3GN5A

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5A02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5A01
2MEZA 1JFSA 1QP7A 1RIOA 1ZZBA 1WH6A 4YG4A 4JCXA 1CQTA 1CJGA 4MCXA 1DW9A 2IVBA 2JVLA 3GN5B 1BDIA 2BJCA 3CROL 1NERA 1WETA 4JCYA 4J1WA 3DNVB 4IVZA 2PUCA 2BNOA 2LCVA 3KJXA 5A7LA 3LFPA 2IU7A 1GT0C 1WIZA 3ZHIA 2KPJA 2EWTA 3H5TA 4PU8A 4Z58A 3VK0A 4X4HA 4X4EA 2KEIA 2L8NA 1RZRA 1E3OC 4Z5DA 4X4GA 3FYMA 2JCGA 3QYXA 2IV1A 4MCTA 3KXAA 2FJRA 1OCTC 2XJ3A 4FBIA 5K98B 4X4FA 4PU7A 4NDWA 3TRBA 1ZS4A 1IC8A 1UTXA 3ZKCA 3GBFA 2PUDA 4O8BA 2KEJA 1ZZ7A 3ZHMA 2D5VA 3JXCL 1L1MA 2AXVA 2H8RA 3FMYA 2XSDC 4IA8A 3FYAA 3BDNA 1VPWA 2GZUA 2O4AA 1UXDA 2GRLA 4I6UA 4J1XA 1YSEA 2OR1L 3LISA 2PIJA 4X4IA 3R1FA 2B5AA 2WUSR 1LMB3 2LYPA 4Z59A 2O38A 3GN5A 2R63A 2LYKA 1JFTA 4PU4C 3KZ3A 3G7DA 3CECA 1QQAA 1RZRD 1QP0A 3IVPA 2LYSA 1ZZ6A 4YBAA 3HZIB 3EUSA 1QP4A 1QPZA 1ADRA 3SCFA 3SCGA 1X57A 4PU3C 4YARA 3OP9A 3BS3A 3PXPA 3OQMA 1O4XA 1LCCA 1ZZCA 1ZVVA 2WIUB 3D1NI 4I6RA 2LYLA 1UXCA 1LQCA 3RZZA 3U3WA 1AU7A 3F6WA 4YG1A 2CSFA 2L49A 3QQ6A 3QF3A 4GHJA 3S8QA 2IVQA 2LYRA 1Y7YA 4FN3A 2HSGA 2IUOA 1R69A 1ZZ8A 3F51A 4GQMA 3OMTA 1ZUGA 1HF0A 3QWGA 1PRAA 2ICTA 2O49A 4F8DA 2PPXA 3BD1A 2AWIA 4IWRA 1NEQA 2XI8A 2R1JL 1SQ8A 2BNMA 2GRMA 2IVGA 3UFDA 1ZZ9A 2AW6A 4X4CA 3JXDL 4I8TA 2PUBA 2HINA 3O9XA 1Y9QA 3JXBC 1BDHA 2PUGA 4Y42A 1ZPQA 1JH9A 1QQBA 1POUA 4YG7B 1WH8A 3B7HA 1DWKA 1RZSA 2EF8A 3G5GA 4Z5HA 1PERL 1ZAYA 2KEKA 1LLIA 4OB4A 4JQDA 3GA8A 2A6CA 3CLCA 3L1PA 2BNNA 2AXUA 2AXZA 2PUEA 1S7EA 1R63A 2CROA 1OSLA 1RPEL 1EFAA 1XWRA 3F52A 4X4BA 4X4DA 3OQOA 1B0NA 3SCHA 3MLFA 2PUAA 2LYJA 2LYQA 1JWLA 2XIUA 1PRUA 1X2LA 2MQKA 1PNRA 3HI2A 2PUFA 2XCJA 2KZ8A 2AUWA 4I6TA 1LCDA 2PE5A 3OQNA 2OFYA 2ICPA 4Z5CA 2EBYA 1PRVA
chains in the Genus database with same CATH superfamily
4YG4A 2ZM0A 4HN9A 4ZI2C 4PJMA 4U72A 3ZEFB 3A9XA 3RKOA 2E5LT 4PJLA 2O4AA 4UXNB 2IV1A 2LEHA 2OLTA 1OCTC 3LQXA 3C98B 3GBFA 3PUZF 4IE6A 2V7MA 4IDOA 4DV3T 2MXDA 4XBFB 4IE4A 3LFMA 4PK4A 4HWIB 4B3ST 2XAJB 4DV6T 1LMB3 2KZ7B 5LA6E 4P1NA 4DV0T 3RRCA 4B6XA 1QP0A 1UURA 1YKEB 4GK5E 3AECA 3OKZA 3L09A 3BQIA 3PXPA 2WZIA 4JLEA 3KVBA 3FZFB 1YQ4A 1BR2A 2KINB 3S4UA 5LB7B 2L49A 3QF3A 2CEAA 3ONLC 1ZZ8A 3I9WA 1WYCA 3QWGA 2WZHA 4AKGA 2PPXA 4DE8A 3JXBC 2IC6A 3CQXC 2XPKA 3H3AA 1LLIA 4DV1T 2WAUA 2JMKA 1S7EA 1LVKA 1R63A 2CROA 1OSLA 1ZKEA 2J47A 4DV4T 3SCHA 3IBPA 1IBMT 4OHFA 3ZC1A 1YXRA 5JUWA 2QVAA 4UELA 4A56A 4TV8E 4GIWA 2V26A 4KUMB 2Q9QA 4V1Av 4AQFA 2H3RA 5IUXA 5LJMA 1QP7A 1ZZBA 3A7MA 3HKEE 2IVBA 1BDIA 4EQZA 4L0RA 4WVLA 2PJQA 2C5IT 3VKGA 3OYXA 4P0AA 2IU7A 1J1JA 1G8XA 2LNMA 4P0BA 5LXTE 5LG3A 4EEBA 2XJ3A 4TNWA 3ZYKA 4PU7A 3JCFA 3WAKA 4Q2JA 2MPKA 4CQIA 3OWQA 4LF4T 3F2EA 5A1LA 3I9YA 2H8RA 4O4JE 2EHOB 4AKRB 2K3WA 1DULA 1HTJF 4BJMA 2O38A 3C51A 3KV5A 2XQ6A 5F3JA 2Y6XA 3PE0A 4TZ4C 3FZKB 2PXEA 5F8PA 3DJBA 4UF0A 3Q5XA 3U3WA 3I0QA 5AFUL 2WMNA 3GMIA 1Y7YA 5JR9A 2IUOA 1R69A 1R8IA 3SX0A 4YHJA 4F8DA 2V6XA 2JQ9A 4QKNA 2J1DG 4O4LE 3ZCIA 4EZIA 2PUGA 2CM0A 2BG9A 3JADA 4U31A 2CLYB 3ZT6A 3SWHA 2ACZA 2AXZA 1OEDB 2H89A 2YINA 3EDVA 3EUHA 5FVLA 4YY3T 3B57A 4ER3A 2X0YA 2YK0A 3OTOT 1M7KA 3DP7A 5FY1A 4IDQA 4I4TE 2VQET 4OX9T 3HI2A 2PXPA 2XCJA 2PXVA 3L39A 3T1YT 4EIWA 3N5LA 1SUMB 1MIYA 4EZ4A 3N2KE 3TELA 4UV9B 4MCXA 4JCYA 2L3LA 2QRXA 2PUCA 5E0OA 2LHRA 2PXTA 1S94A 4AQYT 3OKQA 4QH5A 2ZM6T 3RYHE 2JCGA 3EDUA 5ABGA 4KBMB 1MNDA 3PUXF 4QXCB 2NTYA 3CVRA 5K98B 4ER7A 5LGTB 3PURA 1OXZA 1HG2A 2FJBA 4PK6A 1OEDA 4HFDA 3GZDA 1UXDA 2MBGA 2Y48B 4LF6T 4UVBB 4JYAT 1Z0PA 1JFTA 2X66A 2V5CA 4U33A 4LF7T 5F5WA 4TWDA 4G2AA 3HZIB 2YU2A 4DMWA 3AEBA 2CRBA 2F4VT 2VVNA 4PW8A 1WLXA 3RLFF 3OQMA 4ZI7E 1VRBA 3LBXB 4DR6T 4L9IA 1KK7A 5J2UE 5DTMA 2XTLA 4BAYB 4LF8T 1T98A 4BA9A 2D0TA 1IBKT 3OMTA 2E9XC 5BMVE 1ZP0A 2R1JL 3C4WA 2BBHA 1AJ3A 2V6YB 1GQEA 4AKHA 4TWHA 5FNVE 5L3CB 4X64T 4ILCA 4C91A 1HNXT 1ZPQA 5L3BB 3KBUA 4IDZA 4UIGA 2LRKA 4HFVA 4KMCA 3O1IA 2N1GA 5HXCA 3KL4A 5L3DB 3RYIE 4EGWA 4A98A 4I55E 2PBIA 4P09A 2DWKA 3H37A 3N9LA 4L5GA 3E08A 2LRLA 5HEGA 2NW7A 3MA9A 4WNKA 3UUMA 3P4RA 3UT5E 3RYCE 2UUBT 3TKLB 3VR9A 4IE5A 3NVOA 2LOPA 3PUWF 4JI6T 5ADXL 1US7B 1HS7A 2HCNA 2LSIA 3ZT7A 3OPCA 4JEHB 5LHIB 1NEKA 1VPWA 2W00A 4Q25A 2X9WA 3EABA 4TN7B 1Y64B 4YFSA 2WWUA 5KXJA 1SE7A 2IMLA 4H63H 3CK6A 4ZHQE 2BBJA 3IVPA 2WDQA 2KNDA 1G73A 5ETWA 4DV5T 3CKDA 4H9RC 4YARA 1B7TA 1YQ3A 2H88A 4LMKA 3PTRB 5JDMA 3X1DA 4PFPA 4IE7A 2WDVA 2L1PA 4DBQA 3EI0A 3Q5WA 3WI3A 2H7OA 1W0AA 2HSGA 2M67A 3O4XE 1HF0A 1ZUGA 1HNWT 3Q2MA 1SQ8A 3UFDA 1UX4A 2B1EA 1X9BA 2HINA 3M9LA 2BG9B 1QQBA 3CMLA 2I59A 4DUYT 5AQIB 2IC9A 5AQLB 2UXCT 5DT2A 5L47A 2V7JA 3P50A 5LBMA 2KZ8A 4I6TA 2K24A 3RH3A 2PFVA 4GYRA 4B3MT 2D9DA 3AE1A 3MZKB 1T8BA 1DW9A 2JPFA 2JVLA 4DIDB 4IVZA 5HWXA 3M65A 1WYBA 3T8OA 4O4IE 4K0KT 4Z58A 3GUUA 5HAXA 3FYMA 5M4YA 3FZLB 3KXAA 3RRWA 3O1JA 2ZMAA 2YN6A 4ZZBA 2IIUA 5JVDE 4PJJA 4IHJE 5ABHA 3UQ7A 3J7Yq 2ODRD 4JI8T 5JH7E 1IZNB 1J5WA 3QNUA 1BR0A 3ZC0A 2BG9E 2JQKA 1ADRA 3SCFA 3QB5A 3N9NA 4H63V 1N34T 4PU3C 5GAGi 2E5VA 3ZYMA 4DNDA 4DR5T 2PXLA 4UEMA 2V7KA 3ONJA 1OWAA 4AISA 2DWGA 3QK6A 4F8HA 2J7UA 2HFZA 4O2BE 2IVGA 1HG5A 3KV6A 3JXDL 3HR0A 4OYJA 1KFYA 3ZJ1A 4NXNT 4E7ZA 4OK0A 4IE0A 3VRAA 1XMQT 2CMRA 5AQMB 5EK3A 3NZPA 4I0UA 4ADZA 4ILBA 2KLQA 5LGNB 4ASKA 2HHHT 2JQHA 3N2OA 5JDGA 1CUNA 5LYJE 3KVAA 4JBWF 3J9X1 3UQ4A 2X9XA 2EBYA 1PRVA 2MEZA 3JC6D 5KX5E 1CJGA 2NR4A 2N2NA 5H6RB 4TWFA 2LM2A 3CQGB 2LCVA 3AAAB 2W4XA 2AE9A 5J1GA 