3GN5A

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
b'HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5A02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5A01
2FJRA 1IC8A 4Z5HA 3BS3A 2HSGA 2B5AA 1ZUGA 2A6CA 3GA8A 2PIJA 1RPEL 3G7DA 3VK0A 3EUSA 4PU8A 2BNMA 2PUGA 1LCCA 3B7HA 2XSDC 1B0NA 1BDHA 2PUDA 2LYLA 2KEJA 1Y7YA 3QQ6A 4GHJA 2L8NA 3LFPA 3F52A 2OR1L 4O8BA 2R1JL 1QPZA 4J1WA 1WH6A 1DWKA 4X4EA 3SCFA 4PU3C 2KEKA 3OP9A 3QWGA 1RZSA 1ZZBA 2MQKA 2IVQA 2O38A 3OQOA 1RZRA 1L1MA 1E3OC 1EFAA 1DW9A 2LYSA 2BJCA 1PRAA 3SCHA 2JVLA 1O4XA 4YG7B 2PUBA 1JFTA 2BNOA 3GN5B 1S7EA 2ICPA 3DNVB 2LCVA 3SCGA 1CQTA 1QP7A 1UXDA 2XI8A 3L1PA 1LLIA 2HINA 3HI2A 2PE5A 4MCXA 2KEIA 3HZIB 1HF0A 1RZRD 4IA8A 4X4GA 4OB4A 2AXUA 3QYXA 2GRMA 4Z58A 2GRLA 3F6WA 2IV1A 1PRUA 1ZZCA 1NEQA 3MLFA 1JFSA 2IVBA 1VPWA 4JQDA 2EWTA 4X4DA 3RZZA 2EF8A 3QF3A 3ZHIA 2KZ8A 4X4FA 2PUFA 3FMYA 1UXCA 2XCJA 1JWLA 1POUA 1Y9QA 2AXVA 4JCYA 4PU7A 2D5VA 2PPXA 4J1XA 2AWIA 4GQMA 3G5GA 1QP4A 2MEZA 2CROA 4PU4C 3PXPA 1AU7A 4YARA 3O9XA 1ZAYA 1R69A 4I8TA 3IVPA 2AUWA 3R1FA 5A7LA 2XJ3A 2AW6A 1UTXA 1X57A 2LYQA 2LYJA 2LYPA 4FN3A 3KXAA 2IU7A 2L49A 1QP0A 4Z5CA 1QQBA 1LCDA 3D1NI 1R63A 3CECA 3FYAA 2O49A 4NDWA 3KJXA 2PUEA 4Z5DA 1NERA 2IUOA 1ZZ8A 2GZUA 3KZ3A 1X2LA 4IWRA 3U3WA 3GN5A 3JXCL 1SQ8A 4X4IA 1YSEA 4YG1A 4X4CA 3GBFA 1OSLA 2KPJA 1WETA 2OFYA 2R63A 4IVZA 3ZKCA 4JCXA 2LYRA 1PERL 2EBYA 3TRBA 3OQMA 1LQCA 4FBIA 4X4HA 4Y42A 2IVGA 1PNRA 2XIUA 5K98B 2H8RA 3JXDL 2BNNA 4YBAA 1PRVA 1WIZA 1ZS4A 3CLCA 4YG4A 4X4BA 4Z59A 1BDIA 3LISA 4F8DA 2ICTA 3F51A 4I6RA 2PUCA 4I6UA 3BDNA 1ADRA 2WIUB 3ZHMA 1QQAA 1ZZ6A 2AXZA 1WH8A 1JH9A 1ZZ9A 1OCTC 3FYMA 2CSFA 3OQNA 3CROL 2O4AA 1ZPQA 2LYKA 1ZZ7A 3BD1A 1RIOA 1ZVVA 3H5TA 3OMTA 2WUSR 1GT0C 3JXBC 3S8QA 2PUAA 4MCTA 4I6TA 1LMB3 1XWRA 1CJGA 2JCGA 3UFDA
chains in the Genus database with same CATH superfamily
4BJNA 1VRBA 4Z5HA 2N2NA 5DSXA 4YSYA 2XM1A 1BR2A 2JQ9A 2JQQA 3C51A 1LCCA 1N36T 4UF0A 2JQKA 4CN4A 5FXVA 5IHYA 2IW5B 2PJQA 2KEKA 1RZSA 4L5GA 2VQET 2C0SA 3A9YA 2LYSA 3AE9A 2HH7A 1S7EA 4YT0A 1QP7A 4UELA 4LF8T 2E9XD 4MCXA 3UU3A 1D1CA 1MMDA 2LRLA 4Z91A 3QF3A 2BG9B 3RYIE 2KLQA 2Q9QD 1QP4A 1DU2A 4Z8XA 3ZMTB 2AW6A 4JEHB 3P4PA 4KX6A 4YJ3E 1LVFA 2NW8A 3FYAA 3IF8B 3PUWF 4U2ZA 3T1HT 3MACA 2V7KA 5C3JA 2R63A 2J7UA 2D0UA 1MIWA 1D0XA 2H8RA 3AE4A 3EI0A 4LF4T 4Z59A 1E2AA 3OPCA 3ZHMA 4M1PA 5AQUB 2IC6A 1ZZ9A 2BVMA 3RRWA 2XUEA 4EEDA 5L3GB 4COFA 3OQNA 3KV9A 2K9AA 5GONE 4X1KE 3CK6A 4O8SA 2X0YA 4IIJE 3ZMZB 4KHPT 4BAYB 2C5KT 5LHIB 4JUYA 2PIJA 4EQZA 4G2AA 5CGMA 2LLYA 1QUUA 2PUDA 2XQ5A 5HWXA 3NBXX 4JYAT 1DWKA 2KEIA 3RIFA 5JDMA 2LHRA 2X0HA 4X1YE 5HEJA 3U78A 5CA0E 3N2KE 2PXQA 3JCFA 3SCGA 3KFWX 2PXBA 5JDLA 3CWZB 3SX0A 2YEVC 4Z58A 5JQGE 2W63A 5ABEA 3RZZA 3ZHIA 1UXCA 3ZSTA 2XCJA 2E5VA 2W62A 4GQMA 4H63V 4A5XA 3RH3A 1US7B 2LSIA 4B6XA 2HPJA 2UUBT 5L4HA 5KDMC 2V1DB 5AQJB 3HA4A 4JCXA 2Y6XA 3ZPOA 3CIRA 2J4GA 4JI4T 1MMGA 1WIZA 2D9DA 3KVAA 4Q2JA 1N34T 5JDHA 4YY3T 3AE1A 1ZZ6A 4IE4A 3LDQB 4ER7A 3BQKA 3O1JA 3AE5A 4PK5A 3OKZA 1ZZ7A 3CQCB 1N32T 4I6TA 1HNXT 1OEDE 5LJMA 3BS3A 1ZUGA 1RPEL 5DTQA 3VK0A 1OEDC 4HFIA 3TKLB 3UU8A 4HFCA 3QQ6A 1NENA 2ACZA 1QPZA 2M6IA 4P0AA 3QNUA 3PV0F 2PUBA 1LVKA 2FBWA 2XQYA 2XQ8A 2XY8B 4ISSA 2W61A 5BR8T 2LCVA 4LFCT 3ETVA 4B3TT 3C4ZA 1MNDA 2DWKA 1VOMA 5L2LA 2EF8A 3MZKB 4C91A 1POUA 2AXVA 3FXEB 3N9OA 1HFAA 5L3BB 4GKKT 2E9XB 3ESLA 3AA1B 2E8IA 3LFMA 2L49A 4Z5CA 2LT3A 4JI7T 2F4VT 2PXTA 3RIUA 3MK7C 1NERA 3EUHA 5AQSB 3VR9A 2XSAA 3KZ3A 3JXCL 4ZI3C 4DNDA 2HCSA 4X4CA 3L09A 3GBFA 5FXZA 1LQCA 2A72A 5LHHB 2D5UA 2BKNA 2BBJA 1T72A 4O2BE 4XAXB 2XQ4A 3AEAA 3IEEA 1WH8A 5DRYA 3RYHE 5JREA 4EAHA 5JRCB 4QX8B 3UUNA 4Z90A 2AXDS 4CN6A 3N5LA 3EAMA 3K1SA 3X1DA 2J7WA 3NZLA 3A7MA 3P4WA 4OK0A 1XNRT 1ZV4X 2FJRA 4JI8T 4DR7T 4DVDA 1E1HB 4F8HA 4ZI3D 3ZMUB 4HKAA 4YFSA 3F57A 2R1JL 3CROL 3OP9A 1ZP0A 2PXVA 4KBMB 4LF7T 4QXCB 1J5ET 3NROA 4CI2B 1KNPA 3F2EA 4WNKA 2XI8A 3NZPA 2LHNA 4EKGA 4LF9T 3HZIB 3LK42 1L0VA 3P8CD 3FBZA 4IDNA 2XAQB 4X1IE 3N9QA 2KZ8A 2YU1A 1Y9QA 3VU7H 4X66T 1IBKT 2D5VA 5F3JA 4QXHB 2AWIA 4N78D 1WRDA 1AU7A 1R69A 2ES0A 4TWDA 4HN9A 2N1GA 4DE8A 2HN2A 3C4WA 4OHFA 2YDSA 3CECA 5AQFB 4HWCA 3AXJA 4HRAA 3OVUA 1IBMT 4AI6A 4IWRA 2VVNA 5FYMA 2V6XA 2A9UA 2CM0A 1UX5A 2K48A 5LHGB 5K98B 4TWHA 1HG5A 5LYJE 3ZN1B 3N9LA 4IL4A 3F51A 3AE3A 4LF6T 3E22E 2LE8A 2XQ3A 4QX7B 2HPLA 5F5WA 4GIWA 2MTQA 3QOFA 3OYZA 4HE8A 2DWGA 2PUAA 2LRKA 5EK4A 4O4IE 2Y8DA 3HKEE 4KMCA 3EDUA 4HFDA 1BDHA 1OEDA 4EXTA 2BBHA 4GHJA 4ERRA 3KINB 2LJLA 3QWGA 2O38A 1ZZBA 5HCMA 1EFAA 3AXJB 4WW0A 1NW3A 3ZPXA 4QXBB 4KUMB 4BA9A 3PUXF 3HR0A 4ZS2A 1WYCA 4MHCA 2J1DG 3S4UA 3HI2A 5AQMB 3TFLA 4LFBT 3QYXA 4L9IA 4U3CA 2PBIA 1XZYA 2IV1A 2YDQA 5LG4A 4X65T 2WDQA 2X66A 3FMYA 2WZIA 2PPXA 1ZAYA 4HGAA 2XSBA 4PFPA 4HWIB 3UUXB 3WI3A 5DT2A 1R63A 5LNKA 5AQQB 4JLEA 2PUEA 3UFGA 2OLTA 4I4TE 3AAEB 1X2LA 2ZMAA 2LEHA 3MJXA 2WWUA 5AQTB 4HFBA 3ZKCA 2EHOD 1LKXA 4X4HA 4X20E 4P1NA 4JV5T 4YBAA 4LMJA 1WYBA 4ZZBA 4I6UA 3JAFA 3KBTA 5CJ5A 1SA0E 2J62A 2WMOA 3A9XA 4IE6A 2JRKA 2WM9A 3MXZA 4IDZA 2VB6A 1XMOT 5C2TA 4IREA 3M65A 2X9XA 2V5DA 2WUSR 3VKGA 3BQLA 3R6NA 1Z0PA 1H7CA 2DLRA 2UU9T 4IE5A 1NWMX 3NXHA 1O3XA 1XWRA 1S94A 2V7IA 1CJGA 3CX8B 2W0GA 2CXDA 2CXFA 3RF1A 1X9BA 2UXNB 3ZSSA 4H9QC 3EABA 4CI1B 4O4LE 1MIVA 4B3ST 5AQPB 2E9XC 2PXFA 3OQOA 4LFAT 2MQKA 1M7KA 4UV8B 4HFVA 3UFEA 3RX6A 2ICPA 4WZXA 2LNMA 4PJJA 2HINA 4DR5T 2C5IT 2V6YB 2Q9QC 1MMNA 4IA8A 3F6WA 1PRUA 1JFSA 2HN1A 2PUFA 1VCSA 4ILUA 4TV8E 4AQFC 2KZ7B 3FHNA 2MOZA 4IDOA 3G06A 4ER0A 1UGOA 3AEBA 3PUSA 2QA7A 4OYKA 3DTOA 4ZXLA 3PJAJ 3I0OA 3K3OA 1ZZ8A 4ADZA 2OFYA 2I0MA 3L8RA 1MMAA 2XIUA 2BNNA 1FMVA 2RA1A 4YSZA 3O1HA 4B3RT 3WAJA 4DR3T 3I9YA 2AXZA 4EZ4A 5HWYA 2WAUA 2VQFT 1SHZC 2CPTA 4UEMA 4HWFA 3S8QA 4GKJT 5IYZE 4YJ2E 4DV0T 4ER5A 2KWIB 1IC8A 4WYVA 5HXCA 4V1Av 5LBMA 3EUSA 3CX7B 1B0NA 4KHZF 3AEFA 3QUJA 1D0ZA 1I94T 5DQVA 3Q2MA 2XQ6A 3M9LA 4PJNA 5HCJA 3AE2A 3LQXA 1VPWA 