKA 5FPXA 1YEWA 4PDWB 2ICPA 1RUE1 2WO1A 1RYYA 4Q4V2 3TNPB 2AWIA 1BJQA 1DGWX 3OGVA 1CD3G 2BBAA 2NN8A 3GJAA 4IESA 4AI0A 4CCMA 2RR12 1IHMA 3K75B 1IG0A 4FI9A 3KS7A 4MHRA 3AZXA 2HWE2 2B46X 3NV1A 2DDUA 4LBQB 3VBSA 1UU5A 4UWDA 2GC3A 4YRDA 2XJPA 2C5DA 5DABA 1BCXA 5E8AA 1Y9QA 1JW6A 4PF5A 4A45A 5T5OA 2J1EA 2OQ6A 3WNLA 3WNPA 4BQ1A 2HWC3 3IPVB 5FYBA 1CR7A 3NAPC 3O1RA 2O38A 2C26A 2F4PA 1JFSA 4XF9A 1IQDC 2G9ZA 3USUA 3M70A 3FFQA 3NL1A 3T0AA 3ZYIB 1ZUGA 4BIOA 4RS5A 5CYYA 4BQWA 2LYLA 4WVZA 5FY4A 2VCBA 3JCIA 4LNVA 2NYYA 2MNGA 3OPTA 5F3IA 5BNQA 1ND2C 5EIYB 4CCCA 1F8VA 1PX4A 2OA2A 2D6KA 3P6BA 5ACA2 1RMU1 2W91A 1AX1A 3KQRA 3WUDA 3JD73 5BNOC 2OS2A 4MZUA 4R8HA 1RUD1 3AYDA 4QX2A 3WDWA 3NROA 4XPVA 5BNNB 1LTEA 1W8OA 2ZMKA 3DN7A 4NUBA 3UGFA 5T50A 2A6ZA 3ZX7A 1OUXA 5FFOC 3L2YA 3MIEA 1E57A 2P3KA 3ZSKA 1I3HA 1QJU3 4BCUA 1DFQA 2FDHA 4I8TA 1DLLA 1UOGA 1OFNA 2QFEA 2ZX0A 4Q2FA 4RGGA 2VMCA 5F2SA 4ZU7A 2JECA 2UWBA 4AWDA 4LBMA 4Y5TA 4H55A 3NKGA 2WNVA 4FTSA 5C70A 3VDBA 3OPWA 3WQ0A 4BU2A 4UFHA 4HL0A 2NQYA 1ULEA 1ULOA 1VBB3 5JR2A 5A7WA 1EV13 5FP7A 1FI2A 2A73B 3MUY1 1GZCA 1NLQA 4ONUA 5ANQA 5EHDA 1J1LA 2DU1A 3A23A 3ZFFA 1ZA4A 5C9AC 3ITQA 1UZWA 3ZMOA 2L49A 3PHMA 4OFGA 5IAVA 3V64A 1HRV1 2PPXA 1OLME 2OPKA 1RUI2 1JU4A 1SBEA 1RUF1 1GICA 2PHLA 2XUEA 4Z92B 1NCRA 1TQ5A 2R1BA 3CJIA 3JZVA 3D8CA 5CFDC 3VZJA 1NQDA 1RUE2 4F3JA 2V3CC 3H8OA 1UKGA 2XQXA 3S57A 4JHTA 1VE0A 1VAVA 5EZWA 4M00A 2KEJA 3LISA 2ZGOA 3WD5A 5ANNA 2BP6A 5J98B 2UYAA 2XVGA 3K77A 5C7GA 3FN9A 1B09A 2KA3A 2W52A 3BOPA 3OOXA 4EK9A 4NVPA 4CCNA 2Y33A 4XFFA 5DG1A 1STMA 1SPPB 3ZDSA 1DGRN 4PI0A 4QPYA 2QKDA 4I09A 5DAVA 3VBOC 3ES4A 1ZPQA 2AEZA 1I5PA 3FFZA 4YWAA 1W6PB 2XSDC 1EUTA 2OT7A 5EJ1B 