3GN5A

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5A02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5A01
2O4AA 1EFAA 4GQMA 3ZHIA 2KEKA 3EUSA 3S8QA 1WIZA 1OSLA 1X57A 2AXZA 1B0NA 2PUEA 4X4HA 1QQBA 2XIUA 4MCXA 3IVPA 2OFYA 2IVGA 1R69A 3GA8A 3OMTA 3JXCL 1GT0C 1ZUGA 2LYRA 3MLFA 3ZKCA 4Z58A 1ZZ6A 2BNNA 2BNMA 4I6TA 3F6WA 2IUOA 2A6CA 1R63A 2L8NA 1QQAA 1ZZCA 2CROA 2ICTA 2PUGA 4X4GA 2PUAA 2O49A 2AXUA 4Z5CA 3FYMA 3U3WA 4YG4A 2OR1L 4JCYA 2MEZA 3QQ6A 1RPEL 3PXPA 2AUWA 3KXAA 1WETA 3F52A 3G5GA 4I6RA 1AU7A 2AXVA 1NEQA 4J1WA 1Y7YA 1ZZBA 3HZIB 1CJGA 4O8BA 4Z5DA 3F51A 1JFSA 2LYKA 1S7EA 2R1JL 3QWGA 3BD1A 4JCXA 1ZPQA 2BNOA 3FMYA 2IVQA 2LYSA 1UXCA 1ZZ8A 3L1PA 1ZAYA 1LCDA 2H8RA 1UTXA 4PU3C 3GN5B 1ZS4A 1QP4A 3LFPA 3QF3A 1PRAA 1ZVVA 2L49A 3VK0A 3G7DA 4PU4C 4YARA 4Z5HA 4OB4A 4X4BA 1LQCA 1LCCA 5A7LA 3O9XA 1SQ8A 2PPXA 1PRVA 4JQDA 1QP0A 2KEIA 4IWRA 3TRBA 2GRLA 2HSGA 4J1XA 2KZ8A 3GBFA 2EWTA 3R1FA 2GRMA 3SCGA 1LMB3 1XWRA 2HINA 1RZSA 3CROL 3RZZA 2PE5A 2KPJA 1ADRA 4X4DA 1E3OC 3JXBC 4F8DA 1O4XA 1POUA 1BDIA 4IVZA 1ZZ9A 3GN5A 3H5TA 4IA8A 3B7HA 1UXDA 4X4IA 1QPZA 2IU7A 4PU8A 3JXDL 1RZRD 2IV1A 2O38A 2XCJA 2MQKA 3KZ3A 4PU7A 4GHJA 3QYXA 3UFDA 1ZZ7A 2KEJA 2LYJA 3ZHMA 2IVBA 2PUBA 4MCTA 3SCFA 2JCGA 1WH8A 1YSEA 2R63A 1BDHA 4YG1A 3FYAA 4X4FA 2B5AA 1LLIA 1DW9A 3D1NI 1IC8A 1PNRA 1Y9QA 3LISA 3KJXA 1JFTA 1JWLA 2GZUA 2XSDC 3DNVB 2BJCA 2PUDA 3OQOA 2PUFA 1OCTC 3OP9A 1JH9A 2EBYA 4FBIA 3BDNA 3CLCA 1WH6A 4YBAA 1HF0A 1L1MA 2EF8A 2LYQA 3CECA 3OQMA 2AWIA 1NERA 3OQNA 1RIOA 1QP7A 2LCVA 2LYPA 2PIJA 4I6UA 1DWKA 1VPWA 2AW6A 1CQTA 4Z59A 4Y42A 3SCHA 3BS3A 4YG7B 4X4CA 4X4EA 2CSFA 4FN3A 1PERL 3HI2A 2LYLA 1PRUA 4NDWA 2D5VA 2WIUB 2XJ3A 1RZRA 2WUSR 2JVLA 2ICPA 4I8TA 1X2LA 2XI8A 5K98B 2FJRA 2PUCA
chains in the Genus database with same CATH superfamily
1LKXA 3NZPA 1MMDA 2VKDA 1HCIA 5LG4A 3AECA 2IVGA 3AAEB 3TLVA 3B57A 3OJAA 4X4GA 5JR9A 4YG4A 2E5VA 3PXPA 3AE9A 4U2ZA 4U72A 3RPUA 3ZYLA 3PU8A 2BNOA 2BG9B 1LCDA 2BDEA 1YKEB 2XQ7A 5L47A 2CLYC 1SA0E 4PK4A 3RYCE 2LLWA 4IHJE 5LP6E 1PRVA 3ONJA 2D5UA 2H3RA 4IWRA 2YU2A 1SHZC 4JI7T 2X68A 4ASKA 2XAGB 3QOXA 3QFIA 3ANWB 3CQGB 3L39A 1WRDA 3HKCE 3UTKA 2JJ9A 3SX0A 1MNEA 3UU5A 2CXLA 3KZ3A 2WWUA 3FZFB 4GK5E 2A9UA 3QYXA 3AA6B 2MPKA 1IJ5A 2PUBA 3SRZA 3VHLA 2JCGA 4I55E 2LSIA 4WBOA 1Y9QA 2PXUA 2CE7A 4ER7A 3FXEB 5FL1A 4IE5A 2BZBA 4NXMT 1JNRA 4U33A 2PXTA 1HX1B 2WU5A 2XPKA 1FMVA 2E9XD 3AB3B 2EHOC 2PG8A 2V5DA 3KINB 3A9YA 4BA9A 4MHCA 4ZI2C 2WS3A 4QX7B 3L09A 5K98B 1RZSA 3BQLA 3ZHIA 3ZPOA 2JQ9A 3CPZA 3TLWA 2JQKA 2OFYA 2VL0A 2XZEA 5AQRB 1GT0C 3MJXA 3ZKCA 4AKGA 2BNNA 3AEFA 2BG9E 2IUOA 2CROA 1WYBA 3UQ7A 2XQ9A 2EHOA 2YDSA 4X1YE 2QGSA 1MMGA 2IC9A 2FUPA 2EHOB 2JPFA 3P4QA 1ZZBA 3ONLC 2XAJB 3B5MA 3JC6C 4TV9E 5CB4E 4CN1A 3L1PA 3OYXA 3GN5B 5ABEA 3CK6A 5HWYA 3KL4A 1CUNA 2PXEA 3OTOT 5LGUB 2C0SA 2KEIA 1ZKEA 1W0BA 3VR9A 1IAPA 3R6NA 3P4WA 3ZMSB 4BJMA 3IF8B 1OXZA 5EZYE 4X4DA 2LEHA 3I1AA 1LRZA 1O4XA 2N9DA 4JYAT 2CHNA 3CIRA 4X4IA 1D1AA 3UUBA 1S94A 2CWYA 4B6XA 3RIUA 1HNWT 4CZZB 3H37A 4PJLA 5HEJA 3UQ4A 2Q9QB 2IMLA 1LLIA 3OPCA 4KX6A 4KHPT 2XQAA 2GZUA 1GQEA 3VWSA 1SE7A 4ANJA 3P4PA 5JRCA 4FBIA 4X64T 2G0UA 1QP7A 2Q9QD 5TAOA 1PERL 1WLXA 4FN3A 2NW8A 1VCTA 5IYZE 2VVSA 3N9NA 4IIJE 3G0TA 4MALA 2FJDA 2XI8A 5FL0A 4CXYA 5LG3A 2CHOA 2KMFA 4DMWA 5AQGB 3MA9A 1ZUGA 4DBRA 2CLYB 3HR0A 4EZ4A 2SPCA 4PNIA 4B3MT 3FYMA 3UUMA 1WETA 4CXXA 2MTQA 4EKIA 2KNDA 1UXCA 1IJ6A 4XAXB 4AQYT 3PJAA 4HFDA 2X9HA 3DTOA 3T1YT 4QH1A 3IA3A 1QSDA 4DO0A 2AXDS 4GKKT 5DTQA 4UVCB 3R1FA 2CA5A 2ES0A 4LMJA 3C4ZA 4LMLA 3C51A 1US7B 4ER3A 1UURA 2LOPA 2V6YB 3NBXX 2XTLA 2CMRA 2XSBA 3P8CD 4PU7A 4ZXLA 2KEJA 4UF0B 1IBKT 3FZHB 5AQKB 1YW0A 4GKJT 4IDQA 1VOMA 1VCSA 4A98A 1JWLA 2ZM6T 2F4VT 3A9ZA 5JDFA 1XMOT 3VKGA 2WQYA 1WH6A 3CECA 3PE0A 3ONXA 2CPTA 3N9QA 2CSFA 3NVOA 2LYLA 4DV6T 3D0TA 2XQ8A 5C2TA 3FXDB 2MXDA 2AXZA 3JAEA 3ZT6A 4GYRA 3GWHA 3IVPA 4O4LE 4AISA 3JXCL 4JEHB 3MLFA 4O8SA 1FIOA 3AXJA 2BVMA 3GZCA 2ZM0A 4ZI2D 1R8IA 3ZEFB 4EAHA 2D0TA 2UUCT 3UUNA 1ZHCA 4O4IE 4J1WA 1MMAA 4HWCA 1JFSA 2ZM2A 2HHHT 3FMYA 4PJJA 3UFGA 3RI5A 4CXWA 2HN1A 2BG9A 3AE2A 3ZYMA 2PFVA 2DL1A 5JDMA 3G7DA 4OB4A 5FXZA 1CHUA 3EABA 2GRLA 4QH4A 3ZCIA 3SCGA 2XJ7A 2V7JA 3LK2B 1E1HB 2X51A 1ADRA 5FYMA 4DIDB 3P7IA 2W0GA 5LBQB 4NXNT 3OKQA 3RC3A 3JXDL 2XXAA 4UIGA 4TV8E 3AEEA 3KV6A 4GHJA 3UFDA 3N2OA 4YHHT 2LYJA 2V3CC 4MCTA 3SCFA 3RYIE 4YJ2E 1UUSA 3TEPA 1QLBA 2Y8DA 3GMIA 5CJ5A 2BS4A 2A3DA 1XNRT 4QXHB 3LG7A 2I59A 3EDVA 5FY1A 3H3MA 3JC6D 1Z0PA 2XQ6A 1EFAA 4PJMA 3AE4A 4X5TA 2CEAA 4MFRA 1X57A 2UU9T 2LT3A 1B0NA 1BR0A 2W2UA 5L3GB 3CMLA 2BKOA 4JI2T 2A72A 3DP7A 4ZI3D 5A1LA 3M3ZB 3LK3B 4TZ4C 5AQVB 3NXHA 3QQ6A 2V5CA 2Q9QA 3N9LA 2AXVA 3PUGA 4PJNA 4ZEYA 1ZPQA 2WWVA 2PXQA 3PUSA 2H7VC 2X0LB 3AVSA 3ZCJA 2KINB 1H7CA 2KXPB 3JAFA 2HH7A 4AKLA 5A7LA 2H88A 1QP0A 1T98A 4DV1T 1FEWA 3NROA 2LLVA 2Q9QC 2XQ4A 3F31A 5LYJE 3R09A 4DV5T 4JV5T 2IAKA 1HS7A 1BDIA 1T72A 1XMQT 2IHR1 5LGNB 4ZS3A 1OEDB 2PXVA 2YKSA 5FXWA 5LJNA 2MBGA 2IVBA 2LLYA 4HFVA 1WH8A 5ABGA 3KV9A 3LK42 4AKIA 3Q5EA 3BQKA 2PUDA 1E2AA 3AA7B 1OCTC 4ISTA 3UU3A 3TFLA 2AWIA 3FBZA 1HG5A 4K0KT 3ESLA 1DWKA 2K3WA 5DSXA 3AEBA 4X65T 2L8KA 2V1DB 4QXBB 2CM0A 2L3LA 4WNKA 2IW5B 2E5LT 4FI5A 2LOSA 4P0AA 5DQVA 1FMWA 3A7MA 4DNDA 4DE8A 4LFCT 1QQBA 1MIWA 3C98B 1R69A 2WBLA 2NW9A 5JVDE 1Y64B 3RLFF 2UXDT 2LKHA 2OR1L 3AE5A 4AQFC 3KXAA 1N32T 4XBFB 4OHFA 2HN2A 3K3OA 4P09A 5FP3A 3L3PA 4WZXA 3BD1A 2QYWA 5HEGA 5JREA 3VRBA 3LFPA 4WYVA 4QH5A 4TWHA 3BQIA 2L9QA 3UUXB 4X1KE 3QK6A 3CVRA 3AA0B 4N78D 3L8RA 4AQFA 4ER6A 2WDVA 2FFHA 2GRMA 2LE8A 3K8PC 2YEVC 1HNZT 1E3OC 4LF4T 5LB7B 2NOXA 1POUA 2WZHA 3F57A 1OEDA 3N9OA 1QPZA 4PU8A 5ADXL 3VU7H 5FMNA 3RQUA 3TLTA 1KK7A 1YSEA 4O4HE 1DW9A 2VKOA 4EOZB 3ZC1A 3N9MA 4JI6T 3R84B 4O4JE 1KNPA 3RRCA 1HF0A 3B13A 1OEDC 2XM2A 2M6IA 2E8IA 3ZC0A 3RIUC 2KSRA 3ZSTA 2VURA 4TX5A 1N36T 2WIUB 4ILUA 3RYFE 4OK0A 2LRKA 2KLQA 5GONE 4TUYE 3EUSA 3S8QA 1VRBA 