2QRXA 1NEQA 2YDRA 1IZNB 4F6RC 2QGSA 4DV2T 4EZHA 2KXPB 1HTJF 2E2AA 2LSJA 4K0UA 2K24A 4IDPA 3IA3A 2PXLA 1X57A 2VL8A 1FJGT 1UUSA 2VKJA 2JJ9A 3K8PC 2E5LT 2IUOA 2WBLA 5GAGi 3GN5A 5AQOB 3P7IA 3ZYMA 3N2GE 2V26A 1PERL 2CLYC 4ILAA 4TNWA 3AAAB 2IVGA 3E08A 3LSVA 4DV5T 2WU5A 4I0UA 3LK3B 1XMQT 4WVLA 1ADRA 2V7JA 4U7IA 1OCTC 3TLSA 2WDRA 2XQAA 3U3IA 3UT5E 3H5TA 2LKGA 3N9MA 4OYJA 3JXBC 3JC6D 4EV6A 3IBPA 2DCFA 4DV7T 2OA5A 2HSGA 2B5AA 3GA8A 4O4JE 1QSDA 3KVBA 3O1IA 2MXDA 4HTEA 2M4HA 5AFUL 2E9XA 1IJ5A 1BR4A 2XAHB 3PUYF 3SCHA 3QOXA 1E7PA 3GN5B 3J7Yq 1QLBA 2LOPA 4KP3C 2PE5A 1HF0A 1RZRD 2XXQA 4WBOA 4Q25A 2UUAT 5ETWA 2V5CA 1X79A 4UIGA 1JWLA 1HNZT 4UVAB 3ZKRA 4AQFA 3AECA 3W15B 2DL1A 4PU4C 2VKOA 3ZYLA 3O9XA 4AXPA 3AA7B 3B5MA 5A7LA 2X0LB 2PXEA 5LA6E 2LYPA 2W67A 5HEUA 5JRCA 2XAGB 5C8YE 2O49A 4YHJA 3SR4A 3ABVA 3N9NA 3V5UA 5LP6E 2NW9A 1KF6A 2CEAA 2KPJA 2IUBA 4GOUA 2EBYA 4U2YA 4PFOA 3FZKB 3R84B 2X9HA 4AQYT 3RLFF 2BS2A 2ICTA 4ZS3A 3ZC1A 4DO0A 5AQVB 4J2CA 5LGUB 2UXBT 4AKRB 5LMNT 4QKNA 2YOEA 2Q9QB 2PXKA 1FIOA 3D0TA 1GT0C 2WSSV 2XQ9A 3ZC0A 4PK6A 3PURA 3NDBB 2M67A 3FBLA 1V9DA 4JI6T 2D0TA 3UU5A 1SUMB 3RHWA 5JDQA 4H9SE 3BQIA 4X5TA 3ZCJA 5ABFB 2Y48B 3J9X1 1W0AA 3EDVA 4BJMA 1GQEA 4QH5A 2UXDT 4YG7B 3UQ7A 1JFTA 2NTXA 4ZI2D 3L39A 5GAHi 3KV5A 3PU8A 4I50E 3DJBA 2GRMA 2JMKA 1ZZCA 3QB5A 4TNVA 3RGLA 3TELA 2ZM0A 5L4EA 3ZJ2A 4IT4A 4OX9T 4U7YA 2H7VC 2KMFA 3CPZA 4P09A 4EOZB 1I6ZA 1JNRA 1T8BA 4I8TA 1VCTA 5LOVE 4MLKA 1ZHCA 2IU7A 2JPFA 3LK2B 3D1NI 2BZBA 3H37A 2WQYA 2A2FX 2NOXA 3ZT7A 2VVSA 1SQ8A 2K5BB 5HAXA 2CHNA 3AE6A 4HFEA 2N9DA 3AEDA 3HKDE 4E7SA 4AQGA 2K3WA 3CMLA 1YKHB 4F8DA 3BDNA 4JBWF 3P4SA 4XZCA 4YTPA 4DUZT 4X62T 2LSKA 1ZVVA 1HCIA 3ONXA 3GUUA 4H9OC 3ME5A 2LM9A 4L0RA 4O2AE 3UQ4A 2CHOA 1HR0T 3UFDA 3SRZA 2VURA 3CVRA 3N2OA 2BKPA 2BNMA 3CX6B 1UX4A 3NZQA 2IAKA 3PUVF 2KEJA 2UUCT 2W4XA 2OR1L 2PXUA 4O8BA 3AA6B 4DMVA 1L1MA 3Q9DA 5J2UE 3RYCE 2UXXB 2B76A 1KFYA 3UWPA 1BR0A 2IMLA 2CLYB 1AJ3A 2ZM8A 4AKIA 2L8KA 4U74A 4LF5T 2EWTA 3TLTA 4E7ZA 4QHOA 5HXSA 4OBMA 3G5GA 1U2ZA 3QB5K 4HWDA 2BS4A 3UU4A 1Y64B 3OBVE 3P4RA 4YLHA 3MA9A 2EHOC 2IHR1 2KNDA 5F8PA 4PK4A 3RC8A 2CWYA 5FXXA 2X51A 2GZUA 2WDVA 2H88A 4EEBA 4X64T 2VWAA 4YG1A 1OSLA 4IVZA 1DULA 1D1AA 5AQIB 5EK3A 3RQUA 3C98B 3ETUA 3PUZF 4JI3T 1G8XA 4JI1T 4NPPA 4DV6T 2G0UA 1D1BA 4H9NC 1J5WA 3QC9A 2QYWA 1YQ3A 3OMTA 3RPUA 4U72A 3SWHA 1LMB3 2V6YA 3ONLC 4CXWA 3VWSA 2LSGA 4CXXA 4NXNT 2ODRD 2MBGA 1BR1A 4ZI7E 3FB2A 3VRBA 4LMLA 4EIWA 2LLWA 4UR9A 2X9WA 2BKOA 4EGWA 1ZEEA 4KI0F 1Y01A 2DNXA 1W09A 2ZM6T 2VK9A 4JI0T 2LM2A 3HL6A 4MALA 4DV1T 5M4YA 4GYRA 2KINB 4IGUA 3A8YC 3F31A 3FZFB 3SFEA 4OB4A 3RI5A 3ZYKA 4ZOLE 2GRLA 2WU2A 3MLFA 2IVBA 2L1PA 3L3PA 4X4FA 2ZM2A 2XASB 3I9WA 1UURA 3UULA 5LCYA 2YKSA 2BVLA 5ABHA 2XAJB 4EYYR 2PFVA 2XJ3A 2LYJA 3TLUA 1NEKA 3RRCA 1UK5A 4ASKA 3KJXA 5HXHA 4AISA 1XDPA 5JR9C 4QH4A 1WLXA 5L3EB 3AEGA 1WETA 4U33A 3TLWA 1HQ1A 5LXTE 3NRYA 4NXMT 4YXDA 2NW7A 1OXZA 2D2SA 1ZS4A 3CLCA 4YG4A 3C64A 3PJAA 3KBUA 2X67A 3KL4A 1M62A 3H3MA 1IJ6A 2WMNA 4YTMA 2FUPA 3GMIA 3GWHA 3NRXA 5J2TE 3AVSA 5LGNB 3IHRA 4O4HE 5IUXA 4OFZA 3T1YT 3SOLA 4EB6E 3F52A 2CRBA 3JAEA 4PU3C 3SCFA 2YN6A 3FXDB 4DE9A 1LRZA 3MKDA 1XNQT 2AE9A 3PUQA 2PXPA 4C90A 1IBLT 4DR1T 5IWAT 1HS7A 3L1PA 5A1LA 1FMWA 2V3CC 3RIUC 2CA5A 2VL0A 2AXUA 3UUBA 5JDGA 2XM2A 4ILBA 1QZXA 2RP4A 3ZEFB 1WR6A 2LKHA 2WZHA 2LLVA 5DQWA 1JNZA 4UF0B 2V7LA 3OKQA 5FY7A 5LGTB 2RPAA 3GZDC 1W0BA 1MIYA 3R1FA 5LG3A 4DR2T 1UTXA 4DV4T 3KXAA 1KEYA 5H6RB 4DIDB 5H6QB 2CMRA 2EHOA 4G63A 3UUMA 4NUVA 4U31A 4NDWA 4ZEYA 3ZMVB 3A9ZA 4PJMA 4AKGA 3GZCA 5LMUT 4PAGA 1YW0A 2H7OA 1YSEA 2HFZA 2XPKA 1FEWA 5E0OA 4MFRA 5CA1E 2LOSA 4ER6A 5LB7B 1ZOYA 1BDIA 5HEOA 5DJQC 3JC6C 5L3FB 1D0YA 2W2UA 1YXRA 5AQKB 2PTFA 2O4AA 1ZPQA 1WR0A 5J0ZA 2LYKA 1N33T 4UVBB 5BMVE 3I1AA 4TWFA 2DI4A 2FJAA 3RIAA 2ODUA 2JCGA 1JH9A 3LJCA 4EZIA 3Q5WA 1YKEB 5FVKA 4AKHA 3ZJ1A 4LMKA 3NVOA 1R8IA 3JADA 2L8NA 3LFPA 1T7SA 2J47A 2EHOB 3A5XA 1NAFA 3RYFE 1E3OC 2IVQA 4UXNB 5JDFA 4HEAA 2BNOA 3N9PA 3QOWA 3RKGA 2WWVA 2I6HA 1Z8UA 3ZN0B 2IIUA 4NIQA 5HYAA 3P50A 2VKHA 3T8OA 2XAFB 3PTRB 2PG8A 2L3LA 3CKDA 3PDYA 2KSRA 3P4QA 4IE0A 4YARA 3ANWA 5HXRA 5JDNA 4CN1A 4FN3A 2LYQA 4GYSA 3ZCIA 1QP0A 5TAOA 3AAIA 2ODVA 3RQWA 2Q9QA 5AQRB 4ILCA 5FNVE 2YU2A 1UCUA 3HKCE 4CI3B 1KK7A 2CE7A 2GK9A 1YD8G 4ANJA 4X4IA 5JR9A 5FVLA 3AEEA 2WCAA 1J1JA 3OQMA 2KT9A 2X68A 2ZLYA 4EK9A 3JXDL 4H63H 1PRVA 2UXCT 4AKLA 1U5PA 2PUCA 1QQAA 1G73A 4TN7B 5KX5E 5ABFA 1B7TA 2WB5A 5FXWA 1S35A 5LBQB 4EKIA 2HCNA 3BD1A 1RIOA 3MEJA 2XQ7A 4QWNB 3VR8A 5EK2A 2IC9A 3G0TA 1YQ4A 3Q5EA 2XHEB 4PU8A 2PUGA 2V7MA 3ANWB 3B7HA 4ZI2C 3DM5A 3H3AA 2QVAA 1MFQC 5JH7E 1HX1B 2JQEA 3OTOT 2ACXA 3K3QC 3ZLIA 1T98A 2BJCA 5EZYE 5DTMA 4H9RC 3DNVB 1IAPA 5JR9B 4IDQA 4ISTA 2IDOB 3ZT6A 5L47A 2CWOA 1W9RA 3Q5DA 4AIUA 5CB4E 5DTRA 2XJ7A 4UV9B 5AQLB 2W00A 3AE8A 2MPKA 3V5SA 4DMWA 4PU7A 2KWHA 4PJLA 2CROA 1XDOA 3RC3A 4FJOA 3GZDA 2VKDA 4PW8A 2AUWA 1XWMA 3I0QA 2JMHA 3SS1A 2XXAA 2Z6EA 4ER3A 3FZMB 2LSYA 2BG9E 2CBJA 3AE7A 4Y42A 4HWHA 1CHUA 4I6RA 5L3CB 2BG9C 3K3NA 3KV4A 4I43B 1QB2A 2WY2A 2FJEA 3LG7A 3FYMA 2FFHA 5KMGP 4PNIA 3R09A 4CXYA 3VRAA 3M3ZB 4DBRA 3PUGA 4UVCB 4JEUB 3NKZA 3QK6A 5LJNA 3VKHA 2CXLA 3G7DA 3PUAA 2WS3A 2P9BA 3QFIA 3AA0B 4A97A 5FMNA 3Q5XA 3KDSE 1Y7YA 3C4XA 2H89A 4FI5A 4J1WA 1WH6A 4X4EA 1RZRA 1MNEA 1DW9A 2DHRA 1PRAA 2JVLA 1SE7A 2XZEA 1KNRA 3RKOA 1ZKEA 3NWIA 1CQTA 1UXDA 1LLIA 4X4GA 3PE0A 2VEOA 5JUWA 5L3DB 2SPCA 4DV3T 3OWQA 3TEPA 4J1XA 3WAKA 2MEZA 2JIWA 3PXPA 2WP9A 2CBIA 5AQGB 4IL9A 4MBQA 2V8SV 2CCQA 1QQBA 1LCDA 3HKBE 2HHHT 5AQHB 3EVYA 4JI5T 2I59A 4Z5DA 2W66A 1HG2A 2PXDA 2OV9A 5DRTA 5HEHA 2XXPA 3U3WA 3FZHB 2VASA 5JVDE 3SFDA 2L9QA 2B1EA 4DR6T 3CQXC 2LYRA 3PU3A 4QH1A 3TRBA 3ONJA 1HNWT 2YINA 4P0BA 1PNRA 4NUUA 4X4BA 4YSXA 4DR4T 3ZT5A 4GK0E 5FL1A 1WFDA 3OJAA 4WBNE 3ZMSB 4CQIA 2CSFA 2NWBA 4YTNA 3UU6A 4TUYE 5FL0A 1OWAA 3B57A 2BDEA 5HEGA 4IHJE 4MCTA 3PE5A 4GK5E 2R6GF 3AB3B 2A6CA 5FY0A 3OYXA 2XSDC 2NTYA 1WCRA 2LYLA 4YHHT 5FKYA 3O4XE 4CZZB 2FJDA 1HX8A 4A98A 4TX5A 2YK0A 1O4XA 4HFHA 3CQGB 5ADXL 2FJBA 5AQNB 2XTLA 2NR4A 3UTKA 4ZHQE 4JQDA 4K0KT 4X4DA 3AVRA 2A3DA 3B13A 2X9YA 3LBXA 5JTGA 1OEDB 2H3RA 4JCYA 3DP7A 4A56A 4EYUA 3IVPA 4DBQA 5HXEA 2C5JA 3KV6A 2NP9A 4ZZCA 4JI2T 4I55E 4TZ4C 5ABGA 5KXJA 3BK9A 4H9PC 2JQHA 5DABA 4FBIA 1HF8A 4IE7A 2YBDA 1U4QA 5CFBA 3LISA 4B3MT 2M6BA 1CUNA 2WIUB 2BS3A 2BG9A 3EHZA 2MAWA 1EZ3A 2MYSA 1KNZA 3TLVA 3FZLB 5FY1A 4DUYT 5J1GA 5FP3A 3E0ZA 3VHLA 3C50A 4TV9E 4XBFB 3LBXB
