1ZZBA

Crystal structure of coii hppe in complex with substrate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
total genus 42
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zzbA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zzbA02
3FYMA 2O38A 1SQ4A 3ELNA 2OR1L 3CROL 1NYWA 4XFGA 5BPXA 2BYVE 3BS3A 3CF6E 4HLTA 4IEVA 4AQ6A 5JSPA 2JVLA 2BGCA 4FT8A 4UBHA 5C6CA 2PFWA 2ET1A 4KU7A 1CAWB 2PPXA 4MCTA 4HSJA 2O1QA 3EQEA 4XFFA 1LLIA 1CAWA 1QY4A 1O3RA 5KBFA 2LCVA 3OQOA 4QX5A 4IETA 5I0UA 2Y0OA 1YFXA 1FXZA 5I91A 3KZ3A 3ACLA 4LLOA 1RUOA 2EAAA 1CX4A 3H9AA 4A2UA 2MHFA 4JCYA 1EYBA 3F51A 5F1RA 3DN7A 3FX3A 5KHJA 2XJ3A 1O5LA 3E5XA 2LYSA 1ZVFA 5LEKA 3LFPA 4Q0SA 2LYLA 2FQPA 3OP9A 1OFNA 3KGLA 3D0JA 5C8WA 4QM8A 2O4AA 1DZTA 5LEJA 5E1RA 4LEJA 2HSGA 3FWEA 3LOIA 1XWRA 4O9EA 4IESA 2F4PA 3LA3A 3G5GA 4YBAA 2HJIA 1ZX5A 1ZZ9A 3TNQA 3DV8A 5EFUA 1RC6A 1PRVA 3QYXA 3H1WA 1EFAA 1ZZBA 4FBFA 1J3PA 3SCFA 3ZHMA 1X8MA 4IEOA 4PJYA 2KZ8A 4X4IA 2XLFA 3E6BA 4F8DA 1I5ZA 1J1LA 1CAUB 3OQNA 2CAVA 4L2NA 1WH6A 4YG4A 1CAUA 3I7DA 2A6CA 1NZCA 4IEZA 1JFSA 2PTMA 3G7DA 4X4FA 3IBMA 3H3ZA 3WW2A 2IXKA 1Y9QA 1RGSA 1RL3A 3NVCA 4CYDA 4IWRA 4I6RA 3M3IA 1X57A 2P17A 5CVRA 3TRBA 2H6BA 4PIYA 4KWLA 2EWTA 2IVQA 1YSEA 1ZRRA 4I6UA 2BNOA 2IC1A 2H8RA 2I45A 4R52A 2D40A 3GN5B 1CJGA 4XETA 3GN5A 1CAVB 1DGRA 3ES1A 4MGKE 4ZU4A 4IVZA 4X4HA 2MQKA 3D0SA 5I93A 2IXIA 1CAVA 2VECA 2XLAA 4YG1A 1JFTA 2CSFA 3HIFA 2OZJA 3LZZA 4WVZA 3IVPA 1QQBA 4MCXA 4Z59A 1RPEL 1EPZA 5A7LA 1RZRD 1ZZ7A 1J58A 2OFYA 2UYAA 3KCCA 5KHKA 3U0ZA 2EBYA 2WC2A 3SXWA 2BEOA 1ADRA 2CV6A 2GAUA 2PYTA 2LYKA 3O9XA 4HN0A 3ZHIA 4EWAA 4X4GA 4QXKA 3BD1A 3OCPA 2PHDA 4KU8A 3BCWA 4QM9A 4HVOA 3JXDL 3CO2A 3MYXA 3WW1A 2CGPA 4PIZA 1EP0A 1X7NA 3NSTA 2D93A 4MX3A 4QMAA 5LRRA 2VPVA 1I6XA 3I54A 3RZZA 4LUMA 1POUA 3GYDA 4EWDA 1J3QA 3SCHA 3NKTA 2AW6A 1G6NA 1UD1A 4Z82A 3SMHA 4NDWA 3ES4A 1X8EA 4Q29A 2GC0A 1GQHA 3PXPA 4GQMA 1LCCA 3U3WA 2N7GA 4MGYE 3LISA 1XE8A 1XRUA 3FE5A 1OSLA 4I3PA 3L2HA 2OPKA 1QP4A 4XF1A 4KWKA 4FAGA 2D5FA 2ZKLA 3H1YA 3LAGA 2Z69A 4PU7A 2PUDA 1QXRA 5BY5A 2QVSB 1OCTC 1YLLA 4LTAA 5KHHA 4PU4C 3BB6A 4JCXA 1VPWA 3O14A 4LA3A 3RYKA 3I59B 4FBIA 1O7FA 4JTNA 4JV4A 1JUHA 4N9IA 3S8QA 3QQ6A 3H7JA 4XFIA 1DGWA 4HBNA 4P9GA 3H8UA 5FPZA 1ZRDA 2PUBA 4X6RB 3TNPB 1QWRA 1NE6A 1XE7A 1EY2A 4EV0A 3CL1A 1YUDA 3ZDSA 5FDBA 5HI0A 2B8MA 4XEZA 4UXAA 2AWIA 4IEWA 2BNNA 2XKOA 3QF3A 5I8YA 1NXMA 2UYBA 1V70A 2OYZA 3FHIB 5D1IA 1B0NA 3IDBB 2LYQA 4DINB 1UIJA 2KEIA 1O3QA 3UKVA 2KEKA 3OQMA 4QGNA 4ONUA 2XHKA 4N9HA 3WW3A 2WIUB 3NJZA 3OF1A 4UBGA 1ZZ8A 3BU7A 1L3JA 3QACA 1ZRFA 1ZRCA 2O49A 1VP6A 4X6QB 2ICTA 3BDNA 1QXJA 3B02A 2D5VA 4MGZE 4IERA 2KPJA 3D1NI 3H3UA 4XF3A 1YHFA 2AXVA 3E6DA 1ZPQA 1ZUGA 3UFDA 5JSOA 1R69A 4MGIE 3LA2A 1PRUA 3EO6A 3NW4A 2GZUA 3RYPA 3N4MA 3LA7A 4MZUA 2QCSB 3ST7A 4FN3A 3ROUA 4IEXA 1UCXA 2IXCA 2AXZA 5I8TA 4AVBA 4I6TA 3ZKCA 4HSLA 1IPKA 1UXCA 5JR7B 4YG7B 4NVPA 4HVRA 4QGLA 2H6CA 5I8SA 1E3OC 1OD5A 4I01A 4D7TA 4IEPA 1O3TA 1RIOA 3FZ3A 3E5UA 4AXOA 2PAEA 1U12A 3MDPA 4Z5CA 2KEJA 4ZU5A 1LMB3 4XF9A 4EWEA 1AU7A 1SFNA 3B7HA 1Q5OA 3EBRA 4EROA 3F52A 3KMHA 1RZSA 2AXUA 4Z07A 3HT1A 5BUVA 2LYRA 2DCTA 4X4DA 3GBFA 4B29A 4KWJA 4MUVA 3DL3A 5K8SA 3OTFA 5JCTA 3E6CC 2GC2A 4Z58A 3NL1A 2PAKA 2IV1A 2ATFA 3MZHA 2B5AA 5FQ0B 3E5QA 4Z5HA 2QDRA 3RDIA 1Y3TA 5K98B 4XFHA 1UXDA 2EVXA 4YRDA 4XFAA 4AVAA 5CADA 5FQ0A 5FPXA 4KL1A 5EZWA 4YSFA 4META 2OA2A 4XF4A 3U11A 4OFGA 1RZRA 2MPFA 2PUAA 4Q0VA 1BDHA 1ZREA 5BV6A 5I0SA 1O4TA 2R63A 4BYYA 4PIXA 4E2GA 2GZWA 2GU9A 2UY9A 2L8NA 1PMIA 4H7LA 5FLJA 4BHPA 1DWKA 2K0GA 4TLFA 4OLLA 4Q0UA 2PIJA 1LQCA 1SEFA 4I0BA 3OMTA 3ETQA 4R8HA 3HQXA 2GRMA 4X4EA 2IXJA 1H1MA 1LR5A 3OGJA 1YWKA 3FMYA 3CEWA 2D5HA 4L11A 1H1IA 1YFWA 4LUKA 2L49A 3KSCA 1LCDA 2WFPA 3LWCA 1UW8A 2EA7A 4X4BA 4I8TA 3KJXA 4YNIA 2BNMA 2JCGA 3H1MA 3S7IA 2GC1A 1LB2A 3PLQA 1JWLA 3IDCB 3R6SA 1IPJA 2LYPA 2IVBA 2XIUA 2MEZA 3SHRA 1UPIA 2EF8A 3I59A 4XF0A 1CGPA 1QPZA 1X2LA 3S7EA 1PERL 5AVPA 5E16A 4BIFA 3DNVB 1TQ5A 5J7MA 4QGMA 1O4XA 4YARA 2XLGA 2BJCA 2GRLA 3D82A 4O9GA 2VQAA 3RYRA 3IWZA 5CU1A 2Z2SB 1Q3EA 3F6WA 2CROA 1NEQA 4FAHA 3UKTA 1HW5A 1WLTA 2Q1ZB 5FLIA 5T3NA 1VR3A 4Q0PA 5FCCA 4F7ZA 3H7YA 2ETEA 4XFBA 3FYAA 4WZCA 2WUSR 4Q0QA 1J59A 1ZAYA 4Y42A 1CQTA 4BH9A 2O8QA 5BXXA 3C3VA 4F8AA 1VJ2A 3H50A 2LYJA 3HZIB 1UTXA 1OMIA 2IXLA 2XL9A 4YYOA 2IVGA 1OI6A 4K8FA 1Y7YA 1DW9A 1L1MA 2XKPA 4IA8A 4PU3C 4RD7A 4AQ2A 3VK0A 3MLFA 4J1XA 4AVCA 4MV2A 4HZFA 2XGXA 4XFCA 3RNSA 4JVAA 1YFYA 1PNRA 1NE4A 3H5TA 4LA2A 3CECA 3KGZA 1WETA 2B9UA 2PA7A 3E97A 2PUGA 3EUSA 1SQ8A 3MPBA 1RUNA 3U10A 1QQAA 2MNGA 2Q0AA 2V09A 2XI8A 2UY8A 2GH2A 3M70A 3QOPA 4I09A 3OD0A 1PRAA 2ZCWA 2PQQA 4X4CA 1LRHA 2B5HA 2PHLA 1WIZA 1IC8A 2CAUA 5J48A 4LULA 2PUEA 3CLCA 2E9QA 3VHRA 1O5UA 1BDIA 2ET7A 4HMZA 4IEYA 2IU7A 3RPQA 5J3UA 5JSRA 1GQGA 5I0TA 1ZS4A 1QP0A 1CAXB 2GC3A 1YFUA 5JAXA 1JH9A 4GHJA 2QNKA 3PNAA 1ZZ6A 2C0ZA 2OZ6A 1GT0C 4OB4A 1CAXA 2Q30A 2HINA 3FFQA 1DZRA 1FT9A 3R1FA 3IIAA 5LRSA 1WA4A 2PUCA 1O3SA 3EHKA 1WGPA 4JTOA 4J1WA 3KXAA 4O8BA 1ZNPA 2K9ZA 4E2SA 2R1JL 1RTVA 2XSDC 3UKNA 2PE5A 2XCJA 2IXHA 2XL7A 5I0RA 4HN1A 5KHIA 3SCGA 2FMYA 3S0MA 2QJVA 5KHGA 1R63A 4I2OA 4IEUA 1NERA 1ZZCA 1FI2A 3JXCL 5FLHA 4WBBA 3WW4A 3FJSA 2HKXA 2ICPA 1PM7A 3BALA 2AUWA 2KXLA 3BPZA 2FJRA 3QWGA 1HF0A 3JXBC 2PUFA 1J3RA 2PAMA 4JQDA 4GULA 4ORFA 1ZVVA 4IEQA 2Q4SA 3DKWA 4Z5DA 4D7SA 3HT2A 4MH0E 2IUOA 1X82A 3CLPA 4I02A 4HVQA 4ZU7A 4I0AA 1QP7A 3L1PA 1WH8A 3EJKA 3CJXA 1S7EA 1UIKA 1LKNA 3USSA 4E2QA 4PU8A 2H0VA 3JZVA 3PVBB 1Q43A
