1ZZBA

Crystal structure of coii hppe in complex with substrate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
total genus 42
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zzbA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zzbA02
4IEYA 4FAGA 1X7NA 3D82A 2PUGA 4WVZA 3BDNA 3ACLA 4MX3A 4LULA 1ZZ8A 1CX4A 2O8QA 3H7JA 2D5VA 2D5FA 5EFUA 1ZREA 2MEZA 4I09A 4MGIE 1EY2A 3UKTA 4E2SA 2EVXA 2IXJA 4YSFA 1XWRA 2BJCA 3JXDL 2MHFA 2EF8A 4HVQA 5I91A 4Z82A 2ICPA 1CAXA 3S7EA 5I0TA 1ZPQA 4PU3C 2ET7A 1LB2A 3ELNA 4YRDA 1YFYA 3LA3A 2GZWA 4Z5HA 4FBFA 3SXWA 4IEVA 1ZS4A 3QWGA 5JCTA 3RPQA 1O3TA 3EBRA 2LYQA 2EWTA 3JZVA 2ICTA 5LEJA 1Q43A 4R8HA 3BB6A 1QXJA 4TLFA 3RDIA 1Q3EA 2VECA 4O8BA 4UBHA 2B5HA 1ZX5A 3ES4A 4XF1A 3WW4A 1E3OC 2VPVA 2PPXA 5I8SA 3MLFA 1EYBA 3E97A 3ZHMA 3LISA 4HSJA 3ZHIA 1UIKA 1X8MA 2IVQA 1GT0C 3E5QA 1O5LA 4IEZA 5J3UA 1CQTA 4FAHA 5J48A 4PJYA 3SHRA 3ZDSA 4XF4A 3H3ZA 4AVCA 1ZZBA 2GU9A 5E1RA 5J7MA 4IERA 4GULA 2OZJA 1I6XA 3IIAA 2XL7A 3LZZA 1SQ4A 3EJKA 1QXRA 3OCPA 5I93A 1XE7A 1QQBA 3NJZA 4MUVA 3S7IA 3WW2A 2DCTA 3CLPA 3UFDA 3PXPA 3N4MA 1WETA 2ZCWA 1IPJA 2QJVA 4XFCA 4EWEA 1EP0A 1NE4A 2BEOA 5JR7B 2GRMA 3EO6A 3FWEA 4I0AA 5BPXA 4KU7A 1JH9A 3GN5B 2F4PA 4Z58A 3DNVB 1PM7A 4R52A 4EROA 2V09A 2PUCA 3I7DA 1DGRA 4O9GA 4KWLA 4IEPA 5EZWA 3NSTA 4I2OA 4JVAA 4ORFA 3KMHA 1NYWA 2ZKLA 4OFGA 2Q30A 3HT2A 5KHKA 1GQGA 2LYKA 2IXKA 1O3QA 2OA2A 3OGJA 4O9EA 2BNOA 1NXMA 4UXAA 1JFTA 4JQDA 2XLFA 3O9XA 1BDIA 1LQCA 3OQOA 4OB4A 1QWRA 4QXKA 3B02A 3QF3A 3F51A 2XLAA 3H1MA 5BXXA 3ETQA 3E6DA 3S8QA 4MH0E 1IPKA 2PFWA 3H8UA 4PU8A 2GRLA 4LUMA 3BPZA 1PRUA 2IXIA 4IEQA 2UY8A 5FPXA 2XKOA 3LFPA 3CROL 1ZUGA 2E9QA 1DGWA 5FQ0A 1QP7A 1UD1A 4HBNA 4IVZA 4YG1A 2B8MA 2CAVA 3JXBC 3BCWA 4WBBA 1RZRA 5F1RA 2LYPA 1R69A 3G7DA 1RZSA 1YFWA 2K0GA 2XJ3A 2O1QA 4D7TA 1VR3A 2XL9A 3U0ZA 3JXCL 1V70A 3LA2A 1L1MA 5BV6A 1OSLA 2IVBA 4IETA 4X4BA 3SCHA 3E5XA 1HW5A 4HVOA 4I3PA 1OCTC 4I0BA 2HSGA 1XE8A 2PA7A 3B7HA 4Q29A 3PNAA 1JFSA 2PIJA 5FCCA 2PE5A 1YWKA 2PAKA 3OTFA 3OD0A 2H8RA 4BHPA 1Y7YA 1J58A 5AVPA 4F7ZA 3U11A 4XF0A 4DINB 1NERA 2PUBA 3IDBB 4L2NA 2AW6A 3FYAA 4Q0VA 3F6WA 3DV8A 4N9HA 2O38A 5K8SA 1LLIA 2P17A 4L11A 2KEIA 4Q0PA 4EV0A 5JAXA 3MZHA 2UY9A 4KWJA 3D0SA 4QM9A 2OZ6A 1L3JA 3CL1A 4IEOA 1SQ8A 1QPZA 4ZU7A 3U10A 1RTVA 3NW4A 5I0SA 1LMB3 1ZRFA 4J1XA 3DN7A 1J3PA 3FFQA 1PRAA 3BD1A 4KL1A 4QX5A 4X6RB 2CSFA 1CAVA 4D7SA 4BYYA 1CAWA 3NKTA 4LA2A 5BUVA 3H7YA 1O4TA 1YUDA 2PHLA 2KEJA 4IEXA 1YFXA 1PMIA 4HN1A 2PUFA 3OF1A 4HLTA 1FXZA 2HINA 2UYAA 1WGPA 3H3UA 2I45A 4HZFA 3WW3A 1RGSA 1X82A 4K8FA 2GC0A 1VP6A 3GBFA 2LYLA 4PIZA 5KHHA 1ZRCA 1QP4A 3DKWA 1PNRA 1IC8A 1G6NA 2XLGA 1EFAA 2XHKA 1EPZA 4QGLA 3CF6E 2PHDA 1RUOA 1SFNA 4I6UA 2OR1L 4PIYA 4MGKE 2D93A 3FYMA 2XKPA 4KU8A 4YG7B 1O7FA 2OYZA 4LLOA 3ZKCA 4E2GA 2ETEA 4X4IA 3IBMA 3IWZA 4META 3EUSA 5FLHA 2KZ8A 3VK0A 1CAUB 3WW1A 1LKNA 1PRVA 2GC1A 4CYDA 4JCYA 2D5HA 4XFIA 3H1YA 5K98B 2IU7A 4XFGA 3U3WA 1CAXB 5KHJA 3EHKA 2R63A 1H1MA 3KJXA 3SCFA 5KHIA 1O3RA 2OPKA 1J1LA 3NL1A 4AVBA 2XCJA 2IXCA 4A2UA 3MYXA 1OFNA 2GZUA 3PLQA 2Q1ZB 2QNKA 4IA8A 1AU7A 2AXZA 2GC2A 4AQ6A 2H6BA 2AWIA 4H7LA 1B0NA 3UKVA 2WIUB 4AVAA 2GAUA 1Y9QA 4MCTA 5FPZA 1UTXA 3ST7A 4YBAA 1CJGA 1UPIA 3RNSA 1NZCA 3R1FA 4X4HA 4NDWA 2FQPA 1QP0A 3H50A 3LAGA 3O14A 4Q0QA 4QMAA 5CADA 3HT1A 3MDPA 1DW9A 3QQ6A 2BGCA 4Z5DA 4XFFA 2GH2A 5I8TA 3QYXA 4HSLA 3FX3A 4X4EA 5FLIA 4Z59A 2QCSB 3L2HA 4NVPA 4XFBA 4XETA 3E6BA 1JUHA 2JVLA 3LA7A 4XEZA 1RUNA 2BNMA 3IDCB 3RYRA 3KXAA 5LEKA 3CJXA 1DWKA 4HMZA 1H1IA 1J3RA 3FMYA 4I6RA 1QQAA 5I0UA 2C0ZA 2HKXA 3H9AA 3C3VA 4XFAA 3I54A 1RZRD 2AUWA 1XRUA 3EQEA 5KHGA 2FJRA 4Q0UA 2B5AA 2IV1A 1UCXA 4E2QA 2LYSA 4Z5CA 4I8TA 2IC1A 1O5UA 2A6CA 2KEKA 2O4AA 1ZAYA 1PERL 2Q0AA 2L49A 1R63A 2MQKA 1UXCA 2D40A 2KXLA 5C6CA 1RC6A 2PUEA 2PQQA 5JSRA 5HI0A 1ZZ7A 3M70A 1S7EA 3FHIB 2PTMA 3KSCA 1YSEA 1YLLA 3I59B 2PUDA 3OQNA 4HN0A 1ZZ9A 2L8NA 1ADRA 3E6CC 3LOIA 4EWAA 2QDRA 2K9ZA 2Z69A 4QGNA 2OFYA 2WFPA 2Z2SB 3RYPA 4LEJA 3F52A 1DZRA 2BYVE 3BU7A 4GHJA 4QM8A 5FDBA 2PUAA 4PU7A 4MGZE 3OP9A 4GQMA 4YYOA 2CROA 2VQAA 4WZCA 2AXUA 1RL3A 4X4FA 3CLCA 1BDHA 1FT9A 1LCDA 2EBYA 2N7GA 4QGMA 5LRRA 4AQ2A 3UKNA 4MZUA 1HF0A 3FJSA 2IVGA 3LWCA 4IEWA 1I5ZA 3E5UA 4HVRA 3R6SA 1ZRDA 3TNPB 2ATFA 1WA4A 2IXHA 5A7LA 4J1WA 3VHRA 4MGYE 5D1IA 1ZVFA 1O4XA 2H6CA 5CVRA 4ZU5A 4OLLA 1U12A 2B9UA 2XIUA 2PAMA 2PAEA 3NVCA 4AXOA 1CAWB 4IESA 1DZTA 3KZ3A 1X8EA 2IUOA 3IVPA 4I6TA 3CECA 1RPEL 1ZVVA 5KBFA 3CEWA 2JCGA 5BY5A 1WLTA 1SEFA 4F8AA 4IEUA 1VPWA 1UW8A 3KCCA 3OMTA 1WIZA 5FQ0B 2PYTA 1CAUA 4RD7A 3SCGA 2H0VA 2Q4SA 3D0JA 3S0MA 2AXVA 4JV4A 3ROUA 1UXDA 4UBGA 4I02A 2LYRA 3TNQA 1NE6A 2CAUA 4X6QB 4B29A 1O3SA 3USSA 5JSPA 3QACA 2GC3A 2ET1A 1CGPA 3BS3A 2XSDC 3I59A 2LCVA 5CU1A 4P9GA 2BNNA 2CV6A 1ZZCA 4FBIA 3OQMA 4FT8A 4BIFA 1OI6A 2CGPA 4IWRA 3G5GA 3GN5A 3MPBA 1LR5A 4JTNA 3GYDA 3HIFA 3QOPA 1CAVB 3RYKA 2IXLA 4XF3A 5I0RA 3ES1A 4X4GA 1Y3TA 1VJ2A 5E16A 1JWLA 1OD5A 1ZZ6A 3CO2A 5C8WA 3H5TA 5JSOA 4XFHA 4MCXA 1OMIA 4LA3A 2O49A 4ZU4A 4YARA 4F8DA 4FN3A 1GQHA 2MPFA 1WH8A 4MV2A 4X4CA 1ZNPA 5T3NA 4YG4A 4Y42A 4XF9A 4I01A 2XGXA 4X4DA 2EA7A 1FI2A 1J3QA 3PVBB 1NEQA 4KWKA 1X57A 1YHFA 2EAAA 4N9IA 2R1JL 3FZ3A 1J59A 1ZRRA 4LUKA 3SMHA 1TQ5A 1WH6A 1UIJA 2UYBA 2XI8A 5I8YA 4YNIA 2WC2A 3KGZA 1X2LA 2WUSR 1LCCA 2LYJA 4PU4C 3FE5A 3M3IA 3DL3A 4Q0SA 1YFUA 1RIOA 3TRBA 4BH9A 3HQXA 2MNGA 2FMYA 4Z07A 2QVSB 3KGLA 3D1NI 1POUA 1Q5OA 3HZIB 4LTAA 4JCXA 3H1WA 3L1PA 2Y0OA 4EWDA 4JTOA 4PIXA 5FLJA 4ONUA 1LRHA 3BALA 5LRSA 2KPJA 2HJIA 3RZZA 1QY4A