chains in the Genus database with same CATH topology
3FBLA 4BJNA 1V9DA 1VRBA 4Z5HA 2N2NA 3Q5WA 1YKEB 1BR2A 2D0TA 4AKHA 5JR9C 3ZJ1A 2JQQA 3C51A 5EK4A 4O4IE 2Y8DA 1LCCA 3HKEE 3EDUA 4H9SE 4KMCA 5JDQA 1BDHA 4UF0A 4EXTA 5FXVA 5IHYA 4GHJA 2L8NA 3BQIA 3LFPA 3A5XA 2EHOB 2IW5B 1NAFA 3ZCJA 3KINB 4ERRA 3RYFE 2LJLA 2PJQA 2KEKA 2Y48B 3QWGA 1RZSA 1ZZBA 2O38A 2IVQA 1E3OC 3J9X1 3RRWA 1EFAA 4L5GA 2C0SA 2LYSA 4UXNB 4WW0A 3EDVA 4BJMA 4QXBB 4KUMB 5JDFA 4YG7B 2HH7A 4HEAA 4BA9A 1JFTA 2BNOA 2NTXA 3N9PA 1S7EA 4ZI2D 3HR0A 4ZS2A 3KV5A 3PU8A 1QP7A 1WYCA 4MHCA 4UELA 2J1DG 3S4UA 3HI2A 2E9XD 4MCXA 1D1CA 4I50E 3DJBA 3ZN0B 1MMDA 3QYXA 2GRMA 4L9IA 2PBIA 2JMKA 2IV1A 5HYAA 1ZZCA 5LG4A 2VKHA 3QF3A 3T8OA 2XAFB 2X66A 3PTRB 3FMYA 2PG8A 2L3LA 3CKDA 2ZM0A 3RYIE 3ZJ2A 3PDYA 2PPXA 2KLQA 2Q9QD 2H7VC 1QP4A 2KMFA 3CPZA 4IE0A 4P09A 4EOZB 4YARA 4Z8XA 3ZMTB 1ZAYA 4I8TA 3ANWA 4HGAA 5HXRA 5JDNA 2AW6A 4FN3A 2LYQA 4GYSA 5LOVE 4MLKA 1ZHCA 4PFPA 2IU7A 4JEHB 1QP0A 2JPFA 3UUXB 3WI3A 3ZCIA 5TAOA 3LK2B 3D1NI 1R63A 2BZBA 4YJ3E 1LVFA 3H37A 5LNKA 2NW8A 2ODVA 2A2FX 3AAIA 2Q9QA 3FYAA 4JLEA 2PUEA 2NOXA 3IF8B 5FNVE 2YU2A 1UCUA 3HKCE 4CI3B 1KK7A 2CE7A 3MACA 2GK9A 5L3EB 1YD8G 4ANJA 4I4TE 3AAEB 1X2LA 2ZMAA 1SQ8A 2LEHA 4X4IA 2K5BB 3MJXA 2V7KA 2WWUA 5JR9A 5HAXA 2R63A 3ZKCA 2EHOD 2D0UA 1MIWA 3OQMA 1LKXA 2N9DA 2KT9A 4X4HA 3HKDE 4X20E 4AQGA 4E7SA 2X68A 1D0XA 2H8RA 3JXDL 2ZLYA 4H63H 4YBAA 1PRVA 3CMLA 4Z59A 1WYBA 4F8DA 1YKHB 4AKLA 1U5PA 2PUCA 4I6UA 3BDNA 3KBTA 3ZHMA 1QQAA 1SA0E 1G73A 4M1PA 4TN7B 4XZCA 5KX5E 2WMOA 4IE6A 1B7TA 2IC6A 1ZZ9A 2BVMA 2JRKA 2WM9A 2XUEA 3MXZA 4IDZA 1S35A 5FXWA 5LBQB 2VB6A 5L3GB 3OQNA 3KV9A 2K9AA 3M65A 3BD1A 1RIOA 2LSKA 2X9XA 1ZVVA 1HCIA 3ONXA 5GONE 4X1KE 4O8SA 4H9OC 2WUSR 3VKGA 3BQLA 2LM9A 1Z0PA 4L0RA 4IIJE 4QWNB 3R6NA 1H7CA 2DLRA 4O2AE 4IE5A 3ZMZB 5EK2A 1NWMX 1O3XA 1XWRA 1S94A 2IC9A 1CJGA 2V7IA 2W0GA 2CXDA 3CX8B 2C5KT 4BAYB 5LHIB 3UFDA 2CXFA 3SRZA 2UXNB 4JUYA 3CVRA 3N2OA 2PIJA 4G2AA 2XHEB 4H9QC 4PU8A 2BNMA 2PUGA 1QUUA 2V7MA 3ANWB 3CX6B 3B7HA 4ZI2C 1UX4A 3NZQA 2IAKA 2PUDA 4O4LE 4CI1B 1MIVA 2KEJA 3H3AA 5HWXA 2OR1L 3NBXX 4O8BA 5JH7E 3AA6B 2E9XC 1DWKA 2KEIA 3OQOA 2ACXA 3K3QC 2MQKA 2LHRA 3ZLIA 4DMVA 1L1MA 5JDMA 3Q9DA 1T98A 5J2UE 4X1YE 3RYCE 2BJCA 4UV8B 5EZYE 2UXXB 3U78A 4HFVA 5CA0E 3UFEA 3N2KE 2ICPA 3DNVB 4H9RC 3RX6A 1IAPA 5JR9B 3SCGA 3KFWX 1BR0A 4PJJA 2HINA 4ISTA 5JDLA 2C5IT 3CWZB 2CLYB 2Q9QC 1MMNA 4IA8A 2YEVC 1AJ3A 2ZM8A 4AKIA 4Z58A 2CWOA 2L8KA 3F6WA 4U74A 5JQGE 2W63A 1PRUA 1JFSA 5CB4E 2EWTA 3RZZA 3ZHIA 4UV9B 2PUFA 2W00A 4ILUA 1UXCA 3V5SA 2XCJA 4TV8E 4AQFC 4DMWA 2KZ7B 4PU7A 4E7ZA 4QHOA 5HXSA 2W62A 4GQMA 2KWHA 3G5GA 3FHNA 4PJLA 2CROA 4H63V 2MOZA 3RC3A 1Y64B 4FJOA 3RH3A 1US7B 2VKDA 3OBVE 4PW8A 2AUWA 3PUSA 2LSIA 3I0QA 3MA9A 2JMHA 4YLHA 4B6XA 2EHOC 2HPJA 2QA7A 4OYKA 3DTOA 2KNDA 5F8PA 4PK4A 3SS1A 5KDMC 3RC8A 2CWYA 2Z6EA 3I0OA 5FXXA 2X51A 2V1DB 3K3OA 1ZZ8A 2GZUA 2VWAA 4YG1A 3HA4A 1OSLA 4JCXA 4ADZA 2OFYA 2LSYA 4IVZA 1D1AA 5EK3A 2Y6XA 3C98B 3ZPOA 3ETUA 4Y42A 1MMAA 2XIUA 1MMGA 2BNNA 1FMVA 2RA1A 1WIZA 1G8XA 3O1HA 3WAJA 4I6RA 3KVAA 5L3CB 3K3NA 5JDHA 3KV4A 1ZZ6A 4I43B 4IE4A 2G0UA 3I9YA 2AXZA 4EZ4A 5HWYA 2WAUA 3LG7A 1D1BA 3FYMA 1SHZC 3BQKA 3O1JA 4H9NC 4UEMA 4PK5A 5KMGP 3QC9A 1ZZ7A 4PNIA 3CQCB 3OMTA 4CXYA 3RPUA 3S8QA 4U72A 4I6TA 3SWHA 1LMB3 5LJMA 5IYZE 4DBRA 3PUGA 4YJ2E 3BS3A 4CXWA 2LSGA 2KWIB 1IC8A 5HXCA 4CXXA 4UVCB 4JEUB 1ZUGA 3QK6A 1RPEL 4V1Av 5LBMA 2CXLA 3G7DA 3PUAA 2MBGA 3VK0A 3EUSA 5LJNA 3VKHA 2P9BA 1BR1A 3AA0B 3CX7B 4ZI7E 1B0NA 3FB2A 3TKLB 5FMNA 4EIWA 3Q5XA 3KDSE 1Y7YA 3QQ6A 3C4XA 2X9WA 1QPZA 4FI5A 4J1WA 1ZEEA 1D0ZA 1WH6A 4X4EA 3QUJA 2DNXA 4P0AA 1RZRA 1MNEA 2VK9A 1DW9A 3HL6A 4MALA 2DHRA 1PRAA 2PUBA 2JVLA 1LVKA 2XQYA 4ISSA 5DQVA 3RKOA 5M4YA 4GYRA 2W61A 1ZKEA 2KINB 3Q2MA 2LCVA 4IGUA 4PJNA 3ETVA 3F31A 1CQTA 1UXDA 1LLIA 3C4ZA 4X4GA 1MNDA 4OB4A 2DWKA 3PE0A 3ZYKA 4ZOLE 2GRLA 1VOMA 5L2LA 1VPWA 1NEQA 3MLFA 2IVBA 5L3DB 1IZNB 2SPCA 3L3PA 2EF8A 3MZKB 4F6RC 4C91A 4X4FA 2ZM2A 2QGSA 1POUA 2AXVA 4EZHA 3FXEB 2KXPB 4J1XA 1HTJF 2LSJA 2XASB 3I9WA 2K24A 1HFAA 3N9OA 2MEZA 4K0UA 3WAKA 5L3BB 3UULA 3PXPA 2E9XB 3ESLA 5LCYA 2BVLA 2XAJB 4EYYR 2PFVA 3AA1B 2XJ3A 2E8IA 1X57A 3LFMA 2LYJA 2VL8A 2L49A 2VKJA 4MBQA 4Z5CA 2CCQA 1QQBA 1LCDA 2JJ9A 3HKBE 3K8PC 3EVYA 2LT3A 3RRCA 4ASKA 3KJXA 2I59A 3MK7C 5HXHA 4Z5DA 1NERA 3EUHA 1HG2A 2IUOA 3KZ3A 2WBLA 3U3WA 3GN5A 3JXCL 3ZYMA 2VASA 3P7IA 5JVDE 4ZI3C 1WLXA 4DNDA 2L9QA 2B1EA 4X4CA 3L09A 3GBFA 1WETA 3CQXC 2V26A 3N2GE 2LYRA 3PU3A 1PERL 3TRBA 2CLYC 3NRYA 5LXTE 5FXZA 1LQCA 2NW7A 2A72A 2YINA 4P0BA 1OXZA 3AAAB 2IVGA 1PNRA 2D5UA 5LHHB 3E08A 4NUUA 2D2SA 1ZS4A 3CLCA 4YG4A 4X4BA 3C64A 3LK3B 4O2BE 4XAXB 4GK0E 1ADRA 2V7JA 3IEEA 1WH8A 1OCTC 3KBUA 3OJAA 2X67A 3RYHE 4WBNE 3ZMSB 4CQIA 5JREA 2CSFA 4EAHA 2NWBA 5JRCB 4QX8B 3U3IA 3UUNA 4TUYE 3UT5E 3H5TA 3N9MA 1OWAA 3B57A 3N5LA 4OYJA 2BDEA 1IJ6A 3JXBC 2WMNA 4IHJE 3JC6D 4MCTA 3GMIA 4GK5E 4OK0A 3GWHA 3NRXA 3IBPA 5J2TE 1ZV4X 2DCFA 3AVSA 5LGNB 3IHRA 4O4HE 2FJRA 2OA5A 4DVDA 2HSGA 2B5AA 3AB3B 4OFZA 2A6CA 3GA8A 1E1HB 5FY0A 4O4JE 1QSDA 4ZI3D 3KVBA 3OYXA 2XSDC 2NTYA 3ZMUB 4HKAA 4YFSA 2LYLA 3SOLA 3F57A 3O1IA 3O4XE 4CZZB 3F52A 4EB6E 2R1JL 1HX8A 4HTEA 4PU3C 5AFUL 3SCFA 1IJ5A 3CROL 3OP9A 2E9XA 3FXDB 2YK0A 4KBMB 4TX5A 1LRZA 1BR4A 2XAHB 3MKDA 4QXCB 3SCHA 1O4XA 3PUQA 4C90A 3GN5B 4CI2B 3CQGB 3F2EA 4WNKA 3J7Yq 5ADXL 1HS7A 2LOPA 2XI8A 3L1PA 4KP3C 5A1LA 