2HCNA 4JLEA 4H9SE 1IBMT 3ME5A 3PUXF 2WCAA 2XQ5A 1Z8UA 4PK5A 1QQAA 2ACZA 1MIYA 3M65A 3AEDA 4V1Av 3I9YA 3OWQA 1BR4A 2XSAA 2DLRA 3AE6A 5BMVE 3KBUA 2I6HA 2IVQA 5JDNA 3LQXA 2X66A 3FB2A 5AFUL 3CX8B 1PRAA 4F8HA 4YARA 3PDYA 4P0BA 5HCJA 3U78A 1SQ8A 1BR1A 5FXXA 3PE5A 3P4SA 5FXVA 3UU6A 4GYSA 1LMB3 3RC8A 5DRYA 4NPPA 2PE5A 1D0XA 4PAGA 3C50A 3H5TA 2RPAA 1OEDE 1UXDA 3RRWA 3KVAA 2IU7A 4IT4A 2LHRA 4IL4A 2LM9A 3S4UA 4IDZA 4ZZCA 3G06A 5CA1E 3DJBA 5JDLA 3ETVA 2VK9A 1IC8A 3TELA 2PXPA 2BBHA 4LF8T 5GAHi 5LGTB 4IE0A 1JH9A 4CI1B 2M4HA 2ZMAA 4WBNE 4U74A 3UWPA 4XZCA 1YQ3A 3O1IA 3FBLA 2C5JA 1NWMX 2XJ3A 2WUSR 3KDSE 3CKDA 4ER0A 4U2YA 2FJRA 2WM9A 5L3FB 3EDUA 1HNXT 4ILAA 3U3IA 1X79A 2XM1A 3ETUA 2L8NA 2YINA 2ACXA 3EI0A 4DR1T 2MEZA 3QC9A 3N5LA 5F8PA 3O1HA 3HZIB 2E2AA 3RKOA 3AE7A 1ZZ8A 4DV3T 1G73A 4IE6A 2YK0A 2NTXA 4HFEA 3SWHA 4X4BA 3ANWA 3PUWF 4AQGA 4HFHA 2BBJA 3PUQA 1QZXA 3KVBA 3N2GE 1AJ3A 4HWIB 2XAFB 4DR3T 2ODRD 2V26A 1G8XA 1W9RA 1MNDA 5CFBA 3RQWA 4IA8A 3PTRB 3AVRA 5F5WA 3V5UA 4K0UA 3ZPXA 5DT2A 3ZMUB 3ZHMA 5JRCB 2K5BB 2V7LA 1BDHA 2B76A 4ZI7E 4YY3T 2NTYA 4ZS2A 3AA1B 4CN6A 4QHOA 1U2ZA 2DNXA 4YHJA 3ZKRA 2AE9A 2EF8A 3NZLA 2EHOD 2Z6EA 2BKPA 4LMKA 5FVKA 1W09A 3P50A 2PXLA 2VB6A 2W00A 1CQTA 3ZJ2A 3HKEE 2IUBA 5LMNT 2JVLA 3OYZA 2LJLA 3UT5E 4KI0F 4DMVA 4E7SA 1WIZA 3TLUA 2PUEA 5KDMC 3RHWA 3GA8A 5J0ZA 3F6WA 2XXQA 2C5IT 4KMCA 5KX5E 3ZN0B 3V5SA 2CRBA 3BK9A 4JI3T 4EYUA 1CJGA 1M7KA 3PU3A 5HCMA 1WYCA 2W63A 2Y6XA 4NUVA 2GK9A 4U7IA 2WAUA 5HEOA 1L0VA 2WU2A 4TWFA 2L49A 4Z5HA 5HAXA 3ABVA 1LCCA 3H3AA 5C8YE 2HSGA 2XQYA 5AQTB 2KZ8A 1YD8G 3KFWX 5M4YA 4EV6A 1O3XA 2KZ7B 4KUMB 3PURA 3AEAA 2PXFA 1ZZ7A 4YT0A 3AAIA 1UCUA 5HYAA 4X4FA 3RYHE 2H7OA 5AQFB 2BVLA 2K24A 4ZI3C 5ABHA 4DV2T 3LISA 4KBMB 4AKRB 3QOFA 2EBYA 3T1HT 3CLCA 2H89A 2WY2A 4P1NA 3Q2MA 1M62A 2LYPA 2L1PA 2LSGA 4Y42A 4YG7B 2MYSA 3OBVE 2FJAA 1MFQC 2WMNA 5ABFB 4B3TT 4JI5T 1KF6A 2D2SA 5AQLB 2LM2A 1OSLA 5BR8T 5L3EB 4GOUA 1RPEL 4JI1T 2UUAT 3P4RA 2XY8B 1NEQA 1Y7YA 1NENA 3FZLB 3AXJB 5LA6E 3J9X1 4C91A 5LHHB 2H8RA 1YKHB 2N2NA 1UTXA 4PU3C 4YSXA 2UXBT 3K3NA 3QNUA 4AI6A 3Q9DA 2A2FX 2Y48B 1HF8A 4H9NC 3PUAA 3SR4A 3TRBA 2J7UA 3C4XA 3RH3A 1U4QA 5E0OA 2HINA 5J2TE 2JIWA 5AQOB 5AQHB 5H6QB 2QRXA 4IVZA 1ZZ9A 5EK4A 4UXNB 4ZZBA 4UVBB 3E22E 2BKNA 2XXPA 2XCJA 2LSJA 4UV9B 2N1GA 3FZMB 4ADZA 4GIWA 3NDBB 3LBXB 2V8SV 3E0ZA 4YG1A 2IIUA 3PUVF 3FYAA 5L2LA 4DR5T 3QB5K 4ZOLE 5J2UE 4QXCB 3EVYA 2HPLA 5LNKA 2PUFA 5LOVE 4X1IE 3X1DA 3MEJA 2PIJA 3N9PA 4Z59A 3RKGA 3BS3A 4DV4T 4X4CA 3ZMVB 1XWMA 2NWBA 1RZRA 4KHZF 4NIQA 1X2LA 3TKLB 4YXDA 1XNQT 4X66T 5F3JA 4X4HA 2J47A 2XIUA 4MCXA 1HQ1A 2YDRA 2UXNB 4EEBA 4H63V 2QVAA 4YJ3E 4I6TA 1R63A 2V6XA 2PUGA 4HE8A 4HFBA 4JCYA 3J7Yq 2DI4A 2DCFA 3I0OA 4O2AE 3FHNA 5EK2A 3LDQB 4DVDA 4UV8B 2CBIA 2J7WA 3QF3A 1ZEEA 2WMOA 3VK0A 4IDPA 1LQCA 3SFEA 5JR9C 4IGUA 3MZKB 4HWFA 5FKYA 2YBDA 4YSZA 5HXRA 2W67A 3MKDA 1ZV4X 4Q25A 3AE8A 2VL8A 3SS1A 2WDRA 4DUZT 2KPJA 2LSYA 4QWNB 4BJNA 5JH7E 3I9WA 5H6RB 3GN5A 2CWOA 3ZYKA 2VQET 2O38A 4IL9A 5L4EA 1UX4A 2P9BA 3KV4A 1WR6A 3WAJA 1W0AA 1X9BA 1LVKA 2PBIA 3HL6A 3HKDE 2RA1A 4H9PC 4ISSA 2NP9A 5CA0E 5L3BB 1N33T 4I0UA 3D1NI 3RIAA 3MACA 2KT9A 2XSDC 1ZP0A 2UXCT 4COFA 2JMHA 4PK6A 3OQNA 4PFPA 1FJGT 5CGMA 2I0MA 3SFDA 5FNVE 3SCHA 4H9OC 1PRUA 2IC6A 2WB5A 2OA5A 1I94T 4YSYA 2XAHB 3Q5WA 4DR2T 5FVLA 1UX5A 2JRKA 5AQIB 4X62T 2M6BA 2BNMA 4HWHA 3A8YC 4LFBT 1HG2A 2AXUA 3LJCA 4Z5CA 4DR4T 2AUWA 3KBTA 3AE3A 2LYKA 4F6RC 3QWGA 4YFSA 5LCYA 1V9DA 2HPJA 3ZT7A 4J2CA 3RGLA 4A97A 3ZSSA 3W15B 5ABFA 3GBFA 2E9XA 2EWTA 3CX6B 4IE4A 4HN9A 3CROL 4X20E 1D0YA 4F8DA 5GAGi 5DRTA 3GZDA 5HXHA 4HEAA 5EK3A 1RZRD 3NKZA 3UFEA 5LJMA 3CQCB 5HEHA 3A9XA 4EKGA 4ERRA 4LF7T 4ZHQE 1OWAA 4EGWA 2BJCA 1BR2A 3OP9A 1QB2A 3GZDC 4UR9A 1J5WA 2X0HA 1LVFA 4A56A 4DE9A 2LCVA 1VPWA 1J5ET 1KEYA 2OLTA 1NEKA 3ZT5A 4CI3B 1QUUA 1MIVA 4UF0A 4ER5A 2KEKA 5LMUT 4AIUA 2C5KT 2NR4A 4OYKA 4MLKA 3JCFA 2QA7A 4IREA 2LYRA 2CCQA 4YTPA 2O49A 3O4XE 2DWKA 3F52A 3LBXA 2HFZA 1KFYA 2V7KA 1S7EA 2R1JL 2YU1A 2XQ3A 4CQIA 1U5PA 3UU4A 3Q5XA 2X9XA 4UVAB 2JQQA 4JI0T 4I43B 3OKZA 1ZVVA 4HFCA 4PU4C 2W61A 4A5XA 4YLHA 2M67A 3K3QC 3Q5DA 4EEDA 3CWZB 1IZNB 3O9XA 1B7TA 2E9XB 3PV0F 5AQMB 5JR9B 2YN6A 2W4XA 2V7MA 4EZHA 2PTFA 1HX8A 4WVLA 4L9IA 3MK7C 3VKHA 5JDGA 4Z8XA 1UK5A 2XAQB 1WFDA 3UULA 4O2BE 4U3CA 4HWDA 3WAKA 4YTMA 1JNZA 4ILBA 2CXFA 2YOEA 1XZYA 4PW8A 2X67A 4Q2JA 5AQQB 3KJXA 4EZIA 3NRXA 1ZOYA 5AQNB 4YBAA 4TNVA 2LSKA 3OQMA 1D1CA 1UGOA 1XDPA 4C90A 3EUHA 5DTRA 3HI2A 4IDOA 3ZMTB 5LBMA 5JQGE 3M9LA 4EIWA 1XDOA 1T7SA 3OVUA 4GQMA 2B1EA 3AAAB 2VEOA 2X0YA 2DWGA 5AQUB 2HCSA 2K9AA 1SUMB 3OMTA 3LFMA 4B3RT 1ZZ6A 5LHGB 1EZ3A 1ZZCA 2X9WA 1KNRA 2OV9A 1KNZA 4HRAA 2LKGA 4L0RA 4JUYA 3F51A 3WI3A 5HXCA 3O1JA 3ZN1B 2R6GF 4U7YA 2FJEA 3AEGA 1ZS4A 2VWAA 4Z90A 4DR6T 4JQDA 1YQ4A 3HKBE 4BAYB 4I4TE 3N2KE 4HKAA 3RZZA 3RIFA 4H63H 4M1PA 4DUYT 4AXPA 4OBMA 2IV1A 1DU2A 2FBWA 4QX8B 2VVNA 4DV7T 1N34T 2R63A 2CBJA 2J1DG 4CN4A 3ZLIA 1PNRA 5HXEA 1MMNA 4EK9A 4EB6E 2UXXB 1T8BA 4B3ST 1L1MA 2LYQA 4H9RC 1RIOA 2ODUA 4I6UA 4TWDA 4JBWF 2AW6A 5L3CB 1Y01A 4NUUA 2K48A 2D5VA 4JI8T 4IE7A 1NAFA 5KMGP 3TLSA 3PUZF 2ICPA 4KP3C 4Z91A 2PUCA 2O4AA 2PXKA 1D0ZA 2RP4A 4WW0A 4HFIA 1I6ZA 2VQFT 3EHZA 3QUJA 4ILCA 5JDQA 3RF1A 2PXDA 4Z58A 4U31A 5JDHA 2PUAA 2KWHA 3G5GA 3ZMZB 4E7ZA 3A5XA 4O8BA 4Z5DA 4LF5T 4OX9T 4CI2B 2CXDA 2X9YA 2LYSA 2IDOB 3UU8A 5LXTE 2DHRA 2PPXA 5HXSA 5L3DB 4TNWA 2MAWA 2LHNA 4LFAT 2WZIA 3IEEA 3VR8A 3QOWA 4YTNA 1HFAA 5DJQC 3JXBC 1S35A 2PXBA 5DTMA 5J1GA 2LRLA 4UEMA 2MQKA 2PJQA 4HTEA 4DBQA 3IBPA 1HR0T 2YDQA 5IUXA 2B5AA 5AQSB 3SOLA 2BS2A 2UUBT 2ZM8A 3DNVB 3JADA 4L5GA 5L4HA 2VKJA 3BDNA 5AQPB 2LNMA 3I0QA 1D1BA 1J1JA 2V6YA 4IDNA 3F2EA 4HGAA 2KWIB 2VASA 3C4WA 3FZKB 4I50E 4NDWA 5KXJA 3PJAJ 4UELA 5JTGA 5IHYA 2J62A 4I8TA 3C64A 4OFZA 1WCRA 4LF6T 5ETWA 4G2AA 1IBLT 1DULA 2BG9C 4QKNA 3NWIA 5FY7A 5HEUA 2A6CA 2ICTA 3ZJ1A 5JUWA 3U3WA 3E08A 4I6RA 1HTJF 5AQJB 1AU7A 2D0UA 3PUYF 3KV5A 4JI4T 2D9DA 4JCXA 4EXTA 1ZAYA 2JQEA 4G63A 1QP4A 3CQXC 2W66A 4JEUB 4EYYR 5FY0A 4LF9T 5HWXA 2FJBA 4J1XA 5DQWA 3K1SA 2ZLYA 1XWRA 2XUEA 3IHRA 2MOZA 2JQHA 3B7HA 2WP9A 3VRAA 1E7PA 2J4GA 1NW3A 2XASB 4TN7B 4OYJA 4PFOA 2BS3A 4AKHA 3MXZA 2E9XC 3CX7B 2JMKA 4MBQA 1JFTA 2ODVA 3T8OA 4EQZA 5C3JA 3OQOA 2VKHA 3LSVA 5IWAT 4GK0E 2XHEB 3HA4A 4FJOA 2WDQA 1NERA 3AE1A 3NRYA 5DABA 2V7IA 4DR7T 3QB5A 2NW7A 5LHIB 1WR0A 3NZQA 2WSSV 4X4EA 1YXRA 3GUUA 4H9QC 4DV0T 3EAMA 3RX6A 2W62A 3DM5A
