2PUFA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
338
structure length
338
Chain Sequence
b'TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEQNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Structure-based redesign of corepressor specificity of the Escherichia coli purine repressor by substitution of residue 190.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 110
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pufA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pufA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pufA02
1D1PA 2HQOA 1H9CA 1W25A 3N6VA 5FWYB 1IC8A 2IOYA 2FVYA 1M5UA 4PU4C 4ML3A 1C4WA 4NV3A 2PL1A 3IPCA 4OTZA 4X4CA 5FBKA 4EYOA 3IPAA 4MCTA 3SCGA 2EWTA 3Q41A 1S7EA 3KS9A 4YGXB 2WY2D 5BRJA 4YCSA 1U8TA 1D5WA 1FFGA 2R1JL 3O1JC 1ZZ8A 4RKQA 2GBPA 3TD9A 3QX9A 1ADRA 2FTKE 1E6LA 3S99A 3SNKA 5HKOA 4S05A 2KPJA 3JXBC 3Q15C 3A3KA 5EWJB 4G0ZA 2LYKA 1ZHHA 1QP4A 3ZKCA 3CTPA 1OSLA 4MRMB 4D74A 4W5NA 3G1WA 2OENG 4IA8A 2TMYA 2IV1A 2PLNA 3H1EA 2MYPA 2QV0A 2XDYA 3CNBA 4MLDA 4EUKA 1NXVA 5IX8A 3M6MD 1R69A 4LRQA 3LKBA 3P9YA 1ZZCA 4MQFB 5EWMB 1SQ8A 4MAAA 5JNUA 1NXSA 2WUSR 1NY5A 4F06A 3GWGA 4IMIB 5KWSA 1SXHA 4JQDA 2A9PA 2WB4A 2MYUA 3GV0A 3JPYA 2LUOA 3ILHA 1JHZA 2L18A 2PPXA 3CFYA 3MF4A 4ETIA 3LTEA 1D1QA 3N8IA 4RS3A 1W9HA 1ZS4A 1DW9A 2KZ8A 1DJMA 1NXPA 3RVMA 3JXDL 1ZUGA 3LUAA 3G7DA 3OQMA 4N03A 3RH0A 4YV7A 1JFVA 2LP4Y 5FBHA 3JVDA 4O5AA 4Z4FA 2QZJA 2HSGA 3B2NA 3DNVB 1IIBA 4MR9A 3NHMA 4G0PA 1AB5A 3UK0A 3R0JA 1Z2DA 5TQ0B 4I6RA 3KYIB 3FFXA 3O1HB 3QLUC 3K9CA 2XSDC 1JDNA 4MS3B 4PEVA 3MMNA 3TB6A 4G0OA 1PEYA 3TRBA 2E4ZA 4TLMB 2WWVD 3RVNA 5DCLA 4YG4A 2IUOA 1ZZ9A 4RK1A 2LYQA 3QLUA 1NXWA 2QR3A 1O4XA 4X4BA 3FFTA 1CYEA 2FQXA 1E6KA 4RXTA 5TE9A 1JWLA 1PERL 2HPHA 2GRMA 1M2FA 2FSPA 2MYTA 2AW6A 3CG0A 3JY6A 4EVRA 3O2SB 4ZJPA 7ABPA 3M9WA 5KC9A 1PRUA 2GWRA 2IKSA 2LCVA 4X4FA 2PJUA 2X7XA 3O74A 4WWHA 3O2JA 1RPJA 5KI6A 2QW1A 4XAQA 5IUNC 2H8RA 1VKRA 1DBPA 2GI4A 4F12A 3SQNA 2XJ3A 4W5OA 3FFWA 3RVRA 1GCAA 1L5ZA 3CU5A 2YHBA 4FB4A 1GUBA 3DGFC 5CNKA 3C3WA 2FMFA 2O4AA 1DCKA 3GT7A 3H75A 3HUTA 5TPWA 3DZDA 3G85A 4E7PA 5B3JC 3L6UA 3F73A 5FWXB 3F6PA 3EAFA 2FQYA 1NXXA 4N41A 4GNRA 1WETA 1MIHA 3HZHA 3KTOA 3N0WA 3QLVC 4X4HA 3EJWA 5B3JA 2WRZA 3BS3A 4KQCA 4GPAA 4OATA 1FQWA 2LYSA 2P9HA 3QLVA 1HEYA 1ZESA 4G0XA 2YHAA 2HQBA 4Z99A 4FE7A 1A2OA 1PNTA 1USKA 3N0RA 3KCNA 2RGYA 1C0EA 3H5LA 2I6FA 3SCFA 1ZN2A 3D1NI 4LX8A 4MGEA 4OG2A 3QQ6A 1Z15A 2H3HA 2MYNA 2WMYA 1UTXA 3BD1A 4PZ0A 2PUGA 4RU1A 2E4UA 3A0UA 5T3YA 5ED4A 3BREA 4EYGA 1DWKA 1ZH2A 2QXYA 4IMJB 4JASB 1PRAA 4Q6BA 2B1JA 3NHZA 3LMKA 4Z9AA 1OXKB 4RK7A 2AXUA 3HO1A 3EULA 5ABPA 1TVMA 2L2QA 2IVQA 2FN8A 2IVBA 2GKGA 1ZITA 4HYEA 5FWYA 1ABFA 3C3KA 4L4UA 1RXIA 2FMHA 3H5IA 1DG9A 2IDMA 1L1MA 1LCDA 3OMTA 1YIOA 3OLYA 1XWWA 4MS1A 3EQ2A 2BNMA 3UFDA 3LUKA 3HDVA 2O20A 4LDZA 3DGEC 5JNSA 1WIZA 3KXAA 1XHEA 2FW0A 4MS4B 3RQIA 2GX6A 2KEKA 3F7NA 4KQ9A 1KGSA 3OMWA 3T95A 3H5OA 5EWJA 3LFPA 3QELB 4MRMA 1CJGA 5HM6A 3LUJA 5IUJC 2GZUA 1EWTA 2XIUA 2E4XA 4I8TA 3GBVA 4Z4GA 4EVSA 2V0NA 3HS3A 1CHNA 2FLWA 1ISSA 3IP7A 4PYRA 1MVOA 2JRLA 5TQJA 1S8NA 1ZDMA 3LFTA 5BQ3A 4RXMA 5JNRA 5EWMA 3SAJA 4MQFA 5KQPA 2P4UA 1Z17A 5GOTA 2ZAYA 1Y1LA 2HJ9A 3LUGA 5JNWA 1KMIY 3HDGA 4TN5A 3N53A 1AU7A 3KSMA 2QSJA 3BILA 4H3KB 3EDCA 4P1ZA 1LJUA 3HEBA 3BBLA 2LYJA 4MR7B 3BDNA 3CRNA 4GQMA 3HV2A 4KZKA 4QPJC 5T7BA 4W5RA 1K68A 4WXMA 3RZZA 4DQDA 1YVUA 1ZZ7A 4GHJA 1ZAYA 2ID9A 1BA2A 2E4WA 3E61A 3I09A 3QEMB 4MQEB 1Z13A 1RZSA 1MB0A 2VYCA 5E3JA 2R48A 4W5TA 4Z4EA 1EAYA 1P6UA 4RZSA 2HQRA 1LK0A 4XFKA 4F8DA 1HF0A 2LBPA 3L49A 5TQ0A 1NXTA 4RXUA 5CNIA 4MS3A 1Y9QA 3CLCA 3CZCA 5JNTA 1ZY2A 1SXGA 2RJNA 2MEZA 4RK4A 2FN9A 2QVGA 3IP5A 3LUHA 1LLIA 1UDRA 1B00A 1BDHA 4IILA 4Z5HA 3GN5B 2NT4A 2FEWB 5JS2A 3KG2A 1P8AA 4TMYA 5DTEA 2O49A 1LBIA 3IDOA 3NNNA 1VRVA 4JOQA 5DKFA 3NNSA 1TLFA 1DCFA 1DRJA 1QMPA 3MM4A 2CHEA 1QQBA 1JF8A 1NTRA 3CKMA 2EBYA 3MIZA 2FLKA 2L49A 2WIUB 1CQTA 5DGCA 4I6TA 1JDPA 4RY0A 1EFAA 4X4GA 1L5YA 3Q7SA 1R8JA 2DRIA 1NXOA 3H6GA 5FWXA 2LIVA 1PHRA 3JS5A 4IF4A 4WT7A 3F6CA 3FYMA 1B0NA 1YTUA 4YWHA 4TLLB 3I5AA 2JK1A 2AYXA 5EWLB 3ROTA 5TPZD 2ID7A 1MB3A 4QICA 1EWKA 2M98A 1P6QA 1M2EA 4F8JA 2CHFA 1Z16A 2FMKA 4F3TA 3OLVA 3IP9A 3IP6A 4KV7A 3MLFA 3QWGA 4CBVA 4G0QA 2AWIA 4IWRA 2OR1L 1VLZA 1Z26A 3H5VA 5IUKC 3ROFA 1YSEA 3RVPA 4EVQA 5IULC 4Z58A 4KNYA 2ZWMA 4MR8B 5TQ2B 1DZ3A 4RK0A 1QP7A 4E7OA 1KRXA 2AUWA 2LYPA 3RVKA 3RVOA 2MSKA 4PU8A 3H5WA 4O1IA 2BJCA 2IPLA 3RVJA 5JS1A 4LZLA 1JX6A 2JBAB 3KKEA 3QK7A 4M88A 1DC8A 1EHCA 2XCJA 1YMVA 3M9XA 2M1ZA 3T8YA 2OFYA 4IVZA 1LBHA 1USGA 2E4YA 2MSWA 3H1FA 4RY8A 2A9OA 3BRSA 1ZPQA 1SRRA 3FDFA 3ZHIA 3ILYA 4LDAA 4Z9BA 4KPYA 3C97A 2KEJA 1E3OC 3KYJB 2FQWA 3U3WA 4KMRA 4EGSA 1APBA 1RZRD 5F64A 1U0SY 2NZVG 1JFSA 1AB6A 1D2AA 4HNRA 5GQSA 3W9SA 4JAVC 4O8BA 3CG4A 3A10A 3HUUA 1NERA 1PNRA 4MS4A 2PUCA 2PUBA 1VPWA 4LE2A 3C6QA 3HK2A 4J1XA 5CHYA 3QELA 1DC7A 4FE4A 2B4AA 1D4ZA 6CHYA 1QP0A 1GCGA 1TJYA 4RV5A 1LJLA 2JVIA 4KFCA 2CROA 2PUFA 2IPNA 4KREA 2XI8A 3KHTA 4KK4A 2NZUG 1E2BA 3D02A 3RVSA 2R63A 1OXBB 