3GN5A

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5A02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5A01
4I6UA 4Z5CA 4Z59A 1ZZCA 2PPXA 1ZZ9A 2MEZA 4PU7A 2KEIA 1AU7A 1ZPQA 4JCYA 1QP4A 2IUOA 1PRUA 4PU4C 3R1FA 1POUA 1ZZ6A 1PERL 2PUCA 1WIZA 4Z5DA 2EF8A 4YG7B 2CSFA 3F6WA 3MLFA 3OP9A 2L8NA 2L49A 1ZS4A 2JVLA 3BDNA 4F8DA 2BNOA 3SCGA 1S7EA 3DNVB 2H8RA 2LYQA 2O4AA 2PIJA 4JQDA 3BS3A 3TRBA 1JFSA 1QQAA 1RIOA 4FN3A 1GT0C 1LMB3 1O4XA 2IVQA 2O49A 3GA8A 2ICPA 3LISA 2PUFA 1LCCA 1ZZBA 2LYPA 1RZRD 3SCFA 3D1NI 4NDWA 1LLIA 1JWLA 1NERA 1OSLA 2EBYA 2HSGA 2LYLA 4Z58A 4I6RA 4IA8A 1EFAA 2AXVA 1R63A 5K98B 2AUWA 1PRVA 3GN5A 1QPZA 3JXBC 1ADRA 2LYSA 2XSDC 4I8TA 2CROA 4MCXA 1WH8A 2HINA 3VK0A 1ZVVA 1B0NA 1ZAYA 3FYAA 3G7DA 2LYJA 2B5AA 2KEKA 2PUAA 3QF3A 4J1XA 1RZRA 2D5VA 1LQCA 4J1WA 3GN5B 3KXAA 1Y9QA 1PRAA 1UXDA 1L1MA 3QYXA 2AXZA 4GQMA 3FMYA 2EWTA 3S8QA 3OQMA 2JCGA 1QP0A 2PUEA 2R63A 3ZHMA 1WH6A 3IVPA 3QQ6A 2IV1A 3O9XA 3HZIB 4X4DA 4YARA 1VPWA 2XI8A 2IVBA 2LCVA 3L1PA 2XCJA 3LFPA 4O8BA 4OB4A 3ZHIA 4FBIA 2XIUA 1R69A 3CECA 3H5TA 4PU3C 3U3WA 1HF0A 2BNNA 3CLCA 2IU7A 4Y42A 1DWKA 4X4FA 3G5GA 3FYMA 2BNMA 1CQTA 4X4IA 3CROL 1UTXA 1Y7YA 1IC8A 2KEJA 2OFYA 2PUDA 4JCXA 2GZUA 1XWRA 4I6TA 2O38A 3F52A 4Z5HA 4IVZA 3EUSA 3RZZA 2AW6A 3JXDL 1UXCA 2OR1L 3QWGA 1CJGA 2FJRA 4YBAA 3OQNA 1ZZ7A 2KZ8A 3BD1A 3JXCL 4YG4A 2WUSR 1JFTA 3OQOA 2ICTA 3SCHA 2PUBA 1YSEA 1DW9A 1BDHA 1RZSA 2GRMA 3OMTA 2KPJA 4X4CA 2GRLA 1QQBA 3KJXA 2BJCA 1QP7A 4YG1A 1SQ8A 2LYKA 2MQKA 3ZKCA 4X4BA 2PUGA 2PE5A 4PU8A 1WETA 4X4EA 2A6CA 2LYRA 3KZ3A 4X4GA 1NEQA 4X4HA 2R1JL 1RPEL 2AXUA 1X57A 4GHJA 3UFDA 1OCTC 2IVGA 1BDIA 1PNRA 3F51A 3B7HA 5A7LA 1LCDA 2AWIA 2XJ3A 1X2LA 1JH9A 1ZZ8A 2WIUB 3HI2A 3PXPA 1E3OC 1ZUGA 3GBFA 4MCTA 4IWRA
chains in the Genus database with same CATH superfamily
3P8CD 1ZZ9A 1HX8A 3QNUA 5A1LA 2F4VT 3NRYA 5AQSB 3ZLIA 1IBKT 3SCGA 2LM9A 2P9BA 2MTQA 2KMFA 4H9OC 2UXDT 5FMNA 3IA3A 4BJNA 3FBZA 3LBXA 1YQ4A 3DM5A 4AKLA 5EK3A 2W66A 2XSDC 5JDLA 2E2AA 2MPKA 1B0NA 3N9LA 4QKNA 4IT4A 3A8YC 4YSYA 2JCGA 3K3QC 4X4DA 3C4WA 3CMLA 4YARA 2IVBA 2YN6A 5LHHB 2HPLA 4PU3C 3ZN1B 4QH1A 3RYCE 2YDQA 2LHNA 4PJNA 5DJQC 2LOSA 3GMIA 4IDPA 3D0TA 2KWIB 1U5PA 2V26A 2HFZA 2JQQA 5FXXA 3ZT6A 3ESLA 1YSEA 2XQ8A 3B13A 4G63A 4E7SA 2KPJA 3AAAB 2E8IA 2C5IT 2MOZA 3UQ4A 3F57A 2PXEA 1NAFA 4PU8A 2K3WA 2LYRA 3L3PA 2XJ3A 1J1JA 3AXJA 3N2GE 1JH9A 4ZI7E 4HFBA 2XQ7A 2IUOA 1Z8UA 4CI2B 1YKEB 4ER5A 3F6WA 3NDBB 3QOXA 3KBTA 4KP3C 1S35A 2LT3A 2WBLA 2CHOA 3CWZB 4ILCA 2SPCA 4ILBA 3C64A 1VCTA 2H7VC 4YJ2E 1HS7A 1OEDE 2AUWA 1O3XA 3TFLA 1JNZA 1LRZA 3VK0A 3CQCB 4IDZA 1MFQC 2XM1A 2V5CA 2BDEA 3T8OA 4J1XA 4FJOA 2Q9QC 1FIOA 2CEAA 2I0MA 4BA9A 2R63A 3F2EA 5DT2A 3A9XA 3P7IA 5LP6E 3K8PC 4DR7T 3CX8B 3LFMA 5L3CB 3LFPA 3ZHIA 4OB4A 2XIUA 1CQTA 4UF0A 4TN7B 3ONLC 3JXDL 2PXKA 3ZYLA 2V6XA 3KFWX 2KZ8A 1VRBA 3JXCL 5HXSA 5CFBA 3MK7C 4EYYR 3FZMB 2PBIA 2GRLA 3OTOT 3UU3A 3P4PA 4JI1T 3AE8A 2WZHA 4X4BA 2I6HA 2R1JL 1MMDA 3HA4A 2IDOB 2E9XA 4DR5T 1U2ZA 2WWVA 4KUMB 4OFZA 2FUPA 3HI2A 2BKNA 1XDPA 3MJXA 2BKOA 4EV6A 2LLWA 3QB5A 5ADXL 3ZC0A 4TWFA 2L8NA 2LNMA 4ZZCA 3BDNA 4X65T 4P09A 2LYQA 4TWHA 4YT0A 2UUAT 2L1PA 1Y01A 3AAEB 3A9ZA 1OSLA 3S4UA 4A98A 1WR6A 3MZKB 2PXPA 5AQTB 1QB2A 2NWBA 2QYWA 5ABFB 1WH8A 1G8XA 4DR1T 3BQIA 2ZMAA 5FL0A 4GK0E 2E9XC 4HWCA 4PJJA 4NXNT 2VKHA 1Y9QA 2BS3A 4OYJA 3RH3A 2DI4A 2VEOA 4X1YE 4B3TT 2PUEA 3ZHMA 4UELA 4LF7T 2QVAA 3AE1A 3ZSTA 4PJMA 1CHUA 4ILUA 3SOLA 2XCJA 1D0ZA 2WP9A 2AE9A 3VR9A 5AQUB 4NIQA 1OEDB 3KV4A 4WVLA 1XWRA 1MIYA 2W00A 3GZDA 3R09A 5AQQB 2XQ3A 4EIWA 5CGMA 3BD1A 4CN4A 4HFHA 4EGWA 4DUZT 1KF6A 4H63H 2PUBA 2M67A 5H6RB 3LK2B 2DNXA 4A56A 2BJCA 3RYIE 4M1PA 2G0UA 2V7MA 3UQ7A 2MQKA 3L8RA 2J7WA 2BG9B 4NUUA 4GHJA 1PNRA 3F51A 4PFPA 3RIFA 2LSGA 3LG7A 2PFVA 2VURA 3W15B 4HFVA 2WIUB 5F5WA 4WW0A 4ZI3C 2ZM2A 4UEMA 3ZYMA 2XQ4A 2D9DA 2OLTA 2UXXB 4P1NA 4QH4A 4O4IE 5GONE 4YSZA 1KFYA 1HNXT 3KDSE 4B3ST 4JI6T 2H8RA 5FVLA 3HKDE 5JDMA 3ANWB 3Q5EA 3GZDC 4H9SE 2D0TA 1M7KA 4YLHA 5DQWA 3V5UA 4NDWA 2BBJA 3CKDA 5AQRB 4I8TA 2IC9A 1WR0A 2DWKA 1ZAYA 2X51A 2WZIA 4IE6A 3X1DA 2WY2A 2LE8A 4K0UA 4TZ4C 2EHOB 1R8IA 3PUGA 1N33T 5AFUL 4O4JE 4HFCA 4ILAA 2XQYA 1HCIA 3R6NA 1IC8A 4JCXA 3RIUC 3B5MA 2IC6A 2O38A 1BR4A 2K5BB 2ODUA 5FXZA 3ONJA 3C98B 2HHHT 4OK0A 2GK9A 4CQIA 4X20E 4IL4A 4FI5A 4GYRA 5C3JA 3SWHA 2L9QA 3I9YA 3AVSA 3VRBA 1SQ8A 1YW0A 4EOZB 2XQ5A 4K0KT 4X4GA 2NTXA 1QZXA 3ZMUB 5GAGi 1T72A 2BBHA 1QSDA 4H9RC 2UUCT 2HCSA 2W63A 3N9PA 3NZLA 5EK2A 2VWAA 5HXEA 1XDOA 2CXDA 4UVCB 3PUXF 1IJ5A 5LB7B 5ABGA 2B76A 2WB5A 2PXBA 4IHJE 4DR3T 3DTOA 1N32T 4L0RA 2CXFA 1QQAA 4FN3A 3ZPOA 5JR9A 4UVBB 1I6ZA 2ZM8A 5L47A 1KNZA 3OPCA 2XPKA 2Z6EA 2XUEA 3LDQB 2XM2A 4Z58A 5JRCB 1EFAA 2IHR1 4PW8A 2XXAA 4DBQA 5AQHB 3O4XE 4DR2T 2MAWA 2ZLYA 4HFEA 2FJEA 3LBXB 4QX8B 5LG4A 2IAKA 1H7CA 2X67A 1NEKA 2W4XA 4KHZF 3GBFA 1UXDA 2NP9A 4H63V 4UV8B 4WBOA 2V3CC 1XZYA 2YDSA 2XY8B 2LCVA 4QHOA 4ZI3D 3QK6A 3TLWA 5LMUT 2BNNA 4X4FA 1IAPA 2PXDA 2W62A 2CLYC 2X9WA 2GZUA 3EDUA 3H3MA 4DE9A 2X0LB 4U7IA 1E2AA 3CX7B 5DTMA 5JTGA 1HG2A 2ACXA 3ABVA 2LRLA 5LA6E 2PE5A 3FZFB 3TKLB 4LFBT 1L0VA 1BDIA 5A7LA 4QXCB 5CB4E 1MMGA 3UT5E 2WMOA 5CJ5A 4IWRA 1YD8G 5HWYA 4Z59A 3ONXA 2LOPA 2MEZA 5F3JA 2CWOA 2PUCA 4Z8XA 5AQJB 3AXJB 3OP9A 3AE5A 4AKGA 2JVLA 3A7MA 3EHZA 3IF8B 4F8DA 2BNOA 3ME5A 5JDNA 4DE8A 3BS3A 4X64T 1GT0C 2PXVA 2LEHA 3GA8A 4WZXA 5HEUA 2RA1A 1LLIA 1T7SA 2MXDA 4QWNB 2NW9A 1FJGT 3RQUA 3PDYA 5K98B 2YOEA 3AEGA 5AQNB 2LYJA 5KDMC 2WU2A 2KXPB 3N9QA 2A9UA 3QYXA 4UR9A 3ZT5A 3K3OA 1ZV4X 5ABEA 3BK9A 5JDGA 3L1PA 5LHGB 4LF8T 3U3WA 3CIRA 4CXWA 4DNDA 5AQKB 2KEJA 2OFYA 5JDFA 3H37A 3LK3B 4B6XA 2IUBA 4GOUA 4U2YA 2WSSV 5HCMA 1DULA 4UF0B 5CA1E 1JFTA 1GQEA 2V6YA 3RC3A 1UK5A 3OMTA 4DV6T 2JRKA 3TELA 2CCQA 1DU2A 2A3DA 2X9HA 3G0TA 1WFDA 1VCSA 4X4HA 1HQ1A 2KZ7B 2A72A 3HL6A 4JEHB 3Q9DA 1ZZ8A 3DP7A 2HN2A 2BS4A 3JC6D 3UTKA 4JCYA 4Q25A 5LCYA 4IE4A 4H9QC 2VL8A 3UUBA 1ZS4A 2XSBA 5HEHA 