1ZZBA

Crystal structure of coii hppe in complex with substrate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
total genus 42
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zzbA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zzbA02
3M70A 4OFGA 1UPIA 2B5AA 4ORFA 4PU8A 4IEOA 3BS3A 1LR5A 5A7LA 2CV6A 2ZKLA 4IETA 4MCXA 4L2NA 3KZ3A 2Q4SA 4Q0VA 4IEZA 1SFNA 4X4EA 3FZ3A 4AQ2A 4EWDA 4I09A 4QXKA 2AXVA 2IUOA 4GHJA 3ES1A 4XFHA 2I45A 5BV6A 1OMIA 5JSOA 4MX3A 4KWLA 3BCWA 3BB6A 4Q0SA 3TNPB 4YSFA 2GZUA 3NSTA 2AW6A 1L3JA 1XRUA 1ZS4A 4HVQA 3TRBA 4E2SA 2O4AA 1J3QA 2IVQA 4JQDA 5KHGA 2O38A 4Q0UA 2Q30A 2EA7A 4Z07A 4N9HA 4E2GA 2H6BA 1SQ8A 1BDHA 4QGMA 4CYDA 1TQ5A 2D5VA 3VK0A 4JVAA 2QVSB 4Z82A 1AU7A 3QF3A 1ZPQA 1E3OC 3VHRA 2IXIA 4MUVA 1PRUA 4AVCA 3CLPA 2ICTA 1X57A 1RL3A 3MPBA 4Q29A 2PQQA 5J7MA 1YLLA 1XE8A 1ZUGA 3OGJA 1O4TA 3QYXA 2XHKA 1RZRD 4I0BA 5BXXA 3FJSA 2K0GA 1OSLA 4XF0A 4XETA 1UCXA 3H3UA 4HSLA 3KCCA 2ATFA 4IEYA 5I0UA 5LEKA 4O9EA 2P17A 3FE5A 4LA3A 4AXOA 1J3RA 4I6RA 4XF1A 1IPJA 1WLTA 3D1NI 2CAUA 1Y7YA 3G5GA 1O5LA 5BPXA 3RYKA 3BDNA 2UY9A 4WZCA 2PAEA 4EROA 2GZWA 3E97A 2CSFA 3LISA 4KL1A 1SQ4A 2XI8A 2O8QA 1RGSA 2PIJA 3CL1A 4LULA 5KBFA 3WW3A 2PUAA 3E6CC 5KHHA 1NYWA 2KEJA 2UY8A 2GC2A 2MHFA 2H6CA 1FT9A 2BGCA 1ZZ6A 1ZAYA 2ETEA 1CAUB 5J3UA 5FQ0B 4WBBA 2BEOA 2LYKA 5LRRA 4YRDA 3D0JA 3NJZA 3CROL 4DINB 3S0MA 5FCCA 3RYRA 1JWLA 5BY5A 4AQ6A 2R63A 1VPWA 1EYBA 1CAWA 4XFCA 2LYLA 2ET1A 4Q0PA 5FPXA 3IBMA 2EWTA 3RYPA 1PM7A 5FLIA 3B7HA 2MPFA 3HT1A 5I93A 1G6NA 4Y42A 2WIUB 4XF9A 2WC2A 4MH0E 2EF8A 1QP0A 2Q0AA 3DKWA 1ZNPA 2XLAA 3ES4A 3LOIA 3KXAA 3PXPA 3ZHIA 1QPZA 1XE7A 3RPQA 2IVBA 5K8SA 2FJRA 2CGPA 3KMHA 1WA4A 1YWKA 3O14A 1UXDA 4FBFA 1O3TA 1CAXA 3PNAA 2WFPA 2IXLA 4RD7A 4XFFA 3ETQA 4HZFA 1WETA 1JFSA 2PUGA 3CLCA 4X4BA 2GAUA 1YFXA 4YNIA 3NKTA 3EO6A 3BD1A 1CJGA 1CX4A 4KU7A 2PUDA 4IEPA 5EFUA 5HI0A 1DW9A 2OA2A 1RC6A 4JTNA 1YHFA 3OQMA 2ET7A 3BU7A 2IU7A 2PHLA 4I01A 2XL9A 1L1MA 2JCGA 3GBFA 2Z69A 1I6XA 3JXCL 5KHIA 1WIZA 5E1RA 5LEJA 4ZU4A 4N9IA 3H1YA 4HVRA 4UBGA 2EBYA 3IIAA 1HW5A 4FBIA 1IC8A 1O4XA 3BPZA 3U0ZA 1VR3A 2GU9A 2OPKA 3RNSA 4D7SA 4GQMA 3LAGA 3ELNA 2Y0OA 5I8YA 3UKTA 5JCTA 2E9QA 3HZIB 1J58A 1LRHA 5T3NA 4FAGA 4AVBA 4I02A 2D5HA 1CAXB 1DWKA 3H3ZA 4I0AA 3OQOA 4A2UA 1RZSA 2Q1ZB 1ZREA 5JSRA 4LEJA 1UTXA 3D0SA 4ZU7A 1V70A 2LYPA 4X6QB 3H5TA 5C8WA 1UIJA 4X4GA 1OI6A 5FPZA 1X8MA 2PFWA 4ZU5A 3E6DA 3S7EA 1O3QA 1SEFA 2MNGA 5KHJA 1J3PA 1YFYA 1UW8A 3EUSA 4E2QA 4MGIE 5E16A 1POUA 2IV1A 2R1JL 3BALA 1FXZA 4HN0A 4FAHA 1JUHA 2H0VA 4JCYA 5JAXA 5F1RA 1QQAA 4KWJA 1GQGA 4ONUA 4PIZA 1ZVFA 5CVRA 1LLIA 1Q3EA 4PU7A 2PE5A 1CAUA 3OQNA 4QMAA 5BUVA 1CQTA 1QY4A 2IC1A 3H1WA 5C6CA 1X2LA 5I8TA 2GC3A 3H7YA 3QACA 3IWZA 4X4CA 3DL3A 5I8SA 3JZVA 1ZZBA 2OZ6A 2QJVA 2XLFA 3MZHA 3L2HA 3CO2A 2GRLA 1EY2A 2LCVA 2VQAA 4IWRA 4D7TA 2MEZA 2PTMA 4XFGA 2IXHA 3PVBB 3OF1A 1EPZA 2PUEA 1Y3TA 5JSPA 4F8AA 3PLQA 2PUFA 5KHKA 1CAVA 4I6UA 3O9XA 1NZCA 1Q5OA 3FMYA 1VP6A 3DV8A 3LWCA 1UD1A 3ACLA 3CJXA 3U11A 3SXWA 1DZTA 5I0SA 1EFAA 1NXMA 1QQBA 3LA7A 1X82A 3H1MA 4XF3A 1IPKA 4IEUA 3F51A 3KJXA 1ZZCA 1UXCA 1OCTC 2FMYA 5FLHA 2L8NA 5I91A 5EZWA 2BNMA 4Z5HA 3F52A 1I5ZA 4AVAA 1LKNA 1ZRDA 4Z58A 5FLJA 5I0RA 2JVLA 3E6BA 1Y9QA 1WH6A 1HF0A 4JCXA 1LQCA 4HMZA 1ZX5A 2CAVA 1X7NA 5K98B 1ZZ7A 3FWEA 2XSDC 2XKPA 3ZHMA 2O49A 2OZJA 4IEWA 1OD5A 4QGLA 4BHPA 2QNKA 2XLGA 4GULA 4IESA 3EQEA 4WVZA 3SCHA 2MQKA 2HJIA 2OYZA 3ST7A 3MLFA 3FYAA 2B5HA 3HQXA 4IERA 4YYOA 1EP0A 3UKNA 4I2OA 2GC1A 3L1PA 4BIFA 1NE6A 2FQPA 1ZVVA 2ZCWA 4L11A 4PJYA 4I3PA 1Q43A 2V09A 3TNQA 4XEZA 3OP9A 2GRMA 3F6WA 3NW4A 3R6SA 3SHRA 1ZRCA 2PAKA 4O9GA 1LMB3 4X4IA 2D93A 3H50A 3HIFA 1PNRA 3OMTA 4Z5CA 3EJKA 3S7IA 2PUCA 4QGNA 4XFIA 4OB4A 1CGPA 3NL1A 3U10A 4H7LA 4HVOA 3QQ6A 4BH9A 1QP4A 1NERA 1B0NA 3E5UA 4IEQA 3ZDSA 2DCTA 3H7JA 3RDIA 4YG7B 2EVXA 2Z2SB 1CAVB 1WGPA 1WH8A 2XIUA 4FN3A 2UYBA 2PA7A 2XL7A 4FT8A 4K8FA 1DZRA 1R63A 1JFTA 3MDPA 2OFYA 1UIKA 2HSGA 3DNVB 3E5QA 1H1MA 4LUKA 3EBRA 5JR7B 3E5XA 3FYMA 4NVPA 3ROUA 3FFQA 4KWKA 1PRAA 1X8EA 3I54A 3IDCB 2C0ZA 2BJCA 4I6TA 3LA3A 2ICPA 4QM8A 2L49A 3GN5A 3KGZA 1GQHA 1R69A 3U3WA 2LYQA 1YUDA 4MGYE 4HN1A 1J59A 2HINA 4R52A 4J1XA 2LYJA 2AXZA 2BNOA 4LLOA 3M3IA 3USSA 1O3RA 3JXBC 2IXJA 5D1IA 4EWEA 1ZRRA 4B29A 1JH9A 4X6RB 3OD0A 2IXCA 3KSCA 2D5FA 3MYXA 1PMIA 3OCPA 1LCDA 2PHDA 1RTVA 4IA8A 4EV0A 3DN7A 4EWAA 2WUSR 2F4PA 3CEWA 4QM9A 4PU3C 2LYRA 4I8TA 4LA2A 1RZRA 1RIOA 2PAMA 4YARA 3KGLA 5FDBA 3LA2A 1QXJA 4MGKE 4XF4A 3WW4A 4R8HA 4HLTA 4MGZE 4O8BA 4TLFA 1NE4A 1ZZ8A 1GT0C 5CADA 2KEKA 2GH2A 2KZ8A 2AXUA 4NDWA 4UXAA 2XGXA 5J48A 1YSEA 2QDRA 5AVPA 2UYAA 2VPVA 3HT2A 2B8MA 4X4FA 2PPXA 2BYVE 3LFPA 3IDBB 2CROA 2XCJA 3JXDL 2OR1L 5I0TA 1H1IA 2GC0A 2EAAA 3GN5B 1YFWA 3WW2A 1XWRA 4X4HA 1YFUA 3WW1A 1RPEL 1DGWA 2BNNA 3D82A 4IVZA 3H9AA 4P9GA 4KU8A 1QP7A 1ZRFA 4MZUA 4Z5DA 3QOPA 4HSJA 1RUNA 1ZZ9A 2LYSA 3SCGA 4J1WA 2PUBA 1LCCA 3GYDA 3FX3A 3CECA 2IXKA 4JV4A 4OLLA 4MCTA 3SCFA 3B02A 1O7FA 4IEXA 1LB2A 2AUWA 1OFNA 1NEQA 4F7ZA 2VECA 3OTFA 2KXLA 1RUOA 2B9UA 2XKOA 1U12A 3EHKA 3UFDA 2PYTA 3LZZA 1O5UA 3NVCA 2HKXA 1O3SA 1J1LA 2IVGA 4QX5A 2H8RA 4Z59A 3IVPA 3UKVA 2O1QA 4YBAA 3SMHA 4IEVA 1PRVA 1ADRA 2XJ3A 4F8DA 1QXRA 2N7GA 4XFBA 2AWIA 2D40A 2QCSB 2A6CA 1PERL 3I7DA 3C3VA 4META 4YG1A 1QWRA 2KEIA 1VJ2A 1DGRA 5FQ0A 4HBNA 4LTAA 3QWGA 4PIXA 4XFAA 2KPJA 3S8QA 4UBHA 3G7DA 5LRSA 4LUMA 3ZKCA 3I59B 3I59A 1S7EA 1CAWB 3N4MA 2K9ZA 4JTOA 4PIYA 3R1FA 3H8UA 1FI2A 3RZZA 4X4DA 4BYYA 4MV2A 3FHIB 4Q0QA 4PU4C 3CF6E 1BDIA 4YG4A 5CU1A