3NZPA 2PE5A 2LHNA 1FMWA 3HZIB 3LK42 1HF0A 1RZRD 2XTLA 2CA5A 4WBOA 2AXUA 5JDGA 3P8CD 3FBZA 2XAQB 4X1IE 3UTKA 4ZHQE 4JQDA 2RP4A 5ETWA 4X4DA 3AVRA 3N9QA 2A3DA 3ZEFB 2KZ8A 1WR6A 1X79A 2YU1A 2X9YA 3B13A 3LBXA 5DQWA 4UIGA 1JWLA 2H3RA 1Y9QA 4JCYA 4UF0B 4UVAB 3VU7H 4AQFA 2D5VA 5F3JA 3DP7A 3W15B 4QXHB 4A56A 2V7LA 2AWIA 3OKQA 4N78D 5FY7A 4EYUA 1WRDA 5LGTB 4PU4C 1AU7A 2VKOA 3ZYLA 3O9XA 4AXPA 1R69A 2ES0A 3IVPA 1MIYA 3R1FA 5A7LA 2X0LB 3AA7B 2N1GA 4HN9A 1UTXA 5LA6E 4DBQA 2LYPA 3KXAA 5H6RB 4OHFA 2CMRA 2C5JA 3C4WA 3KV6A 2EHOA 5H6QB 4G63A 2NP9A 5HXEA 3UUMA 5JRCA 3CECA 4NUVA 2XAGB 5C8YE 2O49A 4NDWA 3ZMVB 4YHJA 4I55E 4TZ4C 3V5UA 3N9NA 4PJMA 4AKGA 3BK9A 5LP6E 4IWRA 4AI6A 4PAGA 1YW0A 2H7OA 1YSEA 5FYMA 2NW9A 4H9PC 2CEAA 2KPJA 4GOUA 5DABA 2EBYA 2CM0A 4FBIA 4PFOA 1HF8A 1UX5A 2K48A 5LHGB 4IE7A 1FEWA 5E0OA 3R84B 5K98B 4MFRA 2X9HA 5CA1E 2LOSA 1HG5A 1U4QA 1BDIA 5LYJE 3LISA 3ZN1B 2ICTA 3N9LA 3F51A 5DJQC 1CUNA 4ZS3A 3ZC1A 2WIUB 3JC6C 5L3FB 3E22E 1D0YA 4DO0A 2JCGA 2LE8A 4J2CA 5LGUB 4QX7B 2HPLA 1EZ3A 2MYSA 4AKRB 4QKNA 1KNZA 4GIWA 2O4AA 1ZPQA 2MTQA 5FY1A 2LYKA 2Q9QB 4UVBB 1FIOA 3I1AA 3OYZA 3D0TA 4HE8A 5J1GA 5BMVE 2DI4A 1GT0C 2DWGA 2WSSV 5FP3A 3ZC0A 2PUAA 3E0ZA 3VHLA 3C50A 4PK6A 3PURA 4TV9E 4XBFB 3LBXB 2M67A 2ODUA 1JH9A 3LJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJR A;  1IC8 A;  4Z5H A;  3BS3 A;  2HSG A;  2B5A A;  1ZUG A;  2A6C A;  3GA8 A;  2PIJ A;  1RPE L;  3G7D A;  3VK0 A;  3EUS A;  4PU8 A;  2BNM A;  2PUG A;  1LCC A;  3B7H A;  2XSD C;  1B0N A;  1BDH A;  2PUD A;  2LYL A;  2KEJ A;  1Y7Y A;  3QQ6 A;  4GHJ A;  2L8N A;  3LFP A;  3F52 A;  2OR1 L;  4O8B A;  2R1J L;  1QPZ A;  4J1W A;  1WH6 A;  1DWK A;  4X4E A;  3SCF A;  4PU3 C;  2KEK A;  3OP9 A;  3QWG A;  1RZS A;  1ZZB A;  2MQK A;  2IVQ A;  2O38 A;  3OQO A;  1RZR A;  1L1M A;  1E3O C;  1EFA A;  1DW9 A;  2LYS A;  2BJC A;  1PRA A;  3SCH A;  2JVL A;  1O4X A;  4YG7 B;  2PUB A;  1JFT A;  2BNO A;  3GN5 B;  1S7E A;  2ICP A;  3DNV B;  2LCV A;  3SCG A;  1CQT A;  1QP7 A;  1UXD A;  2XI8 A;  3L1P A;  1LLI A;  2HIN A;  3HI2 A;  2PE5 A;  4MCX A;  2KEI A;  3HZI B;  1HF0 A;  1RZR D;  4IA8 A;  4X4G A;  4OB4 A;  2AXU A;  3QYX A;  2GRM A;  4Z58 A;  2GRL A;  3F6W A;  2IV1 A;  1PRU A;  1ZZC A;  1NEQ A;  3MLF A;  1JFS A;  2IVB A;  1VPW A;  4JQD A;  2EWT A;  4X4D A;  3RZZ A;  2EF8 A;  3QF3 A;  3ZHI A;  2KZ8 A;  4X4F A;  2PUF A;  3FMY A;  1UXC A;  2XCJ A;  1JWL A;  1POU A;  1Y9Q A;  2AXV A;  4JCY A;  4PU7 A;  2D5V A;  2PPX A;  4J1X A;  2AWI A;  4GQM A;  3G5G A;  1QP4 A;  2MEZ A;  2CRO A;  4PU4 C;  3PXP A;  1AU7 A;  4YAR A;  3O9X A;  1ZAY A;  1R69 A;  4I8T A;  3IVP A;  2AUW A;  3R1F A;  5A7L A;  2XJ3 A;  2AW6 A;  1UTX A;  1X57 A;  2LYQ A;  2LYJ A;  2LYP A;  4FN3 A;  3KXA A;  2IU7 A;  2L49 A;  1QP0 A;  4Z5C A;  1QQB A;  1LCD A;  3D1N I;  1R63 A;  3CEC A;  3FYA A;  2O49 A;  4NDW A;  3KJX A;  2PUE A;  4Z5D A;  1NER A;  2IUO A;  1ZZ8 A;  2GZU A;  3KZ3 A;  1X2L A;  4IWR A;  3U3W A;  3GN5 A;  3JXC L;  1SQ8 A;  4X4I A;  1YSE A;  4YG1 A;  4X4C A;  3GBF A;  1OSL A;  2KPJ A;  1WET A;  2OFY A;  2R63 A;  4IVZ A;  3ZKC A;  4JCX A;  2LYR A;  1PER L;  2EBY A;  3TRB A;  3OQM A;  1LQC A;  4FBI A;  4X4H A;  4Y42 A;  2IVG A;  1PNR A;  2XIU A;  5K98 B;  2H8R A;  3JXD L;  2BNN A;  4YBA A;  1PRV A;  1WIZ A;  1ZS4 A;  3CLC A;  4YG4 A;  4X4B A;  4Z59 A;  1BDI A;  3LIS A;  4F8D A;  2ICT A;  3F51 A;  4I6R A;  2PUC A;  4I6U A;  3BDN A;  1ADR A;  2WIU B;  3ZHM A;  1QQA A;  1ZZ6 A;  2AXZ A;  1WH8 A;  1JH9 A;  1ZZ9 A;  1OCT C;  3FYM A;  2CSF A;  3OQN A;  3CRO L;  2O4A A;  1ZPQ A;  2LYK A;  1ZZ7 A;  3BD1 A;  1RIO A;  1ZVV A;  3H5T A;  3OMT A;  2WUS R;  1GT0 C;  3JXB C;  3S8Q A;  2PUA A;  4MCT A;  4I6T A;  1LMB 3;  1XWR A;  1CJG A;  2JCG A;  3UFD A; 
#chains in the Genus database with same CATH topology
 4BJN A;  1VRB A;  4Z5H A;  2N2N A;  5DSX A;  4YSY A;  2XM1 A;  1BR2 A;  2JQ9 A;  2JQQ A;  3C51 A;  1LCC A;  1N36 T;  4UF0 A;  2JQK A;  4CN4 A;  5FXV A;  5IHY A;  2IW5 B;  2PJQ A;  2KEK A;  1RZS A;  4L5G A;  2VQE T;  2C0S A;  3A9Y A;  2LYS A;  3AE9 A;  2HH7 A;  1S7E A;  4YT0 A;  1QP7 A;  4UEL A;  4LF8 T;  2E9X D;  4MCX A;  3UU3 A;  1D1C A;  1MMD A;  2LRL A;  4Z91 A;  3QF3 A;  2BG9 B;  3RYI E;  2KLQ A;  2Q9Q D;  1QP4 A;  1DU2 A;  4Z8X A;  3ZMT B;  2AW6 A;  4JEH B;  3P4P A;  4KX6 A;  4YJ3 E;  1LVF A;  2NW8 A;  3FYA A;  3IF8 B;  3PUW F;  4U2Z A;  3T1H T;  3MAC A;  2V7K A;  5C3J A;  2R63 A;  2J7U A;  2D0U A;  1MIW A;  1D0X A;  2H8R A;  3AE4 A;  3EI0 A;  4LF4 T;  4Z59 A;  1E2A A;  3OPC A;  3ZHM A;  4M1P A;  5AQU B;  2IC6 A;  1ZZ9 A;  2BVM A;  3RRW A;  2XUE A;  4EED A;  5L3G B;  4COF A;  3OQN A;  3KV9 A;  2K9A A;  5GON E;  4X1K E;  3CK6 A;  4O8S A;  2X0Y A;  4IIJ E;  3ZMZ B;  4KHP T;  4BAY B;  2C5K T;  5LHI B;  4JUY A;  2PIJ A;  4EQZ A;  4G2A A;  5CGM A;  2LLY A;  1QUU A;  2PUD A;  2XQ5 A;  5HWX A;  3NBX X;  4JYA T;  1DWK A;  2KEI A;  3RIF A;  5JDM A;  2LHR A;  2X0H A;  4X1Y E;  5HEJ A;  3U78 A;  5CA0 E;  3N2K E;  2PXQ A;  3JCF A;  3SCG A;  3KFW X;  2PXB A;  5JDL A;  3CWZ B;  3SX0 A;  2YEV C;  4Z58 A;  5JQG E;  2W63 A;  5ABE A;  3RZZ A;  3ZHI A;  1UXC A;  3ZST A;  2XCJ A;  2E5V A;  2W62 A;  4GQM A;  4H63 V;  4A5X A;  3RH3 A;  1US7 B;  2LSI A;  4B6X A;  2HPJ A;  2UUB T;  5L4H A;  5KDM C;  2V1D B;  5AQJ B;  3HA4 A;  4JCX A;  2Y6X A;  3ZPO A;  3CIR A;  2J4G A;  4JI4 T;  1MMG A;  1WIZ A;  2D9D A;  3KVA A;  4Q2J A;  1N34 T;  5JDH A;  4YY3 T;  3AE1 A;  1ZZ6 A;  4IE4 A;  3LDQ B;  4ER7 A;  3BQK A;  3O1J A;  3AE5 A;  4PK5 A;  3OKZ A;  1ZZ7 A;  3CQC B;  1N32 T;  4I6T A;  1HNX T;  1OED E;  5LJM A;  3BS3 A;  1ZUG A;  1RPE L;  5DTQ A;  3VK0 A;  1OED C;  4HFI A;  3TKL B;  3UU8 A;  4HFC A;  3QQ6 A;  1NEN A;  2ACZ A;  1QPZ A;  2M6I A;  4P0A A;  3QNU A;  3PV0 F;  2PUB A;  1LVK A;  2FBW A;  2XQY A;  2XQ8 A;  2XY8 B;  4ISS A;  2W61 A;  5BR8 T;  2LCV A;  4LFC T;  3ETV