3LUFA 1DCMA 1LCCA 1BAPA 5CNJA 2FEKA 3DLHA 4JCXA 4YR7A 4MPTA 3F52A 4RK6A 1UXDA 1GT0C 1QKKA 2QU7A 4F11A 3LKVA 3TMYA 1R63A 4OLAA 4KRFA 4Z4HA 2PUDA 1BDJA 1X2LA 1EWVA 1RNLA 1P2FA 5BR1A 3K4HA 4MR7A 1T34A 2N9UA 4PU3C 2ICTA 2GRLA 5DLEA 3I45A 1QQAA 3PXPA 3CZ5A 3QEMA 3HCWA 3GRCA 3H6HA 9ABPA 1U04A 4MQEA 1FSPA 3KLOA 3EUSA 3CS3A 3GBFA 4YBAA 3OLZA 4G86A 4KVFA 3DBIA 4QYMA 4ZMSA 1BVHA 3SY8A 3JVIA 3G5GA 2IYNA 3MA0A 2VK2A 4PE5B 4YG7B 5HQJA 2IPMA 2JB9A 3F51A 1QO0D 4G0MA 4YS6A 5KQGA 3OP9A 4N47A 3O1IC 4NICA 2FEPA 4JCYA 2R4QA 5C5CA 2O38A 2CD7A 1SD5A 1M5TA 2EF8A 3GN5A 3HXMA 1CEYA 3HM9A 2LYLA 1U2QA 2H0AA 1ZGGA 2AXZA 2MSLA 2NUBA 4NQRA 4MS1B 5KQMA 1DBQA 3HJFA 1E6MA 3FMYA 5TPZA 3T6KA 4ZMRA 2PIJA 1Z18A 3OLXA 1ZH4A 2JVKA 5CNMA 1J56A 4IRXA 5IC5A 4LE1A 3KLNA 4DADA 1LMB3 3ZHMA 3DLBA 2CSFA 4Z59A 3I42A 3QYXA 2E4VA 3UUGA 4RY9A 3H5TA 3N0XA 2HINA 1I3CA 2A9QA 1JH9A 5JNVA 1A0OA 3QLTA 1X57A 4Q6WA 1ABEA 3R1FA 1PUXA 2WJAA 4JB0A 2FJRA 4Z5DA 3SG0A 3OO0A 3E3MA 2WJWA 5D2CA 5EWLA 4X4IA 4JA2A 1Y7YA 5I4CA 3JXCL 3D8UA 1JFTA 1JL3A 1DRKA 1FFSA 3CHYA 3JPWA 4NCBA 3VNAA 1WH6A 1K66A 1POUA 4Z5CA 3OM0A 1U2PA 4XLTA 1ISRA 3N75A 2JCGA 1YS6A 3L1PA 2AXVA 1Z2EA 2Q5CA 1USIA 2PL9A 2QVCA 2OQRA 2R25B 3O9XA 4MR8A 5TQ2A 2PMCA 2IU7A 1RZRA 3BRQA 1GLGA 2PUAA 3LUDA 2LYRA 3B7HA 4PICA 3A0RB 2NT3A 1YS7A 2JBAA 1WH8A 2L19A 3LOPA 1NATA 1PRVA 1URPA 4H3HB 4P98A 2PKXA 1F51E 4XARA 1A04A 1UXCA 3IVPA 1F4VA 1XHFA 4XXHA 4ZPJA 3O75A 2VUHB 4RDCA 2D5VA 1ZVVA 1JYEA 1Z12A 4RKRA 3KZ3A 4UHJA 3QF3A 1YK1A 3Q7RA 4YLEA 5HSGA 3HVRA 3MYYA 3OMXA 4HNSA 2W42A 3EGCA 3OQOA 4O1HA 4RK5A 2VUIB 4ETMA 2B5AA 4NCAA 3SCHA 4EY3A 1QPZA 3FGZA 2RJOA 3FMVA 3UKJA 1SXIA 4JP1A 3TX6A 3OO1A 4YG1A 4MR9B 4OB4A 4JB2A 4X4DA 3C3MA 4MCXA 3O21A 4RWEA 3SM9A 4N0PA 5IBQA 4J1WA 4N76A 4EYQA 3KJXA 1JYFA 1RIOA 2A6CA 5KC8A 2KYRA 3GL9A 4D6YA 4X4EA 4YP9A 3HZIB 5PNTA 2MQKA 1BDIA 4L85A 3RVLA 3RVQA 3JTEA 2J48A 4FN3A 3GA5A 1MAVA 4WZZA 4YO7A 4QYWA 3EODA 1KRWA 3Q9SA 4I6UA 3VNBA 4WXEA 2JVJA 5KQLA 2PE5A 3EQZA 3QEKA 4ZYLA 4WUTA 1PEAA 1DP4A 4Y42A 1JLKA 2IPAB 3QX8A 2L8NA 4OBBA 4MYRA 3H1GA 4YRZA 8ABPA 2PAFA 1OCTC 3Q7TA 4XASA 4IGAA 2F8SA 3O2QB 3F6WA 1RPEL 4EYKA 1YK0A 4Y9TA 4YARA 2FMIA 3OM1A 1QO0A 2PUEA 3GBPA 3MQ4A 5K98B 4MLCA 5TPWB 1XWRA 3VK0A 1GUDA 4HNQA 4ETNA 4S04A 1DBWA 1RXEA 2BNOA 4KK3A 4G97A 4DN6A 4PU7A 2AYZA 3OLWA 1LQCA 2CWDA 4W5QA 3S8QA 3CLKA 1NEQA 4Z4CA 4OLBA 4B09A 2FKAA 4LE0A 3T38A 4Z4IA 3FYAA 1TM2A 3NBMA 2LPMA 6ABPA 4G0YA 1ZZBA 3OQNA 2BNNA 2JVLA 2A9RA 5BRAA 4RSMA 1JBEA 3HSYA 5C5EA 3LISA 3NNDA 2IVGA 1QNLA 4UHKA 3LUCA 2RDMA 1ZGZA 4H60A 4N0QA 2FXIA 4NDWA 3URMA 4D6XA 2L17A 2ICPA 1TMYA 4Q7EA 5IEBA 5IEJA 4FBIA 1FFWA 3CECA 2KEIA 4Z0NA 3TO5A 1ZZ6A 1Z25A 2F8TA 2BGGA 5A7LA 1YMUA 2R47A 3GYBA 3CROL
chains in the Genus database with same CATH superfamily
3ZGYA 2HIAA 4A36A 3L4SO 3WRVA 4KU4A 2FZEA 4KUHA 3VTZA 1KEEA 5IVKA 1UODA 4ZOQI 3E7DA 3BWMA 4RHXA 5A5FA 2P2GA 3QE3A 4KO3S 1KZHA 2V58A 4JGGA 4WUVA 4F97A 4JLSA 4ZQBA 2PMFA 1K2WA 2DOKA 1YJXA 4EJSB 4BNFA 2FN7A 2Q5JA 5JS8A 4MQUA 4EVIA 2X1LA 4TTTS 4U2FA 1RXYA 1NZDA 2YV4A 3UG7A 1V35A 2Q2OA 2R6DA 1B43A 2KE5A 3IEIA 3NBUA 1CR6A 4XDGA 2WG2A 2KPJA 3KOOA 3QVKA 2VG8A 3ZLBA 1S89A 3VOAA 1ZHHA 1YULA 3ZKCA 1LY1A 2QRQA 3HLTA 4YJKA 4P4TA 4W5NA 3G1WA 1DUIA 3SFTA 4PSVA 3U5ZB 1WUHS 4A5SA 3WWEA 2CVQA 3UB4A 2X6QA 3B1XA 2MDTA 4MLDA 3VGJA 3BK1A 2BP7A 1QOPB 2X8AA 3NRJA 1TEHA 4RSRA 4QOIA 3NTOA 4LRQA 4WFJA 4C89A 1ILEA 4OJKA 2VH5R 3HZZA 4PC3A 5AM4A 4TZKA 5L51A 1X77A 1SOVA 4D9BA 3I37X 2Q3EA 1FOEB 2V7UA 3BSSA 1Q0TA 2FETA 4B32A 3X2FA 2ZPAA 2VL7A 4IIJF 1W7AA 1O5TA 4S1WA 4FFSA 2WWXA 1L4KA 3NIFB 2YH2A 1S9DA 4Y2SA 3T54A 2C4HA 1USVA 5HILA 1ZUGA 4TS4A 4YV7A 1I14A 3CKKA 3L3BA 1MQ9A 1K1EA 5H80A 5ILQA 3RYIB 5LD2C 3R5HA 2O7VA 4HF7A 1CUUA 1N2BA 4EJMA 1RHUA 1IB6A 3QOFA 3GDFA 1N32B 2JZCA 4LDPA 1K4KA 1OX6A 4GYKA 4HTAA 3EDRA 3ZWCA 3L8FA 4LY3A 3P9SA 2B5WA 5BN5B 5TQ0B 2ZT7A 1VSUA 5CEFA 3OUUA 4WCFB 1U1IA 1IQPA 4LNHA 4MP8A 4R5HA 3TINA 1GSHA 3VHXB 3NVKI 5IXJA 4JNCA 2CDAA 1R37A 3BSYA 4RK1A 5K03A 1YOVB 1M7GA 3GK3A 3QLUA 1EQ2A 3TL3A 2OCDA 1J33A 2AVDA 2P91A 4X90A 5EC8A 1JWLA 2AK2A 1COZA 3G2MA 4HNHA 4LRWA 5LZ5A 4COKA 3GJZA 1QX3A 3QFFA 2QT1A 2VPZA 2XMCA 1IMOA 2H4FA 3CSDA 3SYNA 3R75A 4QSHA 4D26A 1I1NA 4R51A 2G8LA 2NO7A 3C4VA 3DE1X 3H8JA 4PPFA 2IF2A 3VPFA 2XF8A 5IF9A 2IDZA 2H8RA 1G8FA 1VTKA 2B1GA 2IUSA 1K8RA 3BXXA 3OWOA 3TTWA 3UGQA 3AVVA 3IEXA 1VJDA 4WQMA 3RANA 2I5PO 4FBLA 4K05A 3RTDA 5EJIA 4MHTA 3HPRA 1EAMA 1K97A 3OJEA 2QP9X 3N7TA 1PLLA 3DUFA 1BEUB 4MRSA 4KBFA 4PVDA 2WWGA 1AE1A 3A1WA 3H1TA 3EVFA 2BEWB 2NNLD 2AE2A 4RJTA 1K3UB 2DXIA 3HZHA 1ND6A 4OHRA 3F9RA 1CS0A 3LC1O 4Q7JB 3BAZA 2FPSA 1XMQB 1UBJS 2PVSA 1XNRB 3GAMA 3NV7A 3VR2A 3ZW9A 5TMDA 2RHBA 4FDAA 1KAOA 3FI0A 1G3MA 2YL2A 3WDSA 2OKCA 1CXZA 1PG0A 2X6RA 2IXEA 4GBJA 4JUDX 1FK8A 1QYIA 4TV9A 3V46A 3UF0A 3M6XA 3PZRA 1PWYE 1QQTA 5IN4A 1DFGA 3AZPA 5K8VA 3F96A 3OIWA 1MEJA 2FPKA 2NVBA 3SR3A 3BIFA 1LGYA 4B31A 3M9LA 1Y89A 4AMZA 4L2IB 3H83A 4UFOA 5FUQA 2COUA 3CO0S 1TK3A 3ACCA 3FTCA 3ODPA 3QNMA 4JHXA 4LRUA 2O1SA 3PD1A 3HB1A 1R00A 4RPIA 4JDUA 2WKRA 1XDWA 