chains in the Genus database with same CATH superfamily
1W04A 4Z1VA 4LKSA 3O0XA 4OFGA 4URTA 2MEV2 2FMDA 4PU8A 4M3CB 3BS3A 1CVNA 5C71A 4ER0A 5DUUA 5L9BA 4MCXA 3TN93 5A6XA 3FZ3A 1W28A 5GLVA 1VMHA 4QXKA 1W6QA 1OF4A 3MI8A 4DOUA 4E27A 2IUOA 1VBE1 1XNDA 2JKBA 3M2MA 4Q8KA 3ZMOA 5JZGC 2Y8KA 2I45A 1OMIA 2C5DA 4M4PA 4AEJA 2W0XA 4Q0SA 3W20A 4COZA 1HN1A 3MLKA 3KVBA 3SX0A 3LDKA 4QPGC 3WOGA 4EN9B 2P6CA 4EK9A 1SCSA 2O4AA 2VUAA 3LEMA 1UN1A 2GP5A 2O38A 1AYM2 4QQHA 1PZ9A 4Q0UA 3IAPA 4CEYC 1HB2A 2EA7A 3LFMA 2VZQA 3UYJA 4JGZB 3EMRA 1HV0A 5IK4A 1W90A 4CYDA 4XCAA 1TQ5A 2AC1A 4Y26A 2D5VA 5C33A 4JKKA 4QAWA 3ZSKA 1SMVA 5FYUA 4Z82A 1CPMA 5A3TA 4I0WB 1HB3A 2RJ2A 4CP1A 1OA3A 1OURA 2X5IC 4SLIA 3MV01 3KT4A 4IE0A 4K40A 3NJXA 3HNYM 5F6KA 1W8HA 3I3BA 4WVWA 3MF9A 4FTBA 3E1F1 3MPBA 4OMDA 1ND2A 1XE8A 2ZGKA 1ZUGA 5HV4A 4LO8A 1SZBA 1LHVA 4Y1ZA 2WQ8A 3ZYRA 1VBD3 4CUBA 1HXS1 2XHKA 4I0BA 4XIOA 1RUJ1 3WINE 1JN2P 1AJOA 1GQPA 4A4AA 2C26A 4YG6A 3C7HA 4RFRB 1H9WA 2JG9B 1UCXA 4XF0A 4LBOA 4XETA 2ATFA 1PGW2 1WZXA 2A6YA 4QU2A 2RM21 5LEKA 2P17A 3FFZA 3FE5A 1AX0A 4CDXC 4LA3A 4AXOA 4CCEA 1QJEA 1IS4A 1J3RA 1KS5A 4Q4V3 3KZ4C 2Y38A 4CPBA 4UYBA 1FYUA 2XQRA 3KB5A 4YVSA 4Q2FA 5F3GA 3JBG1 1SDWA 5CFDB 4QKFA 5DDJ1 2PAEA 1H6YA 1SBEA 3U4SA 4EROA 2GZWA 4B1MA 2ZMLA 5GZDA 2XI8A 3WP3A 3WW3A 5CISA 1QNYA 1SBDA 4DUWA 2VXJA 1VPHA 1VE0A 3DXTA 5FPUA 1GLHA 1RUC3 2GC2A 1FT9A 2ETEA 1CAUB 1JYIA 3DPRC 5FQ0B 2BEOA 4NMIA 1R1A2 3BYWA 3I2DA 4LPLA 4QQPA 2WKKA 4B1LA 2W08A 1S0BA 3NMBA 3LKJA 3GZCA 5GALA 3BIWE 3GDBA 5CG9A 3URFA 3IPVA 2R63A 3NWKA 5LASA 1G9FA 4XFCA 4HONA 3T1MA 4BJ0A 4ZS3A 2P3KA 1YRZA 1QJU3 3OBRA 2BU9A 3POYA 2FZ1A 4ATFA 3A9ZA 2WYFA 2VBBA 3KT7A 4Y3OA 1OLRA 2QQVA 5DUWA 2BERA 4Y20B 1KQRA 1YIPA 2ZA9A 4WVLA 1GICA 3KD4A 1RUI2 2RG4A 1FATA 4FCAA 3RFRA 1CESA 2C9KA 3U37A 4B7KA 1JYNA 3DKWA 2ES3A 4U2AA 3WDXA 1OQDA 3ES4A 1R083 1RYYA 2XXQA 2GALA 2Y6JA 1QNWA 1XE7A 2VZUA 2IVBA 2I07B 4LHSA 1W8WA 2K2SA 3KMHA 4ER3A 3F95A 1W0OA 2RS52 4AYUA 2NYYA 5CEHA 3O14A 1W6MA 1O3TA 1SFPA 1ULDA 1VBD1 1X36A 3MEPA 4GIQA 3ZSMA 5CFDA 3VBUC 4ATEA 2ZMKA 2PUGA 1RUF2 3VBUB 2YB7A 4X4BA 4LKDA 4LO7A 2GAUA 1YFXA 5FXVA 1HQ1A 2VCBA 3NKTA 4R9CA 5FYVA 2R7EB 4PQQA 3GGLA 1ODNA 5EFUA 4RR3C 1DW9A 1HRI3 5A33A 1W99A 3HJRA 3OQMA 3AFKA 4I01A 2PHLA 2WIIB 5A32A 4OYUA 2YGLA 4P5HA 5KHIA 2HH9A 1JU4A 1MS4A 2WL1A 4JGYB 3SKVA 1ULPA 2CYFA 2JE8A 5JMOA 3JQXA 4HVRA 3PU3A 4UBGA 1Q8VA 2LROA 3SITA 1MZFA 2VH9A 3G6JB 3IIAA 5FBZA 3ZFFC 1JZ8A 3TEZA 2XJSA 1HW5A 2O0OA 3BPZA 2HEWF 4RQPB 4ASMB 5A6YA 3B5LB 3JBG3 4QHBA 5HCAA 2QQOA 2P2KA 2Y0OA 3VZLA 2XJUA 1W9YA 3PIJA 2VQTA 4IGOA 1RINA 5IVVA 4OZXA 4QPIA 1R1A1 3JB4C 2BBVA 3LF7A 1CAXB 5A7SA 3WQBA 3WCRA 4D3WA 3UK9A 1NCRB 1RZSA 2Q1ZB 5F6LB 3PJYA 5M0TA 4LEJA 1UTXA 4NHXA 3GZTB 4WVMA 3AP4A 3BUCA 3V65A 3D0SA 4EN7B 1UU4A 4GALA 5A7PA 1QJU2 2BW8A 3H5TA 4X6QB 4OI0A 1UIJA 1OSGA 5T5PA 1W2UA 4O65A 5KHJA 1RUE2 2AR6A 5C3SA 4E2QA 1IS6A 4MGIE 2R1JL 1BEV1 1Z7S2 2R073 2D6KA 1WW6A 4NE9A 1QOSA 4JCYA 4BIOA 4QKBA 5J98B 4EN0A 1QDOA 3NJYA 3DYPA 5LY1A 5A80A 1DFQA 2OUJA 2UWAA 4LJHA 4ER5A 2GNBA 3I3QA 4UF0B 3OYWB 2FDIA 2ZGTA 3U78A 4XBLA 1LLIA 3FLRA 1MQTC 2ZKNA 4CP9A 1GUIA 5A3LA 5C7GA 3OQNA 2DWRA 2R062 4DB5A 1CQTA 2BGOA 1X2LA 1QXPA 1FX5A 2EIEA 2CGOA 2H0BA 2JJ6A 3IWZA 3L2YA 3QACA 4CDUA 4KBZA 1RUF3 1W8OA 3MZHA 4MGTA 3OBTA 1URXA 3CO2A 5FAXA 2MEV3 2WZR2 3AMHA 5JDBA 2YU1A 2VQAA 2OS2A 1RUI1 2YY1A 3WF1A 3VDDA 2PTMA 5FRAA 1PK6C 2CGNA 2J7MA 2PUEA 1Y3TA 3BN6A 3WG1A 3FL7A 2ZEWA 3JXSA 5L9RA 5JSPA 1VBC2 2BPA2 1UOBA 4I6UA 1DHKB 1GNYA 4Y1YA 1Q5OA 4EQVA 4QPIB 4EQZA 4DXZA 3TEXA 3ACLA 2HWE1 3DPRB 3U11A 1JW6A 4IGPA 1NXMA 1AYM1 4B8EA 5CBLA 1Y7BA 5JXGA 4MVTA 2A6VA 4ZONA 1LAJA 3DCQA 2BP6A 2W46A 3MBWA 1HV1A 3CU7A 2P37A 2L8NA 1W6PA 2XMLA 3GZEA 4AEDB 2JD9A 3RMYA 3WDTA 2BNMA 5HBAA 2EF6A 4LHLA 2G1MA 4AVAA 2B4KA 2FBEA 3DYMA 2HBTA 3LD8A 3H42B 3BI3A 3SR4A 3MIHA 5E6HA 4W50A 5K0UB 1ZZ7A 3FWEA 4P9YA 2XSDC 1Z7S3 4C1WA 2O49A 2O8OA 2OZJA 4IEWA 4QGLA 3ZSEA 3T08A 2LNMA 1U5IA 2QNKA 2WO1A 3CJIB 4GJYA 4IESA 4EN6B 1RJ7A 2OYZA 4BZ4A 3MLFA 1NQDA 4RGKA 5FZOA 3HQXA 4TYSA 5C9AA 2VZ3A 4IERA 1BCXA 1EP0A 4JDMA 3UKNA 2R063 3B93A 3TEWA 2ZCWA 2CSGA 4GH4A 1L7LA 4TLGA 1JYWA 4ZKTB 4FTSA 3NW4A 1Q8PA 2RR13 1OOPC 2A3WA 3VBOB 4X4IA 5KC6A 1PNRA 2CNAA 5EJZB 4P9IA 2DFCA 3AJZA 2ZGNA 1VRH1 3NL1A 3GUUA 4XQ4A 2BVBA 4R9DA 3K77A 4QX0A 2RS33 2WZR1 4FPYA 4K7JA 1H8TA 2ZGQA 2AENA 4AF9A 2ZZQA 5LZ6A 5EIYB 2NPIA 1NOVA 3WG2A 2D6OX 1B0NA 5DRTA 3AYDA 3DPRA 5FZ6A 5A7NA 4ES9A 3RDIA 5ACA1 5J36A 1WCKA 1JOJA 2HWF2 1RUC2 3ASIA 4Q5OA 3T2PA 5BNPA 3NZLA 3AXDA 3LQXA 1DZRA 4DEQA 1AF9A 4P9JA 