3ZMZB 3GZDC 3AEFA 3VK0A 5LCYA 3CX8B 3LBXA 2ACXA 4NXMT 3SR4A 5KDMC 3TLVA 4NDWA 1QUUA 5AQKB 2KEJA 2CE7A 3PUVF 3FYAA 2BG9C 3P7IA 3GN5A 2R63A 2LYKA 3Q5EA 3AXJB 1ZZ6A 3RYFE 4EXTA 3RF1A 4U7IA 4HE8A 1QSDA 5FY7A 3GZCA 1U5PA 2VURA 1MIWA 2YBDA 2VEOA 3O1HA 2V3CC 4QXBB 2M6IA 2PUBA 1HQ1A 2DLRA 4CN6A 4YG7B 3M3ZB 1DWKA 3GA8A 2IHR1 4KI0F 4ER0A 1MMAA 2CPTA 3ZMTB 4X4BA 2KT9A 3RC8A 2CXDA 3FZMB 3N9OA 5FXZA 1H7CA 1N32T 2ZM2A 2VB6A 5HWYA 4UF0B 3UUNA 3WAJA 3CROL 2BNOA 3AA0B 3K8PC 5AQUB 5AQRB 1GT0C 3MEJA 2EWTA 4AQFC 3W15B 4X4GA 2UXNB 1WCRA 3MKDA 2WU2A 3R09A 4UVCB 3SFDA 3JAFA 1QB2A 2WM9A 3P8CD 2GRLA 5FXXA 4YTNA 3QOWA 2YDQA 4EAHA 3N9PA 4FJOA 2WDRA 4UR9A 2BS3A 1NENA 2FFHA 5DTRA 1NAFA 4YJ3E 3AB3B 3UTKA 1X57A 2A9UA 4LF9T 5HYAA 2BS2A 1LCCA 2QYWA 4WW0A 2DL1A 1AU7A 1U4QA 2BVLA 1D0XA 5BR8T 4GQMA 4ER6A 3BD1A 3A5XA 2BNMA 3AEGA 4X4CA 2I6HA 1LRZA 4YSYA 1Y9QA 4QXHB 1BR4A 3P4SA 4YTMA 3RKGA 3UUBA 4JQDA 2MYSA 4KP3C 5JDLA 5JR9C 3FXEB 3KV4A 4G63A 4GK0E 1XWRA 3PUSA 3LK2B 3SS1A 2W67A 2XQYA 3CIRA 3AAIA 2PE5A 5AQHB 2WQYA 4IIJE 4H9NC 4YJ2E 4LMJA 1WH6A 2X0LB 4AQGA 2H7VC 1WETA 5IYZE 1BR1A 3DNVB 3RIFA 3ZMUB 1Y01A 4YT0A 5DQWA 2A3DA 4ZS2A 4X4EA 3MK7C 2PG8A 2Q9QD 3ZSTA 5GAHi 1IBLT 2XSBA 5HCMA 5AQFB 3PUYF 3AEEA 2LLYA 2K48A 4JI2T 4I6UA 3LG7A 2HPJA 3ABVA 4NIQA 2W63A 4ILUA 4WYVA 3G7DA 5AQQB 1XDOA 4O4HE 4HFEA 1M62A 4X1IE 3QOFA 2WU5A 2CBJA 5L2LA 5FXWA 5LMNT 2D5UA 3S8QA 2DNXA 2LYRA 4FN3A 3RI5A 5L3FB 2YU1A 4ZI3C 1E1HB 1SA0E 4COFA 2E9XB 4C90A 2UXXB 2XAQB 3ESLA 4YSXA 3K3QC 2ODUA 4LMLA 3Q5DA 4OB4A 2Y8DA 5FXVA 4HFHA 2BVMA 1V9DA 4ZI2D 2VL0A 4IL9A 2LYQA 2MAWA 3DTOA 2MQKA 1EZ3A 5CFBA 1KEYA 2LLVA 5EK2A 4TV9E 3B13A 3K1SA 1N33T 2BZBA 2PXQA 2BJCA 1NERA 4J1WA 2WSSV 4HKAA 1YW0A 3SOLA 1WIZA 2KPJA 4NUUA 4CN4A 3QYXA 1E2AA 3NKZA 5IWAT 2NTXA 2VKOA 5L3GB 1KF6A 3ZHMA 4DR3T 2XQAA 2LKGA 2VKJA 4IT4A 3VRBA 2FJAA 4E7SA 3OYZA 2GZUA 3RIUA 5LOVE 1JNRA 3IHRA 2X9HA 1WFDA 3I0OA 2A72A 2LJLA 2PXFA 3UU4A 5JQGE 2UXDT 4MFRA 3LK3B 5GONE 3MACA 4A5XA 4PAGA 4I50E 2LSJA 1ZVVA 1UXCA 3CQCB 4DR1T 4KX6A 2LHNA 4EEDA 2ICTA 2WBLA 4TX5A 4ERRA 2V1DB 1HF8A 2XAGB 2M6BA 1POUA 1WH8A 3B7HA 3TLWA 2UU9T 2KEKA 3UULA 2BNNA 4GOUA 2XHEB 3PE5A 2M4HA 3N9MA 3KBTA 3LDQB 3E22E 5DTQA 2LYJA 2C5KT 3N9QA 5LGUB 5L4EA 3G06A 2LE8A 2RPAA 5FL1A 2AUWA 1FMVA 1XNQT 1XDPA 1CQTA 4DV7T 4ZXLA 5AQVB 2CCQA 2XXPA 4WBOA 3ZHIA 3AE9A 4CXXA 2XQ9A 4J2CA 4HTEA 4CI1B 2ODVA 1QZXA 4FBIA 3NXHA 3UU3A 3QB5K 5HXSA 2PUDA 2XM1A 5FL0A 4X65T 1IJ5A 3ZSSA 2IUBA 2JMHA 3KDSE 3BDNA 3ME5A 2VKDA 2OR1L 4UVAB 4CXWA 1DU2A 2X0HA 4UV8B 2XASB 2LYPA 4PU4C 3CECA 4GYSA 5HEJA 2VQFT 1S35A 1HX1B 4ISTA 5ABFA 1O4XA 2HN1A 3ZN1B 3VHLA 2AXDS 1W09A 4A97A 3D1NI 3P4QA 2CSFA 2D0UA 2LLWA 2OA5A 2VASA 2IDOB 5DRTA 4IWRA 5JRCB 2WS3A 4HGAA 4YHHT 5HXRA 1E7PA 5LBQB 2Z6EA 1BDHA 4MBQA 4U74A 4U3CA 4EK9A 1FEWA 3FHNA 3PUAA 4CZZB 2PUEA 3ANWA 5FP3A 1JNZA 1D1CA 2XXAA 4AIUA 3AE7A 2VL8A 1ZEEA 1PNRA 3U78A 1IAPA 4ILAA 1XZYA 4Z91A 5HEHA 3ZKRA 1LCDA 3OQNA 3QUJA 5AQJB 5EZYE 4OYKA 3FXDB 1MMNA 3L3PA 2WP9A 5LNKA 1WRDA 3K3OA 2N9DA 2XAFB 4WZXA 5J2TE 4X4HA 3H5TA 4HRAA 3F31A 5LMUT 2L8NA 3AEDA 3KINB 4ZOLE 1IC8A 2PXDA 4AI6A 3ZKCA 3VU7H 4YXDA 3JXCL 4EYUA 3OJAA 3NRYA 3LISA 4YSZA 2WUSR 2LOSA 1XMOT 3C4ZA 1NWMX 3ZMVB 2VVSA 5AQSB 1UX5A 5EK4A 4JI7T 3IEEA 2MTQA 3SCGA 5CJ5A 3PJAA 3VWSA 5JREA 1UCUA 1UK5A 1HCIA 4KHPT 3KV9A 3QOXA 3UFGA 5CGMA 4CXYA 3PUGA 4DR2T 5FKYA 5C2TA 3PU3A 3F51A 2PXBA 4H9QC 3QFIA 1MMGA 2XAHB 2AWIA 2QA7A 2GRMA 2XQ5A 3ETUA 2EHOA 1ZOYA 3AE5A 1I6ZA 3NRXA 2VKHA 4IGUA 4QHOA 3P4WA 3L1PA 1EFAA 5ABFB 3PUQA 5AQTB 5HEUA 4ZI3D 3QC9A 3I1AA 1WR0A 4K0UA 2BKNA 5JTGA 4Z5HA 4Z5CA 1MNEA 3NBXX 5L4HA 4IDPA 4N78D 3ZLIA 4ISSA 2E2AA 2RP4A 5FVKA 4Z90A 3ETVA 3RPUA 1IJ6A 3ZCJA 2OV9A 4EKIA 1XNRT 3Q9DA 3OBVE 1RZRA 4EKGA 2LSGA 4MCTA 2FUPA 4QH4A 1I94T 2X67A 1ZS4A 3LJCA 1LVFA 4ZS3A 3UUXB 3H3MA 4MALA 2NW9A 1MFQC 1YD8G 2J7WA 3ZT5A 1OEDE 3ONXA 2JIWA 1HFAA 2PIJA 4X4IA 3AE4A 3ZPXA 4PK5A 2WY2A 4U7YA 2XSAA 2KSRA 2UUCT 4HWDA 2EHOD 1QQAA 1QP4A 4H9OC 3UU8A 2VWAA 1ZV4X 3OP9A 3BS3A 4GKJT 4PNIA 1ZZCA 2EHOC 2IAKA 3RX6A 3RZZA 1FMWA 4JI1T 3FZHB 4YLHA 2JQEA 2Q9QB 4EB6E 5JRCA 3TLSA 2ZLYA 2NOXA 4X5TA 2XUEA 3P4PA 1ZZ9A 2AW6A 1FIOA 1J5ET 3O9XA 1W9RA 2NWBA 2LM9A 2YKSA 2HPLA 1RZSA 1ZAYA 3CX7B 2WB5A 1RPEL 2D2SA 2X9YA 2ZM8A 4X1KE 2PUAA 2XIUA 1PRUA 4EV6A 3AE6A 4HWCA 2OFYA 5L3EB 3HKDE 1JFSA 3IF8B 5JDHA 2PTFA 3AA7B 2LSKA 3FBZA 2WWVA 2A2FX 3GN5B 4X62T 4QX7B 1YKHB 3PJAJ 3V5SA 3KJXA 2CWYA 3LFPA 4IL4A 4DR4T 3BK9A 4DO0A 4PU8A 2O49A 2P9BA 3LK42 5DJQC 1D0YA 4O8SA 3IA3A 4Z5DA 1D1BA 3C4XA 2XY8B 3SRZA 3RQUA 4ZEYA 2W62A 1UTXA 2SPCA 1ZZ7A 2D5VA 3UU6A 1L1MA 2AXVA 1LKXA 2XXQA 4X20E 1YSEA 2KWIB 3ZYLA 3MXZA 3AE2A 2JJ9A 2QGSA 3V5UA 4EZHA 3KFWX 4MLKA 5DRYA 2W66A 5CA1E 2XQ8A 2LYLA 2YDSA 2CXLA 3VKHA 3HA4A 1D0ZA 3BQLA 2IVQA 4OBMA 3EHZA 2FJEA 4JI3T 4H9SE 1UGOA 4H9PC 4LFAT 4B3TT 3NZLA 4OFZA 4CN1A 2CA5A 2V8SV 4HWHA 5JDQA 5TAOA 1CHUA 2CWOA 3JC6C 3G5GA 3R84B 2BKPA 2A6CA 2LT3A 3F52A 3OQOA 2X51A 2CBIA 2BKOA 4NUVA 2JRKA 1QLBA 5FY0A 4WBNE 2L8KA 2PUFA 5ABEA 4M1PA 3TEPA 3RQWA 4Z8XA 3MJXA 1RIOA 4DMVA 1N36T 4ANJA 3AE3A 5CA0E 2CXFA 2YEVC 3UFEA 3OVUA 4LF5T 3VR8A 3PU8A 1E3OC 4CI2B 4QWNB 3C64A 5FYMA 2G0UA 5IHYA 2J62A 3AXJA 2V5DA 5LP6E 4FI5A 2DCFA 2W0GA 4ER5A 2XSDC 4IA8A 2LKHA 4F6RC 4J1XA 4AKLA 3A9YA 2VK9A 2JQQA 3R1FA 2X68A 2NW8A 2DHRA 1RZRD 1X79A 2KWHA 2LYSA 3EUSA 4X66T 2PXUA 3L8RA 4HEAA 4DVDA 3LSVA 2XQ3A 3GWHA 1KNRA 2BS4A 1LQCA 2UXBT 1HX8A 3QQ6A 1ZHCA 3AEAA 