4CCLA 1JZ3A 4H14A 4HXCA 2JE7A 3T3YA 3U11A 1GWMA 4HN0A 4QWNA 1W8HA 5ABJC 3JXDL 2OZ6A 5IVBA 1MS4A 1SCRA 2VO5A 4H7LA 4XF1A 4XQ4A 4YBAA 1WIZA 1O8PA 2J1SA 4CDUC 1QJFA 4UOJA 3NNMA 3CNAA 5FY5A 4XAEA 3VBSB 1OPMA 4LBNA 3OF1A 2LYQA 1Q8VA 4NE9A 1QJX3 4WBBA 5I91A 5FZ9A 1W8FA 1RMU2 2ZGQA 4PQ9A 5FBZA 2LYRA 2VMDA 4NPLA 1RUD2 3AVSA
chains in the Genus database with same CATH topology
4GULA 4EN7B 4S2HA 4J1WA 3CLCA 4FP3A 1C8M3 2ZGTA 4GKXA 4W6WA 1I5ZA 1A3KA 3USUB 4HSLA 2CAVA 3KXAA 4RS5B 4LO6B 2WT0A 1V6KA 3LFPA 1RUC1 5GLWA 1YWKA 1F5FA 2HWF3 1YFWA 4MGIE 3VHPA 4WVMA 2JVLA 2AW6A 2R071 3VKOA 4RR3B 5LRSA 4LBOA 2IFRA 5AFBA 1PK6C 3P3PA 1DQ1A 2AGSA 1QOSA 1PNGA 4CDWC 1Y3TA 3RWNA 2XWBB 1LLIA 2AYHA 4BOWA 1COV3 4BE3A 4CP1A 4YGDA 1HQLA 3RI9A 1NXD1 4D3WA 1HRV2 1FV3A 1UPIA 2IVQA 1HXS3 1MS9A 1RUF2 4IERA 3POSA 4N53B 1N1TA 2AENA 1S7EA 2H0BA 3AMPA 2FMDA 2WNVB 1PVC1 2XKOA 1YIFA 3LA7A 3MW2A 2XCJA 2VXRA 4E2SA 4Q4Y1 2H6BA 2MEV1 2D6OX 1IOAA 1QJZA 2XWJB 3AZZA 1H2KA 1W6OA 3ZFFB 3QWGA 1TME1 4R9AA 4AEDC 1UMZA 3T2TA 1CAVA 1H8TB 1QH7A 2D6LX 5GKAC 5D1IA 2ZMNA 1NCQC 1NCRB 2DYCA 3CJIB 4YW4A 1QJY3 3JBG3 4HZFA 4RHV1 2WKKA 2E7QA 2OR1L 2FJRA 1FATA 4GA9A 4JQRA 4D94A 2D93A 2R043 4D7TA 5C8CC 2VMIA 1H9PA 1UU6A 4MYEA 1K5MA 2VNRA 4YW1A 2BVBA 1KRIA 5DUWA 1QQBA 4JCXA 1GFF2 4Y26A 4Y24A 4GMP1 1WD3A 4IEWA 1O91A 2XJSA 3VDDA 3IDBB 4RA0A 3NO8A 4XFIA 4QU2A 4HETA 2DCKA 1VBD1 4PIZA 3M3EA 3ZXJA 1LJ7A 4Y22A 1MS1A 1PGW1 4FBFA 4CRQA 5C6CA 1RUC2 4NPRA 1A8DA 2X8KA 4YGBA 1V6IA 1YRZA 1LGNA 2R072 4HKOA 3IKWA 5K98B 4QGLA 4ASMB 1RPEL 3VN4A 3HWJA 2IZWA 1NEQA 4META 3R05A 5GLVA 1ZS4A 1XNCA 1PERL 4Q26A 4WM7B 3B9IA 4XFHA 2AR6A 1RTVA 1S0GA 4ES9A 3D5OA 4XOGA 3LZZA 3MYXA 5GJ6A 1N1YA 