1D2SA 3ZO0B 4YLZA 2HSGA 1WCUA 1RUI3 2NMNA 3PUQA 5C5TA 3FYMA 4NVPA 3A23A 3ROUA 1XNCA 1PRAA 1JTZX 1X8EA 3I54A 3PUIA 2BJCA 1W2AX 3LA3A 3NV3A 2CU5A 2PHWA 4QHOA 2L49A 4FFIA 2IFWA 3GN5A 4MG2A 3ORJA 4XILA 2WNUB 2RM23 2RS53 3OOXA 4UAPA 1NA1B 4L8QA 2B45X 2J1RA 3HBKA 1JUIA 1DYPA 2PXKA 4P08A 2HINA 3UWPA 2PXTA 1LOGA 1ND2B 3O7OA 1VBB2 4NHYA 4Q4V1 2AXZA 1V6KA 2WAAA 2BNOA 3WQ1A 4N90A 2E63A 5D1IA 4QWNA 2VZVA 4CE8A 5FP8A 3IKWA 1EV13 2RJKA 5FK7A 1PGL2 3R09A 1LHUA 3NRUA 5JXHA 4BXFA 3MYXA 4QXCA 5FXXA 5FZCA 2PLV2 5LK7B 3KT1A 2PHDA 1HRI2 1RTVA 2VBDA 1LOCA 3LSEA 4FP2A 3WG4A 3WR0A 3DN7A 4EWAA 5LBBA 1BMV1 2ZOEB 5FZ4A 3WP5A 1YC61 1TME1 2P3YA 5FP4A 4RHV1 2Q8EA 1ASJ3 1RZRA 1RIOA 3V0BA 1V9U3 3VZOA 1O8SA 3VBRA 4AQSA 4ZZ5A 4U36A 2BOJA 2XXAA 1QXJA 2W1QA 3IMNA 4K3UA 2DTYA 4D6SA 2HCSA 1Z7S1 3RRDA 1S2BA 1W3VA 3LSDA 4XF4A 4Q4Y1 4NPRA 4HLTA 1W6QB 1SLBA 4CCNA 5ABJC 1JXNA 1KEXA 3NDBB 5CADA 3NAPC 5BNPC 4NAOA 2VULA 4HPKA 4QPGA 2XGXA 4UXAA 5FZ1A 1NQJA 1QJFA 2UYAA 4W8JA 5FV3A 2VPVA 3ATGA 1MEC3 3HT2A 2ZX3A 1XBFA 2PPXA 1ND3C 1E5HA 3LFPA 1UZYA 5EJ1B 3POGA 4HRAA 3WNXA 1GSLA 3JXDL 2OR1L 5I0TA 3MEJA 1QF3A 1H1IA 2YYOA 3C8XA 4FOYA 4Y22A 5LA9A 3O1UA 3QCWA 1HX6A 3GN5B 3ZPXA 2QDNA 4N43A 4YZ5A 1CIWA 4CCKA 4NIHA 2JKXA 4GQ7A 2JDZA 2QQWA 2BNNA 1SLAA 3N9NA 1LECA 3H9AA 3AYCA 1H4HA 2LALA 4MZUA 5F3IA 2R041 5FYTA 3MUZ1 1GZTA 1C1LA 1K5JA 1YO8A 3INAA 4O7XA 3UJQA 1G9DA 4M01A 2KR2A 1N3OA 4XHXA 2PHRA 5BNOC 2RS13 3CZUA 4XZPA 4JV4A 3OPZA 3A9XA 3AL5A 4M0HA 2NMOA 2VR4A 3AMMA 2A75A 2R072 2KXLA 2YC2A 4TN7A 2XKOA 1U12A 3A0NA 1LU1A 3AK0A 3AKTA 3UFDA 3EHKA 3LZZA 2VUJA 3ZYJB 3V0BB 1O3SA 2JDPA 2L9LA 2XXPA 4QX5A 1GANA 4QKNA 2H8RA 2GMMA 4BQ3A 4YBAA 1GNZA 1OD3A 2WN3A 4IEVA 1NAEA 1MFQC 2RMU2 4XCBA 1UNBA 2YPDA 1PRVA 1VBA1 2XWJB 1HLCA 1TG7A 2HWD1 2OUHA 2WNEA 3IN9A 4PBOA 4AEDC 5IFPA 4MXWB 4NHLA 3SC7X 4DXTA 1VALA 1ASJ1 2GSYA 3C3VA 3P5BA 5D8AC 2Q1FA 4LHKA 3VBSB 4NIAA 1QQP2 5FR3A 2JQEA 2KEIA 1QJX3 2A70A 1VJ2A 4H14A 2JDYA 1MS5A 1MZ6A 4XFAA 4CA9A 3S8QA 4Q26A 5E88A 1H2LA 2D97A 3VLBB 4CDQC 4LUMA 5DABA 4OQ9A 4BK4A 4XDQA 1ENXA 1LODA 3W9AA 2PQSA 2E7TA 1HB1A 3VZMA 2PELA 2PN5A 3I59B 2HWD2 1AUYA 3I59A 1DBNA 4QQOA 5JPNB 4XZUG 1FPN1 1BDIA 1VBC3 3I4IA 2A3XA 1COV2 2VGDA 4BYYA 2EXJA 1IKPA 3CZJA 4K21A 4XJWA 5FY5A 5GKAC 5IVFA 1N1VA 4YG4A 2OPWA 4N7IA 4E4ZA 1C1FA 4KQ7A 5CU1A 4YM1A 1UPIA 2B5AA 3MIFA 4ORFA 1BK0A 2JEMA 5A7LA 1N1SA 5C8CB 2HFZA 2Q4SA 2RDSA 4Q0VA 3POFA 4N43C 4EWDA 4I09A 5J96B 3KM5A 1ULEA 2RHPA 3RS6A 3I2HA 3M3CA 3OBZA 3CDZB 4GHJA 4XFHA 5BV6A 2I74A 5FOBB 5JSOA 4QDQA 4MX3A 4KWLA 4KNCA 4FPOB 2KM2A 3DGTA 3TNPB 3VDCA 2P4EA 4QX8A 2ZEXA 2GZUA 1GMMA 4UW6A 4DIQA 4YSFA 3HAGA 2W2IA 3J7HA 1ZS4A 2FDJA 3LPGA 1LNSA 2ZGMA 1VRBA 2PMWB 3TRBA 1EAH1 1KDMA 2ZEZA 1C8NA 3O12A 1ZBA2 1G9AA 4ZS2A 4URAA 3R0RA 3FUOA 1C8M2 3KQRA 1S0DA 4AI0A 3MV11 1IS5A 2VC9A 1ONAA 5CG8A 4Z07A 1OUXA 2JE7A 4N9HA 2H6BA 1PVC2 5FZKA 5G05L 1FMD3 5C3OA 1UMIA 2F4LA 3QOXA 2SBAA 2P34A 5LATA 2RS11 5FO7B 1KJRA 2VNGA 1NCRC 2W94A 3C2UA 1W9SA 2VQ0A 1CZVA 1CD3G 1SG3A 1EUTA 1PIV2 1WW7A 1PRUA 1IKQA 3AP7A 4MUVA 4AVCA 3WHTA 3FMGA 3J8F1 3CLPA 5CFCA 5FUNA 5DUXA 1WKYA 4DE8A 2PQQA 5CKMA 1YLLA 4LOSA 1AHSA 3KV4A 3RGBA 3ZXDA 1AX1A 5FMOS 3WF2A 3W59A 3OGRA 5C4WB 1TMF3 3GALA 4AQTA 3ZM8A 4A7ZA 1JHJA 5AVAA 3ZFFA 3NNLA 4GXLA 3CHXA 3LIGA 3POEA 4UWDA 2K0GA 4C91A 1OSLA 4XJ9A 4E4HA 2ZGRA 3H3UA 3I8TA 3SISA 3J7LA 2RM22 2VVDA 1GBGA 1EPWA 5D21A 5ERLA 2XJVA 4BWOA 3RZLA 3A4UA 1V0AA 5EQUA 4UI9L 4RR3B 2XR4A 3VHPA 3ZDVA 1YIFA 1DCSA 3O5SA 1IPJA 1GNHA 4AAXA 4CUAA 1ULGA 1AYN1 2EXIA 4S2GA 4CEWB 5BPXA 1D2QA 4CEWA 4E9KA 5C8CA 3WF3A 2UY9A 2FDKA 3O0VA 3VGIA 4R9BA 1WLCA 2XBO2 3VWSA 2E7AA 2CSFA 2ZXQA 2Y6LA 1WCSA 1XU1A 4P9LA 4DQAA 3CL1A 4WM8C 2PIJA 1GV9A 1MQTB 3A7QA 5A6QA 2PUAA 1WWYA 3ECQA 2J7UA 4UF0A 3E6CC 4BXSV 5KHHA 1NYWA 1JOBA 3AC0A 4XOGA 5HCHA 5JMCA 5L7OB 1ULOA 2MHFA 4NWVA 2VUCA 1ZZ6A 4I30A 3T0BA 5J3UA 5F5IA 3WD5A 3VN4A 2IVIB 2BV4A 1RMU3 4WBBA 2LYKA 4EZHA 4YW1A 5JXJA 4DINB 1SBFA 2D3SA 1JWLA 3VDAA 3SEPA 5BY5A 1ZM1A 1G8WA 4COWA 1RUH1 3H8XA 3OG2A 1XXNA 1CAWA 2JG9A 1T6GC 3WQ7A 3NV2A 2ET1A 2BJSA 3GZAA 3GNEA 2C4XA 1PO13 3RYPA 1PVC3 1BVVA 2FDHA 2EIGA 2WNUC 1JZ6A 3PHMA 5FLIA 3B7HA 1AR82 2MPFA 4OHZA 2ARBA 3HT1A 1FMD1 4I3GA 5AC91 3O1SA 5LW9A 2RVAA 3QLQA 1UO9A 2D44A 5FYCA 2WC2A 4MH0E 2EF8A 5T50A 5KC5A 2NP0A 4IV1B 2Q0AA 2XBO1 4QPWA 4RQPA 4KGQA 3WP6A 3LOIA 3EYPA 5C4WC 1QPZA 3ZHIA 5ANNA 1M4WA 5FXZA 2DU1A 2JDKA 2P3JA 5DAXA 5K8SA 5KR7A 1YJLA 4FPFA 1E57A 5B2GB 5K4LA 2E33A 2UURA 1HB4A 2E26A 5FY7A 1OA4A 1O59A 1ZBE3 4WM8B 2FD8A 4YW3A 1NUKA 1E5RA 2IXLA 2WFPA 4RD7A 4XFFA 3ETQA 1JFSA 4CCJA 4L97A 5D2AA 4E4DX 1N3PA 4YNIA 3THPA 3C7OA 3KV6A 1VB4A 4XJUA 1R081 1GOFA 3T1LA 2OA2A 2AEYA 1RC6A 1ZA7A 1XYNA 2HWB2 2ET7A 3FHQA 3KCXA 1AL0G 4JTNA 4UFMA 4WZFA 4YGDA 2JCGA 4D69A 4CDXA 5JIUA 5BNNB 2EXKA 4CDXB 5IVCA 3JXCL 2XWBB 3A21A 2V5DA 5KXEA 3TELA 3ZN6B 5E1RA 2F6BA 3ZN6A 5LEJA 4B7EA 4ARXA 3AXEA 1PIV1 1AL21 4EKIA 1V6NA 4WM7A 1A8MA 1I3HA 1FV2A 5IVYA 4W65A 2BUKA 4FBIA 4GWMA 1WA6X 2RS12 4FFHA 1O4XA 3AVSA 4ZXKA 2YBSA 1W06A 2LRPA 