2C5JA 4QX8B 1NEQA 3UU5A 3K3NA 1Z8UA 4HFCA 4I8TA 1HNZT 5HXEA 3B5MA 4TNVA 1O3XA 4DV2T 3AA1B 4IREA 3HKCE 3ZPOA 4DBRA 1VOMA 4X4DA 4I43B 3MLFA 3EVYA 3A9ZA 2K9AA 5LG4A 4U2ZA 3UWPA 3EAMA 3DM5A 2ICPA 4XZCA 3JAEA 4TUYE 2PXKA 3CX6B 4HFBA 4PFOA 4LFCT 4EOZB 5JR9B 2FJDA 2CLYC 3AVRA 1T7SA 3T1HT 3R6NA 3NROA 2KEIA 2B76A 2XQ4A 5JDNA 2KMFA 5H6QB 3TRBA 2NP9A 3D0TA 3TFLA 3N2GE 2XQ7A 4PJNA 4ZZCA 3ANWB 4IDNA 3CPZA 3ZMSB 2YDRA 1L0VA 3RIAA 5HCJA 2I0MA 2XJ7A 3ZJ2A 4Z59A 3FBLA 2WMOA 4YBAA 5LHGB 2KXPB 3ZN0B 2E8IA 1UUSA 5FMNA 4JEUB 1KNZA 4I6RA 2V6YA 5DSXA 4XAXB 3G0TA 2FBWA 4GHJA 3SFEA 3PDYA 1PRAA 3RGLA 3HKBE 5AQNB 2BDEA 1OEDC 2RA1A 4JUYA 4Y42A 4JI5T 3RIUC 2EF8A 1PERL 2UUAT 3HL6A 4NPPA 3CLCA 4HWFA 1WR6A 4MHCA 5AQGB 2HCSA 4JI0T 2MOZA 2CHNA 1B0NA 5DQVA 3FB2A 5CB4E 5HEOA 5C3JA 4CI3B 3RC3A 1JWLA 1X2LA 4JV5T 2WCAA 2W61A 4EYYR 3A8YC 2IW5B 2V7LA 4JCXA 4U2YA 2HH7A 2GK9A 4B3RT 5JDFA 2L9QA 5A7LA 1W0BA 3NWIA 1FJGT 2LSYA 3NZQA 2YOEA 5LHHB 3NDBB 5J0ZA 5AQPB 2FJRA 2K5BB 4X4FA 4DUZT 4HFIA 1VCSA 4O8BA 2XZEA 4DR7T 1MIVA 4JI4T 3TLTA 1VCTA 3FMYA 4KHZF 4YTPA 1D1AA 2E9XD 2B5AA 3PV0F 2Q9QC 4AXPA 3E0ZA 1SHZC 3KZ3A 3BQKA 1HR0T 3AE8A 3AAEB 2XM2A 4LFBT 3F57A 1MMDA 4GKKT 2J4GA 2WIUB 3F6WA 4YG1A 4BJNA 5AQOB 2ES0A 2V7IA 3AVSA 2DI4A 1XWMA 2XI8A 4O2AE 2C0SA 3CWZB 5C8YE 3U3IA 2HN2A 1JH9A 5KMGP 5LJNA 3RHWA 2CHOA 2AXUA 2E9XA 2R6GF 4X1YE 3AA6B 3TLUA 4DE9A 1NW3A 4QH1A 4AKIA 3C50A 1U2ZA 2W2UA 1T72A 5DABA 1QPZA 5HXHA 1KNPA
chains in the Genus database with same CATH topology
3HKDE 3RH3A 1JFSA 2BZBA 3IF8B 5JDHA 2PFVA 4GYRA 4YG4A 3AA7B 2ZM0A 3MZKB 2LSKA 3FBZA 1DW9A 2A2FX 2JVLA 3GN5B 2JPFA 2BJCA 4HN9A 1NERA 4ZI2C 4PJMA 4QX7B 1YKHB 4J1WA 4U72A 4IVZA 2WSSV 4HKAA 3V5SA 1YW0A 3KJXA 3ZEFB 5HWXA 3M65A 1WYBA 2CWYA 3T8OA 4O4IE 3LFPA 3SOLA 3RKOA 1WIZA 3BK9A 4Z58A 2KPJA 4PU8A 2O49A 2P9BA 3LK42 4PJLA 2O4AA 1D0YA 4NUUA 4O8SA 4UXNB 5DJQC 4Z5DA 5HAXA 3FYMA 3QYXA 2IV1A 2LEHA 5M4YA 3KXAA 1D1BA 3C4XA 3SRZA 1OCTC 3RRWA 2W62A 2NTXA 3O1JA 1UTXA 2VKOA 2ZMAA 3C98B 3GBFA 5L3GB 2SPCA 1ZZ7A 4IE6A 3ZHMA 2D5VA 5JVDE 4PJJA 2VKJA 4IHJE 2V7MA 1L1MA 2AXVA 3J7Yq 1LKXA 4E7SA 4XBFB 4X20E 3OYZA 2GZUA 4IE4A 5LOVE 5JH7E 1YSEA 1IZNB 2KWIB 3ZYLA 3LFMA 4PK4A 3IHRA 2XAJB 3MXZA 1LMB3 2KZ7B 2X9HA 5LA6E 1BR0A 3I0OA 2A72A 2LJLA 5JQGE 2JJ9A 2QGSA 3RRCA 3V5UA 4B6XA 1QP0A 4MFRA 3ZC0A 4EZHA 1ADRA 3KFWX 1YKEB 3SCFA 3LK3B 3N9NA 4GK5E 3MACA 4MLKA 5GONE 4H63V 4PU3C 3L09A 3BQIA 4PAGA 4I50E 3PXPA 2LSJA 1ZVVA 4JLEA 3KVBA 3ZYMA 5CA1E 2LYLA 4DNDA 1UXCA 1BR2A 3CQCB 2KINB 2CXLA 3S4UA 3VKHA 3HA4A 2L49A 1D0ZA 4UEMA 3QF3A 2V7KA 3BQLA 2IVQA 2CEAA 1OWAA 2DWGA 1ZZ8A 3QK6A 3I9WA 2LHNA 1WYCA 3QWGA 4O2BE 2ICTA 4AKGA 4H9SE 2PPXA 4H9PC 2WBLA 2IVGA 4TX5A 4ERRA 1HG5A 3KV6A 4OFZA 3JXDL 3HR0A 2CA5A 2V1DB 4OYJA 3ZJ1A 3JXBC 1HF8A 2XAGB 5JDQA 4E7ZA 5TAOA 1POUA 2IC6A 2CWOA 1WH8A 3B7HA 3CQXC 3H3AA 3JC6C 4IE0A 3G5GA 4OK0A 3R84B 2CMRA 2KEKA 1LLIA 3UULA 2A6CA 5EK3A 2WAUA 2BNNA 3NZPA 4GOUA 2JMKA 1S7EA 1LVKA 2XHEB 2LT3A 4ADZA 1R63A 2CROA 1OSLA 1ZKEA 3N9MA 3KBTA 3F52A 3OQOA 2KLQA 2X51A 3SCHA 5LGNB 4ASKA 4NUVA 2JRKA 3IBPA 3E22E 2LYJA 4OHFA 3ZC1A 4UELA 5FY0A 2C5KT 3N2OA 3N9QA 4A56A 4TV8E 4WBNE 5JDGA 5LGUB 2L8KA 4GIWA 2PUFA 1CUNA 2V26A 2LE8A 4KUMB 2Q9QA 2AUWA 5LYJE 3KVAA 4M1PA 4V1Av 4AQFA 1FMVA 3J9X1 2H3RA 2X9XA 2EBYA 1PRVA 4Z8XA 3MJXA 2MEZA 3JC6D 1QP7A 5LJMA 1RIOA 1ZZBA 1CQTA 5KX5E 1CJGA 4DMVA 3HKEE 2IVBA 1BDIA 4L0RA 4ANJA 2N2NA 5H6RB 2PJQA 2C5IT 3VKGA 5CA0E 2CXFA 2CCQA 2LCVA 2YEVC 3CQGB 3UFEA 3OYXA 4WBOA 4P0AA 3AAAB 5J1GA 2IU7A 1G8XA 3ZMZB 3ZHIA 3PU8A 1E3OC 3VK0A 5LCYA 4CI2B 4CXXA 4P0BA 4QWNB 4J2CA 3CX8B 4HTEA 4CI1B 5LXTE 3LBXA 2ACXA 3C64A 2ODVA 5FYMA 2G0UA 2XJ3A 3ZYKA 5KDMC 4FBIA 4PU7A 4NDWA 1QUUA 5IHYA 5HXSA 2PUDA 3WAKA 2KEJA 4CQIA 2CE7A 1IJ5A 5LP6E 4FI5A 3F2EA 5A1LA 2DCFA 2W0GA 2JMHA 3KDSE 3I9YA 2H8RA 2XSDC 4IA8A 3FYAA 3BDNA 4F6RC 4J1XA 2VKDA 4O4JE 4AKLA 2OR1L 4UVAB 2EHOB 2VK9A 4AKRB 4CXWA 2JQQA 3P7IA 1HTJF 3R1FA 2X68A 4UV8B 2XASB 4BJMA 2LYPA 2NW8A 2O38A 3GN5A 2R63A 2LYKA 2DHRA 4PU4C 3C51A 3KV5A 2Y6XA 5F3JA 3CECA 1X79A 1RZRD 2KWHA 2LYSA 1ZZ6A 3PE0A 4GYSA 3EUSA 4TZ4C 3RYFE 4EXTA 1S35A 4HEAA 4HE8A 4ISTA 4DVDA 3GWHA 5F8PA 1QSDA 1O4XA 5FY7A 3ZN1B 3VHLA 3DJBA 4UF0A 3D1NI 3Q5XA 1LQCA 3U3WA 1U5PA 1HX8A 2CSFA 3I0QA 3QQ6A 5AFUL 1ZHCA 1MIWA 2D0UA 2WMNA 3GMIA 1Y7YA 5JR9A 2IUOA 1R69A 2OA5A 2VASA 4DO0A 2C5JA 4YHJA 4F8DA 4IWRA 3O1HA 4QX8B 1NEQA 5JRCB 4HGAA 3K3NA 4QXBB 4QKNA 4I8TA 2J1DG 2PUBA 4O4LE 5HXRA 3ZCIA 5LBQB 5JR9C 2Z6EA 1BDHA 2DLRA 4MBQA 5HXEA 2PUGA 2CM0A 4YG7B 1DWKA 4U74A 1FEWA 1O3XA 2CLYB 3AA1B 3FHNA 3GA8A 3PUAA 3HKCE 3SWHA 4CZZB 2AXZA 2PUEA 2YINA 3EUHA 3EDVA 3ZPOA 3ANWA 5FP3A 4DBRA 1MMAA 1D1CA 1VOMA 3B57A 3ZMTB 4X4BA 4X4DA 2KT9A 2CXDA 3RC8A 3N9OA 5FXZA 1H7CA 2YK0A 4I43B 3MLFA 3EVYA 3DP7A 2K9AA 5FY1A 5LG4A 4I4TE 2VL8A 1ZEEA 1PNRA 3U78A 2ZM2A 1IAPA 3HI2A 2XCJA 2VB6A 1LCDA 3OQNA 3QUJA 5HWYA 2ICPA 5EZYE 4UF0B 3N5LA 4EIWA 4XZCA 4TUYE 4OYKA 1MIYA 3CX6B 4PFOA 3UUNA 4EZ4A 3N2KE 3WAJA 3FXDB 4UV9B 4MCXA 3CROL 4JCYA 1MMNA 2L3LA 3L3PA 4EOZB 5LNKA 5JR9B 2CLYC 2PUCA 1WRDA 2BNOA 2LHRA 3AA0B 3AVRA 3K8PC 5E0OA 3K3OA 2N9DA 2XAFB 3R6NA 1S94A 3OKQA 1GT0C 5J2TE 3H5TA 2EWTA 4X4HA 2KEIA 3F31A 4AQFC 3W15B 2L8NA 3RYHE 4X4GA 2JCGA 3EDUA 4KBMB 1MNDA 2UXNB 2KMFA 5JDNA 4QXCB 5H6QB 3KINB 4ZOLE 2NTYA 3CVRA 5K98B 1IC8A 5LGTB 3TRBA 2NP9A 3D0TA 3ZKCA 3MKDA 4AI6A 3PURA 4UVCB 1OXZA 1HG2A 3VU7H 3N2GE 4PK6A 3JXCL 2WM9A 4PJNA 3ANWB 3P8CD 3CPZA 