chains in the Genus database with same CATH superfamily
1S0GA 1YQ6A 1OFSA 2ARAA 1SQ4A 1VBD2 5T55A 4C0HA 1LHUA 4IEVA 1PX4A 3QFIA 4FT8A 4O65A 5T54A 5BNOA 2PFWA 1ZBA1 1ZBE3 2ET1A 2JDPA 1MFQC 3ITQA 2PPXA 3QH6A 4MCTA 3A7QA 4WM8A 5JUWA 1LOAA 1WLDA 2ZHLA 3WCSA 1KXGA 2RDQA 4ASMB 5LK7B 3CDZB 4N43C 2HWF3 4W8JA 1F15A 2VAUA 3U37A 4WVWA 1VBE2 4TTGA 2Y0IA 5SV5A 2R0HA 3J26N 2A70A 5K7PA 4FVVA 4IETA 3OPWA 5JOYA 3V0AA 1FPN2 4QKNA 3M4FA 5I91A 4M0HA 3VBOB 2A71A 5GM0A 5F7UA 5FWJA 1XOYA 1RUOA 4RR3C 2EAAA 4FTBA 3VBUA 2ZAAA 4I0WB 2BOIA 4XMAA 1QOSA 2VCAA 3WCRA 2WO7A 4YVSC 1ZYBA 5FZOB 1RJ7A 4JCYA 1OSGA 4L99A 1V6MA 5HCHA 4OBMA 5LA9A 4M3CA 2WLQA 3ZYPA 3WHUA 2XJ3A 1JYCA 4NRMA 3QOWA 2SLIA 4LBLA 3LFPA 2VU9A 2ZA9A 1W9TA 3JD71 4QM8A 2O4AA 4XTPA 4BQYA 1GKBA 2VBBA 5E1RA 4LEJA 2VQUA 5FYUA 3U75A 4YBAA 2CGOA 3UWPA 4OQ9A 4HXCA 4XDOA 4IV3C 4YGBA 3THCA 3WINE 1RC6A 4JGZC 4Y22B 3QYXA 1K5MA 1WD4A 5LY1A 1FMD2 3BKZA 4JHTA 1QJZA 2YPDA 4MADA 2WNVA 2OXBA 4CEYA 1UZWA 1G8WA 2C4XA 4E4HA 4N90A 3UGGA 3CIHA 2XLFA 1JZ8A 3RJRA 1PIV1 1ND3C 2X5IA 5FYMA 4PBOA 3TEWA 3BTAA 4LHLA 3AVSA 3QD6A 3POJA 1CAUA 1TNFA 2RMU1 3CJIB 4XVHA 1NXD1 1NT0A 2A6CA 2FD8A 3RSJA 1KRIA 2PTMA 2QQKA 2VVEA 3WW2A 5A1LA 2D97A 2IUWA 3U14A 4COVA 1Y9QA 4QPGC 3OSDA 2ZPXA 2W94A 4S2HA 4Y1ZA 3B9CA 5G05L 4IWRA 1UYXA 3TRBA 2A6WA 3WP4A 4Y20B 2EWTA 1ZRRA 1YSEA 2W87A 4I6UA 1HXS3 2AEZA 3A9XA 4LJHA 4LORA 4R52A 3T0AA 2ORXA 1HRV1 3S57A 1COV3 3NWKA 4E8DA 3QCWA 4YM3A 2WSVA 5AC92 1JN2P 1W3VA 2XUMA 3ABZA 2WFF1 4EKGA 2ES3A 1GUIA 3U4SA 3WZ1A 4MGKE 4RYDA 4IE0A 1PVC1 2G19A 3PUAA 4X4HA 2ZAHA 2MQKA 3D0SA 3ILRA 2IXIA 2VECA 5FMOS 5L9BA 5EV7A 5I93A 3ZKYA 4LBNA 3AMNA 5FZEA 2HLEA 4C1WA 4F83A 3NROA 4YFZA 2DV9A 3HIFA 4HKWA 4EYUA 5CFCC 3LZZA 4WVZA 3IVPA 5FZHA 1S4CA 3GZDC 2F4LA 2GNDA 3NQHA 4MCXA 1RUD2 5JXGA 5JXHA 4M4RA 1EPZA 4NHYA 3WR0A 3RZMA 5FZ7A 2W39A 1J58A 2QKDA 2OFYA 2UYAA 4BISA 2XONA 2BFUS 3RZKA 4QHOA 2AACA 1RUJ1 1TME2 1XE0A 1H8TA 3SC7X 2MEV3 5ABJA 1ADRA 1I1EA 1VMJA 1C3HA 3ZHIA 4B8EA 4QAWA 2EIGA 3C7HA 4KMQA 4CCDA 2Y38A 1IOAA 2W2IA 3CO2A 3MYXA 3TRSB 2ZGOA 4PIZA 3T2PA 2P3KA 3MW4A 5LRRA 5K0UB 4JX0A 1VBA2 1QJY1 1GZ9A 2G9GA 2P34A 2PLV1 3Q9OA 4LXLA 5IK4A 1M4WA 3NKTA 3R4DB 2IVJA 2J42A 4Z82A 2R063 3SMHA 4NDWA 1UMHA 3ES4A 5FREA 1DULA 1X8EA 4PBPA 3AP7A 4TWTA 5T52A 2YG0A 2X05A 3RFRA 1DLLA 3SH3A 4EN7B 1IZ3A 3JBG1 5FXWA 5IYYA 1OUSA 1V6OA 1H2NA 3LISA 5CKMA 1XE8A 1O3QA 1OSLA 3SEPA 1Z0HA 4XF1A 4OI0A 3I8TA 1AR81 1EUTA 1SLCA 2JE7A 4BJ0A 2DF7A 4ES8A 2Z69A 5A1AA 1QXRA 3DPRB 5BY5A 3CNAA 3KHCA 3BOWA 3OEAA 4CU9A 3ZYRA 2Z79A 2DBIA 2DCZA 2UWAA 5FZ9A 1ODNA 4LA3A 4O61A 4TYSA 3I59B 1F8VA 1Y43B 2HH9A 2VUJA 3P5BA 5FYIA 1JUHA 2VJXA 2WS91 3VLBB 3S8QA 2JKBA 1SACA 3KZ4C 3MHZA 1S2KA 1DGWA 1I9RA 3KLSA 4HBNA 3CQOA 3HR9A 3AP9A 5JWPA 1VRH1 4UFKA 3KQRA 2MXDA 4MGQA 4X6RB 2RS31 1UXZA 1A8MA 1OA4A 1RUC1 3S5AA 1EY2A 5APAA 3A9ZA 1BKZA 1YUDA 4AI8A 1GZWB 1JZ2A 1RMU2 5C7GA 1EAH1 3POYA 5F37A 2AWIA 2YYOA 4NE9A 1LEDA 2RJLA 3A0NA 1HKDA 3QF3A 5I8YA 1NXMA 1XNBA 5GZDA 5A80A 4IE6A 5FYZA 3TEPA 4Q27A 1RUF1 5D1IA 2J7UA 2VCBA 1UIJA 2KEKA 4WM7B 4QU2A 1PVXA 5JZGC 2RS51 4QX3A 1BLZA 1W6PA 1PNFA 3NJZA 1QZXA 4GB32 4A6OA 2YC4A 4B4QA 4CDXA 1YO8A 2ADEA 5J36A 2YU2A 1OLME 3MIFA 4A41A 1VAKA 2ID4A 4CCLA 2TUNA 3QACA 3SH4A 4AHZA 1ZRCA 1VP6A 2HBTA 3K3NA 1BQPA 5F9TA 1HB3A 4YM0A 2D5VA 1OF4A 2VULA 4Y1XA 5CFDC 3D1NI 2VZOA 4MG2A 2O8OA 2VZ1A 2VUAA 3IN9A 4XHXA 4YM2A 1ZUGA 3WSOA 3UFDA 2AH2A 5FZ4A 5H9QA 5EWSA 3VGIA 2VO5A 3H3LA 1PRUA 2VMDA 3LA2A 4XILA 2EAKA 3RYPA 4CP9B 3QOXA 4UFLA 3PJYA 3IDEA 4YGDA 3R09A 3ST7A 3ZFFC 1OKOA 4CDUA 3AKTA 1DQ4A 5DAWA 4OMCA 3IPVB 3ZYHA 4NHLA 3JB4C 3T2OA 2WL1A 3DKQA 4YG7B 2YBDA 1QJU3 1W2UA 3AFKA 3PMSA 1E3OC 5I8SA 5F3CA 4R4ZA 2JXAA 1BJQA 2VZSA 5L7OC 3O1OA 5HBAA 4YW5A 1AYM2 1U12A 4NMIA 1KITA 3MO4A 4Q4W2 1MS1A 2EXJA 4Z5CA 5HCBA 4ZU5A 2VOXA 1UOGA 2W5FA 4EWEA 3UV9A 5BNPB 1C28A 3OGSA 4CUAA 5FP9A 1GYKA 1SFNA 4FPFA 1XC6A 2DFCA 3B01A 5LZ6A 4CUBA 1RUE1 3OGRA 2NP0A 3F52A 2QZ3A 3VBFA 1G9DA 4X4DA 4B29A 1YQ8A 1HLCA 3DL3A 2BWAA 3UJQA 3ZPYA 2YDEA 3I3DA 2VTFA 4A45A 4NIGA 5BNOC 4XC9A 3N9QA 3VWSA 5ACA1 1HQLA 4ZS3A 2PAKA 2IV1A 3N9LA 4DUXA 4WM8C 5FQ0B 3LOBA 3C7GA 2VD7A 4UT5A 1GV9A 2QDRA 1WCQA 4XFHA 1UXDA 4UFMA 2RG4A 3FUQA 4P9JA 4R9CA 5LBBA 1HV0A 4P5HA 5EZWA 4TZDA 4A3XA 1UF2C 4RHV2 3VD5A 4OFGA 1W28A 2MPFA 3AMMA 1VRBA 4NHKA 3T2QA 3RZJA 1NLRA 5BV6A 3VKLA 5I0SA 2R63A 1GSLA 5HXMA 1AX2A 2ZX1A 4OHWA 4SLIA 3AYEA 3VBUC 4RA0A 4NWVA 2UY9A 2ILMA 2J22A 1QH6A 1QXPA 3LF7A 5FLJA 2HWC1 1VIWB 1DYKA 1QJFA 1VB2A 1XXNA 1P8JA 4I0BA 1BVP1 1NKGA 2E7TA 2GRMA 2XH6A 1T6GC 2HWD1 2QQWA 1AR63 