3GN5A

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5A02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5A01
2BNOA 3KJXA 3S8QA 4J1XA 1ZPQA 4JCXA 2IUOA 2CSFA 2LYSA 2XJ3A 2L8NA 1YSEA 2IV1A 2OR1L 3LFPA 3FYMA 1OCTC 2GRMA 2AW6A 2LYRA 1UXDA 3MLFA 4Z58A 4X4IA 1VPWA 1ZZ9A 1EFAA 1ZVVA 2AUWA 2PPXA 1PNRA 1LQCA 3G5GA 2AWIA 2L49A 1DWKA 3HZIB 4Z5HA 2PUBA 2B5AA 4IWRA 1O4XA 3G7DA 4FN3A 2LYPA 2BNNA 2O38A 2PUGA 3PXPA 4J1WA 1RIOA 3IVPA 3JXCL 1X2LA 5K98B 3B7HA 4GHJA 4I6RA 4X4HA 3JXBC 1RPEL 3OMTA 3ZHMA 3QWGA 2LCVA 4I6UA 3O9XA 1WIZA 1AU7A 2PUCA 4PU3C 1BDHA 3CROL 3GA8A 2WUSR 1JH9A 3GN5B 5A7LA 1NERA 1QP0A 2AXZA 1GT0C 1ZZ7A 3BDNA 2LYQA 1L1MA 3H5TA 3DNVB 3HI2A 2MQKA 1Y9QA 2LYJA 3LISA 2JVLA 1JWLA 3VK0A 3F51A 1ZUGA 4I8TA 4YG7B 1POUA 1Y7YA 2WIUB 4I6TA 1PRAA 4X4FA 1RZRD 4YBAA 1CJGA 1QQAA 2XIUA 4JQDA 4Z59A 4IVZA 1CQTA 1HF0A 3RZZA 1JFSA 4MCTA 1R63A 2AXUA 2PUFA 1RZRA 1QPZA 2PUAA 2LYKA 3BS3A 2GRLA 2ICTA 1XWRA 4YG4A 1PERL 4F8DA 3JXDL 2IVGA 2XCJA 3GBFA 1R69A 2EF8A 2MEZA 4IA8A 2KZ8A 2PIJA 4Z5CA 4X4EA 2KEKA 3FMYA 1ADRA 2KEJA 2EWTA 2D5VA 3UFDA 2AXVA 4X4BA 3KZ3A 1PRUA 1E3OC 3BD1A 2OFYA 2BJCA 3D1NI 1WETA 1RZSA 3QQ6A 4GQMA 2EBYA 1QP4A 2PE5A 2PUEA 2CROA 1UXCA 1BDIA 2HINA 4X4DA 1ZZ8A 3QYXA 1B0NA 4MCXA 1LMB3 1ZZ6A 3FYAA 2IU7A 1DW9A 3OQMA 1X57A 2A6CA 4X4GA 3CLCA 1S7EA 3KXAA 4YG1A 1ZAYA 1NEQA 3OP9A 3ZHIA 2PUDA 4PU4C 2O49A 1IC8A 4YARA 3OQOA 1LLIA 2LYLA 3ZKCA 1QP7A 4PU7A 3L1PA 2FJRA 4JCYA 2ICPA 3TRBA 1ZZBA 4Z5DA 3OQNA 2R1JL 3F52A 2H8RA 2HSGA 1LCDA 2KPJA 2IVBA 1QQBA 2XI8A 2BNMA 3CECA 2XSDC 1UTXA 3U3WA 4X4CA 3SCFA 4NDWA 2IVQA 1WH8A 1ZS4A 1PRVA 3R1FA 3EUSA 3GN5A 4OB4A 4O8BA 4FBIA 1OSLA 2GZUA 2JCGA 2KEIA 3SCGA 2O4AA 3SCHA 1WH6A 4PU8A 1ZZCA 4Y42A 2R63A 1SQ8A 3QF3A 3F6WA 1LCCA 1JFTA
chains in the Genus database with same CATH superfamily
3JADA 4YTNA 2YDQA 2BVLA 3AE4A 2ZMAA 5LG3A 1EZ3A 4KUMB 4LF6T 3RQUA 4Z58A 3TLWA 2HN1A 2PUBA 4IDQA 2BKOA 2PJQA 2O38A 2LOSA 3TELA 3CQCB 2BS2A 3B7HA 3GZCA 1WIZA 1HX1B 3QB5A 3RKOA 1S94A 3GZDA 1LKXA 4OYKA 5JDMA 2VB6A 2J47A 4PNIA 5CB4E 2VVSA 1CJGA 1SA0E 2XIUA 2XAJB 4DE8A 3SFDA 4ER7A 3P8CD 3HL6A 2PUFA 3OWQA 2M6BA 2XZEA 2CA5A 3CX7B 4I55E 2LSKA 4OHFA 4UEMA 3FMYA 2CBJA 1NW3A 4K0KT 1YKHB 4JYAT 2LSGA 3EI0A 2OFYA 3PDYA 1UXCA 3JCFA 4HTEA 1OWAA 4LMJA 2UXXB 1ZAYA 2KXPB 3KBUA 2WP9A 5DRTA 4AISA 4TWHA 4EZIA 4U31A 3PE5A 1NENA 2VQET 5DJQC 2RA1A 2E5VA 3VHLA 2XAGB 3F57A 2W4XA 2XSDC 3UU6A 2NTYA 1WLXA 1ZZCA 4B3MT 3C4XA 3C50A 2CEAA 2CRBA 3RLFF 5LNKA 1GQEA 1KF6A 2MAWA 5J2UE 2JJ9A 1MMAA 5HEOA 1N32T 2VVNA 3ZSSA 4FN3A 3KINB 3UFEA 4EEDA 4UV9B 2XM2A 3QWGA 4I6UA 3O9XA 4LF7T 3PE0A 3GA8A 1X9BA 3GN5B 1QP0A 1FEWA 3AEDA 3BDNA 5KMGP 5CA0E 3DNVB 2LM9A 2A9UA 3RKGA 4YG7B 4I6TA 4O4JE 3UUBA 1RZRA 3ZYKA 2V7LA 2KZ8A 2XQ7A 3LK3B 2VL0A 4X4BA 2KMFA 4IGUA 2IDOB 3P4SA 4X4DA 1DW9A 2IC6A 1XZYA 4WVLA 4FI5A 1LLIA 3A9ZA 1SE7A 5JR9C 4IDZA 4WBOA 3N9NA 3AE8A 4KHPT 2LE8A 4I0UA 5AQTB 3UU3A 4X5TA 4EAHA 5AQOB 1OSLA 5EK3A 1HNWT 3ZMUB 2MPKA 5ABGA 1J1JA 3E22E 3KJXA 3S8QA 5L4HA 3ZYMA 4K0UA 2IUOA 2EHOD 2VURA 3ONXA 2WU2A 3RIAA 2IV1A 4H63H 2IHR1 4WW0A 3FYMA 2AW6A 1UXDA 3M65A 1N34T 3FB2A 1PNRA 2HPJA 4Q2JA 4IWRA 3OPCA 4Z91A 2LYPA 2NR4A 1KNRA 2V7MA 5L3DB 1FJGT 2CHNA 1AJ3A 2NWBA 2V6YA 1NWMX 2LYQA 2MQKA 3KV6A 4IE6A 4X4FA 2C5KT 5JREA 3NZPA 3MACA 2LJLA 4HE8A 4UVBB 2AXUA 3AA1B 5L3EB 2WS3A 2CM0A 4EEBA 1IBMT 4O4IE 1R69A 4H9QC 4Z5CA 1HF8A 4A97A 2EWTA 4YT0A 3I0OA 4ER0A 5KXJA 2D9DA 4A5XA 2PE5A 4OYJA 3KBTA 2XTLA 4DR5T 3RC8A 4ILUA 3AA6B 5HWYA 4E7ZA 4YTMA 2CXLA 2O49A 2LYLA 4HWIB 2X66A 5FXVA 4GKKT 1MMNA 5LHGB 3A9YA 4EK9A 4DBRA 2V7JA 4CI1B 3HKBE 3U3WA 5IHYA 1VOMA 1PRVA 5HAXA 3FHNA 2XXQA 2VKJA 3OVUA 2R63A 3F6WA 5JDFA 4YY3T 3MKDA 3O1JA 5JQGE 1HR0T 4HFCA 3KDSE 3RQWA 3NZLA 4X65T 1ZVVA 2PXDA 2M6IA 2AWIA 2L49A 2WY2A 3PJAJ 3G7DA 4ZI2D 4H9SE 2IW5B 4MBQA 3JXCL 3ZYLA 2FBWA 3RIUA 3CROL 4MALA 1NERA 2ZM8A 1GT0C 2LRKA 5HXRA 4EXTA 3MXZA 4BAYB 1DULA 2UUAT 3A7MA 4MLKA 1QPZA 4F8DA 4CXWA 2V1DB 2QYWA 2BKPA 4X1KE 3IA3A 2MEZA 3C4ZA 3AEEA 3K3QC 2MOZA 2D5VA 3B57A 4ANJA 3IEEA 2J1DG 2XQ8A 2V3CC 3FYAA 1HG2A 3OQMA 4MFRA 4AQGA 4LMLA 4EOZB 1US7B 4IT4A 4PJJA 3ZHIA 3X1DA 4IREA 2VKOA 2IIUA 4JI6T 2ODVA 4ZI3D 4OX9T 1HTJF 1WYBA 5AQSB 2CCQA 2C5JA 5M4YA 2HSGA 3VRBA 4CI3B 3SRZA 5HXEA 3BQIA 2BNMA 2NW9A 4TNWA 3R1FA 5LHHB 5ABHA 3EDVA 2J7WA 2EHOC 1KNZA 2QA7A 3ANWB 2WMNA 5IYZE 1BR4A 4ER5A 2PXUA 3EUHA 2J62A 4UVAB 2XAHB 4U33A 3WI3A 3HR0A 4X62T 3RF1A 4DO0A 5IWAT 3C98B 4GHJA 4P1NA 2ES0A 4IE0A 3FZLB 4I6RA 3ZCJA 5J2TE 1RPEL 3OMTA 2OLTA 3AB3B 4L5GA 3KVAA 4YHHT 3RGLA 1QLBA 3CIRA 5JRCA 4JI0T 3O1HA 5DTRA 3SWHA 1W9RA 2OV9A 2XXAA 4OFZA 3SX0A 3PUVF 2ZM0A 5LP6E 1YKEB 2DLRA 3MA9A 2LYKA 2ODRD 5HYAA 2XUEA 5JDQA 5AQJB 1XNQT 3WAKA 1ZP0A 1NEKA 2X9YA 4PFPA 2KWIB 3PUXF 3LBXB 4ZZCA 2H3RA 5LGUB 4CN4A 2L9QA 5AQVB 4UELA 4DR1T 2M4HA 2XQAA 1OXZA 2IU7A 4HWFA 2FJEA 4YLHA 4I43B 3MJXA 2LLVA 4QH1A 4WBNE 4YTPA 5LG4A 2M67A 2W66A 5H6QB 2D2SA 1N33T 2J7UA 2NW8A 4BA9A 4Z5DA 2YN6A 4U2ZA 3ZJ2A 1T8BA 4QXHB 4DNDA 2Z6EA 5KDMC 4IDPA 3SCFA 4NDWA 3N9PA 3SR4A 3AA0B 2YK0A 2O4AA 3PU8A 3BQLA 4YSYA 2IMLA 3LDQB 3QOWA 2L8NA 3GWHA 4HFHA 1ZZ9A 1Z0PA 4Z5HA 4IL9A 1QSDA 3DJBA 4KI0F 3UUMA 5ABEA 4GKJT 3IVPA 3PTRB 2B1EA 5K98B 2LRLA 2UXNB 5JDHA 2LHRA 2L1PA 1IAPA 3QOFA 2WDVA 3TKLB 4AKLA 2K5BB 2JRKA 3H5TA 3Q5XA 2LYJA 3TLTA 5HEGA 3LK2B 2CE7A 4QXCB 4YG4A 2GRLA 4YSZA 1YQ4A 5AQFB 2PXKA 2W67A 4DR3T 4IA8A 5GAGi 2Q9QB 4XAXB 3UFDA 2AXVA 2BG9A 2YKSA 4JEUB 3LK42 2PUEA 2EBYA 3ZKRA 3FBLA 5DQWA 4JBWF 1BR2A 2DL1A 4CN1A 4X4GA 4ILBA 5DQVA 3R6NA 3OP9A 4ZI3C 3KV5A 2I0MA 1XWMA 2VWAA 3RYCE 3UULA 4TWFA 4P0BA 4PK4A 5KX5E 2PXFA 5JR9A 2WM9A 4L9IA 4DR7T 4PJMA 2YDSA 2LHNA 3C51A 2YBDA 4Q25A 5E0OA 2BNOA 4OBMA 2WDQA 3L3PA 2HCNA 4PFOA 2BKNA 2DHRA 5LHIB 3OYZA 1MNEA 3KV4A 3PURA 2D5UA 4CQIA 4A56A 4G2AA 1KEYA 4JI2T 2AUWA 2IAKA 3RC3A 3UU4A 3ZN1B 2V26A 4WYVA 1G73A 4IHJE 3AEGA 1W09A 3P50A 3P4PA 4NPPA 1BR1A 3AAIA 1CHUA 4PU3C 4DMWA 4DVDA 