2PUFA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
338
structure length
338
Chain Sequence
b'TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEQNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
molecule tags Transcription/dna
source organism Escherichia coli
publication title Structure-based redesign of corepressor specificity of the Escherichia coli purine repressor by substitution of residue 190.
pubmed doi rcsb
total genus 110
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pufA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pufA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pufA02
3E61A 3IP5A 2GRLA 2IVGA 2FEKA 3QK7A 3H6HA 4KQ9A 3O2SB 3N6VA 1OXKB 5KI6A 4D6YA 3BREA 4MYRA 3QLUA 1GCGA 1QP7A 3C3MA 3NNDA 2AXVA 1DCFA 5KWSA 1DG9A 4W5NA 3R1FA 1JBEA 3FFXA 5FWYA 1JYEA 5BRJA 5TQ2A 1D1QA 2FMFA 4O1IA 4PICA 4PU3C 2NUBA 4H3KB 4KK3A 3CS3A 1L1MA 3S8QA 2GBPA 4JQDA 3HXMA 2L2QA 4KPYA 3N0XA 3Q7SA 4MQFA 3UKJA 3EQZA 3H1FA 4YG1A 1RZRD 3LKBA 4TLLB 1OXBB 4X4GA 1D4ZA 1NXVA 3DBIA 2EF8A 2IU7A 5JS1A 4JA2A 2B1JA 4ZMRA 1NXTA 4OBBA 1DCKA 2CWDA 1BDJA 1ZDMA 1MVOA 4EYGA 3CLCA 1JYFA 1BAPA 3OO1A 2F8SA 2M98A 3GN5B 4NV3A 2CHEA 4KFCA 3KHTA 2HPHA 2LCVA 4G0OA 5EWLB 1E3OC 2ICPA 2HINA 1NXOA 1VRVA 3CHYA 1LJUA 4ML3A 3L1PA 1LLIA 4D74A 4NDWA 4WT7A 4RY8A 3IVPA 3FYMA 1TVMA 5TE9A 4XASA 4MRMB 1JFVA 3LKVA 4I6TA 3MF4A 2DRIA 3A0RB 3F51A 2PPXA 4Z5HA 4H3HB 1PRVA 3GBFA 1DCMA 3H5TA 4J1XA 1DP4A 1M2FA 3O1HB 1JHZA 4MR7A 5CNJA 4LZLA 3TMYA 2QVGA 1USGA 4LE2A 3VK0A 1UTXA 4FBIA 1HF0A 1USIA 3LOPA 1EWKA 3LUCA 3NHMA 3T8YA 1F51E 5KQLA 2PUEA 5TQ0A 5JNWA 5KC9A 4Z99A 5JNTA 3CG4A 4MR8B 4DADA 3LFTA 3CKMA 5B3JC 3T6KA 1AB5A 2O20A 4RDCA 1APBA 3KYIB 4S04A 4OTZA 2OFYA 2HQOA 3JPWA 3OQNA 6CHYA 3RVOA 3NHZA 3F7NA 1QP0A 4MS4A 4RZSA 4RSMA 1RZSA 4Z58A 3GL9A 3DNVB 2HQRA 2NZVG 3QX9A 5FBHA 4P98A 3SY8A 4EGSA 2ID9A 4RK4A 2VYCA 1DW9A 3RZZA 1JF8A 4MS4B 2O49A 5F64A 2JK1A 4OG2A 4X4DA 4X4EA 3LUFA 3KZ3A 2QVCA 1JWLA 2KEJA 5EWJA 5HQJA 3A3KA 1NXWA 2BJCA 1XHEA 3OLYA 1FSPA 1KRXA 3K9CA 4X4HA 3Q15C 4JOQA 1RXIA 3IPCA 4XARA 2LIVA 1M5TA 1DC8A 3SQNA 2FVYA 3MM4A 4KV7A 1FFSA 2XJ3A 4ETMA 1O4XA 3F6CA 4N41A 3LUHA 4MLCA 2PUDA 4QYMA 3DGEC 1U2QA 4MR7B 1ZAYA 2MSLA 1W9HA 3C97A 3HDVA 3QLTA 2BNNA 3I5AA 3O2JA 4YCSA 3MLFA 3D1NI 4MQFB 1IC8A 1ZPQA 5IUNC 4JP1A 3O21A 1L5YA 4XAQA 3GRCA 3N53A 1QQBA 1KRWA 2IYNA 2JB9A 5C5CA 4G0XA 4YV7A 1GCAA 5CHYA 3H5IA 3OLXA 1YIOA 2FSPA 2GWRA 1M2EA 4DN6A 5KQMA 1PEYA 2LYPA 2RJNA 5IUJC 1YK0A 2LBPA 4Z4CA 4H60A 2E4XA 3FFWA 3RQIA 1VLZA 2KYRA 2XIUA 3CU5A 3LMKA 4LE1A 4RS3A 3VNBA 4ETIA 5KC8A 4KNYA 2NZUG 4G86A 4G97A 5KQPA 3MIZA 3FDFA 4MRMA 3Q41A 4LDZA 2YHAA 3N0RA 2R1JL 1NATA 2MYTA 5DGCA 5JNRA 2XI8A 2QV0A 3EJWA 4G0PA 1R69A 1QO0D 2FJRA 5TPWB 3EDCA 2OQRA 3EQ2A 1Z15A 4MS1A 4YG4A 4MCTA 2AYZA 4ZJPA 2RJOA 4Q6BA 4UHKA 1A0OA 2PJUA 3ZHIA 1ZS4A 1LBIA 2A6CA 1LQCA 4PEVA 5IEJA 2P9HA 2AW6A 5KQGA 3HZIB 5TPWA 2AUWA 1ZZ9A 4F8DA 1ZVVA 1Z2DA 2WB4A 4I6RA 3CZCA 3IPAA 3IDOA 4W5RA 3NBMA 3FMYA 2R47A 4X4IA 4RV5A 4F11A 4PU8A 3TX6A 5JS2A 2X7XA 1C0EA 4KMRA 4MQEB 1RPJA 4RK0A 4MS3A 2FTKE 3MA0A 4YS6A 3TB6A 2KEKA 4P1ZA 2MQKA 2IVQA 4JCYA 1K68A 4MR8A 3BS3A 3U3WA 4XXHA 4RK1A 1JDNA 5IULC 2F8TA 2ZWMA 1B00A 1EAYA 1XHFA 1Z13A 4RKQA 4MS3B 4IMIB 1DRKA 3H1GA 4F06A 5B3JA 3JVDA 3W9SA 3RVMA 2E4UA 5TQJA 5IX8A 2IV1A 2E4VA 1YTUA 2WUSR 1ZGZA 5DCLA 3QEKA 2ZAYA 2CD7A 3HUUA 2LPMA 1UXDA 2TMYA 5HKOA 4OLBA 2JVIA 3OM1A 3O9XA 4RK7A 4WUTA 4YWHA 2FXIA 1DJMA 3OP9A 2EBYA 2JCGA 3QLVA 3OMXA 2FQYA 2IPLA 4O8BA 2CSFA 1P2FA 8ABPA 3HSYA 1BDIA 1X2LA 5DLEA 4E7PA 5JNVA 5ED4A 2JVKA 4D6XA 3CROL 5DKFA 4XLTA 5DTEA 4N76A 2AXZA 4EUKA 1E6KA 4OB4A 2FQWA 4RU1A 3H5OA 1E6LA 1SQ8A 1Z16A 2HJ9A 1KGSA 2PL9A 4YBAA 1ZUGA 2JVLA 2RDMA 3EAFA 2O38A 4LRQA 2VUHB 3ROTA 4FN3A 4I8TA 2H8RA 1TMYA 3G7DA 3P9YA 4IF4A 4TMYA 2E4YA 4IILA 2R48A 4MPTA 3TO5A 2IKSA 1POUA 2AWIA 3IP9A 1FFWA 4Z5CA 1D1PA 3BRSA 5ABPA 1BA2A 4HNSA 1SRRA 2XSDC 1JFTA 7ABPA 4EVRA 1GLGA 1JX6A 1NXXA 3RVNA 2YHBA 2HSGA 1Y1LA 1EWTA 3I42A 2OENG 5I4CA 3O75A 2IDMA 1LK0A 3KXAA 2GRMA 2OR1L 3FMVA 1JDPA 5EWMB 1PRAA 1YVUA 1P6QA 1PHRA 1AB6A 1FFGA 4IA8A 1YS6A 1E2BA 3KSMA 2RGYA 1QNLA 2I6FA 1J56A 2LYSA 3HEBA 4LE0A 5TPZA 2PIJA 2KPJA 1ZZ7A 1YK1A 2IPMA 3E3MA 3K4HA 4JB0A 3ROFA 5HSGA 3RH0A 1U04A 1AU7A 5CNKA 3RVKA 4NCBA 1BVHA 3SM9A 4Z4FA 2CROA 1ZHHA 2IPNA 4WXEA 1JL3A 2FKAA 3CLKA 4X4BA 3C3WA 1MIHA 3MQ4A 4RK5A 2H0AA 3URMA 2WWVD 3M9WA 3H5LA 3KLOA 3H1EA 1MB0A 4GQMA 1YMUA 4YG7B 4X4FA 2PL1A 5CNIA 1D5WA 4MR9B 4G0QA 3JTEA 1RPEL 4F3TA 3H5VA 5K98B 1RIOA 1LBHA 3QELA 4Q6WA 3RVLA 4F12A 3KCNA 4EY3A 4ZMSA 4YARA 4PZ0A 2JVJA 2GI4A 3D8UA 1CYEA 1IIBA 3M9XA 3G85A 1XWRA 2L49A 3RVQA 3I45A 4GPAA 4RY0A 3HUTA 1JLKA 5IUKC 1WH8A 1P6UA 4I6UA 2IPAB 4FE4A 3RVRA 3RVJA 4RK6A 4E7OA 1WIZA 1GUDA 1Z12A 3HJFA 4KRFA 1DBQA 1NXPA 4FB4A 3FFTA 4N03A 1PRUA 3ILYA 4NICA 3C3KA 2MSKA 2WJWA 4N0PA 4W5QA 4RXTA 3UFDA 4J1WA 2PUFA 2LYKA 1C4WA 2L19A 1WH6A 2EWTA 4PU4C 1PNRA 1S8NA 1YMVA 2QU7A 3CZ5A 6ABPA 4O5AA 3QQ6A 4RXMA 4X4CA 3EGCA 4N47A 2GKGA 2PAFA 4YLEA 4Z9AA 2P4UA 3DZDA 4KVFA 4LX8A 4MAAA 5T7BA 3JS5A 1U8TA 