4EYUA 3ZMSB 3OJAA 1UXDA 2GRLA 5FXXA 2MBGA 2Y48B 3NRYA 3LISA 4UVBB 3ZJ2A 2WUSR 4Z59A 1Z0PA 2LOSA 3N9PA 4FJOA 4EAHA 1JFTA 3C4ZA 1NWMX 2X66A 3ZMVB 3FBLA 2WMOA 4G2AA 1UX5A 3HZIB 4YBAA 5EK4A 5LHGB 2YU2A 4DMWA 1NAFA 3IEEA 2KXPB 3AB3B 4YJ3E 2MTQA 3UTKA 3ZN0B 2E8IA 3SCGA 1X57A 5FMNA 5HYAA 4PW8A 1WLXA 4JEUB 3OQMA 1LCCA 5JREA 1UCUA 4WW0A 1KNZA 4I6RA 1HCIA 4ZI7E 1AU7A 1VRBA 3KV9A 3LBXB 4L9IA 4XAXB 1KK7A 1U4QA 5J2UE 2XTLA 2BVLA 4GHJA 3PUGA 4BAYB 1D0XA 1T98A 4BA9A 4CXYA 3PDYA 2D0TA 3PU3A 4GQMA 3F51A 3OMTA 1PRAA 2E9XC 4H9QC 1MMGA 5BMVE 3BD1A 2XAHB 2AWIA 3A5XA 2R1JL 3C4WA 2QA7A 2BNMA 2GRMA 3ETUA 1AJ3A 4AKHA 4X4CA 5FNVE 5L3CB 1LRZA 2EHOA 3HKBE 1Y9QA 4QXHB 1BR4A 2BDEA 2RA1A 4JUYA 4C91A 4Y42A 1ZPQA 3NRXA 5L3BB 3KBUA 4IDZA 2VKHA 4IGUA 4QHOA 2EF8A 1PERL 4UIGA 4JQDA 2MYSA 4KP3C 3HL6A 4HFVA 3FXEB 4KMCA 5JDLA 3CLCA 3O1IA 3L1PA 3KV4A 2N1GA 5HXCA 4G63A 4GK0E 1WR6A 4MHCA 5L3DB 1EFAA 1XWRA 3RYIE 2MOZA 1B0NA 5DQVA 4I55E 3PUSA 2PBIA 3FB2A 3LK2B 4P09A 5CB4E 2DWKA 3PUQA 3SS1A 4CI3B 3RC3A 3H37A 1JWLA 2XQYA 3N9LA 1X2LA 4ZI3D 3QC9A 3I1AA 4L5GA 3E08A 4K0UA 3AAIA 2PE5A 5HXHA 4Z5HA 4Z5CA 1MNEA 2W61A 3NBXX 4EYYR 4IIJE 2IW5B 2V7LA 4H9NC 2NW7A 4N78D 4YJ2E 1WH6A 4JCXA 2X0LB 4AQGA 2H7VC 3MA9A 3ZLIA 4ISSA 1WETA 4WNKA 2HH7A 2RP4A 5IYZE 3UUMA 1BR1A 3DNVB 2GK9A 3ETVA 3RPUA 3ZMUB 1IJ6A 5JDFA 2L9QA 3ZCJA 3UT5E 5A7LA 3RYCE 3TKLB 5DQWA 3Q9DA 4IE5A 2A3DA 3OBVE 4ZS2A 4X4EA 2LSYA 1RZRA 3MK7C 2LOPA 3NZQA 2LSGA 5LHHB 2PG8A 2Q9QD 4MCTA 1US7B 5ADXL 2FJRA 2K5BB 1HS7A 2X67A 4X4FA 1ZS4A 3LJCA 1LVFA 4ZS3A 2LSIA 3UUXB 4O8BA 4MALA 4JEHB 2NW9A 1YD8G 1MIVA 2K48A 5LHIB 3FMYA 1VPWA 2W00A 4I6UA 3LG7A 2HPJA 3ONXA 2X9WA 1D1AA 1HFAA 4TN7B 2PIJA 4X4IA 1Y64B 2E9XD 2WWUA 4YFSA 2W63A 4PK5A 2B5AA 4ILUA 2Q9QC 4AXPA 3E0ZA 1SHZC 3KZ3A 3BQKA 3G7DA 4H63H 2EHOD 1QQAA 1QP4A 4O4HE 3IVPA 4ZHQE 3AAEB 4H9OC 2KNDA 1G73A 5ETWA 2VWAA 3F57A 1MMDA 3CKDA 4H9RC 1ZV4X 4X1IE 4YARA 1B7TA 3OP9A 3BS3A 5L2LA 5JDMA 3PTRB 4PNIA 1ZZCA 2EHOC 4PFPA 4IE7A 2WIUB 5FXWA 2IAKA 3RX6A 3RZZA 3F6WA 4YG1A 1FMWA 4BJNA 2D5UA 4DBQA 3WI3A 3Q5WA 4YLHA 2ES0A 3S8QA 2DNXA 2H7OA 2LYRA 2Q9QB 4FN3A 2M67A 2HSGA 4EB6E 3O4XE 5L3FB 5JRCA 2V7IA 1ZUGA 1HF0A 2YU1A 2DI4A 3AVSA 4ZI3C 1E1HB 2NOXA 2ZLYA 3Q2MA 1SA0E 2XI8A 2XUEA 1SQ8A 3UFDA 1ZZ9A 2AW6A 2E9XB 1UX4A 2B1EA 4O2AE 1FIOA 2C0SA 3CWZB 4C90A 5C8YE 2HINA 3O9XA 3U3IA 2UXXB 2XAQB 3ESLA 2NWBA 1JH9A 1QQBA 2LM9A 5KMGP 3K3QC 2HPLA 2ODUA 1RZSA 5LJNA 1ZAYA 3CMLA 2I59A 4OB4A 3CX7B 2AXUA 2Y8DA 5FXVA 2E9XA 1RPEL 4X1YE 2BVMA 2IC9A 3AA6B 1V9DA 2D2SA 2X9YA 2ZM8A 4ZI2D 4X1KE 2PUAA 2LYQA 3DTOA 2XIUA 1PRUA 2V7JA 2MQKA 4AKIA 3C50A 1EZ3A 5LBMA 2KZ8A 4I6TA 5EK2A 2K24A 4TV9E 5DABA 2OFYA 1QPZA 5L3EB 3B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEZ A;  1JFS A;  1QP7 A;  1RIO A;  1ZZB A;  1WH6 A;  4YG4 A;  4JCX A;  1CQT A;  1CJG A;  4MCX A;  1DW9 A;  2IVB A;  2JVL A;  3GN5 B;  1BDI A;  2BJC A;  3CRO L;  1NER A;  1WET A;  4JCY A;  4J1W A;  3DNV B;  4IVZ A;  2PUC A;  2BNO A;  2LCV A;  3KJX A;  5A7L A;  3LFP A;  2IU7 A;  1GT0 C;  1WIZ A;  3ZHI A;  2KPJ A;  2EWT A;  3H5T A;  4PU8 A;  4Z58 A;  3VK0 A;  4X4H A;  4X4E A;  2KEI A;  2L8N A;  1RZR A;  1E3O C;  4Z5D A;  4X4G A;  3FYM A;  2JCG A;  3QYX A;  2IV1 A;  4MCT A;  3KXA A;  2FJR A;  1OCT C;  2XJ3 A;  4FBI A;  5K98 B;  4X4F A;  4PU7 A;  4NDW A;  3TRB A;  1ZS4 A;  1IC8 A;  1UTX A;  3ZKC A;  3GBF A;  2PUD A;  4O8B A;  2KEJ A;  1ZZ7 A;  3ZHM A;  2D5V A;  3JXC L;  1L1M A;  2AXV A;  2H8R A;  3FMY A;  2XSD C;  4IA8 A;  3FYA A;  3BDN A;  1VPW A;  2GZU A;  2O4A A;  1UXD A;  2GRL A;  4I6U A;  4J1X A;  1YSE A;  2OR1 L;  3LIS A;  2PIJ A;  4X4I A;  3R1F A;  2B5A A;  2WUS R;  1LMB 3;  2LYP A;  4Z59 A;  2O38 A;  3GN5 A;  2R63 A;  2LYK A;  1JFT A;  4PU4 C;  3KZ3 A;  3G7D A;  3CEC A;  1QQA A;  1RZR D;  1QP0 A;  3IVP A;  2LYS A;  1ZZ6 A;  4YBA A;  3HZI B;  3EUS A;  1QP4 A;  1QPZ A;  1ADR A;  3SCF A;  3SCG A;  1X57 A;  4PU3 C;  4YAR A;  3OP9 A;  3BS3 A;  3PXP A;  3OQM A;  1O4X A;  1LCC A;  1ZZC A;  1ZVV A;  2WIU B;  3D1N I;  4I6R A;  2LYL A;  1UXC A;  1LQC A;  3RZZ A;  3U3W A;  1AU7 A;  3F6W A;  4YG1 A;  2CSF A;  2L49 A;  3QQ6 A;  3QF3 A;  4GHJ A;  3S8Q A;  2IVQ A;  2LYR A;  1Y7Y A;  4FN3 A;  2HSG A;  2IUO A;  1R69 A;  1ZZ8 A;  3F51 A;  4GQM A;  3OMT A;  1ZUG A;  1HF0 A;  3QWG A;  1PRA A;  2ICT A;  2O49 A;  4F8D A;  2PPX A;  3BD1 A;  2AWI A;  4IWR A;  1NEQ A;  2XI8 A;  2R1J L;  1SQ8 A;  2BNM A;  2GRM A;  2IVG A;  3UFD A;  1ZZ9 A;  2AW6 A;  4X4C A;  3JXD L;  4I8T A;  2PUB A;  2HIN A;  3O9X A;  1Y9Q A;  3JXB C;  1BDH A;  2PUG A;  4Y42 A;  1ZPQ A;  1JH9 A;  1QQB A;  1POU A;  4YG7 B;  1WH8 A;  3B7H A;  1DWK A;  1RZS A;  2EF8 A;  3G5G A;  4Z5H A;  1PER L;  1ZAY A;  2KEK A;  1LLI A;  4OB4 A;  4JQD A;  3GA8 A;  2A6C A;  3CLC A;  3L1P A;  2BNN A;  2AXU A;  2AXZ A;  2PUE A;  1S7E A;  1R63 A;  2CRO A;  1OSL A;  1RPE L;  1EFA A;  1XWR A;  3F52 A;  4X4B A;  4X4D A;  3OQO A;  1B0N A;  3SCH A;  3MLF A;  2PUA A;  2LYJ A;  2LYQ A;  1JWL A;  2XIU A;  1PRU A;  1X2L A;  2MQK A;  1PNR A;  3HI2 A;  2PUF A;  2XCJ A;  2KZ8 A;  2AUW A;  4I6T A;  1LCD A;  2PE5 A;  3OQN A;  2OFY A;  2ICP A;  4Z5C A;  2EBY A;  1PRV A; 
#chains in the Genus database with same CATH topology