5A7LA 3AXJB 1ZZ7A 2W61A 5CA1E 4ILAA 3NBXX 5LA6E 1WR0A 3UWPA 2K9AA 1POUA 1QQAA 2A2FX 4QWNB 3LSVA 4IVZA 3IHRA 3RZZA 4DR2T 4YHJA 4MCTA 5JRCB 1SUMB 2YU1A 4AQFC 4EZ4A 1OEDA 3CX6B 2JQHA 1J5WA 4AXPA 1SHZC 4GQMA 1QP4A 1M62A 4DV0T 2CROA 5AQHB 5CFBA 1ZZ6A 5DRYA 2A6CA 3CLCA 2W63A 4ZI7E 1VRBA 2BG9C 2XXPA 4PU4C 5J1GA 3N9QA 4NIQA 2I6HA 2PBIA 3TRBA 4H9NC 4U2YA 2V7KA 3F52A 2H8RA 1LCDA 3B13A 3N5LA 2IVBA 5EK4A 4X4CA 4O8BA 2C5IT 2E9XD 2X9WA 3SCGA 3KVBA 2OA5A 5ABFA 1ZHCA 3TFLA 3EHZA 2MXDA 4LF8T 4ISSA 4JCXA 2LYSA 2XJ3A 5FXWA 2BS3A 3QNUA 4HWHA 4N78D 4UF0A 1ZV4X 1ZOYA 4HFEA 5FL0A 4AKHA 4DV7T 2BNNA 5LXTE 2WQYA 1UGOA 3L39A 1U5PA 2DWGA 2XASB 1HNZT 4Z8XA 2R6GF 2ZLYA 3CVRA 2UUCT 4DV2T 4IE7A 2FJAA 1JH9A 5AQNB 1I94T 2QRXA 1Y01A 3K3OA 3J9X1 1PRAA 4XBFB 4UV8B 4Z59A 3AAEB 3AA7B 3K8PC 4M1PA 2JIWA 2RP4A 5LJMA 2WZHA 5LGTB 3FXEB 4ER3A 2F4VT 2UXCT 5LOVE 2BBHA 4HGAA 2PFVA 2N9DA 1VCTA 3QQ6A 4KHZF 5HEUA 4TWDA 3E08A 3D0TA 1OEDC 2E2AA 1ZEEA 5L3GB 4AKRB 2NOXA 4GIWA 2PUDA 4U7YA 2E9XA 1T98A 1D1AA 1WRDA 2FJRA 2WBLA 5L2LA 3LG7A 5JTGA 3IF8B 2JQKA 5HEHA 3ONJA 4QX8B 3EUSA 4DV1T 2JCGA 3PUZF 3ZMSB 3JAEA 2J4GA 4L0RA 5BMVE 3QYXA 2KZ7B 4MHCA 4U7IA 4J1XA 2PXBA 4LMKA 4JUYA 1BR0A 4HEAA 4ZHQE 2UXDT 2EHOA 2KSRA 3O1IA 4YFSA 5AQMB 2PG8A 2B5AA 2Y48B 3VRAA 2H89A 3Q2MA 3AE3A 4NUUA 3ZCIA 2LLYA 2JQ9A 3QOXA 1AU7A 1BDHA 3OKZA 3AE1A 1YD8G 2DWKA 4DE9A 2HFZA 5HEJA 4LF5T 4B3ST 2LKHA 4UVCB 3RHWA 3U78A 4B3RT 3TEPA 2IVGA 1IJ6A 1WYCA 1YQ3A 5LB7B 4F8HA 3I1AA 3QFIA 1JNRA 3A9XA 4UIGA 3H37A 1WCRA 3VR9A 5LGNB 2N1GA 2PXEA 3AE7A 3N9MA 3J7Yq 1NEQA 2YDRA 1X79A 5FY0A 2X0LB 3F2EA 2CLYC 1IC8A 1D0XA 4P09A 2X9HA 4O4HE 3TLVA 2WWUA 1UUSA 2X67A 2BZBA 4CI2B 3BK9A 3CECA 2E9XC 2AE9A 3I9YA 4EGWA 4IIJE 3ETVA 2ACZA 4BJNA 3AEBA 3N9LA 2PXTA 1WH6A 5AQQB 2K48A 3ZEFB 3UUNA 3T1YT 1MIVA 3P7IA 4UXNB 3CPZA 3ZC1A 5DTQA 5ABFB 2NTXA 4GK0E 2K24A 3B5MA 2PXQA 2XQYA 3HZIB 4TNVA 4CXXA 3GMIA 3UUXB 5FKYA 1KK7A 3LQXA 3AE2A 3N2OA 3ZHMA 3OTOT 4X1YE 5FP3A 2QGSA 1HG5A 2XQ5A 2WAUA 4ILCA 3FZFB 3LISA 1JWLA 2L3LA 3VK0A 5AQGB 2E8IA 3HA4A 4YBAA 2WCAA 5GAHi 3UQ4A 5FNVE 1JFSA 5A1LA 4DV6T 4AI6A 3NWIA 4DV3T 2PUAA 2ICTA 5DABA 2XQ9A 4JEHB 3VWSA 2EF8A 2MBGA 4X1IE 4LFAT 5FL1A 3KV9A 4HWDA 5AQLB 1PRUA 3BD1A 1RZSA 2VKHA 3AEFA 4JI3T 1HCIA 4DBQA 1J5ET 2V6YB 4EV6A 2AXDS 1R8IA 4DV4T 4GYSA 5GONE 4YG1A 2WU5A 2DNXA 4HFVA 4ASKA 2ICPA 4ZOLE 4PAGA 3RI5A 5LCYA 1QQBA 3AECA 4AKGA 1D1CA 2XSAA 1MNDA 3GN5A 1IZNB 4DIDB 4H9PC 1KNPA 2KEIA 2UU9T 5LMUT 4PK6A 4Y42A 5HCMA 4C90A 3DM5A 3P4RA 1HFAA 3NROA 2CBIA 2RPAA 3UT5E 2V7IA 3MLFA 4X4IA 2JMKA 2PPXA 3G5GA 3T8OA 1DWKA 4GK5E 2X9XA 5ADXL 3ZPOA 4PJLA 1MIWA 4J1WA 2EHOB 4P0AA 1LVKA 2XSBA 5BR8T 5JUWA 3ZPXA 2AXZA 2IUBA 2L8KA 2V5DA 4HRAA 5AQRB 2XAQB 5L3BB 4KBMB 4ZI2C 3UQ7A 4JQDA 4DUYT 1R63A 2A3DA 1PERL 4X66T 3JXDL 2LM2A 3UFGA 1ADRA 4HKAA 1YW0A 3T1HT 4AQFA 2BG9E 1KFYA 4ZZBA 1BDIA 2HINA 3BQKA 2LOPA 3CMLA 1FMVA 2WZIA 5CGMA 3KXAA 4O4LE 2WB5A 2MTQA 4U72A 2V5CA 3CKDA 3EAMA 2WWVA 4PW8A 1LRZA 4QKNA 3Q5DA 1WH8A 1XMOT 4O8SA 3ESLA 2PTFA 3GUUA 3SS1A 4ISTA 3PUYF 2XJ7A 2W00A 3U3IA 1QUUA 1YSEA 2OR1L 3LFPA 4J2CA 2LYRA 4IDOA 1EFAA 3Q5EA 2NW7A 1LQCA 5L3FB 4X64T 4O2AE 3Q5WA 3LJCA 2N2NA 2W0GA 2PUCA 5AQPB 4U74A 2WUSR 4YXDA 4NUVA 2LLWA 3MEJA 3OBVE 2FJDA 2VQFT 3PUAA 1ZUGA 1Y7YA 1RZRD 1FMWA 3RIFA 5HXSA 2Y6XA 3HKEE 1HF0A 3ABVA 3CX8B 1XWRA 1MIYA 3ZMTB 3M3ZB 1OEDE 2KLQA 3WAJA 3FZKB 3JC6D 4X20E 2KEKA 4JI4T 4DR4T 5JDLA 2X68A 1E3OC 3AVRA 5TAOA 3ZLIA 2YINA 1S35A 4ER6A 2FUPA 3I9WA 2YEVC 4MCXA 3PUQA 2HCSA 5FVKA 4FJOA 3AE9A 5LBMA 3UU8A 5LYJE 4AIUA 1UK5A 2LSYA 4YARA 2KT9A 3NRYA 1D1BA 3PUWF 2JQEA 4O2BE 1HQ1A 3ZT5A 2KPJA 4EB6E 3R84B 1FIOA 1UURA 3L09A 3EVYA 5L47A 5H6RB 2CHOA 2V8SV 2E5LT 4Z90A 2XY8B 3JAFA 4PU8A 5DSXA 1H7CA 1JFTA 1ZPQA 4ZEYA 3NXHA 3A5XA 4EQZA 1HNXT 2VKDA 2GRMA 5LBQB 3SFEA 2LSIA 3RYFE 1U2ZA 3GZDC 3O4XE 4KX6A 3ZSTA 2PUGA 1T72A 2KINB 1ZKEA 2DI4A 4ZS3A 3FBZA 3ZT6A 1IJ5A 4CXYA 1MFQC 2XAFB 1QB2A 3ONLC 1W0AA 2CWOA 5F5WA 5FXZA 2JVLA 1UCUA 4OK0A 2C0SA 1UX5A 1CQTA 3C64A 2KNDA 3PJAA 2LSJA 3GBFA 4X4EA 2HPLA 4WZXA 5HCJA 5DT2A 3E0ZA 3KFWX 3NKZA 3NDBB 2V6XA 2X0HA 2BJCA 2PXVA 1JNZA 4TV8E 3ANWA 4NXMT 5DTMA 5JH7E 1ZZ8A 1IBKT 2NP9A 2PXLA 1HX8A 5CJ5A 4IL4A 2JPFA 1E2AA 4YJ3E 3NRXA 5C2TA 3HKCE 1W0BA 3L1PA 3FZHB 1T7SA 2HN2A 4QHOA 3FXDB 4CN6A 5L3CB 1XNRT 5IUXA 4TUYE 4AQYT 2BS4A 4GOUA 5LJNA 2XQ3A 2VL8A 2MYSA 1CUNA 2B76A 2BG9B 4AKIA 1O3XA 1L1MA 3OQNA 3HI2A 4LF9T 3UTKA 2HH7A 4DR6T 2LKGA 4I4TE 5JVDE 4H9RC 2D0TA 3K3NA 2BDEA 4IDNA 4TN7B 1XDOA 3OYXA 4ADZA 3LBXA 1X2LA 4JI7T 4NXNT 3JXBC 5JR9B 4DV5T 5FY1A 5ETWA 2P9BA 1U4QA 3UU5A 4H9OC 2Q9QD 3VR8A 3FZMB 1WR6A 4TZ4C 1D0YA 2XM1A 5F3JA 3R09A 3ETUA 4TV9E 4B6XA 2X0YA 2ACXA 3RRWA 5JDNA 3JC6C 2VK9A 2XCJA 3ZT7A 2PIJA 3RX6A 2W2UA 3CQXC 3HKDE 4EIWA 4HN9A 3KZ3A 3P4WA 3N2KE 3AVSA 3AE6A 2YOEA 2CMRA 3V5SA 4PK5A 4G63A 1X57A 4A98A 3CK6A 1S7EA 4KP3C 3F31A 3ME5A 2SPCA 1Y64B 3RPUA 4JCYA 3ZKCA 4BJMA 4JLEA 3AE5A 2CWYA 3G06A 2XHEB 3LFMA 3RYIE 1OEDB 4I50E 2FFHA 2A72A 1ZS4A 3VKHA 3NVOA 1MMDA 4KMCA 4UR9A 4LF4T 5L4EA 3ZJ1A 3PU3A 3MK7C 2FJBA 2JQQA 3S4UA 2Q9QA 1O4XA 3RRCA 4EKIA 3PXPA 1RIOA 1MMGA 4IE4A 2XPKA 3OJAA 4GYRA 2Y8DA 5EK2A 1E7PA 2ODUA 3H3MA 2LCVA 4JI1T 2K3WA 4F6RC 2PXPA 2D0UA 1N36T 4XZCA 3H3AA 1HS7A 2XQ6A 4B3TT 1V9DA 2WIUB 2DCFA 5FXXA 4CZZB 5FVLA 3Q9DA 4QH4A 3DTOA 3BS3A 5AQIB 5HXHA 3VKGA 1UX4A 3K1SA 2CXDA 4QX7B 4PJNA 4UF0B 5FY7A 2WDRA 1QZXA 2KEJA 5EZYE 3QB5K 1G8XA 4TX5A 1WETA 3KL4A 4C91A 2WSSV 5LMNT 1B0NA 1YXRA 5FMNA 4JI5T 1XMQT 3I0QA 4QXBB 5C3JA 3SOLA 5F8PA 2YU2A 3CQGB 3N2GE 3G0TA 4ZS2A 3ZMZB 4LFCT 5HWXA 2R1JL 2CPTA 1I6ZA 3RH3A 4HWCA 2XI8A 2H88A 3QK6A 1UTXA 5J0ZA 2IVQA 4OB4A 4FBIA 2BVMA 3AXJA 1IBLT 4WNKA 3QUJA 3AAAB 3SCHA 2CLYB 3PUSA 1SQ8A 3QF3A 1NAFA 4IE5A 4EYUA 3M9LA 4EZHA 5AQKB 2CSFA 3A8YC 3RYHE 4EKGA 1DU2A 1OCTC 3TLUA 2QVAA 1VPWA 2E9XB 1M7KA 2VEOA 2ZM6T 3N9OA 3W15B 4LFBT 3RIUC 3NZQA 2LEHA 4JV5T 2X51A 4DUZT 4E7SA 4X4HA 4H63V 4HFIA 2Q9QC 1D0ZA 4YJ2E 2GK9A 3VU7H 1Y9QA 3F51A 4I8TA 3V5UA 1VCSA 2VASA 2WMOA 4U3CA 2XQ4A 3MZKB 4DMVA 3EDUA 5AQUB 2BBJA 3AEAA 1XDPA 4HFDA 4ZXLA 2IC9A 3DP7A 5JDGA 1WFDA 2CXFA 3TLSA 3L8RA 2HHHT 2ZM2A 3C4WA 3D1NI 2W62A 3ZN0B 5HXCA 2G0UA 2KWHA 1LMB3 5FYMA 3PUGA 3IBPA 1L0VA 3ZC0A 1E1HB 1Z8UA 3OQOA 1B7TA 1QP7A 4PU7A 2I59A 4HFBA 4EYYR 4JI8T 3EABA 1ZZBA 5C8YE 3ZMVB 2H7VC 2LNMA 2JMHA 4ERRA 4QH5A 4V1Av 4YSXA 2UUBT 2LT3A 1LVFA 3P4QA 3OKQA 2GZUA 2UXBT 2H7OA 3PV0F 3CWZB 5AFUL 4COFA 3QC9A 1LCCA