2XXZA 3MF6A 4D7SA 2Z79A 1T2XA 3VDDC 2VBPA 5JCTA 3MIGA 4E4SA 5CFCC 4CXYA 2G9FA 1LRHA 2QQIA 5IW0A 1TZOA 5IJRA 3I2GA 3OY8A 5T54A 3WG3A 5JI7A 1FOD1 3ZYIB 1UL9A 5JSRA 4X8PA 3ACHA 4IV1A 4BQXA 1V70A 3Q8EA 3AJYA 2VEOA 4X4GA 1D7PM 1OI6A 4QX1A 1Z0HA 1RVF2 1X8MA 3MFCA 4ZU5A 4CEYA 2W47A 3POSA 2MNGA 2Y0IA 4Y4RA 1HJGA 1TNFA 5JLVA 3AMQA 3EUSA 1FAYA 1AR71 2OQ7A 4AFAA 1FXZA 4FAHA 1ST8A 1O4YA 2WNOA 2FDGA 1YNAA 2LLVA 1AR61 1POV0 4QX2A 5F1RA 4KWJA 4LO6B 1K12A 1YI7A 4QB2A 3T2QA 1YQCA 1PO11 2ZGPA 4ONUA 4PT6A 3X29B 1PMJX 1R093 1OKQA 3JQWA 5APAA 1AXKA 5FZGA 5BUVA 1PK6B 1CAUA 5LA1A 2DCKA 1MR5A 2Y33A 1QY4A 4GA9A 2WO3A 1XNKA 3H1WA 5C6CA 1CWPA 3S57A 1V6LA 2NQYA 1K3IA 3DL3A 2Y60A 3ACFA 1AR62 1ZZBA 2QJVA 5EP9A 2ORZA 4OHWA 3BIEA 2BGPA 1BEV2 2VTFA 4HT1T 1GZWB 3WP4A 5JR2A 1PMHX 1RUE1 3HVDA 1YQ8A 4KG8A 1OC1A 4YWAA 4BMEA 2MEZA 1QQP1 1KD7A 3HWJA 2Y26A 4XC9A 5BNNA 4XFGA 4Q4Y2 2VMDA 3DF0A 1I5PA 3OF1A 2W52A 5FYSA 4CP2A 1XJAA 2G9ZA 1UWWA 3PLQA 4CPBD 3GXUA 4N8MA 3DM5A 1CAVA 2EXHA 3K48A 1XSQA 3U07A 4Y5SA 4AE2A 3ZN5A 3FMYA 4HANA 1VP6A 5FZBA 4QU1A 2HLEA 1PIV3 1AL23 3CJXA 3SXWA 1QJX1 3H8RA 5EWSA 1EFAA 1DDLA 1QQBA 3LA7A 4XDPA 3H1MA 4IQPA 4XF3A 4XAAA 4IEUA 1OLME 4NR1A 1ZZCA 1RUD1 1K5MA 2FMYA 4LXLA 2X53S 3PIGA 3WX5A 3RZGA 2ENRA 4Z5HA 5FZ7A 1F35A 1ZRDA 5FLJA 3ZYBA 3VBUA 4AFBA 3V64A 5CFDC 5GZEA 1D4M3 3D6EA 4JCXA 1LQCA 4HMZA 4CEYB 4IE4A 3I3MA 2IUWA 1ALYA 4OI2A 1FNYA 4AGGA 5A7WB 5CFCB 1QH6A 2RR11 1N47A 4GKYA 4IUGA 1O4ZA 1WD4A 4BHPA 4F3JA 3KF3A 4RQPC 1YEWA 3APBA 2WZR3 1W6NB 3DUIA 2VXRA 2HJIA 1PZ8A 3WV6A 4DZGA 3WDWA 1O91A 2D6MA 4OCTA 3NV1A 1HKDA 4LORA 5ACA3 3UV9A 4IE7A 4LBQA 4AI2A 4AZZA 4I2OA 3WNOA 3USUB 4M4RA 2GC1A 3L1PA 1UYZA 1NE6A 1UYPA 2WNUA 2WZ8A 2XJQA 4NHMA 1HXS2 2QFEA 2V09A 4WVMB 3NNGA 3TNQA 2GRMA 3F6WA 5IK7A 1AX2A 3CQOA 2VMEA 3B00A 2ZMNA 2D93A 3H50A 1DGLA 3HIFA 5JIAA 3OMTA 3VL9A 1TVGA 3EJKA 4PDWA 4AHXA 4PHZA 4FI9A 5LBFA 4E8CA 4EE2A 1C57A 3ACGA 2WS93 3KHBA 2LM3A 4H7LA 3U10A 3ZN4A 4HVOA 4BH9A 1QP4A 1ENSA 5IAXA 1XQNA 1I1EA 1RHI3 2BRTA 2DCTA 2VO5A 2YZ4A 3IDAA 4YG7B 4A3XA 2BQPA 3GZUC 4TZDA 1CAVB 2X8KA 1GP5A 2NZ9A 2ADEA 1REFA 2WFF1 2PA7A 2XL7A 1R63A 2W95A 2DV9A 5ABJA 5A3NA 2R32A 3MDPA 1UIKA 4ER6A 2QE3A 3E5QA 4A44A 5FZHA 4BLIA 1UZZA 3E5XA 5B4NA 1UKRA 3ETPA 2XG3A 3ZSJA 1UMHA 4CEWC 4CDUB 4IGQA 1W2OA 2YC4A 4RS5C 3VBRC 3N7JA 4KBBA 1POQA 3U4XA 3HQRA 4N53B 3KGZA 5GZFA 5A7WA 2X05A 2J1SA 1R69A 4QDRA 3KL4A 3U3WA 5HXVA 5C3QA 1S4CA 2WJSA 4YZ4A 3ZKYA 5C3PA 1D0HA 2VZRA 1NLRA 3HBZA 4ZY9A 3ZXAC 3ZR5A 4TWTA 1W9TA 4LLOA 3M3IA 1D0GA 1DP0A 1LOBA 2IXJA 1W6NA 1J1TA 2DCJA 2ZACA 1JH9A 1L7RA 1PNGA 3OD0A 4XE9A 4SBVA 2JXAA 4GWNA 1ND2C 2R30A 3TEPA 5FY0A 3NV4A 2F4PA 3LEKA 5FZAA 1IOAA 1MVEA 1NA1C 4PU3C 3IM0A 3VKFC 4CUGA 2WFF2 2RS32 3KLSA 4CRQA 3A9YA 1TNRA 2J1TA 2VCAA 2PAMA 4BQ1A 1RUG1 3O1TA 3WDVA 5FDBA 3UGGA 5ACA2 3USUA 2BVVA 4O61A 3GHNA 4MGKE 1LULA 4PLMA 5DQ0A 3WHUA 2W92A 4DY5A 4AGVA 5FJKA 2CY6A 2VZ1A 4HFSA 4NO4A 4LHNA 3NNFA 4IW3A 5AC92 4COVA 1UY1A 4JKMA 4NPLA 1W6OA 1GKBA 4OHYA 1EV12 4K20A 2RV9A 2WS92 1TME3 1XNTA 2IWGB 3R4UA 5J48A 4GKXA 1VIWB 3S5AA 3QFIA 1DYKA 2ZGOA 2B8MA 4BA6A 5EYXA 5ISLA 1VBE3 1YQ6A 2QQUA 4JRAA 1UMZA 2EAKA 1W3XA 3AZYA 3NAPB 1OVSA 4DY3A 4EZIA 2WNVA 2XCJA 2NN8A 4LBKA 2ORXA 4OUSA 4PDWC 3J4UH 4CP9B 1L7QA 2R1BA 1EAH2 2Y6FA 2B9VA 5A33B 2GC0A 1IG0A 1YFWA 3K3NA 1XWRA 4X4HA 1YFUA 2JB8A 2ZZJA 4NHKA 1PVXA 1Y9GA 2WT1A 5DN2A 4FPKA 4V1PA 2DVGA 1QP7A 1ZRFA 2D98A 2ZABA 4A45A 4CU6A 4Z5DA 1R092 2W91A 3QOPA 4HSJA 2DVBA 1W8NA 1N1TA 2Y6HA 4JKLA 1D4VB 1J83A 2JX9A 2VE1A 1DQ2A 3ZXJA 4XBNA 2WA3A 3GBGA 5H9SA 2GDFA 3VBOA 3CNAA 2IXKA 4LIVA 3PJQA 3ITQA 1HQLA 1MEC2 1NY72 3SNMA 1UX7A 1OFNA 4FPEA 5LA2A 1AR92 3TBDA 1JZ2A 2VECA 1UOGA 4NWWA 2PYTA 3AKSA 3WEZA 3N9LA 4GWIA 2IVGA 2VCMA 3BOPA 1M06G 1MS1A 4Z59A 1H2MA 4OULA 3UKVA 2O1QA 3SMHA 1GFF2 3GCXA 2YDEA 4AEMA 2RDQA 1WW4A 3IZOA 2VTXA 4CU9A 4D7YA 4TXWA 2J1UA 4BQWA 1ADRA 4D8MA 3KV9A 2XJ3A 4HXCA 2UWBA 3DECA 4XFBA 1VBC1 1K5MC 2HEVF 3K4ZA 2D40A 1S0EA 2ZAAA 2QCSB 3R4DB 1Z78A 1W6OB 1U0AA 1O8PA 3J7NA 4META 4DXRA 1DQ4A 1RUJ3 2WSVA 3ZYFA 2ZHNA 4HBNA 4PIXA 3GZDA 4XTPA 5KXDA 2FFHA 2KPJA 3VBFC 4UFKA 4UBHA 3G7DA 3GJAA 4FO9A 2D6PA 4ET7A 1LEDA 1OF3A 3OSDA 3POBA 1FOD3 5EYYA 4FPJA 5FPLA 2QKDA 1JYXA 3GBWA 3M4FA 2HBUA 1S7EA 4FP3A 4ZXEA 1CAWB 2B39A 2QQNA 2D6NA 2ZX0A 3ILRA 2RMU1 2Q8DA 1WBFA 3WF4A 4FQ4A 1H2KA 3BODA 3FN9A 4OHXA 4AAPA 2PXLA 5E8AA 1C8M1 1LOFA 1JHNA 4Q0QA 1D4M2 5GLZA 3M3OA 3BALA 1OH3A 3ENRA 2VAUA 3OJBA 1DULA 3PNAA 4DFSA 2JE9A 4YFZA 1QJY1 3FBYA 4IEOA 1EAH3 2VTXJ 2A6ZA 5FBJA 5IUQA 2CV6A 2R16A 2ZKLA 4YPJA 4IETA 4AEKA 4CDUC 4LBMA 2RR12 4DO0A 3W5NA 1QB2A 1SFNA 4X4EA 3VDDB 4AFDA 4AQ2A 5KWRA 5EXOA 1SLLA 3UGFA 1UU6A 2J1VA 3VL8A 2AXVA 2RJLA 5FJHA 2JECA 4YW5A 2FZ2A 5LWBA 4Y4YA 1BQPA 3NXHA 3AX4A 3TYJA 2W5FA 5HCBA 3ZFFB 4EZ4A 3TWIA 5DRYA 3BCWA 4BCUA 2J1EA 1QJU1 3BB6A 2DUOA 3DYOA 3CIHA 3N3HA 2WN2A 2WT0A 1E5IA 4G4FA 2XH6A 4JGYC 5DAPA 4CCDA 2AW6A 3WQ0A 2PHXA 1IQDC 1XRUA 4HVQA 1REDA 2JDHA 2QZ3A 4Y5TA 5FYZA 1C3HA 2XJTA 3CBNA 1AR93 1J3QA 4CCMA 2IVQA 4JQDA 2BTVC 3PURA 