3AE4A 2AXDS 4IREA 2O4AA 3TRBA 1JFSA 1O4XA 2Q9QA 4F8HA 2LJLA 3HKCE 1S94A 1LCCA 3CQXC 4EQZA 2CPTA 2J4GA 2Y48B 1LVFA 1R63A 2WDQA 4KX6A 3BQKA 4MCXA 5IYZE 5FXWA 2BKPA 1BR1A 1YKHB 3RF1A 3OBVE 2H89A 4U31A 2KSRA 3L39A 3KVBA 5HAXA 1B7TA 3Q5DA 5AQIB 4AQFC 3FMYA 3QUJA 2E5VA 3HZIB 2IV1A 5AQLB 4ZS2A 1T8BA 4I55E 3ZMVB 2CE7A 1VPWA 2XI8A 1HNZT 2L3LA 3CLCA 3LSVA 3OVUA 3IBPA 4LMLA 3RKOA 4HWDA 2XQ6A 3SRZA 3AB3B 4LF5T 3VWSA 4QXHB 2XXQA 4I43B 2JIWA 2D2SA 2EHOD 4AI6A 4X4EA 5EK4A 3O1IA 2AXUA 4JI2T 3UFDA 2IVGA 2CM0A 3UUMA 3AEFA 3HR0A 5HYAA 1ZOYA 2JPFA 2RPAA 3UFGA 3J7Yq 2YKSA 5LMNT 2BS2A 2A2FX 1PRUA 1XNQT 4DV0T 5LXTE 2XQAA 4CXYA 2CSFA 3AA0B 3JAEA 2DWGA 4IDNA 3M65A 5HEGA 2PIJA 4JBWF 3ETUA 1CUNA 2UXNB 4ERRA 3NROA 3MACA 3PUAA 4EKGA 4OBMA 3KV9A 3GN5A 2V7IA 4YHHT 1ZVVA 4PNIA 4KHPT 2KWHA 2PUAA 2H7OA 2Y6XA 3T1YT 2NTYA 3S8QA 3OQMA 3JADA 3AEEA 2VK9A 4ZI2D 2CRBA 3ZMTB 3TLVA 3FYMA 1LVKA 1UTXA 3EVYA 1KNPA 1ZEEA 1HFAA 3QWGA 2YINA 3OQNA 3C4ZA 4B3RT 4CN1A 4COFA 4PFOA 3RYFE 2FJAA 3MEJA 2X0HA 2LYKA 5HWXA 4C91A 1D1AA 4G2AA 1RPEL 5HCJA 5FL1A 3GUUA 4I4TE 4OX9T 1NENA 4TWDA 2XAGB 3AEAA 1D0XA 3PURA 3PXPA 4IE7A 4YY3T 3R1FA 5F8PA 4O4HE 2H88A 2WU5A 3N9NA 5IUXA 2XAFB 3ZEFB 3RX6A 4CZZB 4DIDB 4YFSA 3Q2MA 3R84B 3VKGA 1RIOA 4HWFA 3O1HA 1SHZC 1G73A 3QC9A 4AKHA 3P50A 2FFHA 1YQ3A 1MIVA 2J62A 4IA8A 4ZOLE 5JR9B 3NXHA 1BR0A 2J7UA 1T98A 2JMHA 1QPZA 2LYSA 4L5GA 5L4HA 3RIUA 1XNRT 1QUUA 1BR2A 3M3ZB 2LKHA 4X66T 3VKHA 4O2BE 1W9RA 1UUSA 4MFRA 5LYJE 1X79A 3F31A 3PE5A 3AECA 3IEEA 3ZCJA 4BJMA 1HF0A 3H5TA 3U3IA 3V5SA 3G5GA 4HKAA 4P0BA 3F52A 5GAHi 3RZZA 2IIUA 3AVRA 3ZYKA 5DQVA 5JDQA 3OQOA 3SCHA 1BDHA 1US7B 1MIWA 3PJAJ 2FJBA 3C4XA 1W0BA 2LHRA 4I50E 1N36T 1KNRA 4BAYB 1ZKEA 2WCAA 2AWIA 5LJNA 1VOMA 2XAQB 2XHEB 2V7KA 2W67A 2H3RA 5ABFA 3HKBE 4JLEA 1ZP0A 2WQYA 3SR4A 2L49A 2XTLA 5IHYA 1KEYA 3AA6B 2O49A 3I1AA 1KK7A 4U33A 4I0UA 2K9AA 5AQPB 3QOWA 4NPPA 4UIGA 2LYPA 4LFAT 5AQMB 3EI0A 3ZN0B 1UX5A 5L3EB 1M62A 2EBYA 2JQ9A 4GYSA 2LYLA 2W2UA 3IHRA 4ADZA 2NOXA 2AXVA 3FXDB 4ER0A 4HWHA 2HINA 2K24A 4YTNA 1IBLT 2KEKA 1D1BA 2E5LT 2ODRD 2EWTA 3I0OA 2VQFT 3PU8A 4IE0A 2WDVA 4IDOA 5HEOA 3UU5A 4DV7T 3EABA 4WYVA 1X9BA 4Y42A 2VKJA 5DABA 5J0ZA 2V8SV 5HXCA 2D0UA 1Z0PA 3AA7B 2KLQA 5LGTB 1UXCA 4WBNE 2OR1L 3H3AA 3E08A 1ZZ7A 3N9MA 5IWAT 3P4SA 3JC6C 3SX0A 5AQVB 4EEDA 2PJQA 1E1HB 1OEDC 4F6RC 3RGLA 1DW9A 3P4RA 2GRMA 3BQLA 1QQBA 3KJXA 2LLYA 2V6YB 1NEQA 5J2UE 1OCTC 5L3GB 3I0QA 4GKJT 3PJAA 2ZM6T 1HX1B 3RHWA 2VVSA 4ZEYA 4U3CA 5BMVE 2BG9C 3RKGA 2MBGA 1ZPQA 3PUWF 3EAMA 5KMGP 1PERL 2EHOA 4PK5A 4EEBA 3NZQA 2JJ9A 4Z91A 3NZPA 2YDRA 3ZPXA 2UXBT 2PXFA 2QRXA 4QX7B 1LMB3 3Q5WA 5LBQB 3HKEE 2ACZA 1ZZBA 1RZRD 4HN9A 3PUQA 1WYBA 4AKRB 1NERA 4L9IA 4JI4T 2NW7A 3P4QA 2Q9QB 3CK6A 4AISA 3LK42 5LJMA 1MMNA 5DTRA 2XXPA 1EZ3A 5HXRA 1L1MA 2PG8A 2KINB 2JQEA 2BVLA 4TNVA 4LFCT 1WH6A 2V5DA 5ETWA 5EZYE 3ZCIA 3N9OA 4X5TA 3FZLB 3LJCA 4HWIB 2EHOC 3KBUA 1J5ET 2XQ9A 5JUWA 5JDHA 4KI0F 3OYZA 1CJGA 1NWMX 2LKGA 2XASB 5ABHA 1WCRA 2WS3A 1WYCA 3P4WA 4AQGA 3NWIA 4X4CA 4TV8E 4YG1A 3UWPA 3PE0A 3N2KE 4HFDA 5LG3A 4CN6A 5KX5E 5HEJA 1X57A 3O1JA 4HE8A 5FY7A 2YK0A 5JRCA 1X2LA 4NXMT 2OA5A 4U72A 2FBWA 4C90A 4I6UA 5C8YE 3RI5A 4PU7A 4AKIA 3WAKA 1WIZA 3UFEA 1J5WA 1MMAA 2LSYA 3TEPA 2DHRA 2J1DG 4JQDA 5AQOB 4XBFB 2LRKA 1SUMB 3MXZA 3SS1A 4AQFA 4AQYT 5FY1A 4LF4T 4DV2T 2C5JA 3VRAA 4ZI2C 5DSXA 2E9XB 4MBQA 2HSGA 2X9YA 2PXQA 1OWAA 3ZMSB 4MHCA 1E7PA 2CBIA 2B5AA 4UVAB 4JUYA 2D5VA 3GN5B 3SFDA 3PUYF 2VKOA 4NUVA 2WWUA 2RP4A 1QP0A 3AE7A 3AE6A 2YEVC 3NBXX 4DR6T 4XZCA 4EKIA 2VVNA 5E0OA 3CECA 5DRTA 5HXHA 3KV6A 2XSAA 2YU1A 3CX6B 2N1GA 2XAJB 4Z5HA 3FB2A 3EUSA 2FJRA 3AE2A 4EYUA 4YG4A 3NRXA 1HF8A 3PTRB 3FZHB 5DRYA 3PUZF 4IDQA 2LM2A 2LSKA 3SFEA 4CXXA 3WAJA 2V1DB 3Q5XA 2V7LA 2VKDA 4YSXA 1UURA 1LCDA 2HH7A 2VB6A 3FZKB 4H9PC 2HPJA 3C51A 4DO0A 4MCTA 2W61A 5JH7E 1I94T 3T1HT 4JV5T 2KEIA 5FKYA 4IGUA 4PU4C 4TUYE 1POUA 1ZZ6A 4EZIA 5CA0E 2EF8A 2UUBT 4OHFA 1SA0E 1XMOT 4DV5T 4GKKT 5LNKA 5FXVA 4ER6A 4V1Av 4EZ4A 4DV4T 1W09A 2CBJA 3RIAA 3LISA 4TV9E 5FY0A 2DCFA 4LMJA 4UV9B 2BG9E 4I6RA 4YTPA 1ADRA 2CROA 4DV1T 4DMWA 2X0YA 3WI3A 4U2ZA 4HRAA 4DR4T 1HG5A 4PK4A 4EB6E 2AXZA 3AA1B 1WLXA 4HGAA 2BZBA 4OYKA 4JI8T 2XAHB 4JI7T 3ZSSA 1IJ6A 2C0SA 1FEWA 4ANJA 5JREA 1R69A 4X62T 2IU7A 4X4IA 2QA7A 2AW6A 3G06A 3AEDA 2XZEA 5J2TE 1HR0T 2ICTA 4JYAT 1JNRA 1UCUA 4ISSA 2CXLA 4ISTA 3KV5A 3ZKCA 1FMVA 2M4HA 1XWMA 1WETA 4IIJE 1N34T 2YBDA 4ER3A 4ER7A 1E3OC 4GK5E 4CI1B 4Z5CA 5L3BB 4KMCA 4E7ZA 2DLRA 2ES0A 3N5LA 2M6IA 3E0ZA 2JQKA 3TLTA 2L8KA 1NW3A 1S7EA 3DNVB 2UXCT 3MA9A 3UU4A 2ICPA 2HN1A 3OKQA 2PUFA 3VHLA 3J9X1 3D1NI 3AAIA 2YU2A 1U4QA 4Z90A 4ZS3A 3OKZA 2X68A 2UU9T 3I9WA 2D5UA 3LQXA 2Y8DA 1PRVA 2ODVA 2VASA 5FYMA 3ZJ2A 4EAHA 5FNVE 3G7DA 4A97A 2QGSA 4MLKA 4U7YA 3GZCA 3QF3A 1RZRA 3UU8A 1LQCA 4J1WA 4X1IE 2CLYB 3PUVF 5C2TA 4U74A 3QQ6A 2C5KT 3OJAA 3TLUA 1IZNB 5LOVE 4O8BA 4FBIA 5LHIB 4DV3T 3ZT7A 4AIUA 3AE9A 2PUDA 4YTMA 5M4YA 1FMWA 1XMQT 4YBAA 4TX5A 2Q9QD 3OYXA 1RZSA 2V7JA 3C50A 1QP7A 4ZHQE 3CVRA 2CWYA 5H6QB 2PUGA 2A6CA 3KZ3A 4EZHA 3EUHA 5FP3A 4HTEA 4ASKA 4QH5A 3VR8A 1D1CA 3K3NA 1ZUGA 1YXRA 3QFIA 1AU7A 4PAGA 2XJ7A 1QP4A 4N78D 3PUSA 5J1GA 4JEUB 2J47A 3MLFA 1OXZA 2JMKA 2IW5B 3JCFA 3U78A 2WM9A 4KBMB 3GWHA 3A5XA 1MNDA 4IE5A 2MYSA 2IVQA 4YJ3E 3TLSA 3ETVA 3RPUA 1UGOA 5L3DB 1ZHCA 2WDRA 1JWLA 4DVDA 5BR8T 2PXTA 5LBMA 2N2NA 4YHJA 3RLFF 3JXBC 4XAXB 5AQFB 1LKXA 4DMVA 1V9DA 2B1EA 4MALA 5FVKA 4LMKA 3FYAA 3VU7H 3KXAA 2WMNA 3DJBA 3IVPA 3O9XA 1OEDA 4LF9T 2ZM0A 2VQET 2CA5A 4HEAA 4GIWA 3RC8A 4ZZBA 2BNMA 3RRWA 1MNEA 1Y7YA 2R6GF 2OV9A 4IVZA 4ZXLA 4YXDA 5KXJA 3UUXB 2I59A 3KINB 2CHNA 2JQHA 2E9XD 4JI3T 3ZKRA 1WRDA 2BG9A 2X9XA 4JI5T 3AEBA 3PU3A 2NW8A 1UX4A 4UXNB 2W0GA 4Q2JA 4A5XA 4H9NC 2CMRA 3FHNA 3B7HA 2X66A 3MKDA 1QLBA 2KNDA 1ZZCA 2PPXA 1HTJF 3A9YA 5DTQA 2PXLA 3ANWA 4Z5DA 4YG7B 3ZC1A 3NVOA 4TNWA 1SE7A 4O4LE 3RQWA 1W0AA 3L09A 4EXTA 2HCNA 3QOFA 2BVMA 1Y64B 2PTFA 2WAUA 3SCFA 4PK6A 4O2AE 3UULA 3CPZA 3PV0F 1AJ3A 3N2OA 4PJLA 2N9DA 4HFIA 2M6BA 4IL9A 4X1KE 3E22E 3EDVA 1D0YA 3ZJ1A 5JR9C 1PRAA 4EK9A 1HNWT 4GQMA 5LGNB 3KVAA 3AE3A 4CI3B 2LSIA 3FXEB 4JI0T 3CQGB 1DWKA 3QB5K 4WNKA 2DL1A 3CROL 3NKZA 5LGUB 4I6TA 3B57A 4QXBB 2NR4A 2K48A 2LSJA 2VL0A 2PXUA 4O8SA 5L2LA 3FBLA 4J2CA 3RYHE 5L4EA 2WUSR 4P0AA 2KT9A 4DUYT 2FJDA 3RRCA 5TAOA 3M9LA 1IBMT 4B3MT 5JQGE 2IMLA 3KL4A 3UUNA 5AQGB 4LF6T 2LLVA 4AXPA 5L3FB 3OWQA 3UU6A 3ZMZB 4DBRA 3K1SA 3JAFA 5JVDE