chains in the Genus database with same CATH superfamily
3LB9A 2JD4A 2PHRA 1WMXA 3KHBA 3LD8A 1X7NA 3GHMA 4FAGA 5GLTA 1QOSA 3W59A 5DZFA 1W90A 1SPPA 3TEYA 5FZ7A 2QQNA 2GH8A 4XUPA 1UX6A 3I3QA 2JG8A 1S0DA 2R1BA 1ZZ8A 1CX4A 2LROA 2DBIA 3CJIA 5D2AA 2JQEA 1AYN2 1UYZA 1ZREA 4I09A 4XBLA 2J1TA 1IG3A 5DZEA 5FYMA 2F6BA 1OUXA 2EVXA 3TAYA 1QKQA 2MHFA 1IQAA 2EF8A 2ORXA 4CDUA 5SV8A 1ZBE2 3OUIA 5C8CA 2ICPA 1CAXA 3A7QA 2D7FA 3K75B 4P14A 4AGGA 4AOCA 1FNZA 3JXSA 4HPKB 3POYA 1UZYA 2ET7A 3SR4A 1YFYA 4Q4W1 1UXXX 4AI0A 4BMBA 5L36A 3MGUA 4D69A 5IAXA 5CG8A 3QWGA 2JDZA 4EKGA 4Q8LA 4HRAA 2ZS6B 1ENXA 2QE3A 4X8PA 1UOGA 2NPIA 4LOTA 1VBD3 3CHXA 2D6MA 1H30A 3QH7A 2B5HA 1NLRA 3VD3A 5CA6A 5FYIA 2V5DA 1IS4A 1UYXA 1XYOA 1YQ2A 3E97A 1VMFA 2RM21 2ZEZA 2R071 1UKRA 5JMCA 1OH4A 3AYEA 5E89A 2ZHLA 1Q8SA 2GP3A 4IEZA 3OGRA 5J48A 4JRLA 4PJYA 5K0UB 1ND2A 3O0VA 1ZZBA 4LBQB 4OZXA 4IERA 4RS5B 4PDWB 4GULA 2RHPA 3IIAA 3LZZA 5ABJA 3BGAA 3R05A 2HCNA 1EAH2 4GWMA 5CKNA 2PXKA 2ZGLA 4HKWA 4NAOA 3S7IA 3KLSA 2BPA2 3ZFGC 3UFDA 1OA3A 2XBO1 3ZYJB 3N4MA 4Q4X3 3BIWE 4HT1T 3UETA 4YM0A 3I2KA 2VZPA 4UOJA 3I2OA 4EWEA 1EP0A 3T2PA 3VBHC 3IAQA 4LO6B 2Y6HA 4I0AA 2QDNA 5BPXA 4C1XA 1AYN3 1WW4A 3J7NA 2R16A 3DNVB 1PM7A 1SLIA 2ZGSA 3OPTA 4NN0A 2A6XA 2VMHA 3SQOA 2WQ4A 5IVBA 3RMYA 1RMU2 5DUVA 1W8OA 1N3PA 2W1SA 3WX5A 2A71A 4DO0A 2ENRA 2JENA 3WNKA 1LEDA 1ND3C 5J37A 3MF6A 1NYWA 2RR11 2ZKLA 4JGYC 4BQXA 2YDEA 3JD73 4NHXA 2LTNA 4QPGC 4F3JA 1MZFA 1O3QA 2OA2A 3OGJA 2Q8CA 1R64A 4LQRA 2C4XA 3IIIA 4BQWA 4GKXA 2XLFA 1BDIA 3PIGA 1ZA7A 1CVNA 2A73B 3I4IA 1QDOA 4QXKA 2D98A 3WQ1A 3PUAA 2RMU1 3ETQA 3E6DA 3ZXDA 1FOD2 1JI6A 1LJ7A 2PFWA 2WNVC 4H55A 2WNVB 4PU8A 3VBOB 5IK8A 5F32A 4AI9A 3BPZA 2XXPA 5F3IA 2UY8A 2XUMA 1G9DA 5AFEA 4EN9B 1FOD3 2VW0A 3V64A 4B7KA 4B4RA 2FD8A 2Q8EA 4AQSA 3VBUA 5CKMA 1G86A 2E9QA 5FQ0A 5FY9A 4HBNA 1NA1B 3W9AA 4Q4Y3 3U4SA 2W95A 5HXVA 3BU0A 1RZRA 3LGRA 1R69A 1PO13 2QQWA 4QX2A 3G7DA 2K0GA 5JZGB 4ET7A 3ORJA 5EJ3A 5FR3A 1CZVA 3JXCL 1UZVA 2YUEA 1US3A 2IZWA 3LA2A 3POBA 1OSLA 4X4BA 1AL0G 5CEHA 1NOVA 4HVOA 5DT2A 2DUQA 4I3PA 5FY1A 3SLIA 4GKYA 2ARAA 1VIWB 2SBAA 1O8SA 3PNAA 3PVOA 3ZSLA 2PIJA 4BWOA 1GWKA 1PO11 1DBNA 2PE5A 1OLQA 5IHRA 1F4AA 1V9U2 1YWKA 3J7LA 1TNRA 2AACA 3OTFA 4A6SA 4OQ8A 3PUHA 2J1SA 5AVPA 5AC91 2J1UA 3CU7A 1V9U3 4OUSA 2CDOA 4HPKA 2WRAA 2TBVA 2AW6A 3U37A 2VXJA 5GM0A 3DV8A 1IGOA 4IE4A 2W68A 3ILFA 3LDBA 5DDJ1 5IVYA 4QPWA 5K8SA 4Q0PA 3AMQA 3TEPA 1EAH1 1PHMA 1H8TA 1V6MA 5CAZA 2VZOA 1GR3A 2WLQA 5D8AA 3MFCA 4DUXA 1AVBA 5ACA1 3J7HA 1RIRA 1RTVA 1DQ4A 1SCSA 2B9VA 2C9KA 2HWD3 5FYCA 2Y6LA 4AEJA 1LODA 2ADDA 1EPWA 1OKQA 3U4XA 2VNGA 1CONA 2RR13 4M3CE 4WM7A 5L19A 3LQCA 1GFF2 4NR1A 5C9AC 2ZABA 4LA2A 4R9CA 5BUVA 1FMD2 2QQOA 1O4TA 1RUJ1 2ZKNA 3VBRB 2PHLA 2PXJA 1GV9A 5BNOB 5KXCA 3GZAA 1PMIA 4HN1A 4LBLA 3B9CA 3DF0A 2JDNA 1FXZA 2NM1A 2WT1A 1OXCA 3A9ZA 4HZFA 2EAKA 1ND2B 4LBQA 4M3CB 3WW3A 1MACA 1X82A 2XQXA 1Q8OA 5FZIA 2J7WA 1RUF2 3KT1A 3GBFA 3VHNA 4PIZA 5ANNA 3NAPA 2R49A 2OS2A 4OI2A 2JKBA 3DKWA 4M0NA 3ME2A 1G6NA 1CX1A 4LO4B 4W6WA 2YGLA 1MFQC 3A0NA 5EIYB 5F5IA 5FZOB 1Y9GA 3K4DA 2YZ4A 2NYYA 4LLFA 1YI9A 4A6OA 1JZ4A 4P5YA 3FYMA 5L7OA 4KU8A 5LW9A 4CCKA 2J1RA 3O1OA 5LASA 2OYZA 4LK6A 3ZKCA 1W2TA 4LLOA 3GZTB 4NPRA 5FLHA 1H2LA 3MUY1 2HWC3 3WW1A 4P5HA 1PRVA 3TELA 5FZ8A 1HRV3 2D5HA 3O1TA 5K98B 2NMOA 1DQ0A 2DCKA 2UURA 3SCFA 4FXGB 4ARXA 5KHIA 1H6YA 2OPKA 1J1LA 2X53S 4RFRB 4WVMB 4YVSA 4BXSV 3W58A 4AFMA 2IXCA 2G9FA 1W99A 1JOBA 3RI8A 5LA9A 3ON7A 3W20A 4LJHA 1LEMA 2DVAA 4OQ9A 3OYWB 1WD4A 1OFNA 1VBB3 5ABJB 2Q1ZB 1HIXA 4IA8A 2YC2A 1AU7A 2MXDA 2AXZA 1A8MA 1V0AA 4AI3A 5FWJA 4GWIA 5FK8A 4AQ6A 1U2ZA 4BK5A 3UWPA 3LF7A 5LA1A 3Q8BA 3WF0A 1AYM2 1YJLA 3NRUA 1UTXA 4HXCA 2VQUA 4OZOA 3K4ZA 3RNSA 1NZCA 1I5PA 2OQ6A 4Q0QA 2KA3A 4QDQA 1GQPA 4QMAA 1BBT2 5JI9A 1PZ9A 3MDPA 3QQ6A 1ONAA 2XG3A 1VE0A 1RUH1 1ULGA 2BGCA 3NXHA 4DNYA 2GSYA 3CZJA 4A44A 3R0RA 3H8OA 4MGTA 2Y60A 5FY0A 4XETA 1VRBA 3JB8A 1JUHA 2JVLA 1POQA 1DYKA 1RUNA 1OH3A 1OQ1A 5FY8A 2VUCA 3MIGA 3POJA 1AR62 3OUJA 1JZ6A 3USUB 5EWSA 1D4M1 3WG3A 3ZN6B 2G4IA 2X29A 2YROA 4I3GA 4XCAA 1DWKA 5FMOL 2AGSA 4HMZA 4M0HA 1DU3D 1J3RA 4I6RA 1UZZA 2YPDA 3ZN6A 4E8CA 3SX0A 3FBMA 4DEVA 1W8ZA 1HN1A 2VZ3A 3HNYM 3MIBA 4M01A 3GZDC 5C5UA 4L97A 3PJYA 4Y20B 3H42B 3ABZA 3N9QA 2LM3A 3N9OA 1W6MB 4DQAA 1O5UA 2CWSA 4NAMA 5HCAA 2XJSA 4LHNA 3AXEA 5GZEA 2E7TA 2A6ZA 2HWC2 1LOFC 3URFA 5HPOA 1V6NA 1VRH1 3ZYRA 1SLCA 3N9NA 1PO12 2Q0AA 4FOVA 4D6SA 2MQKA 1AR82 1OVSA 4QQLA 3ZYHA 3F95A 1JYWA 1Q56A 1G7YA 2BFUS 4QX1A 1WBLA 5IK4A 1ALYA 2JDYA 3WHTA 2PTMA 3ZYIB 1YLLA 1UKGA 4D8MA 4E4SA 1UOBA 2ZHKA 