4BQXA 1H1MA 4Y5SA 5GLTA 3AFGA 1R64A 1YWKA 3CEWA 3ON7A 5JUVA 4FPEA 3RZLA 1KGYA 4AF9A 1TVGA 3KSCA 4M3CF 4LQRA 1XYNA 4XIOA 5FXVA 1CQ9A 4AGVA 4A7KA 5A6QA 3ZXDA 1UW8A 2NPIA 1N1VA 4FP2A 4KG0A 4FFHA 2WNOA 3KJXA 4YNIA 5A3WA 1VE0A 1K5MC 5K4LA 3JQWA 5FY0A 1IPJA 2IVBA 2WNVC 1RXGA 4MHUA 4Y3OA 4GIQA 5DSXA 1UX6A 1X9TA 1DU3D 4Q8LA 1DQ2A 4DEQA 3S7EA 1X2LA 3AVRA 4OUSA 4JQRA 1TQ5A 3HBKA 1DLCA 3HQUA 3OWQA 1O4XA 4C0BA 2XLGA 3AZWA 4MO3M 3GJAA 3N36A 4O9GA 4LITA 2VQAA 4XW3A 2OVUA 3ACFA 3DYPA 3VBRB 2CROA 1YNAA 3MV11 4ASKA 3UKTA 1HW5A 1WLTA 5T3NA 1OT5A 2ZJCA 1MS3A 1SZBA 3TN91 3T09A 4IXLA 5BNNB 3POEA 1PGSA 1UL9A 1HQNA 3FYAA 1CZSA 1XNDA 3D3AA 1DCSA 3NV3A 3PJQA 4WZCA 1OF3A 3A4UA 4NHMA 2DTYA 1JHNA 4LNVA 5FY1A 4ASLA 1DG6A 2P2KA 5D8AB 2P6CA 4BH9A 2FDGA 1RINA 4Q4X1 5FPVA 5CKQA 4AGGA 2E32A 2IXLA 1ULDA 4YYOA 2HCNA 1FNYA 1TZOA 2FMDA 1QKQA 1RUG3 4FI9A 1CESA 4K8FA 1BMV1 4QDRA 3RS6A 4XABA 3OPTA 1H8VA 5E88A 2ZGTA 2XKPA 4LHNA 2CDPA 3IMNA 4IA8A 4GMP1 4PU3C 4QKDA 5C3RA 4RD7A 2GNMA 3MLFA 2VEOA 4Y33A 1VAMA 2J1UA 3NRUA 2YU1A 4AVCA 4JDMA 4LO5B 4MHRA 4XFCA 3RNSA 4JVAA 3N7KA 4S2GA 1OOPB 1JW6A 1JS9A 1T2XA 4XJ9A 3H5TA 4LA2A 4PLMA 3ZIWA 1WETA 2WT0A 2C9AA 2IVIB 1QJX1 2FDFA 1QJEA 3KWVA 3OG2A 2C24A 4N7IA 3EUSA 4QHZA 4XUOA 1EV11 4EE2A 4HKLA 3PUHA 5FP7A 5LA1A 3KT7A 3U10A 1AYN2 4IGOA 3ACGA 1H8TC 2WN3A 1K3IA 2UY8A 4XUPA 5FK8A 5ABJC 4S2DA 4I09A 3OD0A 1LB2A 1PRAA 2ZCWA 2BUKA 1AHSA 3K4AA 2BW8A 4E8CA 1W8TA 1ZBA3 2EIBA 2PHLA 1PO11 5DRTA 2YY1A 4P9IA 2XUEA 2PHTA 2OKXA 5KWRA 2JDNA 2A3WA 1HQWA 1GBGA 3RRDA 3Q8FA 1SLTA 1S2BA 3H0OA 2CY6A 3LDRA 4PDWA 2IU7A 4EQVA 1GZCA 4N53A 3PUSA 5IHRA 2YFZA 4DUVA 3MIHA 4Q4V1 1V0AA 4YVWC 4LOTA 2LLVA 1RUI2 2C0ZA 1HRI2 2VC9A 4MXWB 2Q30A 5JDBA 4QXCA 1AXZA 3NJYA 4AI9A 2WLPA 4AEKA 1UU6A 2V5YA 2ZMKA 1ZA4A 2JIGA 5CZKA 4JRLA 5EJ3A 1NLSA 3USUA 3VD4A 1O3SA 4G3YC 3NNJA 5FOBB 4J1WA 5JPMB 3FBMA 4Q2JA 2K9ZA 1OURA 2RV9A 4GWJA 2R1JL 4JDOA 4OUMA 4QXHA 1PGL1 4QPIB 2ARBA 3JD73 3M7AA 5GZEA 1MZEA 4UOJA 3UKNA 2PE5A 2XL7A 2IXHA 2WWJA 5KHIA 1C8M2 2FMYA 3S0MA 5KHGA 2HWF2 1XJAA 4BLIA 1ZZCA 3ZYBA 4AEJA 2XQRA 3B00A 4CCEA 5LY2A 3WW4A 1S0IA 1UMZA 3FJSA 1YIFA 4JGYA 3BALA 2DUOA 2QQNA 2RHPA 3HVDA 2OUJA 5GLWA 5F32A 4FPCA 2QQVA 3JXBC 4L92A 4U36A 1GANA 2B46X 3DUIA 3J7HA 3KB5A 1MQTA 3GALA 3ZFGB 4ARYA 4AI2A 1A8DA 1PIV3 1VBB1 4PLNA 4D7SA 5C3QA 4MH0E 2A6XA 3CLPA 1S1AA 4HANA 1STMA 3FHAA 1VBD1 1WH8A 1I5PA 1S7EA 1UIKA 2RMU3 4PU8A 3ZIXA 4YZ4A 1Y4WA 3POFA 3VN4A 5IK5A 1ULFA 2W47A 3DYOA 3NJVA 4IGQA 1QGLA 4UAPA 5JVVA 4XJAA 3S30A 4CDXC 1WA6X 4AW7A 1CX1A 3OGVA 1RB8G 4M00A 2UURA 1AL23 3BS3A 1LOGA 1GOFA 3JXSA 3KCYA 4HLTA 1NG0A 2XXPA 1BK1A 1VBE1 4AQ6A 4KU7A 1CAWB 4CXYA 5A32B 1E5HA 2P1BA 1HRV3 1FPN1 2Y6KA 1LLIA 4LE4A 2FDJA 4YW6A 1X50A 2VMCA 2Y6LA 5DG2A 1O3RA 4B1MA 1AR91 3WDUA 5GKAC 3AYCA 2BZDA 2LTNA 4CDUC 5I0UA 3K51A 3OUJA 5FZ8A 3ZXEA 4JKLA 4K40A 4LLOA 1LU2A 2B39A 5B4XA 3O1UA 5A7QA 1CX4A 1BHGA 2Y6FA 2CHHA 2ZTNA 3H9AA 3HBZA 3GZAA 3VBOA 4CTEA 1H6XA 1CJDA 3LIGA 1EYBA 4DOUA 5F1RA 2IFRA 3RZHA 4KG8A 1S0BA 5I0DA 3DN7A 1L7QA 2W52A 3ZN6B 1QB2A 3DM5A 4CUGA 2LYSA 2HWE1 2JG8B 3BPSA 3K46A 4NR1A 1U5ZA 3NAPC 4Q0SA 4YZ2A 3VDAA 5C8WA 1MACA 1HXS2 1FV3A 1OLRA 3RG0A 4URAA 2XJPA 1BYHA 1DZTA 4QXBA 1COV2 5GZGA 4LKEA 1DQ5A 3FWEA 4UFHA 2VBDA 3AL6A 1RVF1 3WP5A 3B9IA 2BOJA 3AZYA 1R091 1F2NA 1RYYA 3I3EA 1QJY3 1E5SA 1WD3A 1ZX5A 2PLV3 3I3QA 3QBQA 5T50A 5C8CA 3WQ1A 4FPLA 2ZOEB 3LPFA 3T2TA 4M01A 3V56A 1CPNA 3IT8A 3RI9A 4Y22A 5E6HA 4DXRA 3JBG3 1PHMA 4PJYA 4X4IA 3J9SA 1W8ZA 5JLVA 4D0QA 5FUNA 1S0EA 5FY5A 1EUUA 4N43B 1C57A 2YV8A 1AR83 4EJRA 2MEV2 3WNXA 1WH6A 4YG4A 3ZN5A 1K12A 3I7DA 5EYXA 1XYOA 3WDTA 1OLMA 3W5MA 1NZCA 1VBC2 2RR12 3VBSC 3VHOA 3VL8A 4DS0A 1JXNA 1JH5A 3G7DA 4X4FA 3CJIA 3H3ZA 5IVBA 2JG9A 5T5PA 4RR3B 1WW6A 2WYFA 4CXWA 2PMWB 2FZ2A 4I6RA 3M3IA 1X57A 2P17A 1LOEA 3B7MA 4JDNA 4YVSB 2H6BA 2WS93 2X53S 3D4KA 1CONA 3DEMA 1YYNA 4P08A 2A1XA 2VW0A 1O4ZA 2D40A 1U5IA 1D7PM 3PVOA 3MIDA 1VRH3 2R062 1CJGA 1GU3A 2E63A 3GCWA 3T08A 4NIIA 2DCJA 4ER7A 2HYKA 3IM0A 1CAVB 1RUC3 1DGRA 3OY8B 1UN1A 3OPZA 3PU3A 2QQMA 1TNRA 4CA9A 1RUD1 3GZUC 2QUOA 4AL9A 2I07B 3N7JA 3O0VA 5DUUA 5FYSA 1EAH3 1OH3A 2NN8A 1IGOA 2PHXA 3OBZA 4GKYA 4INDA 4RFT0 3WD5A 4BMBA 5FZ0A 5CNAA 4OCTA 1RUF3 2K2SA 3F95A 3GJBA 2YC2A 4IV3B 4Z59A 4JGZB 2A6ZA 4W4ZA 5FAXA 4CDWA 1D4M1 1NCRB 2R49A 3LEKA 2B4KA 1YIPA 3IB3A 4QT6A 5GAHi 4P02B 1R1ZA 2D98A 2JDAA 4L0PA 2NYYA 5JXJA 4HT1T 4SBVA 3SXWA 1AR71 3FFZA 1UNBA 3VHPA 1ND3B 1QNYA 2JDHA 2VNVA 5IAVA 3O9XA 4QXKA 3A23A 1UY2A 3MLJA 4CEWC 3BCWA 4BZ4A 3TAYA 2WKKA 2V72A 1IS6A 4BK5A 2D93A 1XNTA 1H9PA 2VZTA 2PXVA 4XE9A 4LUMA 3GYDA 5K0UA 3ZSMA 4BB3A 5KC6A 3LFMA 1J3QA 2ZX0A 4QPGB 4YW7A 1G6NA 3TEYA 4LIVA 4BPZA 2VZ3A 2YBPA 4Q29A 1GNZA 4LO8A 3VDCA 1ND2C 1GQHA 5FJKA 5FKBA 1NAEA 3VD3A 3WDYA 1GOHA 5C3OA 5J1XA 1JBCA 4NWWA 3AKSA 3FE5A 1ONAA 3AYDA 1RHI1 1SCRA 5FZKA 2HBUA 5IK8A 2D5FA 2ZKLA 1W39A 1KDMA 1FAYA 3N9PA 3LAGA 3N9MA 4GD4A 4COYA 1JYTA 1SLBA 4PU7A 2NM1A 2WO3A 3VHNA 4QX8A 2QVSB 5I8TA 1YLLA 5KHHA 4PU4C 4ER5A 2BJSA 4P9WA 1NLQA 1RUE3 2O0OA 2XWBB 3DPRA 