1ABEA 4L4UA 1SXIA 3F73A 1QO0A 5GQSA 3CTPA 3LUGA 2LYQA 3PXPA 4IGAA 4CBVA 1LCCA 3DGFC 3CFYA 2QXYA 5CNMA 4GHJA 3O1JC 2VK2A 3LUJA 3M6MD 4NQRA 2BGGA 3OLVA 1LCDA 2ICTA 2JBAA 3OMTA 3RVSA 2D5VA 3LUKA 1Z17A 1QP4A 5E3JA 1DWKA 3GYBA 3OO0A 3HM9A 4G0YA 4YRZA 5EWMA 1PUXA 1U2PA 2MYPA 5T3YA 2R4QA 3BBLA 1YS7A 3GV0A 4Z9BA 4ZYLA 1FQWA 1ZZ8A 2R25B 3QLUC 2MYNA 1HEYA 3GWGA 1YSEA 2WMYA 2KEIA 3OLWA 1CEYA 4G0MA 2LUOA 1Z26A 3O2QB 1ZESA 4LDAA 3SG0A 1XWWA 3A10A 3QYXA 1ABFA 3BILA 3EULA 3O1IC 3O74A 3KG2A 3EUSA 4MS1B 4QICA 4ETNA 3HDGA 3FYAA 1P8AA 3OMWA 4FE7A 4OATA 4JASB 2FMIA 4PU7A 1EFAA 4RXUA 2FW0A 4KREA 4Z4HA 1K66A 3MMNA 4JCXA 3H6GA 2FLKA 1ISRA 3NNNA 3HS3A 2MSWA 4TN5A 2A9QA 5FWYB 1TLFA 3Q7RA 1CQTA 3N8IA 3S99A 3B2NA 4MGEA 1I3CA 1QPZA 4IRXA 1H9CA 1D2AA 1RZRA 2L18A 2V0NA 5GOTA 4S05A 1ZITA 2H3HA 3SAJA 4Z5DA 3ZKCA 2KZ8A 2FQXA 3JXCL 1TM2A 3JY6A 3JXDL 1WETA 4KZKA 2QSJA 3RVPA 3HK2A 1DRJA 3SCFA 2FMKA 4TLMB 4Z4EA 2PE5A 2FN8A 1OSLA 1NTRA 1UXCA 3HO1A 1QQAA 1ZY2A 2M1ZA 3UUGA 4MR9A 3JPYA 3Q7TA 1USKA 3QF3A 1PNTA 3BDNA 3OQOA 4EYQA 3OLZA 3F6WA 3NNSA 5FWXB 1M5UA 2BNOA 3DLBA 3T95A 4JAVC 4OLAA 2PKXA 1SD5A 4KQCA 3UK0A 2FMHA 1ZZCA 1EHCA 9ABPA 3CG0A 1DBPA 2XDYA 3I09A 4YO7A 2VUIB 4JB2A 1EWVA 5JNUA 3JXBC 4B09A 4W5TA 2B4AA 4Q7EA 2PUCA 3IP6A 3Q9SA 2GZUA 2O4AA 1DC7A 1LJLA 3N75A 4IWRA 4WXMA 3T38A 5IEBA 5TQ0B 3LUDA 2PUAA 2N9UA 2L8NA 1L5ZA 4L85A 3QEMB 3SCHA 1JFSA 3LFPA 4Z4GA 2AXUA 3F52A 3GN5A 2E4WA 4YP9A 2IOYA 1URPA 4M88A 3HZHA 1RXEA 5EWLA 3LTEA 1R63A 1NEQA 1BDHA 3EODA 3QEMA 2PLNA 5PNTA 2AYXA 4PYRA 1PEAA 1SXGA 2L17A 3QELB 4Y9TA 3R0JA 2WJAA 1NY5A 5JNSA 2XCJA 1KMIY 2IUOA 3TD9A 2NT3A 1A04A 3H5WA 1ZZBA 2LYRA 3G5GA 1OCTC 5D2CA 3BD1A 3C6QA 2HQBA 3QX8A 2A9PA 3L6UA 2LYJA 1Z25A 2WIUB 3A0UA 4MCXA 5BRAA 3KJXA 3GT7A 5A7LA 4GNRA 3OQMA 1GT0C 1ADRA 2NT4A 3LUAA 2LYLA 3DLHA 3VNAA 1Y7YA 3KLNA 2PUGA 5IC5A 2CHFA 1U0SY 4RWEA 2FEWB 2BNMA 3QWGA 4UHJA 3ZHMA 1CHNA 1NXSA 3N0WA 1X57A 5TQ2B 2B5AA 2PUBA 1A2OA 1R8JA 3HVRA 4Z0NA 4QPJC 5HM6A 2JRLA 4PE5B 3MYYA 1GUBA 2PMCA 4WWHA 1LMB3 4HYEA 1F4VA 3GBPA 3GA5A 4WZZA 1ZH2A 4MLDA 2E4ZA 2IVBA 2QW1A 2FN9A 5FBKA 1MB3A 3TRBA 4N0QA 5EWJB 1Y9QA 2W42A 4NCAA 2A9RA 1ZGGA 1VPWA 4F8JA 3KKEA 5BQ3A 2MYUA 4EVSA 2J48A 4RKRA 3H75A 2MEZA 3CNBA 4W5OA 2A9OA 3GBVA 4O1HA 4Z4IA 2GX6A 4HNQA 1VKRA 2LP4Y 1TJYA 3ILHA 3KTOA 5BR1A 3SNKA 1E6MA 3CRNA 3KS9A 4Z59A 1T34A 3SCGA 4QYWA 3F6PA 4IVZA 4IMJB 2ID7A 4EVQA 1PERL 1CJGA 1RNLA 1Z2EA 2QZJA 3D02A 3LISA 1JH9A 2FEPA 3FGZA 3JVIA 2Q5CA 1W25A 4ZPJA 1QMPA 4YGXB 1DBWA 5FWXA 1ISSA 1QKKA 3QLVC 2FLWA 2JBAB 1Z18A 4G0ZA 4HNRA 3HCWA 1NERA 1UDRA 1S7EA 1MAVA 1ZH4A 3KYJB 1DZ3A 3G1WA 3HV2A 3B7HA 4RY9A 3CECA 3IP7A 2WY2D 4YR7A 4DQDA 5IBQA 4KK4A 4XFKA 3OM0A 1ZZ6A 5TPZD 4EYOA 5C5EA 4Y42A 2WRZA 2R63A 4MQEA 4EYKA 1ZN2A 1B0NA 3BRQA 3L49A 1SXHA 2QR3A
chains in the Genus database with same CATH superfamily
1A8PA 4YBRA 3SX4A 2PXQA 4F6LA 3F78A 1E3WA 4IUYA 3BXGA 3U81A 3QWBA 2W4MA 1JEOA 1FNNA 2H8KA 8LDHA 4YAUA 2ACKA 3PQFA 1NFRA 2ZT7A 3BRWD 1WEKA 2X3UA 3D6NB 4F6RB 5HIAA 1SC6A 1QP7A 2DPLA 1E6EA 1EJ6A 3JZAA 4B79A 1SQFA 4MDFA 1RKVA 3R1FA 2NTJA 1Z29A 1JQKA 3RUEA 4RBNA 1RWPA 4E5UA 2VF7A 5K0SA 1Z47A 2BC9A 1FTGA 2L42A 4D57A 3SHWA 1PZNA 2L2QA 3GGSA 1A50B 3EQZA 1UZLA 1VKZA 4KLCA 3OM9A 4CYMA 3RANA 4KQ1A 2IGBA 1DKPA 2G83A 2GZMA 5KYYA 2E48A 1J8FA 1RXVA 1QLJA 1B14A 4LW8A 1JG2A 2I4LA 2QRGA 4KAXA 2JH9A 4LVOA 2MIIA 2F8SA 4IKOA 4BNZA 2VYFA 2BMJA 2QUHA 4O4LB 2J5KA 4MGHA 3P0JA 4ALNA 2F9MA 2VQDA 3KZKA 4H7KA 4FMCF 1M6NA 1NXOA 2J67A 1P1JA 4YONB 4H7EA 2P2YA 3VRHA 2QK4A 1MQSA 1W1WA 4Q34A 1J1IA 3NG1A 1Z6TA 4O02B 4EB8A 2DRIA 4D3YA 1I2AA 1ZISA 2IEDA 3N05A 2V7WA 3SVLA 2XHEA 2FI1A 4MA0A 2YN2A 2PXCA 3GLHA 3C7TA 1PUJA 2UYCA 3DOEA 1CJSA 2JAQA 3VK0A 3K6RA 3KJGA 5KOIA 3ZGLA 4RTLA 2OYSA 4D4JA 2JZCA 4NKRA 2CVZA 1B0AA 3RSOA 1JDSA 4BYGA 5BMVA 4W9MC 2PXTA 3CG4A 3K16A 2ZIAA 4MR8B 5IBRA 4JI1B 5AVWA 1T9KA 4NI5A 3OZAA 1SOWA 3T6KA 4NG4A 3E7PA 5E8JA 2I2CA 1JAHA 5HMMA 3W1WA 3A6JA 4Z58A 3DHVA 3QX9A 1V6CA 1L3BA 3E1GA 3SY8A 4BKOA 4CKEB 2Y9MB 3DDUA 5JI2E 2Q2QA 1EM8B 4B43A 4EY6A 4DR2B 4I3HA 3VC7A 1DCTA 1XP8A 5BWOA 3LUFA 1H2HA 4X0EA 1HR0B 1V6SA 2F48A 1E32A 1U98A 2TMDA 2X8WA 3IHKA 2WC1A 4H9GA 4JWKA 2QRPA 2W4IA 4NARA 4QLOA 4D1YA 3AVTA 3IPCA 2JKZA 4I5GA 3WDKA 4YCMA 1QCYA 3OICA 3D6HA 2WNHA 2ECPA 1JHUA 1ODJA 2LCFA 2Q6TA 3UGJA 3IRUA 2FSSA 2WTMA 3SYLA 1O4XA 3W5IA 3KQKA 3FPFA 4W8OA 1C7ZA 3BF7A 3CF4A 3FETA 3GLKA 4PLYA 4LBWA 3HXLA 4L3VA 1F8XA 1ZG3A 1NYTA 3TL6A 3O2JA 3MLFA 1OAOC 3WTBA 2AC2A 4F9FA 1P72A 3B3QA 3ZOKA 1ADGA 1WF3A 3DE7X 1R10A 1R74A 3B6ZA 3D4OA 5DM1A 1EVEA 1WMFA 2QTZA 4WFQA 1KRWA 2IRWA 4F86A 1JG3A 2XYPA 3ZS8A 3KSAC 2YJGA 3IEKA 1S7CA 1W94A 4WN3A 3PGJA 1P1HA 1V4BA 2B5VA 3C7CB 1JWAB 1L5GB 4MVJH 3RBZA 2EFDB 1K5DA 4JA0A 5BSEA 2VQFB 2B7LA 3EW9A 5G3YA 4Z54A 2F3TA 4LC1A 4DNOA 3UJ3X 3T3PB 2XWSA 4BNDB 2Z5FA 5JDIC 4G86A 1E20A 1RLMA 3FTDA 3O2NA 3AL2A 3BK1A 2F1HA 4P9NA 4OSOA 5DI9A 5GMOA 1T1EA 3ZWPA 1VZ2A 4FSXA 3W2IA 1EI9A 4E07A 4GNKA 4LOLA 3ZCSA 3U9SA 2OD2A 5ALLA 2OHGA 3A3YA 2ZB3A 3IEMA 2I4OA 3B5JA 3GVHA 3QITA 2XDWA 5A9SB 3NIBA 4M9CA 1G2IA 3EN0A 3T5BA 4H1VA 