chains in the Genus database with same CATH topology
3P8CD 5JH7E 4IE7A 1ZZ9A 2KEIA 1HX8A 4IGUA 2W63A 4PU4C 3N9PA 4TUYE 3R1FA 5F8PA 1POUA 1ZZ6A 2VWAA 4O4HE 5EK2A 5CA0E 5HXEA 5A1LA 2EF8A 2CXDA 4UVCB 3N9NA 2XAFB 1IJ5A 3NRYA 3ZEFB 4OHFA 1SA0E 3ZLIA 3RX6A 3SCGA 4CZZB 2LM9A 4YFSA 3Q2MA 5FXVA 4V1Av 3R84B 4EZ4A 4IHJE 5LNKA 3DTOA 2P9BA 4L0RA 3VKGA 2CXFA 1QQAA 1RIOA 4FN3A 3ZPOA 5JR9A 2MTQA 2KMFA 4H9OC 3O1HA 4UVBB 3LISA 5FMNA 2ZM8A 1SHZC 4BJNA 1G73A 3FBZA 4TV9E 3QC9A 5FY0A 1KNZA 4AKHA 2DCFA 2Z6EA 2XUEA 3LBXA 4UV9B 1MIVA 4Z58A 5JRCB 4I6RA 4IA8A 4ZOLE 5JR9B 1EFAA 4AKLA 1BR0A 2JMHA 1T98A 4PW8A 1QPZA 1ADRA 5EK3A 5JDLA 2LYSA 2XSDC 4DBQA 2CROA 4DMWA 4L5GA 3WI3A 3O4XE 2ZLYA 1B0NA 1QUUA 3LBXB 3N9LA 1HG5A 1BR2A 4QKNA 4QX8B 5LG4A 2IAKA 1H7CA 2X67A 4PK4A 1UXDA 3VKHA 4EB6E 2NP9A 2AXZA 4H63V 4O2BE 4UV8B 3AA1B 2JCGA 1WLXA 4HGAA 4WBOA 4MFRA 3K3QC 2BZBA 4OYKA 5LYJE 2XAHB 4X4DA 3C4WA 1X79A 1IJ6A 3CMLA 4YARA 2C0SA 1FEWA 2IVBA 3F31A 4QHOA 2LCVA 5LHHB 4ZI3D 4ANJA 3QK6A 2HPLA 5JREA 3IEEA 4PU3C 3ZCJA 1HF0A 3H5TA 1R69A 3ZN1B 4BJMA 2BNNA 2IU7A 3U3IA 4X4FA 1IAPA 3G5GA 3RYCE 3V5SA 4HKAA 4P0BA 2W62A 4X4IA 2CLYC 2LHNA 2X9WA 4PJNA 5DJQC 2LOSA 2GZUA 3EDUA 3GMIA 3F52A 2QA7A 2X0LB 3RZZA 2AW6A 3D0TA 2KWIB 3AVRA 1U5PA 3ZYKA 3CX7B 2V26A 5DQVA 1HG2A 2JQQA 5FXXA 5JDQA 3OQOA 5J2TE 2ICTA 3SCHA 3ESLA 2ACXA 1YSEA 1BDHA 1US7B 1UCUA 3B13A 4G63A 1MIWA 4E7SA 2KPJA 3AAAB 2E8IA 2CXLA 4ISSA 4ISTA 3C4XA 2C5IT 2LHRA 2MOZA 3F57A 3KV5A 4I50E 3ZKCA 1NAFA 1FMVA 5LA6E 2PE5A 4PU8A 1WETA 2LYRA 3TKLB 3L3PA 4BAYB 1ZKEA 4IIJE 1BDIA 5A7LA 2AWIA 2XJ3A 5LJNA 1VOMA 2XAQB 2XHEB 2V7KA 4QXCB 5CB4E 3N2GE 1JH9A 2H3RA 4ZI7E 1MMGA 3UT5E 3HKBE 1E3OC 2WMOA 4GK5E 4IWRA 1YD8G 5HWYA 4CI1B 4Z5CA 4Z59A 3ONXA 5L3BB 2LOPA 4KMCA 2MEZA 4JLEA 5F3JA 2IUOA 2CWOA 4E7ZA 2PUCA 2DLRA 4Z8XA 4CI2B 2ES0A 3N5LA 1YKEB 3E0ZA 3OP9A 3F6WA 2L49A 2XTLA 4AKGA 2JVLA 3IF8B 4F8DA 2BNOA 1S35A 2L8KA 3KBTA 2LT3A 4KP3C 1S7EA 3DNVB 2WBLA 5JDNA 3CWZB 5IHYA 3BS3A 3MA9A 3AA6B 2O49A 3I1AA 1GT0C 1KK7A 2SPCA 2LEHA 3GA8A 2ICPA 2K9AA 3C64A 3OKQA 2PUFA 3VHLA 4UIGA 2LYPA 3J9X1 3D1NI 2RA1A 3AAIA 1LLIA 2H7VC 2YU2A 1U4QA 4ZS3A 1UX5A 4QWNB 2NW9A 3ZN0B 2X68A 4YJ2E 2EBYA 3I9WA 4GYSA 5L3EB 1HS7A 2LYLA 3IHRA 2D5UA 4ADZA 2NOXA 2AXVA 2Y8DA 3PDYA 5K98B 3FXDB 2AUWA 1PRVA 1O3XA 2ODVA 2VASA 2HINA 2K24A 1LRZA 3VK0A 3CQCB 5FYMA 4IDZA 3ZJ2A 4EAHA 5FNVE 3G7DA 2LYJA 2QGSA 4MLKA 2KEKA 1D1BA 3QF3A 4J1XA 1RZRA 2BDEA 1LQCA 4J1WA 3T8OA 5KDMC 2KXPB 2Q9QC 3N9QA 4FJOA 4X1IE 1FIOA 3QYXA 2CLYB 2EWTA 2CEAA 3I0OA 3PU8A 4BA9A 4U74A 2R63A 4IE0A 3QQ6A 3F2EA 2C5KT 3OJAA 3P7IA 3K3OA 5LP6E 1ZV4X 3K8PC 3CX8B 1IZNB 3BK9A 5LOVE 3L1PA 4O8BA 3LFPA 3ZHIA 4OB4A 4FBIA 3LFMA 2XIUA 3U3WA 5L3CB 5LHIB 5LHGB 4Y42A 2VKJA 4CXWA 4DNDA 1CQTA 4UF0A 5DABA 4TN7B 2KEJA 2OFYA 2PUDA 5JDFA 3H37A 3LK3B 5HXCA 2D0UA 1Z0PA 5M4YA 1FMWA 3AA7B 2KLQA 3JXDL 5LGTB 1UXCA 3ZYLA 2OR1L 3H3AA 4B6XA 3KFWX 3E08A 4WBNE 4YBAA 4GOUA 1ZZ7A 2KZ8A 3N9MA 2WSSV 4UF0B 5CA1E 4TX5A 1VRBA 3JXCL 3JC6C 2Q9QD 3MK7C 5HXSA 1JFTA 2PJQA 1E1HB 3OYXA 3RC3A 4F6RC 4EYYR 1DW9A 1RZSA 2GRMA 3BQLA 3OMTA 2JRKA 2PBIA 2V7JA 2GRLA 1QQBA 3KJXA 3C50A 1QP7A 4ZHQE 3CVRA 2CCQA 2CWYA 2A3DA 5H6QB 4X4BA 2PUGA 2X9HA 2A6CA 3KZ3A 4X4HA 1NEQA 2R1JL 1MMDA 2A72A 2KZ7B 3HA4A 3HL6A 4JEHB 5J2UE 1OCTC 4EZHA 2E9XA 5L3GB 3I0QA 3EUHA 5FP3A 4HTEA 4ASKA 3Q9DA 4KUMB 1ZZ8A 4OFZA 3DP7A 3HI2A 1D1CA 3K3NA 1ZUGA 5BMVE 3JC6D 3MJXA 2MBGA 3UTKA 1AU7A 4JCYA 4PAGA 5LCYA 1ZPQA 5ADXL 1QP4A 4N78D 5KMGP 3PUSA 1PERL 3ZC0A 2EHOA 5J1GA 4IE4A 4JEUB 4H9QC 4PK5A 2VL8A 3MLFA 3NZQA 2L8NA 1OXZA 2JMKA 1ZS4A 2JJ9A 2IW5B 3NZPA 3BDNA 4P09A 3U78A 2LYQA 2O4AA 2WM9A 4KBMB 3TRBA 4QX7B 1JFSA 3GWHA 1LMB3 1MNDA 3A5XA 2MYSA 1O4XA 2IVQA 2Q9QA 3Q5WA 4IE5A 3HKEE 4YJ3E 5LBQB 2LJLA 3HKCE 1S94A 3ETVA 1LCCA 1ZZBA 1RZRD 3AAEB 4HN9A 3RPUA 5L3DB 3PUQA 1ZHCA 1WYBA 1JWLA 3CQXC 4AKRB 1NERA 1OSLA 4DVDA 3S4UA 4L9IA 1WR6A 5LBMA 2N2NA 2Y48B 2NW7A 3MZKB 2Q9QB 1LVFA 4YHJA 1R63A 3JXBC 4XAXB 1LKXA 2NWBA 3BQKA 4MCXA 3LK42 5LJMA 1WH8A 1G8XA 1MMNA 5FXWA 5IYZE 4DMVA 5JDGA 1V9DA 2B1EA 3BQIA 1BR1A 1YKHB 4MALA 3OBVE 3FYAA 2ZMAA 1EZ3A 4GK0E 2E9XC 3VU7H 4PJJA 5HXRA 3KVBA 3KXAA 2VKHA 1Y9QA 1B7TA 2WMNA 3DJBA 5HAXA 1L1MA 4OYJA 3RH3A 2PG8A 2KINB 4AQFC 3FMYA 2DI4A 3QUJA 2BVLA 4X1YE 2PUEA 3ZHMA 4UELA 1WH6A 3IVPA 3O9XA 2IV1A 3HZIB 5ETWA 5EZYE 4ZS2A 4I55E 3ZCIA 3ZMVB 2CE7A 3N9OA 1VPWA 2ZM0A 4PJMA 2XI8A 2L3LA 3LJCA 4ILUA 3SOLA 2XCJA 1D0ZA 2CA5A 4HEAA 3CLCA 2EHOC 4GIWA 3KBUA 3RC8A 2BNMA 3RRWA 1MNEA 1Y7YA 3IBPA 3KV4A 1XWRA 3RKOA 1MIYA 5JDHA 4IVZA 2W00A 3UUXB 3OYZA 1CJGA 2I59A 3KINB 3SRZA 4EIWA 1NWMX 3BD1A 2E9XD 2XASB 3AB3B 4H63H 1WRDA 2X9XA 2PUBA 2M67A 1WYCA 4QXHB 4AQGA 5H6RB 3LK2B 2DNXA 4X4CA 4TV8E 3PU3A 4A56A 2BJCA 3RYIE 4M1PA 2G0UA 4YG1A 2V7MA 2NW8A 4I43B 1UX4A 2MQKA 3PE0A 2D2SA 2EHOD 3N2KE 4AI6A 4X4EA 4UXNB 2W0GA 3O1IA 5EK4A 5KX5E 4NUUA 2AXUA 1X57A 3O1JA 4H9NC 4HE8A 4GHJA 5FY7A 3UFDA 2CMRA 2IVGA 2YK0A 1PNRA 3FHNA 5JRCA 3F51A 3B7HA 4PFPA 2CM0A 1X2LA 2LSGA 2X66A 3LG7A 3UUMA 3HR0A 2PFVA 3W15B 3MKDA 2OA5A 5HYAA 4HFVA 2WIUB 4U72A 2JPFA 4WW0A 3J7Yq 4ZI3C 2ZM2A 4C90A 4I6UA 4UEMA 2KNDA 3ZYMA 1ZZCA 2PPXA 1HTJF 2A2FX 4PU7A 5C8YE 4AKIA 1PRUA 3ANWA 3WAKA 5LXTE 2UXXB 1WIZA 4Z5DA 4YG7B 4O4IE 5GONE 3ZC1A 3UFEA 2CSFA 4CXYA 1MMAA 2LSYA 3AA0B 2DHRA 2DWGA 4O4LE 3KDSE 3L09A 4EXTA 2J1DG 3M65A 2H8RA 3HKDE 2BVMA 2PIJA 4JQDA 1Y64B 3ETUA 5JDMA 3ANWB 2WAUA 4XBFB 1CUNA 2UXNB 4ERRA 3MXZA 3SS1A 4AQFA 