3O14A 1A3KA 5CFCB 4MSVA 5GLUA 1OLQA 4AI3A 4UW4A 2JDKA 3SR4A 3ZLIA 5GJ6A 4NIAA 4LR4A 1RMU1 2RDNA 4FOQA 5JXIA 4NROA 5DUXA 2VQ0A 3H8UA 1SLAA 5FPZA 3WF1A 2VM9A 4FO9A 5EJ1B 5F5CA 4BWOA 3AXEA 3HQRA 4EN8B 4B7EA 3HOBA 1QWRA 2VY0A 3WNMA 1M06G 1MS0A 5FXZA 3ZDSA 5FDBA 3OYWB 4UW3A 4J6GA 4N53C 2R071 3ME5A 4DIQA 2P37A 3LSEA 1UZVA 2R6QA 1G9FA 4KGQA 2RM22 1GZWA 4LBKA 4UXAA 4CRQA 5LA0A 1K42A 3HMYA 1HN0A 1SDWA 2FDIA 4IL7A 2OYZA 5FZBA 2GDFA 4PQ9A 2WAAA 2D6MA 4LPLA 5F8PA 3GUUA 3IDBB 5F5QA 3HN1A 4YFWA 3VZOA 5A3TA 3TFLA 2W0XA 4ONUA 2HWC3 1KEXA 3NXHA 1BK0A 5JI9A 2W1UA 4WM7A 1IS4A 3WW3A 5A33A 1FOD1 3MUY1 4XUNA 5C4WA 3WV6A 2DU1A 3S5QA 4ATFA 4P00B 5C9AA 2HWD3 2FHRA 1L3JA 2RS11 4FXKB 1GFF2 3BDNA 2PXKA 4FFFA 4K1ZA 5C5UA 1MS9A 4FPGA 4IERA 4MGZE 4YW4A 4EZHA 4KWUA 1YHFA 3R05A 2AXVA 1ZPQA 1HJFA 1R081 3MPPG 1W6OB 3O0XA 4P9YA 5LBCA 1R69A 3NDBB 5JSOA 2DDUA 4MGIE 2PXFA 1MEC1 1JOJA 2NMOA 2VCMA 2GZUA 2E7QA 4JGYC 4MZUA 3N4MA 1JOPA 4NIHA 2IZWA 3LE0A 1DDLA 2LM3A 2BRTA 2AXZA 2RJKA 3AMHA 5C3SA 4W50A 1NQJA 4IGPA 1MR5A 3ZKCA 4GQ7A 5FY9A 1IPKA 1UXCA 2GNTA 3AYAA 5T5OA 1JZ4A 3IPVA 1OD5A 4I01A 5IK7A 2OX0A 4D7TA 4OHYA 2ZABA 4LBJA 5KXBA 2NZ9A 3FZ3A 3E5UA 4AYUA 3MDPA 3ZYFA 3MEPA 4HONA 3MW2A 4IUGA 1WCDJ 5LBFA 2KEJA 1OA3A 1SBEA 1W2AX 1AR62 5DXDA 2JECA 3TN93 1NCQA 2DVBA 1SLLA 3VZKA 1RZSA 2AXUA 2HYXA 1F5FA 2R0FA 3Q8BA 1VB4A 2VGDA 4Q5OA 4BQ3A 4URTA 3MGUA 1Q8PA 4LHSA 4KWJA 4MUVA 5K8SA 4OI2A 5GLZA 3OTFA 1GWMA 4E27A 3A21A 4RHV1 2A6YA 4YG6A 3VZLA 5JZGB 4Z58A 1YEWA 4XQDA 2ATFA 1VPHA 3KF5A 4Q8KA 1W6QB 2P5BA 4DXTA 3D6EA 4Z5HA 3B3QE 4ZY9A 2QQPA 2PXUA 2FZ1A 3IIIA 3NNFA 1SBDA 3GHMA 4YRDA 5FQ0A 5ISLA 3AKPA 2WINB 1MS5A 1DGRN 4KL1A 2CNAA 4Z2AA 2WZR1 2Y26A 2XBO3 3MF6A 4XF4A 3U11A 5CFDB 3WQ0A 2PXPA 2XJQA 5KXDA 1HX6A 2EIEA 4JAAA 1S0DA 4BYYA 2ERFA 3GF6A 3ZFEC 1SLIA 2GZWA 2VZPA 2VL4A 2ZEYA 4RS5A 4P5YA 3VBOC 1QJX3 2L8NA 3ZFFB 2DYCA 1JYVA 1H30A 2VOKA 3K3OA 1EV13 4XBLA 2P3YA 4X8PA 5FYHA 3UESA 4DNYA 5CKNA 1SEFA 5A7WB 1OVSA 3HQXA 1W0NA 1SPPA 5F39A 1LEMA 4JRAA 5L7OB 3IDAA 5IATA 3FL7A 1X33A 4BQ2A 4D94A 3WNKA 1PO13 4XYXA 2L49A 3K4DA 2PXTA 2DBNA 2D6PA 1JI6A 1LCDA 2ZACA 3DYMA 2WFPA 1PO22 3FBYA 2EA7A 2RDSA 3KM5A 4COZA 1ZRIA 1D0HA 5C8CC 1WMEA 5FPLA 3H1MA 5FYYA 2GC1A 2JDUA 3S7IA 2J1TA 4GH4B 4V1PA 3R6SA 2WDBA 4Q4Y1 5DMYA 4Q4V3 5BNOB 4OQ8A 1W6MB 3SEEA 5FY7A 3WUDA 1QPZA 4E4ZA 1PERL 1WCKA 1YCIA 1HB2A 4YARA 2BJCA 3HJRA 1CZTA 1GP4A 5CU1A 5DDJ1 1Q3EA 3F2ZA 2NQYA 3R4UA 4MOAA 5IWFA 1TG7A 2JJ6A 4FAHA 3KV5A 1OPOA 5FLIA 3G0TA 4Q0PA 4XAEA 3VV1A 2GMMA 3H7YA 2VCCA 2RE9A 5F3IA 1ZBA2 2B45X 1ZAYA 1O8SA 2JG9C 4EN0A 5BNNA 1LENA 1HIXA 2AUYA 1JZ6A 2EIDA 2XJSA 4Y42A 2Z5WA 3I2DA 3O1TA 2D6OX 3OGGA 4NPRA 3UYJA 3C3VA 4F8AA 5H9RA 2FDKA 1CVNA 2BTVC 1UTXA 3PUQA 5D8AA 3W5NA 3PTYA 1NZIA 4Y5TA 1DF0A 1Y7YA 1CR7A 3AL5A 3VB9A 1KJLA 1US3A 4Y26A 1DW9A 1L1MA 1RUH2 3SKVA 3V65A 4EQZA 2ADDA 1WWYA 1LECA 4RGAA 1TMF2 5FZ3A 4J1XA 4RL7A 5EPAA 4MV2A 5FZ1A 2VW1A 2BPA2 1K45A 2OIIA 4Z2WA 1YFYA 1AYN1 2ZXQA 1PNRA 4RFRB 1VBB3 1NE4A 3A22A 3W20A 4HETA 2UU8A 1OOPA 1VBD3 1W0PA 2B9UA 2WNUA 3TWIA 2PUGA 2HEVF 4CDWC 4S2FA 1IS3A 5HV0A 1SQ8A 3JD72 2WNVB 2YHJA 4ITCA 1RIRA 4PHZA 2ZEZA 1PM4A 4EK9A 1KD7A 1XYPA 4DO0A 4XJZA 2HEWF 5L36A 5FZCA 5FYTA 1VBE3 3KVBA 2A7AA 2B5HA 1SDDB 1UO9A 1WBFA 5IVEA 1ASJ1 1V6LA 3VKNA 3DXTA 3PUIA 2KD7A 3THTA 2E9QA 2ODRD 4M4PA 4RSUA 3U1XA 5AFBA 3VHRA 1O5UA 1BDIA 1RUI1 2ET7A 2WQZC 1HRI1 1GR3A 4IV1C 4YGEA 5BNQA 1AR93 1GWLA 4X8NA 3RVHA 2WA3A 3GDBA 3RPQA 4XAAA 5JSRA 4LK6A 4UI9L 4Z8BA 1OD3A 1YXWA 5C33A 3M3EA 4IQPA 3ILFA 3SNMA 1CAXB 3I97A 4CPBD 1REDA 4PT6A 1NUKA 2GH8A 4HOOA 4XUQA 5FY8A 2D6NA 1IKQA 1VALA 2RDRA 4K7JA 1ZZ6A 2ZHKA 4I3GA 2RMU2 3FFQA 4HK8A 2Y6GA 3HD8B 3AZVA 3OKZA 1J1TA 4B7KA 3VZMA 5LRSA 1WA4A 1C8M1 2W9XA 5FUIA 3WLUA 2YGLA 5A7SA 2HWF1 1BVVA 2QQIA 1AL22 4FOWA 4K21A 4KBBA 5FXXA 4O8BA 4ER0A 1ZNPA 2D6KA 1ENRA 2HWE3 4MLOA 3ZXKA 1Y9GA 1WUVA 5CB7A 3THDA 4CVUA 3A0KA 2XSDC 4NOTA 1W05A 1YRZA 4K20A 5A7NA 1IQAA 4LKFA 1HRV2 2XCJA 3IZOA 4YG0A 3ZVXA 5A3UA 1Z7S1 4QPIA 1APNA 1GZTA 2XXZA 2VG9A 1KS5A 3JUUA 4I2OA 1R63A 2ZKNA 2OUHA 5FYBA 1RVF3 1FI2A 2A75A 4YW2A 1R093 5FLHA 1GP6A 2WYSA 4FOYA 2VZVA 2AUWA 5ABJB 3BPZA 3DXUA 2FJRA 3QWGA 1XU2A 4OMDA 5G04L 2EXHA 1HF0A 3SX0A 2BDRA 3ZXJA 3B94A 2PAMA 5CIRA 5FP3A 2JD9A 3CZJA 4L97A 5DT2A 4GULA 4BQWA 4ET7A 3AP4A 5DZEA 4BMEA 4J25A 1H9WA 2LNMA 4GJYA 2HCSA 3DKWA 4FPKA 4XPVA 3JU9A 4Y1YA 1SHWB 3ZFGA 2IUOA 2IWGB 4I02A 2R32A 4ZU7A 1S0FA 2B42B 1LHWA 3M3OA 4N7UA 4QB1A 3EJKA 4BK4A 2GN3A 5HPOA 4HK9A 4L8QA 3USSA 4E2QA 2H0VA 3J8F1 5FZDA 3ZYGA 1UWWA 4H7MA 1SFYA 4AFCA 1RXFA 3KQ4B 1G86A 2VQTA 4YVWB 5FO7B 1AUYA 4RQPA 4A4AA 4QX0A 4CEYC 5C4WC 3ELNA 2OR1L 3CROL 1NYWA 2D3RA 1DIWA 3CF6E 4XFGA 5C9AC 3BODA 5J48A 3WNLA 4WVVA 5JSPA 1VAVA 4UBHA 1LU1A 2OQ7A 2PLV2 2ZZQA 2X5IC 1OH4A 5L19A 2GNBA 4HSJA 4Y1VA 4E9KA 3EQEA 5JI7A 4XFFA 1TEIA 3MICA 1IS5A 1CAWA 1QY4A 2XR4A 5A32A 4PF1A 1JYIA 1WCSA 3ZPOA 1ULPA 4GXLA 3UL2A 3JBG2 2ZMNA 3HAGA 4R9DA 1F31A 4BXFA 2VZUA 1UKGA 2XPJA 1OVPA 3NNGA 1BBT1 3BGAA 3POBA 2Y0OA 1T6BX 1AR82 1FXZA 3KZ3A 