1ZD8A 3E5HA 3EIOA 3LVBA 1Y3IA 3CLTC 3NTUA 2FVXA 4FN4A 4H6VA 4EI8A 1BYIA 4IZHA 2DERA 1T36A 2P9HA 1TOAA 3RTAA 1SPXA 2D74A 2AUWA 2PNFA 3SVZA 1ND5A 3LXXA 5DLQC 4HH1A 4FKMA 1QAMA 2A5FA 3DKKA 3N2ZB 4RMIA 4F11A 1VRWA 2J9FA 5JSHA 1GFWA 3LXMA 2QGNA 1BHO1 3ZXXA 2XEXA 3Q7EA 2R79A 4ZCLA 4ZICA 4EA6A 4MS3A 1T9CA 3AR9A 1ADFA 2BFCA 3E53A 3L7KA 2WIKA 3S2IA 3LBYA 3SU8A 5CFZA 5KNBH 4Q4CA 4XX0A 2Q3BA 1Y6ZA 2WAXA 1PWHA 1RZUA 2AHOA 3D5QA 3KYDA 1E2KA 3QMMA 1RWKA 1QFSA 4JWTA 1JSXA 2X3YA 3DONA 2G9RA 5FLYA 3NUQA 1UXHA 4GXRA 4KACA 5G02A 5SYMA 5L6LB 1HE2A 1I9GA 2O2JA 3RVMA 3TKAA 3LCUA 5I9BA 5JIBA 4MRSA 3M4YA 3O8LA 5JSQA 5LD2C 1LB1B 2HLNA 3OETA 4FFSA 4LN1A 1G3IA 4QBKA 3OQPA 3QBEA 2VDVE 2P9EA 1QHFA 3KQVA 2I34A 4EGFA 1IBLB 1C0PA 2AJBA 3OP9A 2ZYHA 3KSUA 5J2UA 3OMXA 4MRNA 4EW1A 4DG9A 4MW0A 1I2ZA 2IXGA 3T06B 4JYAB 1SD1A 1Q91A 1W48A 4MUJA 2H1IA 4CEIA 1H5UA 1S8AA 5LZ9A 2ZULA 4CRWB 5KTRA 4TSFD 3DMPA 1O77A 1Z16A 3NHPA 3Q40A 2JBHA 1LC0A 3DE4X 3GW8A 3H7IA 2XLCA 3JQEA 6AT1A 3ESDA 2QRNA 3R7LA 3NATA 4WNCA 1DV2A 4AJHA 1F0YA 4M60A 1RYMA 1YQWA 4IQ8A 3SOZA 2ISQA 3W5AA 4ZREA 5DHPA 3N2NA 4KXQA 3BRSA 4J49A 1R6VA 2X2PA 3I83A 1CY1A 1G18A 4ASUA 2BEKA 4LV6A 4PN3A 3BJZA 3C16C 4CF4A 1N32B 2JI4A 3IBCA 4MUKA 1PDVA 3TJMA 3C3JA 4HGQA 3U5TA 10MHA 4PSAA 4EGAA 4RTSA 3KELA 2GRMA 3OU2A 9MHTA 2JFQA 4C5BA 1NOJA 4QPDA 1FJGB 2OXCA 3QYPA 1BGWA 7MDHA 3KLPX 1ZVQA 2NZ2A 1C1XB 4AUKA 5TPZA 5EUQB 4EIWA 3M8KA 2FQQA 5ARCA 4TOIA 4DMKA 4D7AA 1AU7A 2GDJA 3QNMA 5CNKA 4ALKA 4YJ2A 4Z4FA 3EGXB 4BGUA 1PS0A 4OL9A 3PIRA 1ZYUA 2VJPA 3NAZA 1N6HA 3UKDA 4RX1A 5CW2A 3H2BA 2C5HA 3AJAA 4UTNA 1K2WA 1GLNA 3NJ8A 4OSEA 2PUTA 1B8NA 1CQXA 2CF5A 2XCUA 1FBNA 2YJ3A 3UWSA 1QU2A 3F97A 3VH4A 4ABTA 2UVPA 2XF2A 4HNVA 8MHTA 3EC7A 3I9V6 3JASA 3B1WA 1O0SA 3MUFA 4ZMSA 5DBHX 4YARA 1PJCA 4DWWA 4WNAB 1IIBA 2XODA 2Z8YM 1E4EA 1I01A 3E8XA 4KGDA 4UC0A 5IVDA 4LF6B 1I7LA 1C30B 5HFNA 1UZUA 2VH2A 1OGJA 4GBMA 3V33A 4A6EA 3RK4A 1Y34E 1WCIA 1XRMA 3G79A 3L77A 2LDXA 5BSVA 5CP8A 1TYEB 3NDBB 1R6UA 1VBNA 3Q0IA 2HBQA 4EPYA 4HEJA 1UCFA 2Q1UA 1GPLA 2X1HA 3PJFA 4Q82A 1P7PA 1L5SA 4K3UA 2W2LA 2WWHA 4V0OA 3WFJA 1BCSA 1ZAKA 2G07A 4J75A 1FRFS 4PINA 4O6VA 1HF3A 3BUSA 4PIVA 3QA9A 3PNLA 2CVQA 3NXKA 1G1MA 2FSIA 4TSKA 4YJFB 4LX8A 4CLXA 3GLSA 3LC1O 2JCVA 1GRRA 4YRLA 1U0BB 4CHGA 4CIBA 2WHXA 3AETB 1FXWF 1M75A 1OAOA 2LCIA 4IF6A 4PONA 3VHRA 3HDHA 2TYSB 4IGAA 3VHQA 3PG5A 3VU0A 3ELYA 1NOKA 2QT1A 4LDQA 2Y93A 5KQRA 2AW5A 2MOKA 2GEVA 5B4VA 1QPGA 1LC3A 4CM6A 2QV7A 1V48A 4E2YA 2ZT5A 4IXMA 3HYCA 3U2QA 2IZZA 1WEHA 2OC4A 1BGXT 4FK8A 4YRZA 1SB9A 1U2PA 5AI4A 2G4VA 1A9PA 1PT9A 1BKYA 4B9AA 5B5SA 4RYDA 3U0VA 1J0AA 3K8YA 3SS7X 3QOYA 1EP9A 3UPUA 2XOKD 3GVPA 2QNIA 3A10A 3NONA 2C4TA 5HDQA 3KG2A 3QKIA 2WD7B 1XMPA 4O4IB 4CTKA 2YW9A 4LNHA 4CXMA 3KTAB 3M4XA 3D0KA 3HB4X 4ZHQA 3B7GA 5DW3A 1FTNA 2ACWA 3RIYA 2IQIA 4FEYA 4KE6A 4REMA 4CR8A 3KAKA 5ALNA 3FI9A 3TZ6A 4XX1A 4DV6B 4JCXA 3NBYC 4L9RA 1FXUA 3PGLA 4WDQA 3NQ41 3LQ1A 1DS6A 1I0IA 2IHVA 2X14A 4CF7A 1R0LA 1XNQB 1M66A 3N8IA 2LKCA 4N5NA 2W2PA 1SG6A 2CDNA 1K8RA 4GOLD 4AF8A 2WNSA 4U7FA 1E92A 3Q1LA 4YMVA 2CXXA 4XSVA 4H7HA 3AR5A 5EZ6B 1Q14A 4JUAA 3JXCL 1XJCA 4GX2A 4QLAA 3OT5A 4O29A 1FUYB 3L05A 1SIBE 5A05A 1N5RA 2FMKA 4RS4A 4ZQFA 1PX0A 3K5IA 1SK8A 2WT4A 3QY0A 4QTTB 4BTEA 2Q1YA 1KJYA 3F96A 2JBWA 1V11B 4CEJA 1NVBA 2C2YA 2AFHA 3QF3A 1RHUA 3NEPX 4JKYA 3G89A 4EYQA 4QPPA 3ED1A 1VSUA 1UBUS 5DYGA 4JAVC 3AUJB 9GPBA 2P6MA 5ERGB 4XVUA 3DDNA 1IQPA 3U7GA 2GD2A 2WYWA 1NP3A 3ICVA 3N8HA 4JS0A 2BEJA 2VUIB 4N40A 5KOJA 1QUFA 3I76A 3K0FB 2D1TA 4M8KA 4D42A 1EXNA 3FNIA 5EP1A 1NXQA 3BXOA 3EMDA 3TMAA 2H9IA 1JR3A 1Y33E 5AR1A 1FJ2A 1GGKA 2XE8A 5IEBA 1U3UA 3RO7A 3QWHA 1ZMOA 4CW7A 2CSUA 1F8GA 1OX5A 1XL0A 3JQBC 2WT9A 4AS2A 1JFSA 2XXAA 1QB8A 2ZWPA 3I2YX 4H0NA 4Z4GA 2A4MA 1YKGA 4KQWA 5J2TB 4JKIA 4EG0A 4ZYYA 4F5YA 1OKKD 5KWIA 5DFAA 1J24A 1HRDA 2B8EA 4RZHA 3OX3A 4JLVA 4DJJA 2C3UA 1L9XA 1G41A 2WMOB 3OIUA 5AJXA 2PLNA 3B1YA 4ISCA 2E6UX 2WZCA 3L8YA 3TK1A 4WXPA 2QTRA 4NULA 1T4CB 1UC4B 1KSFX 3EGOA 3NOXA 1ZH6A 3TD9A 1ZZBA 2NV6A 2X0FA 2A59A 1PFYA 1RC0A 1Z6QA 2QF7A 2QSUA 3C6QA 2R6GA 3CPHA 1GQFA 3HB0A 3NAGA 3Q87B 1IN4A 3FZGA 4PXSA 5P21A 4KR9A 3VR5D 1F2UA 4FYVA 3THXB 3QVLA 4S24A 3ZX5A 4UFPA 1I2BA 3NGLA 1JE0A 3MMXA 4UASA 5CYGA 1IB6A 4ICIA 2XOKA 1XQ9A 4L4ZA 1VPEA 3KLNA 4OYRA 5JE8A 1WHSB 1NZFA 3MQFA 1KAMA 2RHGB 4IIYA 2OD7A 5EIFA 4EJ0A 5HTOA 1X87A 2ZI7A 4KYVA 1WMBA 2NZYA 3CR7A 3HM2A 5KCMA 4ZI7B 2V7VA 1ZD3A 5B58T 4BLSA 2FYTA 4Y1RA 1YZNA 4M21A 1ZH2A 4GYKA 1AQUA 4I1YA 1IEWA 4L02A 3MVEA 3Q98A 5AW5A 1FSGA 1FU8A 2OOSA 2ZREA 3WMWA 1CLUA 4C3OB 4MP3A 2BFFA 5DT2A 2EZ9A 4Q1CA 4TYMA 2ZSHA 4UREA 1SEVA 4WASA 4AS1A 5F78A 1CXZA 4CLEA 1X86B 2P35A 3OVMA 3BHNA 1C5KA 1M67A 1EBBA 3GEEA 2W2NA 1AQJA 1TAQA 2NU6A 3GGPA 2GEKA 4Q24A 1DL5A 1KARA 2A78A 1Y9DA 1G8GA 1X7XA 3R3YA 1EHYA 2FJPA 1F8UA 3BIXA 5LQNA 3R0XA 2WJ4A 1YZLA 2HKIA 2OMKA 3HRHA 2JGKA 1PBTA 4ZPJA 5K0EA 3IDQA 3SSAA 5JD6A 1O5TA 3RR2A 1RXUA 2BOVA 3IQGX 1GOTA 3R76A 4A03A 4G0ZA 3UCXA 4JI0B 2W7TA 4M6WA 2I3AA 4FZ3A 1V9LA 2OO3A 1NMXA 3FPCA 2YQZA 4NLLA 3KWLA 1CUSA 4I7EA 1NW6A 2OPHA 