4H9SE 2D0TA 5FY1A 3MACA 3PUAA 4YLHA 3SCFA 5DQWA 3V5UA 4NDWA 4PK6A 2C5JA 4ZI2C 3KV9A 3CKDA 2E9XB 4MBQA 2HSGA 2X9YA 4O2AE 3UULA 3CPZA 1AJ3A 1OWAA 3GN5A 3N2OA 4PJLA 3ZMSB 2V7IA 4I8TA 2IC9A 2N9DA 2DWKA 4MHCA 4X1KE 3E22E 1ZVVA 3EDVA 4PNIA 1ZAYA 2X51A 4IE6A 1D0YA 2B5AA 2LE8A 4K0UA 2KWHA 4JUYA 2PUAA 2D5VA 4TZ4C 4UVAB 3ZJ1A 2EHOB 3GN5B 5JR9C 1PRAA 2H7OA 2Y6XA 4GQMA 2NTYA 3S8QA 3OQMA 2VKOA 2WWUA 4NUVA 5LGNB 2RP4A 1QP0A 3PUGA 3KVAA 2YEVC 4CI3B 3NBXX 5AFUL 4O4JE 2VK9A 2LSIA 3FXEB 2XQYA 4XZCA 4ZI2D 5E0OA 1HCIA 3CECA 3CQGB 5HXHA 3ZMTB 1DWKA 4WNKA 3FYMA 3R6NA 3KV6A 3CROL 1UTXA 1IC8A 4JCXA 1LVKA 2YU1A 5LGUB 4I6TA 3B57A 4QXBB 3CX6B 2N1GA 2XAJB 2IC6A 2O38A 4Z5HA 3EVYA 3FB2A 3EUSA 2K48A 2LSJA 1ZEEA 1BR4A 2K5BB 1HFAA 2ODUA 4O8SA 3QWGA 2FJRA 2YINA 3OQNA 3C4ZA 5FXZA 4EYUA 5L2LA 3FBLA 4J2CA 3RYHE 4PFOA 3C98B 4YG4A 2WUSR 4OK0A 3NRXA 2GK9A 1HF8A 4CQIA 3PTRB 4X20E 4P0AA 4FI5A 3RYFE 4GYRA 3SWHA 2KT9A 2L9QA 3I9YA 3AVSA 2LSKA 4CXXA 1SQ8A 2LYKA 1YW0A 3RRCA 4EOZB 3WAJA 5TAOA 2V1DB 5HWXA 5JQGE 4X4GA 3Q5XA 4C91A 1D1AA 4G2AA 1RPEL 2NTXA 2V7LA 2VKDA 3UUNA 1LCDA 2HH7A 3ZMUB 4AXPA 4I4TE 5L3FB 4DBRA 3ZMZB 2XAGB 2VB6A 1D0XA 1QSDA 3PURA 2HPJA 3C51A 4H9PC 3PXPA 4H9RC 4DO0A 3GBFA 4MCTA 5JVDE 2W61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6U A;  4Z5C A;  4Z59 A;  1ZZC A;  2PPX A;  1ZZ9 A;  2MEZ A;  4PU7 A;  2KEI A;  1AU7 A;  1ZPQ A;  4JCY A;  1QP4 A;  2IUO A;  1PRU A;  4PU4 C;  3R1F A;  1POU A;  1ZZ6 A;  1PER L;  2PUC A;  1WIZ A;  4Z5D A;  2EF8 A;  4YG7 B;  2CSF A;  3F6W A;  3MLF A;  3OP9 A;  2L8N A;  2L49 A;  1ZS4 A;  2JVL A;  3BDN A;  4F8D A;  2BNO A;  3SCG A;  1S7E A;  3DNV B;  2H8R A;  2LYQ A;  2O4A A;  2PIJ A;  4JQD A;  3BS3 A;  3TRB A;  1JFS A;  1QQA A;  1RIO A;  4FN3 A;  1GT0 C;  1LMB 3;  1O4X A;  2IVQ A;  2O49 A;  3GA8 A;  2ICP A;  3LIS A;  2PUF A;  1LCC A;  1ZZB A;  2LYP A;  1RZR D;  3SCF A;  3D1N I;  4NDW A;  1LLI A;  1JWL A;  1NER A;  1OSL A;  2EBY A;  2HSG A;  2LYL A;  4Z58 A;  4I6R A;  4IA8 A;  1EFA A;  2AXV A;  1R63 A;  5K98 B;  2AUW A;  1PRV A;  3GN5 A;  1QPZ A;  3JXB C;  1ADR A;  2LYS A;  2XSD C;  4I8T A;  2CRO A;  4MCX A;  1WH8 A;  2HIN A;  3VK0 A;  1ZVV A;  1B0N A;  1ZAY A;  3FYA A;  3G7D A;  2LYJ A;  2B5A A;  2KEK A;  2PUA A;  3QF3 A;  4J1X A;  1RZR A;  2D5V A;  1LQC A;  4J1W A;  3GN5 B;  3KXA A;  1Y9Q A;  1PRA A;  1UXD A;  1L1M A;  3QYX A;  2AXZ A;  4GQM A;  3FMY A;  2EWT A;  3S8Q A;  3OQM A;  2JCG A;  1QP0 A;  2PUE A;  2R63 A;  3ZHM A;  1WH6 A;  3IVP A;  3QQ6 A;  2IV1 A;  3O9X A;  3HZI B;  4X4D A;  4YAR A;  1VPW A;  2XI8 A;  2IVB A;  2LCV A;  3L1P A;  2XCJ A;  3LFP A;  4O8B A;  4OB4 A;  3ZHI A;  4FBI A;  2XIU A;  1R69 A;  3CEC A;  3H5T A;  4PU3 C;  3U3W A;  1HF0 A;  2BNN A;  3CLC A;  2IU7 A;  4Y42 A;  1DWK A;  4X4F A;  3G5G A;  3FYM A;  2BNM A;  1CQT A;  4X4I A;  3CRO L;  1UTX A;  1Y7Y A;  1IC8 A;  2KEJ A;  2OFY A;  2PUD A;  4JCX A;  2GZU A;  1XWR A;  4I6T A;  2O38 A;  3F52 A;  4Z5H A;  4IVZ A;  3EUS A;  3RZZ A;  2AW6 A;  3JXD L;  1UXC A;  2OR1 L;  3QWG A;  1CJG A;  2FJR A;  4YBA A;  3OQN A;  1ZZ7 A;  2KZ8 A;  3BD1 A;  3JXC L;  4YG4 A;  2WUS R;  1JFT A;  3OQO A;  2ICT A;  3SCH A;  2PUB A;  1YSE A;  1DW9 A;  1BDH A;  1RZS A;  2GRM A;  3OMT A;  2KPJ A;  4X4C A;  2GRL A;  1QQB A;  3KJX A;  2BJC A;  1QP7 A;  4YG1 A;  1SQ8 A;  2LYK A;  2MQK A;  3ZKC A;  4X4B A;  2PUG A;  2PE5 A;  4PU8 A;  1WET A;  4X4E A;  2A6C A;  2LYR A;  3KZ3 A;  4X4G A;  1NEQ A;  4X4H A;  2R1J L;  1RPE L;  2AXU A;  1X57 A;  4GHJ A;  3UFD A;  1OCT C;  2IVG A;  1BDI A;  1PNR A;  3F51 A;  3B7H A;  5A7L A;  1LCD A;  2AWI A;  2XJ3 A;  1X2L A;  1JH9 A;  1ZZ8 A;  2WIU B;  3HI2 A;  3PXP A;  1E3O C;  1ZUG A;  3GBF A;  4MCT A;  4IWR A; 
#chains in the Genus database with same CATH topology
 3P8C D;  1ZZ9 A;  1HX8 A;  3QNU A;  5A1L A;  2F4V T;  3NRY A;  5AQS B;  3ZLI A;  1IBK T;  3SCG A;  2LM9 A;  2P9B A;  2MTQ A;  2KMF A;  4H9O C;  2UXD T;  5FMN A;  3IA3 A;  4BJN A;  3FBZ A;  3LBX A;  1YQ4 A;  3DM5 A;  4AKL A;  5EK3 A;  2W66 A;  2XSD C;  5JDL A;  2E2A A;  2MPK A;  1B0N A;  3N9L A;  4QKN A;  4IT4 A;  3A8Y C;  4YSY A;  2JCG A;  3K3Q C;  4X4D A;  3C4W A;  3CML A;  4YAR A;  2IVB A;  2YN6 A;  5LHH B;  2HPL A;  4PU3 C;  3ZN1 B;  4QH1 A;  3RYC E;  2YDQ A;  2LHN A;  4PJN A;  5DJQ C;  2LOS A;  3GMI A;  4IDP A;  3D0T A;  2KWI B;  1U5P A;  2V26 A;  2HFZ A;  2JQQ A;  5FXX A;  3ZT6 A;  3ESL A;  1YSE A;  2XQ8 A;  3B13 A;  4G63 A;  4E7S A;  2KPJ A;  3AAA B;  2E8I A;  2C5I T;  2MOZ A;  3UQ4 A;  3F57 A;  2PXE A;  1NAF A;  4PU8 A;  2K3W A;  2LYR A;  3L3P A;  2XJ3 A;  1J1J A;  3AXJ A;  3N2G E;  1JH9 A;  4ZI7 E;  4HFB A;  2XQ7 A;  2IUO A;  1Z8U A;  4CI2 B;  1YKE B;  4ER5 A;  3F6W A;  3NDB B;  3QOX A;  3KBT A;  4KP3 C;  1S35 A;  2LT3 A;  2WBL A;  2CHO A;  3CWZ B;  4ILC A;  2SPC A;  4ILB A;  3C64 A;  1VCT A;  2H7V C;  4YJ2 E;  1HS7 A;  1OED E;  2AUW A;  1O3X A;  3TFL A;  1JNZ A;  1LRZ A;  3VK0 A;  3CQC B;  4IDZ A;  1MFQ C;  2XM1 A;  2V5C A;  2BDE A;  3T8O A;  4J1X A;  4FJO A;  2Q9Q C;  1FIO A;  2CEA A;  2I0M A;  4BA9 A;  2R63 A;  3F2E A;  5DT2 A;  3A9X A;  3P7I A;  5LP6 E;  3K8P C;  4DR7 T;  3CX8 B;  3LFM A;  5L3C B;  3LFP A;  3ZHI A;  4OB4 A;  2XIU A;  1CQT A;  4UF0 A;  4TN7 B;  3ONL C;  3JXD L;  2PXK A;  3ZYL A;  2V6X A;  3KFW X;  2KZ8 A;  1VRB A;  3JXC L;  5HXS A;  5CFB A;  3MK7 C;  4EYY R;  3FZM B;  2PBI A;  2GRL A;  3OTO T;  3UU3 A;  3P4P A;  4JI1 T;  3AE8 A;  2WZH A;  4X4B A;  2I6H A;  2R1J L;  1MMD A;  3HA4 A;  2IDO B;  2E9X A;  4DR5 T;  1U2Z A;  2WWV A;  4KUM B;  4OFZ A;  2FUP A;  3HI2 A;  2BKN A;  1XDP A;  3MJX A;  2BKO A;  4EV6 A;  2LLW A;  3QB5 A;  5ADX L;  3ZC0 A;  4TWF A;  2L8N A;  2LNM A;  4ZZC A;  3BDN A;  4X65 T;  4P09 A;  2LYQ A;  4TWH A;  4YT0 A;  2UUA T;  2L1P A;  1Y01 A;  3AAE B;  3A9Z A;  1OSL A;  3S4U A;  4A98 A;  1WR6 A;  3MZK B;  2PXP A;  5AQT B;  1QB2 