1YFXA 5FK7A 1ENSA 1PK6A 2ZEWA 1DGLA 3WXPA 1HXS1 4A2UA 3O1MA 2MHFA 4LIUA 1D4M3 2FCTA 5A1FA 3FX3A 1IHMA 3PVEA 5A3MA 4CCMA 2R041 1ZVFA 1AR73 1PGW2 4XBQA 3TYJA 3WEZA 1NCQC 2LYLA 2WS92 1OFNA 1H4GA 3RWKX 5DTQA 5LEJA 2HEYF 2LS6A 5IW0A 5DRYA 2ARXA 2VNOA 2HSGA 3PURA 3R4SA 4UW6A 4AEDA 4DY3A 1NA1A 4GWIA 3LOIA 1RUC2 4O9EA 3LA3A 3G5GA 2WWSA 3CBNA 3I2FA 2R16A 4H3WA 3ZXFA 3B5LB 2HJIA 5C70A 2KA3A 1PZ8A 1B35A 1EAH2 2JENA 2ZGNA 4MYEA 4XURA 2JWPA 4CDXB 1PRVA 3H1WA 1SFPA 2HWB3 3UGFA 3BIWE 4NUBA 1H2MA 3K77A 4Q4X3 4Y4RA 3VDDA 2DVAA 3WNNA 4UWDA 1LOFA 1B09A 1MS8A 4KI5M 3ZHMA 4IEOA 1VBC1 2RR11 2KZ8A 2YPJA 1V9U1 2ZGMA 4F8DA 4AR2A 4UYBA 5KC5A 3EMRA 5IVFA 3MLKA 5A3OA 2BP6A 5J96B 3VD9A 1RHI3 1R1A1 2XG3A 1YI9A 3I2IA 3ZR6A 3PE5A 4RS5C 4N43A 3ASIA 4OHVA 2D43A 2YFUA 3APBA 3AZZA 4W65A 4CDUB 5LW9A 4IEZA 5J37A 2X8KA 1JFSA 4P14A 3RGBA 3AZXA 4QPWA 2OW4A 3INAA 1RGSA 3N35A 1RL3A 3NVCA 2VNRA 1U5XA 4XMIA 1ULOA 2PN5A 3NV4A 1DFQA 4KWLA 4PIYA 3MBWA 2I45A 4YVSA 3E1F1 3GN5B 3PTRB 4RGKA 3T0DA 1G9AA 1GNYA 3NAPB 4EZIA 1YQ5A 2EICA 4AVTA 4YG3A 1AJOA 1URXA 2Z4FA 1UZYA 1ZBE2 1L7LA 3OY8A 4U2AA 1CAVA 2R073 1WW5A 3HWJA 5FP4A 4YG1A 1POQA 3FN9A 2BWCA 4NRQA 3OEBA 1JFTA 2CSFA 3U78A 5IFTA 4FQ4A 2OZJA 5LATA 4PCRA 1KS4A 4AFBA 1QQBA 1F5JA 1KDKA 1RPEL 2YBKA 1OHFA 1QQP1 1RUE2 4OZXA 1RZRD 3VBHB 1ZZ7A 1W2OA 3SITA 3KCCA 1QDOA 3FLPA 1NCRA 3THPA 3U0ZA 2WC2A 1DYPA 2JX9A 1O6UA 3ZXAC 2BEOA 1FOD3 1W90A 1BEV1 2CV6A 4ISRA 2GAUA 1S2EA 3L2YA 2JEMA 4HN0A 2LYKA 3ALQA 4CDQA 3C7EA 2RS13 4X4GA 4CP1A 4DQAA 4EWAA 1GP5A 4KU8A 1ND3A 4Q1PA 2E7AA 4HVOA 2JICA 3J4UH 3JXDL 1W6NA 3OJBA 3LEMA 4HL0A 3WW1A 2FFHA 4ER6A 1EP0A 2F6BA 3NSTA 1R083 5F2WA 4MX3A 3GCXA 5D8AC 3VBSB 5CBLA 2VPVA 1JZ5A 3P6BA 3KV6A 5EP9A 4A42A 1POUA 4EWDA 1MEC3 3NV2A 1POV1 5LASA 1JUIA 2CU5A 2JIJA 2W1QA 2AW6A 2Y34A 5FY4A 3SLIA 3ZOIA 4QPGA 5DN2A 3PU8A 1JU3A 3PXPA 4GQMA 2WJSA 3WUCA 3GZTB 4BQ1A 2DTWA 5F6KA 2Q8OA 4G9SB 4NAOA 4MGYE 3ZXGA 4Z92B 1XRUA 2HWC2 2W3JA 3L2HA 2OPKA 1QP4A 3GNEA 4KWKA 4AFAA 4FAGA 5A3NA 1W99A 1JOBA 3H1YA 3AK0A 5D21A 2WNUC 2FDHA 2WZPP 3M8LA 4NPMA 2PUDA 4B4PA 3U07A 2HWD2 2WFF3 5FPAA 1CZVA 1PVC3 3K2OA 4JCXA 2Y6HA 5IFPA 3N7LA 1DHKB 3J7MA 3RYKA 4FBIA 3MV01 5JMOA 3MIGA 4UF0B 2L9LA 2R7EB 4JTNA 1QU0A 4JV4A 4N9IA 1JYXA 1VMFA 4OI4A 2KR2A 4P9GA 2WRAA 4NJ4A 3POSA 2RM21 5H9SA 1ZRDA 2D3SA 3OBTA 2PUBA 1WLWA 5FZOA 3TNPB 4AOCA 2RJ2A 5ANNA 4XOGA 4C90A 3NV1A 1RUJ3 1CPMA 4EV0A 1PMJX 1Q56A 4YGCA 3OB8A 2WO1A 1UAIA 1U2ZA 2B8MA 2WZR3 4FFIA 3VBFC 3ZM8A 4CEWB 1MVQA 3BN6A 5FBZA 1JODA 2E31A 2G4IA 2Y8KA 3OYWA 4GJZA 1FMD1 1D2SA 1ULEA 1V6JA 2UYBA 1V70A 1UU5A 1F4AA 1LHNA 3PL0A 5ANQA 1B0NA 2LYQA 3TN92 4DINB 2KEIA 3WY6A 1LNSA 3UKVA 4IE7A 3LEIA 3L9JT 3KT1A 5C3PA 1F9KA 2XHKA 1ND2B 5IT6A 2Y60A 4FOVA 2WIUB 5IAXA 2QQOA 3OF1A 4LO7A 3PMEA 2TEPA 4UBGA 1DYOA 2AC1A 1ZZ8A 1W04A 2DCKA 2PHFA 3BU7A 3WG3A 1ZRFA 2O49A 2QE3A 1X9PA 4X6QB 1QXJA 5F3EA 3TEZA 3B02A 5D2AA 3ZSKA 2VH9A 1BMV2 2EF6A 2ORZA 3H3UA 4XF3A 3M3QA 3RI8A 3NKGA 2ZHMA 4ZXEA 1DBNA 4CE8A 2XBO2 3VDBA 1J84A 3EO6A 2Y6JA 1MZFA 3BYWA 3NW4A 4AE2A 4ARXA 2E51A 4LO4B 2QCSB 4UFIA 4BCUA 4ZPIA 3ROUA 4DRRA 4IEXA 1UCXA 1H1AA 2OQ6A 1ODMA 5FOJB 1DGWX 4I6TA 4LO6B 4Q4Y3 5AC91 4LBOA 1BZWA 4HSLA 1O59A 4ZKTB 3SISA 3N9NA 4QGLA 1W9YA 1QJX2 2A3XA 4CCCA 5GZFA 4IEPA 1RIOA 1EV12 1YJLA 4AXOA 4Y20A 2PXEA 1ZA7A 2G9FA 4MVTA 4UW5A 4ZZ5A 5DDJ3 2RS33 5LBEA 3CZUA 3T0BA 3GBWA 4OI1A 3B7HA 1Q5OA 2YBSA 2X09A 2ZGLA 2W95A 4QQ2A 1YJKA 2JB8A 2WNEA 1PO12 1AXYA 4RQPC 1NY72 3RZGA 2LLWA 4FCAA 2DCTA 4CU8A 1TME1 3ZX7A 1C1LA 4AWDA 5FYVA 5JCTA 5FPBA 5L9VA 2J1SA 2JKXA 3OUHA 5DAVA 3NL1A 1PMHX 2VUDA 3MZHA 3W21A 2B5AA 5F6LB 3E5QA 4K9SA 3RDIA 2RS53 1F4HA 3POWA 3LGRA 5K98B 4Q4V2 5CADA 1QOTA 3ILNA 4XFAA 3D8CA 2V73A 5FPXA 1VBA1 1XSRA 4META 2OA2A 4W6YA 3AJYA 2CWSA 4DXSA 3OOXA 4QU1A 2PQSA 2YUEA 1AYN3 5CFDA 1WW4A 2R1BA 3C8XA 1ZREA 2ZGSA 1PK6C 4PIXA 2D7FA 4LMFA 1ALYA 3P3PA 4JGYB 2GU9A 3Q8CA 1PMIA 4QD2A 1UXXX 1DWKA 2K0GA 4TLFA 2PELA 4OLLA 4WVMB 1LQCA 3ZFFA 3OMTA 4H55A 2P3IA 3WF2A 1PO21 2A5ZA 4LBQD 4AI1A 1QIQA 4P9XA 4X4EA 1WCUA 5A7WA 2AREA 4PI2A 2EXIA 3AP6A 4DZGA 4L11A 4B1LA 2D5HA 4DFSA 2JDYA 1FV2A 1CN1A 1YFWA 2W1SA 2AENA 1ASJ3 1Q8QA 4LUKA 4XBNA 4ZZ8A 2LRPA 2PXDA 2ZGQA 1NA1C 4AEDC 2ZGKA 5AFEA 5IVVA 3LWCA 2PHWA 3OD4A 3O1PA 1RUI3 4X4BA 1W8NA 2ZGUA 1HRI3 3AM2A 4DY5A 4I8TA 2E33A 2PXJA 4GALA 1B35C 4LE3A 2BNMA 2JCGA 2A3YA 2I2SA 1O4YA 5FJHA 4RGGA 2VW2A 2LROA 2DU0A 4QWNA 1Q8SA 1JWLA 1VBB2 3VDDC 2LYPA 2XIUA 1G7YA 1UPIA 2EF8A 1LOFC 3I59A 4GH4A 4XF0A 2VMGA 1XNAA 1CGPA 5AVPA 4BIFA 5FO8B 1W6MA 4E4DX 2YB7A 3WT3A 5ACA3 2GRLA 2AYHA 3D82A 3P3NA 5L9RA 4AK3A 1CJPA 1MVEA 1W9WA 4XHBA 3IWZA 3RYRA 1C8M3 3LPGA 3F6WA 2GSYA 3UT0A 2PXBA 4DUWA 3J7LA 3ACHA 1JU4A 1QJU2 4PDWC 4Q1RA 4ZHNA 5FCCA 1UZZA 4V2VA 3T30A 4YWAA 2WUSR 4Q0QA 1J59A 4IDZA 4KH9A 4QHBA 4COWA 1RUH1 2WBKA 4GB31 3ZFEB 1Z7S3 4HPKB 1AX1A 4PQQA 3O1SA 2VUCA 2O8QA 4GWNA 1VJ2A 2LYJA 1AR92 1TMF1 1D0GA 3HZIB 2XL9A 3DGTA 2BQPA 5A6ZA 3FLTA 2IVGA 4MGSA 4MGTA 4BLJA 5LK5A 3NO8A 3WG4A 1IKPA 3O1VA 1UYYA 2BBAA 2R1DA 4AQ2A 3VK0A 4NN0A 4UFJA 