3VOTA 3SXUA 3VPDA 2HCNA 3DPIA 5CFOA 3B7HA 3GZCA 2COUA 3IILA 3PGXA 4LJAA 1CF9A 4RY9A 3TMKA 4ARZB 3S1SA 5IBQA 3TRFA 4AMUA 1FS4A 5CX1A 1NMZA 2EV9A 2ID4A 3ER6A 3HXPA 4OKNA 2IJGX 2PLRA 3WYEA 4DCVA 1W5EA 3W3AA 1F12A 1K7EB 3FPHA 2KSQA 2O7QA 4EYKA 1ORTA 1HSOA 3ZX4A 4IJUA 3JZFA 1V8DA 1GGVA 2BGTA 4FYPA 1F2TB 4NJMA 1TM7E 3ABOB 3GCGA 4OQFA 5E6RB 1PO7A 2R1VA 3QF4B 2QPAA 1FX0B 5J3JA 1UXKA 2GEFA 1TU4A 3EXIA 4ZODA 2YZNA 3K5PA 3RT1A 4B32A 1P1BA 4S12A 4JSTA 1FP1D 4W5NA 3MCWA 1P8JA 3DAFA 4B17A 3LDUA 4GQAA 3AUSA 3MRTA 3OFJA 4V3BA 4KWCA 4PYQA 1GA1A 4PU3C 3ZYCA 5AUOB 5CGZA 2WMDA 4J4HA 2WFMA 1GZVA 1N5MA 3I9LA 3I1FA 3TGWA 2J0EA 3DKPA 3TFWA 3A6HA 2NTVA 1T2UA 4DUGA 4PYMA 2I2XB 2PRKA 1LF5A 1E5DA 2OWEA 2ZIEA 4RD3A 1BN7A 4TRJA 4QGSA 1NXVA 3Q2KA 2I33A 2RONA 4WSOA 3GLVA 4EYGA 4CM9A 4DIFA 5GVSA 1BAPA 3KQYA 2CLHB 1EUDB 2CHUA 5JLAA 1SG0A 1PVOA 4CEHB 2Q4DA 3LP6A 4YA6A 3CJQA 2ICPA 3T7DA 4AO8A 1LJUA 1NHGA 3IE0A 3I6BA 3RIGA 4TYNA 4YQEA 1B0UA 1E99A 3TUZC 2DQYA 2WV7A 3KR1A 2EATA 3DV2A 1E2UA 1Z0KA 3BPSA 3GOQA 2PPXA 1WVIA 5BSUA 3WYNA 1TZKA 1BXRA 1PV1A 1T6XA 1DCMA 1MQ8B 1JIKA 3DTNA 4XD7A 5JSYA 1JHZA 3BAZA 4DA6A 1XTIA 5JYCA 3IV7A 4LVUA 3TMYA 1DQPA 2AB0A 3GJ6A 2OPBA 1USGA 3UHAA 4ENUA 1E59A 2PUJA 1N2CB 2WWWA 1HF0A 2Z8YA 3I73A 4N12A 4C7KA 3C3PA 3T8YA 4V0KA 2PA3A 2QJOA 2FW9A 4R5MA 5JXHA 3ZJTA 3FCAA 3UXHA 4BNHA 2RGXA 4OHPA 1HYEA 3GHYA 1XV5A 1RCTE 2ODEA 2JHFA 4M99A 2NPFA 3TLAA 4EUHA 3OQIA 3WMRA 1APBA 3VJKA 4WZAE 5ISMA 4FYIA 3SNHA 5GOZA 1Q0QA 2OFYA 4ZCTA 2HEIA 4S04A 3ZVNA 1OYOA 3D8HA 3RVOA 3NAQA 2V0GA 3I4FA 1WX1A 1PNQA 2QB5A 1AKNA 4DA7A 3K1YA 3ODGA 1WCV1 1HKUA 1E1CA 4LXGA 5ALKA 1P91A 1U65A 2F3QA 2GBLC 3CT6A 3HBAA 3U4GA 1J90A 4BRWA 5AJHA 4RTMA 3ZZ0A 3BVPA 4LOAA 5EWJA 4YHHB 3MGBA 3QLEA 4LYGA 3OLYA 4MW4A 4TSRA 2PIDA 1GFZA 4A2CA 3DOJA 1VLQA 3R5JA 2O8VA 5EHGA 3ZQ4A 4F8YA 5AM4A 3GLFB 4RA6A 1M5TA 1NVKA 4E30A 4E4YA 1M2WA 3MINA 3QKSA 1AXRA 2FJUA 2KMLA 1BFDA 2BONA 2YFHA 2JCYA 1UJ2A 4JEHA 3JVEA 1B8UA 3HN7A 3LUHA 4HT3B 3BB3A 4OMUA 4MR7B 4TMTA 1KZ4A 4GDFA 3UYKA 4Z53A 1J0XO 1GHTA 2Y1KA 3ANSA 1PGPA 4Q3DA 4Z4QA 3FYUC 4WDRA 3F9RA 5ELXA 4I9HA 3VPSA 3L1UA 3W0LB 1F20A 1D0IA 3N39C 3R24A 3JR7A 3M6FA 2G25A 4U7TB 4AZVA 5THXA 3M6UA 2C77A 1FU4A 4PO9A 3PXXA 5K7SA 3CNHA 1R3UA 3AIIA 3GMTA 1GPYA 3RFVA 3VH2A 2O8EA 2UZ1A 3LMKA 4J0QA 4KAAA 8AT1A 2X58A 1R64A 3IAEA 4OOEA 5CH5A 4YMHA 2FP3A 2Z2ZA 3HKBB 4BO9A 1AMOA 1II0A 2H2FA 3HBJA 9LDTA 4UHDA 4UJ3A 1NSFA 2VEOA 3SD7A 1NLYA 5JO9A 3DKVA 1NATA 2D00A 2YVQA 3K32A 3I1JA 2XD9A 3NS7A 3EJWA 5CVEA 2GPNA 3A58B 3S6JA 4QKQA 4RD1A 2HRZA 3EIEA 1T36B 3JQGA 3L8FA 4WW0A 1LPMA 2PX4A 3CV3A 5FIUA 1NASA 1OYVA 2XXJA 4LJKA 3C87A 4BRZA 1NZDA 1XTVA 3V9AA 3ZHQA 4YG4A 4MCTA 2VCYA 5ER9A 4BE9A 1CP2A 1ITZA 4EG1A 4JI2B 3IUSA 1A0OA 3G0GA 3H9CA 2XCTB 5FOQA 4HV4A 2HWUA 2CV0A 4ARSA 2DQZA 1EAMA 4F8DA 3G6WA 4PQGA 1JAIA 1N6KA 3DEAA 3GFPA 3CZCA 4R1MA 1KAGA 4UEOA 2E7ZA 2NNWB 5HE9A 4C7OB 4C5CA 4KXWA 2H2GA 5G4LA 2FR0A 4BZWA 5D8DA 4B5LA 3P19A 2ZK7A 5LQRA 1CR0A 4WESB 3S0JA 2XXQA 4ZI5A 4E31A 3COYA 2AF3C 3M1LA 2PGDA 4NYIQ 3W6NA 3GVCA 1WXGA 3RWBA 4C2BA 4AX8A 2Q45A 1SXJA 2QROA 2IVQA 1Z0FA 2WVJA 4JBWA 3UK7A 5TLSA 2O59A 4XXHA 3L1HA 4HFNA 3AVOA 5JXWA 3KOYA 4DOMA 4O4JB 5CFRA 3PXGA 3IAFA 4KG7A 1FX0A 1XZIA 5J4LA 2ZVDA 5BOSA 3Q3IA 1BMDA 1U1EA 2OWDA 2FSFA 4FHGA 3UMSA 4NMLA 5J2UB 3OZGA 2G5PA 3U6KA 1E4EB 4U6NA 3TFLA 3U3KA 4TM7A 1S9HA 3GIDA 5D85A 3JQRA 2QM7A 2QX4A 4RK7A 4ZRDA 4ZU1X 3RTGA 4QXRA 2EBYA 5EPOA 2FQYA 2HJHA 4MAFA 3LA6A 4IOJA 1JS1X 3P94A 3VXKA 1JILA 4FEGA 1BDIA 3L79A 3U7FB 4D82A 2NW6A 4A6PA 4D6XA 1I32A 2SKCA 3EUWA 4IOLA 4J8PA 2Q07A 4AJPA 4P6VF 4DL9A 4Q9LA 2GAAA 3TN7A 1MD9A 3WK4A 1H2EA 5FV7A 1M1XB 4FWTA 1MA3A 2JGMA 1OJ7A 3CUUA 4JGGA 3AU9A 1NSYA 3G7DA 3IAUA 2EQAA 2PKQO 3QE2A 5CB8A 5FWDA 2IKSA 5CLJA 2OSBA 4RJKA 2FNAA 2G1JA 1G8YA 1RWXA 4FGJA 1OTXA 4QUDA 1JIVA 1PF7E 4XGRA 2IH4A 4HNSA 1NW7A 2JKVA 4WK6A 4DUGD 4NENB 2XSDC 3D8RA 3SJZA 1GLGA 1NBEA 3EZ2A 4ZT3A 1TTQB 2HFKA 1IN6A 1WZUA 5KYTA 2E37A 2YYAA 3VYVA 4KFUA 4OYLA 3O75A 5I4CA 1UKAA 2IDMA 3PENA 5LZ7A 1E9DA 1NI5A 1XVAA 1PRAA 3KZOA 1P6QA 1FFGA 3JWIA 2B5OA 1UFQA 2RFLA 5AKYA 2Q6VA 2RGYA 3WZ2A 2JI8A 1BX0A 2LYSA 4HYQA 4QJBA 1MKYA 2CW5A 4PLFA 4PZ9A 1E1KA 5HSGA 5K0CA 1BWPA 4IG9A 1U04A 1F0PA 1BVHA 4TV9F 3SM9A 3TB4A 4PRYA 2VRWA 4MKFA 4HNUA 2XE6A 4Z2AA 1V5EA 4MKRA 4QBTA 5J9FA 3MQ4A 3E7XA 1Z5UA 1D0SA 2ZI9A 3PUJA 4HD8A 1JHVA 5DBGA 3EXFA 1T6BY 4M38A 1L5KA 2WWVD 1E94E 1RYZA 3WGTA 3M9WA 2IHTA 3BC1A 4RHXA 2NO6A 4NMXB 1ESZA 3HGTA 3RSLA 5CNIA 1W0KA 3JTEA 4F3TA 1W76A 1U9IA 4IG4A 1KY3A 2C8LA 4TLBA 3ISTA 3K1TA 3NXHA 4E6PA 1R6TA 4PW0A 4QPCA 4BNLA 2VQEB 2QYSA 1EVZA 2FZEA 1NVGA 3BWMA 3PNYA 3U4CA 1XWRA 2L49A 1K89A 2ZSFA 4YT8A 4I36A 3IAAA 2Z56A 4BEBA 3ACDA 1P0QA 2J33A 3IALA 5TVGA 4F0JA 3TVDA 4KZPA 4FB4A 2XQKA 3DJFA 4Q47A 1BXZA 1N2SA 4HUQB 5CLIA 3UXYA 4FLFA 1UJ4A 1A9OA 1XRPA 3NDIA 5L95A 5IKXA 1AUPA 1ZRSA 4IIVA 1SM4A 3WBFA 2NN3C 2Q8PA 4G5XA 4F4DA 4DB4A 3LY8A 1E3JA 3EZLA 3CUYA 5BN5B 3UY4A 1AF7A 2OBXA 2PAFA 5TGDA 2XE4A 1ZGJA 4RTRA 5IBPA 1OXVA 4L5CA 1KYQA 4P7FA 1WAMA 4Q4JA 5IU6A 5JDCC 3RAEC 4HNAB 4B31A 2YZ2A 