chains in the Genus database with same CATH topology
1LKXA 1EFAA 2KEKA 3NZPA 4PJMA 2CEAA 4E7SA 4MFRA 1WIZA 1MMDA 1X57A 2VKDA 2LT3A 1B0NA 2PUEA 1HCIA 5KDMC 5LG4A 1BR0A 2C5KT 5L3GB 3CMLA 4OYKA 4MLKA 3GA8A 2IVGA 2A72A 2QA7A 3DP7A 3AAEB 2LYRA 3B57A 3OJAA 2CCQA 3F6WA 2C5IT 4KMCA 4ZI3D 4X4GA 5KX5E 2O49A 5A1LA 3ZN0B 3O4XE 3LK3B 5JR9A 3V5SA 4TZ4C 4YG4A 2DWKA 3QQ6A 3BK9A 3PXPA 3F52A 2Q9QA 3LBXA 3N9LA 4U72A 2AXVA 4EYUA 1CJGA 3RPUA 3ZYLA 2V7KA 3PU3A 3PUGA 3PU8A 1S7EA 2R1JL 2YU1A 4PJNA 1WYCA 4CQIA 1U5PA 2W63A 1ZPQA 2BNOA 2Y6XA 4NUVA 3PUSA 2H7VC 1LCDA 3Q5XA 2X0LB 2GK9A 2X9XA 3AVSA 2BDEA 1YKEB 3ZCJA 2KINB 4UVAB 2JQQA 1H7CA 2KXPB 2WAUA 4I43B 1ZVVA 2L49A 2CLYC 4PU4C 4Z5HA 1SA0E 2W61A 2HH7A 4YLHA 2M67A 4PK4A 3K3QC 4AKLA 5HAXA 3CWZB 1LCCA 5A7LA 1IZNB 3O9XA 3H3AA 3RYCE 1B7TA 2E9XB 4IHJE 5LP6E 1PRVA 1QP0A 1T98A 2D5UA 5C8YE 2H3RA 4IWRA 1FEWA 2YU2A 2HSGA 1SHZC 2Q9QC 2XQYA 2KZ8A 1YD8G 2X68A 3KFWX 4ASKA 5M4YA 2XAGB 5JR9B 2V7MA 3ANWB 3CQGB 4EZHA 3F31A 1WRDA 1HX8A 3HKCE 5LYJE 4L9IA 3UTKA 2IAKA 1HS7A 1BDIA 3MK7C 3VKHA 5JDGA 1O3XA 2JJ9A 4Z8XA 1MNEA 2XAQB 2KZ7B 2CXLA 4KUMB 3UULA 3KZ3A 2WWUA 3PURA 5LGNB 4GK5E 4O2BE 4ZS3A 3QYXA 3AA6B 5FXWA 5LJNA 1ZZ7A 2MBGA 3WAKA 1IJ5A 2IVBA 2PUBA 3AAIA 1UCUA 4HFVA 3SRZA 5HYAA 3VHLA 2CXFA 2JCGA 1WH8A 4I55E 2LSIA 4WBOA 4X4FA 4PW8A 3RYHE 2H7OA 2X67A 2BVLA 2K24A 4ZI3C 1Y9QA 3KV9A 3LK42 3LISA 3KJXA 4AKIA 2CE7A 3NRXA 4KBMB 3BQKA 3FXEB 2PUDA 4AKRB 3AA7B 1OCTC 2EBYA 4ISTA 3CLCA 4IE5A 4YBAA 2LSKA 3OQMA 2BZBA 2AWIA 3FBZA 1D1CA 1HG5A 3Q2MA 3ESLA 2LYPA 1DWKA 1FMVA 2LSGA 4C90A 2E9XD 3EUHA 3AB3B 4Y42A 4YG7B 2MYSA 2EHOC 2PG8A 3HI2A 3OBVE 3ZMTB 5LBMA 2WMNA 3KINB 5JQGE 2L8KA 2V1DB 4QXBB 2CM0A 2L3LA 4MHCA 4BA9A 4QX7B 4ZI2C 3L09A 4WNKA 2IW5B 4EIWA 5K98B 1RZSA 2D2SA 2LOSA 4FI5A 4P0AA 3BQLA 4GQMA 3ZHIA 2B1EA 3AAAB 1FMWA 5DQVA 3ZPOA 1OSLA 3CPZA 2DWGA 4DNDA 5L3EB 2K9AA 1QQBA 2OFYA 1MIWA 1R69A 3C98B 3OMTA 4GOUA 2WBLA 1GT0C 3LFMA 3MJXA 2NW9A 3ZKCA 5JVDE 1ZZ6A 2BNNA 4AKGA 5LHGB 2IUOA 1EZ3A 1ZZCA 2CROA 2X9WA 1WYBA 1Y64B 2EHOA 4X1YE 2OR1L 1RPEL 4AQFC 3KXAA 2QGSA 1MMGA 1KNZA 4XBFB 2IC9A 4OHFA 1NEQA 4L0RA 2EHOB 2JPFA 1Y7YA 1ZZBA 3K3OA 4JUYA 4P09A 3F51A 5FP3A 3L3PA 3WI3A 5HXCA 3BD1A 2XAJB 3JC6C 3O1JA 4TV9E 5LA6E 5CB4E 3ZN1B 3L1PA 5JREA 3OYXA 3J9X1 4C91A 5LHHB 2H8RA 1YKHB 2N2NA 1UTXA 4PU3C 3GN5B 1ZS4A 2VWAA 3LFPA 3K3NA 3BQIA 5HWYA 2L9QA 3UUXB 1CUNA 4AI6A 4X1KE 3Q9DA 2A2FX 3QK6A 4JQDA 3CVRA 3AA0B 3HKBE 5LGUB 2Y48B 2C0SA 4N78D 2KEIA 1HF8A 1ZKEA 3PUAA 4H9NC 4AQFA 3TRBA 3C4XA 3RH3A 4BAYB 1IAPA 1U4QA 2GRMA 2LE8A 3K8PC 4I4TE 3R6NA 5E0OA 2YEVC 2HINA 3N2KE 4HKAA 3ZMSB 4BJMA 3RZZA 3IF8B 1OXZA 5EZYE 5J2TE 4X4DA 1E3OC 2LEHA 4H63H 3I1AA 1LRZA 1O4XA 4M1PA 2N9DA 2NOXA 5H6QB 1POUA 4IVZA 1ZZ9A 5EK4A 4AXPA 3F57A 3N9OA 4UXNB 4X4IA 1D1AA 1S94A 1QPZA 2CWYA 4PU8A 3E22E 4UVBB 5ADXL 2IV1A 2XCJA 5FMNA 3VU7H 4QX8B 2LSJA 4UV9B 2N1GA 4B6XA 4CZZB 3H37A 4PJLA 4ADZA 4GIWA 1KK7A 2Q9QB 3LBXB 1YSEA 4O4HE 2R63A 3E0ZA 4YG1A 5L2LA 3FYAA 1LLIA 2J1DG 1DW9A 2VKOA 4ZOLE 1PNRA 3ZLIA 5HXEA 4QXCB 5J2UE 1MMNA 3EVYA 4EOZB 3ZC1A 2GZUA 2HPLA 3N9MA 4EB6E 5LNKA 3R84B 2PUFA 4ANJA 4O4JE 2UXXB 5JRCA 4FBIA 3RRCA 1HF0A 1L1MA 3B13A 2LYQA 5LOVE 2G0UA 4X1IE 4H9RC 1RIOA 1QP7A 2ODUA 2E8IA 2Q9QD 4I6UA 3ZC0A 2PIJA 5TAOA 2AW6A 3N9PA 4Z59A 5L3CB 3BS3A 1PERL 4X4CA 1WLXA 4FN3A 2NW8A 2NWBA 4NUUA 2K48A 3ZMVB 2D5VA 5IYZE 3N9NA 4IIJE 4TX5A 2WIUB 1NAFA 1RZRA 4IE7A 4ILUA 4MALA 3RYFE 4OK0A 5KMGP 2KLQA 2ICPA 5GONE 4KP3C 1X2LA 2XI8A 2PUCA 3TKLB 2O4AA 4TUYE 4CXYA 3EUSA 3S8QA 1VRBA 1D0ZA 2RP4A 4JLEA 4WW0A 5F3JA 4H9SE 4X4HA 2KMFA 4DMWA 2XIUA 4MCXA 3QUJA 5JDQA 2UXNB 1ZUGA 3MA9A 4DBRA 4H63V 2CLYB 4YJ3E 3HR0A 4Z58A 4I6TA 4EZ4A 4PK5A 1QQAA 1R63A 2SPCA 4PNIA 1MIYA 2PUGA 2PUAA 5JDHA 3M65A 4HE8A 3FYMA 4JCYA 4V1Av 3J7Yq 3UUMA 2DI4A 3I9YA 1WETA 2KWHA 3G5GA 1BR4A 3ZMZB 4E7ZA 2DLRA 2DCFA 3A5XA 4O8BA 4Z5DA 4CXXA 4CI2B 3I0OA 4O2AE 2MTQA 3FHNA 5BMVE 3KBUA 2CXDA 2X9YA 5EK2A 2KNDA 2IVQA 2LYSA 1UXCA 4DVDA 1IJ6A 5JDNA 3FB2A 2X66A 4UV8B 4XAXB 5AFUL 3QF3A 1PRAA 1ZEEA 2WMOA 2X9HA 3CX8B 3VK0A 4YARA 3PDYA 3DTOA 5LXTE 4P0BA 1LQCA 2DHRA 3U78A 1QSDA 1SQ8A 1BR1A 2PPXA 4DO0A 5HXSA 5JR9C 5L3DB 4IGUA 3MZKB 5FXXA 2LHNA 5FXVA 4UVCB 5HXRA 3IEEA 3MKDA 3R1FA 2CA5A 2ES0A 4GYSA 1ZV4X 1LMB3 3RC8A 2VL8A 1HFAA 3SS1A 2PE5A 3C4ZA 2KPJA 2LSYA 4QWNB 5DJQC 3JXBC 1D0XA 1S35A 3C51A 1US7B 4PAGA 4BJNA 5JH7E 3C50A 3I9WA 3H5TA 3GN5A 2LOPA 5H6RB 3NBXX 1UXDA 2CWOA 5J1GA 3RRWA 3KVAA 3ZYKA 2IU7A 2XTLA 2LHRA 2CMRA 2O38A 2LM9A 2MQKA 1UX4A 2P9BA 2PJQA 1WR6A 3KV4A 3IBPA 4HTEA 4IDZA 4UEMA 3P8CD 4PU7A 3S4UA 4DBQA 5CA1E 3DJBA 5JDLA 1LVKA 2KEJA 2PBIA 4UF0B 3HL6A 3ETVA 3HKDE 2RA1A 4H9PC 4ISSA 2NP9A 2VK9A 5CA0E 5L3BB 2B5AA 1YW0A 3D1NI 1IC8A 3SOLA 3MACA 5LGTB 1VOMA 2ZM8A 2KT9A 1JWLA 3DNVB 2XSDC 5JDFA 4L5GA 3VKGA 4IE0A 1JH9A 3BDNA 2VKJA 4CI1B 1WH6A 2ZMAA 2JMHA 3CECA 4WBNE 3I0QA 4U74A 4PK6A 4XZCA 3OQNA 3PE0A 4PFPA 1D1BA 3ONXA 3O1IA 5FNVE 3F2EA 4HGAA 3SCHA 2KWIB 2VASA 3N9QA 2CSFA 3C4WA 2C5JA 3FBLA 4H9OC 2LYLA 1PRUA 4NDWA 1NWMX 4I50E 2XJ3A 2IC6A 4UELA 2WUSR 3D0TA 2OA5A 3KDSE 3CKDA 5IHYA 4I8TA 3C64A 4OFZA 2FJRA 2WM9A 5ETWA 2XAHB 3Q5WA 3FXDB 5L3FB 3EDUA 4G2AA 2AXZA 4GYRA 3GWHA 3IVPA 4O4LE 3JXCL 1UX5A 4JEHB 3MLFA 2JRKA 4QKNA 1X79A 3U3IA 2BNMA 4O8SA 5FY7A 1FIOA 2A6CA 2L8NA 2YINA 2ACXA 3ETUA 2BVMA 2ICTA 3ZJ1A 2ZM0A 1HG2A 4ZI2D 2AXUA 3LJCA 4Z5CA 3ZEFB 3U3WA 4EAHA 2MEZA 2AUWA 2D0TA 3E08A 3KBTA 4I6RA 1HTJF 3N5LA 3QC9A 1AU7A 