A;  4B3T T;  3C4Z A;  1MND A;  2DWK A;  1VOM A;  5L2L A;  2EF8 A;  3MZK B;  4C91 A;  1POU A;  2AXV A;  3FXE B;  3N9O A;  1HFA A;  5L3B B;  4GKK T;  2E9X B;  3ESL A;  3AA1 B;  2E8I A;  3LFM A;  2L49 A;  4Z5C A;  2LT3 A;  4JI7 T;  2F4V T;  2PXT A;  3RIU A;  3MK7 C;  1NER A;  3EUH A;  5AQS B;  3VR9 A;  2XSA A;  3KZ3 A;  3JXC L;  4ZI3 C;  4DND A;  2HCS A;  4X4C A;  3L09 A;  3GBF A;  5FXZ A;  1LQC A;  2A72 A;  5LHH B;  2D5U A;  2BKN A;  2BBJ A;  1T72 A;  4O2B E;  4XAX B;  2XQ4 A;  3AEA A;  3IEE A;  1WH8 A;  5DRY A;  3RYH E;  5JRE A;  4EAH A;  5JRC B;  4QX8 B;  3UUN A;  4Z90 A;  2AXD S;  4CN6 A;  3N5L A;  3EAM A;  3K1S A;  3X1D A;  2J7W A;  3NZL A;  3A7M A;  3P4W A;  4OK0 A;  1XNR T;  1ZV4 X;  2FJR A;  4JI8 T;  4DR7 T;  4DVD A;  1E1H B;  4F8H A;  4ZI3 D;  3ZMU B;  4HKA A;  4YFS A;  3F57 A;  2R1J L;  3CRO L;  3OP9 A;  1ZP0 A;  2PXV A;  4KBM B;  4LF7 T;  4QXC B;  1J5E T;  3NRO A;  4CI2 B;  1KNP A;  3F2E A;  4WNK A;  2XI8 A;  3NZP A;  2LHN A;  4EKG A;  4LF9 T;  3HZI B;  3LK4 2;  1L0V A;  3P8C D;  3FBZ A;  4IDN A;  2XAQ B;  4X1I E;  3N9Q A;  2KZ8 A;  2YU1 A;  1Y9Q A;  3VU7 H;  4X66 T;  1IBK T;  2D5V A;  5F3J A;  4QXH B;  2AWI A;  4N78 D;  1WRD A;  1AU7 A;  1R69 A;  2ES0 A;  4TWD A;  4HN9 A;  2N1G A;  4DE8 A;  2HN2 A;  3C4W A;  4OHF A;  2YDS A;  3CEC A;  5AQF B;  4HWC A;  3AXJ A;  4HRA A;  3OVU A;  1IBM T;  4AI6 A;  4IWR A;  2VVN A;  5FYM A;  2V6X A;  2A9U A;  2CM0 A;  1UX5 A;  2K48 A;  5LHG B;  5K98 B;  4TWH A;  1HG5 A;  5LYJ E;  3ZN1 B;  3N9L A;  4IL4 A;  3F51 A;  3AE3 A;  4LF6 T;  3E22 E;  2LE8 A;  2XQ3 A;  4QX7 B;  2HPL A;  5F5W A;  4GIW A;  2MTQ A;  3QOF A;  3OYZ A;  4HE8 A;  2DWG A;  2PUA A;  2LRK A;  5EK4 A;  4O4I E;  2Y8D A;  3HKE E;  4KMC A;  3EDU A;  4HFD A;  1BDH A;  1OED A;  4EXT A;  2BBH A;  4GHJ A;  4ERR A;  3KIN B;  2LJL A;  3QWG A;  2O38 A;  1ZZB A;  5HCM A;  1EFA A;  3AXJ B;  4WW0 A;  1NW3 A;  3ZPX A;  4QXB B;  4KUM B;  4BA9 A;  3PUX F;  3HR0 A;  4ZS2 A;  1WYC A;  4MHC A;  2J1D G;  3S4U A;  3HI2 A;  5AQM B;  3TFL A;  4LFB T;  3QYX A;  4L9I A;  4U3C A;  2PBI A;  1XZY A;  2IV1 A;  2YDQ A;  5LG4 A;  4X65 T;  2WDQ A;  2X66 A;  3FMY A;  2WZI A;  2PPX A;  1ZAY A;  4HGA A;  2XSB A;  4PFP A;  4HWI B;  3UUX B;  3WI3 A;  5DT2 A;  1R63 A;  5LNK A;  5AQQ B;  4JLE A;  2PUE A;  3UFG A;  2OLT A;  4I4T E;  3AAE B;  1X2L A;  2ZMA A;  2LEH A;  3MJX A;  2WWU A;  5AQT B;  4HFB A;  3ZKC A;  2EHO D;  1LKX A;  4X4H A;  4X20 E;  4P1N A;  4JV5 T;  4YBA A;  4LMJ A;  1WYB A;  4ZZB A;  4I6U A;  3JAF A;  3KBT A;  5CJ5 A;  1SA0 E;  2J62 A;  2WMO A;  3A9X A;  4IE6 A;  2JRK A;  2WM9 A;  3MXZ A;  4IDZ A;  2VB6 A;  1XMO T;  5C2T A;  4IRE A;  3M65 A;  2X9X A;  2V5D A;  2WUS R;  3VKG A;  3BQL A;  3R6N A;  1Z0P A;  1H7C A;  2DLR A;  2UU9 T;  4IE5 A;  1NWM X;  3NXH A;  1O3X A;  1XWR A;  1S94 A;  2V7I A;  1CJG A;  3CX8 B;  2W0G A;  2CXD A;  2CXF A;  3RF1 A;  1X9B A;  2UXN B;  3ZSS A;  4H9Q C;  3EAB A;  4CI1 B;  4O4L E;  1MIV A;  4B3S T;  5AQP B;  2E9X C;  2PXF A;  3OQO A;  4LFA T;  2MQK A;  1M7K A;  4UV8 B;  4HFV A;  3UFE A;  3RX6 A;  2ICP A;  4WZX A;  2LNM A;  4PJJ A;  2HIN A;  4DR5 T;  2C5I T;  2V6Y B;  2Q9Q C;  1MMN A;  4IA8 A;  3F6W A;  1PRU A;  1JFS A;  2HN1 A;  2PUF A;  1VCS A;  4ILU A;  4TV8 E;  4AQF C;  2KZ7 B;  3FHN A;  2MOZ A;  4IDO A;  3G06 A;  4ER0 A;  1UGO A;  3AEB A;  3PUS A;  2QA7 A;  4OYK A;  3DTO A;  4ZXL A;  3PJA J;  3I0O A;  3K3O A;  1ZZ8 A;  4ADZ A;  2OFY A;  2I0M A;  3L8R A;  1MMA A;  2XIU A;  2BNN A;  1FMV A;  2RA1 A;  4YSZ A;  3O1H A;  4B3R T;  3WAJ A;  4DR3 T;  3I9Y A;  2AXZ A;  4EZ4 A;  5HWY A;  2WAU A;  2VQF T;  1SHZ C;  2CPT A;  4UEM A;  4HWF A;  3S8Q A;  4GKJ T;  5IYZ E;  4YJ2 E;  4DV0 T;  4ER5 A;  2KWI B;  1IC8 A;  4WYV A;  5HXC A;  4V1A v;  5LBM A;  3EUS A;  3CX7 B;  1B0N A;  4KHZ F;  3AEF A;  3QUJ A;  1D0Z A;  1I94 T;  5DQV A;  3Q2M A;  2XQ6 A;  3M9L A;  4PJN A;  5HCJ A;  3AE2 A;  3LQX A;  1VPW A;  2QRX A;  1NEQ A;  2YDR A;  1IZN B;  4F6R C;  2QGS A;  4DV2 T;  4EZH A;  2KXP B;  1HTJ F;  2E2A A;  2LSJ A;  4K0U A;  2K24 A;  4IDP A;  3IA3 A;  2PXL A;  1X57 A;  2VL8 A;  1FJG T;  1UUS A;  2VKJ A;  2JJ9 A;  3K8P C;  2E5L T;  2IUO A;  2WBL A;  5GAG i;  3GN5 A;  5AQO B;  3P7I A;  3ZYM A;  3N2G E;  2V26 A;  1PER L;  2CLY C;  4ILA A;  4TNW A;  3AAA B;  2IVG A;  3E08 A;  3LSV A;  4DV5 T;  2WU5 A;  4I0U A;  3LK3 B;  1XMQ T;  4WVL A;  1ADR A;  2V7J A;  4U7I A;  1OCT C;  3TLS A;  2WDR A;  2XQA A;  3U3I A;  3UT5 E;  3H5T A;  2LKG A;  3N9M A;  4OYJ A;  3JXB C;  3JC6 D;  4EV6 A;  3IBP A;  2DCF A;  4DV7 T;  2OA5 A;  2HSG A;  2B5A A;  3GA8 A;  4O4J E;  1QSD A;  3KVB A;  3O1I A;  2MXD A;  4HTE A;  2M4H A;  5AFU L;  2E9X A;  1IJ5 A;  1BR4 A;  2XAH B;  3PUY F;  3SCH A;  3QOX A;  1E7P A;  3GN5 B;  3J7Y q;  1QLB A;  2LOP A;  4KP3 C;  2PE5 A;  1HF0 A;  1RZR D;  2XXQ A;  4WBO A;  4Q25 A;  2UUA T;  5ETW A;  2V5C A;  1X79 A;  4UIG A;  1JWL A;  1HNZ T;  4UVA B;  3ZKR A;  4AQF A;  3AEC A;  3W15 B;  2DL1 A;  4PU4 C;  2VKO A;  3ZYL A;  3O9X A;  4AXP A;  3AA7 B;  3B5M A;  5A7L A;  2X0L B;  2PXE A;  5LA6 E;  2LYP A;  2W67 A;  5HEU A;  5JRC A;  2XAG B;  5C8Y E;  2O49 A;  4YHJ A;  3SR4 A;  3ABV A;  3N9N A;  3V5U A;  5LP6 E;  2NW9 A;  1KF6 A;  2CEA A;  2KPJ A;  2IUB A;  4GOU A;  2EBY A;  4U2Y A;  4PFO A;  3FZK B;  3R84 B;  2X9H A;  4AQY T;  3RLF F;  2BS2 A;  2ICT A;  4ZS3 A;  3ZC1 A;  4DO0 A;  5AQV B;  4J2C A;  5LGU B;  2UXB T;  4AKR B;  5LMN T;  4QKN A;  2YOE A;  2Q9Q B;  2PXK A;  1FIO A;  3D0T A;  1GT0 C;  2WSS V;  2XQ9 A;  3ZC0 A;  4PK6 A;  3PUR A;  3NDB B;  2M67 A;  3FBL A;  1V9D A;  4JI6 T;  2D0T A;  3UU5 A;  1SUM B;  3RHW A;  5JDQ A;  4H9S E;  3BQI A;  4X5T A;  3ZCJ A;  5ABF B;  2Y48 B;  3J9X 1;  1W0A A;  3EDV A;  4BJM A;  1GQE A;  4QH5 A;  2UXD T;  4YG7 B;  3UQ7 A;  1JFT A;  2NTX A;  4ZI2 D;  3L39 A;  5GAH i;  3KV5 A;  3PU8 A;  4I50 E;  