4HN0A 2JIJA 1ADRA 4AHXA 5LZ6A 1LCLA 1QJU2 1MS9A 2K9ZA 2QDRA 2Z69A 3M3QA 2Z2SB 4QGNA 3RYPA 4CP0A 3F52A 1DZRA 3WVJA 3UNPA 3BKZA 1NG0A 2XXQA 5FDBA 4QM8A 2WAOA 4K7JA 2R072 4G9SB 4GAZA 2R063 3BPSA 3ZFFA 4K21A 5FKBA 2ZX4A 2VMCA 2CROA 5C4WB 1RUD1 1RXFA 4QB1A 4XJZA 5FP9A 3MIHA 4FP2A 4AFBA 5LK5A 2A75A 3USUA 5I0DA 2RVAA 4Q26A 2N7GA 4QGMA 1N1VA 3ZIXA 2DVBA 3TYJA 3OBAA 1HF0A 5FO9B 1WLWA 1DGLA 1H2NA 2HWD2 4HVRA 4ATFA 1GSLA 2ADEA 1W6OB 1WA4A 5A7LA 5JWPA 2FDFA 4NIDA 4NO4A 2RR12 3M3OA 4XUTA 4M4PA 5F5CA 4ZU5A 1STMA 2P6CA 2C5DA 2VOXA 5DAPA 4AXOA 1CAWB 4FOYA 3P3NA 1KXGA 1C8NA 1RUJ3 3T08A 3GUUA 1D4M2 2IUOA 1V6KA 4I6TA 3CECA 1RPEL 3M4FA 4QPIC 3CEWA 3WDWA 3FLTA 5DG1A 1QGLA 1SEFA 1VALA 3AFGA 1WCSA 1HV1A 1UW8A 2CYFA 4YG0A 4R9DA 4I30A 3OMTA 1GWLA 4YWAA 3LQXA 1H9WA 3O1MA 1QB2A 1MVQA 1RHI2 3D0JA 1NY71 3VV1A 1K5MA 5IVFA 2WO7A 2ZPXA 3ZSJA 2ZGKA 5L7OC 3ZFEC 2HWB3 2VD7A 3ILNA 4QDSA 3RSJA 5FYTA 2FFHA 1BEV3 2ZOEB 1VBC3 4AGVA 5L9VA 4D7YA 1HB4A 1VMJA 1MZ5A 2DURA 4P08A 5FOJB 1QJU1 2ET1A 3RGBA 3KF3A 1CGPA 4YW4A 3OSDA 4H14A 3CKHA 2NZ9A 4FFGA 4YZ1A 1LGNA 1R093 3OBZA 2WZ8A 3UJQA 3C7GA 5CFCA 2D6NA 2RM22 3GJAA 2LW8A 2JDMA 5FO7B 1TMF1 4CEWC 2RJKA 1H2MA 2XBO3 2DDUA 4GQ7A 1KEXA 4IWRA 1B35B 3G0TA 4CXYA 2R062 1LR5A 1LOCA 5A70A 3HIFA 1XE0A 1UU4A 3J4UH 4BOWA 2P1BA 1G9CA 4X4GA 5E16A 1VJ2A 1JN2P 2WAAA 2VEOA 1OOPB 3MV11 2XJVA 5C8WA 1OKOA 4RA0A 2IVIB 1RUE2 4CU6A 1JYTA 4AVSA 3MUZ1 3PHMA 5FZFA 1PGW1 3MIEA 2PQSA 5FY5A 2QQIA 2BJSA 1RUI1 2OPWA 5CNAA 2YBDA 4YARA 4F8DA 4FN3A 1GQHA 1V6JA 1H8TC 4MXVA 1WH8A 4Q4Y1 1IKPA 4COZA 5FK7A 4A4AA 3IMMA 1RMU3 2VZQA 4EYUA 4YG4A 5DXDA 2ZGRA 1FI2A 2EIEA 1NUKA 2ZGNA 1YYNA 1AJKA 3NROA 1F35A 1X57A 2VMEA 4IE7A 4JGZB 3UGFA 3JD72 2V73A 1AR73 3OD4A 4IV1C 4QU1A 3LDRA 1XNTA 2Y6GA 4RHV1 1TQ5A 4BPZA 1C8M1 4LHKA 5A32B 2X8KA 3SNMA 4E8DA 5BNPC 2XI8A 1UY1A 3T4VA 2HLEA 4YNIA 2Y64A 3WP4A 4LKEA 5FP8A 2LYJA 1MS8A 1OVPA 3PDQA 5E6HA 1NLQA 5BNPA 3AXDA 1XQNA 2W87A 4JQTA 3PIJA 1K5JA 4OUEA 3WDYA 3AM2A 4UF0A 3DEMA 2ZZQA 2FMYA 2LS6A 1QDCA 3A4UA 4A7KA 2VQ0A 3KGLA 4LTAA 1POUA 4XBNA 2D97A 3THCA 4EWDA 4IXLA 2HEVF 3O1RA 4Q2JA 1S0GA 5LRSA 2VMDA 1QY4A 4FPYA 5D8AB 2LUWA 4RL7A 5FZGA 1NT0A 1RVF2 3D82A 4GB31 3RI9A 1YQCA 4NHKA 1O4YA 4WVZA 1PGSA 4BB3A 3BDNA 1MEC1 4MX3A 4DMIA 4XXAA 1Z0HA 5JDBA 1XB9A 2O8QA 5EFUA 1COV1 1RVF3 1WA6X 3U14A 2MEZA 1QJZA 4YVSB 4MGIE 2WT0A 3RZLA 2RDQA 3FHAA 4M4RA 2CGOA 1JOJA 1Z7S1 2W5FA 2MEV2 3PTRB 3PUSA 3UKTA 1GBGA 2BJCA 3JXDL 1O8PA 2BWAA 5I91A 1C1FA 1HXS3 4Y24A 3DYPA 2KD7A 3IZOA 3MLLA 4U36A 3BIEA 4Q4W3 1AJOA 2NQYA 3NNFA 5J96B 1OPMA 3KQRA 5AFBA 5M0TA 1WZXA 4AFCA 4V1PA 2EIBA 1ZPQA 2WDBA 3ELNA 4YRDA 4BISA 2R073 3LA3A 4CDQB 4Z5HA 5GJ6A 3SXWA 4IEVA 1ZS4A 1W8FA 4NE9A 3RPQA 1RUI2 2ARCA 4D0QA 1NW3A 3KCYA 3T1MA 1K3IA 3D3AA 3JZVA 2WNUC 4QWNA 3WV6A 4DUWA 3ZXGA 2DVGA 5ERLA 1HX6A 4DS0A 1W06A 1KS4A 1O6UA 2JG9C 2Y38A 3INAA 2X05A 4OI0A 4AVTA 2GALA 3ES4A 3NDBB 4W6YA 5LBFA 1RUC3 1EV12 4XUOA 2P2KA 2ZHMA 3MLFA 1EYBA 4COWA 5GLUA 4K9SA 2WNVA 3VBRA 1XXNA 1HQLA 2X5IC 2IVQA 4CDWC 4WM7C 1OLMA 4XJ9A 5FP3A 3X29B 2JDKA 1W6PA 1O5LA 3AC0A 4EE2A 4R4XA 3AP9A 4QHZA 5FZLA 1X50A 4XF4A 1YRZA 2GU9A 2DBNA 3FHQA 3JQWA 5E1RA 1WW5A 2WWSA 2BV4A 5H9SA 1GLHA 2XL7A 1C3HA 1SQ4A 1PVC3 2C6SA 3VBFB 3O1UA 3BI3A 1YC61 3AKPA 3IN9A 3O0XA 5FYHA 3OCPA 4EZIA 4LK7A 4AE2A 1PX3A 1H8VA 3WW2A 2DCTA 4Q4V1 4RR3B 2AYHA 3VHOA 5C3SA 3PURA 2ODRD 1VRH2 2M4HA 4GZ9A 4XFCA 2HBUA 1KITA 1U5ZA 2A3XA 3WG1A 4CDXC 5F39A 1WCUA 4ZKTB 4KU7A 2EXIA 2WABA 2VJXA 4JGYB 2WUHA 4KH9A 4DRRA 4GWNA 3DECA 2WL1A 4R52A 5FV3A 1RINA 5FBJA 5IAVA 1ULDA 2WKKA 3VBSA 1PO22 2PUCA 1HB3A 3I7DA 4KWLA 2PXVA 1O91A 1R092 1J84A 3NSTA 4IEPA 4JDNA 4FVVA 5A7PA 4I2OA 2CWMA 4ORFA 2UWCA 2D6KA 2F4LA 1PK6C 2VAUA 3HT2A 5DRTA 1KJLA 1NKGA 2D3SA 2PHUA 1N47A 2Q1MA 4UW3A 3RMXA 3GCWA 4RQPA 2VNRA 3WF2A 4UXAA 1YIFA 1JFTA 3BUCA 3JBG3 3O9XA 1LQCA 4C1WA 4AL9A 4D6QA 1N1YA 3B02A 3SH4A 4ER7A 3H1MA 2A3YA 5BXXA 3S8QA 1XC6A 1VPHA 4LIVA 2R042 1PIV2 3H8UA 2GRLA 5LBBA 3RRDA 3UGGA 3V56A 3M1HA 5FPXA 4ER0A 2VCCA 4Y5SA 3DPRC 2XKOA 3CROL 2VTXA 2VW2A 4XZPA 5DSXA 4AEMA 2VZTA 5JIUA 4MHUA 3KVAA 4FTEA 2Z5WA 1QP7A 1JYIA 3SEEA 4IVZA 3ZPYA 4YG1A 1D7PM 1NCRA 3A21A 1I1EA 4FTSA 4HK8A 2B8MA 5F2WA 3U07A 2CAVA 4XOGA 5F1RA 3C7HA 2X10A 2LYPA 4YPJA 4AYUA 5JVVA 3GBWA 1AR72 4HG6B 2W1WA 3WG4A 2PHXA 1W8HA 1AL21 4PDWC 3J26N 3ZXEA 1F8VA 1VR3A 5FYZA 1BYHA 2RS12 2QQVA 3K46A 5BV6A 2WNUB 4IV1B 2IVBA 2HWE1 1JZ3A 3PVEA 3VBRC 2FDHA 1UOJA 2AREA 1O59A 4DFSA 3ZYGA 1XE8A 1GOGA 3B7HA 1G8WA 2C26A 3AYAA 3CQOA 3IDAA 1UYYA 3WNPA 1JFSA 4QKNA 4OI1A 2YB7A 3W21A 3K3OA 4C0BA 4PHZA 1UXZA 3SC7X 2AR6A 2QZ2A 3CDZB 1RUG2 2H8RA 5FZHA 4BLIA 4YFZA 2WFF3 3EMRA 4AEKA 1SDWA 4BQ3A 3W5MA 1QJX1 4RSUA 4DINB 2IFWA 1NERA 2PUBA 3VD4A 1UMIA 1BQPA 1J1TA 2VU9A 4N9HA 2Z79A 4LORA 5JXGA 1LLIA 2P17A 2WBKA 4EV0A 3THPA 3WDVA 2ZXQA 3MZHA 4MYEA 1TMF3 1KGYA 4KWJA 4XILA 4CEYB 4PI2A 5C8CB 2OZ6A 1L3JA 1U0AA 3CL1A 3D5OA 3KT7A 3VBOC 4ZU7A 4AVVA 2DWRA 3GALA 5A80A 3WCSA 1X9PA 1W9TA 4B1LA 4TTGA 5DTMA 3WT3A 2J1AA 5FUIA 1U5XA 2FDIA 5L9BA 3POEA 3S30A 4HK9A 