5F8PA 3UUNA 2D0UA 1ZHCA 3O1HA 4O4IE 4J1WA 3HZIB 3KV5A 1MMAA 1JFSA 2LYKA 4F6RC 3RKOA 2ZM2A 3QWGA 4YFSA 4JCXA 3FMYA 4EXTA 1ZZ8A 4PJJA 5LCYA 1ZAYA 4G63A 1G73A 1V9DA 4IE6A 2HPJA 2YK0A 2NTXA 4J2CA 1QP4A 3SWHA 4CXWA 3ZYMA 3CQXC 2PFVA 5JDMA 4X4BA 3ANWA 3G7DA 4OB4A 5FXZA 4AQGA 4JEUB 3PUQA 3KVBA 5FY0A 4EYYR 5HWXA 3N2GE 3W15B 1AJ3A 2GRLA 4J1XA 5DQWA 2XAFB 3GBFA 2E9XA 2EWTA 3CX6B 4IE4A 2ZLYA 3ZCIA 3SCGA 2V7JA 1XWRA 4HN9A 3CROL 2V26A 1G8XA 3LK2B 4X20E 1E1HB 2X51A 1ADRA 1D0YA 4F8DA 2XUEA 3IHRA 1MNDA 5FYMA 2MOZA 3P7IA 2W0GA 5LBQB 4IA8A 3OKQA 3PTRB 3B7HA 5HXHA 3AVRA 4HEAA 5EK3A 3RC3A 3JXDL 3V5UA 1RZRD 4UIGA 4TV8E 2XASB 4K0UA 3KV6A 4GHJA 3UFDA 3N2OA 4TN7B 3UFEA 2LYJA 3ZMUB 3ZHMA 5LJMA 4OYJA 2K5BB 4MCTA 2V7LA 5JRCB 3SCFA 1BDHA 3CQCB 4PFOA 4ZI7E 4AKHA 2NTYA 3MXZA 2E9XC 3RYIE 4YJ2E 3CX7B 2JMKA 4ZS2A 4MBQA 1JFTA 4ERRA 3AA1B 2ODVA 4ZHQE 1OWAA 2BJCA 3T8OA 4QHOA 2Y8DA 3OQOA 3GMIA 2VKHA 1BR2A 2DNXA 4YHJA 3OP9A 4GK0E 2XHEB 2EF8A 2EHOD 3HA4A 4FJOA 1LVFA 2Z6EA 4A56A 1NERA 3NRYA 5DABA 2V7IA 2VB6A 2LCVA 2A3DA 2NW7A 1VPWA 5LHIB 3NZQA 4QXHB 2W00A 1CQTA 2WSSV 3LG7A 3ZJ2A 4X4EA 2I59A 3HKEE 4H9QC 4CI3B 1QUUA 3EDVA 5FY1A 3RX6A 3WAJA 3JC6D 2JVLA 1Z0PA 2W62A 3OYZA 1MIVA 2LJLA 3UT5E 4UF0A 4DMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4A A;  1EFA A;  4GQM A;  3ZHI A;  2KEK A;  3EUS A;  3S8Q A;  1WIZ A;  1OSL A;  1X57 A;  2AXZ A;  1B0N A;  2PUE A;  4X4H A;  1QQB A;  2XIU A;  4MCX A;  3IVP A;  2OFY A;  2IVG A;  1R69 A;  3GA8 A;  3OMT A;  3JXC L;  1GT0 C;  1ZUG A;  2LYR A;  3MLF A;  3ZKC A;  4Z58 A;  1ZZ6 A;  2BNN A;  2BNM A;  4I6T A;  3F6W A;  2IUO A;  2A6C A;  1R63 A;  2L8N A;  1QQA A;  1ZZC A;  2CRO A;  2ICT A;  2PUG A;  4X4G A;  2PUA A;  2O49 A;  2AXU A;  4Z5C A;  3FYM A;  3U3W A;  4YG4 A;  2OR1 L;  4JCY A;  2MEZ A;  3QQ6 A;  1RPE L;  3PXP A;  2AUW A;  3KXA A;  1WET A;  3F52 A;  3G5G A;  4I6R A;  1AU7 A;  2AXV A;  1NEQ A;  4J1W A;  1Y7Y A;  1ZZB A;  3HZI B;  1CJG A;  4O8B A;  4Z5D A;  3F51 A;  1JFS A;  2LYK A;  1S7E A;  2R1J L;  3QWG A;  3BD1 A;  4JCX A;  1ZPQ A;  2BNO A;  3FMY A;  2IVQ A;  2LYS A;  1UXC A;  1ZZ8 A;  3L1P A;  1ZAY A;  1LCD A;  2H8R A;  1UTX A;  4PU3 C;  3GN5 B;  1ZS4 A;  1QP4 A;  3LFP A;  3QF3 A;  1PRA A;  1ZVV A;  2L49 A;  3VK0 A;  3G7D A;  4PU4 C;  4YAR A;  4Z5H A;  4OB4 A;  4X4B A;  1LQC A;  1LCC A;  5A7L A;  3O9X A;  1SQ8 A;  2PPX A;  1PRV A;  4JQD A;  1QP0 A;  2KEI A;  4IWR A;  3TRB A;  2GRL A;  2HSG A;  4J1X A;  2KZ8 A;  3GBF A;  2EWT A;  3R1F A;  2GRM A;  3SCG A;  1LMB 3;  1XWR A;  2HIN A;  1RZS A;  3CRO L;  3RZZ A;  2PE5 A;  2KPJ A;  1ADR A;  4X4D A;  1E3O C;  3JXB C;  4F8D A;  1O4X A;  1POU A;  1BDI A;  4IVZ A;  1ZZ9 A;  3GN5 A;  3H5T A;  4IA8 A;  3B7H A;  1UXD A;  4X4I A;  1QPZ A;  2IU7 A;  4PU8 A;  3JXD L;  1RZR D;  2IV1 A;  2O38 A;  2XCJ A;  2MQK A;  3KZ3 A;  4PU7 A;  4GHJ A;  3QYX A;  3UFD A;  1ZZ7 A;  2KEJ A;  2LYJ A;  3ZHM A;  2IVB A;  2PUB A;  4MCT A;  3SCF A;  2JCG A;  1WH8 A;  1YSE A;  2R63 A;  1BDH A;  4YG1 A;  3FYA A;  4X4F A;  2B5A A;  1LLI A;  1DW9 A;  3D1N I;  1IC8 A;  1PNR A;  1Y9Q A;  3LIS A;  3KJX A;  1JFT A;  1JWL A;  2GZU A;  2XSD C;  3DNV B;  2BJC A;  2PUD A;  3OQO A;  2PUF A;  1OCT C;  3OP9 A;  1JH9 A;  2EBY A;  4FBI A;  3BDN A;  3CLC A;  1WH6 A;  4YBA A;  1HF0 A;  1L1M A;  2EF8 A;  2LYQ A;  3CEC A;  3OQM A;  2AWI A;  1NER A;  3OQN A;  1RIO A;  1QP7 A;  2LCV A;  2LYP A;  2PIJ A;  4I6U A;  1DWK A;  1VPW A;  2AW6 A;  1CQT A;  4Z59 A;  4Y42 A;  3SCH A;  3BS3 A;  4YG7 B;  4X4C A;  4X4E A;  2CSF A;  4FN3 A;  1PER L;  3HI2 A;  2LYL A;  1PRU A;  4NDW A;  2D5V A;  2WIU B;  2XJ3 A;  1RZR A;  2WUS R;  2JVL A;  2ICP A;  4I8T A;  1X2L A;  2XI8 A;  5K98 B;  2FJR A;  2PUC A; 
#chains in the Genus database with same CATH topology
 1LKX A;  3NZP A;  1MMD A;  2VKD A;  1HCI A;  5LG4 A;  3AEC A;  2IVG A;  3AAE B;  3TLV A;  3B57 A;  3OJA A;  4X4G A;  5JR9 A;  4YG4 A;  2E5V A;  3PXP A;  3AE9 A;  4U2Z A;  4U72 A;  3RPU A;  3ZYL A;  3PU8 A;  2BNO A;  2BG9 B;  1LCD A;  2BDE A;  1YKE B;  2XQ7 A;  5L47 A;  2CLY C;  1SA0 E;  4PK4 A;  3RYC E;  2LLW A;  4IHJ E;  5LP6 E;  1PRV A;  3ONJ A;  2D5U A;  2H3R A;  4IWR A;  2YU2 A;  1SHZ C;  4JI7 T;  2X68 A;  4ASK A;  2XAG B;  3QOX A;  3QFI A;  3ANW B;  3CQG B;  3L39 A;  1WRD A;  3HKC E;  3UTK A;  2JJ9 A;  3SX0 A;  1MNE A;  3UU5 A;  2CXL A;  3KZ3 A;  2WWU A;  3FZF B;  4GK5 E;  2A9U A;  3QYX A;  3AA6 B;  2MPK A;  1IJ5 A;  2PUB A;  3SRZ A;  3VHL A;  2JCG A;  4I55 E;  2LSI A;  4WBO A;  1Y9Q A;  2PXU A;  2CE7 A;  4ER7 A;  3FXE B;  5FL1 A;  4IE5 A;  2BZB A;  4NXM T;  1JNR A;  4U33 A;  2PXT A;  1HX1 B;  2WU5 A;  2XPK A;  1FMV A;  2E9X D;  3AB3 B;  2EHO C;  2PG8 A;  2V5D A;  3KIN B;  3A9Y A;  4BA9 A;  4MHC A;  4ZI2 C;  2WS3 A;  4QX7 B;  3L09 A;  5K98 B;  1RZS A;  3BQL A;  3ZHI A;  3ZPO A;  2JQ9 A;  3CPZ A;  3TLW A;  2JQK A;  2OFY A;  2VL0 A;  2XZE A;  5AQR B;  1GT0 C;  3MJX A;  3ZKC A;  4AKG A;  2BNN A;  3AEF A;  2BG9 E;  2IUO A;  2CRO A;  1WYB A;  3UQ7 A;  2XQ9 A;  2EHO A;  2YDS A;  4X1Y E;  2QGS A;  1MMG A;  2IC9 A;  2FUP A;  2EHO B;  2JPF A;  3P4Q A;  1ZZB A;  3ONL C;  2XAJ B;  3B5M A;  3JC6 C;  4TV9 E;  5CB4 E;  4CN1 A;  3L1P A;  3OYX A;  3GN5 B;  5ABE A;  3CK6 A;  5HWY A;  3KL4 A;  1CUN A;  2PXE A;  3OTO T;  5LGU B;  2C0S A;  2KEI A;  1ZKE A;  1W0B A;  3VR9 A;  1IAP A;  3R6N A;  3P4W A;  3ZMS B;  4BJM A;  3IF8 B;  1OXZ A;  5EZY E;  4X4D A;  2LEH A;  3I1A A;  1LRZ A;  1O4X A;  2N9D A;  4JYA T;  2CHN A;  3CIR A;  4X4I A;  1D1A A;  3UUB A;  1S94 A;  2CWY A;  4B6X A;  3RIU A;  1HNW T;  4CZZ B;  3H37 A;  4PJL A;  5HEJ A;  3UQ4 A;  2Q9Q B;  2IML A;  1LLI A;  3OPC A;  4KX6 A;  4KHP T;  2XQA A;  2GZU A;  1GQE A;  3VWS A;  1SE7 A;  4ANJ A;  3P4P A;  5JRC A;  4FBI A;  4X64 T;  2G0U A;  1QP7 A;  2Q9Q D;  5TAO A;  1PER L;  1WLX A;  4FN3 A;  2NW8 A;  1VCT A;  5IYZ E;  2VVS A;  3N9N