 4YG4 A;  2ZM0 A;  4HN9 A;  4ZI2 C;  4PJM A;  4U72 A;  3ZEF B;  3A9X A;  3RKO A;  2E5L T;  4PJL A;  2O4A A;  4UXN B;  2IV1 A;  2LEH A;  2OLT A;  1OCT C;  3LQX A;  3C98 B;  3GBF A;  3PUZ F;  4IE6 A;  2V7M A;  4IDO A;  4DV3 T;  2MXD A;  4XBF B;  4IE4 A;  3LFM A;  4PK4 A;  4HWI B;  4B3S T;  2XAJ B;  4DV6 T;  1LMB 3;  2KZ7 B;  5LA6 E;  4P1N A;  4DV0 T;  3RRC A;  4B6X A;  1QP0 A;  1UUR A;  1YKE B;  4GK5 E;  3AEC A;  3OKZ A;  3L09 A;  3BQI A;  3PXP A;  2WZI A;  4JLE A;  3KVB A;  3FZF B;  1YQ4 A;  1BR2 A;  2KIN B;  3S4U A;  5LB7 B;  2L49 A;  3QF3 A;  2CEA A;  3ONL C;  1ZZ8 A;  3I9W A;  1WYC A;  3QWG A;  2WZH A;  4AKG A;  2PPX A;  4DE8 A;  3JXB C;  2IC6 A;  3CQX C;  2XPK A;  3H3A A;  1LLI A;  4DV1 T;  2WAU A;  2JMK A;  1S7E A;  1LVK A;  1R63 A;  2CRO A;  1OSL A;  1ZKE A;  2J47 A;  4DV4 T;  3SCH A;  3IBP A;  1IBM T;  4OHF A;  3ZC1 A;  1YXR A;  5JUW A;  2QVA A;  4UEL A;  4A56 A;  4TV8 E;  4GIW A;  2V26 A;  4KUM B;  2Q9Q A;  4V1A v;  4AQF A;  2H3R A;  5IUX A;  5LJM A;  1QP7 A;  1ZZB A;  3A7M A;  3HKE E;  2IVB A;  1BDI A;  4EQZ A;  4L0R A;  4WVL A;  2PJQ A;  2C5I T;  3VKG A;  3OYX A;  4P0A A;  2IU7 A;  1J1J A;  1G8X A;  2LNM A;  4P0B A;  5LXT E;  5LG3 A;  4EEB A;  2XJ3 A;  4TNW A;  3ZYK A;  4PU7 A;  3JCF A;  3WAK A;  4Q2J A;  2MPK A;  4CQI A;  3OWQ A;  4LF4 T;  3F2E A;  5A1L A;  3I9Y A;  2H8R A;  4O4J E;  2EHO B;  4AKR B;  2K3W A;  1DUL A;  1HTJ F;  4BJM A;  2O38 A;  3C51 A;  3KV5 A;  2XQ6 A;  5F3J A;  2Y6X A;  3PE0 A;  4TZ4 C;  3FZK B;  2PXE A;  5F8P A;  3DJB A;  4UF0 A;  3Q5X A;  3U3W A;  3I0Q A;  5AFU L;  2WMN A;  3GMI A;  1Y7Y A;  5JR9 A;  2IUO A;  1R69 A;  1R8I A;  3SX0 A;  4YHJ A;  4F8D A;  2V6X A;  2JQ9 A;  4QKN A;  2J1D G;  4O4L E;  3ZCI A;  4EZI A;  2PUG A;  2CM0 A;  2BG9 A;  3JAD A;  4U31 A;  2CLY B;  3ZT6 A;  3SWH A;  2ACZ A;  2AXZ A;  1OED B;  2H89 A;  2YIN A;  3EDV A;  3EUH A;  5FVL A;  4YY3 T;  3B57 A;  4ER3 A;  2X0Y A;  2YK0 A;  3OTO T;  1M7K A;  3DP7 A;  5FY1 A;  4IDQ A;  4I4T E;  2VQE T;  4OX9 T;  3HI2 A;  2PXP A;  2XCJ A;  2PXV A;  3L39 A;  3T1Y T;  4EIW A;  3N5L A;  1SUM B;  1MIY A;  4EZ4 A;  3N2K E;  3TEL A;  4UV9 B;  4MCX A;  4JCY A;  2L3L A;  2QRX A;  2PUC A;  5E0O A;  2LHR A;  2PXT A;  1S94 A;  4AQY T;  3OKQ A;  4QH5 A;  2ZM6 T;  3RYH E;  2JCG A;  3EDU A;  5ABG A;  4KBM B;  1MND A;  3PUX F;  4QXC B;  2NTY A;  3CVR A;  5K98 B;  4ER7 A;  5LGT B;  3PUR A;  1OXZ A;  1HG2 A;  2FJB A;  4PK6 A;  1OED A;  4HFD A;  3GZD A;  1UXD A;  2MBG A;  2Y48 B;  4LF6 T;  4UVB B;  4JYA T;  1Z0P A;  1JFT A;  2X66 A;  2V5C A;  4U33 A;  4LF7 T;  5F5W A;  4TWD A;  4G2A A;  3HZI B;  2YU2 A;  4DMW A;  3AEB A;  2CRB A;  2F4V T;  2VVN A;  4PW8 A;  1WLX A;  3RLF F;  3OQM A;  4ZI7 E;  1VRB A;  3LBX B;  4DR6 T;  4L9I A;  1KK7 A;  5J2U E;  5DTM A;  2XTL A;  4BAY B;  4LF8 T;  1T98 A;  4BA9 A;  2D0T A;  1IBK T;  3OMT A;  2E9X C;  5BMV E;  1ZP0 A;  2R1J L;  3C4W A;  2BBH A;  1AJ3 A;  2V6Y B;  1GQE A;  4AKH A;  4TWH A;  5FNV E;  5L3C B;  4X64 T;  4ILC A;  4C91 A;  1HNX T;  1ZPQ A;  5L3B B;  3KBU A;  4IDZ A;  4UIG A;  2LRK A;  4HFV A;  4KMC A;  3O1I A;  2N1G A;  5HXC A;  3KL4 A;  5L3D B;  3RYI E;  4EGW A;  4A98 A;  4I55 E;  2PBI A;  4P09 A;  2DWK A;  3H37 A;  3N9L A;  4L5G A;  3E08 A;  2LRL A;  5HEG A;  2NW7 A;  3MA9 A;  4WNK A;  3UUM A;  3P4R A;  3UT5 E;  3RYC E;  2UUB T;  3TKL B;  3VR9 A;  4IE5 A;  3NVO A;  2LOP A;  3PUW F;  4JI6 T;  5ADX L;  1US7 B;  1HS7 A;  2HCN A;  2LSI A;  3ZT7 A;  3OPC A;  4JEH B;  5LHI B;  1NEK A;  1VPW A;  2W00 A;  4Q25 A;  2X9W A;  3EAB A;  4TN7 B;  1Y64 B;  4YFS A;  2WWU A;  5KXJ A;  1SE7 A;  2IML A;  4H63 H;  3CK6 A;  4ZHQ E;  2BBJ A;  3IVP A;  2WDQ A;  2KND A;  1G73 A;  5ETW A;  4DV5 T;  3CKD A;  4H9R C;  4YAR A;  1B7T A;  1YQ3 A;  2H88 A;  4LMK A;  3PTR B;  5JDM A;  3X1D A;  4PFP A;  4IE7 A;  2WDV A;  2L1P A;  4DBQ A;  3EI0 A;  3Q5W A;  3WI3 A;  2H7O A;  1W0A A;  2HSG A;  2M67 A;  3O4X E;  1HF0 A;  1ZUG A;  1HNW T;  3Q2M A;  1SQ8 A;  3UFD A;  1UX4 A;  2B1E A;  1X9B A;  2HIN A;  3M9L A;  2BG9 B;  1QQB A;  3CML A;  2I59 A;  4DUY T;  5AQI B;  2IC9 A;  5AQL B;  2UXC T;  5DT2 A;  5L47 A;  2V7J A;  3P50 A;  5LBM A;  2KZ8 A;  4I6T A;  2K24 A;  3RH3 A;  2PFV A;  4GYR A;  4B3M T;  2D9D A;  3AE1 A;  3MZK B;  1T8B A;  1DW9 A;  2JPF A;  2JVL A;  4DID B;  4IVZ A;  5HWX A;  3M65 A;  1WYB A;  3T8O A;  4O4I E;  4K0K T;  4Z58 A;  3GUU A;  5HAX A;  3FYM A;  5M4Y A;  3FZL B;  3KXA A;  3RRW A;  3O1J A;  2ZMA A;  2YN6 A;  4ZZB A;  2IIU A;  5JVD E;  4PJJ A;  4IHJ E;  5ABH A;  3UQ7 A;  3J7Y q;  2ODR D;  4JI8 T;  5JH7 E;  1IZN B;  1J5W A;  3QNU A;  1BR0 A;  3ZC0 A;  2BG9 E;  2JQK A;  1ADR A;  3SCF A;  3QB5 A;  3N9N A;  4H63 V;  1N34 T;  4PU3 C;  5GAG i;  2E5V A;  3ZYM A;  4DND A;  4DR5 T;  2PXL A;  4UEM A;  2V7K A;  3ONJ A;  1OWA A;  4AIS A;  2DWG A;  3QK6 A;  4F8H A;  2J7U A;  2HFZ A;  4O2B E;  2IVG A;  1HG5 A;  3KV6 A;  3JXD L;  3HR0 A;  4OYJ A;  1KFY A;  3ZJ1 A;  4NXN T;  4E7Z A;  4OK0 A;  4IE0 A;  3VRA A;  1XMQ T;  2CMR A;  5AQM B;  5EK3 A;  3NZP A;  4I0U A;  4ADZ A;  4ILB A;  2KLQ A;  5LGN B;  4ASK A;  2HHH T;  2JQH A;  3N2O A;  5JDG A;  1CUN A;  5LYJ E;  3KVA A;  4JBW F;  3J9X 1;  3UQ4 A;  2X9X A;  2EBY A;  1PRV A;  2MEZ A;  3JC6 D;  5KX5 E;  1CJG A;  2NR4 A;  2N2N A;  5H6R B;  4TWF A;  2LM2 A;  3CQG B;  2LCV A;  3AAA B;  2W4X A;  2AE9 A;  5J1G A;  3ZMZ B;  3GZD C;  3AEF A;  3VK0 A;  5LCY A;  3CX8 B;  3LBX A;  2ACX A;  4NXM T;  3SR4 A;  5KDM C;  3TLV A;  4NDW A;  1QUU A;  5AQK B;  2KEJ A;  2CE7 A;  3PUV F;  3FYA A;  2BG9 C;  3P7I