A;  2NWB A;  2QYW A;  5ABF B;  1WH8 A;  1G8X A;  4DR1 T;  3BQI A;  2ZMA A;  5FL0 A;  4GK0 E;  2E9X C;  4HWC A;  4PJJ A;  4NXN T;  2VKH A;  1Y9Q A;  2BS3 A;  4OYJ A;  3RH3 A;  2DI4 A;  2VEO A;  4X1Y E;  4B3T T;  2PUE A;  3ZHM A;  4UEL A;  4LF7 T;  2QVA A;  3AE1 A;  3ZST A;  4PJM A;  1CHU A;  4ILU A;  3SOL A;  2XCJ A;  1D0Z A;  2WP9 A;  2AE9 A;  3VR9 A;  5AQU B;  4NIQ A;  1OED B;  3KV4 A;  4WVL A;  1XWR A;  1MIY A;  2W00 A;  3GZD A;  3R09 A;  5AQQ B;  2XQ3 A;  4EIW A;  5CGM A;  3BD1 A;  4CN4 A;  4HFH A;  4EGW A;  4DUZ T;  1KF6 A;  4H63 H;  2PUB A;  2M67 A;  5H6R B;  3LK2 B;  2DNX A;  4A56 A;  2BJC A;  3RYI E;  4M1P A;  2G0U A;  2V7M A;  3UQ7 A;  2MQK A;  3L8R A;  2J7W A;  2BG9 B;  4NUU A;  4GHJ A;  1PNR A;  3F51 A;  4PFP A;  3RIF A;  2LSG A;  3LG7 A;  2PFV A;  2VUR A;  3W15 B;  4HFV A;  2WIU B;  5F5W A;  4WW0 A;  4ZI3 C;  2ZM2 A;  4UEM A;  3ZYM A;  2XQ4 A;  2D9D A;  2OLT A;  2UXX B;  4P1N A;  4QH4 A;  4O4I E;  5GON E;  4YSZ A;  1KFY A;  1HNX T;  3KDS E;  4B3S T;  4JI6 T;  2H8R A;  5FVL A;  3HKD E;  5JDM A;  3ANW B;  3Q5E A;  3GZD C;  4H9S E;  2D0T A;  1M7K A;  4YLH A;  5DQW A;  3V5U A;  4NDW A;  2BBJ A;  3CKD A;  5AQR B;  4I8T A;  2IC9 A;  1WR0 A;  2DWK A;  1ZAY A;  2X51 A;  2WZI A;  4IE6 A;  3X1D A;  2WY2 A;  2LE8 A;  4K0U A;  4TZ4 C;  2EHO B;  1R8I A;  3PUG A;  1N33 T;  5AFU L;  4O4J E;  4HFC A;  4ILA A;  2XQY A;  1HCI A;  3R6N A;  1IC8 A;  4JCX A;  3RIU C;  3B5M A;  2IC6 A;  2O38 A;  1BR4 A;  2K5B B;  2ODU A;  5FXZ A;  3ONJ A;  3C98 B;  2HHH T;  4OK0 A;  2GK9 A;  4CQI A;  4X20 E;  4IL4 A;  4FI5 A;  4GYR A;  5C3J A;  3SWH A;  2L9Q A;  3I9Y A;  3AVS A;  3VRB A;  1SQ8 A;  1YW0 A;  4EOZ B;  2XQ5 A;  4K0K T;  4X4G A;  2NTX A;  1QZX A;  3ZMU B;  5GAG i;  1T72 A;  2BBH A;  1QSD A;  4H9R C;  2UUC T;  2HCS A;  2W63 A;  3N9P A;  3NZL A;  5EK2 A;  2VWA A;  5HXE A;  1XDO A;  2CXD A;  4UVC B;  3PUX F;  1IJ5 A;  5LB7 B;  5ABG A;  2B76 A;  2WB5 A;  2PXB A;  4IHJ E;  4DR3 T;  3DTO A;  1N32 T;  4L0R A;  2CXF A;  1QQA A;  4FN3 A;  3ZPO A;  5JR9 A;  4UVB B;  1I6Z A;  2ZM8 A;  5L47 A;  1KNZ A;  3OPC A;  2XPK A;  2Z6E A;  2XUE A;  3LDQ B;  2XM2 A;  4Z58 A;  5JRC B;  1EFA A;  2IHR 1;  4PW8 A;  2XXA A;  4DBQ A;  5AQH B;  3O4X E;  4DR2 T;  2MAW A;  2ZLY A;  4HFE A;  2FJE A;  3LBX B;  4QX8 B;  5LG4 A;  2IAK A;  1H7C A;  2X67 A;  1NEK A;  2W4X A;  4KHZ F;  3GBF A;  1UXD A;  2NP9 A;  4H63 V;  4UV8 B;  4WBO A;  2V3C C;  1XZY A;  2YDS A;  2XY8 B;  2LCV A;  4QHO A;  4ZI3 D;  3QK6 A;  3TLW A;  5LMU T;  2BNN A;  4X4F A;  1IAP A;  2PXD A;  2W62 A;  2CLY C;  2X9W A;  2GZU A;  3EDU A;  3H3M A;  4DE9 A;  2X0L B;  4U7I A;  1E2A A;  3CX7 B;  5DTM A;  5JTG A;  1HG2 A;  2ACX A;  3ABV A;  2LRL A;  5LA6 E;  2PE5 A;  3FZF B;  3TKL B;  4LFB T;  1L0V A;  1BDI A;  5A7L A;  4QXC B;  5CB4 E;  1MMG A;  3UT5 E;  2WMO A;  5CJ5 A;  4IWR A;  1YD8 G;  5HWY A;  4Z59 A;  3ONX A;  2LOP A;  2MEZ A;  5F3J A;  2CWO A;  2PUC A;  4Z8X A;  5AQJ B;  3AXJ B;  3OP9 A;  3AE5 A;  4AKG A;  2JVL A;  3A7M A;  3EHZ A;  3IF8 B;  4F8D A;  2BNO A;  3ME5 A;  5JDN A;  4DE8 A;  3BS3 A;  4X64 T;  1GT0 C;  2PXV A;  2LEH A;  3GA8 A;  4WZX A;  5HEU A;  2RA1 A;  1LLI A;  1T7S A;  2MXD A;  4QWN B;  2NW9 A;  1FJG T;  3RQU A;  3PDY A;  5K98 B;  2YOE A;  3AEG A;  5AQN B;  2LYJ A;  5KDM C;  2WU2 A;  2KXP B;  3N9Q A;  2A9U A;  3QYX A;  4UR9 A;  3ZT5 A;  3K3O A;  1ZV4 X;  5ABE A;  3BK9 A;  5JDG A;  3L1P A;  5LHG B;  4LF8 T;  3U3W A;  3CIR A;  4CXW A;  4DND A;  5AQK B;  2KEJ A;  2OFY A;  5JDF A;  3H37 A;  3LK3 B;  4B6X A;  2IUB A;  4GOU A;  4U2Y A;  2WSS V;  5HCM A;  1DUL A;  4UF0 B;  5CA1 E;  1JFT A;  1GQE A;  2V6Y A;  3RC3 A;  1UK5 A;  3OMT A;  4DV6 T;  2JRK A;  3TEL A;  2CCQ A;  1DU2 A;  2A3D A;  2X9H A;  3G0T A;  1WFD A;  1VCS A;  4X4H A;  1HQ1 A;  2KZ7 B;  2A72 A;  3HL6 A;  4JEH B;  3Q9D A;  1ZZ8 A;  3DP7 A;  2HN2 A;  2BS4 A;  3JC6 D;  3UTK A;  4JCY A;  4Q25 A;  5LCY A;  4IE4 A;  4H9Q C;  2VL8 A;  3UUB A;  1ZS4 A;  2XSB A;  5HEH A;  3AE4 A;  2AXD S;  4IRE A;  2O4A A;  3TRB A;  1JFS A;  1O4X A;  2Q9Q A;  4F8H A;  2LJL A;  3HKC E;  1S94 A;  1LCC A;  3CQX C;  4EQZ A;  2CPT A;  2J4G A;  2Y48 B;  1LVF A;  1R63 A;  2WDQ A;  4KX6 A;  3BQK A;  4MCX A;  5IYZ E;  5FXW A;  2BKP A;  1BR1 A;  1YKH B;  3RF1 A;  3OBV E;  2H89 A;  4U31 A;  2KSR A;  3L39 A;  3KVB A;  5HAX A;  1B7T A;  3Q5D A;  5AQI B;  4AQF C;  3FMY A;  3QUJ A;  2E5V A;  3HZI B;  2IV1 A;  5AQL B;  4ZS2 A;  1T8B A;  4I55 E;  3ZMV B;  2CE7 A;  1VPW A;  2XI8 A;  1HNZ T;  2L3L A;  3CLC A;  3LSV A;  3OVU A;  3IBP A;  4LML A;  3RKO A;  4HWD A;  2XQ6 A;  3SRZ A;  3AB3 B;  4LF5 T;  3VWS A;  4QXH B;  2XXQ A;  4I43 B;  2JIW A;  2D2S A;  2EHO D;  4AI6 A;  4X4E A;  5EK4 A;  3O1I A;  2AXU A;  4JI2 T;  3UFD A;  2IVG A;  2CM0 A;  3UUM A;  3AEF A;  3HR0 A;  5HYA A;  1ZOY A;  2JPF A;  2RPA A;  3UFG A;  3J7Y q;  2YKS A;  5LMN T;  2BS2 A;  2A2F X;  1PRU A;  1XNQ T;  4DV0 T;  5LXT E;  2XQA A;  4CXY A;  2CSF A;  3AA0 B;  3JAE A;  2DWG A;  4IDN A;  3M65 A;  5HEG A;  2PIJ A;  4JBW F;  3ETU A;  1CUN A;  2UXN B;  4ERR A;  3NRO A;  3MAC A;  3PUA A;  4EKG A;  4OBM A;  3KV9 A;  3GN5 A;  2V7I A;  4YHH T;  1ZVV A;  4PNI A;  4KHP T;  2KWH A;  2PUA A;  2H7O A;  2Y6X A;  3T1Y T;  2NTY A;  3S8Q A;  3OQM A;  3JAD A;  3AEE A;  2VK9 A;  4ZI2 D;  2CRB A;  3ZMT B;  3TLV A;  3FYM A;  1LVK A;  1UTX A;  3EVY A;  1KNP A;  1ZEE A;  1HFA A;  3QWG A;  2YIN A;  3OQN A;  3C4Z A;  4B3R T;  4CN1 A;  4COF A;  4PFO A;  3RYF E;  2FJA A;  3MEJ A;  2X0H A;  2LYK A;  5HWX A;  4C91 A;  1D1A A;  4G2A A;  1RPE L;  5HCJ A;  5FL1 A;  3GUU A;  4I4T E;  4OX9 T;  1NEN A;  4TWD A;  2XAG B;  3AEA A;  1D0X A;  3PUR A;  3PXP A;  4IE7 A;  4YY3 T;  3R1F A;  5F8P A;  4O4H E;  2H88 A;  2WU5 A;  3N9N A;  5IUX A;  2XAF B;  3ZEF B;  3RX6 A;  4CZZ B;  4DID B;  4YFS A;  3Q2M A;  3R84 B;  3VKG A;  1RIO A;  4HWF