3C70A 1SOUA 2HJVA 2Q4BA 1ZJ4A 5A3RA 1CUWA 3PXPA 2G8LA 3AF5A 3STYA 5KOHA 1R66A 1MW8X 3CFYA 2ZG6A 4J6FA 5EE0A 3DFZA 3EVTA 1HOXA 2FN3A 1GRVA 4XCVA 1Y3BE 4JBGA 5CA1F 2HAEA 4R8RA 3Q8LA 1JEYB 2XXAB 1NWCA 3ZLVA 4BMZA 3GYBA 2J6BA 3MQ2A 1GWNA 4H3SA 4L5AA 1LRLA 2ZVQX 3ZWQA 2G9UA 1YAHA 1QAQA 3FB1A 3IPXA 3TFQA 2ZTVA 3LCJA 3IJPA 4MV6A 1UMBA 1GUZA 1JPNA 4NONA 4XIJA 5ALFA 3WDSA 4EGJA 4GGMX 4MPPA 1U3VA 2IUYA 2RHMA 2ZJ5A 3ZD8A 1N77A 3W8FA 2XZOA 4DEYA 1ULUA 3VDNB 2C5EA 2ZCUA 1MIOA 2JZOA 2LNMA 3QXSA 4MYCA 4TMFA 3PYLA 4G4GA 4YAEA 4YPOA 5EJ5A 4CLRA 4KXUA 2VLBA 2RHTA 1P8AA 3D1LA 4CTNA 1CY2A 3PDIA 3E5MA 4ZVQA 1Q77A 1EDZA 3TEMA 1ODKA 3E2IA 3FSGD 2Q1SA 3GQVA 5TGZA 3OT1B 4AJKA 2BSAA 2Z5LA 4DREA 5BPFA 4FOTA 2H7CA 3HGMA 4NCBA 3ELBA 3HL0A 3JQ9C 3O7MA 5LZ4A 1W5SA 4UHEA 2OMEA 3HS3A 3L82B 3V7YA 2W6JD 1VHDA 3G8BA 4TN5A 1RYFA 2FWRA 5ALMA 4A2PA 1GV0A 1E77A 4BNYA 1V1RB 2ZJ4A 1MO3A 1RVDA 4M3NA 2DY0A 1L8AA 4MGEA 3X2FA 4D5EA 1K08A 2JJ8A 4HTFB 1VMKA 4KIUA 1YR6A 4HEA1 2CNOA 3GRRA 1IU9A 3DW1X 4KZKA 1JFLA 2VNAA 4EFDA 1A76A 4RVHA 2H1FA 3KEMA 4Z4EA 1RLOA 2JARA 2Q7XA 4NYJQ 1PDOA 3RM3A 1QQAA 3B5EA 3I58A 1J9GA 1NJ6A 4EL0A 2IP2A 3AXTA 4GBED 3CF4G 3GRPA 3MD9A 4KVGA 2BSQA 1SUSA 3BDNA 1NNI1 4AC9A 3OFNA 3R20A 3FR8A 1NN0A 2NV0A 3K0FA 3NC1C 3RUHA 4HG2A 3VVMA 5A4KA 3VU9B 1IATA 1M5RA 1Z5NA 4G65A 3N6RA 4B3HA 2I4TA 4C6TA 2GR9A 1G9SA 3LLSA 2IPOA 3GUCA 1YA8A 5FPHA 2GD0A 1E6UA 1WA5A 2CLEB 2P30A 4JB2A 1NQUA 5AQEA 2Z2XA 3I8SA 1UDXA 4Y2VA 4K9SA 3RRBA 3T1QA 4B74A 1I7DA 3K9LA 2IOFA 2ZBFA 3N75A 4XYMA 4UAJA 4JJ8A 5ILQA 1K88A 5CEFA 2XUIA 1KE1A 3G0BA 3W79A 3ZY2A 4BFWA 2AUNA 4PPYA 2HCTA 4PG5A 3D8SA 4YH1A 4BKRA 4L8WB 3L8HA 4FNAA 1E9VA 4L73A 4OD0A 1WW3A 3LNCA 1HI9A 1RXEA 4K8RB 1IWOA 1YAJA 2KX7A 5ILGA 4DRXB 1DWQA 3QEMA 1P2VA 3SCZA 4N8SA 3ZDFA 3K92A 5BWLA 1HT1E 5KSWB 2IX9A 5M29A 4N5LA 2PRIA 5CA1B 5EJ4A 5ALSA 3G3EA 4XPIB 1WNFA 2GBIA 1L6RA 2HT6A 3C6ZA 1HV8A 2G7MC 3BD1A 2V6GA 1Y7IA 3VTZA 1ZEJA 4JCOA 1HMPA 2EZTA 1UT6A 3S29A 4LFCB 3Q5GA 4QOHA 1KZ9A 1F2TA 3KKNA 1WDWB 2BM8A 1JLHA 4G9BA 4MROA 4IOKA 4KAFA 2LYLA 4JXKA 4MUIA 3ZD6A 1IM5A 1K7CA 1XXHB 2ZJYA 1SFRA 1OBFO 5AKKA 3AOGA 3WLRA 3FZQA 4GM4A 4FW8A 3BRWA 2RHHA 2YXEA 3B60A 2WZDA 3DFIA 4Y1RB 2XGMA 4U5XA 1LSSA 3NBKA 2I8LA 1P5RA 2GK3A 3HMKA 5HG0A 3IC5A 4ZAZA 1IH8A 3Q85A 4ZA2A 2R1TB 1H05A 3OOWA 3ECCA 1RAFA 3AEXA 4PTYA 4Y1EA 3ORQA 4YCBA 2FN9A 5A7HA 4AZSA 5BURA 3A4TA 3ZTTA 3AVUA 2BEUB 4P4TA 4PRLA 3I30X 3JYLA 3SEQA 4Q9JA 5ESWA 4CL0A 1JU3A 3EIQA 2O06A 4DEVA 2GZ2A 3CNBA 1VFPA 2JFPA 1XLTC 4MI1A 1JYSA 3FPGA 2ZBPA 2Z58A 4JP3A 1U4NA 3JAWB 3ZNOA 4GRAA 3CRNA 1T34A 4OQ4A 4R4JA 4X90A 2ZB8A 2C82A 1YE3A 1Z2EA 1JH9A 1RJDA 2QP9X 3MJTA 2GBFA 2HSDA 3TSOA 4QL3A 3D7RA 1H23A 4WH0A 5F76A 1EB8A 3IVMA 4BJ1A 2HJWA 4FX5A 2CK3A 5CJJA 4GP6A 1O9GA 1E6CA 3BD7A 3G8CA 1OIXA 3MTAA 1V45E 1UBCA 2GUWA 1SD2A 4QFMA 5IT4A 4RKEA 2PCLA 4TTJA 5EXXA 5JD5A 1JR6A 4GKAA 3GDGA 4NYMR 3IURA 1M6EX 2XKAA 4HRVA 1WP4A 4MRVA 1GILA 1KI4A 1ZFNA 3BIFA 4QPZA 4EJSB 3QLJA 3L8DA 1PV2A 3G9ZA 5T41A 3IUMA 1IJKA 3AY7A 4E4TA 2OHJA 4MWCA 5EJAA 2CWWA 4KO8A 4K26A 4QXPA 3GJZA 2AOXA 4YI5A 3PUVA 5T67A 3UKJA 2DFVA 1V6AA 1HL7A 2QR3A 4DV2B 2V03A 1IHUA 4DR5B 1Z8HA 3KSBC 4H77A 3ETLA 2IDZA 3DDCA 4L50A 4RLQA 3CMCO 1GQRA 3FOCA 1XPRA 3RTEA 1UBOS 2JLAA 1W88B 4FTWA 4UNNA 1L1RA 3GJSA 1AXEA 2FFBA 1EFVB 3PCTA 2B4QA 4LY6A 4CIDA 5IF3A 3KZXA 5A04A 1MX5A 4F1JA 5COQA 3FPSA 3CB4A 4X94A 4ND8A 4NSNA 3GRVA 1H9CA 2AEEA 1M6VA 1KC3A 4B80A 3G0HA 2BKUA 1OD6A 2IE8A 1XD8A 3HN2A 4G5SA 1L5NA 4AJ2A 2ZXUA 3EZYA 2W2KB 2EDCA 4YEDA 1CS4C 3CN7A 3OZDA 3WG9A 1E79A 4X4GA 4JIGA 5A71A 5A3QA 3GLGB 3ZXSA 2DWOA 4X3OA 3OEEA 4R1SA 2DE0X 4L0QA 1FIUA 2PWZA 4K6HA 4E12A 3ESYA 3QJYA 3A14A 4XIGS 3LZ6A 2QQGA 1YQUA 5HK9A 1THZA 2AC4A 2OESA 4OAQA 3FOFC 3UA4A 2XUGA 3N1UA 1VSVA 3LQ2A 4LEIA 1HTTA 5FJIA 1IJBA 3M9LA 4IDNA 5DHSA 4XYLA 4I6TA 3GLIA 3PFWO 3ES9A 4KLZA 4PF1A 4LQLA 1V3UA 4DBZA 1N2XA 4LXIA 3PFNA 2SKEA 2Z2YA 1N5JA 4BPRA 1W8DA 2BDTA 1VG0B 4MHTA 1MRSA 1O3YA 1YMQA 3RIEA 3LOPA 1USIA 3O4FA 3S1AA 5F2NA 2B2NA 2UXBB 3HFJA 2B36A 4XGKA 1VLJA 2GM5A 2BGIA 1ZIXA 1W34A 5CIQA 2UUPA 5JSZA 3A1EA 4JLDA 1T8TA 4OHOA 2VTKA 4YIHA 2QYHA 2UU9B 2O2IA 2HBZA 1IY9A 3F7NA 1QP0A 4MS4A 4R8SA 4GE0A 3D3WA 3PPIA 4FS8A 4IDBA 4HLCA 2VRCD 4G8DA 1TAHA 3NT4A 3HRKA 2ZTSA 4NXMB 2O49A 3KAJA 5ENZA 2GN6A 3BFKA 1KKUA 4RFSA 4Q03A 1RIFA 5AVOA 3Q11A 3AJDA 4DTCA 2ZB4A 3LWNA 1GEEA 3D4BA 4X8LA 5HXAA 2LIVA 1AS2A 2IYOA 5IT5A 5ITZA 1QKIA 4GLOA 2EKZA 5IFKA 2CMGA 4PFJA 1GYPA 3DZKA 3SLGA 2QVBA 4B3MB 4QQ8A 3AU8A 2X76A 4KE9A 3KVOA 2OGSA 3JQQA 4CM8A 5HP4A 3QVUA 5MHTA 1ZAYA 1GP2A 3I5MA 1R4NB 2RC5A 4D4KA 1EJ0A 2BNNA 1P5FA 2V45A 4FWBA 5J59A 5BNTA 1RRFA 2JRCA 1RLIA 1T8UA 4XQ0A 1ZPQA 1U2TA 3VSEA 4LVNA 2IV2X 5M5BA 4E11A 3UH0A 3PD7A 2GFQA 1QQBA 4ZI2A 3ZHXA 3OPYA 1W36D 4IW3B 3HRIA 4FCVA 4MV8A 4FD2A 4MITA 3KPVA 2GWRA 3IUPA 1M2EA 1T5SA 1N4DA 1YZVA 2LBPA 3B1FA 5JQGB 4L78A 2EARA 1BS9A 2YYZA 3G0CA 4G97A 3BORA 2IS6A 4KLRA 3T7AA 3PR2B 3E8SA 4OF4A 1H2FA 2I3ZA 4L16A 1A4IA 1B74A 1YBFA 2PZAA 2ZIXA 2E21A 3EZ6A 1FUEA 3WVNA 1K98A 5FTLA 5L3QA 3KQHA 1FFEA 1LPBB 3TAUA 3TAHA 5AH0A 