1JSXA 4BE4A 2ABWA 3OQ6A 1JE1A 2XTNA 3ORQA 3P9XA 4GRDA 4JP8A 5TT0A 4DWWA 5J59A 5DXFA 2BKAA 4N3GA 4WRRA 4WSOA 4EJSA 4PHGA 1K63A 2XGSA 2FZLA 4BNMA 4EITA 1ENPA 4HR7A 2F62A 2A7XA 4AM8A 4ZQHA 5F3WB 5NLLA 1TMKA 1QS0B 1S2LA 1YJQA 3OMWA 1GU7A 4OQLA 3SZRA 1IZ7A 1MVLA 10MHA 1BQ3A 3LYAA 3LUJA 1BWQA 4B1FA 4ESHA 3DAYA 5BSHA 1G5FA 2JI4A 1IB0A 2EF0A 2HF9A 1SPBS 4QXAA 4GLJA 3H6KA 2PMDA 1P91A 5K0ZA 5LUBA 2J46A 1GDDA 1MVOA 2FJ0A 4TYMA 1ST2A 4I55F 4DANA 3OCZA 2RGWA 4E2YA 4K6GA 2ZBUA 2NP6A 3FRIA 2A5GA 5CH5A 1W6RA 3L02A 5E4YA 3ZXIA 4B6PA 3CSUA 1M7HA 3AEXA 1J09A 1PDOA 2WUGA 2C3OA 2IIQA 4MTLA 3JSAA 3U4GA 3ZQ6A 1DRUA 5D51S 3CLUD 2X23A 3EZYA 1T5IA 3PB3A 4R9VA 4YO8A 3V2IA 4DRXB 4DTCA 3R9WA 4GRIA 1XQ6A 1EVQA 1L7PA 3JAMA 2GYWA 1ICIA 2POQX 5DP1A 4KN5A 1XLUA 3O4VA 2QVZX 3N8HA 3IE2A 3RYIA 3PENA 3FRHA 5B6PA 4BVLA 2H08A 2R84A 2VYCA 4O29A 1KKUA 2YW9A 4RZSA 2VSNA 3B6MA 5A1JA 3QHPA 4C3OB 5EXSA 4Q4DA 2XYVA 4QAJA 5IAEA 5TQ0A 5BN5A 5EPOA 1YZ3A 2QE6A 4RM2A 3NPMA 1TQ8A 2XNJA 4RADA 4WCFA 1LV7A 4UFPA 1NP6A 3O3NB 4LGVA 3VHXA 4JXJA 4XR4A 3V00A 1Y8AA 5DGIA 1ZCFA 1YOVA 3LUHA 2CL6X 3DDNA 5AD1A 1A50B 3KELA 3RSQA 3GN5B 1XCPA 3DWEX 1M6HA 4K0RA 3U1BA 1GARA 1IOZA 5JSUA 2JW5A 2ZEJA 2IY8A 3GFSA 1E60A 1LBIA 3PC7A 1OLUB 4GIBA 2FW6A 1CUHA 2CLIB 3ELUA 4FLFA 1S3GA 3PS9A 3TSCA 4ZVPA 2WIJA 1P0QA 5DKFA 4CKXA 1XLVA 5TF4A 1G8PA 3ZYZA 4CM7A 1TCVA 4RD1A 1RWOA 1GR0A 3Q3CA 2CHEA 5A3RA 3I53A 3NHJA 3DDCA 3N2GB 2VSXA 5HF8A 4Q19A 2EBYA 2FEMA 5P21A 2WUEA 1YQTA 4B4VA 4PO3X 5DHUA 4W63A 1SH7A 3O2NA 4C0JA 2BZ0A 4YJ2A 2WOJA 4PQRA 3GGJA 3DDHA 2OMKA 2O05A 2BEWA 1CY1A 1QFZA 3JS5A 5COBA 1JHRA 1TFRA 2JFBA 5EWLB 1KJJA 1NQ5A 2QGZA 4Z3DA 3VYTB 1EXMA 4RQBA 4KLAA 2M98A 3A27A 4LJ7A 1ZC4A 4WEQA 3WYAA 4NCIA 4F4DA 4EKDA 4ZYYA 1E2GA 2FWJA 5BMVB 1MOPA 2Z4TA 5KVVA 1K6XA 2AWIA 4G0QA 3H9UA 5C31A 1UPUA 4BMOB 2DUJA 3KLBA 3QTTA 4G1UC 4QDKA 1EI9A 4BMZA 2ZRCA 2GK6A 4XDHA 2OD2A 3BTUA 5A0FA 3DV0B 2AKAB 2QENA 2QMYA 1OGIA 4AIIA 1X7GA 3ENVA 1LRLA 2JBAB 2XA9A 3TL6A 3UJNA 3T1HB 4PINA 1BGXT 3GMDA 1Z68A 4L2IA 2GN6A 3IUJA 2QORA 1V7PC 1DCTA 4US1R 1OTXA 4JC8A 1O0SA 3VR5H 1A9TA 2R1VB 2WZQA 3VPHA 1F4PA 1IG0A 1QVWA 1QYRA 3MBOA 3QJ5A 4E30A 1W4RA 3DTTA 5FNVF 1G8KA 3PPXA 2CJXA 4BLRA 3Q0TA 1W5SA 3KVVA 1FW6A 3T94A 1PX0A 2UV8A 3SSNA 4QNMA 4IGIA 3AKCA 1H8HD 3CX6A 1QS0A 1GOTA 3EXG1 3DR3A 3RBAA 3C6MA 4YH1A 3LIIA 3LIPA 4FMPA 3TNFA 5JZOA 2W6NA 3V7NA 3H8VA 4OP2A 1MKYA 1GCGA 1TA4A 3GLHE 3S55A 1LJLA 4FUTA 2ZBQA 3BPSA 4QOHA 5ELXA 5AKGA 1RPNA 5HCUA 3L07A 2RGRA 3T3OA 4MJXA 1LCCA 1CJVC 1RI3A 1M83A 4CMCA 5REQB 3OZWA 3JD4A 1QKKA 3OZGA 4KQ2A 4O2BF 3CN9A 1PJAA 3LBHA 1R63A 1SCIA 4OGGA 5TJ9A 2PUDA 2O19A 5C1BA 1Z6ZA 1I33A 4GECA 4DRXA 1SC4A 4A8JB 3E03A 3QQ5A 4RZIA 3V1UA 2XB8A 1YZKA 4JFRA 1DXQA 4X60A 5HBGA 3TOSA 5KNLA 1CDDA 1T4DA 4HSGA 4OP3A 5FLKA 3S8EA 4I19A 2SCUB 2ODBA 3HCWA 4MQ6A 2UZ0A 5DBFA 1PSDA 1V2HE 1FPQA 4J6EA 5IDVA 4TKVB 1ZW6A 2ETXA 2QTWB 3WZMA 3HDYA 3E1GA 1MW9X 3R7LA 3ECCA 2IYNA 1FLNA 1HFWA 2B6NA 2P5YA 2VK2A 3KDAA 4P36A 4DIKA 3TGWA 2BKVA 1OV4A 1F2UB 4IDBA 1QO0D 4JYMA 1QFMA 2VF4X 3SQMA 1KOGA 1VP9A 2EC5A 2HL6A 3L8HA 4PAMA 1YC5A 4KR3A 2EW1A 5KVCA 1Z08A 3GN5A 4BQRA 2X0KA 3L1KA 4D96A 2IH2A 1ZGGA 1QDEA 3C5WP 3LAWA 2W2LD 1OLUA 4FC7A 1DO0A 1KDTA 1WMBA 3BHJA 4G4GA 4MQ4A 1PKEA 4URHA 5KWEA 3L0YA 3LJKA 3P2EA 1BZYA 2ZK7A 2KBFA 3QRWA 2YMMA 3QFIA 1FNSA 3TTUA 5HUHA 2Z5GA 1O0BA 1GNLA 2XYHA 1XQWA 1V9CA 2OFWA 1A8UA 1E9VA 3IJRA 3IX7A 3N2GA 3RODA 4BKQA 4DKXA 1W36D 3LP5A 4MMZB 1SCDA 2OLKA 2QB5A 2VDVE 3OE1A 2NX2A 4HQNA 4XX1A 4CLRB 3HY3A 3H5TA 3ZX5A 3L1JA 1OJ7A 2Z09A 3KYBA 4UNNA 5H4HA 2A9QA 4FGSA 1J9ZA 2VN8A 1WF3A 3QTLA 4ZCLA 3R1FA 4QT0A 3SG0A 1SKAA 5DB4A 2ENWA 1ZM3A 3E18A 3PNLA 5EWLA 1Y7HA 2O9JA 3I04M 3KPVA 3S1LA 3TVTA 3U09A 2AFHE 4FYYA 1C7EA 2EKZA 2I03A 2PBZA 3I64A 3TSOA 2FZCA 1UOEA 1GGEA 1F48A 4IIDA 3UEOA 1EINA 2VFAA 1M0TA 3L5KA 1BHSA 4UD2A 5BMVA 2Y1EA 3DOHA 1IK6A 1HO3A 2CMGA 1PGJA 3L04A 1HFKA 5H16A 4AULA 2ENUA 3H5VA 2ZGVA 6ADHA 3O9XA 2HC9A 5E7JA 3QV1A 2GZDA 3DV0A 3CBGA 2CNDA 4F6CA 5IJZA 4TKLA 1DOHA 2JBAA 3B8EA 4P98A 1GLVA 3O26A 1ULSA 2V7QD 4LISA 4BVBA 4KWTA 2I8LA 4WJKB 1GG9A 4HN4B 3KOZA 4K9PA 1FYWA 4F60A 3IS3A 3IO3A 2FSSA 2FR8A 3LWZA 2ZR8A 1T9DA 1UADA 4MWTA 2R1VA 4FKMA 3KZXA 5EINA 2ERYA 3WYDA 3W5BA 3WXBA 2V7WA 3UPUA 4BFLA 3PJFA 1PJ3A 3O38A 2R85A 4P86A 4X4DA 4BRSA 1XG5A 4EPXA 4PQYA 2XEXA 3AILA 3GA7A 3GGDA 3FZGA 5TC4A 1MBZA 4IXDA 2ZRIA 1C0PA 3TVYA 3MJDA 1WSDA 3IJEB 4OIFA 4F86A 1JLLB 4YREA 5G0TA 3C1TA 1V3VA 2YHSA 2REQB 4HQ0A 1ZQ1A 4Q3DA 1V96A 3NWBA 5AJYA 1P2SA 5JYEA 4UHFA 1GNQA 5BVHB 1GN8A 1TDJA 4N0DA 3VNBA 4RTRA 3T3IA 5MF6A 2PE5A 4URZR 1TQDA 1Z33A 2HLHA 2MHCA 2ORVA 4FD2A 1FEZA 2GJKA 5REQA 3M6VA 5ALSA 1M2WA 1GCUA 3CZ9A 2GNAA 4ZZ2A 3TCXB 3EW7A 3NKFA 4KOAA 3X1KA 1J23A 1NLFA 1PK8A 4GE3A 4JYPA 2H4WA 1RPEL 4L1KA 4CQLB 2C29D 2C31A 4NZYA 4A8JA 1WR8A 3H99A 5SZKB 5L7WA 3WY9A 3SIWA 3GFGA 4QTZA 3OQJA 4DN6A 4Z3OA 3KL2A 4IDHA 2SCUA 2AFIB 3HJRA 4TTSA 3ESAA 5FT9A 1II8B 3M6IA 3V4PB 4YT2A 4W5QA 2CJYA 4GPZA 5LOVB 1Q7RA 2PGLA 4FK8A 3HU1A 1QKJA 4TX1A 1JDTA 1B3BA 3HRHA 3A36A 3FYAA 3NBMA 4HLUC 5G0UA 2BLNA 