A;  4IIJ E;  3G0T A;  4MAL A;  2FJD A;  2XI8 A;  5FL0 A;  4CXY A;  5LG3 A;  2CHO A;  2KMF A;  4DMW A;  5AQG B;  3MA9 A;  1ZUG A;  4DBR A;  2CLY B;  3HR0 A;  4EZ4 A;  2SPC A;  4PNI A;  4B3M T;  3FYM A;  3UUM A;  1WET A;  4CXX A;  2MTQ A;  4EKI A;  2KND A;  1UXC A;  1IJ6 A;  4XAX B;  4AQY T;  3PJA A;  4HFD A;  2X9H A;  3DTO A;  3T1Y T;  4QH1 A;  3IA3 A;  1QSD A;  4DO0 A;  2AXD S;  4GKK T;  5DTQ A;  4UVC B;  3R1F A;  2CA5 A;  2ES0 A;  4LMJ A;  3C4Z A;  4LML A;  3C51 A;  1US7 B;  4ER3 A;  1UUR A;  2LOP A;  2V6Y B;  3NBX X;  2XTL A;  2CMR A;  2XSB A;  3P8C D;  4PU7 A;  4ZXL A;  2KEJ A;  4UF0 B;  1IBK T;  3FZH B;  5AQK B;  1YW0 A;  4GKJ T;  4IDQ A;  1VOM A;  1VCS A;  4A98 A;  1JWL A;  2ZM6 T;  2F4V T;  3A9Z A;  5JDF A;  1XMO T;  3VKG A;  2WQY A;  1WH6 A;  3CEC A;  3PE0 A;  3ONX A;  2CPT A;  3N9Q A;  2CSF A;  3NVO A;  2LYL A;  4DV6 T;  3D0T A;  2XQ8 A;  5C2T A;  3FXD B;  2MXD A;  2AXZ A;  3JAE A;  3ZT6 A;  4GYR A;  3GWH A;  3IVP A;  4O4L E;  4AIS A;  3JXC L;  4JEH B;  3MLF A;  4O8S A;  1FIO A;  3AXJ A;  2BVM A;  3GZC A;  2ZM0 A;  4ZI2 D;  1R8I A;  3ZEF B;  4EAH A;  2D0T A;  2UUC T;  3UUN A;  1ZHC A;  4O4I E;  4J1W A;  1MMA A;  4HWC A;  1JFS A;  2ZM2 A;  2HHH T;  3FMY A;  4PJJ A;  3UFG A;  3RI5 A;  4CXW A;  2HN1 A;  2BG9 A;  3AE2 A;  3ZYM A;  2PFV A;  2DL1 A;  5JDM A;  3G7D A;  4OB4 A;  5FXZ A;  1CHU A;  3EAB A;  2GRL A;  4QH4 A;  3ZCI A;  3SCG A;  2XJ7 A;  2V7J A;  3LK2 B;  1E1H B;  2X51 A;  1ADR A;  5FYM A;  4DID B;  3P7I A;  2W0G A;  5LBQ B;  4NXN T;  3OKQ A;  3RC3 A;  3JXD L;  2XXA A;  4UIG A;  4TV8 E;  3AEE A;  3KV6 A;  4GHJ A;  3UFD A;  3N2O A;  4YHH T;  2LYJ A;  2V3C C;  4MCT A;  3SCF A;  3RYI E;  4YJ2 E;  1UUS A;  3TEP A;  1QLB A;  2Y8D A;  3GMI A;  5CJ5 A;  2BS4 A;  2A3D A;  1XNR T;  4QXH B;  3LG7 A;  2I59 A;  3EDV A;  5FY1 A;  3H3M A;  3JC6 D;  1Z0P A;  2XQ6 A;  1EFA A;  4PJM A;  3AE4 A;  4X5T A;  2CEA A;  4MFR A;  1X57 A;  2UU9 T;  2LT3 A;  1B0N A;  1BR0 A;  2W2U A;  5L3G B;  3CML A;  2BKO A;  4JI2 T;  2A72 A;  3DP7 A;  4ZI3 D;  5A1L A;  3M3Z B;  3LK3 B;  4TZ4 C;  5AQV B;  3NXH A;  3QQ6 A;  2V5C A;  2Q9Q A;  3N9L A;  2AXV A;  3PUG A;  4PJN A;  4ZEY A;  1ZPQ A;  2WWV A;  2PXQ A;  3PUS A;  2H7V C;  2X0L B;  3AVS A;  3ZCJ A;  2KIN B;  1H7C A;  2KXP B;  3JAF A;  2HH7 A;  4AKL A;  5A7L A;  2H88 A;  1QP0 A;  1T98 A;  4DV1 T;  1FEW A;  3NRO A;  2LLV A;  2Q9Q C;  2XQ4 A;  3F31 A;  5LYJ E;  3R09 A;  4DV5 T;  4JV5 T;  2IAK A;  1HS7 A;  1BDI A;  1T72 A;  1XMQ T;  2IHR 1;  5LGN B;  4ZS3 A;  1OED B;  2PXV A;  2YKS A;  5FXW A;  5LJN A;  2MBG A;  2IVB A;  2LLY A;  4HFV A;  1WH8 A;  5ABG A;  3KV9 A;  3LK4 2;  4AKI A;  3Q5E A;  3BQK A;  2PUD A;  1E2A A;  3AA7 B;  1OCT C;  4IST A;  3UU3 A;  3TFL A;  2AWI A;  3FBZ A;  1HG5 A;  4K0K T;  3ESL A;  1DWK A;  2K3W A;  5DSX A;  3AEB A;  4X65 T;  2L8K A;  2V1D B;  4QXB B;  2CM0 A;  2L3L A;  4WNK A;  2IW5 B;  2E5L T;  4FI5 A;  2LOS A;  4P0A A;  5DQV A;  1FMW A;  3A7M A;  4DND A;  4DE8 A;  4LFC T;  1QQB A;  1MIW A;  3C98 B;  1R69 A;  2WBL A;  2NW9 A;  5JVD E;  1Y64 B;  3RLF F;  2UXD T;  2LKH A;  2OR1 L;  3AE5 A;  4AQF C;  3KXA A;  1N32 T;  4XBF B;  4OHF A;  2HN2 A;  3K3O A;  4P09 A;  5FP3 A;  3L3P A;  4WZX A;  3BD1 A;  2QYW A;  5HEG A;  5JRE A;  3VRB A;  3LFP A;  4WYV A;  4QH5 A;  4TWH A;  3BQI A;  2L9Q A;  3UUX B;  4X1K E;  3QK6 A;  3CVR A;  3AA0 B;  4N78 D;  3L8R A;  4AQF A;  4ER6 A;  2WDV A;  2FFH A;  2GRM A;  2LE8 A;  3K8P C;  2YEV C;  1HNZ T;  1E3O C;  4LF4 T;  5LB7 B;  2NOX A;  1POU A;  2WZH A;  3F57 A;  1OED A;  3N9O A;  1QPZ A;  4PU8 A;  5ADX L;  3VU7 H;  5FMN A;  3RQU A;  3TLT A;  1KK7 A;  1YSE A;  4O4H E;  1DW9 A;  2VKO A;  4EOZ B;  3ZC1 A;  3N9M A;  4JI6 T;  3R84 B;  4O4J E;  1KNP A;  3RRC A;  1HF0 A;  3B13 A;  1OED C;  2XM2 A;  2M6I A;  2E8I A;  3ZC0 A;  3RIU C;  2KSR A;  3ZST A;  2VUR A;  4TX5 A;  1N36 T;  2WIU B;  4ILU A;  3RYF E;  4OK0 A;  2LRK A;  2KLQ A;  5GON E;  4TUY E;  3EUS A;  3S8Q A;  1VRB A;  2HCN A;  4JLE A;  4H9S E;  1IBM T;  3ME5 A;  3PUX F;  2WCA A;  2XQ5 A;  1Z8U A;  4PK5 A;  1QQA A;  2ACZ A;  1MIY A;  3M65 A;  3AED A;  4V1A v;  3I9Y A;  3OWQ A;  1BR4 A;  2XSA A;  2DLR A;  3AE6 A;  5BMV E;  3KBU A;  2I6H A;  2IVQ A;  5JDN A;  3LQX A;  2X66 A;  3FB2 A;  5AFU L;  3CX8 B;  1PRA A;  4F8H A;  4YAR A;  3PDY A;  4P0B A;  5HCJ A;  3U78 A;  1SQ8 A;  1BR1 A;  5FXX A;  3PE5 A;  3P4S A;  5FXV A;  3UU6 A;  4GYS A;  1LMB 3;  3RC8 A;  5DRY A;  4NPP A;  2PE5 A;  1D0X A;  4PAG A;  3C50 A;  3H5T A;  2RPA A;  1OED E;  1UXD A;  3RRW A;  3KVA A;  2IU7 A;  4IT4 A;  2LHR A;  4IL4 A;  2LM9 A;  3S4U A;  4IDZ A;  4ZZC A;  3G06 A;  5CA1 E;  3DJB A;  5JDL A;  3ETV A;  2VK9 A;  1IC8 A;  3TEL A;  2PXP A;  2BBH A;  4LF8 T;  5GAH i;  5LGT B;  4IE0 A;  1JH9 A;  4CI1 B;  2M4H A;  2ZMA A;  4WBN E;  4U74 A;  3UWP A;  4XZC A;  1YQ3 A;  3O1I A;  3FBL A;  2C5J A;  1NWM X;  2XJ3 A;  2WUS R;  3KDS E;  3CKD A;  4ER0 A;  4U2Y A;  2FJR A;  2WM9 A;  5L3F B;  3EDU A;  1HNX T;  4ILA A;  3U3I A;  1X79 A;  2XM1 A;  3ETU A;  2L8N A;  2YIN A;  2ACX A;  3EI0 A;  4DR1 T;  2MEZ A;  3QC9 A;  3N5L A;  5F8P A;  3O1H A;  3HZI B;  2E2A A;  3RKO A;  3AE7 A;  1ZZ8 A;  4DV3 T;  1G73 A;  4IE6 A;  2YK0 A;  2NTX A;  4HFE A;  3SWH A;  4X4B A;  3ANW A;  3PUW F;  4AQG A;  4HFH A;  2BBJ A;  3PUQ A;  1QZX A;  3KVB A;  3N2G E;  1AJ3 A;  4HWI B;  2XAF B;  4DR3 T;  2ODR D;  2V26 A;  1G8X A;  1W9R A;  1MND A;  5CFB A;  3RQW A;  4IA8 A;  3PTR B;  3AVR A;  5F5W A;  3V5U A;  4K0U A;  3ZPX A;  5DT2 A;  3ZMU B;  3ZHM A;  5JRC B;  2K5B B;  2V7L A;  1BDH A;  2B76 A;  4ZI7 E;  4YY3 T;  2NTY A;  4ZS2 A;  3AA1 B;  4CN6 A;  4QHO A;  1U2Z A;  2DNX A;  4YHJ A;  3ZKR A;  2AE9 A;  2EF8 A;  3NZL A;  2EHO D;  2Z6E A;  2BKP A;  4LMK A;  5FVK A;  1W09 A;  3P50 A;  2PXL A;  2VB6 A;  2W00 A;  1CQT A;  3ZJ2 A;  3HKE E;  2IUB A;  5LMN T;  2JVL