1MS3A 1SLAA 3VDDC 3FFQA 1SG3A 4HETA 3BD1A 2YBKA 3N7KA 4QX5A 5GKAC 5T5LA 2B7YA 5FXZA 2OKXA 3ZKUA 4D7SA 5DN2A 1VBC1 2GP5A 4FPJA 2VO5A 2YHJA 4JHZA 4JKLA 3VL9A 4ASLA 2KEJA 2W1QA 5J98B 1YFXA 4FPCA 4CEWA 3PE5A 3A0KA 4XJUA 2PUFA 1GZCA 2DFCA 1UWWA 3AP6A 4CCJA 2DCZA 1NLSA 1YJKA 3M7AA 5FYSA 1RGSA 5CB7A 3WQ7A 1SFPA 4K8FA 1AYM1 2J7UA 4YW1A 4CCEA 3RS6A 3TEZA 2WN2A 1E5IA 5H9PA 1E5HA 1NCQC 2WNUA 3KCXA 5JUVA 2XQRA 1ZRCA 4KGQA 4P9IA 1JXNA 1C57A 1DZQA 1I9RA 4PT6A 2WINB 4IL7A 4QGLA 1RUOA 3O12A 2YU1A 3L9JT 3V0AA 1SFNA 1JBCA 3I3DA 4N43B 1SPPB 2XR4A 3ZLIA 1GU3A 2XKPA 3FC0A 5TSWA 4I0WB 2D6OX 5JI7A 3ZDVA 2XONA 4ATEA 3IBMA 4LPLA 2XVKA 3R4SA 4COYA 2TEPA 3J9SA 1ZBE1 4QX3A 1LKNA 3KV6A 2GC1A 4E27A 2VC9A 2AH2A 3LFIA 1D0GA 2YGMA 3VZKA 3PU3A 5A3LA 4YFWA 3VBSB 5DZGA 2R63A 1H1MA 2A70A 1NX9A 2DVDA 1QJY1 2OT7A 2ZEXA 3IMNA 4WV8A 1MVEA 4RGGA 3NJVA 4LIUA 3ZXJA 2XCJA 3O5SA 4GXLA 3I8TA 4FQ4A 3MYXA 5BNQA 2GN7A 4AI2A 2GZUA 3WZ1A 2QNKA 3SKJE 5EYXA 1OUSA 1ENRA 1W0PA 2WIIB 2H6BA 2VBPA 5HCBA 1B0NA 3I2HA 4AI1A 4RR3A 2WIUB 4QKFA 5FUPA 3BODA 3DYMA 3RJ2X 3LOBA 4YM1A 4P9YA 4CU7A 3VBOA 5HXMA 1BJQA 2WN3A 2XVLA 1W0OA 3NV2A 3R1FA 4X4HA 3T3YA 1QP0A 2Y26A 3LAGA 4CXXA 1MPXA 1TVGA 3HT1A 1ZBE3 4DEQA 3VWSA 1ST8A 4Z5DA 1SDDB 3JB4C 4XFFA 5DAVA 3P1IA 4D3WA 5CISA 3QYXA 1BHGA 1YEWA 4KQ7A 3ZXLA 2BBVA 1SHWB 4Z8BA 3ITQA 4DXSA 3E6BA 4UAPA 4XTPA 1UZWA 2HYKA 5F6KA 5GLZA 5A1FA 1XNDA 3LA7A 2BNMA 5FBZA 4DIQA 3IDCB 4Y1XA 3RYRA 3TB0A 3OWQA 4ER5A 1DGWX 1FAYA 1JUIA 3KXAA 3FUOA 4W6XA 2PHFA 4ZPIA 4BQ2A 5IK7A 4LO7A 3JBG2 5LEKA 1WKYA 4AAXA 4XUNA 2YFZA 5A3UA 3VHPA 3CJXA 1PK6A 2D43A 3RZJA 4W4ZA 4Q2FA 4Y5Z0 4LOSA 2W39A 4XJ8A 4YW5A 3BTYA 2JDHA 4OUMA 3WDXA 1DLLA 4LNVA 2UU8A 1ASJ1 3B00A 4CE8A 2QBXA 4UW4A 1DF0A 5IYYA 5A6ZA 2VULA 1APNA 1XNCA 3I2FA 1LHWA 3KL4A 4ASKA 4BDVB 2V3CC 1XRUA 1QIQA 2WZR3 1XNAA 5FFOC 4Q0UA 1RUE1 4DPNA 2B5AA 4WVLA 2LNMA 4YW3A 5GLWA 4AEDC 4SLIA 2FBEA 1PGL1 2LYSA 4URAA 4I8TA 1PMHX 2IC1A 4XXPA 1YIPA 4V2WA 3I2GA 3J8F3 3ACGA 4YVWA 3ZXKA 1VBA1 1PERL 4E4DX 1XSRA 4DY5A 2LRPA 5GLVA 5C3OA 2D40A 3VL8A 3TN91 5K0UA 2GMMA 5C6CA 2PUEA 2RS13 3BTZA 1DFQA 1RYYA 3AJYA 3HMYA 1MS1A 1C5IA 2VE1A 2VUJA 2HWE2 1RUH3 4RN5A 1S7EA 4UFKA 3AZWA 3VKMA 5T55A 1C8M3 3KSCA 1YSEA 4CP9A 2BQPA 1ZA4A 1J83A 1AYM3 2L8NA 2RDSA 1MS5A 1A8DA 2VZSA 1WCQA 4UW6A 2WFPA 3ZFEB 3LIGA 1XPWA 2GNDA 2BYVE 2GN3A 5T5PA 5IVEA 5APAA 5FZ0A 4GHJA 4HSJA 4EZ4A 1HRI1 1A6CA 5GZGA 4MGZE 2IUWA 3M8LA 3OGSA 4ZY9A 4MOAA 3ZFEA 3OGVA 4ZS2A 1TG7A 2ZACA 2PN5A 2VQAA 3P5BA 3R4DB 3RZGA 1W8UA 2VOVA 2JG9B 2VZUA 5FZCA 2VW1A 2EXJA 1JYNA 3DUIA 3NZLA 1FATA 4NHLA 1BMV1 2VR4A 3GCXA 4AQ2A 1IS6A 4MZUA 2R0FA 3FLPA 1QQP3 2XJTA 4IEWA 3E5UA 3R6SA 4H3WA 3CNAA 5JPMB 5KWRA 1LHOA 2ATFA 3EYPA 5EQUA 2IXHA 3VHRA 4J1WA 4CDUB 4MGYE 5D1IA 3DCQA 1W39A 1ZVFA 4DXRA 5CVRA 4L99A 1D4M3 3ATGA 4OLLA 3ZFGB 1CPNA 1QJX3 4B4PA 3MFAA 2YBPA 3NVCA 4N7IA 4YVSC 3WF3A 2ZJCA 3ZMNA 1KRIA 1SLBA 1DZTA 4IESA 2XUEA 1LHVA 2P3YA 3N7JA 4YGDA 1ZVVA 2HWD1 2P3JA 2WNOA 1W9WA 5LA2A 2ZAHA 4YVWC 5GZCA 5CFDB 3T1LA 2MEV1 4F8AA 3ZN4A 4N53C 5A3WA 4RYDA 1PVXA 4FPLA 1WIZA 4Z92B 3I2JA 4M3CA 2HFZA 2HWB1 4GB33 1NCRB 1LU1A 2B39A 4RD7A 5IVVA 3SCGA 1SLTA 2H0VA 2Q4SA 2W9XA 3S0MA 3UGHA 3I3MA 1D4VB 4NPMA 3ACFA 2CTVA 4CVUA 1W9SA 4A41A 2ZX2A 2DFBA 4UBGA 2XJPA 4I02A 1AUYA 1Y7BA 3TNQA 4Z1VA 1HRI2 5FZ1A 1QJU3 3RVHA 3VLBB 3VD9A 1XYPA 3ZSKA 2ZEWA 3USSA 3S5QA 5JSPA 3TN93 3P3PA 4YM2A 1GYKA 2WNEA 4NRPA 4RQPC 1QNYA 1UX7A 2PXUA 3T0BA 3RZHA 2JB4A 3PMSA 2A7AA 2BNNA 4LXLA 1MZ6A 3VKLA 1SBDA 1ZZCA 4XW3A 2JD9A 5FYYA 1JMUB 4FT8A 3HQUA 3VDAA 1CZSA 2QTWB 2OW4A 2DU1A 1EV11 4PLOA 3T2OA 5FIXA 2P3KA 4GD4A 3TWIA 3G5GA 3LCPA 4OMDA 3THDA 1Z78A 4WM7B 4AG4A 4CDUC 3GYDA 1LOFA 3T0DA 2HWC1 1POV0 2A6VA 3QOPA 5IFTA 2IXLA 1C8M2 2JG8B 3CJIB 3LEKA 1XOYA 2O8OA 2BVVA 4KBBA 1L7RA 1OD5A 1PGL2 3T2QA 2GNTA 3CO2A 4Z2AA 2ES3A 2A1XA 1R1A3 5JSOA 4OHWA 5L73A 1EUUA 3VBUB 1IPSA 4XIOA 3RWNA 1WBFA 3ACIA 4ZU4A 1WD3A 4NJ4A 4CUGA 4TLGA 2IVJA 4YZ3A 4NIIA 4CCNA 4Y22B 1POV1 4CUBA 5JXIA 2V4VA 3UK9A 3M3CA 1I3HA 1RUF3 1T6BX 5FPVA 1Y43B 1NA1C 3PVBB 3T0AA 1PGW2 4KWKA 4AQTA 5F7UA 2QQLA 2QQJA 1ZRRA 4LUKA 4KG0A 4CDQC 1CIYA 3I97A 2DU0A 1UMZA 1Z7S2 2XH6A 3ASIA 1RUD3 1AR63 3V65A 1W8NA 3HOBA 4L9BA 3WUDA 1Z7S3 1C4RA 2JX9A 3K2OA 3Q8CA 4CP2A 2XJUA 3GZEA 1GMMA 1RVF1 2Y33A 3M3IA 4GB32 4UW5A 4Q0SA 3NQHA 2G1MA 1OQDA 1RIOA 3IB3A 3NJYA 3M2MA 3HQXA 1ACCA 5A6YA 2ORZA 4AFAA 2YPJA 3CIHA 2XWBB 3KWVA 4FSJA 3O1VA 4S2FA 5CYYA 1BK1A 3KV9A 4JCXA 1SZBA 3H1WA 1AXZA 2Y0OA 3OY8B 3NAPC 4X8NA 3ZFFB 4FPGA 5ISLA 2KPJA 1CD3G 4HKLA 3GHNA 4Y4RA 3WHUA 3O14A 1SBEA 3Q9OA 3S57A 2V4AA 3WOGA 1DLCA 1REEA 1RJ8A 2VZ1A 2WS93 4IEYA 4J6GA 4O7XA 1WMFA 3WDUA 5K9YA 1UOFA 5DDJ2 4BZ4A 1WCKA 3D8CA 3LPGA 2BERA 1NY72 3N3HA 4LULA 3VKFC 3H7JA 2D5VA 4CP1A 4QPYA 1QJY2 2JEMA 4HOOA 3KF5A 4FOWA 4G4FA 5DAQA 4FFHA 5FY4A 4Y26A 1EY2A 1HLCA 4N53A 5JOZA 1R082 4YSFA 3I3BA 5C4WA 4XQWA 3PUQA 4CXWA 1IZ3A 2ZGUA 4WVVA 5LBEA 4AFDA 4B1MA 4HVQA 1US2A 1W9FA 1QOOA 1VAKA 4JQRA 2PXQA 5CZKA 3S7EA 1YQ6A 2DV9A 3C2UA 5I0TA 4K1ZA 4PU3C 4AAPA 1LB2A 3ZOIA 1ENQA 