3WGLA 2NTEA 4I7EA 1U94A 3HVIA 3S2UA 4Q4JB 6ABPA 2B6HA 4LRYA 2A9RA 3NWOA 2QL6A 1VG0B 1F2UA 2ZSUA 3IALA 3OX4A 2D2IA 2H2DA 3T9AA 2IF0A 1NBHA 4F7DA 1ODKA 4NDWA 2B34A 2VQEB 1GA1A 1QHXA 1LBEA 3OEWA 3HJHA 1SBYA 5IBRA 5JATA 3HXLA 4HWSA 3BFVA 4POAA 3MT0A 4LF4B 2X2OA 3QEOA 1FS4A 5A7LA 3GZNB 3OFKA 2MMGA 4HWKA 4F71A 3SC6A 2Q2VA 2XXPA 2AHRA 1R15A 2XW6A 4IJVA 5CFOA 4Q9HA 1Y7TA 1XLTC 1LDBA 2RFLA 3LD9A 4HVTA 1GYRA 1UT5A 2PL1A 1X8XA 1Z2PX 1YVPA 1YA4A 3A4LA 2WABA 2NV0A 3WV4A 4CLRA 3KS9A 1U90A 3R3YA 1LUAA 2CLOB 3GLUA 3RHZA 3AL0C 3OECA 2FEXA 3CLRD 3RYCB 2JANA 2B2XA 1BN6A 1EQUA 2ORWA 3EH2A 3H4MA 3WG9A 5TMEA 5FKJA 4EHHA 4I8DA 3JZAA 2EBWA 5ALRA 5FLEX 3B1KA 2QQGA 4HK4A 1SHJA 3QXGA 1DT5A 3E1KA 2RCNA 3D4OA 2QV0A 3CNBA 3K8OE 1ZH8A 2B5VA 1ZHFA 3LKBA 4CMEA 1W85B 2QTVB 4MQFB 3JALB 4H7FA 2I4TA 2ZRGA 2BFDB 1BMFD 3GVXA 1CZKA 3DDSA 3VWSA 5KWSA 1KORA 4E2WA 1W6UA 4JQDA 4RTJA 2H6EA 1UP6A 5IKEA 1SG6A 3IAUA 5JSFA 1GSAA 3VHLB 3R0QA 3K0BA 2EGGA 4AY6A 1OI4A 1GEGA 4JOCA 4FR0A 2ZB8A 1XCGB 2BFEB 2F1KA 4MV1A 2FFAA 2WKQA 3N8IA 4R68A 3G5MA 7AT1A 4RVGA 3NTVA 2QLTA 1LTKA 4OXXA 2X5XA 4N03A 3FCAA 3WIVA 4CG0A 1JFVA 2RGEA 2JI9A 1U2DC 2VSOA 1LC3A 4OXYA 4FMDF 5JH7F 3K4PA 1IIBA 2AL7A 2D1SA 3AZOA 4NZNA 5D3QA 1O8CA 2CXPA 1U7HA 3K3PA 3STYA 3WHPA 2IE0A 1SM4A 2CLHB 2H1CA 4C01A 2HMTA 4UATA 3QXXA 5F3DA 1L2TA 2WJHA 1AKTA 1LVGA 2OUKA 4WOJA 3BMNB 2VNAA 1JLLA 3D54D 3C6XA 4HZUB 3UAVA 4CQNA 1CEEA 2FWNA 4B35A 2REQA 2DQKA 4EY5A 3GPIA 4CLXA 1YDGA 3ROKA 1JU3A 1GRRA 2QNBA 3AB7A 5BVHA 3EX7C 4JP5A 5E2AA 4XYMA 2WUFA 5JSZB 2CXOA 5EIBD 3W8FA 3MTGA 4JZYA 4D98A 2HDNB 4YACA 2GI4A 3CC8A 4CQLA 3NHRA 1JECA 4M1EA 4O6VA 4KACA 2G70A 3QA9A 4YMGA 2RGDA 5EP3A 1FXWF 1V43A 4A73A 1EHYA 1HQ1A 2VRCD 4GPTA 3UMFA 5CH3A 5GONF 2RARA 2Y9PB 3DZDA 3WGJA 3F5QA 1YU6A 3CRZA 1RP1A 2WKSA 1JA9A 1NZJA 1NXXA 2AFIA 3EAFA 2FG7C 3LDAA 1II8A 3R24A 1IZZA 4GUAA 1TJ4A 4X4HA 4L76A 4IUDS 2OK7A 1KC1A 4HZGA 4DQLA 5LOVA 5DLDA 1YCHA 1MX9A 2QYHA 3E3NA 4GPAA 3BD7A 4TL7A 4QXOA 1ZBDA 4QBTA 4EBFA 1OLXB 2H1IA 3OJWA 2FDCA 4TTPA 2YHAA 1GV0A 2H17A 4N7BA 4PPGA 4QYTA 5A4IS 5ALVA 1RMTA 5C5IA 1AGYA 4Q4JA 1J6UA 3JZFA 1ZN2A 3L4BC 5E4JA 3BRWD 4JUFA 3CNQS 5LB4A 3SDSA 1O77A 2FWRA 4BFSA 2D3TA 1NP7A 2VNKA 3I9OA 3KJFA 5EJ8A 5IWAB 1A9PA 2O3QA 2BGJA 1ATIA 2PGDA 3BXEA 3ZUGA 5CVTA 1O9BA 3HMQA 4D8TA 3O4IA 1HNXB 1NOKA 3W78A 1QHNA 4K9OA 5B2FA 1MG5A 4DABA 5KDOA 2XWSA 1V3UA 3QVTA 3ZXXA 1Z2OX 3FTDA 3Q8XB 5I01A 3GZNA 1WXQA 3SDBA 1OXKB 2Q5HA 1JAIA 1P1JA 3EULA 1HDOA 3LDFA 3LSYA 5A62A 3RDPA 1RAAA 1T0BA 3E4CA 5AKZA 3X2EA 3MUEA 1ABBA 4RLSA 4N48A 1A76A 2H2HA 3LCJA 2FMHA 3RKSA 3H5IA 4N40A 2V0GA 2ZLBA 4KXWA 4EKYA 4JITA 1SXJE 1XE3A 2P9TA 1ZP6A 2JH3A 3LVBA 5A06A 4GGMX 1U7TA 4M1MA 4YIKA 3RTGA 5HKKD 4DCGA 1W49A 4RNDB 1L5HA 5K4HA 4R7GA 4HZIA 4IRMA 4BMNA 3A6PC 1PZXA 1SHTX 2HTEA 2IT1A 3LBAA 2H8GA 2EOAA 1JH8A 2VP4A 1YBVA 3H5OA 4P8RA 1CUSA 3ZBUA 3OP1A 3AJDA 2E4XA 2JHGA 1KGDA 5E95A 2P6RA 2G04A 5BSVA 3KQLA 2B3DA 1IM8A 1OX4B 4H4EA 2Q7DA 1OYOA 4R2HA 4C21A 3KUKA 4GM4A 2Z1MA 2IX9A 3NAGA 2OVBA 3R7AA 5JNRA 4WNIA 4GNKA 1W85A 2QTVA 4MQFA 5IK2A 3JALA 2IOFA 4KN9S 2BFDA 4XRGA 3EVDA 3C39A 3I1YA 4B4OA 4LMBA 1L6IA 4PG4A 2VXCA 2CDNA 4NE9A 5HQ3B 5AJWA 2QN7A 3A28A 1N3YA 2JEOA 1U7PA 3NOVA 1M74A 3WGYA 1EUCB 1Z37A 5EIXA 1ORRA 2W6JD 1ZCAA 2HBZA 2HN9A 2BFEA 4LPKA 3W8NA 1W4ZA 4GQMA 3F97A 1ZVMA 1SOMA 2XBUA 5TT1A 4EIWA 4B83A 4G26A 2OXRA 1S96A 4DW8A 1XA3A 3GEHA 4WFIA 4UM8B 3GR6A 4R83A 3H2GA 2PT5A 2AKEA 4XW2A 2VTEA 3VOBA 4FDMA 3SQDA 4CL8A 5HWSA 1Q1BA 1KDRA 5LQCA 4MULA 4JQZA 2IYWA 4MVJD 4NJOA 1QE5A 2CXSA 3SHQA 2PH5A 4L6IA 4EELA 2B9VA 3FKSA 1R6VA 3OF2A 4JC0A 4P9NA 4AD8A 4YHHB 3CZCA 3N58A 2R6AA 3RI3A 4H0FA 3BMNA 4HZUA 4NFHA 1NL3A 2JLRA 1YB4A 1DULA 4ZEWA 5IPFA 5KS2A 2PA0A 3K6SB 5BV8A 4OH1A 1XVTA 3VYUB 2PGJA 4ENSA 3VO9A 1SWVA 1P74A 3TZHA 2FVXA 4X00A 3BWEA 5JSZA 1TK2A 2R6CA 2IH5A 1QIIA 4Q9AA 1WW2A 3L5OA 2C4WA 2TS1A 4L4XA 4UHHA 3W8EA 3QIAA 4RH3A 3JXEA 3ZWVA 4BVEA 1SZPA 5DBEX 1Q1GA 2EZUA 3OFND 4OMUA 3FLMA 5B1EA 2L49A 4OB7A 3IMKA 4PLYA 4AZTA 3VVLA 1K7XB 1VRWA 2GNPA 2H57A 1T9KA 3LWNA 4DA7A 5IAKA 1ECGA 2QMUA 2RC6A 1I10A 4W5HA 2X15A 3QZUA 5F2EA 1COWA 3TIFA 4R8RA 4D43A 3PE5A 1NXOA 1OASA 4MQMA 1GJRA 2ECKA 2LIVA 4C0QC 1U8EA 2PQ0A 1XV5A 1G0NA 2PX5A 4NBVA 1I3OA 5CEEA 5A6SB 1SG9A 2PRIA 2L42A 3G2JA 1D7OA 1C80A 1MGPA 1BVUA 2WVHA 3OZBA 2VAVA 3HGTA 1VMIA 4X92A 2QT9A 3E0QA 5EZSA 1OLXA 5CG2A 2XTJA 1XRQA 2FMKA 4CFYA 1XD2B 2EFGA 3RYTC 5FQNA 3IP6A 2FMXA 1THZA 2GXQA 2DJ5A 2E2WA 3T3NA 3AY0A 4RHYA 4PZAA 1YSEA 1CY2A 1KFCB 4FX5A 3D6HA 4IY1A 4MR8B 2A0FA 1XB2A 1E0SA 2VWGA 3FFAA 2HX1A 4QOSA 5CFMA 4IX1A 2HEIA 4G0NA 3H05A 5A5GA 3K6KA 4NYJR 1ISGA 3M0EA 1DC8A 1P1RA 1VCHA 4PRLA 3ZK8A 4I5DA 5KJEA 5DHAA 2CV0A 4H6PA 4IVZA 3M83A 3PHIA 2MSWA 3W5CA 1P7VA 2HMSA 1ZPQA 3OKPA 2P79A 5DYGA 2IW3A 3H9QA 4MVJF 1Q1ZA 1FBNA 4ZICA 2FK7A 5IXYA 4DDTA 1ST3A 2VI5A 1O4VA 1P1IA 4OEHA 4YN3A 3FYHA 1M1YE 1PS9A 1RPZA 4XVHA 1T4MA 4OXRA 2YWHA 5AI6A 1U5CA 1YL5A 5GM1A 2BUAA 1U8XX 2HU7A 4G2TA 4KAXA 4MROA 4B48A 1SIBE 3X2SA 4AP5A 5ALIA 2AG5A 4CKWB 4K9RA 4L74A 1YS1X 4GQAA 4QYSA 5DNDA 1CUFA 3OPYI 