2JG8A 3IPVB 1QQP3 5T5OA 4BQ5A 1COV1 1QJX2 4BMBA 1VRH3 1US2A 2EICA 1SQ8A 2RE9A 3POWA 1BDHA 3RWKX 5A1LA 4Z2WA 1GP4A 2VJXA 3VK0A 3T0DA 4JVAA 2QVSB 4GD4A 5LBCA 3ZFGC 5FPBA 4LITA 3VHRA 2A7AA 4LBQB 3OGSA 2ICTA 1XYOA 1NA1A 2IFRA 2JWPA 4CDWA 1RL3A 4CDWB 4Q29A 3CJIC 5J7MA 4Q1PA 4AVSA 2ZJCA 4QQLA 3N7MA 1RUD3 1F8VA 2HWB1 1A34A 2Z5WA 1O4TA 4NIIA 2YFZA 2ZAHA 4WM7B 5I0DA 5BXXA 3FJSA 4EKGA 1UOJA 3VKOA 1QH7A 2IVJA 3WNLA 4W6WA 4Z92B 3BTXA 1DIWA 2PXBA 3JD73 4CCOA 1YYNA 3DXUA 3KS7A 4RHV2 4RA0A 5EHDA 1D4M1 3HOBA 2W87A 3IIIA 1VBD2 5B4XA 3B9IA 3NNMA 1HRI1 1MZ5A 2Z4FA 4I6RA 4HOOA 2JENA 4COUA 4PQ9A 4Y33A 1RMU1 4QHZA 2HWC3 4XF1A 2XQXA 3B01A 3OBAA 3D1NI 1WLTA 5JOXA 2CAUA 3G5GA 3RYKA 2AGSA 3BDNA 3DKQA 1W8ZA 4WZCA 1KRIA 4Q4V2 1IS3A 3E97A 3LISA 2DDUA 3P1IA 1H9PA 1OQ1A 4KL1A 1SQ4A 4B4QA 1RGSA 4LULA 1R1A3 5F3EA 3HN3A 2VNVA 3BVCA 1CR7A 4GZ9A 2UY8A 2KEJA 4BLJA 4ISQA 3RJ2X 1V9U1 2H6CA 2BGCA 3CMGA 1ZAYA 3KF5A 4EJRA 5LK5A 5C4WA 5LRRA 4C0HA 4Q4X3 3LCPA 4HKWA 1DG6A 2CWSA 2WQZC 2YXSA 1LGBA 3D0JA 3S5QA 3S0MA 4UW4A 2PXPA 3RYRA 4BISA 1CIYA 1QDCA 1X9TA 1STMA 4DE9A 2OVUA 1VPWA 2VOTA 4OQ8A 2E7QA 5CAZA 2LYLA 3T0AA 1H30A 1ZYBA 2F17A 3FC0A 4Q0PA 3IBMA 5FPXA 1AR91 4WVVA 2DVAA 1PM7A 2B7YA 4MSVA 3B9CA 4M3CE 1O6UA 2JG9C 4Y42A 1G6NA 1B35A 3K51A 1B35B 2IZWA 1DQ6A 5C9AC 1VAVA 1VBE2 3HN1A 4ISRA 1OFSA 4XUNA 4HG6B 1MPXA 1S1AA 1QP0A 4NRPA 4NRQA 1HRV2 1ZNPA 3UETA 2CHHA 4FFFA 1IG3A 3RI9A 2XJRA 4NIDA 1W2NA 2MXDA 3KXAA 3PXPA 4BE3A 4P9XA 1MVQA 3NNJA 2FJRA 2GN3A 2MEV1 2CGPA 3I97A 2P6HA 3RMXA 3N9PA 1S0JA 1WW5A 1TME2 2VQUA 3AM2A 2X5IB 1SPPA 1RJ8A 5FZMA 2R043 2Y6GA 2CWMA 4NOTA 5EV7A 3LEIA 4AW7A 4HZFA 1WETA 2X29A 4XUQA 2P5BA 3RZMA 5F37A 1AR83 3EO6A 3BD1A 1CJGA 2C9AA 4KU7A 1NLSA 3MO4A 1X33A 4NROA 4OMCA 1JU3A 4XURA 5FY9A 5HI0A 2WLQA 1YHFA 3BU7A 1OA2A 1H0BA 4L9BA 4BOWA 2XL9A 4JC1A 3MLLA 5DTRA 3GBFA 3PMEA 4XPVA 5A32B 3JU9A 5FYHA 4K1ZA 3P3PA 4OVEA 2EBYA 2HWE3 2Y6KA 2CL2A 1PO21 2HWD3 1R64A 2HWC1 3R05A 1IC8A 5G04L 1S2EA 2KA3A 2GU9A 3PUAA 1RXFA 1PK6A 1ULFA 4Y22B 2OPKA 1SDDB 2W1UA 4NUBA 3RNSA 4Y1XA 2GNMA 4GQMA 1IQAA 1LHOA 1BBT2 5BNNC 4W6YA 4KMQA 4ZZ8A 1F9KA 1W9FA 5CA6A 1W39A 3OPWA 3K2OA 1BZWA 2D5HA 3PTRB 1DWKA 1QGLA 4HL0A 4MLOA 1UZ0A 2GMEA 1NCRA 3OQOA 4I0AA 3ZXGA 2VMGA 4A2UA 1ZREA 2ID4A 3LQCA 1PO22 3J9SA 3DEMA 2Y64A 5EJ3A 4CU7A 2LYPA 4ZU7A 1AVBA 3SH5A 2BFUL 2YU2A 4LKFA 5IK8A 2ARXA 4B4RA 1U5YA 4Y20A 2EALA 5FO9B 3S7EA 1O3QA 3FLTA 4IE6A 1J3PA 1BMV2 3GHMA 1WLDA 4LOTA 5E16A 1POUA 4HN0A 2OW4A 4LE4A 4JQRA 3WNMA 2PXJA 4PLOA 2V5YA 3NJVA 2A6XA 1AYN2 3BPSA 1HRV3 4L92A 1QQAA 3F2ZA 3VD5A 1RUE3 2QQJA 2WR9A 1PGSA 1GWLA 1WBLA 5D8AB 1BKZA 1KGYA 5CVRA 4A41A 4M0NA 2R061 4OUMA 4S2FA 4ARYA 5JWPA 1JS9A 3AL6A 1QKQA 1TMF2 2PE5A 4DXSA 4AVTA 1OT5A 4LBJA 2WQ4A 3AKRA 1JYCA 2V3CC 4UFIA 5A70A 5JUWA 3VZNA 5I8TA 1F2NA 5FWJA 3BKZA 5I8SA 3JZVA 2XLFA 1K42A 1W0NA 2EIDA 4OBMA 1XU2A 2BZDA 4GJZA 5F8PA 3SEEA 3WUCA 2GRLA 2AACA 1EY2A 2LCVA 4IWRA 4D7TA 4LO5B 1U5XA 3OEAA 1PX4A 3TFLA 1LU2A 1JZ3A 3RVHA 2ERFA 3HR9A 2XB6C 3KVAA 4F8AA 2E51A 1YXWA 5L7OC 3ON7A 1JBCA 3O9XA 2ADDA 3K4AA 5FZIA 1QU0A 4A3ZA 3GZDC 3DV8A 3LIHA 3LWCA 1NCQA 1UD1A 1US3A 2VY0A 2KD7A 3NO8A 2GH8A 3J8F3 4AGRA 1DZTA 1HQWA 1X82A 5FWEA 3BOWA 5DSXA 2GNTA 3MGUA 3PL0A 2DBIA 4LBNA 1G9BA 1JH5A 4RR3A 1ZRIA 1OCTC 5H9QA 1HIXA 1KDKA 1EUUA 4AEDA 4CZSA 3OEBA 3GJBA 1I5ZA 4Z58A 5I0RA 3UL2A 3LE0A 1Y9QA 4RHV3 1HF0A 1KFXL 4QXBA 5C3RA 2QZ2A 1F5FA 4CTEA 1X7NA 1QJY3 2GN7A 4AHYA 5K98B 2DVDA 5FOJB 2PXEA 1X9PA 3WCSA 5J09A 2ZS6B 5JXIA 3NROA 4JQTA 1DQ0A 4J25A 5HXMA 3ZHMA 1H4GA 2Q8CA 1RMU2 4H3WA 1AYN3 1RUD2 1VMJA 1WMFA 1OQEA 2XLGA 1BEV3 4GULA 4WVZA 4AFCA 2ZHKA 3I2JA 4F83A 3SCHA 1XE0A 4UFJA 3ST7A 1RHI1 4W6XA 3TEYA 1FV3A 5JI9A 4Q4Y3 1V6IA 3MICA 3QD6A 5A7OA 4BM8A 3U0ZA 1PO12 3UJOA 2BWAA 3HD8B 2FQPA 3OB8A 3T4VA 4FXKB 1Q43A 4XEZA 3T2TA 3OP9A 5GJ6A 1UQXA 2VCCA 4R9AA 4UT5A 2PAKA 3C7GA 1LMB3 1JZ5A 3VKMA 2PHUA 3AVRA 3UT0A 4JHTA 4Q4X2 3S7IA 1UX6A 4YZ2A 2PUCA 4OB4A 1CZTA 4IE5A 2AYHA 2M4HA 2VOVA 1YJKA 3S6PA 3RSJA 3VBFB 4AI1A 2G19A 4QPGB 1LOAA 2YBPA 4DPNA 4PCRA 2W9XA 4BPZA 1XSRA 3MIEA 2Y34A 4IEQA 4WV8A 3AKPA 3H7JA 4K9SA 4HETA 3ZDSA 2D43A 4ASKA 2YC0A 4MYEA 3O1OA 1VBA2 2G4IA 1WH8A 2V72A 1UXZA 2WA4A 2VD7A 1KJLA 2UYBA 4OUEA 3AKQA 4HPKB 1Y9MA 4FT8A 4RGGA 3WT3A 2JG8B 4WM8A 4M00A 3ZFEA 4KI5M 5FZEA 2OFYA 1DU3D 3EBRA 1NLQA 2A71A 1NZIA 5FZ8A 1AXYA 5C8CC 4FTEA 1HXS3 2HCNA 1S0IA 2B42B 2C0ZA 3M3EA 3PVNA 3TOJA 1MS8A 4DUXA 1ZA4A 4QM8A 1B09A 5JOYA 5A3PA 1XC6A 1GQHA 1V6JA 2ARAA 2VZPA 5IVBA 4XUPA 5FZ3A 2LYQA 1YUDA 1OVPA 5L73A 1J59A 2J22A 3WXPA 2R042 5DT2A 5SV8A 2LYJA 1AYM3 4IV3B 4AFMA 4Q2JA 1GWMA 5LA0A 4IL7A 2ZGSA 4XACA 1LOEA 3ME2A 5K0UA 2WABA 1ZRRA 3THTA 4B29A 1QJY2 3PVOA 5IAVA 4UW3A 3KSCA 3OCPA 1PMIA 2JICA 3L9JT 3N36A 3N7LA 2VMCA 3CJIA 1VMFA 4EV0A 2YPJA 3CEWA 4RN5A 1OHFA 1PGW1 2LYRA 4I8TA 1YQ2A 3ZIXA 4LA2A 1BVP1 5FMCA 4E8DA 1RUC1 2PHFA 5AFBA 3ZSLA 5T55A 3KGLA 1A8DA 3LDBA 3RWNA 3LA2A 1UZWA 3D4KA 4ASLA 3AZXA 4P14A 5FMDA 4AHWA 3VDBA 1H2NA 3AP9A 3W58A 5CNAA 4P9WA 3OWQA 2R1DA 2DCYA 2XDVA 3K75B 4O8BA 1NG0A 2OXBA 