2XJRA 5JXHA 3VDBA 2GZWA 3PJQA 3N36A 4FBFA 5BNNB 2CNAA 5JCTA 1O3TA 1JHJA 3WG2A 1KD7A 5DTRA 2LYQA 2EWTA 4TZDA 4XDOA 4QXCA 2ICTA 4ER3A 2WQZC 4WM8A 5A33B 5LEJA 4AHZA 4MADA 2BBAA 5FZ3A 3A9XA 5C33A 3R09A 1TZOA 4GIQA 5FAXA 3RDIA 3BB6A 1QXJA 1Q3EA 3DM5A 1MEC3 2VECA 1ZM1A 3HD8B 4O8BA 2CY6A 2C9AA 4O65A 4UBHA 5E88A 2R061 4XF1A 1U5IA 1GNHA 3IPVB 2RMU3 1E3OC 1CIWA 1BZWA 2VPVA 4Q27A 5FP7A 1AXYA 2V72A 4YGBA 3WXPA 1TEIA 1ZBA1 2YC4A 3ZHMA 2PXBA 4XABA 2RS31 4ZXKA 1LESA 3DKQA 2VH9A 2NLRA 3ZKYA 3ZYFA 5BYNA 3DXUA 4RS5A 4TSVA 5J3UA 1CQTA 1UYPA 3MLKA 2A6WA 4K20A 4QB2A 4FAHA 4ZZ8A 4IV1A 1PVC2 3H3ZA 1YXWA 3E1F1 2YV8A 2OZJA 1I6XA 2E31A 3FUQA 5SV5A 1OA4A 4CP9B 4QHBA 1DQ2A 4CPBD 4QAWA 2FCVA 3H0OA 2ZX1A 5LB6A 5T52A 1QQBA 1GUIA 4W8JA 3WD5A 4YZ4A 1W6MA 2FHRA 3B5LB 3VZLA 1AZDA 1RHI3 3CLPA 3GF6A 4M3CF 4EN0A 3PXPA 4KI5M 1ODNA 2PXEA 1S0CA 4RHV3 4RGAA 4XVHA 1IPJA 2QJVA 2HWB2 1GZWA 5L9RA 3J7MA 1NE4A 4Y33A 4CU9A 1K45A 2DCYA 1RITA 3FWEA 3HVDA 1ZBA3 1JH9A 1V9U1 2V5YA 4Z58A 2QFEA 5LY2A 1VLNA 4AHWA 4D6RA 1IS5A 3AKTA 3POIA 4EROA 2V09A 1DGRN 1DGRA 1RUI3 2Q1FA 4RQPB 1ND3A 3PL0A 4JVAA 5EZWA 1FPN1 3KMHA 1ULFA 2DTWA 2Q30A 3ECQA 3VN4A 2TUNA 1F15A 1GQGA 2I74A 2IXKA 4O9EA 4NIGA 3OYWA 2BNOA 1NXMA 1JZ8A 3NJXA 2B45X 4JQDA 3GJBA 3KT4A 4OB4A 4XPVA 1H1AA 4CEWB 3IPVA 4RS5C 3F51A 2DCJA 1HRV1 4MO3M 2VY0A 3B93A 2YBSA 1XJAA 3MIDA 2IXIA 4IEQA 4LUMA 5C3QA 1K5MC 3AZXA 2XHNA 2W91A 4BA6A 2OXBA 1W6PB 1P8JA 4LBKA 1FMD3 4DRVA 5J1XA 5KC5A 1DGWA 1HQWA 1TME1 1DQ5A 2RMU2 2VL4A 2QUOA 4CZSA 3HPNA 2W94A 2WR9A 4PCRA 3OPWA 4XCBA 4Y22A 3BCWA 4WBBA 5A1AA 1YO8A 2FDJA 2XJQA 2A6YA 4LBJA 4RR3C 3WNLA 3H8XA 1UU5A 3GZDA 1YFWA 5F6LB 1UPSA 2WA3A 1W6NA 4D7TA 4YM3A 2VM9A 1JOPA 2XL9A 3U0ZA 1C28A 3VBFC 3VZNA 1OBNA 4YGCA 4CDWA 4C91A 2RG4A 4PLMA 4IETA 3WY6A 2ZBJA 4GJYA 2VVEA 3FFZA 3TEWA 1HW5A 3A22A 4LE3A 5GZDA 2BU9A 1JZ2A 2HSGA 3V0AB 2PA7A 3L2YA 3OEBA 4KNCA 4Q29A 5FJKA 4L0PA 5KXBA 3GZUC 3RG0A 2BTVC 4QPGB 1HKDA 3ENRA 1NAEA 2BZDA 5FCCA 2VBBA 2VOTA 1VBA2 2LLWA 4IW3A 2WO3A 3N7LA 5J36A 1SFYA 1Y7YA 1J58A 1BXHA 1S0JA 1HV0A 4XF0A 1AYN1 2WZPP 3W5NA 3IDBB 4L2NA 4OHXA 3OKZA 2JECA 3FYAA 3WLUA 4IGPA 4EJRA 5JR2A 5JLVA 4AW7A 1QJY3 4QX8A 3O0WA 4L11A 5JAXA 1U5YA 4EN6B 1H4GA 1AHSA 1TNFA 1UY3A 1D2SA 2CU5A 2UY9A 4QM9A 4CUAA 2XDVA 4Y1YA 5DDJ3 4DY3A 1NQDA 4XDPA 1SQ8A 1HXS2 1W05A 2VBDA 4NMIA 4LBOA 1NCQA 1QXPA 3AMNA 1QMJA 4KWUA 5I0SA 1OD3A 4XBQA 2WJSA 4LE4A 1ZRFA 2Y0IA 1LHNA 1J3PA 1AR92 2HEWF 1B35C 4NWWA 2W1UA 3WF1A 4FFIA 2A5ZA 1BLZA 1CAWA 3NKTA 4XAEA 5DAXA 4LT5A 2BGOA 3H7YA 5EPAA 3ZN5A 1AR93 2D3RA 4IEXA 1H4HA 5K0UC 3ZMOA 2PXTA 2JE7A 4E4HA 4EN8B 4WVWA 3OF1A 4HLTA 1N1TA 1WCDJ 2UYAA 1WGPA 3H3UA 5C9AA 2I45A 2P4EA 5FXWA 4IE5A 5CIRA 1OC1A 5F37A 2PLV3 4OI4A 3JQXA 4P00B 1KQRA 1VP6A 4CDQA 2LYLA 4B7EA 5KHHA 5BNNC 1F2NA 1QP4A 1EV13 4NRQA 5LATA 1HXS1 1EFAA 3ZYBA 3FLRA 1T2XA 3C7OA 5F5QA 4YW2A 4F83A 5FXVA 2ZAAA 4PIYA 4MGKE 5C3RA 2D93A 5G05L 2K2SA 5CFDA 1BVP1 4HONA 4SBVA 4QQOA 1O7FA 2JIGA 2ZHNA 4CCOA 1AX2A 5A6QA 1IHMA 1PM4A 4X4IA 2OX0A 4XAAA 5FXXA 1HQ1A 2WO2A 3TRSB 1QJX2 3UJOA 1IS3A 4JAAA 4BU2A 4CDWB 1W28A 1F4HA 1OA2A 5DUXA 4LHLA 4C0HA 2W0XA 3G6JB 4UFJA 1MQTA 3AZYA 2R7EB 5FPLA 1RUG1 4MLOA 3WQBA 4V2VA 4B8EA 1CAXB 3EHKA 3KJXA 4K1YA 5A32A 2ZTNA 2D44A 2AEZA 1CN1A 3N35A 5A3TA 3NL1A 4AVBA 4CEYA 2E7AA 3VD7A 3ZR5A 1TMF2 4ZZ5A 1UQXA 4A2UA 1HB2A 3WP3A 2QQMA 2Z4FA 4CTEA 1JH5A 1OF3A 3TOJA 2MEV3 4BLJA 5F9TA 4DZGA 2GC2A 4ZS3A 2VXRA 4Q5OA 5EV7A 3U75A 2P37A 1HRI3 1W9YA 4H7LA 4YW6A 1FV3A 4EKIA 4LR4A 5FRAA 3UKVA 3AYDA 2VOWA 3ME5A 1Y9QA 3KS7A 3N9MA 4Q1PA 5FPZA 3T4HB 4EN7B 2D6PA 2RS33 3ST7A 4YBAA 2HWF3 1CJGA 1GNYA 4N8MA 1NCRC 4XDQA 1DQ1A 4W50A 4NDWA 2VMFA 3AZZA 3KD4A 2JICA 4XYXA 5T5OA 5FYVA 3NWKA 1F31A 2F17A 3POFA 3MHZA 2WO1A 2RM23 2GH2A 1QHDA 1RHI1 4A3ZA 1PIV1 1MS0A 3JUUA 4HSLA 4MXWA 1VMHA 2L9LA 4Z59A 2VVDA 3SH5A 4NVPA 3WQ0A 4A42A 1VBD2 1A3KA 2LLVA 4Z2WA 1B35A 1AR91 4XEZA 2WYFA 4MXWB 3J8F1 2BW8A 4AK3A 1KDKA 4OHVA 4IV3A 5FKCA 1WMDA 2TNFA 4B3NA 1JU3A 3FMYA 2CL2A 1QQAA 1V6LA 5FMCA 5I0UA 5HV0A 2C0ZA 2P34A 3AKSA 4UFMA 1OLME 2QQPA 3H9AA 4CSWA 1S0IA 2SLIA 1GP6A 4XQDA 1S4CA 2AUWA 3ZM8A 4BMEA 3EQEA 3MPPG 1UCXA 3V0BB 1UU6A 1A34A 4FPEA 5AC92 1QEXA 4TYSA 4Z5CA 1ULEA 5A33A 5JOYA 2VGDA 2KEKA 2AZ5A 1ZAYA 3QH6A 3OBTA 1L7QA 3VBUC 5AC93 3AVRA 1R63A 1UXCA 1QJFA 3DXTA 2KXLA 1CPMA 2E32A 1AX1A 2YYOA 4Q4X2 4TXWA 1VBA3 4A3XA 3QLQA 3SITA 5HI0A 1ZZ7A 4DE9A 3QCWA 3FHIB 4TN7A 1EAH3 5B4NA 1UY4A 4WVMA 3VBFA 3I59B 2FZ2A 4G3YC 2PUDA 2BOJA 1DHKB 5HCHA 3OQNA 1ZZ9A 5IW0A 1NXD1 3FL7A 4BM8A 5FMOS 2OFYA 1PO23 3T09A 3VZMA 5A3PA 2UWBA 3UT0A 2RDRA 1CR7A 4QXHA 1E57A 3OOXA 4PU7A 1GZ9A 1UY2A 4Y3OA 3OP9A 3LPFA 4IGQA 1B09A 4BQ5A 3RJRA 3DPRA 1AR81 1RL3A 4ZONA 5KR7A 1H9PA 5FZ9A 1URXA 1UZ0A 1Y9MA 1FOD1 2FDKA 3OBRA 1BDHA 3AL5A 1UMHA 1GKBA 2D3PA 2EBYA 1LOAA 3HN1A 3O1SA 5LRRA 3WNNA 1JW6A 3UKNA 4JDOA 3LWCA 1DQ6A 5FJHA 1PZ7A 1ZRDA 2WA4A 4CRQA 4K40A 2EXKA 5HBAA 5ANQA 4AEDB 4UFLA 1O4XA 3GGLA 3I49A 3WCRA 4QB6A 3OPZA 4N7UA 2B9UA 2O14A 4Y20A 2XIUA 1LGCA 1F5FA 1POV3 1CJPA 5JZGA 1W04A 4PDWA 3BOPA 3KZ3A 