chains in the Genus database with same CATH topology
3ANWB 2WMNA 4J1XA 5IYZE 4JUYA 1ZPQA 1BR0A 4HEAA 4ZHQE 2BVLA 1BR4A 3A5XA 2ZMAA 1EZ3A 3EUHA 2EHOA 4KUMB 3O1IA 2VKDA 2GRMA 5LBQB 4Z58A 2LSIA 4UVAB 4YFSA 3RYFE 2PG8A 2PUBA 2B5AA 2Y48B 2XAHB 2PJQA 3WI3A 3O4XE 2O38A 2LOSA 3HR0A 2PUGA 3Q2MA 4DO0A 3CQCB 4NUUA 2KINB 3C98B 1ZKEA 3B7HA 4GHJA 2ES0A 4IE0A 2DI4A 4I6RA 4ZS3A 3ZCJA 1RPEL 3FBZA 3OMTA 3ZCIA 1IJ5A 5J2TE 4CXYA 1WIZA 1AU7A 2XAFB 3AB3B 1S94A 1BDHA 3KVAA 4L5GA 3RKOA 1LKXA 4OYKA 5JDMA 2VB6A 5JRCA 2CWOA 3O1HA 3SWHA 1YD8G 4PNIA 5FXZA 2DWKA 5CB4E 2JVLA 1UCUA 4OFZA 4OK0A 1CJGA 2ZM0A 2C0SA 5LP6E 1SA0E 1UX5A 2XIUA 2XAJB 1CQTA 1YKEB 4UVCB 3C64A 2KNDA 3HL6A 2PUFA 3P8CD 2DLRA 3MA9A 3U78A 2LYKA 5HYAA 2IVGA 2LSJA 1IJ6A 2CA5A 3GBFA 3CX7B 2LSKA 4I55E 2XUEA 4OHFA 1WYCA 5JDQA 4X4EA 4UEMA 2HPLA 3WAKA 3FMYA 2X9YA 3I1AA 1YKHB 4PFPA 2KWIB 3E0ZA 3KFWX 3LBXB 2H3RA 2LSGA 5LGUB 2OFYA 4UIGA 2BJCA 2L9QA 3PDYA 4TV8E 3H37A 3ANWA 1UXCA 4UELA 5JH7E 5LGNB 4HTEA 1OXZA 1ZZ8A 1OWAA 2IU7A 2N1GA 2NP9A 4YLHA 2UXXB 4I43B 3MJXA 1HX8A 1ZAYA 4WBNE 3N9MA 2KXPB 2JPFA 1NEQA 3KBUA 3J7Yq 5LG4A 5FY0A 1X79A 2M67A 2X0LB 3F2EA 2CLYC 3NRXA 1IC8A 4YJ3E 5H6QB 3HKCE 2D2SA 1D0XA 4P09A 3L1PA 2X9HA 4O4HE 2WWUA 2X67A 3FXDB 2BZBA 4QHOA 2NW8A 4BA9A 4Z5DA 3ZJ2A 4CI2B 5DJQC 3BK9A 2RA1A 3VHLA 5L3CB 2XAGB 4QXHB 4DNDA 3CECA 2Z6EA 3F57A 2XSDC 4TUYE 5KDMC 2E9XC 3SCFA 4NDWA 3I9YA 3N9PA 4GOUA 5LJNA 2VL8A 3AA0B 4IIJE 2MYSA 3ETVA 1CUNA 2NTYA 2YK0A 4BJNA 3N9LA 1WLXA 2O4AA 1WH6A 3PU8A 1ZZCA 4AKIA 2K48A 1O3XA 3BQLA 3ZEFB 1LCCA 1L1MA 3OQNA 3HI2A 3UUNA 3C4XA 3UTKA 2HH7A 3C50A 1MIVA 2CEAA 3P7IA 4UXNB 3CPZA 3ZC1A 2L8NA 4I4TE 5JVDE 4H9RC 2D0TA 3K3NA 2BDEA 3GWHA 5LNKA 2NTXA 4GK0E 2K24A 1ZZ9A 4TN7B 5J2UE 2JJ9A 1Z0PA 1MMAA 2XQYA 3HZIB 4Z5HA 1QSDA 4CXXA 3DJBA 4FN3A 3GMIA 3KINB 3OYXA 3UFEA 4UV9B 3UUXB 1KK7A 4ADZA 3UUMA 3LBXA 3IVPA 3PTRB 2B1EA 1X2LA 5K98B 3N2OA 2UXNB 5JDHA 3JXBC 5JR9B 3ZHMA 5FY1A 4X1YE 2LHRA 3QWGA 4I6UA 1IAPA 3O9XA 5FP3A 3PE0A 3GA8A 2QGSA 3GN5B 3TKLB 1QP0A 1FEWA 5ETWA 4AKLA 2K5BB 1HG5A 3BDNA 5KMGP 2P9BA 5CA0E 2JRKA 2WAUA 3H5TA 1U4QA 3DNVB 3Q5XA 4H9OC 2LYJA 3LISA 2LM9A 2Q9QD 1JWLA 2L3LA 3VK0A 3LK2B 4YG7B 4I6TA 2E8IA 3HA4A 4O4JE 4YBAA 2CE7A 1WR6A 4TZ4C 4QXCB 1D0YA 1JFSA 5FNVE 5A1LA 4AI6A 5F3JA 3ETUA 4TV9E 4B6XA 1RZRA 3RRWA 2PUAA 4YG4A 2ACXA 2GRLA 2ICTA 3JC6C 5DABA 2VK9A 3ZYKA 5JDNA 2V7LA 2XCJA 4JEHB 2MBGA 2EF8A 4X1IE 4IA8A 2KZ8A 2PIJA 3RX6A 2Q9QB 3CQXC 3HKDE 4XAXB 4EIWA 3KV9A 4HN9A 3LK3B 3UFDA 2AXVA 4X4BA 4JEUB 3KZ3A 1PRUA 3BD1A 2KMFA 4IGUA 1RZSA 2VKHA 3LK42 2PUEA 2EBYA 3N2KE 1HCIA 3FBLA 3AVSA 5DQWA 4X4DA 4DBQA 3V5SA 2CMRA 4PK5A 4G63A 1BR2A 1DW9A 1X57A 2IC6A 4X4GA 1S7EA 4GYSA 4YG1A 3F31A 4KP3C 5DQVA 5GONE 2SPCA 2DNXA 4HFVA 3OP9A 4MHCA 4ZI3C 3R6NA 1Y64B 4FI5A 3KV5A 1LLIA 4JCYA 3RPUA 3ZKCA 5JR9C 4ASKA 4BJMA 4JLEA 2VWAA 2ICPA 2CWYA 4IDZA 3RYCE 4WBOA 4ZOLE 3UULA 3N9NA 4PAGA 2LE8A 2XHEB 4P0BA 3LFMA 5LCYA 3RYIE 1QQBA 4PK4A 5KX5E 4I50E 5JR9A 4AKGA 1D1CA 2A72A 1ZS4A 1MNDA 4EAHA 3VKHA 2WM9A 3GN5A 1IZNB 4L9IA 1OSLA 5EK3A 4H9PC 4PJMA 2KEIA 1MMDA 2LHNA 4KMCA 4PK6A 4Y42A 3ZMUB 3C51A 4C90A 5E0OA 1HFAA 2BNOA 3E22E 3KJXA 3ZJ1A 3S8QA 3L3PA 3ZYMA 4PFOA 4K0UA 2DHRA 2IUOA 2EHOD 3ONXA 3OYZA 3MK7C 1MNEA 3KV4A 3PU3A 5LHIB 3PURA 1KNZA 2D5UA 4CQIA 2IV1A 4H63H 4WW0A 3UT5E 3FYMA 4A56A 2V7IA 4G2AA 2AW6A 1UXDA 3MLFA 4X4IA 2JMKA 2JQQA 3M65A 2AUWA 3FB2A 2PPXA 1PNRA 3G5GA 2HPJA 2IAKA 3S4UA 2Q9QA 1DWKA 4GK5E 2X9XA 3RC3A 3T8OA 4IWRA 3ZPOA 1O4XA 5ADXL 4PJLA 2LYPA 3RRCA 3ZN1B 1MIWA 2V7MA 2V26A 1G73A 3PXPA 4J1WA 1RIOA 2EHOB 4IHJE 5L3DB 1MMGA 4IE4A 4P0AA 3OJAA 1LVKA 4GYRA 1BR1A 2Y8DA 5EK2A 2ODUA 3AAIA 2LCVA 4PU3C 4DMWA 1AJ3A 4DVDA 2NWBA 5A7LA 2AXZA 1NWMX 1ZZ7A 2W61A 5CA1E 2LYQA 4F6RC 2L8KA 3NBXX 2D0UA 4XZCA 3H3AA 2MQKA 3KV6A 5LA6E 1HS7A 2K9AA 2XAQB 5L3BB 4IE6A 1V9DA 4KBMB 4X4FA 1POUA 2WIUB 1QQAA 2C5KT 5JREA 2A2FX 3NZPA 4QWNB 2DCFA 4ZI2C 3MACA 4JQDA 5FXXA 4IVZA 2LJLA 4CZZB 3IHRA 3RZZA 4HE8A 4YHJA 4MCTA 4UVBB 3Q9DA 1R63A 2AXUA 2A3DA 3AA1B 5JRCB 3DTOA 5L3EB 3QC9A 2YU1A 3BS3A 2CM0A 5HXHA 3VKGA 1PERL 1UX4A 2CXDA 4AQFC 3JXDL 4EZ4A 4QX7B 4PJNA 4UF0B 4O4IE 1R69A 4H9QC 5FY7A 4Z5CA 1HF8A 3CX6B 1ADRA 2KEJA 4HKAA 5EZYE 4AXPA 1YW0A 2EWTA 4AQFA 3I0OA 1G8XA 4TX5A 1SHZC 1WETA 4GQMA 1QP4A 2PE5A 4C91A 2CROA 4OYJA 2WSSV 1BDIA 2HINA 3BQKA 3KBTA 2XTLA 1B0NA 2LOPA 1ZZ6A 3RC8A 4ILUA 3CMLA 3AA6B 5FMNA 5HWYA 1FMVA 2A6CA 3CLCA 4E7ZA 3KXAA 2W63A 4ZI7E 1VRBA 3I0QA 2CXLA 4PU4C 2O49A 4O4LE 4QXBB 5J1GA 3N9QA 2LYLA 3SOLA 2X66A 5F8PA 2MTQA 5FXVA 2YU2A 2PBIA 3CQGB 3TRBA 3N2GE 4H9NC 4ZS2A 3ZMZB 4U72A 5HWXA 2R1JL 2V7KA 3F52A 1MMNA 2H8RA 5LHGB 1LCDA 3CKDA 3B13A 3N5LA 2IVBA 4PW8A 3RH3A 4DBRA 2V7JA 5EK4A 4CI1B 2XI8A 1LRZA 3HKBE 3QK6A 4QKNA 1UTXA 3U3WA 4X4CA 5IHYA 1VOMA 2IVQA 1WH8A 1PRVA 4OB4A 4O8BA 4FBIA 5HAXA 2BVMA 4WNKA 3QUJA 2C5IT 3AAAB 3FHNA 4O8SA 2E9XD 2X9WA 3SCGA 3ESLA 3KVBA 3SCHA 2CLYB 2OA5A 3PUSA 1ZHCA 3SS1A 2VKJA 2R63A 1NAFA 1SQ8A 3QF3A 4ISTA 3F6WA 4IE5A 5JDFA 4ISSA 4EYUA 3MKDA 3O1JA 5JQGE 4JCXA 4EZHA 3KDSE 2CSFA 2W00A 2LYSA 3U3IA 2XJ3A 3RYHE 1QUUA 1YSEA 5FXWA 2OR1L 3LFPA 4J2CA 1OCTC 2LYRA 1VPWA 1ZVVA 2E9XB 1EFAA 4N78D 4UF0A 2NW7A 1ZV4X 1LQCA 3N9OA 2AWIA 2L49A 3W15B 4AKHA 3G7DA 4ZI2D 5L3FB 2BNNA 3NZQA 4H9SE 2IW5B 2LEHA 5LXTE 4O2AE 4MBQA 2X51A 1U5PA 2DWGA 3Q5WA 3JXCL 2XASB 3LJCA 4Z8XA 4E7SA 2ZLYA 2N2NA 3CVRA 4X4HA 2W0GA 3ZYLA 2PUCA 4IE7A 4H63V 3CROL 4U74A 2WUSR 1JH9A 4MALA 1NERA 2ZM8A 