A;  3OYZ A;  2LJL A;  3UT5 E;  4KI0 F;  4DMV A;  4E7S A;  1WIZ A;  3TLU A;  2PUE A;  5KDM C;  3RHW A;  3GA8 A;  5J0Z A;  3F6W A;  2XXQ A;  2C5I T;  4KMC A;  5KX5 E;  3ZN0 B;  3V5S A;  2CRB A;  3BK9 A;  4JI3 T;  4EYU A;  1CJG A;  1M7K A;  3PU3 A;  5HCM A;  1WYC A;  2W63 A;  2Y6X A;  4NUV A;  2GK9 A;  4U7I A;  2WAU A;  5HEO A;  1L0V A;  2WU2 A;  4TWF A;  2L49 A;  4Z5H A;  5HAX A;  3ABV A;  1LCC A;  3H3A A;  5C8Y E;  2HSG A;  2XQY A;  5AQT B;  2KZ8 A;  1YD8 G;  3KFW X;  5M4Y A;  4EV6 A;  1O3X A;  2KZ7 B;  4KUM B;  3PUR A;  3AEA A;  2PXF A;  1ZZ7 A;  4YT0 A;  3AAI A;  1UCU A;  5HYA A;  4X4F A;  3RYH E;  2H7O A;  5AQF B;  2BVL A;  2K24 A;  4ZI3 C;  5ABH A;  4DV2 T;  3LIS A;  4KBM B;  4AKR B;  3QOF A;  2EBY A;  3T1H T;  3CLC A;  2H89 A;  2WY2 A;  4P1N A;  3Q2M A;  1M62 A;  2LYP A;  2L1P A;  2LSG A;  4Y42 A;  4YG7 B;  2MYS A;  3OBV E;  2FJA A;  1MFQ C;  2WMN A;  5ABF B;  4B3T T;  4JI5 T;  1KF6 A;  2D2S A;  5AQL B;  2LM2 A;  1OSL A;  5BR8 T;  5L3E B;  4GOU A;  1RPE L;  4JI1 T;  2UUA T;  3P4R A;  2XY8 B;  1NEQ A;  1Y7Y A;  1NEN A;  3FZL B;  3AXJ B;  5LA6 E;  3J9X 1;  4C91 A;  5LHH B;  2H8R A;  1YKH B;  2N2N A;  1UTX A;  4PU3 C;  4YSX A;  2UXB T;  3K3N A;  3QNU A;  4AI6 A;  3Q9D A;  2A2F X;  2Y48 B;  1HF8 A;  4H9N C;  3PUA A;  3SR4 A;  3TRB A;  2J7U A;  3C4X A;  3RH3 A;  1U4Q A;  5E0O A;  2HIN A;  5J2T E;  2JIW A;  5AQO B;  5AQH B;  5H6Q B;  2QRX A;  4IVZ A;  1ZZ9 A;  5EK4 A;  4UXN B;  4ZZB A;  4UVB B;  3E22 E;  2BKN A;  2XXP A;  2XCJ A;  2LSJ A;  4UV9 B;  2N1G A;  3FZM B;  4ADZ A;  4GIW A;  3NDB B;  3LBX B;  2V8S V;  3E0Z A;  4YG1 A;  2IIU A;  3PUV F;  3FYA A;  5L2L A;  4DR5 T;  3QB5 K;  4ZOL E;  5J2U E;  4QXC B;  3EVY A;  2HPL A;  5LNK A;  2PUF A;  5LOV E;  4X1I E;  3X1D A;  3MEJ A;  2PIJ A;  3N9P A;  4Z59 A;  3RKG A;  3BS3 A;  4DV4 T;  4X4C A;  3ZMV B;  1XWM A;  2NWB A;  1RZR A;  4KHZ F;  4NIQ A;  1X2L A;  3TKL B;  4YXD A;  1XNQ T;  4X66 T;  5F3J A;  4X4H A;  2J47 A;  2XIU A;  4MCX A;  1HQ1 A;  2YDR A;  2UXN B;  4EEB A;  4H63 V;  2QVA A;  4YJ3 E;  4I6T A;  1R63 A;  2V6X A;  2PUG A;  4HE8 A;  4HFB A;  4JCY A;  3J7Y q;  2DI4 A;  2DCF A;  3I0O A;  4O2A E;  3FHN A;  5EK2 A;  3LDQ B;  4DVD A;  4UV8 B;  2CBI A;  2J7W A;  3QF3 A;  1ZEE A;  2WMO A;  3VK0 A;  4IDP A;  1LQC A;  3SFE A;  5JR9 C;  4IGU A;  3MZK B;  4HWF A;  5FKY A;  2YBD A;  4YSZ A;  5HXR A;  2W67 A;  3MKD A;  1ZV4 X;  4Q25 A;  3AE8 A;  2VL8 A;  3SS1 A;  2WDR A;  4DUZ T;  2KPJ A;  2LSY A;  4QWN B;  4BJN A;  5JH7 E;  3I9W A;  5H6R B;  3GN5 A;  2CWO A;  3ZYK A;  2VQE T;  2O38 A;  4IL9 A;  5L4E A;  1UX4 A;  2P9B A;  3KV4 A;  1WR6 A;  3WAJ A;  1W0A A;  1X9B A;  1LVK A;  2PBI A;  3HL6 A;  3HKD E;  2RA1 A;  4H9P C;  4ISS A;  2NP9 A;  5CA0 E;  5L3B B;  1N33 T;  4I0U A;  3D1N I;  3RIA A;  3MAC A;  2KT9 A;  2XSD C;  1ZP0 A;  2UXC T;  4COF A;  2JMH A;  4PK6 A;  3OQN A;  4PFP A;  1FJG T;  5CGM A;  2I0M A;  3SFD A;  5FNV E;  3SCH A;  4H9O C;  1PRU A;  2IC6 A;  2WB5 A;  2OA5 A;  1I94 T;  4YSY A;  2XAH B;  3Q5W A;  4DR2 T;  5FVL A;  1UX5 A;  2JRK A;  5AQI B;  4X62 T;  2M6B A;  2BNM A;  4HWH A;  3A8Y C;  4LFB T;  1HG2 A;  2AXU A;  3LJC A;  4Z5C A;  4DR4 T;  2AUW A;  3KBT A;  3AE3 A;  2LYK A;  4F6R C;  3QWG A;  4YFS A;  5LCY A;  1V9D A;  2HPJ A;  3ZT7 A;  4J2C A;  3RGL A;  4A97 A;  3ZSS A;  3W15 B;  5ABF A;  3GBF A;  2E9X A;  2EWT A;  3CX6 B;  4IE4 A;  4HN9 A;  3CRO L;  4X20 E;  1D0Y A;  4F8D A;  5GAG i;  5DRT A;  3GZD A;  5HXH A;  4HEA A;  5EK3 A;  1RZR D;  3NKZ A;  3UFE A;  5LJM A;  3CQC B;  5HEH A;  3A9X A;  4EKG A;  4ERR A;  4LF7 T;  4ZHQ E;  1OWA A;  4EGW A;  2BJC A;  1BR2 A;  3OP9 A;  1QB2 A;  3GZD C;  4UR9 A;  1J5W A;  2X0H A;  1LVF A;  4A56 A;  4DE9 A;  2LCV A;  1VPW A;  1J5E T;  1KEY A;  2OLT A;  1NEK A;  3ZT5 A;  4CI3 B;  1QUU A;  1MIV A;  4UF0 A;  4ER5 A;  2KEK A;  5LMU T;  4AIU A;  2C5K T;  2NR4 A;  4OYK A;  4MLK A;  3JCF A;  2QA7 A;  4IRE A;  2LYR A;  2CCQ A;  4YTP A;  2O49 A;  3O4X E;  2DWK A;  3F52 A;  3LBX A;  2HFZ A;  1KFY A;  2V7K A;  1S7E A;  2R1J L;  2YU1 A;  2XQ3 A;  4CQI A;  1U5P A;  3UU4 A;  3Q5X A;  2X9X A;  4UVA B;  2JQQ A;  4JI0 T;  4I43 B;  3OKZ A;  1ZVV A;  4HFC A;  4PU4 C;  2W61 A;  4A5X A;  4YLH A;  2M67 A;  3K3Q C;  3Q5D A;  4EED A;  3CWZ B;  1IZN B;  3O9X A;  1B7T A;  2E9X B;  3PV0 F;  5AQM B;  5JR9 B;  2YN6 A;  2W4X A;  2V7M A;  4EZH A;  2PTF A;  1HX8 A;  4WVL A;  4L9I A;  3MK7 C;  3VKH A;  5JDG A;  4Z8X A;  1UK5 A;  2XAQ B;  1WFD A;  3UUL A;  4O2B E;  4U3C A;  4HWD A;  3WAK A;  4YTM A;  1JNZ A;  4ILB A;  2CXF A;  2YOE A;  1XZY A;  4PW8 A;  2X67 A;  4Q2J A;  5AQQ B;  3KJX A;  4EZI A;  3NRX A;  1ZOY A;  5AQN B;  4YBA A;  4TNV A;  2LSK A;  3OQM A;  1D1C A;  1UGO A;  1XDP A;  4C90 A;  3EUH A;  5DTR A;  3HI2 A;  4IDO A;  3ZMT B;  5LBM A;  5JQG E;  3M9L A;  4EIW A;  1XDO A;  1T7S A;  3OVU A;  4GQM A;  2B1E A;  3AAA B;  2VEO A;  2X0Y A;  2DWG A;  5AQU B;  2HCS A;  2K9A A;  1SUM B;  3OMT A;  3LFM A;  4B3R T;  1ZZ6 A;  5LHG B;  1EZ3 A;  1ZZC A;  2X9W A;  1KNR A;  2OV9 A;  1KNZ A;  4HRA A;  2LKG A;  4L0R A;  4JUY A;  3F51 A;  3WI3 A;  5HXC A;  3O1J A;  3ZN1 B;  2R6G F;  4U7Y A;  2FJE A;  3AEG A;  1ZS4 A;  2VWA A;  4Z90 A;  4DR6 T;  4JQD A;  1YQ4 A;  3HKB E;  4BAY B;  4I4T E;  3N2K E;  4HKA A;  3RZZ A;  3RIF A;  4H63 H;  4M1P A;  4DUY T;  4AXP A;  4OBM A;  2IV1 A;  1DU2 A;  2FBW A;  4QX8 B;  2VVN A;  4DV7 T;  1N34 T;  2R63 A;  2CBJ A;  2J1D G;  4CN4 A;  3ZLI A;  1PNR A;  5HXE A;  1MMN A;  4EK9 A;  4EB6 E;  2UXX B;  1T8B A;  4B3S T;  1L1M A;  2LYQ A;  4H9R C;  1RIO A;  2ODU A;  4I6U A;  4TWD A;  4JBW F;  2AW6 A;  5L3C B;  1Y01 A;  4NUU A;  2K48 A;  2D5V A;  4JI8 T;  4IE7 A;  1NAF A;  5KMG P;  3TLS A;  3PUZ F;  2ICP A;  4KP3 C;  4Z91 A;  2PUC A;  2O4A A;  2PXK A;  1D0Z A;  2RP4 A;  4WW0 A;  4HFI A;  1I6Z A;  2VQF T;  3EHZ A;  3QUJ A;  4ILC A;  