4IV3C 3VGIA 3IVPA 1AR61 3UL2A 2VMIA 5KBFA 2JCGA 3VZOA 1E5SA 2WQ8A 4CCLA 3NNGA 1WLTA 1WW6A 1R081 5BY5A 2ILMA 4IEUA 4CDXA 5FQ0B 4HFSA 3OB8A 2WS92 2PYTA 5FREA 4Y1UA 1CAUA 4YGEA 4JRAA 2WWUA 2AXVA 2RE9A 4O61A 5J09A 1H8TB 3U1XA 2RJLA 5FZ4A 5IVJA 4OHYA 1BBT1 1OLRA 4FPOB 4JV4A 1UAIA 1UXDA 3ZVXA 4URTA 1NE6A 4LKDA 2CAUA 3NO8A 4X6QB 5GZFA 3QOXA 3AMHA 4MHRA 1UL9A 5IWFA 2GDFA 5AVAA 3QACA 3RQ0A 4UT5A 2GC3A 2RJ2A 1PMJX 5DUWA 2PXPA 4UFHA 2FDGA 4LO5B 3I59A 2LCVA 5CU1A 2YFUA 3VKNA 2YU2A 4GH4C 2VQTA 3HJRA 4XJWA 4FBIA 3OQMA 4BIFA 5LY1A 1V6IA 3S6PA 1OI6A 4Q4X1 4DXZA 3B9IA 3ZIWA 5IVCA 2E26A 5C8CC 2ERFA 3LSEA 2XPJA 1OHFA 3AX4A 3TBDA 1SLLA 5A3MA 2HWF2 2B46X 1CAVB 3POSA 1G9AA 4MGQA 3RYKA 3OEAA 4AZZA 3ES1A 2G9ZA 1Y3TA 2WSVA 2PXFA 4ITCA 1XNBA 1YQ8A 3JD71 3H5TA 3HBZA 3VZJA 4AHYA 4XFHA 2WSUA 1YCIA 1OMIA 1QJEA 1W8TA 2O49A 4LA3A 3N9PA 3ZFGA 4H2AA 4IE0A 2FCTA 3ZXAC 5DMYA 1QQP2 2MPFA 3IDEA 5CFDC 1N3OA 2LALA 4QQ2A 4X4CA 4XMIA 4QKDA 4FCAA 4KG8A 4WM8B 2ZMLA 3F2ZA 5FPUA 4XJAA 4Y42A 2CSGA 4BXFA 5ABJC 2J7MA 2XGXA 2ZMKA 2EA7A 1ASJ3 4NWVA 1J3QA 2Q8OA 3WINE 1NEQA 3JBG1 3K51A 3U78A 1LULA 5BNNA 1MQTB 2EAAA 1Q8VA 1YQ5A 2R1JL 2VTFA 2Y8KA 5A7SA 1ODMA 3O1PA 1ZYBA 2CDPA 4UI9L 3AYCA 1W2OA 3NNJA 2HWF1 1GOFA 2UYBA 4AR2A 3A9YA 2C1FA 2WYSA 3DGTA 5G04L 5T54A 4Q8KA 1OF4A 2I07B 2WC2A 3POWA 1SCRA 3KGZA 1QZXA 5A3NA 3H8RA 3VBHB 1LCCA 4PU4C 1VBC2 3KM5A 2JE9A 2DVFA 4GMP1 1HB1A 5FMBA 5CFCC 5K7PA 2BRTA 2JE8A 4XMAA 2VG9A 2Y6FA 4IUGA 5JPNB 2EIDA 4Z07A 1VBE2 1RJ7A 3D1NI 3HZIB 1Q5OA 3L1PA 3ZXFA 2HEYF 5FLJA 4PIXA 5ACA2 5DTQA 4ONUA 1LRHA 4YZ2A 3BYWA 1HQNA 2QQKA 4Q4V3 4FQZA 3RZZA 2HWE3 2R1DA 4LBNA 1KFXL 1KDMA 4ISRA 5F2SA 4ISQA 1S0FA 1DDLA 4JDMA 2PUGA 1NZIA 1JS9A 3LKJA 4YW7A 5JOXA 2GNMA 3ACLA 1JZ7A 1VAMA 4CEYC 1GP4A 4OVEA 5F5AA 2D5FA 4BQ1A 3MW3A 2W3JA 3QFIA 4FPKA 2OVUA 3WR0A 3HBKA 5BNOC 1RUE3 4E2SA 1VBB2 2IXJA 5DAWA 1XWRA 4YZ5A 4GWJA 2OUJA 3C7EA 2W92A 4QU2A 4COUA 4Z82A 4A45A 1FNYA 3VUOA 4XZUG 5C9AB 2VUAA 3MBWA 4Q1RA 5FZMA 4B4QA 2W08A 5DABA 5CG9A 3KZ4C 2ARBA 4EZHA 3TFLA 1PZ8A 1QQP1 3R4UA 3EBRA 1AL22 3IKWA 4PBOA 1X33A 3AMPA 2HBTA 1PNGA 2C24A 5A7QA 1UO9A 1Q43A 3PTYA 5LWBA 4BK4A 5L7OB 1NCQB 4Y1VA 4R8HA 4TLFA 1WW7A 2RV9A 4M00A 2J1EA 3MF9A 1ZX5A 1W2UA 4QHOA 3WW4A 1JZ5A 2VCAA 4ES9A 3I3EA 5DPNA 2PPXA 5I8SA 5C71A 3NAPB 4OCTA 4JZRA 4EQZA 3LISA 4DE8A 1RUC1 1DULA 1HRV2 3ZHIA 1PK6B 1UIKA 2PHWA 1X8MA 1GT0C 2BVBA 1GANA 4P9JA 4R4ZA 5FYUA 3E5QA 2ZGMA 2ZMNA 3GXUA 1LHUA 4NRMA 3SHRA 3ZDSA 5IK5A 3Q8AA 3WDTA 1AR83 4AVCA 3CMGA 1LU2A 1R1A1 3WNOA 4E4ZA 2JDPA 1ULOA 4XE9A 4LO8A 4BCUA 5J7MA 3OG2A 5JZGC 3CZUA 5DUUA 3NMBA 2JJ6A 3EJKA 1QXRA 1FPN2 3MIFA 4AGRA 4ES8A 5F3GA 5I93A 1XE7A 4CDXB 2UWAA 3NJZA 3O7OA 5IATA 4MUVA 3VDCA 2OUHA 3HNMA 4N43A 2VNVA 2YMZA 3FMGA 4N53B 2XXZA 1G9FA 4QT6A 1WETA 2WZEA 4IQPA 2ZCWA 3T30A 3B94A 3RZKA 1SBFA 2WS91 3JCIA 3LEGA 2RS51 2BEOA 1LOBA 1H0BA 3WNXA 2RS52 5A7WA 5JR7B 2GRMA 3EO6A 4PBPA 2JB8A 3S5AA 2ID4A 3LE0A 2P3IA 3GN5B 1LENA 2F4PA 3HAGA 4ZXEA 3AL6A 2WFF2 3D4KA 5F3CA 4QQHA 5FZBA 4JC1A 4JGYA 4O9GA 2L1PA 1OT5A 3P6BA 4WZFA 2RDNA 4XIKA 4OFGA 2R0HA 5B2GB 1W2NA 1OFSA 5KHKA 2LYKA 1D0HA 2VNOA 3HNBM 4FI9A 1R1A2 1XSQA 4PQ9A 1UN1A 1JHNA 3OQOA 1QWRA 3QF3A 1BCXA 1GP5A 2X5IA 2XLAA 1TME2 2RS32 4MH0E 3ZSMA 1PX4A 1IPKA 4YG3A 2E53A 3GNEA 2YC0A 3IM0A 2E51A 1PRUA 2VOKA 2JXAA 3VD5A 1HN0A 3AFKA 4QDRA 3LFPA 3V0BA 2BP6A 1ZUGA 5JMOA 3LIHA 3ZFFC 4GJZA 1UD1A 5FPBA 2JG9A 5CBLA 3WEZA 2ZX0A 3HEIA 2ZGPA 3JXBC 3ZX7A 4WM8C 4FOQA 4CPBA 2E33A 2R30A 3FBYA 1RZSA 2XJ3A 2O1QA 4FPFA 1V70A 4IV3B 1L1MA 3SISA 4OBMA 3SCHA 1SACA 3E5XA 3I2IA 3ILRA 5H9QA 1R091 1OCTC 1RMU1 2AC1A 1UF2C 3PUIA 4I0BA 4RFT0 4NIHA 3TN92 2IFRA 4UWDA 2WFF1 4JCKA 4MGSA 4N90A 2BFUL 3AP7A 3VKOA 4CUCA 5GAHi 2D6LX 3AK0A 4PF5A 4PF1A 1COV3 2PAKA 3KHCA 3OD0A 4BHPA 2WZR2 4P9LA 2W2IA 3K48A 3MEPA 4NOTA 3RFRA 4DUVA 1W6QB 3VB9A 3LEIA 3U11A 4F7ZA 1VBE3 4YLZA 4FP3A 1CJDA 4GH4B 1GZWB 3RZMA 3BVCA 4OYUA 2FMDA 2XBO2 4KBZA 4S2GA 5FY7A 2RS53 4Q0VA 2CHHA 3F6WA 1BKZA 2DUOA 4N43C 2O38A 1W6QA 4Q4V2 4P02B 5A7OA 3WP5A 1JYCA 2KEIA 2B4KA 3CBNA 4L8QA 2Z42A 3D0SA 5KXDA 1FX5A 4IEOA 1Y4WA 4BIOA 1N1SA 2J42A 4XHBA 1QPZA 2QZ3A 3U10A 2VZVA 2XVGA 4LMFA 3NW4A 3IAPA 1PVC1 1LMB3 4GMP3 4J1XA 3DN7A 5GAGi 1PNFA 3IT8A 2R043 1X36A 2X09A 1ZRIA 1PRAA 1VBD1 4KL1A 4X6RB 2AUYA 2CSFA 1CAVA 1RUC2 1WLCA 1JU4A 2WWJA 3APBA 3MW2A 1A78A 3PVNA 4KGGA 4OHZA 4BYYA 5FO8B 1YUDA 2JG8C 1LOGA 3CJIC 1JYVA 2ZGTA 3DYOA 1WLDA 3SKVA 2JDAA 1RUJ2 2XB6C 4PLNA 5EJZB 3SH3A 4YG6A 3THTA 2P5BA 4AI8A 2HINA 1XNKA 3MEJA 1OQEA 1XYNA 2FZ1A 2PMWB 3AKQA 1M06G 3MO4A 1MQTC 4JGZC 1Q8PA 2GC0A 4IE6A 4BQYA 4EQVA 1AL23 1QOTA 4W65A 5JIAA 4CU8A 4HANA 1PNRA 1IC8A 2XLGA 3SEPA 2XWJB 4XC9A 1ULCA 2XHKA 1IQDC 1EPZA 1S2BA 1OPOA 2PHDA 3CF6E 4LKFA 4QXBA 4I6UA 2OR1L 5EP9A 1RB8G 1H2KA 4HL0A 3A23A 3QBQA 3GZCA 1MS4A 4FXKB 4YG7B 2Y6KA 2BUKA 4U2AA 5T5JA 1TE1B 2BGPA 4E2GA 2ETEA 3IWZA 4META 3WF4A 3EUSA 4BJ0A 2KZ8A 3VK0A 2DYCA 1CAUB 5FYBA 5H9RA 4LBQD 2EF6A 4CYDA 5JXJA 3BTXA 1OURA 4JCYA 1K5MB 3ETPA 4XFIA 5EHDA 2WZR1 5C4WC 3NNLA 3H1YA 4C8DA 2OIIA 2IU7A 