1GT0C 2Q9QC 1D0ZA 5HXRA 4YJ2E 4EXTA 3MXZA 2GK9A 4NUVA 3VU7H 3OBVE 1Y9QA 3K3OA 3PUAA 3F51A 4BAYB 1ZUGA 4I8TA 3J9X1 1Y7YA 1RZRD 1FMWA 1PRAA 5HXSA 2Y6XA 3V5UA 4XBFB 4UV8B 4Z59A 3AAEB 3AA7B 3HKEE 1HF0A 2VASA 3K8PC 4M1PA 2WMOA 3MZKB 4MLKA 4DMVA 2RP4A 1QPZA 5LJMA 3CX8B 3EDUA 1XWRA 5LGTB 1MIYA 4F8DA 3FXEB 3ZMTB 4CXWA 2V1DB 4X1KE 2KLQA 3WAJA 2MEZA 3JC6D 2IC9A 4X20E 2KEKA 3C4ZA 3DP7A 5LOVE 5JDLA 5JDGA 3K3QC 2MOZA 2X68A 2D5VA 2CXFA 4HGAA 3B57A 2PFVA 2N9DA 4ANJA 2ZM2A 1E3OC 3IEEA 3C4WA 2J1DG 3AVRA 3D1NI 2W62A 5TAOA 3QQ6A 3ZN0B 2YINA 3ZLIA 1S35A 3I9WA 2G0UA 2KWHA 2YEVC 3E08A 3D0TA 5HXCA 1ZEEA 1LMB3 4MCXA 5L3GB 3PUQA 3FYAA 4AKRB 1HG2A 3OQMA 2NOXA 4MFRA 4FJOA 4GIWA 4AQGA 5FYMA 3PUGA 4EOZB 5LBMA 1US7B 3IBPA 4PJJA 5LYJE 3ZC0A 2PUDA 3ZHIA 2E9XA 1T98A 1E1HB 2LSYA 1D1AA 4YARA 3OQOA 1WRDA 1B7TA 2KT9A 1QP7A 4PU7A 2I59A 2FJRA 2VKOA 2WBLA 3NRYA 5L2LA 2ODVA 4EYYR 4ZI3D 1HTJF 1WYBA 3LG7A 1ZZBA 1D1BA 5C8YE 2CCQA 2C5JA 4O2BE 5M4YA 2HSGA 3IF8B 3ZMVB 2KPJA 4EB6E 3R84B 1FIOA 2H7VC 4CI3B 3SRZA 5HXEA 2JMHA 3BQIA 4ERRA 3L09A 2BNMA 2NW9A 3EVYA 4V1Av 5H6RB 4QX8B 2LT3A 5LHHB 3R1FA 1LVFA 3EUSA 3OKQA 2GZUA 3EDVA 2JCGA 2H7OA 3ZMSB 4L0RA 4PU8A 3CWZB 5AFUL 5BMVE 3QYXA 2EHOC 2KZ7B 2QA7A 1H7CA 1JFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNO A;  3KJX A;  3S8Q A;  4J1X A;  1ZPQ A;  4JCX A;  2IUO A;  2CSF A;  2LYS A;  2XJ3 A;  2L8N A;  1YSE A;  2IV1 A;  2OR1 L;  3LFP A;  3FYM A;  1OCT C;  2GRM A;  2AW6 A;  2LYR A;  1UXD A;  3MLF A;  4Z58 A;  4X4I A;  1VPW A;  1ZZ9 A;  1EFA A;  1ZVV A;  2AUW A;  2PPX A;  1PNR A;  1LQC A;  3G5G A;  2AWI A;  2L49 A;  1DWK A;  3HZI B;  4Z5H A;  2PUB A;  2B5A A;  4IWR A;  1O4X A;  3G7D A;  4FN3 A;  2LYP A;  2BNN A;  2O38 A;  2PUG A;  3PXP A;  4J1W A;  1RIO A;  3IVP A;  3JXC L;  1X2L A;  5K98 B;  3B7H A;  4GHJ A;  4I6R A;  4X4H A;  3JXB C;  1RPE L;  3OMT A;  3ZHM A;  3QWG A;  2LCV A;  4I6U A;  3O9X A;  1WIZ A;  1AU7 A;  2PUC A;  4PU3 C;  1BDH A;  3CRO L;  3GA8 A;  2WUS R;  1JH9 A;  3GN5 B;  5A7L A;  1NER A;  1QP0 A;  2AXZ A;  1GT0 C;  1ZZ7 A;  3BDN A;  2LYQ A;  1L1M A;  3H5T A;  3DNV B;  3HI2 A;  2MQK A;  1Y9Q A;  2LYJ A;  3LIS A;  2JVL A;  1JWL A;  3VK0 A;  3F51 A;  1ZUG A;  4I8T A;  4YG7 B;  1POU A;  1Y7Y A;  2WIU B;  4I6T A;  1PRA A;  4X4F A;  1RZR D;  4YBA A;  1CJG A;  1QQA A;  2XIU A;  4JQD A;  4Z59 A;  4IVZ A;  1CQT A;  1HF0 A;  3RZZ A;  1JFS A;  4MCT A;  1R63 A;  2AXU A;  2PUF A;  1RZR A;  1QPZ A;  2PUA A;  2LYK A;  3BS3 A;  2GRL A;  2ICT A;  1XWR A;  4YG4 A;  1PER L;  4F8D A;  3JXD L;  2IVG A;  2XCJ A;  3GBF A;  1R69 A;  2EF8 A;  2MEZ A;  4IA8 A;  2KZ8 A;  2PIJ A;  4Z5C A;  4X4E A;  2KEK A;  3FMY A;  1ADR A;  2KEJ A;  2EWT A;  2D5V A;  3UFD A;  2AXV A;  4X4B A;  3KZ3 A;  1PRU A;  1E3O C;  3BD1 A;  2OFY A;  2BJC A;  3D1N I;  1WET A;  1RZS A;  3QQ6 A;  4GQM A;  2EBY A;  1QP4 A;  2PE5 A;  2PUE A;  2CRO A;  1UXC A;  1BDI A;  2HIN A;  4X4D A;  1ZZ8 A;  3QYX A;  1B0N A;  4MCX A;  1LMB 3;  1ZZ6 A;  3FYA A;  2IU7 A;  1DW9 A;  3OQM A;  1X57 A;  2A6C A;  4X4G A;  3CLC A;  1S7E A;  3KXA A;  4YG1 A;  1ZAY A;  1NEQ A;  3OP9 A;  3ZHI A;  2PUD A;  4PU4 C;  2O49 A;  1IC8 A;  4YAR A;  3OQO A;  1LLI A;  2LYL A;  3ZKC A;  1QP7 A;  4PU7 A;  3L1P A;  2FJR A;  4JCY A;  2ICP A;  3TRB A;  1ZZB A;  4Z5D A;  3OQN A;  2R1J L;  3F52 A;  2H8R A;  2HSG A;  1LCD A;  2KPJ A;  2IVB A;  1QQB A;  2XI8 A;  2BNM A;  3CEC A;  2XSD C;  1UTX A;  3U3W A;  4X4C A;  3SCF A;  4NDW A;  2IVQ A;  1WH8 A;  1ZS4 A;  1PRV A;  3R1F A;  3EUS A;  3GN5 A;  4OB4 A;  4O8B A;  4FBI A;  1OSL A;  2GZU A;  2JCG A;  2KEI A;  3SCG A;  2O4A A;  3SCH A;  1WH6 A;  4PU8 A;  1ZZC A;  4Y42 A;  2R63 A;  1SQ8 A;  3QF3 A;  3F6W A;  1LCC A;  1JFT A; 
#chains in the Genus database with same CATH topology
 3JAD A;  4YTN A;  2YDQ A;  2BVL A;  3AE4 A;  2ZMA A;  5LG3 A;  1EZ3 A;  4KUM B;  4LF6 T;  3RQU A;  4Z58 A;  3TLW A;  2HN1 A;  2PUB A;  4IDQ A;  2BKO A;  2PJQ A;  2O38 A;  2LOS A;  3TEL A;  3CQC B;  2BS2 A;  3B7H A;  3GZC A;  1WIZ A;  1HX1 B;  3QB5 A;  3RKO A;  1S94 A;  3GZD A;  1LKX A;  4OYK A;  5JDM A;  2VB6 A;  2J47 A;  4PNI A;  5CB4 E;  2VVS A;  1CJG A;  1SA0 E;  2XIU A;  2XAJ B;  4DE8 A;  3SFD A;  4ER7 A;  3P8C D;  3HL6 A;  2PUF A;  3OWQ A;  2M6B A;  2XZE A;  2CA5 A;  3CX7 B;  4I55 E;  2LSK A;  4OHF A;  4UEM A;  3FMY A;  2CBJ A;  1NW3 A;  4K0K T;  1YKH B;  4JYA T;  2LSG A;  3EI0 A;  2OFY A;  3PDY A;  1UXC A;  3JCF A;  4HTE A;  1OWA A;  4LMJ A;  2UXX B;  1ZAY A;  2KXP B;  3KBU A;  2WP9 A;  5DRT A;  4AIS A;  4TWH A;  4EZI A;  4U31 A;  3PE5 A;  1NEN A;  2VQE T;  5DJQ C;  2RA1 A;  2E5V A;  3VHL A;  2XAG B;  3F57 A;  2W4X A;  2XSD C;  3UU6 A;  2NTY A;  1WLX A;  1ZZC A;  4B3M T;  3C4X A;  3C50 A;  2CEA A;  2CRB A;  3RLF F;  5LNK A;  1GQE A;  1KF6 A;  2MAW A;  5J2U E;  2JJ9 A;  1MMA A;  5HEO A;  1N32 T;  2VVN A;  3ZSS A;  4FN3 A;  3KIN B;  3UFE A;  4EED A;  4UV9 B;  2XM2 A;  3QWG A;  4I6U A;  3O9X A;  4LF7 T;  3PE0 A;  3GA8 A;  1X9B A;  3GN5 B;  1QP0 A;  1FEW A;  3AED A;  3BDN A;  5KMG P;  5CA0 E;  3DNV B;  2LM9 A;  2A9U A;  3RKG A;  4YG7 B;  4I6T A;  4O4J E;  3UUB A;  1RZR A;  3ZYK A;  2V7L A;  2KZ8 A;  2XQ7 A;  3LK3 B;  2VL0 A;  4X4B A;  2KMF A;  4IGU A;  2IDO B;  3P4S A;  4X4D A;  1DW9 A;  2IC6 A;  1XZY A;  4WVL A;  4FI5 A;  1LLI A;  3A9Z A;  1SE7 A;  5JR9 C;  4IDZ A;  4WBO A;  3N9N A;  3AE8 A;  4KHP T;  2LE8 A;  4I0U A;  5AQT B;  3UU3 A;  4X5T A;  4EAH A;  5AQO B;  1OSL A;  5EK3 A;  1HNW T;  3ZMU B;  2MPK A;  5ABG A;  1J1J A;  3E22 E;  3KJX A;  3S8Q A;  5L4H A;  3ZYM A;  4K0U A;  2IUO A;  2EHO D;  2VUR A;  3ONX A;  2WU2 A;  3RIA A;  2IV1 A;  4H63 H;  2IHR 1;  4WW0 A;  3FYM A;  2AW6 A;  1UXD A;  3M65 A;  1N34 T;  3FB2 A;  1PNR A;  2HPJ A;  4Q2J A;  4IWR A;  3OPC A;  4Z91 A;  2LYP A;  2NR4 A;  1KNR A;  2V7M A;  5L3D B;  1FJG T;  2CHN A;  1AJ3 A;  2NWB A;  2V6Y A;  1NWM