3DJB A;  2GRM A;  2JMK A;  1ZZC A;  3QB5 A;  4TNV A;  3RGL A;  3TEL A;  2ZM0 A;  5L4E A;  3ZJ2 A;  4IT4 A;  4OX9 T;  4U7Y A;  2H7V C;  2KMF A;  3CPZ A;  4P09 A;  4EOZ B;  1I6Z A;  1JNR A;  1T8B A;  4I8T A;  1VCT A;  5LOV E;  4MLK A;  1ZHC A;  2IU7 A;  2JPF A;  3LK2 B;  3D1N I;  2BZB A;  3H37 A;  2WQY A;  2A2F X;  2NOX A;  3ZT7 A;  2VVS A;  1SQ8 A;  2K5B B;  5HAX A;  2CHN A;  3AE6 A;  4HFE A;  2N9D A;  3AED A;  3HKD E;  4E7S A;  4AQG A;  2K3W A;  3CML A;  1YKH B;  4F8D A;  3BDN A;  4JBW F;  3P4S A;  4XZC A;  4YTP A;  4DUZ T;  4X62 T;  2LSK A;  1ZVV A;  1HCI A;  3ONX A;  3GUU A;  4H9O C;  3ME5 A;  2LM9 A;  4L0R A;  4O2A E;  3UQ4 A;  2CHO A;  1HR0 T;  3UFD A;  3SRZ A;  2VUR A;  3CVR A;  3N2O A;  2BKP A;  2BNM A;  3CX6 B;  1UX4 A;  3NZQ A;  2IAK A;  3PUV F;  2KEJ A;  2UUC T;  2W4X A;  2OR1 L;  2PXU A;  4O8B A;  3AA6 B;  4DMV A;  1L1M A;  3Q9D A;  5J2U E;  3RYC E;  2UXX B;  2B76 A;  1KFY A;  3UWP A;  1BR0 A;  2IML A;  2CLY B;  1AJ3 A;  2ZM8 A;  4AKI A;  2L8K A;  4U74 A;  4LF5 T;  2EWT A;  3TLT A;  4E7Z A;  4QHO A;  5HXS A;  4OBM A;  3G5G A;  1U2Z A;  3QB5 K;  4HWD A;  2BS4 A;  3UU4 A;  1Y64 B;  3OBV E;  3P4R A;  4YLH A;  3MA9 A;  2EHO C;  2IHR 1;  2KND A;  5F8P A;  4PK4 A;  3RC8 A;  2CWY A;  5FXX A;  2X51 A;  2GZU A;  2WDV A;  2H88 A;  4EEB A;  4X64 T;  2VWA A;  4YG1 A;  1OSL A;  4IVZ A;  1DUL A;  1D1A A;  5AQI B;  5EK3 A;  3RQU A;  3C98 B;  3ETU A;  3PUZ F;  4JI3 T;  1G8X A;  4JI1 T;  4NPP A;  4DV6 T;  2G0U A;  1D1B A;  4H9N C;  1J5W A;  3QC9 A;  2QYW A;  1YQ3 A;  3OMT A;  3RPU A;  4U72 A;  3SWH A;  1LMB 3;  2V6Y A;  3ONL C;  4CXW A;  3VWS A;  2LSG A;  4CXX A;  4NXN T;  2ODR D;  2MBG A;  1BR1 A;  4ZI7 E;  3FB2 A;  3VRB A;  4LML A;  4EIW A;  2LLW A;  4UR9 A;  2X9W A;  2BKO A;  4EGW A;  1ZEE A;  4KI0 F;  1Y01 A;  2DNX A;  1W09 A;  2ZM6 T;  2VK9 A;  4JI0 T;  2LM2 A;  3HL6 A;  4MAL A;  4DV1 T;  5M4Y A;  4GYR A;  2KIN B;  4IGU A;  3A8Y C;  3F31 A;  3FZF B;  3SFE A;  4OB4 A;  3RI5 A;  3ZYK A;  4ZOL E;  2GRL A;  2WU2 A;  3MLF A;  2IVB A;  2L1P A;  3L3P A;  4X4F A;  2ZM2 A;  2XAS B;  3I9W A;  1UUR A;  3UUL A;  5LCY A;  2YKS A;  2BVL A;  5ABH A;  2XAJ B;  4EYY R;  2PFV A;  2XJ3 A;  2LYJ A;  3TLU A;  1NEK A;  3RRC A;  1UK5 A;  4ASK A;  3KJX A;  5HXH A;  4AIS A;  1XDP A;  5JR9 C;  4QH4 A;  1WLX A;  5L3E B;  3AEG A;  1WET A;  4U33 A;  3TLW A;  1HQ1 A;  5LXT E;  3NRY A;  4NXM T;  4YXD A;  2NW7 A;  1OXZ A;  2D2S A;  1ZS4 A;  3CLC A;  4YG4 A;  3C64 A;  3PJA A;  3KBU A;  2X67 A;  3KL4 A;  1M62 A;  3H3M A;  1IJ6 A;  2WMN A;  4YTM A;  2FUP A;  3GMI A;  3GWH A;  3NRX A;  5J2T E;  3AVS A;  5LGN B;  3IHR A;  4O4H E;  5IUX A;  4OFZ A;  3T1Y T;  3SOL A;  4EB6 E;  3F52 A;  2CRB A;  3JAE A;  4PU3 C;  3SCF A;  2YN6 A;  3FXD B;  4DE9 A;  1LRZ A;  3MKD A;  1XNQ T;  2AE9 A;  3PUQ A;  2PXP A;  4C90 A;  1IBL T;  4DR1 T;  5IWA T;  1HS7 A;  3L1P A;  5A1L A;  1FMW A;  2V3C C;  3RIU C;  2CA5 A;  2VL0 A;  2AXU A;  3UUB A;  5JDG A;  2XM2 A;  4ILB A;  1QZX A;  2RP4 A;  3ZEF B;  1WR6 A;  2LKH A;  2WZH A;  2LLV A;  5DQW A;  1JNZ A;  4UF0 B;  2V7L A;  3OKQ A;  5FY7 A;  5LGT B;  2RPA A;  3GZD C;  1W0B A;  1MIY A;  3R1F A;  5LG3 A;  4DR2 T;  1UTX A;  4DV4 T;  3KXA A;  1KEY A;  5H6R B;  4DID B;  5H6Q B;  2CMR A;  2EHO A;  4G63 A;  3UUM A;  4NUV A;  4U31 A;  4NDW A;  4ZEY A;  3ZMV B;  3A9Z A;  4PJM A;  4AKG A;  3GZC A;  5LMU T;  4PAG A;  1YW0 A;  2H7O A;  1YSE A;  2HFZ A;  2XPK A;  1FEW A;  5E0O A;  4MFR A;  5CA1 E;  2LOS A;  4ER6 A;  5LB7 B;  1ZOY A;  1BDI A;  5HEO A;  5DJQ C;  3JC6 C;  5L3F B;  1D0Y A;  2W2U A;  1YXR A;  5AQK B;  2PTF A;  2O4A A;  1ZPQ A;  1WR0 A;  5J0Z A;  2LYK A;  1N33 T;  4UVB B;  5BMV E;  3I1A A;  4TWF A;  2DI4 A;  2FJA A;  3RIA A;  2ODU A;  2JCG A;  1JH9 A;  3LJC A;  4EZI A;  3Q5W A;  1YKE B;  5FVK A;  4AKH A;  3ZJ1 A;  4LMK A;  3NVO A;  1R8I A;  3JAD A;  2L8N A;  3LFP A;  1T7S A;  2J47 A;  2EHO B;  3A5X A;  1NAF A;  3RYF E;  1E3O C;  2IVQ A;  4UXN B;  5JDF A;  4HEA A;  2BNO A;  3N9P A;  3QOW A;  3RKG A;  2WWV A;  2I6H A;  1Z8U A;  3ZN0 B;  2IIU A;  4NIQ A;  5HYA A;  3P50 A;  2VKH A;  3T8O A;  2XAF B;  3PTR B;  2PG8 A;  2L3L A;  3CKD A;  3PDY A;  2KSR A;  3P4Q A;  4IE0 A;  4YAR A;  3ANW A;  5HXR A;  5JDN A;  4CN1 A;  4FN3 A;  2LYQ A;  4GYS A;  3ZCI A;  1QP0 A;  5TAO A;  3AAI A;  2ODV A;  3RQW A;  2Q9Q A;  5AQR B;  4ILC A;  5FNV E;  2YU2 A;  1UCU A;  3HKC E;  4CI3 B;  1KK7 A;  2CE7 A;  2GK9 A;  1YD8 G;  4ANJ A;  4X4I A;  5JR9 A;  5FVL A;  3AEE A;  2WCA A;  1J1J A;  3OQM A;  2KT9 A;  2X68 A;  2ZLY A;  4EK9 A;  3JXD L;  4H63 H;  1PRV A;  2UXC T;  4AKL A;  1U5P A;  2PUC A;  1QQA A;  1G73 A;  4TN7 B;  5KX5 E;  5ABF A;  1B7T A;  2WB5 A;  5FXW A;  1S35 A;  5LBQ B;  4EKI A;  2HCN A;  3BD1 A;  1RIO A;  3MEJ A;  2XQ7 A;  4QWN B;  3VR8 A;  5EK2 A;  2IC9 A;  3G0T A;  1YQ4 A;  3Q5E A;  2XHE B;  4PU8 A;  2PUG A;  2V7M A;  3ANW B;  3B7H A;  4ZI2 C;  3DM5 A;  3H3A A;  2QVA A;  1MFQ C;  5JH7 E;  1HX1 B;  2JQE A;  3OTO T;  2ACX A;  3K3Q C;  3ZLI A;  1T98 A;  2BJC A;  5EZY E;  5DTM A;  4H9R C;  3DNV B;  1IAP A;  5JR9 B;  4IDQ A;  4IST A;  2IDO B;  3ZT6 A;  5L47 A;  2CWO A;  1W9R A;  3Q5D A;  4AIU A;  5CB4 E;  5DTR A;  2XJ7 A;  4UV9 B;  5AQL B;  2W00 A;  3AE8 A;  2MPK A;  3V5S A;  4DMW A;  4PU7 A;  2KWH A;  4PJL A;  2CRO A;  1XDO A;  3RC3 A;  4FJO A;  3GZD A;  2VKD A;  4PW8 A;  2AUW A;  1XWM A;  3I0Q A;  2JMH A;  3SS1 A;  2XXA A;  2Z6E A;  4ER3 A;  3FZM B;  2LSY A;  2BG9 E;  2CBJ A;  3AE7 A;  4Y42 A;  4HWH A;  1CHU A;  4I6R A;  5L3C B;  2BG9 C;  3K3N A;  3KV4 A;  4I43 B;  1QB2 A;  2WY2 A;  2FJE A;  3LG7 A;  3FYM A;  2FFH A;  5KMG P;  4PNI A;  3R09 A;  4CXY A;  3VRA A;  3M3Z B;  4DBR A;  3PUG A;  4UVC B;  4JEU B;  3NKZ A;  3QK6 A;  5LJN A;  3VKH A;  2CXL A;  3G7D A;  3PUA A;  2WS3 A;  2P9B A;  3QFI A;  3AA0 B;  4A97 A;  5FMN A;  3Q5X A;  3KDS E;  1Y7Y