5TS3A 4BAZA 5DT9A 4J1XA 1CNEA 3DZFA 2V55B 5BN1A 2UVDA 1NQAO 3FVVA 2XAAA 5JY6A 4RV5A 1TJYA 3AG5A 1XO1A 4KYUA 4ND4A 4QO7A 1OX4A 2JFYA 1I6MA 4QUIA 4NKRA 1CUCA 4FOPA 5KIAA 3ET5A 5CD9A 3H0KA 3KQUA 2CLEB 3HKEB 4KIFA 1MZVA 1BAPA 5CNJA 4X44A 4X20B 2G9NA 3NC1C 3JVVA 3O84A 1QG6A 4GOXA 4GX1A 4L3VA 4FDVA 4ZVNA 3IUMA 2FGJA 3COSA 4FWIB 3UAOA 1TMOA 4DCSA 5HQ3A 2DPHA 1MGOA 2PX3A 2EWVA 1WHTB 2C9OA 1ACJA 2HJSA 3TMYA 5H7XA 4Z4HA 3HWSA 4JODA 4AF6A 4UOZA 1J5EB 1EUCA 1RNLA 4H16A 5G53C 5FR1A 4HH3C 4CKZA 1AK9A 1NGSA 1HLGA 2BTEA 4L6AA 1OBHA 5JSKA 5L3RA 1SPXA 3N8GA 1RRGA 4PYJA 3BB4A 1MX1A 3PXPA 3L01A 1WIWA 5EZQA 2ALJA 4P4UA 3H5NA 1JQAA 2KI5A 3I1IA 5C51B 2XLBA 1JTFA 5AW2A 4UDOA 3R3WA 1GL7A 4TWRA 3V1MA 2GYYA 4YK7A 3SQXA 4QRDA 3RARA 4AP6A 1QYWA 3AJEA 2VIIA 4MVWA 3PRKE 2DBRA 1B1CA 2ZYRA 4PLPA 4U7TB 4Q9LA 4C07A 1C3VA 1KFBB 1WOYA 3X1XA 1NYLA 1O95A 2VYND 4XDZA 4YFYA 3BXPA 2BM0A 5CXUA 2R8YA 1QU2A 1DKLA 1U6IA 1EFRA 1ZD1A 3H11A 3J7TA 1X86B 4ZT2A 2CVHA 2PSEA 3K6SA 1XN1A 2CD7A 1NRJB 2XCTB 4HX9A 1OFGA 3AV0B 3HM9A 1WHSB 3VX3A 4Z1OA 2H0AA 2BDEA 5BPFA 1ACLA 2I2BA 4OLFA 2FPXA 3LQRA 5H8WA 1GAXA 3JYPA 2FG5A 4JLKA 2FUCA 4O2RA 4RE5A 4AW9A 2H7CA 4Q7QA 3O92A 2EKBA 1B8UA 2QPAA 3OLXA 4J9UE 4RFVA 2A5YB 1B3RA 4BNYA 1DWUA 1A82A 2RGAA 2Z5FA 3DJYA 4IRXA 2W6PA 2XA1A 5FF9A 1VXOA 1GU1A 1H9BA 1P1CA 4MUEA 1JEOA 2RI6A 3N0XA 3T0FA 1LWOA 3E9QA 3RVDA 4BCCA 3DDOA 1GPUA 3WC4A 4R4JA 4AWBA 4MCHA 2ZETA 3UUEA 1D7AA 3QXHA 1QVVA 5A6SA 5HZKA 4R8LA 1E7WA 1RWQA 2W2NA 4MPPA 1L4EA 5FTWA 1UXGA 3RNOA 1WB4A 1XD2A 2TRSB 4B46A 2WF7A 3AXSA 4ARCA 1E1NA 3USES 1BFKA 3OVMA 4LFBB 2PKQP 1QXSA 2BGNA 3N75A 2EFHB 1KYZA 4KNVA 3QUCA 3VKHA 1UPCA 2ZRNA 5IJ9B 4MR8A 1YFLA 1AIPA 3VAYA 5KX5F 2PO5A 2ILVA 4B6OA 4G5QA 4RCZA 3MTAA 3HC7A 4E5NA 1NATA 1TADA 3JQFC 4K9QA 4N3CA 4BYGA 3TRJA 3MWDB 1DB3A 1SVUA 2ZIZA 3O75A 1JAXA 4UHJA 1V7ZA 4IPTA 4KBYA 3ZHSA 4MQBA 3QF3A 4BMVA 1PJCA 2BKXA 2IYVA 4TKMA 4DCNA 3DH0A 2IXBA 4GC5A 3STWA 5HIAA 3OQOA 3FWNA 4RK5A 2VUIB 1GY8A 1CR4A 1YRYE 2IS6A 5G0SA 2BHTA 5AO9A 3T5CA 3KJHA 4BMCA 4CCWA 4D8VA 1SXIA 2DCUA 3FY4A 3GFRA 3MMZA 4NHOA 4N5MA 4OU5A 4I1VA 3SHTA 4PWZA 4EPRA 4V0LA 4H27A 4OB4A 3PR3A 1XZJA 2R1UA 2AT1A 1T4CB 3P19A 3IJPA 4NDAA 4IDPA 4CKWA 5F7XA 2AX4A 5DRYA 1N9GB 3COZA 4AZSA 1HL7A 3UJ8A 3HA2A 2DPXA 3IXMA 1M8KA 3K9NA 4KN6A 4PC7A 4D6YA 3R7BA 4ZYWA 4YP9A 3TEFA 2OHXA 5ES4B 3A1DA 3WIEA 3M3DA 1DKOA 4FI3F 4QJ3A 4BUCA 4ZEXA 1A69A 5LBUA 4D57A 4DC1A 1XJ5A 2IIVA 3GUVA 1X8LA 4PZZA 1P4AA 1PZHA 1H3FA 4EGQA 2JGNA 1ZLXA 3LRPA 4MK4A 4I8XA 4LBVA 3QU2A 4GH5A 1DL5A 4X20A 1KJWA 3DL7A 4G4IA 4RY2A 3QWAA 1U0OC 3F3MA 3RRFA 3ESYA 1WHTA 2CHVA 1AK2A 5AUNB 3N2LA 1EFHA 4YFVA 1YK0A 3ENWA 4HLCA 4V0KA 4Y9TA 5ALZA 1S7CA 4UXJA 2CMFA 3RCBA 2PUEA 3TFWA 4POOA 3V5NA 1PNOA 2JFZA 4AXBA 3KQHA 5JPDA 3DMTC 4GKAA 1O3YA 1BMTA 4RULA 4EMTA 1NP3A 3OLWA 2Q0XA 3BXOA 4X64B 4OOEA 4BAGA 4DLXA 3UA4A 4QRIA 5EKTA 1H2ZA 5A3QA 1YACA 3CLHA 1YASA 5EESA 5LXTF 1YQEA 1LQUA 2HRRA 3W4KA 3IIKA 4Z4IA 3ZOZA 1TM2A 1R10A 3BMQB 2PT9A 2WPNA 1YR1A 4JSTA 1YI8A 2H06A 5IS2A 4ESEA 3B9PA 1H2RS 3DCYA 2HAEA 4NMLA 3X44A 5C5EA 4V1CI 4JYBA 1TX4B 4LKRA 1VHDA 1L7MA 2W8BB 2YVUA 5GPBA 2IOFK 1TMYA 1Z36A 4XQCA 3ZGVA 3TNYA 9LDTA 1OPRA 4GICA 1WHSA 2YJ3A 3AYZB 4JQOA 3NDBB 1L1RA 5DHFA 3RRYA 1DFHA 3VXKA 1JJVA 1FRQA 1F2VA 1SVLA 3NOXA 1JJBA 2F00A 3I9NA 2XXAB 3NIGB 4I1SA 5JJIA 4AQDA 3E70C 1MEOA 1NVBA 3A9SA 3E53A 3UO8B 3IAS6 3BZUA 4BN5A 3QG5A 5IDXA 4O8ZA 4HBZA 1CZNA 4OTZA 4UM7A 4J29A 3JQAB 2EWTA 1YDMA 3IHLA 4I1IA 4BVHA 5K8LA 4H2DA 3ZBPA 3D8RA 2GETA 1T15A 1N0IA 1V6SA 3LP6A 1NFQA 2YVKA 3U3JA 3E7WA 1I94B 1PR0A 3NAQA 3QPBA 4IJMA 4EFKA 1E6LA 1XZHA 5FBQB 4DCJA 3R76A 1EXVA 1JAYA 4DS3A 1EDEA 3A3KA 5EWJB 2NSYA 4BMXA 1E1QD 2A92A 3HE3A 4P2GA 2V6BA 5DNAA 1XCJA 1NC1A 3EQ6A 3A4MA 4S1PA 3UB2A 3IAS1 4DA6A 3BYZA 3N6XA 3H1EA 3PWKA 1ZMXA 2MYPA 4EF5A 4KLZA 4IIUA 1PYOA 4H7JA 3HHPA 2JLZA 1K86A 2B98A 4PHFA 5IJ9A 3PSHA 1W0JA 2P3SA 2A33A 4GOKA 4RF3A 3TXAA 1UKBA 3PDIA 4U1RA 3ZD8A 5IAGA 4FNOA 5HXAA 3L6DA 2QIOA 5IFKA 1G6KA 1RM4A 2QR5A 3CFYA 4IIEA 2VPPA 1P77A 3U31A 1VBMA 4YUAA 4RS3A 3VNSA 2BKUA 2I91A 1Y82A 2X0NA 3WLKX 3OQMA 3JQRA 5EZYF 4B7ZA 3NGLA 3NXKA 5BN3B 3CVJA 4GF5A 3KDSE 5BQPA 2QR2A 3I2HA 3ONDA 2NU8B 1NM5C 2IEDA 3GJYA 3L2OB 4RYDA 1KFKB 5H70A 3RJ9A 1SMKA 1AB5A 1ZMBA 4PRKA 4DB4A 1SCNE 2CE7A 4GYWA 5CGQB 1T4CA 1MAWA 4YMWA 1XL1A 3OSUA 3UBTA 1N9GA 3FWYA 3ZVLA 1X9IA 2CLFB 2RGUA 3FWHA 4WINA 1A5AB 2OHVA 4BO4A 3C6YA 3K9WA 4Z51A 4D8UA 4JVNA 1B7GO 5LA6B 3ZV5A 1V5WA 2O1EA 2F59A 1CZRA 4LZOA 2WP8J 4J1TA 1O97C 3RFXA 2EARA 4GZMA 1U31A 1WCXA 2IKSA 1O9HA 4NYJQ 2X7XA 1V1MB 2FN4A 2OK8A 2B94A 2OOSA 4JJIA 4JB3A 3WL7A 4DJTA 4EUHA 1CUAA 1RQLA 3FJOA 1DO8A 2ZATA 3I28A 1Z0FA 1DQNA 1H22A 1V25A 4H7PA 1L5ZA 3ABZA 3OCCA 4RTQA 4B7AA 1NN0A 2QN9A 4F4UA 4ZVRA 5BSRA 3VDNB 3Q3EA 3L7YA 3H75A 1IU9A 4RL6A 2QUJA 2VP0A 1VDZA 1U4NA 3L9XA 3NHBA 3ZWXA 4PLZA 4F9EA 4OB8A 1KEKA 2I2CA 4L0QA 1G9SA 3EXG2 4LHEA 3VOSA 1NOJA 2VSYA 4ZZ0A 2LV8A 1UC9A 2GM4A 4IIXA 1W2WB 3GLIE 2OBYA 4KYIB 5H3CA 3MUOA 4L6CA 1FDWA 4C0KA 4X1KB 1Z4JA 8AT1A 3HGQA 1NJFA 1ZESA 3MRTA 4XWAA 4CR8A 3BMQA 