X;  2LYQ A;  2MQK A;  3KV6 A;  4IE6 A;  4X4F A;  2C5K T;  5JRE A;  3NZP A;  3MAC A;  2LJL A;  4HE8 A;  4UVB B;  2AXU A;  3AA1 B;  5L3E B;  2WS3 A;  2CM0 A;  4EEB A;  1IBM T;  4O4I E;  1R69 A;  4H9Q C;  4Z5C A;  1HF8 A;  4A97 A;  2EWT A;  4YT0 A;  3I0O A;  4ER0 A;  5KXJ A;  2D9D A;  4A5X A;  2PE5 A;  4OYJ A;  3KBT A;  2XTL A;  4DR5 T;  3RC8 A;  4ILU A;  3AA6 B;  5HWY A;  4E7Z A;  4YTM A;  2CXL A;  2O49 A;  2LYL A;  4HWI B;  2X66 A;  5FXV A;  4GKK T;  1MMN A;  5LHG B;  3A9Y A;  4EK9 A;  4DBR A;  2V7J A;  4CI1 B;  3HKB E;  3U3W A;  5IHY A;  1VOM A;  1PRV A;  5HAX A;  3FHN A;  2XXQ A;  2VKJ A;  3OVU A;  2R63 A;  3F6W A;  5JDF A;  4YY3 T;  3MKD A;  3O1J A;  5JQG E;  1HR0 T;  4HFC A;  3KDS E;  3RQW A;  3NZL A;  4X65 T;  1ZVV A;  2PXD A;  2M6I A;  2AWI A;  2L49 A;  2WY2 A;  3PJA J;  3G7D A;  4ZI2 D;  4H9S E;  2IW5 B;  4MBQ A;  3JXC L;  3ZYL A;  2FBW A;  3RIU A;  3CRO L;  4MAL A;  1NER A;  2ZM8 A;  1GT0 C;  2LRK A;  5HXR A;  4EXT A;  3MXZ A;  4BAY B;  1DUL A;  2UUA T;  3A7M A;  4MLK A;  1QPZ A;  4F8D A;  4CXW A;  2V1D B;  2QYW A;  2BKP A;  4X1K E;  3IA3 A;  2MEZ A;  3C4Z A;  3AEE A;  3K3Q C;  2MOZ A;  2D5V A;  3B57 A;  4ANJ A;  3IEE A;  2J1D G;  2XQ8 A;  2V3C C;  3FYA A;  1HG2 A;  3OQM A;  4MFR A;  4AQG A;  4LML A;  4EOZ B;  1US7 B;  4IT4 A;  4PJJ A;  3ZHI A;  3X1D A;  4IRE A;  2VKO A;  2IIU A;  4JI6 T;  2ODV A;  4ZI3 D;  4OX9 T;  1HTJ F;  1WYB A;  5AQS B;  2CCQ A;  2C5J A;  5M4Y A;  2HSG A;  3VRB A;  4CI3 B;  3SRZ A;  5HXE A;  3BQI A;  2BNM A;  2NW9 A;  4TNW A;  3R1F A;  5LHH B;  5ABH A;  3EDV A;  2J7W A;  2EHO C;  1KNZ A;  2QA7 A;  3ANW B;  2WMN A;  5IYZ E;  1BR4 A;  4ER5 A;  2PXU A;  3EUH A;  2J62 A;  4UVA B;  2XAH B;  4U33 A;  3WI3 A;  3HR0 A;  4X62 T;  3RF1 A;  4DO0 A;  5IWA T;  3C98 B;  4GHJ A;  4P1N A;  2ES0 A;  4IE0 A;  3FZL B;  4I6R A;  3ZCJ A;  5J2T E;  1RPE L;  3OMT A;  2OLT A;  3AB3 B;  4L5G A;  3KVA A;  4YHH T;  3RGL A;  1QLB A;  3CIR A;  5JRC A;  4JI0 T;  3O1H A;  5DTR A;  3SWH A;  1W9R A;  2OV9 A;  2XXA A;  4OFZ A;  3SX0 A;  3PUV F;  2ZM0 A;  5LP6 E;  1YKE B;  2DLR A;  3MA9 A;  2LYK A;  2ODR D;  5HYA A;  2XUE A;  5JDQ A;  5AQJ B;  1XNQ T;  3WAK A;  1ZP0 A;  1NEK A;  2X9Y A;  4PFP A;  2KWI B;  3PUX F;  3LBX B;  4ZZC A;  2H3R A;  5LGU B;  4CN4 A;  2L9Q A;  5AQV B;  4UEL A;  4DR1 T;  2M4H A;  2XQA A;  1OXZ A;  2IU7 A;  4HWF A;  2FJE A;  4YLH A;  4I43 B;  3MJX A;  2LLV A;  4QH1 A;  4WBN E;  4YTP A;  5LG4 A;  2M67 A;  2W66 A;  5H6Q B;  2D2S A;  1N33 T;  2J7U A;  2NW8 A;  4BA9 A;  4Z5D A;  2YN6 A;  4U2Z A;  3ZJ2 A;  1T8B A;  4QXH B;  4DND A;  2Z6E A;  5KDM C;  4IDP A;  3SCF A;  4NDW A;  3N9P A;  3SR4 A;  3AA0 B;  2YK0 A;  2O4A A;  3PU8 A;  3BQL A;  4YSY A;  2IML A;  3LDQ B;  3QOW A;  2L8N A;  3GWH A;  4HFH A;  1ZZ9 A;  1Z0P A;  4Z5H A;  4IL9 A;  1QSD A;  3DJB A;  4KI0 F;  3UUM A;  5ABE A;  4GKJ T;  3IVP A;  3PTR B;  2B1E A;  5K98 B;  2LRL A;  2UXN B;  5JDH A;  2LHR A;  2L1P A;  1IAP A;  3QOF A;  2WDV A;  3TKL B;  4AKL A;  2K5B B;  2JRK A;  3H5T A;  3Q5X A;  2LYJ A;  3TLT A;  5HEG A;  3LK2 B;  2CE7 A;  4QXC B;  4YG4 A;  2GRL A;  4YSZ A;  1YQ4 A;  5AQF B;  2PXK A;  2W67 A;  4DR3 T;  4IA8 A;  5GAG i;  2Q9Q B;  4XAX B;  3UFD A;  2AXV A;  2BG9 A;  2YKS A;  4JEU B;  3LK4 2;  2PUE A;  2EBY A;  3ZKR A;  3FBL A;  5DQW A;  4JBW F;  1BR2 A;  2DL1 A;  4CN1 A;  4X4G A;  4ILB A;  5DQV A;  3R6N A;  3OP9 A;  4ZI3 C;  3KV5 A;  2I0M A;  1XWM A;  2VWA A;  3RYC E;  3UUL A;  4TWF A;  4P0B A;  4PK4 A;  5KX5 E;  2PXF A;  5JR9 A;  2WM9 A;  4L9I A;  4DR7 T;  4PJM A;  2YDS A;  2LHN A;  3C51 A;  2YBD A;  4Q25 A;  5E0O A;  2BNO A;  4OBM A;  2WDQ A;  3L3P A;  2HCN A;  4PFO A;  2BKN A;  2DHR A;  5LHI B;  3OYZ A;  1MNE A;  3KV4 A;  3PUR A;  2D5U A;  4CQI A;  4A56 A;  4G2A A;  1KEY A;  4JI2 T;  2AUW A;  2IAK A;  3RC3 A;  3UU4 A;  3ZN1 B;  2V26 A;  4WYV A;  1G73 A;  4IHJ E;  3AEG A;  1W09 A;  3P50 A;  3P4P A;  4NPP A;  1BR1 A;  3AAI A;  1CHU A;  4PU3 C;  4DMW A;  4DVD A;  5A7L A;  3AXJ B;  1ZZ7 A;  2W61 A;  5CA1 E;  4ILA A;  3NBX X;  5LA6 E;  1WR0 A;  3UWP A;  2K9A A;  1POU A;  1QQA A;  2A2F X;  4QWN B;  3LSV A;  4IVZ A;  3IHR A;  3RZZ A;  4DR2 T;  4YHJ A;  4MCT A;  5JRC B;  1SUM B;  2YU1 A;  4AQF C;  4EZ4 A;  1OED A;  3CX6 B;  2JQH A;  1J5W A;  4AXP A;  1SHZ C;  4GQM A;  1QP4 A;  1M62 A;  4DV0 T;  2CRO A;  5AQH B;  5CFB A;  1ZZ6 A;  5DRY A;  2A6C A;  3CLC A;  2W63 A;  4ZI7 E;  1VRB A;  2BG9 C;  2XXP A;  4PU4 C;  5J1G A;  3N9Q A;  4NIQ A;  2I6H A;  2PBI A;  3TRB A;  4H9N C;  4U2Y A;  2V7K A;  3F52 A;  2H8R A;  1LCD A;  3B13 A;  3N5L A;  2IVB A;  5EK4 A;  4X4C A;  4O8B A;  2C5I T;  2E9X D;  2X9W A;  3SCG A;  3KVB A;  2OA5 A;  5ABF A;  1ZHC A;  3TFL A;  3EHZ A;  2MXD A;  4LF8 T;  4ISS A;  4JCX A;  2LYS A;  2XJ3 A;  5FXW A;  2BS3 A;  3QNU A;  4HWH A;  4N78 D;  4UF0 A;  1ZV4 X;  1ZOY A;  4HFE A;  5FL0 A;  4AKH A;  4DV7 T;  2BNN A;  5LXT E;  2WQY A;  1UGO A;  3L39 A;  1U5P A;  2DWG A;  2XAS B;  1HNZ T;  4Z8X A;  2R6G F;  2ZLY A;  3CVR A;  2UUC T;  4DV2 T;  4IE7 A;  2FJA A;  1JH9 A;  5AQN B;  1I94 T;  2QRX A;  1Y01 A;  3K3O A;  3J9X 1;  1PRA A;  4XBF B;  4UV8 B;  4Z59 A;  3AAE B;  3AA7 B;  3K8P C;  4M1P A;  2JIW A;  2RP4 A;  5LJM A;  2WZH A;  5LGT B;  3FXE B;  4ER3 A;  2F4V T;  2UXC T;  5LOV E;  2BBH A;  4HGA A;  2PFV A;  2N9D A;  1VCT A;  3QQ6 A;  4KHZ F;  5HEU A;  4TWD A;  3E08 A;  3D0T A;  1OED C;  2E2A A;  1ZEE A;  5L3G B;  4AKR B;  2NOX A;  4GIW A;  2PUD A;  4U7Y A;  2E9X A;  1T98 A;  1D1A A;  1WRD A;  2FJR A;  2WBL A;  5L2L A;  3LG7 A;  5JTG A;  3IF8 B;  2JQK A;  5HEH A;  3ONJ A;  4QX8 B;  3EUS A;  4DV1 T;  2JCG A;  3PUZ F;  3ZMS B;  3JAE A;  2J4G A;  4L0R A;  5BMV E;  3QYX A;  2KZ7 B;  4MHC A;  4U7I A;  4J1X A;  2PXB A;  4LMK A;  4JUY A;  1BR0 A;  4HEA A;  4ZHQ E;  2UXD T;  2EHO A;  2KSR A;  3O1I A;  4YFS A;  5AQM B;  2PG8 A;  2B5A