4TXHA 3QX7A 2HR1A 5ICCA 3O4VA 1R5OA 1UPAA 3Q1KA 4XM1A 1NJ2A 1RWNA 5LR6A 3Q3EA 2IKQA 3AI7A 4UHKA 1MAAA 1U8EA 3ZHIA 4FYKA 4K9QA 4NE9A 2IYEA 3ZR4B 4KI0A 4B2IA 4IXNA 2XRYA 1EE2A 1XEXB 5TPWA 3TW0A 2O19A 4QOJA 2XUDA 5BMOA 1STOA 1U99A 3HUEA 3RS5A 3IPAA 3HDQA 3IDOA 4WMLA 5KVCA 1L4HA 3KP1A 1NDHA 1QJ4A 1LJ8A 3F47A 1L5OA 2AN1A 1M54A 3BXHA 1W9MA 1D03A 1KO4A 5JS2A 1JPUA 3PHIA 3ZBQA 4DT1B 2RIRA 2P90A 1V4NA 2GSWA 3DLAA 4MI6A 1UBGA 1U3DA 2AOWA 3TCXB 3W2EA 2MQKA 4JCYA 1LD3A 1QE3A 1PL6A 1USUA 1G3QA 1SBZA 2JATA 2JJ1D 2R8RA 3PHLA 3WWEA 1XK6A 4G0WA 1K8XB 2DY1A 5SV2A 3AL0C 2OBNA 1O95D 1EAYA 3SEAA 1KF0A 3NWEA 1TZJA 2EGUA 1IOVA 1Y8ZA 1XRLA 2RK3A 4F06A 1DUSA 1MG5A 3A31A 1L6IA 5DIZA 3FTCA 3UWOA 4BB0A 5LOVA 5L3ZA 2YIVX 4MEBA 3CLRD 5CMLA 4NBVA 5CLGA 3P71T 3U37A 4BEVA 4OLBA 3D3KA 2ZS7A 3OD5A 1RKUA 2F2TA 1UZMA 3DDZX 1IUPA 3MWKA 1HDRA 2W6JA 4QECA 2X0DA 1JQLB 5C46F 1PZGA 1NDUA 2CZGA 4K9MA 1KMMA 1XTKA 2Q5IA 3OCWA 3WB0A 3WNZA 5FBZA 2GEUA 3FOEC 3F98A 2OV6A 2A58A 2FN4A 4ON9A 5EJEA 2A8YA 5KDLA 3KU4A 3ACCA 3H5OA 1YHZA 3AKEA 1XTQA 5K0GA 2H1LA 1MW9X 4GEGA 4JVMA 4TMYA 4ZEMA 2BFWA 1CUCA 4BMOB 2Q3MA 2R48A 5JCOA 1Q1EA 3GVIA 3RU3A 1POUA 4BXOB 1J8VA 1E1DA 1ECLA 4HKTA 2WSIA 1JH8A 4MPRA 1LZKA 3D6VA 2XVXA 2H2HA 2P0AA 2Q46A 3JR3A 3P4UA 5FA5A 3A05A 1CZRA 1D2GA 2QI9C 3AUKA 4KQMA 5JCPA 1MQ9A 2EIHA 2M6KA 5GP1A 3G8AA 2JIOA 4TWIA 1X80A 2WLTA 4C2AA 5EWMB 1Q7BA 4DR7B 2QMYA 1QIMA 5HGJA 1H6AA 2ZIZA 4FYHA 4Q3KA 4M8SA 5LP1A 1E2NA 1GAEO 1QONA 4CM5A 5ECWA 2C83A 4R98A 4WVLA 1MFQC 2POCA 3ZHSA 4BOYA 2QMEA 4GLLA 4LBYA 3LT1A 3RVKA 1UBEA 4IHJB 1B6RA 4Q4AA 3VKHA 1T4MA 1CUFA 4V1CI 4FS3A 4CKWB 5JAPA 4BEWA 4K7JA 2VP5A 4LF4B 4AKHA 2VEDA 2CMFA 4V02A 3S2EA 4BQRA 2GZ1A 2ZYUX 4KJXA 4PSKA 3R4CA 4X6LA 5FULA 4V24A 4D8XA 3PVCA 2DFPA 1XT6A 1WHTB 1ESDA 3TFOA 1NQ5A 1YR3A 2F6RA 2ZSEA 3DEFA 2GLXA 1CJVC 2XYGA 3IMEA 3IUNA 3R09A 1D5WA 2PZGA 4DSZA 1VIMA 4D25A 1T0PA 1LVGA 4Q6WA 2VJQA 4QULA 2YDXA 4Q01A 1QHIA 1U7HA 1HZJA 4LJ5A 3CVVA 1KHHA 3RIHA 5CG1A 4BZXA 2CLKB 4BE7B 1XYVA 2O8NA 1N3YA 1ZONA 4FE4A 2Q3LA 3JQAA 2BFAA 3F2IA 1GSAA 2HTEA 4LTMA 4PSCA 5FFFA 1B2LA 3FAKA 5LB2A 3FKJA 2G67A 4Q15A 3V46A 4ERXA 1KU6A 1PRUA 1P7WA 1TRHA 4GM1A 1JQ5A 3NANA 4R8KA 1FF9A 1QFJA 4G5OA 4PG7A 2QYOA 4G63A 1F7VA 5HKKD 2GESA 4NPHA 5DXAA 3QQ6A 5CA0F 1P80A 5JJ5A 4BX0A 3ESRA 2V7TA 2YTZA 4HSEA 1CETA 4Y7CA 4F3NA 4BV3A 4KVAA 3LOQA 4CT5A 3GJYA 4HC4A 1GGFA 5C1BA 3KUDA 3U56A 4EI9A 1UQTA 3KJEA 4DJAA 1E5VA 1WUJS 1EKXA 1IZYA 4WFJA 4Y2JA 2J5QA 3T4PA 2BUAA 5T4FA 4WAUA 5SY6A 1T25A 2AXNA 5B12A 5C8VA 3S2ZA 5DTRA 2GK6A 2UYQA 3WISA 4II7A 1LCIA 3WWYA 4F4UA 4QT0A 2BGGA 3OLVA 4ZOQI 5FTWA 1KEVA 3X0DA 5BSMA 1C9KA 3PE6A 2JLWA 1MV8A 2E9SA 2G82A 3PLRA 4KO2S 2ZJOA 4BX2A 5B7PA 3H99A 3HU2A 1PUXA 2ZSBA 4KW7A 2OXEA 1BX1A 4IVNA 4OHZA 3CJTA 4HDRA 1E64A 3DHNA 5IYZA 4PAGA 4ANFA 1CZHA 1QHXA 1U3TA 3GMIA 4I50B 1E2IA 1E3LA 2QRVA 4P2BA 2QRHA 4G0MA 3GEPA 2W6QA 4IR7A 1CW2B 3O74A 3O1IC 4XR4A 3LECA 2Q3CA 3EUSA 2QLLA 3CGGA 2OKCA 1CHDA 3ZHUA 3JQAD 4Q9IA 1MEOA 5CM2Z 1HE3A 4UZFA 1V3QE 4IRMA 1TKAA 1WQ1R 1ZUHA 2AXEA 4FBMA 4L95C 2EFJA 3P0IA 5HZKA 2Q5EA 2QYTA 4OYYA 2FPWA 3IPYA 2BUBA 4JXXA 3G2LA 4KMOA 2BM0A 2FRXA 2O50A 4PY2A 4YN3A 1DDIA 3CVUA 4HK4A 2A9QA 4BX8A 3NPMA 1CQTA 1V3VA 4LJ8A 1XAJA 3PQ7A 1MFZA 5AI0A 3DEHA 4QAJA 1BC5A 5GOTA 1NU8A 2AEFA 3PUWA 3PE5A 3HEMA 2RHLA 1NR7A 4KO1S 1UK8A 2PEZA 5IXYA 2AVDA 1EVYA 4RV9A 1S01A 4CMEA 1J8DA 1WCYA 3H2GA 1IG0A 4GLJA 3FFBA 4WPGA 4FMCB 3HK2A 4J0JA 1UEJA 3SCFA 4KQ6A 1ZX1A 4GI2A 1IXZA 3DL4A 1A2BA 2QRZA 3LC0A 4L4SA 4C4RA 2VJAA 1U1GA 3WE7A 5KU1A 5FOVA 5BUCA 1QGUB 1PNTA 1J2UA 1ZS9A 2WAOA 3MPOA 3OLZA 3ZH9B 3QE3A 2ZANA 4KLNA 3TW8B 3COPA 4GZ5A 1WXXA 4FCTA 4GPIB 5K3OA 1ZZCA 3CINA 1NR1A 3F5DA 3N2KA 1G7RA 4FFRA 1OFGA 1K7XB 1PG2A 4GVLA 3TLGA 4C4PA 3HJHA 4Q9KA 2GS9A 4FCCA 4B09A 5BNFA 4A5OA 1W52X 2X2EA 3HDJA 2PUCA 4N49A 3Q9SA 1GARA 2O8BA 2J45A 4N65A 4J0GA 1NN5A 3ID6C 1P0CA 4KWEA 3T38A 1X92A 3QVOA 1G21A 3EXHC 1CE8A 3L07A 3SLKA 2VYVA 1JTVA 3VZBA 4F1KA 1BOFA 4YRQA 1YWGO 4DNQA 1PX2A 3URKA 2AXUA 4FNOA 3V7WA 1LSUA 1Y37A 3UHOA 3G02A 3DE6X 1Y3CE 2PSDA 4Q16A 1ZKDA 5EWLA 2ICAA 2O05A 4TRRA 4P4UA 2VJMA 5PNTA 2OHHA 5DW0A 4P0TA 1BA3A 3R0JA 1TADA 3ELUA 1SVUA 3H0EA 5A03A 1QTIA 3IR6A 4LDPA 3GROA 1QPBA 5LKAA 4JT9A 4PPFA 5A7GA 1W85A 4P38A 3F8TA 1RI4A 3LFUA 5FNZA 3CW8X 2G9ZA 1N8NA 3FYHA 1KMCA 1QH1B 1CB7A 2J5BA 5KYUB 3I9OA 4EGCB 4ZCPA 1ADRA 4LZAA 1I9CA 3SHTA 5C52B 1UPCA 2PA0A 1BE8A 3LUAA 4PO1A 1A7AA 2RGRA 1WHTA 2KLBA 5ITWA 4Z8YA 5DP2A 5IC5A 4KN5A 3IE1A 5LP6B 1P3Y1 1QH0A 1HQKA 2BJHA 4IRUB 4ALIA 4JYZA 3O0TA 2ZUBA 4YDRA 3CQ9A 3K9GA 2X0KA 2D5AA 4Y2TA 2VJYA 5A4AA 4WK2B 3CH4B 2Y67A 3HP4A 4QPJC 3R4VA 4PE5B 2B78A 2X4LA 5HE8A 3U4HA 5KJ6A 3P4YA 3B3GA 2B20A 5IK2D 3X1ZA 5B7QA 3TSAA 1PL8A 2FHPA 2I4NA 5JC1A 1NF8A 2Q0SA 4WXHA 5FCDA 3BL5A 1U4OA 1GTZA 4EECA 2PSFA 2AXPA 2HA2A 2QTHA 4H59A 4D8TA 5I7FA 5JVDF 4F8JA 1Z34A 1CKEA 2RMKA 3OUUA 3FSJX 4P53A 1RMYA 3EXHA 3R5FA 1RACA 1B0PA 3ROMA 3PWKA 4HNQA 2ZYSA 3UJNA 1G3UA 2P5TB 1B41A 3T4XA 2KBFA 1BYUA 3GCWA 5A3JA 1AZSC 5AQ1A 4FGUA 2X0NA 1XLTA 1MT0A 3LO8A 3G88A 4A82A 3PD1A 4HX5A 