2LW8A 5IVYA 4HZFA 3KT4A 3WQBA 3H42B 1E5IA 1UOFA 1UU4A 4TN7A 3BU0A 1LHVA 3CECA 3UK9A 4CP2A 2HWE2 5DUWA 1N3OA 4NPLA 4BDVB 1KJRA 5C8CB 4EKIA 3JCIA 3WF4A 4Y5Z0 3J8F3 4AVSA 2OT7A 3T3YA 1AYM1 2TNFA 4XCBA 4AFMA 1ULCA 2TBVA 4Q4W1 3TELA 1NCRC 5L73A 3IAPA 3EB7A 4QQPA 4AG4A 1QQAA 2MNGA 1LJ7A 3KHBA 3MIEA 5DAQA 2XI8A 3ATGA 3M70A 3ZKUA 4CP9A 3UJOA 1BXHA 3V0BB 1RVF2 4HRAA 3QOPA 4CEWA 1MQTC 2VOVA 1R092 2PQQA 4CDQC 5F2SA 1LRHA 1LULA 5ERLA 1WIZA 5FRAA 1Y7BA 2M4HA 5FMDA 4LT5A 4JHZA 4LULA 3LCPA 3GM8A 2WUHA 2PUEA 1LODA 5FZAA 1XNCA 2ENRA 1WKYA 5EQUA 4ISQA 3UNPA 4KQ7A 2P3JA 1W06A 2JG9B 5BNPA 4JZRA 4QQHA 5I0TA 4A7YA 1BBT3 1YFUA 2GMPA 1GQPA 3NZLA 2OS2A 1AL21 1JH9A 5JAXA 4GHJA 2QNKA 3PNAA 4QQOA 2X10A 2O14A 1GT0C 4OB4A 1CAXA 2CSGA 2DVFA 5KXCA 3ZN4A 4HFSA 3WP6A 1SMVA 1DZRA 3U4XA 1OUXA 4EN9B 4QB6A 4WVLA 3IIAA 3N3HA 1AVBA 2PUCA 4YW3A 3EHKA 1WGPA 3W59A 2WZEA 4ZS2A 4Y1UA 1JMUB 3KXAA 4GMP3 5DG1A 5FZ6A 2R043 4E2SA 3GZEA 3O7OA 2R30A 5SV8A 2GP5A 3MW3A 4COUA 1CIWA 1LAJA 5IVJA 1AZDA 5I0RA 2VXRA 1YQ2A 3OUIA 4HN1A 1GWKA 4OHZA 2JDMA 2VVFA 2QJVA 1O8PA 3CMGA 4CDWB 4IEUA 1NERA 4EN6B 1W03A 1N3QA 3DECA 3JXCL 4N8MA 4WBBA 1N1SA 2ICPA 1PM7A 1Q8VA 2HKXA 4C91A 2KXLA 2VMEA 1MZ5A 2CDOA 1W0OA 1YQCA 2Z42A 2WABA 2PHRA 2PUFA 3BTXA 4MXVA 4ORFA 2J7WA 1UKRA 3PVNA 1ZVVA 1VBC3 2RR13 2V3CC 1RUG2 1V9U3 1D4M2 3IKWA 2Q4SA 3FUOA 4LBQB 4QKBA 4XIKA 4Z5DA 2ARCA 4IV1B 1QF3A 1LGBA 1LGCA 1GICA 1QP7A 1R1A3 4I0AA 2ZGRA 3URFA 1AR72 5A3LA 1C4RA 1LKNA 1WW7A 3WDVA 1V6IA 3AJZA 4XZPA 1JZ3A 3AC0A 3PVBB 1W8UA 3ZMOA 1Q43A 3B93A 3FYMA 2FBEA 3RMYA 2O38A 1DP0A 1SG3A 4YVWA 3WVJA 3GGLA 2BERA 2BYVE 5DPNA 5BPXA 2JVLA 2BGCA 2XJVA 4WM8B 4XCAA 5C6CA 4XACA 3ETPA 4LKSA 2O1QA 2HWB2 3BTZA 5FZFA 1C8NA 5DZGA 4XJ8A 4Q4X2 5LA2A 4P9LA 1VLNA 1JTZX 2WWUA 1AXKA 1QHDA 2LCVA 5KBFA 3T1MA 3VBRA 4FPJA 3I2OA 3OQOA 3VL9A 3H8OA 5JOZA 3V0AB 3CJIC 1HV1A 2G1MA 4QX5A 4CCNA 3MFAA 5HV4A 2AGSA 5A3PA 1RHI2 3VBUB 1LOCA 3WQ7A 3ACLA 1PGW1 2B9VA 1OQEA 4JCKA 2Y33A 5C71A 2B7YA 4M3CB 3ZYIB 3F51A 1QQP3 1W9SA 4ATEA 1NW3A 4A6SA 4TXWA 3IMMA 5KHJA 4GA9A 2JE9A 4YW1A 1O5LA 1PZ7A 3E5XA 3M9LA 3KL4A 1E5RA 2DWRA 5LEKA 1BEV3 3KGLA 2FQPA 3OP9A 3K48A 5TSWA 3D0JA 1GNHA 2YZ4A 5FWEA 3WF3A 1G9CA 5T5JA 1AX0A 1H4HA 5B2GB 4D8MA 1JHJA 2JQEA 1FYUA 2D44A 4AFDA 1PNGA 1HN1A 1XWRA 4QX7A 4IESA 2F4PA 3ZPXA 2BGOA 3X29B 5A6YA 4FTSA 1K5MB 1UY3A 2CWMA 2R072 1ZZ9A 5A33B 2NLRA 3TNQA 3DV8A 1W3XA 5EFUA 4CEYB 1POV3 4KNCA 5C4WB 2XJRA 5B4NA 1EFAA 5C9AB 1Q8OA 1DQ1A 3I2JA 3KV4A 4NO4A 1ZZBA 1UOBA 4YLZA 4FBFA 5CISA 1J3PA 3SCFA 1X8MA 2X5IB 5JR2A 3E6BA 1N1YA 4GAZA 4H2AA 1I5ZA 1MZ6A 1J1LA 4QDQA 3C7OA 5FR3A 1CAUB 1ENQA 1FPN3 1HB4A 5EIYB 3OQNA 5IVCA 5IUQA 2CAVA 4DPNA 3LD8A 1UZ0A 1FOD2 1OQDA 4L2NA 2Q1MA 4K8RB 3SQOA 2SBAA 5K0UC 1REEA 2GMEA 3LDKA 2RS12 3FLRA 3IBMA 2D6LX 1PIV2 4LKDA 2IXKA 4YM1A 5FO9B 3VZNA 3VD7A 2XJUA 2VMIA 4CYDA 1R082 5CVRA 3ZO0B 2C26A 2ZBJA 1ZBE1 2IVQA 3MEJA 2IC1A 1MEC2 2BNOA 1ST8A 2H8RA 2WQ4A 3ME2A 3O5SA 5HCFA 3S6PA 4BA6A 4GKXA 1HJGA 4MXWA 2PXQA 2RM23 2VOTA 3UETA 4CPBA 1CD3G 1QH7A 4XETA 2YGMA 4BM8A 1PZ9A 1NCQB 3GN5A 5KR7A 2YMZA 3ES1A 1MPXA 3NAPA 4IVZA 3JQXA 4ZU4A 3DPRC 1W8WA 3BIEA 1N3PA 2JD4A 3I4IA 2XLAA 4XTMA 5CEHA 1C1FA 5H9PA 3W58A 1FMD3 4JKKA 4CXXA 2BV4A 3J7NA 1FNZA 3KF3A 4GH4C 4XQWA 3BUCA 3GZCA 2JB4A 3ZSJA 3A9YA 2LUWA 2WFF2 1PVC2 3TEXA 3IAQA 5A7LA 1H8TB 2P6HA 3O12A 3ZYJB 3G6JB 1S55A 5KHKA 4AAPA 2EBYA 3WX5A 1LGNA 3LB9A 3VBHA 3HEIA 4Q2FA 4CP0A 2XOMA 2V4VA 1BCXA 2ZX2A 3WNPA 1KFUL 1OXCA 2J1VA 3MFCA 4YZ5A 2PYTA 1CWPA 3T4VA 3BD1A 3OCPA 2PHDA 5FBJA 4QM9A 3VKFC 3NNMA 4K6BA 4RS5B 2J1EA 1RUJ2 4IW3A 5LWBA 1KFXL 4D6SA 2CGPA 1X7NA 4QMAA 1RITA 1HQ1A 1I6XA 2WZR2 3I54A 3RZZA 1QNWA 1GLHA 5FZMA 2IFWA 3KV9A 4BQ5A 3Q8AA 3VBSA 3SCHA 2L1PA 1UYPA 4WM7C 1SPPB 1UD1A 4YPJA 3WDXA 3FMGA 1H0BA 5EXOA 4B4RA 4FSJA 2GC0A 5CA6A 1GMMA 2C6SA 2V4AA 3NMBA 4CSWA 2BVBA 5AC93 1LCCA 1F35A 2W92A 1WLCA 3U3WA 4FQZA 2VZRA 1QJY2 2N7GA 1UY4A 3FC0A 1YI7A 2XB6C 4D69A 4L9BA 4I3PA 4R4XA 5JMCA 2QQLA 3QH7A 3O0WA 4KGGA 2QDNA 2ZZJA 1IPSA 1X36A 3P1IA 4QQLA 2QTWB 1OCTC 3LIHA 4LTAA 1RUD3 4XJUA 4AZZA 1OBNA 5BYNA 3BB6A 3WP3A 5LB6A 1VPWA 3AX4A 2F17A 2W08A 3LKJA 1V6KA 4M3CE 4TSVA 1OPMA 4A7ZA 5KXEA 5A7OA 1O7FA 4R9BA 1TME3 5FP8A 2CYFA 2BGPA 4IE4A 4UF0A 3I3MA 2VVDA 3QQ6A 2XXQA 1E57A 3H7JA 3PHMA 4XFIA 5GAGi 5EYYA 2Q8CA 4D6QA 2VTXJ 1COV1 1SBFA 2DVGA 1YC61 4Q4Y2 1NE6A 1XE7A 2XWJB 4XZUG 4NAMA 4XQ4A 4AQSA 4AVVA 3CL1A 3ZN6A 5HI0A 1VBA3 5BNPC 4FTEA 4XEZA 5FIXA 2JDZA 2JG8A 5C5TA 1QMJA 4IEWA 1AL0G 1VRH2 3NJXA 3PIJA 4K1YA 2BNNA 4LLFA 1WZXA 2XKOA 4NRPA 1K5JA 4OZOA 4YZ3A 2RS32 1VMHA 4IE5A 5DDJ2 4AAXA 3GBGA 5LCWL 3FHIB 5M0TA 1N1TA 2WQ8A 3C7FA 3HN3A 4BQ4A 2DURA 1C5IA 3GHNA 3OQMA 1W6PB 4QGNA 3RWNA 4CCJA 3OBRA 2JE8A 5FMBA 5EJZB 3ZMNA 1W2TA 2J1RA 4GWMA 4N9HA 2E53A 2MEV1 3K4ZA 1UYZA 1PO23 1ND2A 4AHYA 2XHNA 1PX3A 2XBO1 1RUF2 1XSQA 3KVAA 3W9AA 1WMDA 2VNGA 2ICTA 1IG0A 2KPJA 2WNUB 2RS52 3WOGA 4BXSV 5FUPA 3RMXA 1W8FA 3E6DA 2WAOA 3HPNA 5FTTC 4FPOB 3ZDVA 5CG8A 2QQJA 2UWBA 5J98B 3HNBM 1LHOA 1S0JA 2DVDA 4HG6B 3LA7A 5E89A 3VUOA 3ZSEA 4FN3A 