A;  2Y48 B;  3VRA A;  2H89 A;  3Q2M A;  3AE3 A;  4NUU A;  3ZCI A;  2LLY A;  2JQ9 A;  3QOX A;  1AU7 A;  1BDH A;  3OKZ A;  3AE1 A;  1YD8 G;  2DWK A;  4DE9 A;  2HFZ A;  5HEJ A;  4LF5 T;  4B3S T;  2LKH A;  4UVC B;  3RHW A;  3U78 A;  4B3R T;  3TEP A;  2IVG A;  1IJ6 A;  1WYC A;  1YQ3 A;  5LB7 B;  4F8H A;  3I1A A;  3QFI A;  1JNR A;  3A9X A;  4UIG A;  3H37 A;  1WCR A;  3VR9 A;  5LGN B;  2N1G A;  2PXE A;  3AE7 A;  3N9M A;  3J7Y q;  1NEQ A;  2YDR A;  1X79 A;  5FY0 A;  2X0L B;  3F2E A;  2CLY C;  1IC8 A;  1D0X A;  4P09 A;  2X9H A;  4O4H E;  3TLV A;  2WWU A;  1UUS A;  2X67 A;  2BZB A;  4CI2 B;  3BK9 A;  3CEC A;  2E9X C;  2AE9 A;  3I9Y A;  4EGW A;  4IIJ E;  3ETV A;  2ACZ A;  4BJN A;  3AEB A;  3N9L A;  2PXT A;  1WH6 A;  5AQQ B;  2K48 A;  3ZEF B;  3UUN A;  3T1Y T;  1MIV A;  3P7I A;  4UXN B;  3CPZ A;  3ZC1 A;  5DTQ A;  5ABF B;  2NTX A;  4GK0 E;  2K24 A;  3B5M A;  2PXQ A;  2XQY A;  3HZI B;  4TNV A;  4CXX A;  3GMI A;  3UUX B;  5FKY A;  1KK7 A;  3LQX A;  3AE2 A;  3N2O A;  3ZHM A;  3OTO T;  4X1Y E;  5FP3 A;  2QGS A;  1HG5 A;  2XQ5 A;  2WAU A;  4ILC A;  3FZF B;  3LIS A;  1JWL A;  2L3L A;  3VK0 A;  5AQG B;  2E8I A;  3HA4 A;  4YBA A;  2WCA A;  5GAH i;  3UQ4 A;  5FNV E;  1JFS A;  5A1L A;  4DV6 T;  4AI6 A;  3NWI A;  4DV3 T;  2PUA A;  2ICT A;  5DAB A;  2XQ9 A;  4JEH B;  3VWS A;  2EF8 A;  2MBG A;  4X1I E;  4LFA T;  5FL1 A;  3KV9 A;  4HWD A;  5AQL B;  1PRU A;  3BD1 A;  1RZS A;  2VKH A;  3AEF A;  4JI3 T;  1HCI A;  4DBQ A;  1J5E T;  2V6Y B;  4EV6 A;  2AXD S;  1R8I A;  4DV4 T;  4GYS A;  5GON E;  4YG1 A;  2WU5 A;  2DNX A;  4HFV A;  4ASK A;  2ICP A;  4ZOL E;  4PAG A;  3RI5 A;  5LCY A;  1QQB A;  3AEC A;  4AKG A;  1D1C A;  2XSA A;  1MND A;  3GN5 A;  1IZN B;  4DID B;  4H9P C;  1KNP A;  2KEI A;  2UU9 T;  5LMU T;  4PK6 A;  4Y42 A;  5HCM A;  4C90 A;  3DM5 A;  3P4R A;  1HFA A;  3NRO A;  2CBI A;  2RPA A;  3UT5 E;  2V7I A;  3MLF A;  4X4I A;  2JMK A;  2PPX A;  3G5G A;  3T8O A;  1DWK A;  4GK5 E;  2X9X A;  5ADX L;  3ZPO A;  4PJL A;  1MIW A;  4J1W A;  2EHO B;  4P0A A;  1LVK A;  2XSB A;  5BR8 T;  5JUW A;  3ZPX A;  2AXZ A;  2IUB A;  2L8K A;  2V5D A;  4HRA A;  5AQR B;  2XAQ B;  5L3B B;  4KBM B;  4ZI2 C;  3UQ7 A;  4JQD A;  4DUY T;  1R63 A;  2A3D A;  1PER L;  4X66 T;  3JXD L;  2LM2 A;  3UFG A;  1ADR A;  4HKA A;  1YW0 A;  3T1H T;  4AQF A;  2BG9 E;  1KFY A;  4ZZB A;  1BDI A;  2HIN A;  3BQK A;  2LOP A;  3CML A;  1FMV A;  2WZI A;  5CGM A;  3KXA A;  4O4L E;  2WB5 A;  2MTQ A;  4U72 A;  2V5C A;  3CKD A;  3EAM A;  2WWV A;  4PW8 A;  1LRZ A;  4QKN A;  3Q5D A;  1WH8 A;  1XMO T;  4O8S A;  3ESL A;  2PTF A;  3GUU A;  3SS1 A;  4IST A;  3PUY F;  2XJ7 A;  2W00 A;  3U3I A;  1QUU A;  1YSE A;  2OR1 L;  3LFP A;  4J2C A;  2LYR A;  4IDO A;  1EFA A;  3Q5E A;  2NW7 A;  1LQC A;  5L3F B;  4X64 T;  4O2A E;  3Q5W A;  3LJC A;  2N2N A;  2W0G A;  2PUC A;  5AQP B;  4U74 A;  2WUS R;  4YXD A;  4NUV A;  2LLW A;  3MEJ A;  3OBV E;  2FJD A;  2VQF T;  3PUA A;  1ZUG A;  1Y7Y A;  1RZR D;  1FMW A;  3RIF A;  5HXS A;  2Y6X A;  3HKE E;  1HF0 A;  3ABV A;  3CX8 B;  1XWR A;  1MIY A;  3ZMT B;  3M3Z B;  1OED E;  2KLQ A;  3WAJ A;  3FZK B;  3JC6 D;  4X20 E;  2KEK A;  4JI4 T;  4DR4 T;  5JDL A;  2X68 A;  1E3O C;  3AVR A;  5TAO A;  3ZLI A;  2YIN A;  1S35 A;  4ER6 A;  2FUP A;  3I9W A;  2YEV C;  4MCX A;  3PUQ A;  2HCS A;  5FVK A;  4FJO A;  3AE9 A;  5LBM A;  3UU8 A;  5LYJ E;  4AIU A;  1UK5 A;  2LSY A;  4YAR A;  2KT9 A;  3NRY A;  1D1B A;  3PUW F;  2JQE A;  4O2B E;  1HQ1 A;  3ZT5 A;  2KPJ A;  4EB6 E;  3R84 B;  1FIO A;  1UUR A;  3L09 A;  3EVY A;  5L47 A;  5H6R B;  2CHO A;  2V8S V;  2E5L T;  4Z90 A;  2XY8 B;  3JAF A;  4PU8 A;  5DSX A;  1H7C A;  1JFT A;  1ZPQ A;  4ZEY A;  3NXH A;  3A5X A;  4EQZ A;  1HNX T;  2VKD A;  2GRM A;  5LBQ B;  3SFE A;  2LSI A;  3RYF E;  1U2Z A;  3GZD C;  3O4X E;  4KX6 A;  3ZST A;  2PUG A;  1T72 A;  2KIN B;  1ZKE A;  2DI4 A;  4ZS3 A;  3FBZ A;  3ZT6 A;  1IJ5 A;  4CXY A;  1MFQ C;  2XAF B;  1QB2 A;  3ONL C;  1W0A A;  2CWO A;  5F5W A;  5FXZ A;  2JVL A;  1UCU A;  4OK0 A;  2C0S A;  1UX5 A;  1CQT A;  3C64 A;  2KND A;  3PJA A;  2LSJ A;  3GBF A;  4X4E A;  2HPL A;  4WZX A;  5HCJ A;  5DT2 A;  3E0Z A;  3KFW X;  3NKZ A;  3NDB B;  2V6X A;  2X0H A;  2BJC A;  2PXV A;  1JNZ A;  4TV8 E;  3ANW A;  4NXM T;  5DTM A;  5JH7 E;  1ZZ8 A;  1IBK T;  2NP9 A;  2PXL A;  1HX8 A;  5CJ5 A;  4IL4 A;  2JPF A;  1E2A A;  4YJ3 E;  3NRX A;  5C2T A;  3HKC E;  1W0B A;  3L1P A;  3FZH B;  1T7S A;  2HN2 A;  4QHO A;  3FXD B;  4CN6 A;  5L3C B;  1XNR T;  5IUX A;  4TUY E;  4AQY T;  2BS4 A;  4GOU A;  5LJN A;  2XQ3 A;  2VL8 A;  2MYS A;  1CUN A;  2B76 A;  2BG9 B;  4AKI A;  1O3X A;  1L1M A;  3OQN A;  3HI2 A;  4LF9 T;  3UTK A;  2HH7 A;  4DR6 T;  2LKG A;  4I4T E;  5JVD E;  4H9R C;  2D0T A;  3K3N A;  2BDE A;  4IDN A;  4TN7 B;  1XDO A;  3OYX A;  4ADZ A;  3LBX A;  1X2L A;  4JI7 T;  4NXN T;  3JXB C;  5JR9 B;  4DV5 T;  5FY1 A;  5ETW A;  2P9B A;  1U4Q A;  3UU5 A;  4H9O C;  2Q9Q D;  3VR8 A;  3FZM B;  1WR6 A;  4TZ4 C;  1D0Y A;  2XM1 A;  5F3J A;  3R09 A;  3ETU A;  4TV9 E;  4B6X A;  2X0Y A;  2ACX A;  3RRW A;  5JDN A;  3JC6 C;  2VK9 A;  2XCJ A;  3ZT7 A;  2PIJ A;  3RX6 A;  2W2U A;  3CQX C;  3HKD E;  4EIW A;  4HN9 A;  3KZ3 A;  3P4W A;  3N2K E;  3AVS A;  3AE6 A;  2YOE A;  2CMR A;  3V5S A;  4PK5 A;  4G63 A;  1X57 A;  4A98 A;  3CK6 A;  1S7E A;  4KP3 C;  3F31 A;  3ME5 A;  2SPC A;  1Y64 B;  3RPU A;  4JCY A;  3ZKC A;  4BJM A;  4JLE A;  3AE5 A;  2CWY A;  3G06 A;  2XHE B;  3LFM A;  3RYI E;  1OED B;  4I50 E;  2FFH A;  2A72 A;  1ZS4 A;  3VKH A;  3NVO A;  1MMD A;  4KMC A;  4UR9 A;  4LF4 T;  5L4E A;  3ZJ1 A;  3PU3 A;  3MK7 C;  2FJB A;  2JQQ A;  3S4U A;  2Q9Q A;  1O4X A;  3RRC A;  4EKI A;  3PXP A;  1RIO A;  1MMG A;  4IE4 A;  2XPK A;  3OJA A;  4GYR A;  2Y8D A;  5EK2 A;  1E7P A;  2ODU A;  3H3M A;  2LCV A;  4JI1 T;  2K3W A;  4F6R C;  2PXP A;  2D0U A;  1N36 T;  4XZC A;  