5C4WA 4OHXA 3LSEA 3ETQA 4FXGB 2GDFA 1FOD1 2WC2A 1YFUA 1Q8SA 4WVMB 4GWNA 1PVC2 4OVEA 3TBDA 4YVSA 1O4TA 1GR3A 3VHNA 1HX6A 3WP6A 4Q4Y2 1RIOA 2XJRA 4HMZA 1FX5A 2MEV2 2DCZA 2VVDA 3O7OA 2E6VA 1WLCA 3PXPA 2VW2A 3TB0A 1TME2 4B4PA 4TYSA 2RJKA 2WT2A 3WNXA 1REEA 3I7DA 5K0UA 1SFYA 4FQ4A 1LOFC 2EVXA 4CYDA 3ZXKA 1XRUA 1EAH1 1JOJA 4RHV2 2JE9A 4YG3A 2AZ5A 1JHNA 1PO21 3EO6A 3H5TA 1QNYA 4IV1A 2EALA 3MPBA 5E16A 1RC6A 3R4SA 1UAIA 3EQEA 4XIOA 3R4DB 4ATEA 1OQ1A 1W6OB 2KEKA 3ZFEA 1CAVB 2GMMA 1R083 1POV3 2ARXA 4N43B 4OI1A 1MQTB 4O9EA 3VZOA 2JD4A 1IPKA 2XLAA 1UX6A 3FWEA 1PNRA 1AR83 3W9AA 4YFZA 1VBD2 5EXOA 1T6GC 1PGW2 1Q8PA 2PUFA 2GMEA 2WFF3 2ETEA 2SBAA 5F6LB 2VULA 3MPPG 1X8EA 2BW8A 4I01A 2ZGPA 2DWRA 3KGLA 1LHUA 5J96B 1BEV3 1RZSA 5C9AB 5IK7A 5JLVA 1WCKA 1PIV1 2ERFA 1FV2A 2PAMA 3W59A 3VDDB 4Q0VA 3AMMA 3ZXAC 5CADA 1ULDA 1F9KA 2LM3A 3OCPA 4GH4A 4Q4W3 1VBA3 1RUNA 4Y22B 3H3UA 2NLRA 4FPJA 1FPN3 4RFT0 2TUNA 1NLSA 1FOD2 2UWCA 2E63A 4URTA 1M4WA 3I54A 4FAHA 4KU8A 3HR9A 2IC1A 3VUOA 5DDJ1 4QQ2A 2MQKA 4X6QB 1SDWA 1WA4A 3U10A 3AKPA 4NHLA 1ZAYA 1EFAA 2I45A 1JFTA 3VBUA 2BVVA 3QACA 1RINA 3M1HA 2IV1A 1DIWA 1CN1A 5CB7A 2JDZA 1EAH2 4WZCA 1SLIA 1S2BA 3HMYA 4YVSB 4BYYA 1LB2A 4YVWA 1PO22 1UD1A 3E5UA 3AKTA 3BTAA 4WVVA 4FAGA 5FLIA 4OB4A 4XJZA 3UL2A 5I0RA 2EA7A 3GNEA 2A3YA 2PAEA 4AQSA 1ONAA 4Q8LA 2Q4SA 4CZSA 1H1MA 4YYOA 2VECA 3H1WA 2ZCWA 4AFAA 5K0UB 3SHRA 4S2FA 1RJ8A 4NWWA 4WM8A 3S7EA 2ZX1A 1O4XA 3AFGA 1N47A 1R1A3 4CDQC 3WQ7A 3LWCA 1DGWA 3B9CA 2EAAA 2AXZA 1LHOA 2D44A 5BNNC 4UBHA 4IV1B 3F52A 1YLLA 2X29A 2CWMA 3TWIA 5HCBA 5KC5A 4I3GA 2R6QA 3PVBB 3WR0A 2GNDA 2IXLA 3ZFEB 3IIAA 4FTEA 1PIV2 3RQ0A 3SLIA 3RJRA 2Q8OA 4Y4YA 1QNWA 1C57A 3TN91 5BXXA 2AXVA 