A;  3C4X A;  2H89 A;  4FI5 A;  4J1W A;  1WH6 A;  4X4E A;  1RZR A;  1MNE A;  1DW9 A;  2DHR A;  1PRA A;  2JVL A;  1SE7 A;  2XZE A;  1KNR A;  3RKO A;  1ZKE A;  3NWI A;  1CQT A;  1UXD A;  1LLI A;  4X4G A;  3PE0 A;  2VEO A;  5JUW A;  5L3D B;  2SPC A;  4DV3 T;  3OWQ A;  3TEP A;  4J1X A;  3WAK A;  2MEZ A;  2JIW A;  3PXP A;  2WP9 A;  2CBI A;  5AQG B;  4IL9 A;  4MBQ A;  2V8S V;  2CCQ A;  1QQB A;  1LCD A;  3HKB E;  2HHH T;  5AQH B;  3EVY A;  4JI5 T;  2I59 A;  4Z5D A;  2W66 A;  1HG2 A;  2PXD A;  2OV9 A;  5DRT A;  5HEH A;  2XXP A;  3U3W A;  3FZH B;  2VAS A;  5JVD E;  3SFD A;  2L9Q A;  2B1E A;  4DR6 T;  3CQX C;  2LYR A;  3PU3 A;  4QH1 A;  3TRB A;  3ONJ A;  1HNW T;  2YIN A;  4P0B A;  1PNR A;  4NUU A;  4X4B A;  4YSX A;  4DR4 T;  3ZT5 A;  4GK0 E;  5FL1 A;  1WFD A;  3OJA A;  4WBN E;  3ZMS B;  4CQI A;  2CSF A;  2NWB A;  4YTN A;  3UU6 A;  4TUY E;  5FL0 A;  1OWA A;  3B57 A;  2BDE A;  5HEG A;  4IHJ E;  4MCT A;  3PE5 A;  4GK5 E;  2R6G F;  3AB3 B;  2A6C A;  5FY0 A;  3OYX A;  2XSD C;  2NTY A;  1WCR A;  2LYL A;  4YHH T;  5FKY A;  3O4X E;  4CZZ B;  2FJD A;  1HX8 A;  4A98 A;  4TX5 A;  2YK0 A;  1O4X A;  4HFH A;  3CQG B;  5ADX L;  2FJB A;  5AQN B;  2XTL A;  2NR4 A;  3UTK A;  4ZHQ E;  4JQD A;  4K0K T;  4X4D A;  3AVR A;  2A3D A;  3B13 A;  2X9Y A;  3LBX A;  5JTG A;  1OED B;  2H3R A;  4JCY A;  3DP7 A;  4A56 A;  4EYU A;  3IVP A;  4DBQ A;  5HXE A;  2C5J A;  3KV6 A;  2NP9 A;  4ZZC A;  4JI2 T;  4I55 E;  4TZ4 C;  5ABG A;  5KXJ A;  3BK9 A;  4H9P C;  2JQH A;  5DAB A;  4FBI A;  1HF8 A;  4IE7 A;  2YBD A;  1U4Q A;  5CFB A;  3LIS A;  4B3M T;  2M6B A;  1CUN A;  2WIU B;  2BS3 A;  2BG9 A;  3EHZ A;  2MAW A;  1EZ3 A;  2MYS A;  1KNZ A;  3TLV A;  3FZL B;  5FY1 A;  4DUY T;  5J1G A;  5FP3 A;  3E0Z A;  3VHL A;  3C50 A;  4TV9 E;  4XBF B;  3LBX B; 
#chains in the Genus database with same CATH homology
 3FBL A;  4BJN A;  1V9D A;  1VRB A;  4Z5H A;  2N2N A;  3Q5W A;  1YKE B;  1BR2 A;  2D0T A;  4AKH A;  5JR9 C;  3ZJ1 A;  2JQQ A;  3C51 A;  5EK4 A;  4O4I E;  2Y8D A;  1LCC A;  3HKE E;  3EDU A;  4H9S E;  4KMC A;  5JDQ A;  1BDH A;  4UF0 A;  4EXT A;  5FXV A;  5IHY A;  4GHJ A;  2L8N A;  3BQI A;  3LFP A;  3A5X A;  2EHO B;  2IW5 B;  1NAF A;  3ZCJ A;  3KIN B;  4ERR A;  3RYF E;  2LJL A;  2PJQ A;  2KEK A;  2Y48 B;  3QWG A;  1RZS A;  1ZZB A;  2O38 A;  2IVQ A;  1E3O C;  3J9X 1;  3RRW A;  1EFA A;  4L5G A;  2C0S A;  2LYS A;  4UXN B;  4WW0 A;  3EDV A;  4BJM A;  4QXB B;  4KUM B;  5JDF A;  4YG7 B;  2HH7 A;  4HEA A;  4BA9 A;  1JFT A;  2BNO A;  2NTX A;  3N9P A;  1S7E A;  4ZI2 D;  3HR0 A;  4ZS2 A;  3KV5 A;  3PU8 A;  1QP7 A;  1WYC A;  4MHC A;  4UEL A;  2J1D G;  3S4U A;  3HI2 A;  2E9X D;  4MCX A;  1D1C A;  4I50 E;  3DJB A;  3ZN0 B;  1MMD A;  3QYX A;  2GRM A;  4L9I A;  2PBI A;  2JMK A;  2IV1 A;  5HYA A;  1ZZC A;  5LG4 A;  2VKH A;  3QF3 A;  3T8O A;  2XAF B;  2X66 A;  3PTR B;  3FMY A;  2PG8 A;  2L3L A;  3CKD A;  2ZM0 A;  3RYI E;  3ZJ2 A;  3PDY A;  2PPX A;  2KLQ A;  2Q9Q D;  2H7V C;  1QP4 A;  2KMF A;  3CPZ A;  4IE0 A;  4P09 A;  4EOZ B;  4YAR A;  4Z8X A;  3ZMT B;  1ZAY A;  4I8T A;  3ANW A;  4HGA A;  5HXR A;  5JDN A;  2AW6 A;  4FN3 A;  2LYQ A;  4GYS A;  5LOV E;  4MLK A;  1ZHC A;  4PFP A;  2IU7 A;  4JEH B;  1QP0 A;  2JPF A;  3UUX B;  3WI3 A;  3ZCI A;  5TAO A;  3LK2 B;  3D1N I;  1R63 A;  2BZB A;  4YJ3 E;  1LVF A;  3H37 A;  5LNK A;  2NW8 A;  2ODV A;  2A2F X;  3AAI A;  2Q9Q A;  3FYA A;  4JLE A;  2PUE A;  2NOX A;  3IF8 B;  5FNV E;  2YU2 A;  1UCU A;  3HKC E;  4CI3 B;  1KK7 A;  2CE7 A;  3MAC A;  2GK9 A;  5L3E B;  1YD8 G;  4ANJ A;  4I4T E;  3AAE B;  1X2L A;  2ZMA A;  1SQ8 A;  2LEH A;  4X4I A;  2K5B B;  3MJX A;  2V7K A;  2WWU A;  5JR9 A;  5HAX A;  2R63 A;  3ZKC A;  2EHO D;  2D0U A;  1MIW A;  3OQM A;  1LKX A;  2N9D A;  2KT9 A;  4X4H A;  3HKD E;  4X20 E;  4AQG A;  4E7S A;  2X68 A;  1D0X A;  2H8R A;  3JXD L;  2ZLY A;  4H63 H;  4YBA A;  1PRV A;  3CML A;  4Z59 A;  1WYB A;  4F8D A;  1YKH B;  4AKL A;  1U5P A;  2PUC A;  4I6U A;  3BDN A;  3KBT A;  3ZHM A;  1QQA A;  1SA0 E;  1G73 A;  4M1P A;  4TN7 B;  4XZC A;  5KX5 E;  2WMO A;  4IE6 A;  1B7T A;  2IC6 A;  1ZZ9 A;  2BVM A;  2JRK A;  2WM9 A;  2XUE A;  3MXZ A;  4IDZ A;  1S35 A;  5FXW A;  5LBQ B;  2VB6 A;  5L3G B;  3OQN A;  3KV9 A;  2K9A A;  3M65 A;  3BD1 A;  1RIO A;  2LSK A;  2X9X A;  1ZVV A;  1HCI A;  3ONX A;  5GON E;  4X1K E;  4O8S A;  4H9O C;  2WUS R;  3VKG A;  3BQL A;  2LM9 A;  1Z0P A;  4L0R A;  4IIJ E;  4QWN B;  3R6N A;  1H7C A;  2DLR A;  4O2A E;  4IE5 A;  3ZMZ B;  5EK2 A;  1NWM X;  1O3X A;  1XWR A;  1S94 A;  2IC9 A;  1CJG A;  2V7I A;  2W0G A;  2CXD A;  3CX8 B;  2C5K T;  4BAY B;  5LHI B;  3UFD A;  2CXF A;  3SRZ A;  2UXN B;  4JUY A;  3CVR A;  3N2O A;  2PIJ A;  4G2A A;  2XHE B;  4H9Q C;  4PU8 A;  2BNM A;  2PUG A;  1QUU A;  2V7M A;  3ANW B;  3CX6 B;  3B7H A;  4ZI2 C;  1UX4 A;  3NZQ A;  2IAK A;  2PUD A;  4O4L E;  4CI1 B;  1MIV A;  2KEJ A;  3H3A A;  5HWX A;  2OR1 L;  3NBX X;  4O8B A;  5JH7 E;  3AA6 B;  2E9X C;  1DWK A;  2KEI A;  3OQO A;  2ACX A;  3K3Q C;  2MQK A;  2LHR A;  3ZLI A;  4DMV A;  1L1M A;  5JDM A;  3Q9D A;  1T98 A;  5J2U E;  4X1Y E;  3RYC E;  2BJC A;  4UV8 B;  5EZY E;  2UXX B;  3U78 A;  4HFV A;  5CA0 E;  3UFE A;  3N2K E;  2ICP A;  3DNV B;  4H9R C;  3RX6 A;  1IAP A;  5JR9 B;  3SCG A;  3KFW X;  1BR0 A;  4PJJ A;  2HIN A;  4IST A;  5JDL A;  2C5I T;  3CWZ B;  2CLY B;  2Q9Q C;  1MMN A;  4IA8 A;  2YEV C;  1AJ3 A;  2ZM8 A;  4AKI A;  4Z58 A;  2CWO A;  2L8K A;  3F6W A;  4U74 A;  5JQG E;  2W63 A;  1PRU A;  1JFS A;  5CB4 E;  2EWT A;  3RZZ A;  3ZHI A;  4UV9 B;  2PUF A;  2W00 A;  4ILU A;  1UXC A;  3V5S A;  2XCJ A;  4TV8 E;  4AQF C;  4DMW A;  2KZ7 B;  4PU7 A;  4E7Z A;  4QHO A;  5HXS A;  2W62 A;  4GQM A;  2KWH A;  3G5G A;  3FHN A;  4PJL A;  2CRO A;  4H63 V;  2MOZ A;  3RC3 A;  1Y64 B;  4FJO A;  3RH3 A;  1US7 B;  2VKD A;  3OBV E;  4PW8 A;  2AUW A;  3PUS A;  2LSI A;  3I0Q A;  