3H3A A;  1HS7 A;  2XQ6 A;  4B3T T;  1V9D A;  2WIU B;  2DCF A;  5FXX A;  4CZZ B;  5FVL A;  3Q9D A;  4QH4 A;  3DTO A;  3BS3 A;  5AQI B;  5HXH A;  3VKG A;  1UX4 A;  3K1S A;  2CXD A;  4QX7 B;  4PJN A;  4UF0 B;  5FY7 A;  2WDR A;  1QZX A;  2KEJ A;  5EZY E;  3QB5 K;  1G8X A;  4TX5 A;  1WET A;  3KL4 A;  4C91 A;  2WSS V;  5LMN T;  1B0N A;  1YXR A;  5FMN A;  4JI5 T;  1XMQ T;  3I0Q A;  4QXB B;  5C3J A;  3SOL A;  5F8P A;  2YU2 A;  3CQG B;  3N2G E;  3G0T A;  4ZS2 A;  3ZMZ B;  4LFC T;  5HWX A;  2R1J L;  2CPT A;  1I6Z A;  3RH3 A;  4HWC A;  2XI8 A;  2H88 A;  3QK6 A;  1UTX A;  5J0Z A;  2IVQ A;  4OB4 A;  4FBI A;  2BVM A;  3AXJ A;  1IBL T;  4WNK A;  3QUJ A;  3AAA B;  3SCH A;  2CLY B;  3PUS A;  1SQ8 A;  3QF3 A;  1NAF A;  4IE5 A;  4EYU A;  3M9L A;  4EZH A;  5AQK B;  2CSF A;  3A8Y C;  3RYH E;  4EKG A;  1DU2 A;  1OCT C;  3TLU A;  2QVA A;  1VPW A;  2E9X B;  1M7K A;  2VEO A;  2ZM6 T;  3N9O A;  3W15 B;  4LFB T;  3RIU C;  3NZQ A;  2LEH A;  4JV5 T;  2X51 A;  4DUZ T;  4E7S A;  4X4H A;  4H63 V;  4HFI A;  2Q9Q C;  1D0Z A;  4YJ2 E;  2GK9 A;  3VU7 H;  1Y9Q A;  3F51 A;  4I8T A;  3V5U A;  1VCS A;  2VAS A;  2WMO A;  4U3C A;  2XQ4 A;  3MZK B;  4DMV A;  3EDU A;  5AQU B;  2BBJ A;  3AEA A;  1XDP A;  4HFD A;  4ZXL A;  2IC9 A;  3DP7 A;  5JDG A;  1WFD A;  2CXF A;  3TLS A;  3L8R A;  2HHH T;  2ZM2 A;  3C4W A;  3D1N I;  2W62 A;  3ZN0 B;  5HXC A;  2G0U A;  2KWH A;  1LMB 3;  5FYM A;  3PUG A;  3IBP A;  1L0V A;  3ZC0 A;  1E1H B;  1Z8U A;  3OQO A;  1B7T A;  1QP7 A;  4PU7 A;  2I59 A;  4HFB A;  4EYY R;  4JI8 T;  3EAB A;  1ZZB A;  5C8Y E;  3ZMV B;  2H7V C;  2LNM A;  2JMH A;  4ERR A;  4QH5 A;  4V1A v;  4YSX A;  2UUB T;  2LT3 A;  1LVF A;  3P4Q A;  3OKQ A;  2GZU A;  2UXB T;  2H7O A;  3PV0 F;  3CWZ B;  5AFU L;  4COF A;  3QC9 A;  1LCC A; 
#chains in the Genus database with same CATH homology
 3ANW B;  2WMN A;  4J1X A;  5IYZ E;  4JUY A;  1ZPQ A;  1BR0 A;  4HEA A;  4ZHQ E;  2BVL A;  1BR4 A;  3A5X A;  2ZMA A;  1EZ3 A;  3EUH A;  2EHO A;  4KUM B;  3O1I A;  2VKD A;  2GRM A;  5LBQ B;  4Z58 A;  2LSI A;  4UVA B;  4YFS A;  3RYF E;  2PG8 A;  2PUB A;  2B5A A;  2Y48 B;  2XAH B;  2PJQ A;  3WI3 A;  3O4X E;  2O38 A;  2LOS A;  3HR0 A;  2PUG A;  3Q2M A;  4DO0 A;  3CQC B;  4NUU A;  2KIN B;  3C98 B;  1ZKE A;  3B7H A;  4GHJ A;  2ES0 A;  4IE0 A;  2DI4 A;  4I6R A;  4ZS3 A;  3ZCJ A;  1RPE L;  3FBZ A;  3OMT A;  3ZCI A;  1IJ5 A;  5J2T E;  4CXY A;  1WIZ A;  1AU7 A;  2XAF B;  3AB3 B;  1S94 A;  1BDH A;  3KVA A;  4L5G A;  3RKO A;  1LKX A;  4OYK A;  5JDM A;  2VB6 A;  5JRC A;  2CWO A;  3O1H A;  3SWH A;  1YD8 G;  4PNI A;  5FXZ A;  2DWK A;  5CB4 E;  2JVL A;  1UCU A;  4OFZ A;  4OK0 A;  1CJG A;  2ZM0 A;  2C0S A;  5LP6 E;  1SA0 E;  1UX5 A;  2XIU A;  2XAJ B;  1CQT A;  1YKE B;  4UVC B;  3C64 A;  2KND A;  3HL6 A;  2PUF A;  3P8C D;  2DLR A;  3MA9 A;  3U78 A;  2LYK A;  5HYA A;  2IVG A;  2LSJ A;  1IJ6 A;  2CA5 A;  3GBF A;  3CX7 B;  2LSK A;  4I55 E;  2XUE A;  4OHF A;  1WYC A;  5JDQ A;  4X4E A;  4UEM A;  2HPL A;  3WAK A;  3FMY A;  2X9Y A;  3I1A A;  1YKH B;  4PFP A;  2KWI B;  3E0Z A;  3KFW X;  3LBX B;  2H3R A;  2LSG A;  5LGU B;  2OFY A;  4UIG A;  2BJC A;  2L9Q A;  3PDY A;  4TV8 E;  3H37 A;  3ANW A;  1UXC A;  4UEL A;  5JH7 E;  5LGN B;  4HTE A;  1OXZ A;  1ZZ8 A;  1OWA A;  2IU7 A;  2N1G A;  2NP9 A;  4YLH A;  2UXX B;  4I43 B;  3MJX A;  1HX8 A;  1ZAY A;  4WBN E;  3N9M A;  2KXP B;  2JPF A;  1NEQ A;  3KBU A;  3J7Y q;  5LG4 A;  5FY0 A;  1X79 A;  2M67 A;  2X0L B;  3F2E A;  2CLY C;  3NRX A;  1IC8 A;  4YJ3 E;  5H6Q B;  3HKC E;  2D2S A;  1D0X A;  4P09 A;  3L1P A;  2X9H A;  4O4H E;  2WWU A;  2X67 A;  3FXD B;  2BZB A;  4QHO A;  2NW8 A;  4BA9 A;  4Z5D A;  3ZJ2 A;  4CI2 B;  5DJQ C;  3BK9 A;  2RA1 A;  3VHL A;  5L3C B;  2XAG B;  4QXH B;  4DND A;  3CEC A;  2Z6E A;  3F57 A;  2XSD C;  4TUY E;  5KDM C;  2E9X C;  3SCF A;  4NDW A;  3I9Y A;  3N9P A;  4GOU A;  5LJN A;  2VL8 A;  3AA0 B;  4IIJ E;  2MYS A;  3ETV A;  1CUN A;  2NTY A;  2YK0 A;  4BJN A;  3N9L A;  1WLX A;  2O4A A;  1WH6 A;  3PU8 A;  1ZZC A;  4AKI A;  2K48 A;  1O3X A;  3BQL A;  3ZEF B;  1LCC A;  1L1M A;  3OQN A;  3HI2 A;  3UUN A;  3C4X A;  3UTK A;  2HH7 A;  3C50 A;  1MIV A;  2CEA A;  3P7I A;  4UXN B;  3CPZ A;  3ZC1 A;  2L8N A;  4I4T E;  5JVD E;  4H9R C;  2D0T A;  3K3N A;  2BDE A;  3GWH A;  5LNK A;  2NTX A;  4GK0 E;  2K24 A;  1ZZ9 A;  4TN7 B;  5J2U E;  2JJ9 A;  1Z0P A;  1MMA A;  2XQY A;  3HZI B;  4Z5H A;  1QSD A;  4CXX A;  3DJB A;  4FN3 A;  3GMI A;  3KIN B;  3OYX A;  3UFE A;  4UV9 B;  3UUX B;  1KK7 A;  4ADZ A;  3UUM A;  3LBX A;  3IVP A;  3PTR B;  2B1E A;  1X2L A;  5K98 B;  3N2O A;  2UXN B;  5JDH A;  3JXB C;  5JR9 B;  3ZHM A;  5FY1 A;  4X1Y E;  2LHR A;  3QWG A;  4I6U A;  1IAP A;  3O9X A;  5FP3 A;  3PE0 A;  3GA8 A;  2QGS A;  3GN5 B;  3TKL B;  1QP0 A;  1FEW A;  5ETW A;  4AKL A;  2K5B B;  1HG5 A;  3BDN A;  5KMG P;  2P9B A;  5CA0 E;  2JRK A;  2WAU A;  3H5T A;  1U4Q A;  3DNV B;  3Q5X A;  4H9O C;  2LYJ A;  3LIS A;  2LM9 A;  2Q9Q D;  1JWL A;  2L3L A;  3VK0 A;  3LK2 B;  4YG7 B;  4I6T A;  2E8I A;  3HA4 A;  4O4J E;  4YBA A;  2CE7 A;  1WR6 A;  4TZ4 C;  4QXC B;  1D0Y A;  1JFS A;  5FNV E;  5A1L A;  4AI6 A;  5F3J A;  3ETU A;  4TV9 E;  4B6X A;  1RZR A;  3RRW A;  2PUA A;  4YG4 A;  2ACX A;  2GRL A;  2ICT A;  3JC6 C;  5DAB A;  2VK9 A;  3ZYK A;  5JDN A;  2V7L A;  2XCJ A;  4JEH B;  2MBG A;  2EF8 A;  4X1I E;  4IA8 A;  2KZ8 A;  2PIJ A;  3RX6 A;  2Q9Q B;  3CQX C;  3HKD E;  4XAX B;  4EIW A;  3KV9 A;  4HN9 A;  3LK3 B;  3UFD A;  2AXV A;  4X4B A;  4JEU B;  3KZ3 A;  1PRU A;  3BD1 A;  2KMF A;  4IGU A;  1RZS A;  2VKH A;  3LK4 2;  2PUE A;  2EBY A;  3N2K E;  1HCI A;  3FBL A;  3AVS A;  5DQW A;  4X4D A;  4DBQ A;  3V5S A;  2CMR A;  4PK5 A;  4G63 A;  1BR2 A;  1DW9 A;  1X57 A;  2IC6 A;  4X4G A;  1S7E A;  4GYS A;  4YG1 A;  3F31 A;  4KP3 C;  5DQV A;  5GON E;  2SPC A;  2DNX A;  4HFV A;  3OP9 A;  4MHC A;  4ZI3 C;  