5JDQ A;  3RF1 A;  2PXD A;  4Z58 A;  4U31 A;  5JDH A;  2PUA A;  2KWH A;  3G5G A;  3ZMZ B;  4E7Z A;  3A5X A;  4O8B A;  4Z5D A;  4LF5 T;  4OX9 T;  4CI2 B;  2CXD A;  2X9Y A;  2LYS A;  2IDO B;  3UU8 A;  5LXT E;  2DHR A;  2PPX A;  5HXS A;  5L3D B;  4TNW A;  2MAW A;  2LHN A;  4LFA T;  2WZI A;  3IEE A;  3VR8 A;  3QOW A;  4YTN A;  1HFA A;  5DJQ C;  3JXB C;  1S35 A;  2PXB A;  5DTM A;  5J1G A;  2LRL A;  4UEM A;  2MQK A;  2PJQ A;  4HTE A;  4DBQ A;  3IBP A;  1HR0 T;  2YDQ A;  5IUX A;  2B5A A;  5AQS B;  3SOL A;  2BS2 A;  2UUB T;  2ZM8 A;  3DNV B;  3JAD A;  4L5G A;  5L4H A;  2VKJ A;  3BDN A;  5AQP B;  2LNM A;  3I0Q A;  1D1B A;  1J1J A;  2V6Y A;  4IDN A;  3F2E A;  4HGA A;  2KWI B;  2VAS A;  3C4W A;  3FZK B;  4I50 E;  4NDW A;  5KXJ A;  3PJA J;  4UEL A;  5JTG A;  5IHY A;  2J62 A;  4I8T A;  3C64 A;  4OFZ A;  1WCR A;  4LF6 T;  5ETW A;  4G2A A;  1IBL T;  1DUL A;  2BG9 C;  4QKN A;  3NWI A;  5FY7 A;  5HEU A;  2A6C A;  2ICT A;  3ZJ1 A;  5JUW A;  3U3W A;  3E08 A;  4I6R A;  1HTJ F;  5AQJ B;  1AU7 A;  2D0U A;  3PUY F;  3KV5 A;  4JI4 T;  2D9D A;  4JCX A;  4EXT A;  1ZAY A;  2JQE A;  4G63 A;  1QP4 A;  3CQX C;  2W66 A;  4JEU B;  4EYY R;  5FY0 A;  4LF9 T;  5HWX A;  2FJB A;  4J1X A;  5DQW A;  3K1S A;  2ZLY A;  1XWR A;  2XUE A;  3IHR A;  2MOZ A;  2JQH A;  3B7H A;  2WP9 A;  3VRA A;  1E7P A;  2J4G A;  1NW3 A;  2XAS B;  4TN7 B;  4OYJ A;  4PFO A;  2BS3 A;  4AKH A;  3MXZ A;  2E9X C;  3CX7 B;  2JMK A;  4MBQ A;  1JFT A;  2ODV A;  3T8O A;  4EQZ A;  5C3J A;  3OQO A;  2VKH A;  3LSV A;  5IWA T;  4GK0 E;  2XHE B;  3HA4 A;  4FJO A;  2WDQ A;  1NER A;  3AE1 A;  3NRY A;  5DAB A;  2V7I A;  4DR7 T;  3QB5 A;  2NW7 A;  5LHI B;  1WR0 A;  3NZQ A;  2WSS V;  4X4E A;  1YXR A;  3GUU A;  4H9Q C;  4DV0 T;  3EAM A;  3RX6 A;  2W62 A;  3DM5 A; 
#chains in the Genus database with same CATH homology
 1LKX A;  1EFA A;  2KEK A;  3NZP A;  4PJM A;  2CEA A;  4E7S A;  4MFR A;  1WIZ A;  1MMD A;  1X57 A;  2VKD A;  2LT3 A;  1B0N A;  2PUE A;  1HCI A;  5KDM C;  5LG4 A;  1BR0 A;  2C5K T;  5L3G B;  3CML A;  4OYK A;  4MLK A;  3GA8 A;  2IVG A;  2A72 A;  2QA7 A;  3DP7 A;  3AAE B;  2LYR A;  3B57 A;  3OJA A;  2CCQ A;  3F6W A;  2C5I T;  4KMC A;  4ZI3 D;  4X4G A;  5KX5 E;  2O49 A;  5A1L A;  3ZN0 B;  3O4X E;  3LK3 B;  5JR9 A;  3V5S A;  4TZ4 C;  4YG4 A;  2DWK A;  3QQ6 A;  3BK9 A;  3PXP A;  3F52 A;  2Q9Q A;  3LBX A;  3N9L A;  4U72 A;  2AXV A;  4EYU A;  1CJG A;  3RPU A;  3ZYL A;  2V7K A;  3PU3 A;  3PUG A;  3PU8 A;  1S7E A;  2R1J L;  2YU1 A;  4PJN A;  1WYC A;  4CQI A;  1U5P A;  2W63 A;  1ZPQ A;  2BNO A;  2Y6X A;  4NUV A;  3PUS A;  2H7V C;  1LCD A;  3Q5X A;  2X0L B;  2GK9 A;  2X9X A;  3AVS A;  2BDE A;  1YKE B;  3ZCJ A;  2KIN B;  4UVA B;  2JQQ A;  1H7C A;  2KXP B;  2WAU A;  4I43 B;  1ZVV A;  2L49 A;  2CLY C;  4PU4 C;  4Z5H A;  1SA0 E;  2W61 A;  2HH7 A;  4YLH A;  2M67 A;  4PK4 A;  3K3Q C;  4AKL A;  5HAX A;  3CWZ B;  1LCC A;  5A7L A;  1IZN B;  3O9X A;  3H3A A;  3RYC E;  1B7T A;  2E9X B;  4IHJ E;  5LP6 E;  1PRV A;  1QP0 A;  1T98 A;  2D5U A;  5C8Y E;  2H3R A;  4IWR A;  1FEW A;  2YU2 A;  2HSG A;  1SHZ C;  2Q9Q C;  2XQY A;  2KZ8 A;  1YD8 G;  2X68 A;  3KFW X;  4ASK A;  5M4Y A;  2XAG B;  5JR9 B;  2V7M A;  3ANW B;  3CQG B;  4EZH A;  3F31 A;  1WRD A;  1HX8 A;  3HKC E;  5LYJ E;  4L9I A;  3UTK A;  2IAK A;  1HS7 A;  1BDI A;  3MK7 C;  3VKH A;  5JDG A;  1O3X A;  2JJ9 A;  4Z8X A;  1MNE A;  2XAQ B;  2KZ7 B;  2CXL A;  4KUM B;  3UUL A;  3KZ3 A;  2WWU A;  3PUR A;  5LGN B;  4GK5 E;  4O2B E;  4ZS3 A;  3QYX A;  3AA6 B;  5FXW A;  5LJN A;  1ZZ7 A;  2MBG A;  3WAK A;  1IJ5 A;  2IVB A;  2PUB A;  3AAI A;  1UCU A;  4HFV A;  3SRZ A;  5HYA A;  3VHL A;  2CXF A;  2JCG A;  1WH8 A;  4I55 E;  2LSI A;  4WBO A;  4X4F A;  4PW8 A;  3RYH E;  2H7O A;  2X67 A;  2BVL A;  2K24 A;  4ZI3 C;  1Y9Q A;  3KV9 A;  3LK4 2;  3LIS A;  3KJX A;  4AKI A;  2CE7 A;  3NRX A;  4KBM B;  3BQK A;  3FXE B;  2PUD A;  4AKR B;  3AA7 B;  1OCT C;  2EBY A;  4IST A;  3CLC A;  4IE5 A;  4YBA A;  2LSK A;  3OQM A;  2BZB A;  2AWI A;  3FBZ A;  1D1C A;  1HG5 A;  3Q2M A;  3ESL A;  2LYP A;  1DWK A;  1FMV A;  2LSG A;  4C90 A;  2E9X D;  3EUH A;  3AB3 B;  4Y42 A;  4YG7 B;  2MYS A;  2EHO C;  2PG8 A;  3HI2 A;  3OBV E;  3ZMT B;  5LBM A;  2WMN A;  3KIN B;  5JQG E;  2L8K A;  2V1D B;  4QXB B;  2CM0 A;  2L3L A;  4MHC A;  4BA9 A;  4QX7 B;  4ZI2 C;  3L09 A;  4WNK A;  2IW5 B;  4EIW A;  5K98 B;  1RZS A;  2D2S A;  2LOS A;  4FI5 A;  4P0A A;  3BQL A;  4GQM A;  3ZHI A;  2B1E A;  3AAA B;  1FMW A;  5DQV A;  3ZPO A;  1OSL A;  3CPZ A;  2DWG A;  4DND A;  5L3E B;  2K9A A;  1QQB A;  2OFY A;  1MIW A;  1R69 A;  3C98 B;  3OMT A;  4GOU A;  2WBL A;  1GT0 C;  3LFM A;  3MJX A;  2NW9 A;  3ZKC A;  5JVD E;  1ZZ6 A;  2BNN A;  4AKG A;  5LHG B;  2IUO A;  1EZ3 A;  1ZZC A;  2CRO A;  2X9W A;  1WYB A;  1Y64 B;  2EHO A;  4X1Y E;  2OR1 L;  1RPE L;  4AQF C;  3KXA A;  2QGS A;  1MMG A;  1KNZ A;  4XBF B;  2IC9 A;  4OHF A;  1NEQ A;  4L0R A;  2EHO B;  2JPF A;  1Y7Y A;  1ZZB A;  3K3O A;  4JUY A;  4P09 A;  3F51 A;  5FP3 A;  3L3P A;  3WI3 A;  5HXC A;  3BD1 A;  2XAJ B;  3JC6 C;  3O1J A;  4TV9 E;  5LA6 E;  5CB4 E;  3ZN1 B;  3L1P A;  5JRE A;  3OYX A;  3J9X 1;  4C91 A;  5LHH B;  2H8R A;  1YKH B;  2N2N A;  1UTX A;  4PU3 C;  3GN5 B;  1ZS4 A;  2VWA A;  3LFP A;  3K3N A;  3BQI A;  5HWY A;  2L9Q A;  3UUX B;  1CUN A;  4AI6 A;  4X1K E;  3Q9D A;  2A2F X;  3QK6 A;  4JQD A;  3CVR A;  3AA0 B;  3HKB E;  5LGU B;  2Y48 B;  2C0S A;  4N78 D;  2KEI A;  1HF8 A;  1ZKE A;  3PUA A;  4H9N C;  4AQF A;  3TRB A;  3C4X A;  3RH3 A;  4BAY B;  1IAP A;  1U4Q A;  2GRM A;  2LE8 A;  3K8P C;  4I4T E;  3R6N A;  5E0O A;  2YEV C;  2HIN A;  3N2K E;  4HKA A;  3ZMS B;  4BJM A;  3RZZ A;  3IF8 B;  1OXZ A;  5EZY E;  5J2T E;  4X4D A;  1E3O C;  2LEH A;  4H63 H;  3I1A A;  1LRZ A;  1O4X A;  4M1P A;  2N9D A;  2NOX A;  5H6Q B;  1POU A;  4IVZ A;  1ZZ9 A;  5EK4 A;  4AXP A;  3F57 A;  