5CKNA 1JYTA 3OKZA 4QB1A 1ZZ8A 1FPN3 3WZ1A 2GP3A 4B4PA 2KEKA 1OPOA 4BDVB 3O1MA 2GH2A 2KZ8A 2PXUA 3C7FA 4OZOA 2XUEA 1A78A 1CJPA 3HPNA 4JGYA 3ZKUA 4QX7A 4Y1VA 5J1XA 4JRLA 2L1PA 3Q9OA 4FOQA 5HV0A 3FLPA 4X4FA 5JOZA 2RS31 1I9RA 2XPJA 1VAKA 2BYVE 2VM9A 4LKEA 3M1HA 1PZ7A 1S2KA 3D5OA 4PF1A 1OOPA 2DUPA 5JUVA 2EAAA 5GZGA 4D0QA 2WAOA 5IT6A 3GM8A 3QBQA 3THCA 3WW1A 1UYYA 4Q4W2 2Q5TA 1RPEL 1AR63 5DAQA 5DTQA 2A1XA 1ENRA 2X09A 1RXGA 1IZ3A 1AL22 1F5JA 3T2OA 1CX1A 3LEGA 2VMIA 5DZGA 1DLCA 4P9GA 4IV3A 5ANQA 4H55A 3OUHA 4PLNA 5F9TA 2ARCA 1LOFC 2RDNA 5L36A 2LYSA 1RUNA 4J1WA 1E5SA 1ULCA 1NX9A 2DBNA 5DDJ2 2J1AA 4B3NA 4JGZC 5CYYA 4ES8A 1XB9A 2WWJA 1R082 3W21A 2I2SA 4GAZA 2XHNA 1AR81 4OLLA 3SCFA 1FNZA 1C5IA 3B02A 1HJFA 1Q56A 1JMUB 4IEXA 4XXAA 1LB2A 1NEQA 4RGAA 4UOJA 3OTFA 2WO7A 1BK1A 2W39A 3HEIA 5DPNA 4CDQA 1H6XA 1W6MB 2HKXA 1J1LA 1GWKA 3VBRB 2ZX2A 3LDRA 3SH4A 1UKGA 1H1AA 5DAVA 1BBT1 3IVPA 2Q8OA 2E31A 4IDZA 1QIQA 4C1XA 5FY8A 4QB6A 4COYA 1BXHA 3T09A 1MZEA 4MHRA 2WZEA 5F32A 1UOFA 2WWUA 4F8DA 1BYHA 1SACA 2N7GA 5A6ZA 4ITCA 4QT6A 1WD3A 3OGVA 3T4HB 1EV11 2A6CA 1PERL 2A3YA 3I7DA 1GOHA 3TN92 4LT5A 4K1YA 1QZXA 5F5CA 1LGNA 1LHWA 3WSOA 5FUIA 3HNBM 5CIRA 4A42A 1DGRA 4S2HA 3VHOA 1W9WA 3J8F2 3ZXKA 3AMPA 4LTAA 5F5QA 5FQ0A 2DVFA 1Q8OA 4XUOA 3TN91 1SFYA 5BYNA 5HCFA 3AB0A 3I3DA 3TAYA 3ZKCA 4DS0A 2ZX4A 2D3PA 2K9ZA 1OOPB 4JTOA 4JGZA 3VBOC 3VD4A 1FI2A 3RZZA 1T6BX 2VZOA 4X4DA 5FMBA 4JZRA 3VKNA 2E53A 1LJ7A 3HQUA 3K4DA 3PTYA 4YW7A 1ZBA1 4PU4C 2LLWA 3PU8A 1W8FA 2YV8A 3CF6E 5CB7A 5FO8B 4IV3C 3CKHA 2YGMA 2AEZA 3M70A 2OIIA 1GZWA 2WINB 1LR5A 3HMYA 3HNMA 3PDQA 4MGQA 5IK5A 4L2NA 3KZ3A 2XVLA 5HPOA 4IEZA 4Q4W3 3ZLIA 3WLUA 4N53C 1TEIA 5A3WA 4BQYA 2ZEYA 3TB0A 2O14A 1MQTA 2FHRA 3A0KA 3ES1A 1UY0A 1WMEA 2NM1A 2LW8A 5FP7A 4JDNA 4FOWA 4KH9A 5DG1A 1ND3A 1C8M3 3WF0A 3ZX7A 5K7PA 2WO2A 3NSTA 1L3JA 3H8OA 3FBMA 1S0FA 4FPGA 1RIRA 1HDKA 4YVWA 4E2SA 2BWCA 2JIGA 1S55A 3Q8FA 4N7UA 1PVC1 5F39A 1JZ4A 2VG9A 4NRMA 2WNVB 3MPPG 5KHGA 5ABJB 5L19A 3AMNA 2Q30A 4E2GA 3BTYA 4QGMA 3H3LA 3V56A 2QQMA 3JD71 2D7FA 1AU7A 2D3RA 3OUJA 4XHBA 3QF3A 1ZPQA 1E3OC 2HYXA 4EN8B 1C28A 4M3CF 2IXIA 3OUIA 4QPIC 5FY1A 4XTMA 5JOWA 3PE5A 1VBA3 1JOPA 2WFF3 3RQ0A 1X57A 4MGSA 1W03A 5FYMA 2JDAA 4BK5A 1WCQA 4Z8BA 2BOIA 4GB32 3WY6A 4RL7A 4XMAA 3OGJA 4NN0A 4Q27A 4YM2A 2TUNA 1ZBE1 3QYXA 1BJQA 1RZRD 3LFIA 5K0UC 4QKDA 2D6LX 3I49A 2JDNA 3JB8A 1H8TB 5JVVA 3ZXFA 1DLLA 1F4AA 2TEPA 5I0UA 1GU3A 4HSLA 3KCCA 4IEYA 4LLFA 3MW2A 1CQ9A 4O9EA 5FK8A 5DMYA 3KWVA 5CKQA 4CCCA 1GOGA 1GZCA 2CDPA 5H9PA 5T5LA 4AG4A 4DRRA 4YW4A 4YM0A 3MIDA 3KCYA 4C8DA 4RS5A 3Q8BA 4FOVA 1Y7YA 4OHVA 1P8JA 1O5LA 1UXXX 4BB3A 2VVEA 1RB8G 3BTAA 4XW3A 2WWSA 4TTGA 1N3QA 2VL4A 2HEYF 1VAMA 3ZFEC 2O8QA 5KBFA 5A3UA 1RVF1 5DTMA 5C70A 5JPMB 3OYWA 1LESA 3KHCA 1RUG3 5BNQA 2ZTNA 2NLRA 5IVJA 1Q8QA 3JD72 5F7UA 3D3AA 4YRDA 5K9YA 3NJZA 3CROL 4XXPA 3O0WA 5KXCA 5FCCA 3WNNA 3ZMNA 1REEA 1GR3A 2VUDA 4XABA 2E32A 4C0BA 4Y24A 4Z2AA 5FZFA 3W5MA 4AQ6A 2V4AA 1PM4A 1EYBA 1B35C 2OQ6A 3VKLA 5C9AB 3S30A 1YCIA 1FPN2 2XVGA 2VOWA 3AZZA 3ILFA 1W8TA 3AFGA 5IATA 4QD2A 2EWTA 3V0AA 4YG3A 4LIUA 4R4XA 2WDBA 3AYEA 4YG0A 3U14A 1AR73 3K46A 4XAEA 1W8UA 3J26N 1CN1A 2YG0A 2P1BA 5I93A 4MOAA 2WIUB 3QH6A 1C5HA 4R4ZA 3OY8B 4HKLA 4XF9A 3TRSB 4NJ4A 4ZHNA 4OI1A 2R0FA 3VBHC 4Q4X1 4CXXA 1R091 3POIA 2XLAA 4XVHA 4KG0A 3VD7A 4OI4A 4XIKA 4XDOA 5FZLA 1QMJA 3RPQA 2AH2A 3ME5A 4G3YC 1BLZA 3T30A 2HWF3 1WA4A 1SHWB 4QDSA 1YWKA 1OPMA 2XOMA 5A1FA 5C5UA 3UNPA 1UXDA 2DUQA 1TMF1 4FBFA 4CVUA 1CAXA 1U5ZA 1QOTA 1KXGA 2V73A 4QXHA 4V2VA 2J7WA 3O1PA 5F5AA 1WUVA 3BGAA 3SLIA 2ZBJA 3IT8A 3CLCA 5FMOL 1U2ZA 3EB7A 3PMSA 4KWUA 2WYSA 5IWFA 1NXD1 3Q8AA 4XBQA 4YVSC 3RZKA 5IYYA 1CX4A 3H0OA 1CPNA 1W6PB 4FPLA 5T52A 1ZBE2 2PUDA 1QEXA 4IEPA 3ZYHA 3ZYPA 3MUY1 3M3QA 1LENA 2IU7A 2W3JA 1L1MA 4PI2A 2WBKA 3I2FA 5FUPA 2Z69A 1I6XA 2VW1A 1ACCA 1WIZA 2PXDA 5DUVA 2VZSA 4TSVA 1NCQC 4ZU4A 2P3IA 1CZSA 4N9IA 3H1YA 1DYOA 5E89A 5FXWA 1CONA 1FOD2 2XVKA 1APNA 5T5JA 5L7OA 4YW2A 5SV5A 3ZIWA 4YGCA 1VR3A 1RUG2 1WLWA 1WMXA 3I2OA 1JODA 1RUH2 3LAGA 3ELNA 1LTEA 3K3OA 3SH3A 4CDWC 3UKTA 5I8YA 4CCLA 1UPSA 2TNFA 4D6QA 2E9QA 4ZPIA 3HZIB 1J58A 3FUQA 4UFLA 5T3NA 4FAGA 4AVBA 2X5IA 1RVF3 2YBDA 3OD4A 4I02A 5DAWA 4XMIA 5FZ9A 4AWDA 4YZ1A 2A5ZA 3H3ZA 4YVSB 3ZFGA 3N35A 4M3CA 2VMHA 3ZFGB 4S2DA 2GNDA 3V0AB 1MEC1 2C24A 2V4VA 2LUWA 1VB2A 1J84A 4P02B 2QQPA 2YUEA 5C8WA 5FPZA 5FKCA 4FXGB 1VRH2 2PFWA 3E6DA 4AI3A 1OLQA 1SEFA 3GF6A 1YFYA 3N9MA 5FYBA 1UW8A 2W68A 4MHUA 3VD3A 4QQ2A 3VZKA 3ACIA 4PI0A 4AI8A 4YVWC 5F2SA 2IV1A 5FPAA 2YBKA 3AP5A 2ZHMA 1JUHA 3M8LA 5FFOC 2H0VA 1WCDJ 5CZKA 5JAXA 5LB6A 4CP0A 1DQ5A 1GQGA 5FZDA 2OX0A 4P5YA 1OUSA 4IXLA 1ZVFA 1OBNA 3P3NA 4GMP0 3LGRA 4KGGA 4PIZA 1LGCA 4DRVA 3POJA 2FCTA 1Q3EA 2DCZA 1V6OA 3ZFEB 4PU7A 4CXWA 5GAHi 4QMAA 3IMMA 2PLV1 2VZTA 2YROA 2XONA 5GZCA 2IC1A 1IGOA 1PHMA 3OPTA 2HWF1 4IV1C 2GC3A 3H7YA 2ODRD 1MS3A 4CSWA 1PGL1 4X4CA 4XJAA 4XYXA 1PNFA 2EIBA 2RDRA 2OZ6A 2WS91 3L2HA 2R6QA 5KXBA 1HN0A 1HRV1 1VBB1 4YW6A 1XNBA 1AJKA 2B46X 2K46A 5F3CA 3PUSA 1BBT3 3AP6A 4P00B 