2R061 1CIYA 3EYPA 2IXCA 4PLOA 1U5YA 1XB9A 2BU9A 4KBZA 5HXVA 2GP3A 5A7PA 1US2A 3ECQA 4AVBA 5JR7B 5DTRA 1W2NA 2FCVA 4NVPA 5DABA 4HVRA 5AVAA 2H6CA 4RR3A 1A78A 1SCSA 1RMU3 3KD4A 4QDSA 4XXAA 4AGRA 1O3TA 4NIDA 1NY71 1OKQA 2PAEA 1HDKA 4FPHA 1FATA 3LQXA 5GLVA 5JIAA 4C1XA 1QDCA 1LMB3 4XF9A 1I3HA 2W91A 2YROA 5FFOC 5DAPA 1AU7A 3VBFB 2XJTA 5DTMA 2DUQA 1JZ7A 3AB0A 3PIGA 3EBRA 2RVAA 4AEMA 2PHUA 4DRVA 3WG1A 4EROA 3VKMA 3KMHA 4Z07A 3HT1A 5BUVA 1ASJ2 3I49A 4PF5A 2LYRA 4EZ4A 3ZSLA 3GBFA 1RUH3 2C1FA 4GB33 2CTVA 2G9ZA 4OVEA 1QEXA 3E6CC 1TMF3 2GC2A 3JB8A 4WZFA 4QB2A 2DCYA 2VMFA 3FHQA 4IV3A 4JKMA 4JGZA 4V2WA 1Y3TA 3VKOA 3HNYM 1UX7A 4OUEA 4F3JA 1A34A 2EVXA 1OC1A 2W46A 5F5AA 4QX1A 4AVAA 3UGHA 4DEVA 1AF9A 3MF9A 3VBRC 2Y64A 4YSFA 3CKHA 4D7YA 4OYUA 2ZX4A 1KQRA 1W8OA 2A73B 3AP5A 5ACA2 1Y9MA 4H14A 1RZRA 2VOWA 4DMIA 2PUAA 3B69A 4WV8A 4Q0VA 5BNNC 2ZHNA 4DE8A 1BDHA 4K3UA 3H8RA 4LOSA 1O4TA 4E2GA 5A6XA 1ENXA 3TB0A 3AKRA 5F3GA 4ER3A 2AEYA 4H7LA 4BHPA 2D3PA 5FZGA 4Q0UA 4D6RA 1AYM3 4R9AA 2PIJA 3KS7A 4DE9A 2GN7A 3ETQA 4Q4W3 4R8HA 1Z7S2 2BVVA 2XDVA 1DZQA 2YXSA 3PDQA 1C5HA 2EALA 2Q8EA 3SKJE 4WVMA 5DAXA 5IJRA 2IXJA 1LR5A 2AZ5A 3OGJA 5DZFA 3FMYA 1H1IA 4XDQA 2ZGPA 4CU6A 4FPYA 2AR6A 3DCQA 1NX9A 1L7RA 3TOJA 4DXZA 4JQTA 1JYWA 3OBAA 1OOPC 4QX2A 1ULGA 5T5LA 2E6VA 4A3ZA 4AHXA 1NQDA 1D2QA 3V64A 4RQPB 3AMQA 2WT1A 1UY0A 3PLQA 4W6WA 3IDCB 1V00A 4GMP0 5CYYA 3LDBA 4Y24A 2MEZA 3ACIA 5FKCA 1UMIA 3SHRA 1QJU1 5CFCA 3MI8A 3ORJA 4RHV3 2XVGA 3WG2A 3GZDA 5E16A 3DNVB 3J8F2 5J7MA 4QGMA 1UQXA 2Q1FA 4DB5A 1WBLA 2Z2SB 2QZ2A 1MS4A 3N9OA 3R0RA 2OPWA 1ACCA 1NEQA 5F5IA 4BE3A 2Q1ZB 5GALA 1G9BA 1DQ6A 4OHXA 4B3NA 1VR3A 3I3BA 4BOWA 3MLLA 4F7ZA 3BTYA 2BBVA 4QPYA 4XXPA 4I30A 1WMXA 2DFBA 2ETEA 3T4HB 5JOXA 2J7MA 5GZCA 2QFEA 3WHTA 2C5DA 1PK6B 3LEGA 4LBMA 1CQTA 4XJWA 2ZMLA 5E8AA 3D5OA 3HNMA 3MIBA 5BXXA 2X29A 3H50A 1A6CA 3ZFEA 1OQ1A 2KM2A 4HPKA 1OMIA 4GZ9A 4ES9A 3POIA 4CUCA 5DQ0A 1OI6A 4OULA 1GOGA 1XQNA 3AMPA 2VE1A 2LALA 5A70A 2WIIB 2WR9A 1BBT2 4LHKA 3O1RA 2V5DA 1IG3A 1ZM1A 3POGA 4C8DA 3NNLA 2WSUA 1V6NA 4CU7A 1O91A 1OA2A 4AHWA 3WDWA 2XGXA 2DUPA 1LTEA 2WO2A 4XFBA 4AEDB 1NA1B 4QPIC 2I74A 5FPUA 2WZ8A 4BU2A 1N47A 4Q26A 2ZX3A 3KGZA 5FV3A 3DF0A 1B35B 2XVLA 2R042 5FZLA 2PA7A 3E97A 4CCOA 2Q5TA 3TBDA 3WNOA 1W6OA 3ZR5A 3MPBA 3VDDB 2VZQA 2A6VA 1RUNA 4A44A 4NHXA 1S0CA 2V09A 2Q0AA 4QKFA 3VBHC 1QOOA 2GH2A 5JIUA 1AR61 5K9YA 1FX5A 3V0BA 3AXDA 4X4CA 1IC8A 3GXUA 2CAUA 3BOPA 2GALA 4TLGA 3ZFGC 1H2LA 4BIOA 1LOBA 3CLCA 2VR4A 2C9KA 2Q8DA 2XXAA 4PDWB 5FYCA 4AI0A 1RJ8A 2VBPA 2ZEXA 1H6YA 2UWCA 4N53B 1EPWA 4HMZA 5DUVA 4IEYA 2VXJA 4O7XA 3CU7A 4YZ1A 5J3UA 1W8HA 1V9U2 1GQGA 2YC0A 3CHXA 5EHDA 2VTXA 3Q8EA 1ZS4A 2HFZA 2FCUA 1QP0A 3QLQA 2GC3A 4FP3A 3M2MA 1LCLA 1R1A2 1WMFA 3AKQA 2H0BA 3EXUA 3T1LA 3I2HA 1AJKA 2OZ6A 4E4SA 3BI3A 2HINA 1LESA 1XNKA 1DQ0A 2QBXA 3USUB 1REFA 4XUTA 1FT9A 4G4FA 3C2UA 3N7MA 3R1FA 3ZXLA 5JZGA 5JPNB 3I2GA 4JTOA 5CG9A 1W6QA 1UOJA 2P4EA 5JOWA 3ENRA 1D4VB 3MUZ1 3VZJA 2VMHA 3KCXA 1IQDC 2W1WA 1POV0 1UPSA 1RTVA 4FFGA 2CL2A 1TE1B 1UY1A 3RQ0A 2J1AA 2WN2A 1XU1A 3RJ2X 1XBFA 3SCGA 4AQTA 1J83A 4XDPA 3H8XA 2XVKA 2CGNA 3SH5A 1Z78A 4D3WA 2NMNA 4ZONA 4Y4YA 2E26A 2K46A 4HKOA 3LQCA 1RUG1 3M3CA 2WA4A 1PGL2 1U0AA 1XPWA 1H2KA 3BVCA 4FXGB 1MQTB 5FMOL 4JC1A 3I2KA 1J3RA 4CDQB 2XQXA 4CZSA 4JQDA 4W6XA 2JG8C 3K75B 3LSDA 5FZIA 4IEQA 4Z1VA 2XMLA 4RN5A 1W6NB 2PXLA 1QQP2 4M0NA 5L7OA 3HT2A 2ZS6B 1X82A 5FMCA 3WF0A 4LBQA 1NOVA 4HVQA 2EXKA 1W9FA 1JYNA 3L1PA 5HCAA 4PI0A 1HB1A 3CJXA 1BEV2 4IV1A 5J09A 2QQUA 2BFUL 3JZVA 2WT2A 4ZXKA 4CCKA 5CAZA 3M1HA 2HWB1 3LFIA 2W68A 4LK7A
chains in the Genus database with same CATH topology
1S0GA 1OFSA 1SQ4A 1VBD2 5T55A 4C0HA 1LHUA 4IEVA 4FT8A 5T54A 5BNOA 2PFWA 1ZBA1 1ZBE3 2ET1A 3QH6A 2PPXA 4MCTA 4WM8A 1LOAA 1WLDA 2ZHLA 3WCSA 4ASMB 1KXGA 5LK7B 4N43C 2HWF3 4WVWA 1VBE2 2Y0IA 5SV5A 2R0HA 3J26N 2A70A 5K7PA 4FVVA 4IETA 5JOYA 3V0AA 1FPN2 3M4FA 5I91A 4M0HA 3VBOB 2A71A 5GM0A 1RUOA 4RR3C 2EAAA 4FTBA 3VBUA 2ZAAA 4I0WB 4XMAA 3WCRA 1QOSA 4YVSC 1ZYBA 1RJ7A 4JCYA 1OSGA 4L99A 1V6MA 4M3CA 2WLQA 3ZYPA 3WHUA 2XJ3A 1JYCA 4LBLA 2SLIA 3LFPA 2VU9A 2ZA9A 3JD71 4QM8A 2O4AA 4XTPA 1GKBA 5E1RA 4LEJA 4YBAA 2CGOA 4IV3C 4YGBA 3WINE 1RC6A 4JGZC 4Y22B 3QYXA 1K5MA 1WD4A 1FMD2 1QJZA 2WNVA 4CEYA 1G8WA 4N90A 2XLFA 3RJRA 1PIV1 1ND3C 2X5IA 4PBOA 3BTAA 4LHLA 3QD6A 1CAUA 1TNFA 2RMU1 3CJIB 1NXD1 2A6CA 3RSJA 1KRIA 2PTMA 2VVEA 3WW2A 2D97A 4COVA 1Y9QA 4QPGC 2ZPXA 4S2HA 4Y1ZA 3B9CA 4IWRA 3TRBA 2A6WA 3WP4A 4Y20B 2EWTA 1ZRRA 1YSEA 4R52A 4I6UA 1HXS3 1HRV1 1COV3 3NWKA 3QCWA 4YM3A 2WSVA 5AC92 1JN2P 2XUMA 3WZ1A 2WFF1 2ES3A 4MGKE 1PVC1 4X4HA 2ZAHA 2MQKA 3D0SA 3ILRA 2IXIA 2VECA 5FMOS 5I93A 5EV7A 4LBNA 3AMNA 4C1WA 4F83A 4YFZA 2DV9A 3HIFA 4HKWA 5CFCC 3LZZA 4WVZA 3IVPA 2GNDA 4MCXA 1RUD2 1EPZA 3WR0A 2W39A 1J58A 2QKDA 2OFYA 2UYAA 2BFUS 1RUJ1 1TME2 1H8TA 2MEV3 5ABJA 1ADRA 1I1EA 1C3HA 3ZHIA 4B8EA 2EIGA 2Y38A 1IOAA 3CO2A 3MYXA 3TRSB 2ZGOA 4PIZA 5K0UB 2P3KA 3MW4A 5LRRA 1VBA2 1QJY1 1GZ9A 2G9GA 2P34A 2PLV1 3Q9OA 5IK4A 1M4WA 3NKTA 3R4DB 4Z82A 2R063 3SMHA 