3R6N A;  1Y64 B;  4FI5 A;  3KV5 A;  1LLI A;  4JCY A;  3RPU A;  3ZKC A;  5JR9 C;  4ASK A;  4BJM A;  4JLE A;  2VWA A;  2ICP A;  2CWY A;  4IDZ A;  3RYC E;  4WBO A;  4ZOL E;  3UUL A;  3N9N A;  4PAG A;  2LE8 A;  2XHE B;  4P0B A;  3LFM A;  5LCY A;  3RYI E;  1QQB A;  4PK4 A;  5KX5 E;  4I50 E;  5JR9 A;  4AKG A;  1D1C A;  2A72 A;  1ZS4 A;  1MND A;  4EAH A;  3VKH A;  2WM9 A;  3GN5 A;  1IZN B;  4L9I A;  1OSL A;  5EK3 A;  4H9P C;  4PJM A;  2KEI A;  1MMD A;  2LHN A;  4KMC A;  4PK6 A;  4Y42 A;  3ZMU B;  3C51 A;  4C90 A;  5E0O A;  1HFA A;  2BNO A;  3E22 E;  3KJX A;  3ZJ1 A;  3S8Q A;  3L3P A;  3ZYM A;  4PFO A;  4K0U A;  2DHR A;  2IUO A;  2EHO D;  3ONX A;  3OYZ A;  3MK7 C;  1MNE A;  3KV4 A;  3PU3 A;  5LHI B;  3PUR A;  1KNZ A;  2D5U A;  4CQI A;  2IV1 A;  4H63 H;  4WW0 A;  3UT5 E;  3FYM A;  4A56 A;  2V7I A;  4G2A A;  2AW6 A;  1UXD A;  3MLF A;  4X4I A;  2JMK A;  2JQQ A;  3M65 A;  2AUW A;  3FB2 A;  2PPX A;  1PNR A;  3G5G A;  2HPJ A;  2IAK A;  3S4U A;  2Q9Q A;  1DWK A;  4GK5 E;  2X9X A;  3RC3 A;  3T8O A;  4IWR A;  3ZPO A;  1O4X A;  5ADX L;  4PJL A;  2LYP A;  3RRC A;  3ZN1 B;  1MIW A;  2V7M A;  2V26 A;  1G73 A;  3PXP A;  4J1W A;  1RIO A;  2EHO B;  4IHJ E;  5L3D B;  1MMG A;  4IE4 A;  4P0A A;  3OJA A;  1LVK A;  4GYR A;  1BR1 A;  2Y8D A;  5EK2 A;  2ODU A;  3AAI A;  2LCV A;  4PU3 C;  4DMW A;  1AJ3 A;  4DVD A;  2NWB A;  5A7L A;  2AXZ A;  1NWM X;  1ZZ7 A;  2W61 A;  5CA1 E;  2LYQ A;  4F6R C;  2L8K A;  3NBX X;  2D0U A;  4XZC A;  3H3A A;  2MQK A;  3KV6 A;  5LA6 E;  1HS7 A;  2K9A A;  2XAQ B;  5L3B B;  4IE6 A;  1V9D A;  4KBM B;  4X4F A;  1POU A;  2WIU B;  1QQA A;  2C5K T;  5JRE A;  2A2F X;  3NZP A;  4QWN B;  2DCF A;  4ZI2 C;  3MAC A;  4JQD A;  5FXX A;  4IVZ A;  2LJL A;  4CZZ B;  3IHR A;  3RZZ A;  4HE8 A;  4YHJ A;  4MCT A;  4UVB B;  3Q9D A;  1R63 A;  2AXU A;  2A3D A;  3AA1 B;  5JRC B;  3DTO A;  5L3E B;  3QC9 A;  2YU1 A;  3BS3 A;  2CM0 A;  5HXH A;  3VKG A;  1PER L;  1UX4 A;  2CXD A;  4AQF C;  3JXD L;  4EZ4 A;  4QX7 B;  4PJN A;  4UF0 B;  4O4I E;  1R69 A;  4H9Q C;  5FY7 A;  4Z5C A;  1HF8 A;  3CX6 B;  1ADR A;  2KEJ A;  4HKA A;  5EZY E;  4AXP A;  1YW0 A;  2EWT A;  4AQF A;  3I0O A;  1G8X A;  4TX5 A;  1SHZ C;  1WET A;  4GQM A;  1QP4 A;  2PE5 A;  4C91 A;  2CRO A;  4OYJ A;  2WSS V;  1BDI A;  2HIN A;  3BQK A;  3KBT A;  2XTL A;  1B0N A;  2LOP A;  1ZZ6 A;  3RC8 A;  4ILU A;  3CML A;  3AA6 B;  5FMN A;  5HWY A;  1FMV A;  2A6C A;  3CLC A;  4E7Z A;  3KXA A;  2W63 A;  4ZI7 E;  1VRB A;  3I0Q A;  2CXL A;  4PU4 C;  2O49 A;  4O4L E;  4QXB B;  5J1G A;  3N9Q A;  2LYL A;  3SOL A;  2X66 A;  5F8P A;  2MTQ A;  5FXV A;  2YU2 A;  2PBI A;  3CQG B;  3TRB A;  3N2G E;  4H9N C;  4ZS2 A;  3ZMZ B;  4U72 A;  5HWX A;  2R1J L;  2V7K A;  3F52 A;  1MMN A;  2H8R A;  5LHG B;  1LCD A;  3CKD A;  3B13 A;  3N5L A;  2IVB A;  4PW8 A;  3RH3 A;  4DBR A;  2V7J A;  5EK4 A;  4CI1 B;  2XI8 A;  1LRZ A;  3HKB E;  3QK6 A;  4QKN A;  1UTX A;  3U3W A;  4X4C A;  5IHY A;  1VOM A;  2IVQ A;  1WH8 A;  1PRV A;  4OB4 A;  4O8B A;  4FBI A;  5HAX A;  2BVM A;  4WNK A;  3QUJ A;  2C5I T;  3AAA B;  3FHN A;  4O8S A;  2E9X D;  2X9W A;  3SCG A;  3ESL A;  3KVB A;  3SCH A;  2CLY B;  2OA5 A;  3PUS A;  1ZHC A;  3SS1 A;  2VKJ A;  2R63 A;  1NAF A;  1SQ8 A;  3QF3 A;  4IST A;  3F6W A;  4IE5 A;  5JDF A;  4ISS A;  4EYU A;  3MKD A;  3O1J A;  5JQG E;  4JCX A;  4EZH A;  3KDS E;  2CSF A;  2W00 A;  2LYS A;  3U3I A;  2XJ3 A;  3RYH E;  1QUU A;  1YSE A;  5FXW A;  2OR1 L;  3LFP A;  4J2C A;  1OCT C;  2LYR A;  1VPW A;  1ZVV A;  2E9X B;  1EFA A;  4N78 D;  4UF0 A;  2NW7 A;  1ZV4 X;  1LQC A;  3N9O A;  2AWI A;  2L49 A;  3W15 B;  4AKH A;  3G7D A;  4ZI2 D;  5L3F B;  2BNN A;  3NZQ A;  4H9S E;  2IW5 B;  2LEH A;  5LXT E;  4O2A E;  4MBQ A;  2X51 A;  1U5P A;  2DWG A;  3Q5W A;  3JXC L;  2XAS B;  3LJC A;  4Z8X A;  4E7S A;  2ZLY A;  2N2N A;  3CVR A;  4X4H A;  2W0G A;  3ZYL A;  2PUC A;  4IE7 A;  4H63 V;  3CRO L;  4U74 A;  2WUS R;  1JH9 A;  4MAL A;  1NER A;  2ZM8 A;  1GT0 C;  2Q9Q C;  1D0Z A;  5HXR A;  4YJ2 E;  4EXT A;  3MXZ A;  2GK9 A;  4NUV A;  3VU7 H;  3OBV E;  1Y9Q A;  3K3O A;  3PUA A;  3F51 A;  4BAY B;  1ZUG A;  4I8T A;  3J9X 1;  1Y7Y A;  1RZR D;  1FMW A;  1PRA A;  5HXS A;  2Y6X A;  3V5U A;  4XBF B;  4UV8 B;  4Z59 A;  3AAE B;  3AA7 B;  3HKE E;  1HF0 A;  2VAS A;  3K8P C;  4M1P A;  2WMO A;  3MZK B;  4MLK A;  4DMV A;  2RP4 A;  1QPZ A;  5LJM A;  3CX8 B;  3EDU A;  1XWR A;  5LGT B;  1MIY A;  4F8D A;  3FXE B;  3ZMT B;  4CXW A;  2V1D B;  4X1K E;  2KLQ A;  3WAJ A;  2MEZ A;  3JC6 D;  2IC9 A;  4X20 E;  2KEK A;  3C4Z A;  3DP7 A;  5LOV E;  5JDL A;  5JDG A;  3K3Q C;  2MOZ A;  2X68 A;  2D5V A;  2CXF A;  4HGA A;  3B57 A;  2PFV A;  2N9D A;  4ANJ A;  2ZM2 A;  1E3O C;  3IEE A;  3C4W A;  2J1D G;  3AVR A;  3D1N I;  2W62 A;  5TAO A;  3QQ6 A;  3ZN0 B;  2YIN A;  3ZLI A;  1S35 A;  3I9W A;  2G0U A;  2KWH A;  2YEV C;  3E08 A;  3D0T A;  5HXC A;  1ZEE A;  1LMB 3;  4MCX A;  5L3G B;  3PUQ A;  3FYA A;  4AKR B;  1HG2 A;  3OQM A;  2NOX A;  4MFR A;  4FJO A;  4GIW A;  4AQG A;  5FYM A;  3PUG A;  4EOZ B;  5LBM A;  1US7 B;  3IBP A;  4PJJ A;  5LYJ E;  3ZC0 A;  2PUD A;  3ZHI A;  2E9X A;  1T98 A;  1E1H B;  2LSY A;  1D1A A;  4YAR A;  3OQO A;  1WRD A;  1B7T A;  2KT9 A;  1QP7 A;  4PU7 A;  2I59 A;  2FJR A;  2VKO A;  2WBL A;  3NRY A;  5L2L A;  2ODV A;  4EYY R;  4ZI3 D;  1HTJ F;  1WYB A;  3LG7 A;  1ZZB A;  1D1B A;  5C8Y E;  2CCQ A;  2C5J A;  4O2B E;  5M4Y A;  2HSG A;  3IF8 B;  3ZMV B;  2KPJ A;  4EB6 E;  3R84 B;  1FIO A;  2H7V C;  4CI3 B;  3SRZ A;  5HXE A;  2JMH A;  3BQI A;  4ERR A;  3L09 A;  2BNM A;  2NW9 A;  3EVY A;  4V1A v;  5H6R B;  4QX8 B;  2LT3 A;  5LHH B;  3R1F A;  1LVF A;  3EUS A;  3OKQ A;  2GZU A;  3EDV A;  2JCG A;  2H7O A;  3ZMS B;  4L0R A;  4PU8 A;  3CWZ B;  5AFU L;  5BMV E;  3QYX A;  2EHO C;  2KZ7 B;  2QA7 A;  1H7C A;  1JFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...