3FUTA 1VCOA 3VX4A 3N7AA 1K2VN 4R9VA 1UXOA 3UNXA 4CMAA 4FHEA 4ZVPA 5HPYB 2WUEA 4E4RA 4KHPB 5F33A 3AZOA 3MD0A 4R1NA 4P8RA 4TXNA 4IQFA 2WD9A 2GNOA 8ATCA 3LPLA 4XB6B 3IUJA 1UDRA 3DULA 4AYTA 3H11A 1DZ3A 1A77A 2QW0X 5AOAA 5FBVB 1I3NA 5AK4A 3ZGOA 2WFLA 2GPAA 4KUHA 1XB2A 3OZ7A 3RSHA 4YGXB 3UATA 5BSWA 2V0CA 2SHKA 3O8NA 1RQXA 3QU2A 2IDJA 4EYOA 4A27A 1TRKA 1E1MA 4L57A 3W5JA 3ORFA 1ZW6A 3SYRA 3UAXA 1XRNA 5TC4A 3BRQA 3CNEA 5JBNA 4W5OA 5J5VA 3O91A 1W36C 3DEKA 4K1XA 1BCRA 4LRWA 4AMZA 2CV2A 2KPOA 1PJ3A 2Q8NA 1A72A 1NUQA 4RY0A 4X41A 5FRDA 2B8WA 3QLUA 2HXGA 1CF2O 4JUIA 1DDGA 1YE5A 1T8PA 4L4XA 1WD5A 2MR6A 3RK1A 1XELA 4N7BA 1JJAA 1H42A 1TA9A 4UNQA 4CNQA 2Z1NA 6ADHA 3I4LA 2W2KA 1E2FA 1TYAE 2BZGA 2E49A 2DQKA 3EJ6A 3L1VA 3GZ4A 3MS7A 3GT3A 3RSCA 5DB4A 1R16A 3N9IA 3S8QA 4HGOA 4KQFA 3UJDA 5IDWA 1EXVA 5JOQA 3MWDA 3OTQA 4BMSA 1J5PA 1T5BA 2ZT8A 3M6XA 2H54A 1X9IA 4L76A 2EZ4A 4KXYA 2LTAA 4YRJA 4TWAA 1DAKA 4BO2A 2B1JA 1VGRA 4OXNA 3F5MA 1DCKA 1L0BA 2CWDA 1O97C 2I78A 1P0IA 1L7RA 2G0TA 4MV7A 2UUAB 2CUZA 2OCKA 5H59A 5LQAA 3GN5B 2D8MA 1I3KA 1SCUA 2NG1A 2PH5A 4I6GA 4BQEA 2GT1A 1NC1A 3E4CA 1OCEA 2WILA 3PDWA 4OAPA 1LI7A 4ZOLB 1C9YA 1MFPA 2OXFA 1NUUA 4NMWA 3ZZ1A 4RY8A 4IFBA 5CJPA 1W5TA 3L93A 3R1IA 1BSVA 3O4RA 4XASA 3NH6A 2YXNA 4RFLA 3UN1A 4JGIA 3W9YA 3S1AB 4DDKA 4AECA 1MB4A 2RHRA 2H06A 1O6GA 2E55A 2J3MA 3GBFA 3LQQA 2D1SA 4MA5A 4J1XA 4JH0A 4YY3B 3ROEA 2COKA 2R5WA 5JSZB 2QVGA 2BHTA 3CZMA 3FOWA 4LE2A 1EWKA 1MA0A 1DG3A 1MV5A 1SC3A 2SECE 5LA6B 3K4PA 2J6HA 1P1IA 2D1QA 4B2YA 7REQB 5KC9A 5JNTA 3AUUA 1YCFA 1IG3A 3B6IA 5G1PA 4K6GA 1P2BA 4J4TA 4CR7A 4BKPA 1W35A 1YU9A 4F2GA 4KEAA 3ZD7A 3O4HA 3GP5A 3FUWA 1T1SA 4FLEA 3MBOA 4KOEC 2XOXA 5KTMA 1RZSA 4Y30A 5I8WA 2XMDA 1ULAA 2I65A 2I71A 1ZM3A 2ZAIA 2LDBA 4QU9A 1IUOA 3JASB 1RMQA 4CFZA 5LU9A 3PEEA 4UHBA 1LK7A 2XPCA 3W4KA 1GL9B 1HYGA 4ZOCA 2JK1A 1F48A 3RAGA 3CY6A 3DWFA 2P6PA 1H66A 3OZSA 3K9CA 1AC5A 4BLTA 2PQMA 4CEIB 2AUMA 3BHJA 4EPXA 2BF4A 3KVRA 4V2UA 3P2JA 2V7EA 2R6JA 4RESA 3MTDA 3D0RA 2XB8A 3TI7A 2AW3A 3ZG6A 2ZI3A 1AO0A 3PKIA 1Q5PA 2EJUA 2AK2A 3ZIUA 1NI4A 4A2WA 3BEDA 3PI7A 4YRTA 1T1RA 1SBTA 4YYZA 1QRTA 2VDPB 3WXBA 4O25A 1N7HA 3FCCA 4DE8A 2A9VA 1GL6A 1WTCA 2GFHA 4B87A 1EUZA 1I51A 3N53A 4ROTA 4EHLA 2YV3A 2QN3A 4W82A 3BD9A 2BKEA 4JLKA 1ZD2P 2Q6OA 1PJQA 3DAOA 5CHYA 3U13A 4HS9A 4D56A 3A1UA 1OZGA 2OP1A 3EXHB 3V4PB 4N7MA 4XX0B 2X7HA 2GASA 2VT6A 2BLNA 1G6Q1 2NXEA 4Z4CA 5IF9A 1DB3A 3N8DA 5LQDA 4AZ0A 2GF2A 2DWQA 4BATA 1BE1A 4EUNA 2NZUG 5KQPA 1UBNA 2CL0X 5BR4A 5LVAA 2VRBA 5YASA 4U6SA 4M37A 1DOZA 4PYNA 1UOEA 2WVGA 1L4KA 1MJFA 1GPNA 2G08A 4DLSA 2MYTA 2DAPA 3AB8A 3F7OA 4XDGA 5DGCA 3B1KA 1U8ZA 2V5AA 3KEOA 3ZJYA 1QO0D 1JT9A 1OI7A 3B2QA 4DGSA 2JAPA 4HX9A 2NU9B 2DMRA 3C3AA 3FVQA 1SKBA 1VPDA 1B15A 3O9VA 4EELA 2I5PO 3EISA 4YVFA 3T15A 4DT1A 2O1EA 1D6SA 4AAYA 3HZIB 3ZQKA 4OI1A 2HPVA 3TRKA 1SWVA 3OPYI 1RC8A 3CEMA 1TO1E 2Y05A 3AHCA 5HTKA 4MVWA 3TKLA 3V1TC 5JAZA 5IWAB 3OBBA 4OIFA 2ZIVB 4P4NA 5EKTA 3I32A 1JECA 2W43A 3JQ7B 1MJNA 4QWMA 3E27A 5GAJA 4PAQA 3NASA 3DBLA 3DE3X 1WOMA 2D2XA 3UMBA 3EAQA 1E1YA 1U3GA 1I1HA 2GQ0A 3T7KA 3U44A 5I01A 5J2UF 1GV1A 4WBSA 4AJLA 4YB8A 4ZO9A 2XGOA 1E7QA 1JHMA 4NBKA 5UKDA 3PRHA 3ONFA 4PHHA 3RC8A 1JHXA 3CLSC 3PGKA 5ALYA 5H81A 5IX8A 4LCJA 1BCSB 3IIMA 2ZI4A 1RHMA 2WG0A 4AKEA 1N2EA 1UXDA 1EX1A 2PS3A 2F00A 3GJXC 4NJOA 1UOPA 3V1MA 3O9XA 1X2EA 4IPTA 2AFHB 1Y5RA 5D3QA 4D9BA 1BXGA 3QLVA 3IEXA 4ER6A 4BGEA 4BP1A 1OLUB 1R50A 1U0GA 1VBFA 3O7WA 4R2KA 4V0NA 5EHZA 1VBMA 1X74A 3AR2A 4A26A 1TK3A 1F0NA 2XB6A 5CXXA 2WD8A 4JIMA 4YJ3F 3H5AA 4IJ6A 3GLHB 4EUEA 3EUAA 4RU1A 3ZJ4A 1DLJA 1NUSA 1IRIA 3KYIB 2B99A 3NX4A 4NFSA 1NJGA 3ZE6A 3JYHA 5CYPA 1VMEA 3TJZA 1HDYA 1ACJA 4RPKA 2VQ3A 3GD7A 4Q7LA 3G2JA 2GO1A 1K8ZB 3KUKA 3TO5A 4EG6A 1EM6A 4MMYB 3S7ZA 2GSDA 4CN9A 4CT4B 3AONB 3RKUA 1D1PA 3FUCA 4R1LA 3VH3A 5M34A 4UM9D 3V8BA 1Z0IA 3BWXA 4IH9A 5J2TA 2B30A 4JX9A 2PMDA 2XJ4A 2R97A 4BNKA 5ECYA 4DLXA 5CDUA 1Z6AA 4WLUA 1ELOA 2FFRA 1Z3IX 3U3DA 5JZBA 4KFSA 3PUHA 1WCIB 4C88A 2CV1A 2OK7A 4HWOA 3I42A 2AKEA 4IO1A 5E7MA 2QJFA 1RM0A 1RM3A 3UT5B 4GGOA 3I9KA 2FG5A 1OQAA 3IIKA 2IYYA 3DQPA 3RLIA 3H0KA 1PGOA 1UMKA 1PW7A 1TUGA 3OOSA 4MUGA 5I9MA 5CAEB 2NWQA 4J9VA 5FOXA 4Z2YA 1KZHA 3U3RA 2EKDA 2XMZA 1JHQA 1QNFA 4I66A 2XRZA 7GPBA 5FNVB 1IFXA 4HTAA 1U2ZA 2EFGA 3AOEC 2O2DA 4MIKA 1UOOA 1U90A 5CFLA 3AKYA 1ZHHA 3HFRA 1A69A 4JODA 4EF4A 5EJGA 1W88A 3ITKA 1EFHA 3MTBA 1QQ7A 2BFNA 2O8CA 1ZI9A 3VV3A 3LBIA 4OCZA 2ZYGA 3G9UA 3N28A 5AHKA 2NO4A 1L4EA 1WHSA 1KE2A 2HBRA 3KXIA 1VJ5A 1J4AA 4MI9A 4M9XA 5D3KA 4NESA 5AJTA 3T1VA 3I52A 3ND9A 2ISCA 1ENOA 2FDXA 3DVLA 4XYBA 1W44A 4G09A 2P41A 5DBFA 4TQGA 3VR5A 3ZXUB 1IHXA 4AD8A 4CM3A 4ZXPA 3AEQA 4PZ0A 2GFIA 5JARA 5JWRA 1CYEA 3FI0A 4CGYA 3QTBA 3WOVA 1G4AE 3CSDA 1SU7A 4GPAA 1PDWA 4BAGA 4OKIA 1DPFA 3GH1A 3INRA 4D3SA 4IS3A 1Z12A 4KRFA 1NN3A 3GLFE 2XTJA 3H8VA 2HA6A 3PEYA 2PDAA 1RBZA 1Z68A 3AP1A 3NHSA 5CIWA 2WJWA 2JKYA 1LH0A 2QP4A 2YMLA 5ECGC 4J1WA 1ANKA 2OILA 2QT9A 5F21A 1ORIA 2NU6B 4YQZA 5C18A 1U1DA 4WBNF 2FPGA 1ICIA 5CLFA 5KTYA 5DYNA 4L27A 3TW8A 4O5AA 1O6BA 3VR2D 4AYXA 4G5RA 2LXNA 