5JRDS 3RKUA 3TWOA 4JC4A 4LC0A 2CLLB 4M0FA 3P4XA 3UMJA 3KCNA 3F2IA 5HW0A 3SCFA 1ZCZA 5DHTA 5IKOA 1USUA 3SBDA 3V34A 1QR2A 4ENPA 4ZXPA 2QMQA 4D0LB 4Y2QA 1NW6A 2QP3A 2XA2A 3DMGA 2W8BA 3VX4A 4EUEA 4PYKA 4P3PA 2FEAA 3CEHA 2F4NA 1DNPA 4B4KA 2QD4A 4P5EA 5G41A 4WDRA 1BKYA 1WZNA 1S4MA 3HZOA 3THYB 3M6AA 1IBKB 4TVOA 1GN9A 2CSXA 1DGQA 2LKCA 1HA3A 2XXAA 2IVBA 3TOXA 1YS9A 4MUFA 3MHTA 3GLGE 1L4LA 3MIIA 1V71A 5E7MA 4G5YA 2E6KA 2W6IA 2PYZA 2A5JA 4UEJA 1NFRA 1P39A 2WWFA 1QDUA 3MS7A 4CT5A 4DNFA 3A06A 3GFTA 3ZWMA 5K0BA 1KPHA 1KYIA 3JQAA 3OWHA 4V0SA 3R7DA 3TQCA 4AWAA 1FC0A 1XWWA 4UTNA 4KX3A 2JAUA 3DZKA 4RHEA 3RSSA 2QSYA 1YZQA 4RF5A 4XR9A 3SLRA 3WFJA 1KF0A 2YRXA 3IUYA 4KQ9A 2KEKA 1KGSA 5EWJA 1UBCA 1F3LA 4ZQCB 3IBTA 3B1VA 4UKDA 3I9MA 1RQ7A 4QBGB 4ZO7A 1E9AA 4UM9B 5GAHi 4FN4A 4FNGA 1J24A 2BONA 2GN2A 1X70A 2R7MA 5E8JA 4XOUA 3TD6A 1KQ3A 2XB2A 2A0KA 3CINA 3GMSA 1U7ZA 4MWCA 5LPNA 3K1TA 1K5HA 4INJA 2CLMB 4WBNF 4JX9A 3AWIA 5AI5A 3D6AA 1Y42X 2ZSDA 4KE8A 2R6HA 2QTTA 5TSDA 3G8AA 3UN1A 1NJ2A 3G6KA 1ODFA 4EATA 5GTDA 1O1YA 1PL8A 3NWPA 1EX9A 3V6MA 3A1UA 1KU6A 1Q17A 2AG8A 3CF0A 4CFSA 3H19A 4QPJC 2M32A 4QUHA 3FVRA 1VSQA 1EB9A 4IKEA 5FTJA 1J99A 5LCXA 5IT5A 2WUDA 3WB2A 2EBHX 5KTSA 4J49A 1L5FA 1YVDA 1RZSA 1H2BA 3D7KA 2MCFA 2C9ZA 3GI1A 3AONB 1IPFA 4R41A 3SBEA 4E0BA 1IATA 3GVCA 3ITNA 4YV0A 3KEOA 2LBPA 3P2MA 4U4AA 2WJGA 5AVYA 2VJDA 4QSMA 3L40A 1CRQA 3FCCA 4BTVA 3E9YA 1PJRA 4E3ZA 3AEZA 4H7DA 2OR3A 3H0CA 4EARA 1RRVA 4RK4A 2QE7D 3ST7A 3AB3A 3BDAA 3T4EA 2UZ3A 4LOIA 5LA6A 1AG9A 2ZRPA 1X7XB 1Z0ZA 3DE5X 3W5AA 3IDAA 1KKMA 2GPNA 3TLBA 4BNNA 1YL7A 5HHTA 2LCFA 1QIEA 3FF1A 3IDOA 4DIUA 2Y9MB 2QRLA 2IHJA 4J9VA 1V1MA 4IIHA 5LYYA 1KAGA 1KDPA 1QMPA 1TF2A 3ZWQA 3BB3A 5DHSA 3RHTA 5C8YF 5CDTA 3IUBA 3KFLA 4R8KA 3LXXA 3PUIA 3MMPA 1MC8A 2ADOA 3JW8A 3L18A 4GL4A 1GVHA 3Q12A 1JDPA 1Z0UA 1QB8A 5BR8B 3CO5A 8LDHA 1UPBA 2CBXA 4I9FA 2F3TA 3ZEAA 4BLUA 1AQYA 3LH5A 1N5JA 4BB9A 1MRZA 1EKXA 2HWWA 2PRZA 4TLLB 2AYXA 3LBYA 5DSXA 1DJLA 1TQ2A 2O2HA 5THQA 2G5CA 2GBLC 4TTQA 4X1KA 1UWCA 4YRNA 1EUYA 3EE6A 1S01A 3B7GA 4B3JA 4ID9A 4ZMBA 1VB5A 1UFQA 4NVRA 3QWGA 3ODGA 4DA9A 3T7JA 1E94E 1P5HA 1R0ZA 4RX1A 3K0AB 2F9LA 4UNIA 1A72A 3SEAA 4IJ6A 1KRXA 4RK0A 2DY0A 2DAPA 1GKKA 5KYVA 2OLEA 2PGXA 3V8RA 5JS1A 4DXDA 3THYA 1XBTA 4M88A 5CLQA 4JA0A 4BNHA 4XTCS 1CERA 2PZ8A 5CH8A 3FNIA 4JXXA 3WFZA 1LBHA 3I6MA 1MTZA 2IXAA 1EG7A 2G9QA 4G8BA 2ZTMA 3EEYA 3C97A 4M83A 1Z6TA 2KEJA 1E3OC 4FFVA 2PTHA 5C5DA 1UKVY 3O90A 2DFKB 3HP1A 2H1FA 5HZMA 3NWJA 3QE0A 3J81A 3AUJB 4D46A 2FR1A 3NC0C 4LVCA 5I9NA 4O8BA 1LQ2A 4WV3A 5DHQA 3R7WB 4Y6RA 2DPMA 2PRYA 2HCBA 3HK2A 2CXRA 7GPBA 4DQKA 1IN5A 1KEWA 1O2DA 1B6GA 2ZWPA 4JLBA 3SI7A 4CQMD 2XGJA 1B6SA 1QIFA 4BJ6A 4C5BA 4ZKDA 3QKRA 3U17A 2CROA 3UT5B 1F12A 3FLAA 5K8UA 4JCOA 2D1FA 1TIBA 4AMYA 3OKAA 1JG3A 3QHQA 1OBCA 5CGZA 2FHPA 2QMHA 4OVKA 1DCMA 4H1HA 5E7IA 2Z3WA 4B85A 3HDTA 4RSHA 3CR8A 1Z4NA 2A86A 1NPDA 5LBTA 3TQSA 1E98A 5G02A 3G79A 4J0IA 1AD2A 1EVJA 1RWMA 1Y9EA 4FFNA 4PVCA 4RJIA 4DM7A 2EWMA 2I4OA 1EEXB 1QANA 5JRZA 3ZYCA 2QF7A 4IDAA 2IBTA 5IRCD 5SY6A 2NSLA 3K73O 3OY2A 1L1FA 4NEGA 4OSEA 2PWZA 2YC2C 3ZU5A 3EHEA 4QWMA 5BMOA 2E5WA 5HR5A 3C3PA 4K88A 3GQBB 5DNVA 2OP0A 1SBCA 1I24A 2VR1A 3OQ1A 4G09A 1X94A 3H97A 3HLKA 4QYMA 1JXMA 3JWJA 2ET6A 1YB5A 1NJSA 3PZBA 3NP9A 1FUUA 4URXR 3FDXA 2C9CA 2IX3A 4B3CA 2PT7A 3THWB 5H59A 3COVA 2WTAA 4I4TB 3OTQA 4EF6A 1E4VA 1Y7IA 4G0MA 4WXPA 3HA7A 1IY9A 1D3AA 2WMOB 4GLFA 3T7RA 3W4JA 3PBKA 3WMEA 3K70D 2HBYA 2J7UA 3F9CA 3RUDA 1X7XA 2XZOA 4B8YA 3I83A 4ER3A 3SQLA 2VF2A 1O96B 2FPUA 1EFTA 3NDJA 2I2WA 4PGAA 2H1OA 3QE4A 3S8YA 1GILA 1TZ2A 4WADA 1O03A 5C80A 3FB4A 3MCWA 4AYTA 1IPHA 3B3QA 5TPZA 2ZZNA 1M10A 5H02A 3G02A 2XF2A 3RAGA 3V7YA 3RU7A 3PA6A 1Q0RA 2OYSA 4C0WA 2A67A 5JZMA 3GRUA 3PCTA 4Z59A 2P4SA 3QKSA 4TWJA 4QUDA 3A4IA 5JFGA 3ZE6A 1CV2A 1FYVA 2HXSA 1WUYA 1E3IA 1NA5A 1VPEA 1VJGA 4Q6WA 1F0KA 4KMOA 4Y2GA 4LXXA 3ESZA 1O6GA 5DYWA 3SC3A 1MPXA 2P2YA 3FVTA 4XJVA 1YBFA 3E6AA 5BWBA 2ZVPX 3DE0X 4O3FA 2X4GA 3GJ7A 1R9JA 4IHJB 3VZPA 4XJSA 2NU7B 3TLMA 3VZCA 1VYVA 1R8YA 3LO8A 1PBTA 3U44B 3M6WA 3O82A 4OJNA 1WH6A 1INLA 2JARA 3FSRA 1LH0A 3BWVA 4DY4A 5IFLA 1JLRA 4YQEA 1NQWA 2EFJA 5IWCA 3NTLA 3K0AA 1S3IA 4JLOA 3IBCA 3A9XA 4CI0B 3TUJC 4IDNA 3RSOA 1GLGA 4E22A 5B2ZA 1E20A 2E9SA 2KW5A 4QUKA 3K0HA 1LQTA 2WM3A 5ALPA 3RBXA 1G5IA 5F23A 2ACKA 4YYEA 4KVGA 1F4VA 1ULTA 4JLUA 5LMCA 2ZYAA 1Q0ZA 4LBZA 1CZOA 3JU3A 1JYEA 3BJRA 4UC0A 3B6IA 2ATCA 5CX1B 4TZ6A 5A2QA 2O4CA 2IS1A 1IJBA 4GI5A 4O1HA 4B81A 2ZM6B 1NG1A 2HQ1A 5CM9C 2HSZA 3NAZA 2WF6A 3ULKA 3QOYA 4WEOA 4OHYA 3VO1A 2J0EA 2A8YA 5IMSA 5J4VA 2ACEA 5FA6A 3RBVA 3R7WA 1KJYA 4E5MA 3UT6A 1MAUA 2E0IA 1G6HA 1K6JA 1NSTA 1RIOA 4RVUA 4AIRA 2QMEA 3U1VA 2KB0A 3U26A 1WB6A 4IWYA 1C30B 1VHWA 2IRWA 5PNTA 1QWOA 4C4TA 2CNWA 4AS3A 4EY8A 4UMDA 3UT5A 4DJJA 121PA 1PJBA 2I6XA 1B93A 2AOTB 2QX9A 3DWGA 3PUKA 1KRWA 2PHZA 4PAGA 2IYFA 2RAFA 4MO9A 1NBOA 3RROA 4ZYLA 1T35A 4ZO8A 1BE1A 2J6CA 3B3JA 1BHQ1 3LA8A 2IOQA 4WOKA 5CW1A 2XCRB 2P7IA 3RKRA 2WHEA 2BMVA 3C8ZA 2OM2A 3G13A 3KL4A 1AGNA 5C8ZA 3WB9A 4D4KA 3Q9NA 4PIVA 1R4ZA 2FFRA 