A;  3GN5 A;  2R63 A;  2LYK A;  3Q5E A;  3AXJ B;  1ZZ6 A;  3RYF E;  4EXT A;  3RF1 A;  4U7I A;  4HE8 A;  1QSD A;  5FY7 A;  3GZC A;  1U5P A;  2VUR A;  1MIW A;  2YBD A;  2VEO A;  3O1H A;  2V3C C;  4QXB B;  2M6I A;  2PUB A;  1HQ1 A;  2DLR A;  4CN6 A;  4YG7 B;  3M3Z B;  1DWK A;  3GA8 A;  2IHR 1;  4KI0 F;  4ER0 A;  1MMA A;  2CPT A;  3ZMT B;  4X4B A;  2KT9 A;  3RC8 A;  2CXD A;  3FZM B;  3N9O A;  5FXZ A;  1H7C A;  1N32 T;  2ZM2 A;  2VB6 A;  5HWY A;  4UF0 B;  3UUN A;  3WAJ A;  3CRO L;  2BNO A;  3AA0 B;  3K8P C;  5AQU B;  5AQR B;  1GT0 C;  3MEJ A;  2EWT A;  4AQF C;  3W15 B;  4X4G A;  2UXN B;  1WCR A;  3MKD A;  2WU2 A;  3R09 A;  4UVC B;  3SFD A;  3JAF A;  1QB2 A;  2WM9 A;  3P8C D;  2GRL A;  5FXX A;  4YTN A;  3QOW A;  2YDQ A;  4EAH A;  3N9P A;  4FJO A;  2WDR A;  4UR9 A;  2BS3 A;  1NEN A;  2FFH A;  5DTR A;  1NAF A;  4YJ3 E;  3AB3 B;  3UTK A;  1X57 A;  2A9U A;  4LF9 T;  5HYA A;  2BS2 A;  1LCC A;  2QYW A;  4WW0 A;  2DL1 A;  1AU7 A;  1U4Q A;  2BVL A;  1D0X A;  5BR8 T;  4GQM A;  4ER6 A;  3BD1 A;  3A5X A;  2BNM A;  3AEG A;  4X4C A;  2I6H A;  1LRZ A;  4YSY A;  1Y9Q A;  4QXH B;  1BR4 A;  3P4S A;  4YTM A;  3RKG A;  3UUB A;  4JQD A;  2MYS A;  4KP3 C;  5JDL A;  5JR9 C;  3FXE B;  3KV4 A;  4G63 A;  4GK0 E;  1XWR A;  3PUS A;  3LK2 B;  3SS1 A;  2W67 A;  2XQY A;  3CIR A;  3AAI A;  2PE5 A;  5AQH B;  2WQY A;  4IIJ E;  4H9N C;  4YJ2 E;  4LMJ A;  1WH6 A;  2X0L B;  4AQG A;  2H7V C;  1WET A;  5IYZ E;  1BR1 A;  3DNV B;  3RIF A;  3ZMU B;  1Y01 A;  4YT0 A;  5DQW A;  2A3D A;  4ZS2 A;  4X4E A;  3MK7 C;  2PG8 A;  2Q9Q D;  3ZST A;  5GAH i;  1IBL T;  2XSB A;  5HCM A;  5AQF B;  3PUY F;  3AEE A;  2LLY A;  2K48 A;  4JI2 T;  4I6U A;  3LG7 A;  2HPJ A;  3ABV A;  4NIQ A;  2W63 A;  4ILU A;  4WYV A;  3G7D A;  5AQQ B;  1XDO A;  4O4H E;  4HFE A;  1M62 A;  4X1I E;  3QOF A;  2WU5 A;  2CBJ A;  5L2L A;  5FXW A;  5LMN T;  2D5U A;  3S8Q A;  2DNX A;  2LYR A;  4FN3 A;  3RI5 A;  5L3F B;  2YU1 A;  4ZI3 C;  1E1H B;  1SA0 E;  4COF A;  2E9X B;  4C90 A;  2UXX B;  2XAQ B;  3ESL A;  4YSX A;  3K3Q C;  2ODU A;  4LML A;  3Q5D A;  4OB4 A;  2Y8D A;  5FXV A;  4HFH A;  2BVM A;  1V9D A;  4ZI2 D;  2VL0 A;  4IL9 A;  2LYQ A;  2MAW A;  3DTO A;  2MQK A;  1EZ3 A;  5CFB A;  1KEY A;  2LLV A;  5EK2 A;  4TV9 E;  3B13 A;  3K1S A;  1N33 T;  2BZB A;  2PXQ A;  2BJC A;  1NER A;  4J1W A;  2WSS V;  4HKA A;  1YW0 A;  3SOL A;  1WIZ A;  2KPJ A;  4NUU A;  4CN4 A;  3QYX A;  1E2A A;  3NKZ A;  5IWA T;  2NTX A;  2VKO A;  5L3G B;  1KF6 A;  3ZHM A;  4DR3 T;  2XQA A;  2LKG A;  2VKJ A;  4IT4 A;  3VRB A;  2FJA A;  4E7S A;  3OYZ A;  2GZU A;  3RIU A;  5LOV E;  1JNR A;  3IHR A;  2X9H A;  1WFD A;  3I0O A;  2A72 A;  2LJL A;  2PXF A;  3UU4 A;  5JQG E;  2UXD T;  4MFR A;  3LK3 B;  5GON E;  3MAC A;  4A5X A;  4PAG A;  4I50 E;  2LSJ A;  1ZVV A;  1UXC A;  3CQC B;  4DR1 T;  4KX6 A;  2LHN A;  4EED A;  2ICT A;  2WBL A;  4TX5 A;  4ERR A;  2V1D B;  1HF8 A;  2XAG B;  2M6B A;  1POU A;  1WH8 A;  3B7H A;  3TLW A;  2UU9 T;  2KEK A;  3UUL A;  2BNN A;  4GOU A;  2XHE B;  3PE5 A;  2M4H A;  3N9M A;  3KBT A;  3LDQ B;  3E22 E;  5DTQ A;  2LYJ A;  2C5K T;  3N9Q A;  5LGU B;  5L4E A;  3G06 A;  2LE8 A;  2RPA A;  5FL1 A;  2AUW A;  1FMV A;  1XNQ T;  1XDP A;  1CQT A;  4DV7 T;  4ZXL A;  5AQV B;  2CCQ A;  2XXP A;  4WBO A;  3ZHI A;  3AE9 A;  4CXX A;  2XQ9 A;  4J2C A;  4HTE A;  4CI1 B;  2ODV A;  1QZX A;  4FBI A;  3NXH A;  3UU3 A;  3QB5 K;  5HXS A;  2PUD A;  2XM1 A;  5FL0 A;  4X65 T;  1IJ5 A;  3ZSS A;  2IUB A;  2JMH A;  3KDS E;  3BDN A;  3ME5 A;  2VKD A;  2OR1 L;  4UVA B;  4CXW A;  1DU2 A;  2X0H A;  4UV8 B;  2XAS B;  2LYP A;  4PU4 C;  3CEC A;  4GYS A;  5HEJ A;  2VQF T;  1S35 A;  1HX1 B;  4IST A;  5ABF A;  1O4X A;  2HN1 A;  3ZN1 B;  3VHL A;  2AXD S;  1W09 A;  4A97 A;  3D1N I;  3P4Q A;  2CSF A;  2D0U A;  2LLW A;  2OA5 A;  2VAS A;  2IDO B;  5DRT A;  4IWR A;  5JRC B;  2WS3 A;  4HGA A;  4YHH T;  5HXR A;  1E7P A;  5LBQ B;  2Z6E A;  1BDH A;  4MBQ A;  4U74 A;  4U3C A;  4EK9 A;  1FEW A;  3FHN A;  3PUA A;  4CZZ B;  2PUE A;  3ANW A;  5FP3 A;  1JNZ A;  1D1C A;  2XXA A;  4AIU A;  3AE7 A;  2VL8 A;  1ZEE A;  1PNR A;  3U78 A;  1IAP A;  4ILA A;  1XZY A;  4Z91 A;  5HEH A;  3ZKR A;  1LCD A;  3OQN A;  3QUJ A;  5AQJ B;  5EZY E;  4OYK A;  3FXD B;  1MMN A;  3L3P A;  2WP9 A;  5LNK A;  1WRD A;  3K3O A;  2N9D A;  2XAF B;  4WZX A;  5J2T E;  4X4H A;  3H5T A;  4HRA A;  3F31 A;  5LMU T;  2L8N A;  3AED A;  3KIN B;  4ZOL E;  1IC8 A;  2PXD A;  4AI6 A;  3ZKC A;  3VU7 H;  4YXD A;  3JXC L;  4EYU A;  3OJA A;  3NRY A;  3LIS A;  4YSZ A;  2WUS R;  2LOS A;  1XMO T;  3C4Z A;  1NWM X;  3ZMV B;  2VVS A;  5AQS B;  1UX5 A;  5EK4 A;  4JI7 T;  3IEE A;  2MTQ A;  3SCG A;  5CJ5 A;  3PJA A;  3VWS A;  5JRE A;  1UCU A;  1UK5 A;  1HCI A;  4KHP T;  3KV9 A;  3QOX A;  3UFG A;  5CGM A;  4CXY A;  3PUG A;  4DR2 T;  5FKY A;  5C2T A;  3PU3 A;  3F51 A;  2PXB A;  4H9Q C;  3QFI A;  1MMG A;  2XAH B;  2AWI A;  2QA7 A;  2GRM A;  2XQ5 A;  3ETU A;  2EHO A;  1ZOY A;  3AE5 A;  1I6Z A;  3NRX A;  2VKH A;  4IGU A;  4QHO A;  3P4W A;  3L1P A;  1EFA A;  5ABF B;  3PUQ A;  5AQT B;  5HEU A;  4ZI3 D;  3QC9 A;  3I1A A;  1WR0 A;  4K0U A;  2BKN A;  5JTG A;  4Z5H A;  4Z5C A;  1MNE A;  3NBX X;  5L4H A;  4IDP A;  4N78 D;  3ZLI A;  4ISS A;  2E2A A;  2RP4 A;  5FVK A;  4Z90 A;  3ETV A;  3RPU A;  1IJ6 A;  3ZCJ A;  2OV9 A;  4EKI A;  1XNR T;  3Q9D A;  3OBV E;  1RZR A;  4EKG A;  2LSG A;  4MCT