1URXA 4KBBA 1ENSA 3KGZA 4TSVA 3ZIWA 3C2UA 4M3CE 3VZMA 1BXHA 1VLNA 4D7YA 1J59A 4OHYA 1PZ9A 1W6QA 4HN1A 4LE3A 2ZMLA 1O5LA 4GB31 4HKWA 4IWRA 4Q8KA 1YHFA 2A6VA 1DQ6A 2XI8A 3OBRA 3MW3A 5DDJ2 5CU1A 4EJRA 4MCXA 4FOVA 3ZXGA 4YZ5A 4CEWA 3D1NI 3KCXA 1AYN1 1C8NA 5B2GB 4GH4B 5KWRA 2W08A 5IK8A 3DNVB 4XE9A 2ZOEB 4MGZE 3WQ1A 4QPIA 4FPOB 3EUSA 1FMD1 4P9XA 2CGOA 4AFMA 4TLFA 2RHPA 3VZKA 2G4IA 1JN2P 1G9FA 3U07A 4K9SA 4XETA 5FQ0B 1LCCA 4DRVA 1J1TA 2EIGA 1X2LA 2OYZA 1QQP3 2B9UA 5I0SA 1OHFA 5A32A 3B69A 4LTAA 1V70A 2WIUB 1VJ2A 4AG4A 1ADRA 3VBSC 2FZ2A 1X36A 4G4FA 2RMU1 1AUYA 5H9QA 3RYKA 4Z2WA 1H8VA 1RZRD 4JCKA 4L97A 1MS8A 5FAXA 3VBRA 1WBLA 4AFBA 4XDQA 4GWMA 3IMNA 5GZEA 3BB6A 3TRSB 4FPHA 4W65A 2N7GA 3BALA 2XKPA 4IEUA 2PLV3 2ZGMA 3KSCA 1VBE1 2GSYA 1ENRA 1RITA 4WVWA 4RS5C 4FO9A 1RVF3 1LODA 3GBGA 1TMF2 4AVVA 3AYEA 5J37A 4O9GA 1IQAA 3ZPYA 4RR3C 3TN92 4YZ1A 2ZHLA 4XIKA 1UN1A 3JXCL 4PLMA 1YCIA 2VW0A 2WZR3 1R69A 1BKZA 2DF7A 2VPVA 1GV9A 2OVUA 3AM2A 4LBJA 3OMTA 2NM1A 1RUJ1 3D0JA 2Q30A 4GMP0 5IT6A 4GB32 4YM3A 2ZX4A 1LMB3 3F6WA 4XMAA 3QQ6A 2VUJA 4AHZA 2PHUA 4D7SA 2R0HA 2WNVC 1DF0A 2PHXA 1AYN2 3ST7A 3S0MA 3GBFA 1LHNA 5GZFA 1F31A 2CROA 5L19A 1S1AA 2HWD3 4ZXKA 4CDXA 1S2KA 1FMD2 3M4FA 3ZFFC 3ES1A 2IXKA 1SCSA 4FOWA 3QF3A 3QLQA 1XYOA 1ZM1A 2IXCA 1XNKA 1NCRC 3CJIC 4A2UA 1VRH3 2Q0AA 3IDCB 3DL3A 1PRUA 3SNMA 4CEWB 3A0KA 2DURA 1XNDA 5F9TA 1Y7BA 4Q1PA 5SV8A 4QM8A 5CFCA 4QPIB 3TYJA 4KG0A 2RMU2 2YPJA 1DW9A 5LRRA 3ELNA 2XUMA 1Q5OA 4QPGA 4HANA 3LA2A 2A75A 3NKTA 4MUVA 2JXAA 4LEJA 3LKJA 1X82A 3O9XA 3HZIB 1OKQA 4IEVA 3D4KA 4Y42A 1DU3D 2ZA9A 1V6NA 3FMGA 5KC6A 3VL9A 5A32B 1VBE2 1I6XA 3U4XA 3IDEA 4CTEA 3KM5A 3VHOA 2GC0A 1MZFA 2QDRA 1DZTA 3WP4A 3AX4A 