A;  3O1H A;  1SHZ C;  1G73 A;  3QC9 A;  4AKH A;  3P50 A;  2FFH A;  1YQ3 A;  1MIV A;  2J62 A;  4IA8 A;  4ZOL E;  5JR9 B;  3NXH A;  1BR0 A;  2J7U A;  1T98 A;  2JMH A;  1QPZ A;  2LYS A;  4L5G A;  5L4H A;  3RIU A;  1XNR T;  1QUU A;  1BR2 A;  3M3Z B;  2LKH A;  4X66 T;  3VKH A;  4O2B E;  1W9R A;  1UUS A;  4MFR A;  5LYJ E;  1X79 A;  3F31 A;  3PE5 A;  3AEC A;  3IEE A;  3ZCJ A;  4BJM A;  1HF0 A;  3H5T A;  3U3I A;  3V5S A;  3G5G A;  4HKA A;  4P0B A;  3F52 A;  5GAH i;  3RZZ A;  2IIU A;  3AVR A;  3ZYK A;  5DQV A;  5JDQ A;  3OQO A;  3SCH A;  1BDH A;  1US7 B;  1MIW A;  3PJA J;  2FJB A;  3C4X A;  1W0B A;  2LHR A;  4I50 E;  1N36 T;  1KNR A;  4BAY B;  1ZKE A;  2WCA A;  2AWI A;  5LJN A;  1VOM A;  2XAQ B;  2XHE B;  2V7K A;  2W67 A;  2H3R A;  5ABF A;  3HKB E;  4JLE A;  1ZP0 A;  2WQY A;  3SR4 A;  2L49 A;  2XTL A;  5IHY A;  1KEY A;  3AA6 B;  2O49 A;  3I1A A;  1KK7 A;  4U33 A;  4I0U A;  2K9A A;  5AQP B;  3QOW A;  4NPP A;  4UIG A;  2LYP A;  4LFA T;  5AQM B;  3EI0 A;  3ZN0 B;  1UX5 A;  5L3E B;  1M62 A;  2EBY A;  2JQ9 A;  4GYS A;  2LYL A;  2W2U A;  3IHR A;  4ADZ A;  2NOX A;  2AXV A;  3FXD B;  4ER0 A;  4HWH A;  2HIN A;  2K24 A;  4YTN A;  1IBL T;  2KEK A;  1D1B A;  2E5L T;  2ODR D;  2EWT A;  3I0O A;  2VQF T;  3PU8 A;  4IE0 A;  2WDV A;  4IDO A;  5HEO A;  3UU5 A;  4DV7 T;  3EAB A;  4WYV A;  1X9B A;  4Y42 A;  2VKJ A;  5DAB A;  5J0Z A;  2V8S V;  5HXC A;  2D0U A;  1Z0P A;  3AA7 B;  2KLQ A;  5LGT B;  1UXC A;  4WBN E;  2OR1 L;  3H3A A;  3E08 A;  1ZZ7 A;  3N9M A;  5IWA T;  3P4S A;  3JC6 C;  3SX0 A;  5AQV B;  4EED A;  2PJQ A;  1E1H B;  1OED C;  4F6R C;  3RGL A;  1DW9 A;  3P4R A;  2GRM A;  3BQL A;  1QQB A;  3KJX A;  2LLY A;  2V6Y B;  1NEQ A;  5J2U E;  1OCT C;  5L3G B;  3I0Q A;  4GKJ T;  3PJA A;  2ZM6 T;  1HX1 B;  3RHW A;  2VVS A;  4ZEY A;  4U3C A;  5BMV E;  2BG9 C;  3RKG A;  2MBG A;  1ZPQ A;  3PUW F;  3EAM A;  5KMG P;  1PER L;  2EHO A;  4PK5 A;  4EEB A;  3NZQ A;  2JJ9 A;  4Z91 A;  3NZP A;  2YDR A;  3ZPX A;  2UXB T;  2PXF A;  2QRX A;  4QX7 B;  1LMB 3;  3Q5W A;  5LBQ B;  3HKE E;  2ACZ A;  1ZZB A;  1RZR D;  4HN9 A;  3PUQ A;  1WYB A;  4AKR B;  1NER A;  4L9I A;  4JI4 T;  2NW7 A;  3P4Q A;  2Q9Q B;  3CK6 A;  4AIS A;  3LK4 2;  5LJM A;  1MMN A;  5DTR A;  2XXP A;  1EZ3 A;  5HXR A;  1L1M A;  2PG8 A;  2KIN B;  2JQE A;  2BVL A;  4TNV A;  4LFC T;  1WH6 A;  2V5D A;  5ETW A;  5EZY E;  3ZCI A;  3N9O A;  4X5T A;  3FZL B;  3LJC A;  4HWI B;  2EHO C;  3KBU A;  1J5E T;  2XQ9 A;  5JUW A;  5JDH A;  4KI0 F;  3OYZ A;  1CJG A;  1NWM X;  2LKG A;  2XAS B;  5ABH A;  1WCR A;  2WS3 A;  1WYC A;  3P4W A;  4AQG A;  3NWI A;  4X4C A;  4TV8 E;  4YG1 A;  3UWP A;  3PE0 A;  3N2K E;  4HFD A;  5LG3 A;  4CN6 A;  5KX5 E;  5HEJ A;  1X57 A;  3O1J A;  4HE8 A;  5FY7 A;  2YK0 A;  5JRC A;  1X2L A;  4NXM T;  2OA5 A;  4U72 A;  2FBW A;  4C90 A;  4I6U A;  5C8Y E;  3RI5 A;  4PU7 A;  4AKI A;  3WAK A;  1WIZ A;  3UFE A;  1J5W A;  1MMA A;  2LSY A;  3TEP A;  2DHR A;  2J1D G;  4JQD A;  5AQO B;  4XBF B;  2LRK A;  1SUM B;  3MXZ A;  3SS1 A;  4AQF A;  4AQY T;  5FY1 A;  4LF4 T;  4DV2 T;  2C5J A;  3VRA A;  4ZI2 C;  5DSX A;  2E9X B;  4MBQ A;  2HSG A;  2X9Y A;  2PXQ A;  1OWA A;  3ZMS B;  4MHC A;  1E7P A;  2CBI A;  2B5A A;  4UVA B;  4JUY A;  2D5V A;  3GN5 B;  3SFD A;  3PUY F;  2VKO A;  4NUV A;  2WWU A;  2RP4 A;  1QP0 A;  3AE7 A;  3AE6 A;  2YEV C;  3NBX X;  4DR6 T;  4XZC A;  4EKI A;  2VVN A;  5E0O A;  3CEC A;  5DRT A;  5HXH A;  3KV6 A;  2XSA A;  2YU1 A;  3CX6 B;  2N1G A;  2XAJ B;  4Z5H A;  3FB2 A;  3EUS A;  2FJR A;  3AE2 A;  4EYU A;  4YG4 A;  3NRX A;  1HF8 A;  3PTR B;  3FZH B;  5DRY A;  3PUZ F;  4IDQ A;  2LM2 A;  2LSK A;  3SFE A;  4CXX A;  3WAJ A;  2V1D B;  3Q5X A;  2V7L A;  2VKD A;  4YSX A;  1UUR A;  1LCD A;  2HH7 A;  2VB6 A;  3FZK B;  4H9P C;  2HPJ A;  3C51 A;  4DO0 A;  4MCT A;  2W61 A;  5JH7 E;  1I94 T;  3T1H T;  4JV5 T;  2KEI A;  5FKY A;  4IGU A;  4PU4 C;  4TUY E;  1POU A;  1ZZ6 A;  4EZI A;  5CA0 E;  2EF8 A;  2UUB T;  4OHF A;  1SA0 E;  1XMO T;  4DV5 T;  4GKK T;  5LNK A;  5FXV A;  4ER6 A;  4V1A v;  4EZ4 A;  4DV4 T;  1W09 A;  2CBJ A;  3RIA A;  3LIS A;  4TV9 E;  5FY0 A;  2DCF A;  4LMJ A;  4UV9 B;  2BG9 E;  4I6R A;  4YTP A;  1ADR A;  2CRO A;  4DV1 T;  4DMW A;  2X0Y A;  3WI3 A;  4U2Z A;  4HRA A;  4DR4 T;  1HG5 A;  4PK4 A;  4EB6 E;  2AXZ A;  3AA1 B;  1WLX A;  4HGA A;  2BZB A;  4OYK A;  4JI8 T;  2XAH B;  4JI7 T;  3ZSS A;  1IJ6 A;  2C0S A;  1FEW A;  4ANJ A;  5JRE A;  1R69 A;  4X62 T;  2IU7 A;  4X4I A;  2QA7 A;  2AW6 A;  3G06 A;  3AED A;  2XZE A;  5J2T E;  1HR0 T;  2ICT A;  4JYA T;  1JNR A;  1UCU A;  4ISS A;  2CXL A;  4IST A;  3KV5 A;  3ZKC A;  1FMV A;  2M4H A;  1XWM A;  1WET A;  4IIJ E;  1N34 T;  2YBD A;  4ER3 A;  4ER7 A;  1E3O C;  4GK5 E;  4CI1 B;  4Z5C A;  5L3B B;  4KMC A;  4E7Z A;  2DLR A;  2ES0 A;  3N5L A;  2M6I A;  3E0Z A;  2JQK A;  3TLT A;  2L8K A;  1NW3 A;  1S7E A;  3DNV B;  2UXC T;  3MA9 A;  3UU4 A;  2ICP A;  2HN1 A;  3OKQ A;  2PUF A;  3VHL A;  3J9X 1;  3D1N I;  3AAI A;  2YU2 A;  1U4Q A;  4Z90 A;  4ZS3 A;  3OKZ A;  2X68 A;  2UU9 T;  3I9W A;  2D5U A;  3LQX A;  2Y8D A;  1PRV A;  2ODV A;  2VAS A;  5FYM A;  3ZJ2 A;  4EAH A;  5FNV E;  3G7D A;  4A97 A;  2QGS A;  4MLK A;  4U7Y A;  3GZC A;  3QF3 A;  1RZR A;  3UU8 A;  1LQC A;  4J1W A;  4X1I E;  2CLY B;  3PUV F;  5C2T A;  4U74 A;  3QQ6 A;  2C5K T;  3OJA A;  3TLU A;  1IZN B;  5LOV E;  4O8B A;  4FBI A;  5LHI B;  4DV3 T;  3ZT7 A;  4AIU A;  3AE9 A;  2PUD A;  4YTM A;  5M4Y A;  1FMW A;  1XMQ T;  4YBA A;  4TX5 A;  2Q9Q D;  3OYX A;  1RZS A;  2V7J A;  3C50 A;  1QP7 A;  4ZHQ E;  3CVR A;  2CWY A;  5H6Q B;  2PUG A;  2A6C A;  3KZ3 A;  4EZH A;  3EUH A;  5FP3 A;  4HTE A;  4ASK A;  4QH5 A;  3VR8 A;  1D1C A;  3K3N A;  1ZUG A;  1YXR A;  3QFI A;  1AU7 A;  4PAG A;  2XJ7 A;  1QP4 A;  4N78 D;  3PUS A;  5J1G A;  4JEU B;  2J47 A;  3MLF A;  1OXZ A;  2JMK A;  2IW5 B;  3JCF A;  3U78 A;  