A;  2FUP A;  4QH4 A;  1I94 T;  2X67 A;  1ZS4 A;  3LJC A;  1LVF A;  4ZS3 A;  3UUX B;  3H3M A;  4MAL A;  2NW9 A;  1MFQ C;  1YD8 G;  2J7W A;  3ZT5 A;  1OED E;  3ONX A;  2JIW A;  1HFA A;  2PIJ A;  4X4I A;  3AE4 A;  3ZPX A;  4PK5 A;  2WY2 A;  4U7Y A;  2XSA A;  2KSR A;  2UUC T;  4HWD A;  2EHO D;  1QQA A;  1QP4 A;  4H9O C;  3UU8 A;  2VWA A;  1ZV4 X;  3OP9 A;  3BS3 A;  4GKJ T;  4PNI A;  1ZZC A;  2EHO C;  2IAK A;  3RX6 A;  3RZZ A;  1FMW A;  4JI1 T;  3FZH B;  4YLH A;  2JQE A;  2Q9Q B;  4EB6 E;  5JRC A;  3TLS A;  2ZLY A;  2NOX A;  4X5T A;  2XUE A;  3P4P A;  1ZZ9 A;  2AW6 A;  1FIO A;  1J5E T;  3O9X A;  1W9R A;  2NWB A;  2LM9 A;  2YKS A;  2HPL A;  1RZS A;  1ZAY A;  3CX7 B;  2WB5 A;  1RPE L;  2D2S A;  2X9Y A;  2ZM8 A;  4X1K E;  2PUA A;  2XIU A;  1PRU A;  4EV6 A;  3AE6 A;  4HWC A;  2OFY A;  5L3E B;  3HKD E;  1JFS A;  3IF8 B;  5JDH A;  2PTF A;  3AA7 B;  2LSK A;  3FBZ A;  2WWV A;  2A2F X;  3GN5 B;  4X62 T;  4QX7 B;  1YKH B;  3PJA J;  3V5S A;  3KJX A;  2CWY A;  3LFP A;  4IL4 A;  4DR4 T;  3BK9 A;  4DO0 A;  4PU8 A;  2O49 A;  2P9B A;  3LK4 2;  5DJQ C;  1D0Y A;  4O8S A;  3IA3 A;  4Z5D A;  1D1B A;  3C4X A;  2XY8 B;  3SRZ A;  3RQU A;  4ZEY A;  2W62 A;  1UTX A;  2SPC A;  1ZZ7 A;  2D5V A;  3UU6 A;  1L1M A;  2AXV A;  1LKX A;  2XXQ A;  4X20 E;  1YSE A;  2KWI B;  3ZYL A;  3MXZ A;  3AE2 A;  2JJ9 A;  2QGS A;  3V5U A;  4EZH A;  3KFW X;  4MLK A;  5DRY A;  2W66 A;  5CA1 E;  2XQ8 A;  2LYL A;  2YDS A;  2CXL A;  3VKH A;  3HA4 A;  1D0Z A;  3BQL A;  2IVQ A;  4OBM A;  3EHZ A;  2FJE A;  4JI3 T;  4H9S E;  1UGO A;  4H9P C;  4LFA T;  4B3T T;  3NZL A;  4OFZ A;  4CN1 A;  2CA5 A;  2V8S V;  4HWH A;  5JDQ A;  5TAO A;  1CHU A;  2CWO A;  3JC6 C;  3G5G A;  3R84 B;  2BKP A;  2A6C A;  2LT3 A;  3F52 A;  3OQO A;  2X51 A;  2CBI A;  2BKO A;  4NUV A;  2JRK A;  1QLB A;  5FY0 A;  4WBN E;  2L8K A;  2PUF A;  5ABE A;  4M1P A;  3TEP A;  3RQW A;  4Z8X A;  3MJX A;  1RIO A;  4DMV A;  1N36 T;  4ANJ A;  3AE3 A;  5CA0 E;  2CXF A;  2YEV C;  3UFE A;  3OVU A;  4LF5 T;  3VR8 A;  3PU8 A;  1E3O C;  4CI2 B;  4QWN B;  3C64 A;  5FYM A;  2G0U A;  5IHY A;  2J62 A;  3AXJ A;  2V5D A;  5LP6 E;  4FI5 A;  2DCF A;  2W0G A;  4ER5 A;  2XSD C;  4IA8 A;  2LKH A;  4F6R C;  4J1X A;  4AKL A;  3A9Y A;  2VK9 A;  2JQQ A;  3R1F A;  2X68 A;  2NW8 A;  2DHR A;  1RZR D;  1X79 A;  2KWH A;  2LYS A;  3EUS A;  4X66 T;  2PXU A;  3L8R A;  4HEA A;  4DVD A;  3LSV A;  2XQ3 A;  3GWH A;  1KNR A;  2BS4 A;  1LQC A;  2UXB T;  1HX8 A;  3QQ6 A;  1ZHC A;  3AEA A;  2C5J A;  4QX8 B;  1NEQ A;  3UU5 A;  3K3N A;  1Z8U A;  4HFC A;  4I8T A;  1HNZ T;  5HXE A;  3B5M A;  4TNV A;  1O3X A;  4DV2 T;  3AA1 B;  4IRE A;  3HKC E;  3ZPO A;  4DBR A;  1VOM A;  4X4D A;  4I43 B;  3MLF A;  3EVY A;  3A9Z A;  2K9A A;  5LG4 A;  4U2Z A;  3UWP A;  3EAM A;  3DM5 A;  2ICP A;  4XZC A;  3JAE A;  4TUY E;  2PXK A;  3CX6 B;  4HFB A;  4PFO A;  4LFC T;  4EOZ B;  5JR9 B;  2FJD A;  2CLY C;  3AVR A;  1T7S A;  3T1H T;  3R6N A;  3NRO A;  2KEI A;  2B76 A;  2XQ4 A;  5JDN A;  2KMF A;  5H6Q B;  3TRB A;  2NP9 A;  3D0T A;  3TFL A;  3N2G E;  2XQ7 A;  4PJN A;  4ZZC A;  3ANW B;  4IDN A;  3CPZ A;  3ZMS B;  2YDR A;  1L0V A;  3RIA A;  5HCJ A;  2I0M A;  2XJ7 A;  3ZJ2 A;  4Z59 A;  3FBL A;  2WMO A;  4YBA A;  5LHG B;  2KXP B;  3ZN0 B;  2E8I A;  1UUS A;  5FMN A;  4JEU B;  1KNZ A;  4I6R A;  2V6Y A;  5DSX A;  4XAX B;  3G0T A;  2FBW A;  4GHJ A;  3SFE A;  3PDY A;  1PRA A;  3RGL A;  3HKB E;  5AQN B;  2BDE A;  1OED C;  2RA1 A;  4JUY A;  4Y42 A;  4JI5 T;  3RIU C;  2EF8 A;  1PER L;  2UUA T;  3HL6 A;  4NPP A;  3CLC A;  4HWF A;  1WR6 A;  4MHC A;  5AQG B;  2HCS A;  4JI0 T;  2MOZ A;  2CHN A;  1B0N A;  5DQV A;  3FB2 A;  5CB4 E;  5HEO A;  5C3J A;  4CI3 B;  3RC3 A;  1JWL A;  1X2L A;  4JV5 T;  2WCA A;  2W61 A;  4EYY R;  3A8Y C;  2IW5 B;  2V7L A;  4JCX A;  4U2Y A;  2HH7 A;  2GK9 A;  4B3R T;  5JDF A;  2L9Q A;  5A7L A;  1W0B A;  3NWI A;  1FJG T;  2LSY A;  3NZQ A;  2YOE A;  5LHH B;  3NDB B;  5J0Z A;  5AQP B;  2FJR A;  2K5B B;  4X4F A;  4DUZ T;  4HFI A;  1VCS A;  4O8B A;  2XZE A;  4DR7 T;  1MIV A;  4JI4 T;  3TLT A;  1VCT A;  3FMY A;  4KHZ F;  4YTP A;  1D1A A;  2E9X D;  2B5A A;  3PV0 F;  2Q9Q C;  4AXP A;  3E0Z A;  1SHZ C;  3KZ3 A;  3BQK A;  1HR0 T;  3AE8 A;  3AAE B;  2XM2 A;  4LFB T;  3F57 A;  1MMD A;  4GKK T;  2J4G A;  2WIU B;  3F6W A;  4YG1 A;  4BJN A;  5AQO B;  2ES0 A;  2V7I A;  3AVS A;  2DI4 A;  1XWM A;  2XI8 A;  4O2A E;  2C0S A;  3CWZ B;  5C8Y E;  3U3I A;  2HN2 A;  1JH9 A;  5KMG P;  5LJN A;  3RHW A;  2CHO A;  2AXU A;  2E9X A;  2R6G F;  4X1Y E;  3AA6 B;  3TLU A;  4DE9 A;  1NW3 A;  4QH1 A;  4AKI A;  3C50 A;  1U2Z A;  2W2U A;  1T72 A;  5DAB A;  1QPZ A;  5HXH A;  1KNP A; 
#chains in the Genus database with same CATH homology