3N9O A;  4UXN B;  4X4I A;  1D1A A;  1S94 A;  1QPZ A;  2CWY A;  4PU8 A;  3E22 E;  4UVB B;  5ADX L;  2IV1 A;  2XCJ A;  5FMN A;  3VU7 H;  4QX8 B;  2LSJ A;  4UV9 B;  2N1G A;  4B6X A;  4CZZ B;  3H37 A;  4PJL A;  4ADZ A;  4GIW A;  1KK7 A;  2Q9Q B;  3LBX B;  1YSE A;  4O4H E;  2R63 A;  3E0Z A;  4YG1 A;  5L2L A;  3FYA A;  1LLI A;  2J1D G;  1DW9 A;  2VKO A;  4ZOL E;  1PNR A;  3ZLI A;  5HXE A;  4QXC B;  5J2U E;  1MMN A;  3EVY A;  4EOZ B;  3ZC1 A;  2GZU A;  2HPL A;  3N9M A;  4EB6 E;  5LNK A;  3R84 B;  2PUF A;  4ANJ A;  4O4J E;  2UXX B;  5JRC A;  4FBI A;  3RRC A;  1HF0 A;  1L1M A;  3B13 A;  2LYQ A;  5LOV E;  2G0U A;  4X1I E;  4H9R C;  1RIO A;  1QP7 A;  2ODU A;  2E8I A;  2Q9Q D;  4I6U A;  3ZC0 A;  2PIJ A;  5TAO A;  2AW6 A;  3N9P A;  4Z59 A;  5L3C B;  3BS3 A;  1PER L;  4X4C A;  1WLX A;  4FN3 A;  2NW8 A;  2NWB A;  4NUU A;  2K48 A;  3ZMV B;  2D5V A;  5IYZ E;  3N9N A;  4IIJ E;  4TX5 A;  2WIU B;  1NAF A;  1RZR A;  4IE7 A;  4ILU A;  4MAL A;  3RYF E;  4OK0 A;  5KMG P;  2KLQ A;  2ICP A;  5GON E;  4KP3 C;  1X2L A;  2XI8 A;  2PUC A;  3TKL B;  2O4A A;  4TUY E;  4CXY A;  3EUS A;  3S8Q A;  1VRB A;  1D0Z A;  2RP4 A;  4JLE A;  4WW0 A;  5F3J A;  4H9S E;  4X4H A;  2KMF A;  4DMW A;  2XIU A;  4MCX A;  3QUJ A;  5JDQ A;  2UXN B;  1ZUG A;  3MA9 A;  4DBR A;  4H63 V;  2CLY B;  4YJ3 E;  3HR0 A;  4Z58 A;  4I6T A;  4EZ4 A;  4PK5 A;  1QQA A;  1R63 A;  2SPC A;  4PNI A;  1MIY A;  2PUG A;  2PUA A;  5JDH A;  3M65 A;  4HE8 A;  3FYM A;  4JCY A;  4V1A v;  3J7Y q;  3UUM A;  2DI4 A;  3I9Y A;  1WET A;  2KWH A;  3G5G A;  1BR4 A;  3ZMZ B;  4E7Z A;  2DLR A;  2DCF A;  3A5X A;  4O8B A;  4Z5D A;  4CXX A;  4CI2 B;  3I0O A;  4O2A E;  2MTQ A;  3FHN A;  5BMV E;  3KBU A;  2CXD A;  2X9Y A;  5EK2 A;  2KND A;  2IVQ A;  2LYS A;  1UXC A;  4DVD A;  1IJ6 A;  5JDN A;  3FB2 A;  2X66 A;  4UV8 B;  4XAX B;  5AFU L;  3QF3 A;  1PRA A;  1ZEE A;  2WMO A;  2X9H A;  3CX8 B;  3VK0 A;  4YAR A;  3PDY A;  3DTO A;  5LXT E;  4P0B A;  1LQC A;  2DHR A;  3U78 A;  1QSD A;  1SQ8 A;  1BR1 A;  2PPX A;  4DO0 A;  5HXS A;  5JR9 C;  5L3D B;  4IGU A;  3MZK B;  5FXX A;  2LHN A;  5FXV A;  4UVC B;  5HXR A;  3IEE A;  3MKD A;  3R1F A;  2CA5 A;  2ES0 A;  4GYS A;  1ZV4 X;  1LMB 3;  3RC8 A;  2VL8 A;  1HFA A;  3SS1 A;  2PE5 A;  3C4Z A;  2KPJ A;  2LSY A;  4QWN B;  5DJQ C;  3JXB C;  1D0X A;  1S35 A;  3C51 A;  1US7 B;  4PAG A;  4BJN A;  5JH7 E;  3C50 A;  3I9W A;  3H5T A;  3GN5 A;  2LOP A;  5H6R B;  3NBX X;  1UXD A;  2CWO A;  5J1G A;  3RRW A;  3KVA A;  3ZYK A;  2IU7 A;  2XTL A;  2LHR A;  2CMR A;  2O38 A;  2LM9 A;  2MQK A;  1UX4 A;  2P9B A;  2PJQ A;  1WR6 A;  3KV4 A;  3IBP A;  4HTE A;  4IDZ A;  4UEM A;  3P8C D;  4PU7 A;  3S4U A;  4DBQ A;  5CA1 E;  3DJB A;  5JDL A;  1LVK A;  2KEJ A;  2PBI A;  4UF0 B;  3HL6 A;  3ETV A;  3HKD E;  2RA1 A;  4H9P C;  4ISS A;  2NP9 A;  2VK9 A;  5CA0 E;  5L3B B;  2B5A A;  1YW0 A;  3D1N I;  1IC8 A;  3SOL A;  3MAC A;  5LGT B;  1VOM A;  2ZM8 A;  2KT9 A;  1JWL A;  3DNV B;  2XSD C;  5JDF A;  4L5G A;  3VKG A;  4IE0 A;  1JH9 A;  3BDN A;  2VKJ A;  4CI1 B;  1WH6 A;  2ZMA A;  2JMH A;  3CEC A;  4WBN E;  3I0Q A;  4U74 A;  4PK6 A;  4XZC A;  3OQN A;  3PE0 A;  4PFP A;  1D1B A;  3ONX A;  3O1I A;  5FNV E;  3F2E A;  4HGA A;  3SCH A;  2KWI B;  2VAS A;  3N9Q A;  2CSF A;  3C4W A;  2C5J A;  3FBL A;  4H9O C;  2LYL A;  1PRU A;  4NDW A;  1NWM X;  4I50 E;  2XJ3 A;  2IC6 A;  4UEL A;  2WUS R;  3D0T A;  2OA5 A;  3KDS E;  3CKD A;  5IHY A;  4I8T A;  3C64 A;  4OFZ A;  2FJR A;  2WM9 A;  5ETW A;  2XAH B;  3Q5W A;  3FXD B;  5L3F B;  3EDU A;  4G2A A;  2AXZ A;  4GYR A;  3GWH A;  3IVP A;  4O4L E;  3JXC L;  1UX5 A;  4JEH B;  3MLF A;  2JRK A;  4QKN A;  1X79 A;  3U3I A;  2BNM A;  4O8S A;  5FY7 A;  1FIO A;  2A6C A;  2L8N A;  2YIN A;  2ACX A;  3ETU A;  2BVM A;  2ICT A;  3ZJ1 A;  2ZM0 A;  1HG2 A;  4ZI2 D;  2AXU A;  3LJC A;  4Z5C A;  3ZEF B;  3U3W A;  4EAH A;  2MEZ A;  2AUW A;  2D0T A;  3E08 A;  3KBT A;  4I6R A;  1HTJ F;  3N5L A;  3QC9 A;  1AU7 A;  5F8P A;  3UUN A;  2D0U A;  1ZHC A;  3O1H A;  4O4I E;  4J1W A;  3HZI B;  3KV5 A;  1MMA A;  1JFS A;  2LYK A;  4F6R C;  3RKO A;  2ZM2 A;  3QWG A;  4YFS A;  4JCX A;  3FMY A;  4EXT A;  1ZZ8 A;  4PJJ A;  5LCY A;  1ZAY A;  4G63 A;  1G73 A;  1V9D A;  4IE6 A;  2HPJ A;  2YK0 A;  2NTX A;  4J2C A;  1QP4 A;  3SWH A;  4CXW A;  3ZYM A;  3CQX C;  2PFV A;  5JDM A;  4X4B A;  3ANW A;  3G7D A;  4OB4 A;  5FXZ A;  4AQG A;  4JEU B;  3PUQ A;  3KVB A;  5FY0 A;  4EYY R;  5HWX A;  3N2G E;  3W15 B;  1AJ3 A;  2GRL A;  4J1X A;  5DQW A;  2XAF B;  3GBF A;  2E9X A;  2EWT A;  3CX6 B;  4IE4 A;  2ZLY A;  3ZCI A;  3SCG A;  2V7J A;  1XWR A;  4HN9 A;  3CRO L;  2V26 A;  1G8X A;  3LK2 B;  4X20 E;  1E1H B;  2X51 A;  1ADR A;  1D0Y A;  4F8D A;  2XUE A;  3IHR A;  1MND A;  5FYM A;  2MOZ A;  3P7I A;  2W0G A;  5LBQ B;  4IA8 A;  3OKQ A;  3PTR B;  3B7H A;  5HXH A;  3AVR A;  4HEA A;  5EK3 A;  3RC3 A;  3JXD L;  3V5U A;  1RZR D;  4UIG A;  4TV8 E;  2XAS B;  4K0U A;  3KV6 A;  4GHJ A;  3UFD A;  3N2O A;  4TN7 B;  3UFE A;  2LYJ A;  3ZMU B;  3ZHM A;  5LJM A;  4OYJ A;  2K5B B;  4MCT A;  2V7L A;  5JRC B;  3SCF A;  1BDH A;  3CQC B;  4PFO A;  4ZI7 E;  4AKH A;  2NTY A;  3MXZ A;  2E9X C;  3RYI E;  4YJ2 E;  3CX7 B;  2JMK A;  4ZS2 A;  4MBQ A;  1JFT A;  4ERR A;  3AA1 B;  2ODV A;  4ZHQ E;  1OWA A;  2BJC A;  3T8O A;  4QHO A;  2Y8D A;  3OQO A;  3GMI A;  2VKH A;  1BR2 A;  2DNX A;  4YHJ A;  3OP9 A;  4GK0 E;  2XHE B;  2EF8 A;  2EHO D;  3HA4 A;  4FJO A;  1LVF A;  2Z6E A;  4A56 A;  1NER A;  3NRY A;  5DAB A;  2V7I A;  2VB6 A;  2LCV A;  2A3D A;  2NW7 A;  1VPW A;  5LHI B;  3NZQ A;  4QXH B;  2W00 A;  1CQT A;  2WSS V;  3LG7 A;  3ZJ2 A;  4X4E A;  2I59 A;  3HKE E;  4H9Q C;  4CI3 B;  1QUU A;  3EDV A;  5FY1 A;  3RX6 A;  3WAJ A;  3JC6 D;  2JVL A;  1Z0P A;  2W62 A;  3OYZ A;  1MIV A;  2LJL A;  3UT5 E;  4UF0 A;  4DMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...