2LS6A 3ALQA 5GAGi 1W0PA 1Y4WA 4YGBA 1BHGA 2IXHA 3PVBB 1KS4A 1EPZA 1CJDA 2HYKA 4XQDA 3AZWA 4AI9A 3JUUA 2PUFA 3N9QA 5KHKA 2Q1MA 4JHZA 1XNAA 2JB4A 1NZCA 4WM7C 1HQNA 2J42A 2BFUS 3A22A 1SLIA 1W2TA 2Z42A 3B69A 2PXQA 1UYXA 5H9RA 3OGGA 5I0SA 2VMFA 4XJZA 5D8AA 3U1XA 3VD9A 4GH4B 2YFUA 1IPKA 3BTZA 2BDRA 3F51A 3KJXA 2VVFA 4XUTA 5LCWL 1IHMA 2HWC2 1UXCA 1F15A 5FLHA 4FSJA 2VOXA 1NT0A 4XJ8A 4YZ3A 5I91A 1SLCA 1DF0A 1OXCA 4V2WA 5EZWA 4YFWA 3F52A 1G9CA 2A6WA 3I3EA 2R0HA 1MS0A 1LKNA 2QQLA 2ZHLA 3MIBA 5DG2A 4BU2A 2JVLA 3E6BA 2ZX1A 3WNPA 3BU0A 4Y5Z0 1WH6A 2WUHA 3IDEA 2A73B 3NKGA 1XYPA 1ZX5A 2CAVA 4UW5A 3C7EA 1YQ5A 4AOCA 1RITA 3IAQA 5TSWA 1ODMA 1W05A 2XKPA 1F31A 1POV3 4GB33 4Q4W1 1OD5A 3JCIA 5GM0A 3UGHA 2DU0A 2QTWB 1UY2A 4N43B 3VHNA 3EQEA 2DURA 4AHZA 3WNKA 4GMP3 3KQ4B 5FYIA 2MQKA 3VBHB 3VBHA 3ILNA 3FYAA 3PUHA 4A7KA 2B5HA 4L99A 4JAAA 4YYOA 1NCQB 1IPSA 2JDMA 2C6SA 4RFT0 4BIFA 1X50A 4PJYA 1ZVVA 3J7MA 4L11A 4I3PA 1UY4A 1GYKA 3R6SA 5J37A 2BBAA 1ZRCA 3SHRA 1PX3A 2PLV3 3B3QE 4O9GA 2ZGLA 3RJRA 4AK3A 4Z5CA 1LEMA 4DUVA 2WNVC 4PDWB 4QGNA 4XFIA 2AZ5A 2XJPA 2VW2A 3SQOA 1CGPA 3QOWA 5A3OA 1ASJ2 1G7YA 1Q8SA 2VW0A 3PVEA 4CDQB 3QQ6A 2ZGUA 4X8NA 4LQRA 1NERA 1VBB3 3GCWA 3M9LA 1C4RA 4MO3M 3E5UA 3WDYA 2QBXA 4FFGA 3LOBA 2EVXA 2Z2SB 2JD4A 1NKGA 3ZYGA 1MACA 1WGPA 3Q8CA 3NAPA 1DQ1A 4JX0A 2XIUA 4FN3A 1YI9A 3MW3A 1SPPB 4K8FA 4QX3A 3O1VA 1KFUL 1RHI2 4JCKA 1AZDA 1JFTA 2HWE2 3O1RA 3DNVB 4LUKA 1H1MA 4MXVA 5JR7B 5IHRA 2QUOA 1DGRN 2WZPP 3FFQA 3I2KA 4KWKA 3VBSA 5L9VA 2UWCA 3IDCB 4FQZA 1K5MB 1V9U2 4PF5A 1A6CA 4MXWA 4I6TA 2ICPA 5GLWA 1JI6A 4Q1RA 2DYCA 4QPYA 4MGYE 1AR72 3FHAA 2QQKA 2PXVA 4HN1A 2YMZA 4ER7A 2C1FA 4R52A 4RSUA 5FTTC 2E6VA 3ZPYA 1V00A 4BQ4A 5A1AA 4J1XA 4GWJA 1XPWA 1XOYA 3USSA 1S0CA 1QOOA 3JXBC 2VNRA 4L0PA 4LBLA 4C90A 3B7MA 3THDA 4D94A 1O3RA 4EWEA 1GP6A 2R49A 4UFHA 4X6RB 1KITA 4MADA 2IXCA 3EXUA 2D5FA 3D8CA 3LB9A 4DMIA 4NAMA 3ZXLA 5GLUA 4AL9A 1LCDA 5A3MA 4IA8A 4J6GA 5LY2A 2WUSR 1GZ9A 4QM9A 1H8VA 4LO4B 2RS51 3KV5A 5A7QA 4CU8A 4YARA 2G9GA 1SCRA 4GMP1 1PO23 2WRAA 4LR4A 3VBSC 1ND3B 5LBEA 3AYAA 1POV1 1K45A 4GB31 5FPVA 3T3YA 4FVVA 4LK6A 4R8HA 3WW4A 2DF7A 4MGZE 4BQ2A 2VNOA 4TLFA 1SLTA 2JDUA 5FKBA 3ZVXA 1RUH3 2JG8C 1NE4A 4YGEA 5F2WA 1GT0C 4FPCA 2RMU3 2WT2A 1F4HA 4AR2A 2AXUA 4NDWA 1ENQA 2WLPA 4LK7A 1YSEA 2QDRA 5EPAA 5AVPA 1JZ7A 3VUOA 3N7KA 3ZPOA 2OT7A 3MHZA 3WDUA 5DZEA 3MLJA 1DGWX 1H8TC 1OKOA 2VU9A 4G9SB 3VZJA 3WUDA 5AC93 2WSUA 1UU5A 4RYDA 3SKJE 2X10A 3IDBB 2CROA 1UY3A 2FCUA 5JZGB 5JZGA 1JYVA 4XQWA 3ABZA 2XBO3 2TBVA 4EYUA 5GLTA 2CDOA 3WW2A 4N53A 2FCVA 1VLNA 2R071 4PBPA 4W4ZA 1QJZA 3R4SA 1A3KA 4GH4C 2VOKA 3WVJA 5BNOB 2PHTA 2OKXA 1NY71 4H2AA 1DGWA 3D82A 4IVZA 4HK9A 1V6MA 5FZOB 1Y43B 3NQHA 4KU8A 2GMPA 1COV3 2JIJA 3I2IA 1ZZ9A 4NPMA 3SCGA 2PUBA 3VV1A 3ZR6A 1LCCA 3GYDA 2YHJA 2DFBA 3FX3A 3RZHA 2FDFA 5FP9A 3CECA 2ILMA 3P6BA 4A6OA 3JBG2 4MCTA 1O7FA 2AUWA 1R1ZA 4HK8A 1S0GA 4LE3A 5FREA 1RUF1 4F7ZA 5DXDA 1RUOA 2B9UA 5FY4A 1UAIA 5IVEA 1N1YA 3NVCA 3QH7A 3VBFA 1O5UA 3RG0A 4D6RA 3ZXEA 2LTNA 1AXZA 3N9OA 5FIXA 3UESA 4YM3A 4INDA 4FPHA 4LMFA 5FZ0A 3RI8A 5BNPB 2ZPXA 3U75A 1RUJ2 3MFAA 5FYYA 1QXRA 4RS5B 5DZFA 2AWIA 1LHNA 1WMDA 3IB3A 2HWB3 2DTWA 2XUMA 1ZBA3 1LCLA 5AFEA 2W1WA 1UF2C 1UZVA 4HKOA 4YG1A 3VB9A 4A7YA 2PXFA 1QWRA 2CTVA 3ZOIA 4DNYA 4H7MA 1QHDA 4NIGA 1OLMA 3QWGA 1FMD2 2W1SA 1TE1B 3MW4A 5LRSA 4K6BA 5FP3A 4K8RB 4YVWB 4CUCA 4LBQD 4Q8LA 3AZVA 3M7AA 4Y1UA 5IFTA 1DZQA 3N4MA 2AUYA 1G86A 4PIYA 2AREA 3R1FA 3H8UA 4DEVA 4A6SA 4AVVA 2UU8A 5BNOA 4LNVA 3LPFA 1OH4A 3RZJA 4MV2A 3G0TA 3FHIB 1MS9A 5DDJ3 3B94A 2SLIA 1NW3A 4JDOA
chains in the Genus database with same CATH topology
4Z1VA 4URTA 3O0XA 4OFGA 2MEV2 2FMDA 4PU8A 4M3CB 3BS3A 1CVNA 5DUUA 3TN93 4MCXA 3FZ3A 5GLVA 4QXKA 1W6QA 3MI8A 4DOUA 4E27A 2IUOA 1VBE1 1XNDA 2JKBA 3M2MA 4Q8KA 3ZMOA 5JZGC 2I45A 1OMIA 2C5DA 4AEJA 2W0XA 4Q0SA 4COZA 3MLKA 4QPGC 3WOGA 4EN9B 1SCSA 2O4AA 2VUAA 1UN1A 4QQHA 2O38A 1AYM2 1PZ9A 4Q0UA 4CEYC 2EA7A 4JGZB 1HV0A 5IK4A 4CYDA 1TQ5A 5C33A 4Y26A 2D5VA 3ZSKA 1SMVA 4Z82A 1CPMA 4I0WB 4CP1A 1OA3A 2X5IC 4SLIA 3KT4A 4K40A 5F6KA 4WVWA 3MF9A 4FTBA 3MPBA 1ND2A 1XE8A 2ZGKA 1ZUGA 4LO8A 4Y1ZA 1LHVA 3ZYRA 1VBD3 1HXS1 2XHKA 4I0BA 4XIOA 1RUJ1 3WINE 1JN2P 1AJOA 4YG6A 1H9WA 2JG9B 1UCXA 4XF0A 4LBOA 4XETA 2ATFA 1PGW2 2A6YA 4QU2A 5LEKA 2RM21 2P17A 3FFZA 3FE5A 1AX0A 4CDXC 4LA3A 4AXOA 1IS4A 1J3RA 1KS5A 4Q4V3 3KZ4C 2Y38A 1FYUA 3KB5A 4YVSA 4Q2FA 3JBG1 1SDWA 5CFDB 5DDJ1 2PAEA 1SBEA 4EROA 2GZWA 2ZMLA 5GZDA 2XI8A 3WP3A 3WW3A 1QNYA 1SBDA 1GLHA 1RUC3 2GC2A 1FT9A 2ETEA 1CAUB 1JYIA 3DPRC 5FQ0B 2BEOA 1R1A2 4QQPA 3I2DA 2WKKA 2W08A 1S0BA 3LKJA 5GALA 3BIWE 5CG9A 3URFA 3IPVA 2R63A 3NWKA 1G9FA 4XFCA 3T1MA 2P3KA 1YRZA 1QJU3 3OBRA 3POYA 4ATFA 2FZ1A 3KT7A 1OLRA 5DUWA 4Y20B 1KQRA 1YIPA 2ZA9A 1GICA 3KD4A 1RUI2 4FCAA 1FATA 1CESA 4B7KA 3DKWA 2ES3A 4U2AA 3WDXA 1OQDA 3ES4A 1R083 2GALA 1QNWA 1XE7A 2IVBA 2I07B 2K2SA 3KMHA 1W0OA 2RS52 4AYUA 2NYYA 3O14A 1W6MA 1O3TA 1ULDA 1VBD1 1X36A 3MEPA 4GIQA 3ZSMA 5CFDA 3VBUC 4ATEA 2ZMKA 2PUGA 1RUF2 3VBUB 4X4BA 4LO7A 2GAUA 1YFXA 