4XFGA 3U3WA 5KHJA 4GMP0 1COV2 1DG6A 3AP4A 2VTXJ 2VUDA 1O3RA 2R6QA 3BOWA 2HH9A 2HCSA 4YVWB 5HCFA 2AENA 5A7WB 1AF9A 2K46A 2KM2A 1OOPA 4MSVA 1GZTA 2ZGQA 5FZKA 1R083 2H0BA 3PLQA 1GNZA 2RS11 1OSGA 5FPAA 5KC6A 2YXSA 4QX0A 2AWIA 2W52A 2Q8DA 4AVAA 2GAUA 2VCMA 2AEYA 4MCTA 3AZVA 3I2DA 4MG2A 1UPIA 1WMEA 2I2SA 1K12A 1QU0A 2FQPA 1QF3A 3H50A 5C5TA 2W47A 1CZTA 4PQQA 5CADA 1DW9A 1ULPA 1HJFA 4FO9A 4HKOA 4XQ4A 4K3UA 4AF9A 5I8TA 3NNMA 3FX3A 4X4EA 5FLIA 2QCSB 3L2HA 1W3XA 5FZEA 1JODA 3GDBA 4XFBA 5A3OA 3WP6A 3ZR6A 3C7FA 3VDDA 1O4ZA 3H3LA 1TME3 4GALA 2ARXA 4CA9A 3B3QE 3WSOA 4QPIA 4EK9A 5F3EA 1QNWA 3AB0A 1CESA 4CCMA 4A7ZA 1IOAA 1ENSA 3FN9A 1NA1A 3JU9A 5BNPB 1H1IA 2DUPA 2KR2A 3POGA 1QH7A 3HR9A 2XOMA 1JTZX 4IDZA 2HKXA 3K3NA 1AXKA 3T2TA 2YY1A 1PO21 3C3VA 4NPLA 3C8XA 4XFAA 5FMDA 3I54A 1RZRD 2GNBA 2R32A 1NQJA 5KHGA 2FJRA 2IV1A 3LEMA 5CKQA 4E2QA 5C3PA 5DQ0A 2E6VA 2DF7A 3VBHA 2B42B 3ACHA 3KV5A 4JGZA 3Q8EA 2A6CA 4ASMB 2O4AA 3KQ4B 5HV4A 4QQPA 2BOIA 2DTYA 3BTAA 2L49A 1W2AX 4JHTA 1H6XA 1KJRA 3GBGA 4QX7A 1LOEA 1KFUL 1RUD2 5FZAA 4CCDA 4FTBA 1WUVA 5EJ1B 1VRH3 1RC6A 3QOWA 2OQ7A 1UNBA 2PQQA 5LBCA 3AJZA 3B7MA 4Y5TA 3TEXA 1DP0A 3M70A 1M4WA 2O0OA 4GH4A 2PXDA 1V00A 4LKSA 5A7NA 3N9LA 1F5JA 1CWPA 5JUWA 3E6CC 3NV3A 1AR71 3LOIA 1BEV2 1DYPA 2JKXA 4EWAA 3WUCA 4A7YA 5JSRA 3AMMA 1CQ9A 1ND3B 4LEJA 4E9KA 4GA9A 2QKDA 3AKRA 4D94A 1S2EA 1WWYA 2PXLA 2J22A 2VVFA 3BU7A 2PUAA 3OY8A 1V6OA 1ZBA2 4GQMA 4YYOA 1LTEA 4NHMA 4S2HA 1XU2A 4NROA 5T50A 3ZO0B 4WZCA 1N3QA 2AXUA 2GMEA 4X4FA 2R041 3CLCA 1QH6A 3NV4A 4DXTA 2QQUA 3EXUA 5FWEA 4TWTA 4R9BA 2NP0A 1LCDA 1FT9A 1GOHA 3B69A 4LBMA 5DRYA 2VZRA 5IT6A 1T6GC 1PIV3 2IVGA 3FJSA 1I5ZA 4P9WA 4XHXA 2NN8A 4OMCA 4OULA 3TNPB 3ZYPA 1FV2A 4L92A 4J25A 1RXGA 1IKQA 3UV9A 2ZGOA 3LFMA 1C1LA 1E5RA 3Q8FA 4IGOA 3ALQA 2H6CA 1L7LA 3MW4A 4ER6A 4H7MA 1S2KA 4C90A 5KXEA 1MZEA 4MVTA 1U12A 2IWGB 4JX0A 5A1LA 1R1ZA 3HQRA 3VBSC 2PAMA 2PAEA 3PU8A 2XXAA 1Q8QA 2WT2A 4XURA 1X8EA 4XACA 5D21A 1F9KA 2G9GA 1UY0A 1W03A 2ZX3A 3WNMA 1REDA 2FCUA 1AX0A 1VBB1 1VAVA 1VPWA 1DIWA 1HDKA 2XMLA 3KCCA 4DB5A 4XTMA 5C70A 1BMV2 1XBFA 2BWCA 1XU1A 2E63A 4FFFA 4BE3A 3OGGA 5LK7B 3NV1A 1S0EA 4UF0B 1EUTA 5FOBB 3ROUA 2A3WA 1RUG3 3NKGA 2LYRA 4NHYA 1KS5A 3MICA 3EB7A 4ARYA 3LSDA 2YG0A 4B29A 5FUNA 3M3EA 1O3SA 2EXHA 1GICA 1REFA 4XUQA 1LGBA 5C7GA 3HWJA 3MV01 1BEV1 1LAJA 1VBE1 4QD2A 1LNSA 4QKBA 2J1VA 3QD6A 3BS3A 2XSDC 4LITA 1SMVA 3B01A 4QPGA 2Y6JA 3MI8A 4R9AA 4Y1ZA 1BBT3 4PI0A 4P9GA 1BK0A 3RWKX 2CV6A 3AVSA 4UFIA 5GALA 3K77A 5F8PA 5B4XA 5EXOA 4K6BA 2CGPA 4S2DA 3KV4A 3VDDB 5CFCB 3GN5A 3K4AA 3MPBA 5DG2A 2EALA 4JTNA 1S55A 2HYXA 2PLV1 2X5IB 2Y34A 4XF3A 5I0RA 4RHV2 1FYUA 1W8WA 5FTTC 3DPRB 4NUBA 1JWLA 2EIGA 5BNOA 5LCWL 1JYXA 1ZZ6A 4CCCA 1VB2A 2EICA 4AEDA 1K42A 2ZA9A 1S0BA 5EYYA 5FZOA 1X9TA 4MCXA 5FZ6A 4FPHA 3ZSEA 2ZEYA 2NMNA 1IG0A 1YI7A 4LHSA 4Y4YA 3OJBA 3M9LA 2WLPA 1ASJ2 1MR5A 4RGKA 4NIAA 4MV2A 4K8RB 4QPIB 1ZNPA 1OOPC 2JDUA 4JKMA 4Q4W2 4Q4Y2 5IUQA 3KVBA 2GMPA 2W46A 4XF9A 3HN3A 5T3NA 1W6OA 4I01A 4X4DA 2VMGA 3MLJA 1C5HA 1YHFA 2Q5TA 3AP5A 1ND2C 4N9IA 3ZPXA 1DYOA 1YNAA 3FZ3A 1VB4A 1RUF1 2JWPA 1J59A 3J8F2 3UYJA 3SMHA 1HJGA 3D6EA 1WH6A 1BVVA 1UIJA 1D2QA 1FPN3 2PLV2 3N7MA 5E8AA 4AWDA 3GM8A 3PMEA 5FZDA 5I8YA 3OUHA 5JOWA 3ZPOA 2E7QA 2PHTA 5A6XA 1X2LA 1LECA 1W3VA 1MEC2 2WUSR 2P6HA 4UYBA 1RUH2 1FMD1 4P9XA 3FE5A 3DL3A 3UESA 1GWMA 1YFUA 3TRBA 1W6NB 1G9BA 2CGNA 4INDA 4JKKA 4BH9A 2MNGA 5ACA3 4KMQA 1S1AA 2VCBA 2BDRA 2QVSB 3BN6A 2G19A 3LDKA 5LA0A 5FP4A 4DOUA 4JTOA 4BQ4A 5K4LA 1W0NA 5IJRA 4COVA 3BALA 5IFPA 2ZZJA 1DCSA 2HJIA 4ZHNA 5D8AC 3KB5A 2PELA
chains in the Genus database with same CATH topology
3LB9A 2JD4A 2PHRA 4FAGA 1X7NA 3GHMA 5GLTA 1QOSA 3W59A 5DZFA 2GH8A 1UX6A 2JG8A 1S0DA 2R1BA 1ZZ8A 1CX4A 3CJIA 1AYN2 1ZREA 4I09A 4XBLA 5DZEA 2F6BA 2EVXA 3TAYA 1QKQA 2MHFA 1IQAA 2EF8A 4CDUA 5SV8A 1ZBE2 5C8CA 2ICPA 1CAXA 2D7FA 4P14A 4AGGA 1FNZA 4HPKB 3POYA 1UZYA 2ET7A 1YFYA 4Q4W1 4AI0A 4BMBA 5L36A 3MGUA 4D69A 5CG8A 3QWGA 2JDZA 4Q8LA 2ZS6B 1ENXA 2QE3A 4X8PA 2NPIA 1VBD3 2D6MA 1H30A 3QH7A 2B5HA 1NLRA 5CA6A 1IS4A 1XYOA 3E97A 2RM21 2R071 1UKRA 5JMCA 3AYEA 5E89A 2ZHLA 1Q8SA 4IEZA 5J48A 4JRLA 4PJYA 5K0UB 1ND2A 3O0VA 1ZZBA 4LBQB 4OZXA 4IERA 4RS5B 4PDWB 4GULA 2RHPA 3IIAA 3LZZA 5ABJA 3R05A 1EAH2 4GWMA 2ZGLA 4HKWA 3S7IA 3KLSA 2BPA2 3ZFGC 3UFDA 1OA3A 2XBO1 3ZYJB 3N4MA 4Q4X3 3BIWE 4HT1T 4YM0A 4EWEA 1EP0A 3VBHC 4LO6B 5BPXA 4I0AA 2QDNA 4C1XA 1AYN3 1WW4A 2R16A 3DNVB 1PM7A 1SLIA 2ZGSA 4NN0A 2A6XA 2VMHA 2WQ4A 3RMYA 1RMU2 5DUVA 3WX5A 1N3PA 2A71A 2ENRA 2JENA 5J37A 1LEDA 1ND3C 3MF6A 1NYWA 2RR11 2ZKLA 4JGYC 2YDEA 3JD73 4F3JA 2LTNA 4QPGC 1MZFA 1O3QA 2OA2A 3OGJA 4GKXA 2XLFA 1BDIA 1CVNA 2A73B 3I4IA 1QDOA 4QXKA 2D98A 3WQ1A 2RMU1 3ETQA 3E6DA 3ZXDA 1FOD2 2WNVC 1LJ7A 2PFWA 4H55A 3VBOB 2WNVB 4PU8A 5IK8A 3BPZA 2UY8A 2XUMA 1G9DA 5AFEA 4EN9B 1FOD3 2VW0A 3V64A 4B7KA 4B4RA 4AQSA 3VBUA 1G86A 2E9QA 5FQ0A 4HBNA 1NA1B 3W9AA 4Q4Y3 5HXVA 1RZRA 3LGRA 1R69A 1PO13 3G7DA 2K0GA 5JZGB 5EJ3A 3JXCL 2YUEA 3LA2A 2IZWA 1OSLA 4X4BA 1AL0G 1NOVA 4HVOA 4I3PA 2DUQA 3SLIA 