2WM9 A;  4KBM B;  3GWH A;  3A5X A;  1MND A;  4IE5 A;  2MYS A;  2IVQ A;  4YJ3 E;  3TLS A;  3ETV A;  3RPU A;  1UGO A;  5L3D B;  1ZHC A;  2WDR A;  1JWL A;  4DVD A;  5BR8 T;  2PXT A;  5LBM A;  2N2N A;  4YHJ A;  3RLF F;  3JXB C;  4XAX B;  5AQF B;  1LKX A;  4DMV A;  1V9D A;  2B1E A;  4MAL A;  5FVK A;  4LMK A;  3FYA A;  3VU7 H;  3KXA A;  2WMN A;  3DJB A;  3IVP A;  3O9X A;  1OED A;  4LF9 T;  2ZM0 A;  2VQE T;  2CA5 A;  4HEA A;  4GIW A;  3RC8 A;  4ZZB A;  2BNM A;  3RRW A;  1MNE A;  1Y7Y A;  2R6G F;  2OV9 A;  4IVZ A;  4ZXL A;  4YXD A;  5KXJ A;  3UUX B;  2I59 A;  3KIN B;  2CHN A;  2JQH A;  2E9X D;  4JI3 T;  3ZKR A;  1WRD A;  2BG9 A;  2X9X A;  4JI5 T;  3AEB A;  3PU3 A;  2NW8 A;  1UX4 A;  4UXN B;  2W0G A;  4Q2J A;  4A5X A;  4H9N C;  2CMR A;  3FHN A;  3B7H A;  2X66 A;  3MKD A;  1QLB A;  2KND A;  1ZZC A;  2PPX A;  1HTJ F;  3A9Y A;  5DTQ A;  2PXL A;  3ANW A;  4Z5D A;  4YG7 B;  3ZC1 A;  3NVO A;  4TNW A;  1SE7 A;  4O4L E;  3RQW A;  1W0A A;  3L09 A;  4EXT A;  2HCN A;  3QOF A;  2BVM A;  1Y64 B;  2PTF A;  2WAU A;  3SCF A;  4PK6 A;  4O2A E;  3UUL A;  3CPZ A;  3PV0 F;  1AJ3 A;  3N2O A;  4PJL A;  2N9D A;  4HFI A;  2M6B A;  4IL9 A;  4X1K E;  3E22 E;  3EDV A;  1D0Y A;  3ZJ1 A;  5JR9 C;  1PRA A;  4EK9 A;  1HNW T;  4GQM A;  5LGN B;  3KVA A;  3AE3 A;  4CI3 B;  2LSI A;  3FXE B;  4JI0 T;  3CQG B;  1DWK A;  3QB5 K;  4WNK A;  2DL1 A;  3CRO L;  3NKZ A;  5LGU B;  4I6T A;  3B57 A;  4QXB B;  2NR4 A;  2K48 A;  2LSJ A;  2VL0 A;  2PXU A;  4O8S A;  5L2L A;  3FBL A;  4J2C A;  3RYH E;  5L4E A;  2WUS R;  4P0A A;  2KT9 A;  4DUY T;  2FJD A;  3RRC A;  5TAO A;  3M9L A;  1IBM T;  4B3M T;  5JQG E;  2IML A;  3KL4 A;  3UUN A;  5AQG B;  4LF6 T;  2LLV A;  4AXP A;  5L3F B;  3OWQ A;  3UU6 A;  3ZMZ B;  4DBR A;  3K1S A;  3JAF A;  5JVD E; 
#chains in the Genus database with same CATH homology
 3P8C D;  5JH7 E;  4IE7 A;  1ZZ9 A;  2KEI A;  1HX8 A;  4IGU A;  2W63 A;  4PU4 C;  3N9P A;  4TUY E;  3R1F A;  5F8P A;  1POU A;  1ZZ6 A;  2VWA A;  4O4H E;  5EK2 A;  5CA0 E;  5HXE A;  5A1L A;  2EF8 A;  2CXD A;  4UVC B;  3N9N A;  2XAF B;  1IJ5 A;  3NRY A;  3ZEF B;  4OHF A;  1SA0 E;  3ZLI A;  3RX6 A;  3SCG A;  4CZZ B;  2LM9 A;  4YFS A;  3Q2M A;  5FXV A;  4V1A v;  3R84 B;  4EZ4 A;  4IHJ E;  5LNK A;  3DTO A;  2P9B A;  4L0R A;  3VKG A;  2CXF A;  1QQA A;  1RIO A;  4FN3 A;  3ZPO A;  5JR9 A;  2MTQ A;  2KMF A;  4H9O C;  3O1H A;  4UVB B;  3LIS A;  5FMN A;  2ZM8 A;  1SHZ C;  4BJN A;  1G73 A;  3FBZ A;  4TV9 E;  3QC9 A;  5FY0 A;  1KNZ A;  4AKH A;  2DCF A;  2Z6E A;  2XUE A;  3LBX A;  4UV9 B;  1MIV A;  4Z58 A;  5JRC B;  4I6R A;  4IA8 A;  4ZOL E;  5JR9 B;  1EFA A;  4AKL A;  1BR0 A;  2JMH A;  1T98 A;  4PW8 A;  1QPZ A;  1ADR A;  5EK3 A;  5JDL A;  2LYS A;  2XSD C;  4DBQ A;  2CRO A;  4DMW A;  4L5G A;  3WI3 A;  3O4X E;  2ZLY A;  1B0N A;  1QUU A;  3LBX B;  3N9L A;  1HG5 A;  1BR2 A;  4QKN A;  4QX8 B;  5LG4 A;  2IAK A;  1H7C A;  2X67 A;  4PK4 A;  1UXD A;  3VKH A;  4EB6 E;  2NP9 A;  2AXZ A;  4H63 V;  4O2B E;  4UV8 B;  3AA1 B;  2JCG A;  1WLX A;  4HGA A;  4WBO A;  4MFR A;  3K3Q C;  2BZB A;  4OYK A;  5LYJ E;  2XAH B;  4X4D A;  3C4W A;  1X79 A;  1IJ6 A;  3CML A;  4YAR A;  2C0S A;  1FEW A;  2IVB A;  3F31 A;  4QHO A;  2LCV A;  5LHH B;  4ZI3 D;  4ANJ A;  3QK6 A;  2HPL A;  5JRE A;  3IEE A;  4PU3 C;  3ZCJ A;  1HF0 A;  3H5T A;  1R69 A;  3ZN1 B;  4BJM A;  2BNN A;  2IU7 A;  3U3I A;  4X4F A;  1IAP A;  3G5G A;  3RYC E;  3V5S A;  4HKA A;  4P0B A;  2W62 A;  4X4I A;  2CLY C;  2LHN A;  2X9W A;  4PJN A;  5DJQ C;  2LOS A;  2GZU A;  3EDU A;  3GMI A;  3F52 A;  2QA7 A;  2X0L B;  3RZZ A;  2AW6 A;  3D0T A;  2KWI B;  3AVR A;  1U5P A;  3ZYK A;  3CX7 B;  2V26 A;  5DQV A;  1HG2 A;  2JQQ A;  5FXX A;  5JDQ A;  3OQO A;  5J2T E;  2ICT A;  3SCH A;  3ESL A;  2ACX A;  1YSE A;  1BDH A;  1US7 B;  1UCU A;  3B13 A;  4G63 A;  1MIW A;  4E7S A;  2KPJ A;  3AAA B;  2E8I A;  2CXL A;  4ISS A;  4IST A;  3C4X A;  2C5I T;  2LHR A;  2MOZ A;  3F57 A;  3KV5 A;  4I50 E;  3ZKC A;  1NAF A;  1FMV A;  5LA6 E;  2PE5 A;  4PU8 A;  1WET A;  2LYR A;  3TKL B;  3L3P A;  4BAY B;  1ZKE A;  4IIJ E;  1BDI A;  5A7L A;  2AWI A;  2XJ3 A;  5LJN A;  1VOM A;  2XAQ B;  2XHE B;  2V7K A;  4QXC B;  5CB4 E;  3N2G E;  1JH9 A;  2H3R A;  4ZI7 E;  1MMG A;  3UT5 E;  3HKB E;  1E3O C;  2WMO A;  4GK5 E;  4IWR A;  1YD8 G;  5HWY A;  4CI1 B;  4Z5C A;  4Z59 A;  3ONX A;  5L3B B;  2LOP A;  4KMC A;  2MEZ A;  4JLE A;  5F3J A;  2IUO A;  2CWO A;  4E7Z A;  2PUC A;  2DLR A;  4Z8X A;  4CI2 B;  2ES0 A;  3N5L A;  1YKE B;  3E0Z A;  3OP9 A;  3F6W A;  2L49 A;  2XTL A;  4AKG A;  2JVL A;  3IF8 B;  4F8D A;  2BNO A;  1S35 A;  2L8K A;  3KBT A;  2LT3 A;  4KP3 C;  1S7E A;  3DNV B;  2WBL A;  5JDN A;  3CWZ B;  5IHY A;  3BS3 A;  3MA9 A;  3AA6 B;  2O49 A;  3I1A A;  1GT0 C;  1KK7 A;  2SPC A;  2LEH A;  3GA8 A;  2ICP A;  2K9A A;  3C64 A;  3OKQ A;  2PUF A;  3VHL A;  4UIG A;  2LYP A;  3J9X 1;  3D1N I;  2RA1 A;  3AAI A;  1LLI A;  2H7V C;  2YU2 A;  1U4Q A;  4ZS3 A;  1UX5 A;  4QWN B;  2NW9 A;  3ZN0 B;  2X68 A;  4YJ2 E;  2EBY A;  3I9W A;  4GYS A;  5L3E B;  1HS7 A;  2LYL A;  3IHR A;  2D5U A;  4ADZ A;  2NOX A;  2AXV A;  2Y8D A;  3PDY A;  5K98 B;  3FXD B;  2AUW A;  1PRV A;  1O3X A;  2ODV A;  2VAS A;  2HIN A;  2K24 A;  1LRZ A;  3VK0 A;  3CQC B;  5FYM A;  4IDZ A;  3ZJ2 A;  4EAH A;  5FNV E;  3G7D A;  2LYJ A;  2QGS A;  4MLK A;  2KEK A;  1D1B A;  3QF3 A;  4J1X A;  1RZR A;  2BDE A;  1LQC A;  4J1W A;  3T8O A;  5KDM C;  2KXP B;  2Q9Q C;  3N9Q A;  4FJO A;  4X1I E;  1FIO A;  3QYX A;  2CLY B;  2EWT A;  2CEA A;  3I0O A;  3PU8 A;  4BA9 A;  4U74 A;  2R63 A;  4IE0 A;  3QQ6 A;  3F2E A;  2C5K T;  3OJA A;  3P7I A;  3K3O A;  5LP6 E;  1ZV4 X;  3K8P C;  3CX8 B;  1IZN B;  3BK9 A;  5LOV E;  3L1P A;  4O8B A;  3LFP A;  3ZHI A;  4OB4 A;  4FBI A;  3LFM A;  2XIU A;  3U3W A;  5L3C B;  5LHI B;  5LHG B;  4Y42 A;  2VKJ A;  4CXW A;  4DND A;  1CQT A;  4UF0 A;  