3MA9 A;  2JMH A;  4YLH A;  4B6X A;  2EHO C;  2HPJ A;  2QA7 A;  4OYK A;  3DTO A;  2KND A;  5F8P A;  4PK4 A;  3SS1 A;  5KDM C;  3RC8 A;  2CWY A;  2Z6E A;  3I0O A;  5FXX A;  2X51 A;  2V1D B;  3K3O A;  1ZZ8 A;  2GZU A;  2VWA A;  4YG1 A;  3HA4 A;  1OSL A;  4JCX A;  4ADZ A;  2OFY A;  2LSY A;  4IVZ A;  1D1A A;  5EK3 A;  2Y6X A;  3C98 B;  3ZPO A;  3ETU A;  4Y42 A;  1MMA A;  2XIU A;  1MMG A;  2BNN A;  1FMV A;  2RA1 A;  1WIZ A;  1G8X A;  3O1H A;  3WAJ A;  4I6R A;  3KVA A;  5L3C B;  3K3N A;  5JDH A;  3KV4 A;  1ZZ6 A;  4I43 B;  4IE4 A;  2G0U A;  3I9Y A;  2AXZ A;  4EZ4 A;  5HWY A;  2WAU A;  3LG7 A;  1D1B A;  3FYM A;  1SHZ C;  3BQK A;  3O1J A;  4H9N C;  4UEM A;  4PK5 A;  5KMG P;  3QC9 A;  1ZZ7 A;  4PNI A;  3CQC B;  3OMT A;  4CXY A;  3RPU A;  3S8Q A;  4U72 A;  4I6T A;  3SWH A;  1LMB 3;  5LJM A;  5IYZ E;  4DBR A;  3PUG A;  4YJ2 E;  3BS3 A;  4CXW A;  2LSG A;  2KWI B;  1IC8 A;  5HXC A;  4CXX A;  4UVC B;  4JEU B;  1ZUG A;  3QK6 A;  1RPE L;  4V1A v;  5LBM A;  2CXL A;  3G7D A;  3PUA A;  2MBG A;  3VK0 A;  3EUS A;  5LJN A;  3VKH A;  2P9B A;  1BR1 A;  3AA0 B;  3CX7 B;  4ZI7 E;  1B0N A;  3FB2 A;  3TKL B;  5FMN A;  4EIW A;  3Q5X A;  3KDS E;  1Y7Y A;  3QQ6 A;  3C4X A;  2X9W A;  1QPZ A;  4FI5 A;  4J1W A;  1ZEE A;  1D0Z A;  1WH6 A;  4X4E A;  3QUJ A;  2DNX A;  4P0A A;  1RZR A;  1MNE A;  2VK9 A;  1DW9 A;  3HL6 A;  4MAL A;  2DHR A;  1PRA A;  2PUB A;  2JVL A;  1LVK A;  2XQY A;  4ISS A;  5DQV A;  3RKO A;  5M4Y A;  4GYR A;  2W61 A;  1ZKE A;  2KIN B;  3Q2M A;  2LCV A;  4IGU A;  4PJN A;  3ETV A;  3F31 A;  1CQT A;  1UXD A;  1LLI A;  3C4Z A;  4X4G A;  1MND A;  4OB4 A;  2DWK A;  3PE0 A;  3ZYK A;  4ZOL E;  2GRL A;  1VOM A;  5L2L A;  1VPW A;  1NEQ A;  3MLF A;  2IVB A;  5L3D B;  1IZN B;  2SPC A;  3L3P A;  2EF8 A;  3MZK B;  4F6R C;  4C91 A;  4X4F A;  2ZM2 A;  2QGS A;  1POU A;  2AXV A;  4EZH A;  3FXE B;  2KXP B;  4J1X A;  1HTJ F;  2LSJ A;  2XAS B;  3I9W A;  2K24 A;  1HFA A;  3N9O A;  2MEZ A;  4K0U A;  3WAK A;  5L3B B;  3UUL A;  3PXP A;  2E9X B;  3ESL A;  5LCY A;  2BVL A;  2XAJ B;  4EYY R;  2PFV A;  3AA1 B;  2XJ3 A;  2E8I A;  1X57 A;  3LFM A;  2LYJ A;  2VL8 A;  2L49 A;  2VKJ A;  4MBQ A;  4Z5C A;  2CCQ A;  1QQB A;  1LCD A;  2JJ9 A;  3HKB E;  3K8P C;  3EVY A;  2LT3 A;  3RRC A;  4ASK A;  3KJX A;  2I59 A;  3MK7 C;  5HXH A;  4Z5D A;  1NER A;  3EUH A;  1HG2 A;  2IUO A;  3KZ3 A;  2WBL A;  3U3W A;  3GN5 A;  3JXC L;  3ZYM A;  2VAS A;  3P7I A;  5JVD E;  4ZI3 C;  1WLX A;  4DND A;  2L9Q A;  2B1E A;  4X4C A;  3L09 A;  3GBF A;  1WET A;  3CQX C;  2V26 A;  3N2G E;  2LYR A;  3PU3 A;  1PER L;  3TRB A;  2CLY C;  3NRY A;  5LXT E;  5FXZ A;  1LQC A;  2NW7 A;  2A72 A;  2YIN A;  4P0B A;  1OXZ A;  3AAA B;  2IVG A;  1PNR A;  2D5U A;  5LHH B;  3E08 A;  4NUU A;  2D2S A;  1ZS4 A;  3CLC A;  4YG4 A;  4X4B A;  3C64 A;  3LK3 B;  4O2B E;  4XAX B;  4GK0 E;  1ADR A;  2V7J A;  3IEE A;  1WH8 A;  1OCT C;  3KBU A;  3OJA A;  2X67 A;  3RYH E;  4WBN E;  3ZMS B;  4CQI A;  5JRE A;  2CSF A;  4EAH A;  2NWB A;  5JRC B;  4QX8 B;  3U3I A;  3UUN A;  4TUY E;  3UT5 E;  3H5T A;  3N9M A;  1OWA A;  3B57 A;  3N5L A;  4OYJ A;  2BDE A;  1IJ6 A;  3JXB C;  2WMN A;  4IHJ E;  3JC6 D;  4MCT A;  3GMI A;  4GK5 E;  4OK0 A;  3GWH A;  3NRX A;  3IBP A;  5J2T E;  1ZV4 X;  2DCF A;  3AVS A;  5LGN B;  3IHR A;  4O4H E;  2FJR A;  2OA5 A;  4DVD A;  2HSG A;  2B5A A;  3AB3 B;  4OFZ A;  2A6C A;  3GA8 A;  1E1H B;  5FY0 A;  4O4J E;  1QSD A;  4ZI3 D;  3KVB A;  3OYX A;  2XSD C;  2NTY A;  3ZMU B;  4HKA A;  4YFS A;  2LYL A;  3SOL A;  3F57 A;  3O1I A;  3O4X E;  4CZZ B;  3F52 A;  4EB6 E;  2R1J L;  1HX8 A;  4HTE A;  4PU3 C;  5AFU L;  3SCF A;  1IJ5 A;  3CRO L;  3OP9 A;  2E9X A;  3FXD B;  2YK0 A;  4KBM B;  4TX5 A;  1LRZ A;  1BR4 A;  2XAH B;  3MKD A;  4QXC B;  3SCH A;  1O4X A;  3PUQ A;  4C90 A;  3GN5 B;  4CI2 B;  3CQG B;  3F2E A;  4WNK A;  3J7Y q;  5ADX L;  1HS7 A;  2LOP A;  2XI8 A;  3L1P A;  4KP3 C;  5A1L A;  3NZP A;  2PE5 A;  2LHN A;  1FMW A;  3HZI B;  3LK4 2;  1HF0 A;  1RZR D;  2XTL A;  2CA5 A;  4WBO A;  2AXU A;  5JDG A;  3P8C D;  3FBZ A;  2XAQ B;  4X1I E;  3UTK A;  4ZHQ E;  4JQD A;  2RP4 A;  5ETW A;  4X4D A;  3AVR A;  3N9Q A;  2A3D A;  3ZEF B;  2KZ8 A;  1WR6 A;  1X79 A;  2YU1 A;  2X9Y A;  3B13 A;  3LBX A;  5DQW A;  4UIG A;  1JWL A;  2H3R A;  1Y9Q A;  4JCY A;  4UF0 B;  4UVA B;  3VU7 H;  4AQF A;  2D5V A;  5F3J A;  3DP7 A;  3W15 B;  4QXH B;  4A56 A;  2V7L A;  2AWI A;  3OKQ A;  4N78 D;  5FY7 A;  4EYU A;  1WRD A;  5LGT B;  4PU4 C;  1AU7 A;  2VKO A;  3ZYL A;  3O9X A;  4AXP A;  1R69 A;  2ES0 A;  3IVP A;  1MIY A;  3R1F A;  5A7L A;  2X0L B;  3AA7 B;  2N1G A;  4HN9 A;  1UTX A;  5LA6 E;  4DBQ A;  2LYP A;  3KXA A;  5H6R B;  4OHF A;  2CMR A;  2C5J A;  3C4W A;  3KV6 A;  2EHO A;  5H6Q B;  4G63 A;  2NP9 A;  5HXE A;  3UUM A;  5JRC A;  3CEC A;  4NUV A;  2XAG B;  5C8Y E;  2O49 A;  4NDW A;  3ZMV B;  4YHJ A;  4I55 E;  4TZ4 C;  3V5U A;  3N9N A;  4PJM A;  4AKG A;  3BK9 A;  5LP6 E;  4IWR A;  4AI6 A;  4PAG A;  1YW0 A;  2H7O A;  1YSE A;  5FYM A;  2NW9 A;  4H9P C;  2CEA A;  2KPJ A;  4GOU A;  5DAB A;  2EBY A;  2CM0 A;  4FBI A;  4PFO A;  1HF8 A;  1UX5 A;  2K48 A;  5LHG B;  4IE7 A;  1FEW A;  5E0O A;  3R84 B;  5K98 B;  4MFR A;  2X9H A;  5CA1 E;  2LOS A;  1HG5 A;  1U4Q A;  1BDI A;  5LYJ E;  3LIS A;  3ZN1 B;  2ICT A;  3N9L A;  3F51 A;  5DJQ C;  1CUN A;  4ZS3 A;  3ZC1 A;  2WIU B;  3JC6 C;  5L3F B;  3E22 E;  1D0Y A;  4DO0 A;  2JCG A;  2LE8 A;  4J2C A;  5LGU B;  4QX7 B;  2HPL A;  1EZ3 A;  2MYS A;  4AKR B;  4QKN A;  1KNZ A;  4GIW A;  2O4A A;  1ZPQ A;  2MTQ A;  5FY1 A;  2LYK A;  2Q9Q B;  4UVB B;  1FIO A;  3I1A A;  3OYZ A;  3D0T A;  4HE8 A;  5J1G A;  5BMV E;  2DI4 A;  1GT0 C;  2DWG A;  2WSS V;  5FP3 A;  3ZC0 A;  2PUA A;  3E0Z A;  3VHL A;  3C50 A;  4PK6 A;  3PUR A;  4TV9 E;  4XBF B;  3LBX B;  2M67 A;  2ODU A;  1JH9 A;  3LJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...