4GKYA 1VIWB 2SBAA 3PNAA 3PVOA 3ZSLA 2PIJA 4BWOA 1PO11 1DBNA 2PE5A 1OLQA 1V9U2 1YWKA 1TNRA 3OTFA 5AVPA 5AC91 3CU7A 1V9U3 4OUSA 4HPKA 2TBVA 2AW6A 5GM0A 3DV8A 1IGOA 2W68A 3ILFA 5DDJ1 5K8SA 4Q0PA 3AMQA 1EAH1 1PHMA 1H8TA 1V6MA 5CAZA 1GR3A 2WLQA 5D8AA 3MFCA 1AVBA 5ACA1 1RIRA 1RTVA 1DQ4A 1SCSA 2HWD3 4AEJA 1LODA 1EPWA 1OKQA 3U4XA 2VNGA 1CONA 2RR13 4M3CE 4WM7A 5L19A 1GFF2 4NR1A 5C9AC 2ZABA 4LA2A 4R9CA 5BUVA 1FMD2 1O4TA 1RUJ1 2ZKNA 3VBRB 2PHLA 5BNOB 1GV9A 5KXCA 3GZAA 1PMIA 4HN1A 4LBLA 3B9CA 3DF0A 1FXZA 2NM1A 2WT1A 4HZFA 4M3CB 3WW3A 2EAKA 1ND2B 4LBQA 1MACA 1X82A 1Q8OA 1RUF2 3KT1A 3GBFA 3VHNA 4PIZA 3NAPA 2R49A 4OI2A 2JKBA 3DKWA 3ME2A 1G6NA 4LO4B 4W6WA 2YGLA 3A0NA 2YZ4A 2NYYA 4LLFA 1YI9A 3FYMA 5L7OA 4KU8A 2OYZA 4LLOA 3ZKCA 4NPRA 3GZTB 5FLHA 1H2LA 2HWC3 3WW1A 4P5HA 1PRVA 1HRV3 2D5HA 5K98B 2NMOA 1DQ0A 2UURA 2DCKA 3SCFA 4FXGB 5KHIA 2OPKA 1J1LA 2X53S 4WVMB 4YVSA 3W58A 4AFMA 2IXCA 2G9FA 3RI8A 1LEMA 2DVAA 3OYWB 1WD4A 1OFNA 1VBB3 5ABJB 2Q1ZB 1HIXA 4IA8A 1AU7A 1A8MA 2AXZA 4AI3A 4AQ6A 1AYM2 1YJLA 1UTXA 3RNSA 1NZCA 4Q0QA 4QMAA 2KA3A 5JI9A 1BBT2 1PZ9A 3MDPA 3QQ6A 1ONAA 2XG3A 2BGCA 1RUH1 1ULGA 4DNYA 2GSYA 3R0RA 4XETA 3JB8A 1JUHA 2JVLA 1DYKA 1RUNA 1OQ1A 3MIGA 1AR62 3USUB 5EWSA 1D4M1 3WG3A 3ZN6B 2G4IA 2X29A 2YROA 4I3GA 1DWKA 5FMOL 2AGSA 4HMZA 4M0HA 1DU3D 1J3RA 4I6RA 1UZZA 3ZN6A 3FBMA 4M01A 3MIBA 4L97A 3PJYA 4Y20B 2LM3A 1W6MB 4DQAA 1O5UA 2CWSA 5HCAA 2XJSA 4LHNA 3AXEA 5GZEA 2E7TA 2A6ZA 2HWC2 1LOFC 3URFA 1V6NA 1VRH1 3ZYRA 1SLCA 1PO12 2Q0AA 4FOVA 2MQKA 1AR82 4QQLA 1Q56A 1G7YA 2BFUS 1WBLA 5IK4A 1ALYA 3WHTA 2PTMA 3ZYIB 1YLLA 1UKGA 4E4SA 2ZHKA 4HN0A 1ADRA 4AHXA 1LCLA 1QJU2 1MS9A 2K9ZA 2QDRA 2Z69A 3M3QA 2Z2SB 4QGNA 3RYPA 4CP0A 3F52A 1DZRA 3WVJA 1NG0A 5FDBA 4QM8A 4K7JA 2R072 4G9SB 2R063 3ZFFA 4K21A 2ZX4A 2CROA 5C4WB 1RUD1 4XJZA 3MIHA 4FP2A 4AFBA 5LK5A 2A75A 3USUA 4Q26A 2N7GA 4QGMA 1N1VA 3ZIXA 2DVBA 3TYJA 1HF0A 5FO9B 1WLWA 1DGLA 1H2NA 2HWD2 4HVRA 4ATFA 1GSLA 1W6OB 1WA4A 5A7LA 5JWPA 4NO4A 2RR12 3M3OA 4ZU5A 2C5DA 2VOXA 4AXOA 1CAWB 4FOYA 3P3NA 1KXGA 1C8NA 1RUJ3 1V6KA 1D4M2 2IUOA 4I6TA 3CECA 1RPEL 3M4FA 4QPIC 3CEWA 3WDWA 3FLTA 5DG1A 1QGLA 1SEFA 1VALA 3AFGA 1WCSA 1HV1A 1UW8A 2CYFA 4YG0A 4R9DA 4I30A 3OMTA 1H9WA 1RHI2 1MVQA 3D0JA 1NY71 3VV1A 1K5MA 2ZPXA 3ZSJA 2ZGKA 5L7OC 3ZFEC 2HWB3 3ILNA 3RSJA 1BEV3 2ZOEB 1VBC3 4AGVA 4D7YA 1MZ5A 2DURA 5FOJB 1QJU1 2ET1A 1CGPA 4YW4A 4H14A 2NZ9A 4YZ1A 1LGNA 1R093 3UJQA 5CFCA 2D6NA 2RM22 5FO7B 1TMF1 4CEWC 2RJKA 1H2MA 2XBO3 4GQ7A 4IWRA 1B35B 2R062 1LR5A 1LOCA 3HIFA 1UU4A 3J4UH 4BOWA 1G9CA 4X4GA 5E16A 1VJ2A 1JN2P 1OOPB 2XJVA 5C8WA 4RA0A 1RUE2 4AVSA 3PHMA 1PGW1 3MIEA 1RUI1 5CNAA 4YARA 4F8DA 4FN3A 1GQHA 1V6JA 1H8TC 4MXVA 1WH8A 4Q4Y1 1IKPA 4COZA 1RMU3 4YG4A 5DXDA 2ZGRA 1FI2A 2ZGNA 1YYNA 1AJKA 1X57A 4JGZB 3JD72 2V73A 1AR73 3OD4A 4IV1C 4RHV1 1TQ5A 4BPZA 1C8M1 4LHKA 5A32B 2X8KA 3SNMA 5BNPC 2XI8A 4YNIA 3WP4A 2LYJA 1MS8A 5BNPA 3AXDA 1XQNA 3WDYA 3AM2A 2ZZQA 2FMYA 3A4UA 1QDCA 4A7KA 2VQ0A 3KGLA 4LTAA 1POUA 4XBNA 2D97A 4EWDA 4IXLA 2HEVF 1S0GA 5LRSA 5D8AB 1QY4A 4FPYA 2LUWA 4RL7A 1RVF2 3D82A 4GB31 3RI9A 4WVZA 4NHKA 1O4YA 1PGSA 3BDNA 1MEC1 4MX3A 4DMIA 4XXAA 1Z0HA 5JDBA 2O8QA 5EFUA 1COV1 1RVF3 2MEZA 1QJZA 4YVSB 4MGIE 2WT0A 2CGOA 1JOJA 1Z7S1 3UKTA 2MEV2 1GBGA 2BJCA 3JXDL 2BWAA 5I91A 1C1FA 1HXS3 4Y24A 4U36A 3MLLA 4Q4W3 1AJOA 2NQYA 5J96B 1OPMA 3KQRA 5AFBA 4AFCA 4V1PA 1ZPQA 3ELNA 4YRDA 2R073 3LA3A 4CDQB 4Z5HA 5GJ6A 3SXWA 4IEVA 1ZS4A 3RPQA 1RUI2 3KCYA 3T1MA 3JZVA 2WNUC 3WV6A 3ZXGA 2DVGA 1HX6A 4DS0A 1KS4A 2JG9C 2Y38A 3INAA 4OI0A 4AVTA 2GALA 3ES4A 4W6YA 1RUC3 1EV12 2P2KA 2ZHMA 3MLFA 1EYBA 4COWA 5GLUA 4K9SA 2WNVA 3VBRA 1XXNA 1HQLA 2X5IC 2IVQA 4CDWC 4WM7C 4XJ9A 3X29B 1W6PA 1O5LA 4R4XA 3AP9A 1X50A 4XF4A 1YRZA 2GU9A 3JQWA 5E1RA 1WW5A 2WWSA 5H9SA 1GLHA 2XL7A 1C3HA 1SQ4A 1PVC3 3VBFB 3AKPA 3IN9A 3O0XA 3OCPA 4AE2A 1H8VA 3WW2A 2DCTA 4Q4V1 4RR3B 2AYHA 3VHOA 1VRH2 4XFCA 1KITA 1U5ZA 2A3XA 3WG1A 4CDXC 4ZKTB 4KU7A 2EXIA 4DRRA 4JGYB 4KH9A 4GWNA 2WL1A 4R52A 1RINA 1ULDA 2WKKA 3VBSA 1PO22 2PUCA 3I7DA 4KWLA 1O91A 1R092 4IEPA 3NSTA 4I2OA 4JDNA 4FVVA 2CWMA 4ORFA 2UWCA 2D6KA 1PK6C 3HT2A 1KJLA 2D3SA 2Q1MA 2PHUA 1N47A 4UW3A 3RMXA 4RQPA 2VNRA 4UXAA 1YIFA 1JFTA 3JBG3 3O9XA 1LQCA 4C1WA 1N1YA 3B02A 3SH4A 3H1MA 2A3YA 5BXXA 3S8QA 2R042 1PIV2 3H8UA 2GRLA 3RRDA 3V56A 3M1HA 5FPXA 3DPRC 2XKOA 3CROL 2VW2A 4XZPA 4AEMA 5JIUA 4FTEA 2Z5WA 1QP7A 1JYIA 3ZPYA 4IVZA 4YG1A 1NCRA 4FTSA 4HK8A 2B8MA 3U07A 2CAVA 4XOGA 5F1RA 2LYPA 4AYUA 5JVVA 3GBWA 1AR72 3WG4A 2PHXA 1AL21 4PDWC 3J26N 3ZXEA 1F8VA 1VR3A 1BYHA 2RS12 5BV6A 2WNUB 4IV1B 2IVBA 2HWE1 3PVEA 3VBRC 2AREA 4DFSA 3ZYGA 1XE8A 3AYAA 3B7HA 1G8WA 4C0BA 1JFSA 4OI1A 2AR6A 2QZ2A 1RUG2 2H8RA 4BLIA 4YFZA 2WFF3 4AEKA 1SDWA 1QJX1 4RSUA 4DINB 2IFWA 1NERA 2PUBA 1BQPA 1J1TA 2VU9A 4N9HA 2Z79A 1LLIA 2P17A 4EV0A 3THPA 3WDVA 3MZHA 4MYEA 1TMF3 4KWJA 4XILA 4CEYB 5C8CB 2OZ6A 1L3JA 1U0AA 3CL1A 3D5OA 3KT7A 3VBOC 4ZU7A 4AVVA 2DWRA 3GALA 3WCSA 3WT3A 1U5XA 3S30A 4HK9A 1MS3A 1SLAA 3VDDC 3FFQA 4HETA 3BD1A 3N7KA 4QX5A 5T5LA 5GKAC 4DY5A 2B7YA 4D7SA 1I1E