5DAB A;  4TN7 B;  2KEJ A;  2OFY A;  2PUD A;  5JDF A;  3H37 A;  3LK3 B;  5HXC A;  2D0U A;  1Z0P A;  5M4Y A;  1FMW A;  3AA7 B;  2KLQ A;  3JXD L;  5LGT B;  1UXC A;  3ZYL A;  2OR1 L;  3H3A A;  4B6X A;  3KFW X;  3E08 A;  4WBN E;  4YBA A;  4GOU A;  1ZZ7 A;  2KZ8 A;  3N9M A;  2WSS V;  4UF0 B;  5CA1 E;  4TX5 A;  1VRB A;  3JXC L;  3JC6 C;  2Q9Q D;  3MK7 C;  5HXS A;  1JFT A;  2PJQ A;  1E1H B;  3OYX A;  3RC3 A;  4F6R C;  4EYY R;  1DW9 A;  1RZS A;  2GRM A;  3BQL A;  3OMT A;  2JRK A;  2PBI A;  2V7J A;  2GRL A;  1QQB A;  3KJX A;  3C50 A;  1QP7 A;  4ZHQ E;  3CVR A;  2CCQ A;  2CWY A;  2A3D A;  5H6Q B;  4X4B A;  2PUG A;  2X9H A;  2A6C A;  3KZ3 A;  4X4H A;  1NEQ A;  2R1J L;  1MMD A;  2A72 A;  2KZ7 B;  3HA4 A;  3HL6 A;  4JEH B;  5J2U E;  1OCT C;  4EZH A;  2E9X A;  5L3G B;  3I0Q A;  3EUH A;  5FP3 A;  4HTE A;  4ASK A;  3Q9D A;  4KUM B;  1ZZ8 A;  4OFZ A;  3DP7 A;  3HI2 A;  1D1C A;  3K3N A;  1ZUG A;  5BMV E;  3JC6 D;  3MJX A;  2MBG A;  3UTK A;  1AU7 A;  4JCY A;  4PAG A;  5LCY A;  1ZPQ A;  5ADX L;  1QP4 A;  4N78 D;  5KMG P;  3PUS A;  1PER L;  3ZC0 A;  2EHO A;  5J1G A;  4IE4 A;  4JEU B;  4H9Q C;  4PK5 A;  2VL8 A;  3MLF A;  3NZQ A;  2L8N A;  1OXZ A;  2JMK A;  1ZS4 A;  2JJ9 A;  2IW5 B;  3NZP A;  3BDN A;  4P09 A;  3U78 A;  2LYQ A;  2O4A A;  2WM9 A;  4KBM B;  3TRB A;  4QX7 B;  1JFS A;  3GWH A;  1LMB 3;  1MND A;  3A5X A;  2MYS A;  1O4X A;  2IVQ A;  2Q9Q A;  3Q5W A;  4IE5 A;  3HKE E;  4YJ3 E;  5LBQ B;  2LJL A;  3HKC E;  1S94 A;  3ETV A;  1LCC A;  1ZZB A;  1RZR D;  3AAE B;  4HN9 A;  3RPU A;  5L3D B;  3PUQ A;  1ZHC A;  1WYB A;  1JWL A;  3CQX C;  4AKR B;  1NER A;  1OSL A;  4DVD A;  3S4U A;  4L9I A;  1WR6 A;  5LBM A;  2N2N A;  2Y48 B;  2NW7 A;  3MZK B;  2Q9Q B;  1LVF A;  4YHJ A;  1R63 A;  3JXB C;  4XAX B;  1LKX A;  2NWB A;  3BQK A;  4MCX A;  3LK4 2;  5LJM A;  1WH8 A;  1G8X A;  1MMN A;  5FXW A;  5IYZ E;  4DMV A;  5JDG A;  1V9D A;  2B1E A;  3BQI A;  1BR1 A;  1YKH B;  4MAL A;  3OBV E;  3FYA A;  2ZMA A;  1EZ3 A;  4GK0 E;  2E9X C;  3VU7 H;  4PJJ A;  5HXR A;  3KVB A;  3KXA A;  2VKH A;  1Y9Q A;  1B7T A;  2WMN A;  3DJB A;  5HAX A;  1L1M A;  4OYJ A;  3RH3 A;  2PG8 A;  2KIN B;  4AQF C;  3FMY A;  2DI4 A;  3QUJ A;  2BVL A;  4X1Y E;  2PUE A;  3ZHM A;  4UEL A;  1WH6 A;  3IVP A;  3O9X A;  2IV1 A;  3HZI B;  5ETW A;  5EZY E;  4ZS2 A;  4I55 E;  3ZCI A;  3ZMV B;  2CE7 A;  3N9O A;  1VPW A;  2ZM0 A;  4PJM A;  2XI8 A;  2L3L A;  3LJC A;  4ILU A;  3SOL A;  2XCJ A;  1D0Z A;  2CA5 A;  4HEA A;  3CLC A;  2EHO C;  4GIW A;  3KBU A;  3RC8 A;  2BNM A;  3RRW A;  1MNE A;  1Y7Y A;  3IBP A;  3KV4 A;  1XWR A;  3RKO A;  1MIY A;  5JDH A;  4IVZ A;  2W00 A;  3UUX B;  3OYZ A;  1CJG A;  2I59 A;  3KIN B;  3SRZ A;  4EIW A;  1NWM X;  3BD1 A;  2E9X D;  2XAS B;  3AB3 B;  4H63 H;  1WRD A;  2X9X A;  2PUB A;  2M67 A;  1WYC A;  4QXH B;  4AQG A;  5H6R B;  3LK2 B;  2DNX A;  4X4C A;  4TV8 E;  3PU3 A;  4A56 A;  2BJC A;  3RYI E;  4M1P A;  2G0U A;  4YG1 A;  2V7M A;  2NW8 A;  4I43 B;  1UX4 A;  2MQK A;  3PE0 A;  2D2S A;  2EHO D;  3N2K E;  4AI6 A;  4X4E A;  4UXN B;  2W0G A;  3O1I A;  5EK4 A;  5KX5 E;  4NUU A;  2AXU A;  1X57 A;  3O1J A;  4H9N C;  4HE8 A;  4GHJ A;  5FY7 A;  3UFD A;  2CMR A;  2IVG A;  2YK0 A;  1PNR A;  3FHN A;  5JRC A;  3F51 A;  3B7H A;  4PFP A;  2CM0 A;  1X2L A;  2LSG A;  2X66 A;  3LG7 A;  3UUM A;  3HR0 A;  2PFV A;  3W15 B;  3MKD A;  2OA5 A;  5HYA A;  4HFV A;  2WIU B;  4U72 A;  2JPF A;  4WW0 A;  3J7Y q;  4ZI3 C;  2ZM2 A;  4C90 A;  4I6U A;  4UEM A;  2KND A;  3ZYM A;  1ZZC A;  2PPX A;  1HTJ F;  2A2F X;  4PU7 A;  5C8Y E;  4AKI A;  1PRU A;  3ANW A;  3WAK A;  5LXT E;  2UXX B;  1WIZ A;  4Z5D A;  4YG7 B;  4O4I E;  5GON E;  3ZC1 A;  3UFE A;  2CSF A;  4CXY A;  1MMA A;  2LSY A;  3AA0 B;  2DHR A;  2DWG A;  4O4L E;  3KDS E;  3L09 A;  4EXT A;  2J1D G;  3M65 A;  2H8R A;  3HKD E;  2BVM A;  2PIJ A;  4JQD A;  1Y64 B;  3ETU A;  5JDM A;  3ANW B;  2WAU A;  4XBF B;  1CUN A;  2UXN B;  4ERR A;  3MXZ A;  3SS1 A;  4AQF A;  4H9S E;  2D0T A;  5FY1 A;  3MAC A;  3PUA A;  4YLH A;  3SCF A;  5DQW A;  3V5U A;  4NDW A;  4PK6 A;  2C5J A;  4ZI2 C;  3KV9 A;  3CKD A;  2E9X B;  4MBQ A;  2HSG A;  2X9Y A;  4O2A E;  3UUL A;  3CPZ A;  1AJ3 A;  1OWA A;  3GN5 A;  3N2O A;  4PJL A;  3ZMS B;  2V7I A;  4I8T A;  2IC9 A;  2N9D A;  2DWK A;  4MHC A;  4X1K E;  3E22 E;  1ZVV A;  3EDV A;  4PNI A;  1ZAY A;  2X51 A;  4IE6 A;  1D0Y A;  2B5A A;  2LE8 A;  4K0U A;  2KWH A;  4JUY A;  2PUA A;  2D5V A;  4TZ4 C;  4UVA B;  3ZJ1 A;  2EHO B;  3GN5 B;  5JR9 C;  1PRA A;  2H7O A;  2Y6X A;  4GQM A;  2NTY A;  3S8Q A;  3OQM A;  2VKO A;  2WWU A;  4NUV A;  5LGN B;  2RP4 A;  1QP0 A;  3PUG A;  3KVA A;  2YEV C;  4CI3 B;  3NBX X;  5AFU L;  4O4J E;  2VK9 A;  2LSI A;  3FXE B;  2XQY A;  4XZC A;  4ZI2 D;  5E0O A;  1HCI A;  3CEC A;  3CQG B;  5HXH A;  3ZMT B;  1DWK A;  4WNK A;  3FYM A;  3R6N A;  3KV6 A;  3CRO L;  1UTX A;  1IC8 A;  4JCX A;  1LVK A;  2YU1 A;  5LGU B;  4I6T A;  3B57 A;  4QXB B;  3CX6 B;  2N1G A;  2XAJ B;  2IC6 A;  2O38 A;  4Z5H A;  3EVY A;  3FB2 A;  3EUS A;  2K48 A;  2LSJ A;  1ZEE A;  1BR4 A;  2K5B B;  1HFA A;  2ODU A;  4O8S A;  3QWG A;  2FJR A;  2YIN A;  3OQN A;  3C4Z A;  5FXZ A;  4EYU A;  5L2L A;  3FBL A;  4J2C A;  3RYH E;  4PFO A;  3C98 B;  4YG4 A;  2WUS R;  4OK0 A;  3NRX A;  2GK9 A;  1HF8 A;  4CQI A;  3PTR B;  4X20 E;  4P0A A;  4FI5 A;  3RYF E;  4GYR A;  3SWH A;  2KT9 A;  2L9Q A;  3I9Y A;  3AVS A;  2LSK A;  4CXX A;  1SQ8 A;  2LYK A;  1YW0 A;  3RRC A;  4EOZ B;  3WAJ A;  5TAO A;  2V1D B;  5HWX A;  5JQG E;  4X4G A;  3Q5X A;  4C91 A;  1D1A A;  4G2A A;  1RPE L;  2NTX A;  2V7L A;  2VKD A;  3UUN A;  1LCD A;  2HH7 A;  3ZMU B;  4AXP A;  4I4T E;  5L3F B;  4DBR A;  3ZMZ B;  2XAG B;  2VB6 A;  1D0X A;  1QSD A;  3PUR A;  2HPJ A;  3C51 A;  4H9P C;  3PXP A;  4H9R C;  4DO0 A;  3GBF A;  4MCT A;  5JVD E;  2W61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...