1HQCA 1THGA 4FZVA 2P9GA 4O08A 3ROPA 3F73A 4Q48A 2OSVA 5JCZA 1J42A 2JJ2D 2VSNA 2AOTA 3SZOA 3L7MA 3LUGA 5L45A 2N42A 2Q9AA 4GECA 4YAKA 1T1JA 3RABA 1A1SA 2MTBA 4WKNA 3V6LA 2PV7A 2VK2A 3LUJA 3M6MD 3WFZA 4D9CA 4I55F 2PWBA 3GCZA 4QIHA 2ICTA 3M1YA 3OMTA 2Z98A 5FAXA 2QHXA 4RVGA 1QP4A 3SHVA 5CXQA 2IDKA 4QGHA 1ISIA 4G0YA 2AJCA 2CLLB 3ORSA 2J08A 4CEJB 2ANBA 3AY3A 4Z9BA 1GT6A 1U0OC 1OH5A 4BBAA 4LXQA 4ZYXA 5C51B 3ZDBA 3MSXA 2G76A 5CLQA 2LUOA 3TELA 4QDUA 3CUKA 1XEWX 4YP1A 5CDFA 3RYHB 1UKZA 4WGFA 4DLVA 3G9QA 4GPEA 4IM7A 3OPMA 3OEWA 1DAGA 3L0DA 3PXEA 4WJZA 4OATA 4ZPXA 1W4RA 2AMJA 1A4UA 2I6UA 1VL0A 4PU7A 2DQSA 3BXPA 3HCPA 2DGDA 2B21A 4EHIA 4EUFA 4Z51A 5KTPA 3M34A 4LF8B 3W2HA 2V4ZA 4QO7A 3ABZA 3ZY6A 4E13A 3U44B 1OVGA 5I9SA 4KQXA 4N76A 4FR0A 1L2TA 2Q4RA 3WB2A 2C8VA 2WSBA 3VGJA 4FIZA 4P2GA 3QG5A 3R0VA 5JHGB 4E2XA 4GI3A 3RSGA 5KHAA 3WI7A 1I3CA 2OV8A 3PIDA 5CB4A 4C6HA 3LLMA 1H1LA 3H9QA 3O6VA 3ZHVA 3LAWA 3V97A 4Z5DA 5MGNA 1QC5A 3O3CA 1OLSB 3QUTA 2IL1A 4MO2A 3FCEA 4GOJA 4JJAA 3TG8A 3PJDA 3SKXA 2DLNA 5C1IA 1P44A 1SIUA 2PNJA 4B46A 1OLUA 4R1TA 5EUMA 4XYGA 4K28A 2ZBGA 1GPBA 4UVGA 1A8SA 4BMCA 4DCNA 1ST3A 3OQOA 1QCDA 2D0DA 4I1UA 1MHPA 4HXGA 1QDLB 3FH0A 2HQ1A 1DC5A 5B58C 1WKBA 5EYPA 4XKJA 1R18A 3ESQA 4Y2XA 1VI2A 1U3CA 2NACA 3ITNA 3PHHA 4Q4DA 2OCYC 1EWVA 4RDHA 3LOUA 3JXBC 1Q17A 3FPLA 2OXRA 4K3VA 3P2IA 4WKOA 1OFUX 2PXXA 4JL6A 3T3EA 4YV2A 1ZR2A 2GN1A 3Q5EA 2O4AA 3NM6B 1UPFA 1LJLA 5HCUA 2VJDA 3E03A 3VA7A 3GEIA 1YR7A 4LJ7A 3WLEA 2AXQA 2GXUA 3LYLA 4BO7A 3HJRA 2PUAA 1OZHA 2DECA 4BU1A 1PJBA 2PVPA 4YP6A 3EWSA 4F91B 4M1ZA 3GAAA 4J76A 5IAAA 1U63A 4OL0A 4KB5A 1TVCA 2W5UA 2E4WA 1FYDA 2X9LA 3ACBA 2EC5A 3L7CA 1CP3A 3JXEA 3OCXA 3OKPA 3X1YA 1PG0A 4KHZA 4LSWA 3P32A 1G64A 3LY9A 1CUDA 2J3DA 1Q44A 2XYHA 1Q1NA 1TU0A 2YIJA 4XVRA 5JJBA 5G0VA 2IUEA 1Y7LA 2FEOA 1E9EA 2P2DA 1X38A 2VJKA 2VVTA 1ZI8A 2GLTA 3D4IA 4LZPA 5K0LA 1ZNXA 3RVDA 3SFZA 3TQCA 3IOEA 1N9KA 4BIMA 2IHUA 3OH8A 3WDMA 2P6OA 4X8OA 4EK9A 4BEJA 3DAHA 1P5JA 3PNQA 4YCDA 4P58A 1XCLA 5E6SB 4BUJA 3DMFA 5AIBA 4R16A 1JXOA 4FU0A 1Z25A 2D1FA 3AFIA 2FE4A 3H2JA 2C9MA 4MUBA 4GNRA 2CF6A 3TKYA 2I22A 1VIDA 2PU5A 4QO8A 3R7BA 1E3MA 2O8DB 3K09A 3AF1A 3LPDA 2JAXA 3TVYA 4XWAA 4JLWA 4M8LA 3QU4A 4PBSA 4BO8A 5I9NA 1E66A 2VAWA 5JPIA 5LWHA 3M6WA 4LHXA 3RJMA 1G8MA 1NOIA 3WYDA 1CHNA 2C2BA 4EENA 4CQLB 2CCKA 3DDOA 1Q92A 1MX9A 2GM9A 2Y1GA 3M89A 4ARZA 4BFXA 4D9EA 3LZDA 5BYBA 3HVRA 4GFDA 5CX1B 2VI5A 3CZPA 1ML4A 1OMOA 2ZR0A 3NLLA 4IIXA 1PTJC 4QHYA 1SMKA 5AT1A 2AEMA 2QW1A 2BE9A 2YUIA 5BNZA 1M2OA 3K4QA 4NCKA 2CNKA 1PRYA 4KWTA 3N59A 3S3TA 1U9IC 4RKRA 1NVDA 4HX2A 4CM9D 2NADA 2J85A 4YYEA 5BSFA 3KSDO 3H13A 5KAMA 1Q3TA 3DLPX 2QMOA 3ZQ6A 1EA7A 3EDYA 2XWBF 4URUR 4GP7A 2C00A 1BJTA 1CR6A 3OQIB 5CB4F 4BFCA 4KDFA 3OWOA 1IZ0A 5A9RA 1E1NA 1RYNA 1QYWA 3IMFA 3OCJA 4HDAA 2HQSA 3EQ7A 1FDIA 5A5GA 3NBUA 1W59A 1E0KA 5JRJA 4IWYA 2GJ9A 5GGYA 1IWPB 3E3AA 2C84A 4B45A 1LS6A 3C3YA 4JVOA 4FVTA 3LX6A 4ZVRA 1LLQA 2P3QA 4CKWA 4RNDB 5REQA 4BECA 2OP0A 2X8LA 3VDMA 4IYRA 4ZHQF 5JZ9A 2Z04A 5AUQA 3IP7A 5B6IA 1XXLA 2VF5X 3PDHA 1WE2A 5IMSA 5IJWA 3GT4A 2NSDA 2YUTA 3MJFA 1SXJB 1E7YA 4RZ3A 2FF7A 3PPVA 1BCRB 5LKRA 2EWMA 4KBFA 4POOA 3T1TA 1A9SA 1Y63A 5SYNA 5EI5A 3VSDA 3G49A 3IP5A 2GRLA 2FEKA 1SZJG 3RB8A 3GLRA 5I7OA 3FWNA 221PA 2OHXA 1QJCA 3VDXA 4RJTA 2JGDA 2Y6VA 4F7WA 1H5QA 1YBHA 4MGYR 4UHFA 4P86A 1KOLA 1X19A 5FX2A 3MUNA 1P9LA 2HL6A 1A5SB 4GZLA 1L4GA 1GGNA 3IEPA 3JQAB 2E85A 3EWNA 2A5LA 1I1NA 4G8BA 5E0KB 4H31A 4ISBA 4UUBA 3RAJA 2DLCX 1T91A 3BHMA 1Y1KE 3L7YA 2GETA 4GEKA 2QUKA 4LCBA 4A8PA 3WBKA 4DV1B 2F1IA 1Z5WA 5DYIA 1XZLA 4PANA 1FNBA 1Y9ZA 3HKEA 4EHDA 5HW0A 2D6FA 1XG5A 2O7RA 5JW6A 3SC2B 4KC0A 3B3JA 4X64B 2ADMA 1GPH1 3CEHA 4NF2A 3CX7A 3PNPA 3QPWA 1ZSYA 1E1CB 2QJRA 3F5QA 4HB0A 4EJMA 4PG8A 2AZXA 4YIKA 3T7CA 1OFUA 4ZU6X 4W9NC 4WA8A 1FCJA 2QUJA 1YHYA 2DUUA 2WJJA 4R0NA 3VKUA 3ESZA 4LYJA 3HCDA 1Z74A 1CYDA 4D4LA 2HPZA 4RTNA 1PAUA 3A9RA 5KVAA 2WG1A 3GB9A 4LGCA 3S27A 3CHYA 4B7ZA 4ML3A 4YP5A 4EATA 4GSYA 5ED0A 4JENA 3RG8A 1I3MA 1KQNA 3SBDA 4YMTA 1CDZA 2G6BA 3D0OA 3AEYA 4NZYA 3A0RB 2IXAA 2PEYA 4KH0A 3GJQA 1VYUA 4MR7A 1NQOA 4I55A 4JBYA 4BVAA 1KQGA 5FI5A 3O8RA 1W0CA 2I4MA 3D0QA 2IF0A 4G07A 5I7UA 5J4YA 2OQVA 4I50F 5AXDA 1G20A 4ZIRA 5F9MA 5JTUA 2A7QA 2H7YA 1GXSB 2P77A 1U5BB 3I3SR 1SJ9A 2WV9A 2PKQP 5I4KA 1UQUA 2EL7A 2P9CA 3TTTA 2TRSB 2FSVC 1P3DA 1K63A 4OM7A 3IA2A 4P7KA 2F3SA 3RODA 2HQOA 4BWYA 4N0EA 5AW1A 2GM4A 4QSMA 2XMPA 4E15A 2C7RA 1G42A 4PC1A 1FE8A 3FZNA 4FFVA 2UZ0A 3WA7A 2GTHA 4UAVA 1MJHA 4CPDA 4KSYA 2INGX 4EMBA 1OPRA 1KR2A 4BNVA 2VYCA 4UVHA 1YVDA 5JADA 5C8YB 5E6SA 1U7OA 2V74B 3STUA 3A4IA 3RUDA 1KYWA 1XHEA 1FSPA 2R1ZA 5HRAA 1TM3E 1BG6A 2VS1A 3GARA 4N39A 5J40A 4O2BA 1A2QA 2HM7A 5A1JA 1W1UA 2A1IA 3AG6A 2F17A 3CIOA 4RSRA 3I5YA 1CR2A 1LSOA 2IHZA 2PMBA 1NJ5A 1PR1A 1BEUB 4YCSA 3FMOB 3WR5A 1X7XB 4CUJA 1DKMA 4JP1A 3J7TA 1U0EA 1KJQA 2AE1A 3N2KB 3VKWA 6REQB 2C5SA 1GA4A 4EW2A 5HX7A 1BD4A 4D97A 3MELA 4G0NA 1OZ0A 1X42A 4GM0A 1Y7HA 2C61A 2IYVA 3IJEB 3PC8A 1QHSA 3IR7A 4M6WB 2AG0A 4HFRA 2H92A 2FWBA 4IOMA 5ICFA 4DLYA 4BN0A 4H60A 3FYUB 4PBRA