3MEPA 4RL7A 2AREA 2RM21 4KWLA 2IWGB 1MZ5A 3CO2A 5FREA 1RIRA 1RZRA 3VBRB 4DINB 2VNOA 2QZ2A 3B5LB 4BM8A 5SV5A 1XQNA 1Z7S3 3EXUA 3O12A 4WM7C 1LRHA 1RUJ2 1WD4A 3OQMA 2KEIA 1SBFA 4FOYA 1H0BA 4BZ4A 1PRVA 4CP0A 4AEKA 1PGL1 5E89A 2WS91 3VZLA 1PNFA 1B0NA 3RMYA 4S2DA 4JTNA 3GN5A 1AR91 2JENA 4EWDA 1QQAA 1VR3A 3UFDA 1U5IA 3MLJA 3CL1A 2VNGA 5H9PA 5JSPA 3OY8B 3WOGA 5BUVA 2NPIA 3S30A 3KZ4C 1U5YA 3QCWA 2IUOA 2D3RA 2EAKA 1SEFA 1UZZA 3HN1A 2GU9A 5A3LA 4P9IA 2BPA2 5CBLA 3N7LA 3PTYA 2PHWA 2C9AA 1REFA 4Q4X3 2NP0A 2XB6C 2FZ1A 2Y38A 1QOTA 3M3OA 4F8AA 4L11A 1PO11 1SLLA 1UZYA 4L2NA 4XF3A 3UKNA 4JGZA 1Q43A 1AYM1 1GZWA 4CDQB 5FDBA 1LCDA 1TNRA 4CDXB 1REDA 1QHDA 3E6BA 3G6JB 4H7MA 3ZVXA 3OD0A 3AXDA 3TNQA 3ENRA 2BGCA 3KZ3A 3OD4A 2R1JL 2B42B 1J58A 2ZZJA 4N43C 1KJLA 4N9IA 3IBMA 2EWTA 1MQTC 2ILMA 4HVQA 3V65A 1CQTA 3CJXA 1AR61 3OYWA 1JYCA 2ZKLA 1RHI1 1R63A 5CG8A 1AVBA 3OPZA 4X4FA 1BVVA 4X4IA 1J3RA 4IEQA 4E2GA 2KZ8A 4JC1A 2TEPA 5C8WA 4X4BA 2GRLA 2O49A 3IN9A 3JU9A 1K5MC 1ZZ8A 2RM22 2XJUA 3DKWA 2DFCA 4QPGB 2A3XA 3AMQA 2D98A 4MXVA 1O4YA 3BODA 3VDDC 3J4UH 4KWKA 4N9HA 2PUBA 4MXWA 2I74A 2DCJA 1AR73 3F51A 2FQPA 1PGL2 2WS92 2XBO1 5FOJB 4I0WB 5A3MA 4QGMA 1QP7A 3EHKA 1JWLA 1HRI3 1NERA 1AR92 1PMIA 4UW6A 1DGLA 2PHRA 3H50A 4E27A 1H2NA 1R091 3N35A 4GIQA 5FO7B 2PUDA 3ZIXA 2VMHA 4HPKB 1H1AA 1D4M3 3AFKA 2BWCA 1LQCA 4P5HA 3N7KA 2SLIA 1ZBA3 4HLTA 2O4AA 2DUOA 3FYMA 4YZ3A 1LOAA 5C4WC 1G9BA 3VBFA 2RS51 4INDA 4OZXA 5I0TA 2BFUS 3PVEA 4NOTA 1QOOA 1BBT1 2RS31 1CX4A 3N36A 1FYUA 3GN5B 1QPZA 1MACA 2C0ZA 4MGKE 4FPFA 1Q56A 3VKMA 3GBWA 5KXDA 1AX0A 4YVSC 2ZS6B 5JSRA 1PO12 1PM7A 2WJSA 1DWKA 2VVFA 2EF6A 3WX5A 3WXPA 1ZBE3 1AYM2 5HCFA 3WLUA 4TWTA 1X7NA 1OI6A 3GZUC