4RFSB 1YTLA 3QGMA 1KI7A 1JI0A 5K98B 3KSDO 4ZT5A 3GX1A 1IK4A 2FDXA 2BNOA 2K7FA 2CF6A 3ZXUB 1R3UA 3GQBA 1OYVA 2CWDA 3PGLA 1Z7GA 1E69A 2VDOB 4PY2A 4B0PA 1KVSA 5ITZB 4LE0A 4B3BA 2JIQA 3M1AA 4IO0A 3EPRA 3D6NB 5TEWA 2XUDA 4AY4A 4GEKA 3CRQA 2WICA 3QP9A 3IL2A 1BRMA 3THWA 1IPEA 3ND6A 3OQNA 5DLPA 2JVLA 4I4TA 4MV4A 4BNIA 4XCVA 1D6SA 3AU9A 2E5FA 2O7RA 4I4IA 1ILWA 3SYMA 1AF4A 1E7QA 4O0MA 3STVA 1JEYB 1PL6A 4KVAA 4U7PB 5FDFA 3I2IA 1F9AA 5AW0A 1O96A 2GPJA 4C4XA 3AFGA 2R47A 2EJCA 1DEXA 2OXFA 2UZ1B 3GWGA 1CJMA 4EAQA 1PJSA 4L4YA 2BMFA 3VR2D 4RDIA 1KFEB 1Z5OA 4GT1A 1DIRA 3WBJA 2DKNA 1S8FA 2J3DA 1X2EA 1KK3A 3QU7A 4YVFA 5KOYA 3ROGA 3NIDB 2OKGA 2I3BA 4B4WA 4AJ9A 4YAGA 2Q9CA 2NP7A 1QMGA 4HFNA 4QATA 1QTRA 3PHGA 1CD5A 4D9GA 4KG7A 1FFGA 1SHZA 2X0FA 4YDSA 4YCNA 3LKZA 1IOLA 1GTG1 3S99A 1Q0LA 5EUMA 1W88B 2OZEA 1C9JA 2LYKA 1HGXA 3W8DA 4RF4A 2ANBA 4IHJA 3ND7A 5C81A 4ZGWA 3C2QA 5ETJA 2GF0A 2NU7A 3TL2A 5TARA 4D2IA 2C8LA 1QV6A 2P9GA 4XB2A 2XQFA 3TGPA 3AUTA 1GQ2A 2OV3A 3C15C 4M1ZA 4F3KA 1NXVA 5IX8A 4M1OA 1XA0A 4MWEA 5ITWA 3P7MA 1YGPA 4QREA 3UFXB 4U2EA 3EPLA 3AHEA 1NY5A 4IW3B 3A32A 5TVKA 1C2TA 4LQCA 2A9PA 2OAP1 3MTQA 4PAWA 2CKDA 3DPUA 1CVIA 3K0EA 5MN5A 5K45A 1NBAA 1GGHA 2BEUB 2O2YA 3KJZA 3WLIA 1IBCA 1XIVA 2NM0A 5LQMA 1YF3A 1PQ4A 1TQ6A 2ZAGA 4AO7A 1WF6A 1XNQB 3UFBA 3LYHA 5CX1A 1C1DB 3VSCA 3ZR4B 2QJRA 2EDAA 2VJKA 5AHOA 2J33A 3JXDL 1PR2A 3WQHA 2PJZA 4MAMA 5FA8A 3GCWA 2WU4A 1GNTA 4U9IS 2LR0A 3K32A 5FBHA 4CF7A 3PEYA 1KP9A 3WA7A 2HSGA 3T5TA 2WAMA 1F4LA 3E1SA 4IOMA 4COOA 2P27A 4O2AB 1E61A 4V2IA 1DDIA 1ENZA 1MU0A 4TXMA 1DAGA 5MGBA 4I6RA 1U0EA 5ERXA 4D9MA 4TMFA 4Q00A 3KQYA 3D8BA 3ER6A 1VGQA 4A0SA 3EMDA 4TLMB 2C7RA 3SHOA 3VC7A 1C30A 2BJWA 4PQFA 4XIYA 4PPYA 4UDYX 4ZQEA 3T41A 1O4XA 3FFTA 3TBKA 3WADA 4D02A 5TE9A 2WHQA 3RS8A 1CYEA 1U1EA 2AOTA 3LLSA 2VYFA 2XE7A 3WIUA 4CIWA 1BKSB 4EP1A 1P5FA 2GYVA 3U16A 2R8XA 1LI5A 4MV6A 3ZWOA 3IUPA 5FX2A 3U39A 5JT1A 1C29B 1JALA 5AESA 4TV9F 5KI6A 5HRUA 1BGWA 2B0CA 4R2MA 4GR4A 3RIXA 5GVSA 2X1VA 3SQNA 4RHUA 3V9PA 4ERXA 3E3AA 4EFMA 4JI2B 3LQ1A 2MR5A 2WE7A 1SO8A 3NATA 3VISA 1GUBA 1WMSA 4CMIB 3UPTA 4RFSA 2FPOA 5M34A 1A4RA 1DCKA 4JS0A 4ROTA 5KTYA 2IW1A 4LDNA 3L6UA 5ADWA 1IXSB 1WXFA 2UVPB 4KMMA 3JR7A 1ZUD1 3QITA 3R6GA 1PO7A 1Q84A 2H29A 3EJWA 2KMLA 2QRMA 4ZXFA 2LCQA 2AE1A 4JVOA 4NFSA 3S0JA 4A8JC 5AIBA 2LYSA 5ITZA 1GQQA 4KXLA 2YINC 2PUHA 3F4LA 2Q9UA 5K3OA 5B12A 1A96A 3AW8A 1RKUA 5EE5B 1Z5UA 3K31A 2UZAA 2O2IA 4O33A 2B8JA 1S5PA 1Z15A 4CLEA 5H4GA 4WLEA 5AWFC 2CDRA 2EXXA 2O2EA 1Y5IA 3DL4A 2CFIA 4X3OA 3S2YA 1HEIA 4TYNA 4JJZA 4OKNA 5J1SB 2C4UA 2ODTX 2ZR7A 1JEYA 2TSYB 3TAHA 1WPRA 2UZ1A 1W34A 1XDUA 4TLCA 1Z5ZA 2MSEB 2JGAA 3HRKA 2XWBF 3OC6A 1N7GA 1Z5GA 4ZT7A 1N2SA 4GQIA 3TQTA 2B7LA 2C7PA 1HNNA 5JD3A 4GLBA 4MWBA 4UBKA 2CLKB 5KYYB 1F06A 2EJVA 3NV9A 4YPVA 4X62B 1VSBA 4U63A 4C1NA 4D7AA 3H17A 3UFDA 4RD6A 1G8JA 4EABA 1F7VA 3H5RA 2OWEA 1ECBA 1K88A 3K1ZA 3Q3JB 1FFAA 3SZOA 1BD4A 1XHEA 2O23A 4RA6B 4EHLA 1W48A 2PXVA 1IJEA 1P4SA 1W88A 1ONNA 3LFPA 4IKPA 3HXOA 3AP1A 1RWBA 3DMHA 4HYYA 1EWQA 1CVLA 2A9KA 2RHRA 2JFPA 2FLWA 2JCBA 3IHTA 4FHEA 1JLSA 2J3QA 1VM6A 1CY4A 1AS0A 2WA2A 2OXIA 1YXMA 1C7IA 1PE0A 2V45A 3KFVA 3QWFA 1XPRA 3STHA 1NJ5A 1VE3A 3UFXA 2HPAA 3WRXA 3ICEA 1AQLA 1JXAA 3DBLB 3GUYA 5JQGB 3RTAA 2OVFA 4DLTA 4DMMA 5A1TA 2PS0A 5JNWA 5SZIA 1AU7A 1L7EA 2BEUA 2GZMA 1E6CA 2ZBFA 3TAXA 3IOMA 1VE5A 1YIDA 5EKUA 1EJ6A 5EKSA 4JI4B 4P4GA 4L7VA 4E13A 2QSUA 2R8OA 3CRNA 4YLGA 4ZVTA 5T6MA 3RJZA 1C1DA 4NV1A 3HKBA 3KOUA 3P52A 4GHJA 3HA3A 3LXUX 5LP6B 2XD9A 4BOYA 2P30A 5CA0B 3DS8A 3H2HA 3VZQA 4MVJG 2BW0A 4K6FA 2J3LA 2HO4A 1AO0A 5JC8A 1P6UA 4PLWA 4TT8A 5DOVA 2JBHA 2VDLB 2XTAA 1E1RA 2D1TA 2D54A 4LMAA 4O2AA 4EK9A 2DR2A 3RS2A 3FPFA 3L49A 3MPUA 3BM5A 5GV8A 4C0LA 5EJ7A 5KYXB 3W3AA 5K0GA 4ZI7F 4QJBA 1DINA 1IUOA 1EP9A 3W79A 4U7DA 3WGOA 4NIMA 2AMVA 4B3DA 5KPJA 5HQTA 4YT4A 2QW8A 1SCJA 1RHQA 4OFBA 1G291 5EERA 5IKXA 3WS7A 2NPIA 3PDJA 2PXXA 5C1IA 1TC1A 4RJ2A 4A8HA 4K40A 1AS2A 2VWHA 1G8AA 3HR4A 3FHCB 4IUBS 3NHLA 5EFOA 2Y4OA 1F9EA 3WK7A 3V1TC 3SQOA 1B2RA 3OLQA 6LDHA 3ZJUA 1E7RA 3A6LA 1DRJA 4K8RB 4XTRA 5DISB 3AHJA 3SX0A 3CPJB 2ODWA 2ZUVA 2FZKA 4FOTA 5EGSA 3MIZA 3GCXA 1JKJB 4BWVA 1I9GA 1UBNA 1UFVA 3MB5A 4CMIA 4RTMA 1TRKA 2EW2A 1MJNA 2BAGA 3Q7QA 1L5YA 1TIPA 3CN7A 5KWVA 2DRIA 2HGSA 4LHZA 4M86A 5CB8A 1ORTA 2UVPA 1GNSA 3L8GA 2XXQA 1FW8A 2Y0DA 2JGFA 6YASA 1IBLB 1B0NA 2B3TA 1L5KA 1KMCA 3L43A 4JN6B 3PKIA 5JTTA 5AVKA 3EZ2A 2H0QA 4Q9KA 4TLDA 4XUEA 2IV2X 3ZZMA 5A3VA 5LUAA 3OLVA 5EJAA 5FOWA 3IP9A 2DBQA 5AICA 4KE9A 5F9MA 1LPPA 5CFPA 1Z26A 1MXHA 1WPQA 2YZNA 1LF5A 2V7PA 4Z58A 1Y9JA 1DS6A 5FPYA 2HLPA 4IDDA 3O0TA 3TXYA 2GF2A 3RVKA 1XA4A 3IOEA 3K8ZA 4JEUA 1N1EA 2Z4RA 4YJ3B 1QIJA 3REOA 2QYSA 5BV7A 3UYKA 4FZRA 1ZK0A 3I0NA 4F7WA 5BW5A 5DGDA 2G4VA 3WLOA 1NQXA 4M7PA 2C2ZA 4LGCA 3BGVA 3BF8A 1L3BA 2AI1A 1LFDB 5BUSA 2HLNA 3MCVA 5G4LA 1X0VA 5CCXA 3M3HA 4RY8A 4B75A 2L82A 3D4PA 2Z2ZA 5LNK6 4ZQGA 1U1FA 3O9MA 2YN0A 3HBLA 4LOKA 1KI4A 3NBFA 4Q3KA 5KYYA 4B79A 1KO1A 3FVQA 1E1MA 1K8XB 1R5JA 1PV2A 2GPWA 4FUQA 2FZVA 2HJGA 3WLEA 5T4HA 4CKEA 5EE3A 