4NDWA 3ES4A 5FREA 1X8EA 4TWTA 4PBPA 3AP7A 5T52A 4BOWA 4EN7B 1DLLA 1IZ3A 3JBG1 1V6OA 1H2NA 3LISA 1XE8A 1O3QA 1OSLA 1Z0HA 4XF1A 4OI0A 3I8TA 1AR81 1SLCA 2JE7A 2DF7A 4ES8A 2Z69A 1QXRA 3DPRB 5BY5A 3CNAA 3BOWA 3ZYRA 2Z79A 2DCZA 2UWAA 4LA3A 4TYSA 1F8VA 3I59B 1Y43B 2VUJA 1JUHA 2WS91 3VLBB 3S8QA 2JKBA 1SACA 3KZ4C 1S2KA 1DGWA 1I9RA 3KLSA 4HBNA 3HR9A 3AP9A 5JWPA 1VRH1 3KQRA 4X6RB 2RS31 1A8MA 1OA4A 1RUC1 1EY2A 1BKZA 1YUDA 4AI8A 1GZWB 1RMU2 1EAH1 3POYA 2AWIA 2YYOA 1LEDA 2RJLA 3A0NA 1HKDA 3QF3A 5I8YA 1NXMA 1XNBA 5GZDA 4Q27A 1RUF1 5D1IA 1UIJA 2KEKA 4WM7B 4QU2A 1PVXA 5JZGC 2RS51 3NJZA 1W6PA 1PNFA 4GB32 4B4QA 4CDXA 1YO8A 5J36A 3MIFA 1VAKA 2TUNA 3QACA 3SH4A 4AHZA 1ZRCA 1VP6A 5F9TA 1BQPA 4YM0A 2D5VA 2VULA 4Y1XA 5CFDC 3D1NI 2O8OA 2VUAA 3IN9A 4XHXA 4YM2A 1ZUGA 3UFDA 2AH2A 5H9QA 5EWSA 3VGIA 3LA2A 1PRUA 4XILA 2EAKA 3RYPA 3ST7A 3PJYA 3IDEA 4YGDA 3ZFFC 4CDUA 3AKTA 1DQ4A 3IPVB 4NHLA 3JB4C 2WL1A 4YG7B 1QJU3 1W2UA 3AFKA 3PMSA 1E3OC 5I8SA 4R4ZA 2JXAA 1BJQA 5L7OC 5HBAA 4YW5A 1AYM2 1U12A 1KITA 4Q4W2 5HCBA 1MS1A 2EXJA 4Z5CA 4ZU5A 2VOXA 4EWEA 3UV9A 5BNPB 1C28A 1GYKA 1SFNA 4FPFA 2DFCA 3B01A 1RUE1 2NP0A 3F52A 2QZ3A 3VBFA 1G9DA 4X4DA 4B29A 3DL3A 1HLCA 2BWAA 3UJQA 3ZPYA 2YDEA 5BNOC 5ACA1 1HQLA 2PAKA 2IV1A 4WM8C 5FQ0B 3LOBA 1GV9A 2QDRA 4XFHA 1UXDA 3FUQA 4P9JA 4R9CA 1HV0A 4P5HA 5EZWA 4TZDA 4A3XA 1UF2C 4RHV2 4OFGA 2MPFA 3AMMA 4NHKA 1NLRA 5BV6A 3VKLA 5I0SA 2R63A 1GSLA 1AX2A 2ZX1A 4OHWA 3VBUC 3AYEA 4RA0A 4NWVA 2UY9A 2ILMA 1QH6A 1QXPA 5FLJA 2HWC1 1VIWB 1DYKA 1XXNA 1VB2A 4I0BA 1BVP1 2E7TA 2GRMA 2XH6A 1T6GC 2HWD1 1AR63 1H1MA 5GLTA 3AFGA 1YWKA 3CEWA 4FPEA 4AF9A 3KSCA 4M3CF 1XYNA 4XIOA 1CQ9A 4AGVA 4A7KA 3ZXDA 1UW8A 2NPIA 1N1VA 4FP2A 4KG0A 3KJXA 4YNIA 1K5MC 3JQWA 1IPJA 2IVBA 2WNVC 4GIQA 1UX6A 1DU3D 4Q8LA 1DQ2A 3S7EA 1X2LA 4OUSA 4JQRA 1TQ5A 4C0BA 1O4XA 2XLGA 3AZWA 3N36A 4O9GA 2VQAA 4XW3A 2OVUA 3VBRB 2CROA 1YNAA 3UKTA 1HW5A 1WLTA 5T3NA 2ZJCA 1MS3A 3TN91 4IXLA 5BNNB 4LE4A 1PGSA 1UL9A 1HQNA 3FYAA 1XNDA 4WZCA 3NV3A 4XFBA 3PJQA 3A4UA 4NHMA 2DTYA 1JHNA 4LNVA 4ASLA 1DG6A 2P2KA 5D8AB 4BH9A 1RINA 4AGGA 2IXLA 1ULDA 4YYOA 2FMDA 1FNYA 1QKQA 1RUG3 1CESA 4K8FA 1BMV1 3RS6A 1H8VA 5E88A 2ZGTA 2XKPA 4LHNA 3IMNA 4IA8A 4GMP1 4PU3C 4RD7A 2GNMA 3MLFA 1VAMA 4AVCA 4JDMA 4LO5B 4XFCA 3RNSA 4JVAA 3N7KA 4S2GA 1OOPB 1JW6A 4XJ9A 3H5TA 4LA2A 4PLMA 3ZIWA 1WETA 2WT0A 2C9AA 1QJX1 4N7IA 3EUSA 1EV11 4HKLA 3KT7A 3U10A 1AYN2 1H8TC 2UY8A 5ABJC 4S2DA 4I09A 3OD0A 1PRAA 2ZCWA 2BUKA 1AHSA 2BW8A 1ZBA3 2PHLA 1PO11 2YY1A 2PHTA 5KWRA 2A3WA 1HQWA 1GBGA 3RRDA 1SLTA 1S2BA 3H0OA 2CY6A 4PDWA 2IU7A 1GZCA 4N53A 3MIHA 4Q4V1 4YVWC 1RUI2 2C0ZA 1HRI2 4MXWB 2Q30A 5JDBA 1AXZA 2WLPA 4AEKA 1UU6A 2V5YA 2ZMKA 1ZA4A 5EJ3A 4JRLA 3USUA 1NLSA 1O3SA 4G3YC 5FOBB 4J1WA 5JPMB 3FBMA 2K9ZA 2R1JL 4JDOA 4OUMA 1PGL1 4QPIB 2ARBA 3JD73 3M7AA 5GZEA 1MZEA 3UKNA 2PE5A 2XL7A 2IXHA 5KHIA 1C8M2 2FMYA 3S0MA 5KHGA 2HWF2 4BLIA 1ZZCA 4AEJA 3B00A 3WW4A 1S0IA 1UMZA 3FJSA 1YIFA 4JGYA 3BALA 2DUOA 2RHPA 2OUJA 5GLWA 4FPCA 3JXBC 4L92A 4U36A 1GANA 2B46X 3DUIA 3KB5A 1MQTA 3GALA 3ZFGB 4AI2A 1A8DA 1PIV3 1VBB1 4PLNA 4D7SA 4MH0E 2A6XA 3CLPA 1S1AA 4HANA 1VBD1 1WH8A 1S7EA 1UIKA 2RMU3 4PU8A 3ZIXA 4YZ4A 3VN4A 5IK5A 1ULFA 1QGLA 5JVVA 4XJAA 3S30A 4CDXC 4AW7A 1RB8G 4M00A 2UURA 1AL23 3BS3A 1LOGA 4HLTA 3KCYA 4AQ6A 1NG0A 1BK1A 1VBE1 4KU7A 1CAWB 5A32B 1HRV3 1FPN1 1LLIA 1X50A 5DG2A 1O3RA 1AR91 3WDUA 5GKAC 3AYCA 2LTNA 4CDUC 5I0UA 3K51A 3ZXEA 4K40A 4LLOA 1LU2A 2B39A 1CX4A 2ZTNA 4CTEA 3H9AA 3HBZA 3GZAA 3VBOA 1CJDA 1EYBA 4DOUA 5F1RA 2IFRA 4KG8A 1S0BA 3DN7A 3ZN6B 2W52A 2LYSA 2HWE1 2JG8B 4NR1A 1U5ZA 3NAPC 4Q0SA 4YZ2A 5C8WA 1MACA 1HXS2 1FV3A 1OLRA 3RG0A 2XJPA 1BYHA 1DZTA 1COV2 5GZGA 1DQ5A 3FWEA 1RVF1 3WP5A 3B9IA 3AZYA 1R091 1F2NA 1QJY3 1WD3A 2PLV3 1ZX5A 5T50A 3QBQA 5C8CA 3WQ1A 4FPLA 2ZOEB 3T2TA 4M01A 3V56A 1CPNA 3IT8A 3RI9A 4Y22A 3JBG3 1PHMA 4PJYA 4X4IA 3J9SA 5JLVA 1S0EA 4N43B 1C57A 2YV8A 1AR83 4EJRA 2MEV2 3WNXA 1WH6A 4YG4A 3ZN5A 3I7DA 5EYXA 1XYOA 3WDTA 1NZCA 1VBC2 2RR12 3VBSC 3VHOA 3VL8A 4DS0A 1JXNA 1JH5A 3G7DA 4X4FA 3CJIA 3H3ZA 2JG9A 5T5PA 4RR3B 1WW6A 2FZ2A 4I6RA 3M3IA 1X57A 2P17A 1LOEA 3B7MA 4JDNA 4YVSB 2H6BA 2WS93 2X53S 3D4KA 1CONA 1YYNA 3PVOA 2VW0A 1O4ZA 2D40A 1U5IA 3MIDA 1VRH3 2R062 1CJGA 2E63A 2DCJA 2HYKA 3IM0A 3OY8B 1CAVB 1RUC3 1DGRA 3OPZA 1UN1A 3ZSEA 1TNRA 1RUD1 3GZUC 2QUOA 2I07B 3N7JA 3O0VA 5DUUA 1EAH3 2NN8A 1IGOA 2PHXA 4GKYA 4INDA 4RFT0 3WD5A 4BMBA 5CNAA 1RUF3 2K2SA 4IV3B 4Z59A 4JGZB 2A6ZA 5FAXA 4CDWA 1D4M1 1NCRB 2R49A 1YIPA 4QT6A 1R1ZA 2D98A 2NYYA 4HT1T 4SBVA 3SXWA 1AR71 3FFZA 3VHPA 1ND3B 1QNYA 3O9XA 4QXKA 3MLJA 4CEWC 3BCWA 3TAYA 2WKKA 1IS6A 2D93A 1H9PA 4XE9A 4LUMA 3GYDA 5K0UA 3ZSMA 5KC6A 1J3QA 2ZX0A 4QPGB 1G6NA 4BPZA 4Q29A 1GNZA 4LO8A 1ND2C 1GQHA 3WDYA 1JBCA 4NWWA 3AKSA 3FE5A 1ONAA 3AYDA 1RHI1 1SCRA 5IK8A 2D5FA 2ZKLA 1W39A 1KDMA 1FAYA 3LAGA 4COYA 1SLBA 4PU7A 2NM1A 3VHNA 2QVSB 1YLLA 5KHHA 4PU4C 4P9WA 1RUE3 2O0OA 2XWBB 3DPRA 3O14A 1A3KA 5CFCB 4MSVA 5GLUA 1OLQA 4AI3A 4UW4A 5GJ6A 4LR4A 1RMU1 4FOQA 5DUXA 2VQ0A 3H8UA 1SLAA 5FPZA 4BWOA 4FO9A 4EN8B 3AXEA