3NKTA 4R9CA 5A33A 5EFUA 4RR3C 1DW9A 1HRI3 3OQMA 3AFKA 4I01A 2PHLA 2WIIB 5A32A 2YGLA 4P5HA 5KHIA 1MS4A 2WL1A 4JGYB 2CYFA 3JQXA 4HVRA 4UBGA 1Q8VA 3SITA 2VH9A 1MZFA 3G6JB 3IIAA 5FBZA 3ZFFC 2XJSA 1HW5A 2O0OA 3BPZA 2HEWF 4RQPB 4ASMB 3B5LB 3JBG3 4QHBA 5HCAA 2P2KA 2Y0OA 3VZLA 2XJUA 1RINA 4OZXA 4QPIA 1R1A1 3JB4C 2BBVA 1CAXB 3WCRA 4D3WA 3UK9A 1NCRB 1RZSA 2Q1ZB 5F6LB 3PJYA 4LEJA 1UTXA 3GZTB 4WVMA 3AP4A 3V65A 3D0SA 4EN7B 1UU4A 4GALA 1QJU2 2BW8A 3H5TA 4X6QB 4OI0A 1UIJA 1OSGA 5T5PA 1W2UA 5KHJA 1RUE2 2AR6A 4E2QA 1IS6A 4MGIE 2R1JL 1BEV1 1Z7S2 2R073 2D6KA 1WW6A 4EN0A 1QOSA 4JCYA 4BIOA 5J98B 1QDOA 1DFQA 2OUJA 2UWAA 2GNBA 3OYWB 2ZGTA 4XBLA 1LLIA 3FLRA 1MQTC 2ZKNA 5A3LA 3OQNA 2R062 2DWRA 4DB5A 1CQTA 1X2LA 1QXPA 1FX5A 2H0BA 2CGOA 2JJ6A 3IWZA 3L2YA 3QACA 4CDUA 1RUF3 3MZHA 3OBTA 1URXA 3CO2A 5FAXA 2MEV3 2WZR2 3AMHA 5JDBA 2VQAA 1RUI1 2YY1A 3VDDA 2PTMA 5FRAA 1PK6C 2CGNA 3WG1A 2PUEA 1Y3TA 5JSPA 1VBC2 2BPA2 4I6UA 1DHKB 4Y1YA 1Q5OA 4QPIB 4DXZA 3ACLA 2HWE1 3DPRB 3U11A 1JW6A 5CBLA 1NXMA 1AYM1 4B8EA 1Y7BA 4MVTA 2A6VA 1HV1A 3CU7A 2P37A 2L8NA 1W6PA 4AEDB 3RMYA 3WDTA 2BNMA 5HBAA 2EF6A 4LHLA 4AVAA 2FBEA 3MIHA 5K0UB 1ZZ7A 3FWEA 4P9YA 2XSDC 1Z7S3 4C1WA 2OZJA 2O49A 2O8OA 4IEWA 4QGLA 3ZSEA 1U5IA 2QNKA 3CJIB 4IESA 4EN6B 1RJ7A 2OYZA 4BZ4A 3MLFA 1NQDA 3HQXA 4TYSA 5C9AA 4IERA 1BCXA 1EP0A 4JDMA 3UKNA 2R063 3B93A 2ZCWA 4GH4A 4ZKTB 4FTSA 3NW4A 1Q8PA 2RR13 1OOPC 2A3WA 3VBOB 4X4IA 5KC6A 1PNRA 2CNAA 4P9IA 2DFCA 3AJZA 2ZGNA 1VRH1 3NL1A 4XQ4A 2BVBA 4R9DA 2RS33 2WZR1 4FPYA 4K7JA 1H8TA 2ZGQA 2AENA 4AF9A 2ZZQA 2NPIA 1NOVA 3WG2A 2D6OX 1B0NA 3AYDA 3DPRA 4ES9A 3RDIA 5ACA1 5J36A 1WCKA 1JOJA 2HWF2 1RUC2 3ASIA 5BNPA 3AXDA 1DZRA 1AF9A 4P9JA 1D2SA 3ZO0B 4YLZA 2HSGA 1RUI3 2NMNA 3FYMA 4NVPA 3ROUA 1XNCA 1PRAA 1JTZX 1X8EA 3I54A 2BJCA 3LA3A 3NV3A 2PHWA 2L49A 2IFWA 3GN5A 4XILA 2WNUB 2RM23 2RS53 1NA1B 4L8QA 2B45X 3ZXFA 1JUIA 1DYPA 2HINA 1LOGA 1ND2B 3O7OA 1VBB2 4Q4V1 3WQ1A 2AXZA 1V6KA 2BNOA 4N90A 2E63A 5D1IA 3IKWA 1EV13 2RJKA 1PGL2 1LHUA 3MYXA 2PLV2 5LK7B 3KT1A 2PHDA 1HRI2 1RTVA 3LSEA 1LOCA 4FP2A 3WR0A 3WG4A 4B4RA 3DN7A 4EWAA 1BMV1 2ZOEB 3WP5A 1TME1 4RHV1 1ASJ3 1RZRA 1RIOA 3V0BA 1V9U3 3VZOA 3VBRA 4AQSA 4U36A 1QXJA 3IMNA 4K3UA 2DTYA 1Z7S1 3RRDA 1S2BA 4XF4A 3LSDA 4Q4Y1 4NPRA 4HLTA 1W6QB 1SLBA 5ABJC 1JXNA 5CADA 3NAPC 5BNPC 2VULA 4HPKA 4QPGA 2XGXA 4UXAA 1NQJA 2UYAA 2VPVA 3ATGA 1MEC3 3HT2A 2ZX3A 2PPXA 1ND3C 3LFPA 1UZYA 3WNXA 1GSLA 3JXDL 2OR1L 5I0TA 1QF3A 1H1IA 2YYOA 4FOYA 4Y22A 3QCWA 1HX6A 3GN5B 2QDNA 4N43A 4YZ5A 1CIWA 4GQ7A 2JDZA 2BNNA 1SLAA 1LECA 3H9AA 3AYCA 1H4HA 2LALA 4MZUA 2R041 3UJQA 1C1LA 1YO8A 3INAA 1G9DA 4M01A 1N3OA 4XHXA 2PHRA 5BNOC 2RS13 4XZPA 4JV4A 3OPZA 4M0HA 2NMOA 3AMMA 2A75A 2R072 2KXLA 2XKOA 1U12A 3A0NA 1LU1A 3AK0A 3AKTA 3UFDA 3EHKA 3LZZA 2VUJA 3ZYJB 3V0BB 1O3SA 4QX5A 1GANA 2H8RA 2GMMA 4YBAA 1GNZA 4IEVA 2RMU2 1PRVA 1VBA1 2XWJB 1HLCA 2OUHA 2HWD1 2WNEA 3IN9A 4PBOA 4AEDC 4MXWB 4NHLA 1VALA 1ASJ1 2GSYA 3C3VA 5D8AC 4LHKA 3VBSB 1QQP2 2KEIA 1QJX3 2A70A 1VJ2A 4H14A 1MS5A 1MZ6A 4XFAA 4CDQC 3S8QA 4Q26A 5E88A 1H2LA 2D97A 3VLBB 4LUMA 4XDQA 1ENXA 1LODA 3W9AA 3VZMA 2E7TA 2PELA 2PN5A 3I59B 2HWD2 1AUYA 3I59A 1DBNA 4QQOA 5JPNB 1FPN1 1BDIA 1VBC3 3I4IA 2A3XA 1COV2 2VGDA 4BYYA 2EXJA 1IKPA 4XJWA 4K21A 5GKAC 1N1VA 4YG4A 4N7IA 4E4ZA 1C1FA 4KQ7A 5CU1A 4YM1A 1UPIA 2B5AA 3MIFA 4ORFA 2JEMA 5A7LA 1N1SA 5C8CB 2Q4SA 4Q0VA 4N43C 4EWDA 4I09A 5J96B 3KM5A 1ULEA 2RHPA 3RS6A 3M3CA 4GHJA 4XFHA 5BV6A 2I74A 5FOBB 5JSOA 4MX3A 4KWLA 4KNCA 4FPOB 2KM2A 3DGTA 3TNPB 4YSFA 2GZUA 4UW6A 3HAGA 1ZS4A 2ZGMA 3O12A 3TRBA 1EAH1 1KDMA 1G9AA 1C8NA 1ZBA2 3R0RA 3FUOA 1C8M2 3KQRA 1S0DA 4AI0A 1IS5A 1ONAA 5CG8A 4Z07A 2JE7A 4N9HA 2H6BA 1PVC2 1FMD3 2SBAA 2P34A 2RS11 5FO7B 1KJRA 2VNGA 1NCRC 3C2UA 2VQ0A 1CD3G 1PIV2 1WW7A 1PRUA 1IKQA 3AP7A 4MUVA 4AVCA 3WHTA 3FMGA 3J8F1 3CLPA 5CFCA 5DUXA 2PQQA 1YLLA 3ZXDA 1AHSA 1AX1A 5FMOS 5C4WB 3W59A 1TMF3 3GALA 4AQTA 4A7ZA 5AVAA 3ZFFA 4GXLA 2K0GA 4C91A 1OSLA 4XJ9A 2ZGRA 3H3UA 3I8TA 3SISA 2RM22 2VVDA 1GBGA 1EPWA 2XJVA 4BWOA 3A4UA 3VHPA 4RR3B 1YIFA 3O5SA 1IPJA 1GNHA 1ULGA 1AYN1 2EXIA 4S2GA 4CEWB 5BPXA 1D2QA 4CEWA 4E9KA 5C8CA 2UY9A 3O0VA 3VGIA 4R9BA 1WLCA 2XBO2 2E7AA 2CSFA 1WCSA 1XU1A 4P9LA 3CL1A 4WM8C 2PIJA 1GV9A 1MQTB 2PUAA 3ECQA 3E6CC 5KHHA 1NYWA 4XOGA 5JMCA 5L7OB 2MHFA 4NWVA 4I30A 1ZZ6A 5J3UA 3WD5A 3VN4A 1RMU3 4WBBA 2LYKA 4YW1A 4DINB 1SBFA 2D3SA 1JWLA 5BY5A 1ZM1A 1G8WA 4COWA 1RUH1 1XXNA 1CAWA 2JG9A 1T6GC 3WQ7A 3NV2A 2ET1A 3GZAA 3GNEA 1PO13 3RYPA 1PVC3 1BVVA 2EIGA 2WNUC 3PHMA 5FLIA 3B7HA 1AR82 2MPFA 4OHZA 2ARBA 3HT1A 1FMD1 4I3GA 5AC91 3QLQA 2D44A 2WC2A 4MH0E 2EF8A 5T50A 5KC5A 2NP0A 4IV1B 2Q0AA 2XBO1 4RQPA 4KGQA 3WP6A 3LOIA 5C4WC 1QPZA 3ZHIA 1M4WA 2DU1A 2P3JA 5K8SA 1YJLA 4FPFA 1E57A 5B2GB 2UURA 1OA4A 1ZBE3 4WM8B 4YW3A 2WFPA 2IXLA 4RD7A 4XFFA 3ETQA 1JFSA 4L97A 4E4DX 1N3PA 4YNIA 3THPA 1VB4A 4XJUA 1R081 3T1LA 2OA2A 1RC6A 2HWB2 4JTNA 1XYNA 3KCXA 2ET7A 1AL0G 4YGDA 4WZFA 4D69A 2JCGA 4CDXA 5JIUA 5BNNB 2EXKA 4CDXB 3JXCL 2XWBB 5KXEA 3ZN6B 5E1RA 2F6BA 3ZN6A 5LEJA 4B7EA 3AXEA 1PIV1 1AL21 1V6N