2OMEA 4QGFA 4ZCPA 3VKFA 3CWZA 3OKZA 2PA3A 3UMBA 4EG6A 5DX8A 5K0CA 1LKZA 3DM9B 4DJEC 3HVUA 1R9MA 4RA6A 4YAWA 1VPWA 4UNQA 1QUFA 2XLCA 1CT9A 1ECJA 3AF0A 3T61A 3C7TA 4BO3A 3ORRA 3A8TA 1E1KA 3ZW7A 2OHJA 1UKEA 6CHYA 1UP7A 1A1SA 3E15A 3ETJA 2WINI 4ZCSA 2OOKA 1P1FA 5LNK1 4EPVA 1PFKA 1SQ0A 2XI8A 1IZ9A 5CM2Z 1CEQA 5IH7A 1J9GA 3QUAA 5FBZA 4CF6A 2B99A 4BATA 1KEVA 1MN6A 2HB6A 1X1BA 2BI4A 4JYAB 1IN6A 1YR6A 1OH5A 1TM1E 3RJ5A 1I3NA 2CC2A 4FGUA 1ZCBA 2G76A 3PVSA 4OHVA 1HDYA 1I2CA 5AVWA 3A2NA 3DBLA 3I58A 5JQGA 3RC1A 2QU7A 2PBRA 3SS8A 3ZU4A 1P3Y1 4KRFA 5CDFE 3E7XA 3RAJA 3IEMA 2ZIFA 3A3OA 2OB1A 2ERXA 2V9PA 1V41E 1QGOA 2CCGA 2PPVA 5BWCA 2B1RA 2FSIA 3QX3A 4IMPA 4K9KA 5DU2A 3PC3A 2Q3HA 3AR8A 5GM2A 3ZLTA 2KPOA 3TOVA 4DCMA 5LP6A 1GKUB 5CA0A 1FSPA 1DWPA 4OLHA 1DELA 2WFZA 1N6IA 1RTKA 1WNTA 2Q1XA 4G86A 4KVFA 1ISMA 4UAVA 4BRUA 1HI9A 2J3EA 3EXFB 2RB5A 3I3SR 5BNFA 3X1ZA 5BV1A 2C5GA 5ALLA 3PJRA 1T9ZA 2AQHA 1ISPA 3FMIA 5CLGA 3LM8A 5E0KB 4AT1A 1YO6A 5KYXA 1JQDA 1CVRA 2Z1DA 1XTQA 2HJHA 3A4TA 2W2QA 1R0BA 3D5QA 2NYUA 3I05A 5D3ZA 4MYTA 2M6LA 1SIUA 3F6YA 1Z4OA 4BRZA 2NYAA 5AVSA 4NE2A 4OV6B 3EIEA 1T0HB 2VDPB 4MYSA 3H5AA 1LVUA 2GPYA 1YZLA 1SRQA 2GD0A 4J7AA 4BCBA 2G0TA 5SY9A 1E5VA 2ZB7A 3NBQA 4ZRMA 2X22A 4C7VA 4ZMRA 2R2AA 3HTXA 5CNMA 2XVYA 4JLMA 2DF8A 4KW7A 4PCVA 5C8VA 1LMB3 5EIFA 3AWDA 1EEHA 1JKJA 4RPCA 4TKZA 2TMGA 3TQRA 2B82A 3DO5A 4FZJA 4ZTBA 4ZZ1A 2WQZA 1YVRA 5K3EA 2XDQB 3VR6A 3R8XA 3IE1A 1XZEA 3WVNA 1JH9A 5K6AA 3PG5A 2GPAA 3RUHA 1AMNA 4J1SA 2EX0A 4M89A 1I36A 4YDQA 4BJHB 4G8DA 3U6KA 3ANMA 2VUTA 4ZOLB 3A7EA 5CT9A 3GLRA 1E1LA 3SR0A 2REBA 4Y6GB 4PZ9A 4EBBA 4AY2A 1TM4E 1AH2A 1NC3A 5CLLA 5LDGA 3OM0A 1I9CA 2P8JA 1GPMA 4XLTA 5CLHA 3LPDA 2EG5A 3CZRA 3I0MA 2Q5CA 3P97A 3WKBA 3ONEA 2IZ7A 1WDLA 4U2CA 2IU7A 3EQ9A 2PUAA 1FQOA 2B36A 4GM1A 3S6JA 2IUYA 4YJ3A 3I01M 4XWYA 1JW9B 1PLJA 1BGVA 2JIZA 2NT3A 1D1SA 5BWMA 1PRVA 4I50B 3DPSA 4BNKA 3P2IA 1NJ1A 3R5TA 2DTEA 1YB7A 1YK1A 1L1QA 2Z43A 3KXPA 4GRAA 4OQMA 1PRYA 1T3LA 1Y3BE 3H18A 4RM3A 5CDSA 1KVUA 4E32A 2C0QA 3I3OA 3MJSA 1T9AA 3ASZA 3SF0A 2HF2A 3DJFA 4LZNA 1XPOA 2DP4E 3LBFA 4YONB 5H82A 2IXTA 5K7SA 3GP3A 2OO5C 4HGQA 1KZ4A 2YDYA 3EZFA 3TZQA 3IR5A 4BQNA 5HX7A 4MCXA 2E6UX 2PLWA 3IKMB 1PU2A 1MHTA 3O4RA 2XMRA 1GT6A 1JYFA 1MH1A 1MX3A 2WSSA 3PXGA 4A91A 3LGAA 4RVDA 4X95A 3TN7A 3E9DA 1LWNA 3I72A 2ES4A 2MQKA 4C0BA 1GEEA 1E96A 2PO7A 2PWBA 5G4KB 1QYVA 4MYUA 4FN3A 1OA0A 2GN0A 4FX2A 4JUCA 4V38A 4WASA 1V37A 1OBVA 4GR5A 2AXQA 2R6ZA 2VCEA 1NVUQ 3CNLA 2BM8A 4W9NC 1ZVQA 5J43A 4G0UA 3GCGA 5HFJA 1BQEA 1W0CA 3SFZA 5CITA 4MYRA 2PXAA 4GD3Q 3ZHZA 2C4NA 2QX4A 1XCBA 4I2VA 3PFGA 4NBSA 5JMPA 2J6HA 3TTYA 2O2JA 3UW3A 2IYZA 2F8SA 1Z7BA 2JL1A 5F9FA 1NBEA 1XTTA 3H2YA 4K8OA 3OM1A 1VG9B 3SN6A 2AS0A 3GBPA 2F67A 3OFJA 1YDEA 3PFKA 1U3UA 3Q1LA 4MLCA 3RSZA 3E84A 1T8WA 4C6TB 4Q7KA 3GGSA 4PU7A 1CDOA 5AOAA 1Q74A 1U9IC 1JN0A 2RONA 3M1IA 3CLKA 3DULA 3IMCA 3JQBA 4TLEA 4Z4CA 2DLCX 3DC2A 4B09A 5J4HA 3VTKA 1U2GA 5HGJA 4AKGA 3OD5A 2NQ2C 4WUTA 1HSOA 3EXFA 3NXSA 4AZ0B 4TLBA 3K6RA 2F1JA 5TGZA 5DZSA 1O5IA 3EW9A 3HJAA 2GBCA 1ND5A 3KSZO 1Y6FA 2OBFA 3F71A 4D6XA 3G2IA 3MB8A 1A8PA 3R3XA 1ZK2A 4IAOA 5GMOA 1CS4C 2OBXA 1M73E 1T0IA 1NMQA 3K0CC 3QMWA 1G8SA 3BXGA 3IQHX 4GMXA 3HEMA 5UKDA 4D8XA 4AL4A 3NEPX 1NI3A 2GA9A 3UHFA 3A37A 3WDLA 4Z6KA 1VPTA 4F72A 3C7KA 1NG9A 4II3A 3HNOA 1C4WA 5GJWC 3P0RA 5G3YA 1VMEA 4JGBA 5G2OA 1W93A 2J9RA 1N78A 2A84A 4DFDA 5DBOA 4MCTA 3PQDA 3ZWAA 1NSFA 4JP3A 4PYMA 2LVBA 4PU0A 5EYPB 4PZLA 521PA 4RKQA 2D0DA 3O1JC 2PSJA 3LA6A 3SNHA 2QM7A 4QVKA 2JFQA 1Z0AA 2HCJB 2XE8A 3F2VA 4PW0A 1TO6A 1GZHB 3AJ8A 4UREA 2CUKA 4ZOLA 5ALHA 3MJVA 5LYJB 1XZPA 3NEYA 5FI0B 1UWKA 4EDFA 3FMGA 4N39A 1W0KA 3A2KA 4ZC1A 3SYKA 1RQNA 2WFLB 1Y34E 2XDYA 2Q8QA 3KXLA 4RJKA 2RHTA 5IARA 4A6XA 2VK4A 2ZI3A 4I4CA 4NY1A 4W7IA 3LVFO 1SQ8A 4UPDA 5IJXA 4CTJA 1LK5A 3AHIA 4OHUA 2SKCA 1TB4A 3TPCA 2BH9A 2XCLA 2JJMA 4N8SA 1ONSA 4N6GA 2Q1SA 3O4JA 4YEDA 1QDLB 1JXOA 4JSYA 4I50A 4K81B 4Z7QB 1JHZA 1II9A 3I5MA 2AXNA 3ZHUA 1QNFA 1EE2A 4QQNA 5K6RA 1V1RB 3QNUA 3UJ6A 3UJBA 1D0IA 1G19A 1H2XA 5AVUA 4EGFA 1JVBA 1KJQA 5DGXA 1YB1A 2LP4Y 5IK2D 1NMSA 2I22A 4Q4HB 3CRW1 4A0QA 1U0LA 1X9GA 3ADKA 3I2YX 4NYMR 4JR1A 1U02A 1XD9A 1HKHA 3RT9A 2FNAA 4FGLA 1NDUA 1W76A 8ADHA 1BSVA 1Y9AA 3KZCA 4I1OA 5CLJA 1N2EA 5LDDC 4BGUA 3IOCA 5J1TB 1BTOA 1V3TA 3FHLA 4G9EA 4U7JA 3ZZ1A 1TC2A 3K9CA 1RLIA 4Y0NA 1V6CA 2CHQA 2CLDX 4PR3A 5LOVF 1PEYA 1MNAA 3DYVA 1ZZ9A 1S2OA 2XECA 3L7DA 4RV4A 4MRVA 5G4KA 3FUVA 4J75A 4RXTA 3R5FA 4B6FA 1K2VN 2O7NA 4L4ZA 1E3LA 3AI2A 1UFOA 1OY1A 1GZ6A 3OTIA 1Q3TA 3CUKA 4LXUA 4CEHB 3KLMX 5FOUA 4IL5A 5BT8A 3OU6A 3AQIA 4OFXA 4MGHA 2QKYA 3QJYA 1J70A 2IZZA 3FKSD 3UPDA 2X8BA 3B8HA 2ZJBA 1XRNA 3RABA 3IB6A 4NNOA 5T64A 4E15A 2NZJA 5HFAA 3W2HA 3EISA 1NVVR 3DZ8A 4K6OA 1E9BA 3C5EA 2NO5A 3C3WA 2OECA 5EJEA 3LWDA 4OIMA 1XF9A 2H1WA 1P33A 2ZJOA 4E88A 4C6TA 3U3ZA 2OHIA 4M1TA 4CMBA 2FB9A 1SBNE 1Z0IA 2I9KA 1UT6A 4ZCIA 1G5PA 3V8VA 3VI3B 5K01A 1TEVA 3G59A 4IIVA 4FNMA 3CXRA 5C3MA 3ROMA 5M5BA 3CCFA 4G0XA 3FG9A 1YNOA 2HQBA 2AQKA 2Q49A 2XTZA 4L4SA 5FOXA 3V4ZA 1T1EA 4B6QA 2W4MA 1E9CA