 3HKD E;  3RH3 A;  1JFS A;  2BZB A;  3IF8 B;  5JDH A;  2PFV A;  4GYR A;  4YG4 A;  3AA7 B;  2ZM0 A;  3MZK B;  2LSK A;  3FBZ A;  1DW9 A;  2A2F X;  2JVL A;  3GN5 B;  2JPF A;  2BJC A;  4HN9 A;  1NER A;  4ZI2 C;  4PJM A;  4QX7 B;  1YKH B;  4J1W A;  4U72 A;  4IVZ A;  2WSS V;  4HKA A;  3V5S A;  1YW0 A;  3KJX A;  3ZEF B;  5HWX A;  3M65 A;  1WYB A;  2CWY A;  3T8O A;  4O4I E;  3LFP A;  3SOL A;  3RKO A;  1WIZ A;  3BK9 A;  4Z58 A;  2KPJ A;  4PU8 A;  2O49 A;  2P9B A;  3LK4 2;  4PJL A;  2O4A A;  1D0Y A;  4NUU A;  4O8S A;  4UXN B;  5DJQ C;  4Z5D A;  5HAX A;  3FYM A;  3QYX A;  2IV1 A;  2LEH A;  5M4Y A;  3KXA A;  1D1B A;  3C4X A;  3SRZ A;  1OCT C;  3RRW A;  2W62 A;  2NTX A;  3O1J A;  1UTX A;  2VKO A;  2ZMA A;  3C98 B;  3GBF A;  5L3G B;  2SPC A;  1ZZ7 A;  4IE6 A;  3ZHM A;  2D5V A;  5JVD E;  4PJJ A;  2VKJ A;  4IHJ E;  2V7M A;  1L1M A;  2AXV A;  3J7Y q;  1LKX A;  4E7S A;  4XBF B;  4X20 E;  3OYZ A;  2GZU A;  4IE4 A;  5LOV E;  5JH7 E;  1YSE A;  1IZN B;  2KWI B;  3ZYL A;  3LFM A;  4PK4 A;  3IHR A;  2XAJ B;  3MXZ A;  1LMB 3;  2KZ7 B;  2X9H A;  5LA6 E;  1BR0 A;  3I0O A;  2A72 A;  2LJL A;  5JQG E;  2JJ9 A;  2QGS A;  3RRC A;  3V5U A;  4B6X A;  1QP0 A;  4MFR A;  3ZC0 A;  4EZH A;  1ADR A;  3KFW X;  1YKE B;  3SCF A;  3LK3 B;  3N9N A;  4GK5 E;  3MAC A;  4MLK A;  5GON E;  4H63 V;  4PU3 C;  3L09 A;  3BQI A;  4PAG A;  4I50 E;  3PXP A;  2LSJ A;  1ZVV A;  4JLE A;  3KVB A;  3ZYM A;  5CA1 E;  2LYL A;  4DND A;  1UXC A;  1BR2 A;  3CQC B;  2KIN B;  2CXL A;  3S4U A;  3VKH A;  3HA4 A;  2L49 A;  1D0Z A;  4UEM A;  3QF3 A;  2V7K A;  3BQL A;  2IVQ A;  2CEA A;  1OWA A;  2DWG A;  1ZZ8 A;  3QK6 A;  3I9W A;  2LHN A;  1WYC A;  3QWG A;  4O2B E;  2ICT A;  4AKG A;  4H9S E;  2PPX A;  4H9P C;  2WBL A;  2IVG A;  4TX5 A;  4ERR A;  1HG5 A;  3KV6 A;  4OFZ A;  3JXD L;  3HR0 A;  2CA5 A;  2V1D B;  4OYJ A;  3ZJ1 A;  3JXB C;  1HF8 A;  2XAG B;  5JDQ A;  4E7Z A;  5TAO A;  1POU A;  2IC6 A;  2CWO A;  1WH8 A;  3B7H A;  3CQX C;  3H3A A;  3JC6 C;  4IE0 A;  3G5G A;  4OK0 A;  3R84 B;  2CMR A;  2KEK A;  1LLI A;  3UUL A;  2A6C A;  5EK3 A;  2WAU A;  2BNN A;  3NZP A;  4GOU A;  2JMK A;  1S7E A;  1LVK A;  2XHE B;  2LT3 A;  4ADZ A;  1R63 A;  2CRO A;  1OSL A;  1ZKE A;  3N9M A;  3KBT A;  3F52 A;  3OQO A;  2KLQ A;  2X51 A;  3SCH A;  5LGN B;  4ASK A;  4NUV A;  2JRK A;  3IBP A;  3E22 E;  2LYJ A;  4OHF A;  3ZC1 A;  4UEL A;  5FY0 A;  2C5K T;  3N2O A;  3N9Q A;  4A56 A;  4TV8 E;  4WBN E;  5JDG A;  5LGU B;  2L8K A;  4GIW A;  2PUF A;  1CUN A;  2V26 A;  2LE8 A;  4KUM B;  2Q9Q A;  2AUW A;  5LYJ E;  3KVA A;  4M1P A;  4V1A v;  4AQF A;  1FMV A;  3J9X 1;  2H3R A;  2X9X A;  2EBY A;  1PRV A;  4Z8X A;  3MJX A;  2MEZ A;  3JC6 D;  1QP7 A;  5LJM A;  1RIO A;  1ZZB A;  1CQT A;  5KX5 E;  1CJG A;  4DMV A;  3HKE E;  2IVB A;  1BDI A;  4L0R A;  4ANJ A;  2N2N A;  5H6R B;  2PJQ A;  2C5I T;  3VKG A;  5CA0 E;  2CXF A;  2CCQ A;  2LCV A;  2YEV C;  3CQG B;  3UFE A;  3OYX A;  4WBO A;  4P0A A;  3AAA B;  5J1G A;  2IU7 A;  1G8X A;  3ZMZ B;  3ZHI A;  3PU8 A;  1E3O C;  3VK0 A;  5LCY A;  4CI2 B;  4CXX A;  4P0B A;  4QWN B;  4J2C A;  3CX8 B;  4HTE A;  4CI1 B;  5LXT E;  3LBX A;  2ACX A;  3C64 A;  2ODV A;  5FYM A;  2G0U A;  2XJ3 A;  3ZYK A;  5KDM C;  4FBI A;  4PU7 A;  4NDW A;  1QUU A;  5IHY A;  5HXS A;  2PUD A;  3WAK A;  2KEJ A;  4CQI A;  2CE7 A;  1IJ5 A;  5LP6 E;  4FI5 A;  3F2E A;  5A1L A;  2DCF A;  2W0G A;  2JMH A;  3KDS E;  3I9Y A;  2H8R A;  2XSD C;  4IA8 A;  3FYA A;  3BDN A;  4F6R C;  4J1X A;  2VKD A;  4O4J E;  4AKL A;  2OR1 L;  4UVA B;  2EHO B;  2VK9 A;  4AKR B;  4CXW A;  2JQQ A;  3P7I A;  1HTJ F;  3R1F A;  2X68 A;  4UV8 B;  2XAS B;  4BJM A;  2LYP A;  2NW8 A;  2O38 A;  3GN5 A;  2R63 A;  2LYK A;  2DHR A;  4PU4 C;  3C51 A;  3KV5 A;  2Y6X A;  5F3J A;  3CEC A;  1X79 A;  1RZR D;  2KWH A;  2LYS A;  1ZZ6 A;  3PE0 A;  4GYS A;  3EUS A;  4TZ4 C;  3RYF E;  4EXT A;  1S35 A;  4HEA A;  4HE8 A;  4IST A;  4DVD A;  3GWH A;  5F8P A;  1QSD A;  1O4X A;  5FY7 A;  3ZN1 B;  3VHL A;  3DJB A;  4UF0 A;  3D1N I;  3Q5X A;  1LQC A;  3U3W A;  1U5P A;  1HX8 A;  2CSF A;  3I0Q A;  3QQ6 A;  5AFU L;  1ZHC A;  1MIW A;  2D0U A;  2WMN A;  3GMI A;  1Y7Y A;  5JR9 A;  2IUO A;  1R69 A;  2OA5 A;  2VAS A;  4DO0 A;  2C5J A;  4YHJ A;  4F8D A;  4IWR A;  3O1H A;  4QX8 B;  1NEQ A;  5JRC B;  4HGA A;  3K3N A;  4QXB B;  4QKN A;  4I8T A;  2J1D G;  2PUB A;  4O4L E;  5HXR A;  3ZCI A;  5LBQ B;  5JR9 C;  2Z6E A;  1BDH A;  2DLR A;  4MBQ A;  5HXE A;  2PUG A;  2CM0 A;  4YG7 B;  1DWK A;  4U74 A;  1FEW A;  1O3X A;  2CLY B;  3AA1 B;  3FHN A;  3GA8 A;  3PUA A;  3HKC E;  3SWH A;  4CZZ B;  2AXZ A;  2PUE A;  2YIN A;  3EUH A;  3EDV A;  3ZPO A;  3ANW A;  5FP3 A;  4DBR A;  1MMA A;  1D1C A;  1VOM A;  3B57 A;  3ZMT B;  4X4B A;  4X4D A;  2KT9 A;  2CXD A;  3RC8 A;  3N9O A;  5FXZ A;  1H7C A;  2YK0 A;  4I43 B;  3MLF A;  3EVY A;  3DP7 A;  2K9A A;  5FY1 A;  5LG4 A;  4I4T E;  2VL8 A;  1ZEE A;  1PNR A;  3U78 A;  2ZM2 A;  1IAP A;  3HI2 A;  2XCJ A;  2VB6 A;  1LCD A;  3OQN A;  3QUJ A;  5HWY A;  2ICP A;  5EZY E;  4UF0 B;  3N5L A;  4EIW A;  4XZC A;  4TUY E;  4OYK A;  1MIY A;  3CX6 B;  4PFO A;  3UUN A;  4EZ4 A;  3N2K E;  3WAJ A;  3FXD B;  4UV9 B;  4MCX A;  3CRO L;  4JCY A;  1MMN A;  2L3L A;  3L3P A;  4EOZ B;  5LNK A;  5JR9 B;  2CLY C;  2PUC A;  1WRD A;  2BNO A;  2LHR A;  3AA0 B;  3AVR A;  3K8P C;  5E0O A;  3K3O A;  2N9D A;  2XAF B;  3R6N A;  1S94 A;  3OKQ A;  1GT0 C;  5J2T E;  3H5T A;  2EWT A;  4X4H A;  2KEI A;  3F31 A;  4AQF C;  3W15 B;  2L8N A;  3RYH E;  4X4G A;  2JCG A;  3EDU A;  4KBM B;  1MND A;  2UXN B;  2KMF A;  5JDN A;  4QXC B;  5H6Q B;  3KIN B;  4ZOL E;  2NTY A;  3CVR A;  5K98 B;  1IC8 A;  5LGT B;  3TRB A;  2NP9 A;  3D0T A;  3ZKC A;  3MKD A;  4AI6 A;  3PUR A;  4UVC B;  1OXZ A;  1HG2 A;  3VU7 H;  3N2G E;  4PK6 A;  3JXC L;  2WM9 A;  4PJN A;  3ANW B;  3P8C D;  3CPZ A;  4EYU A;  3ZMS B;  3OJA A;  1UXD A;  2GRL A;  5FXX A;  2MBG A;  2Y48 B;  3NRY A;  3LIS A;  4UVB B;  3ZJ2 A;  2WUS R;  4Z59 A;  1Z0P A;  2LOS A;  3N9P A;  4FJO A;  4EAH A;  1JFT A;  3C4Z A;  1NWM X;  2X66 A;  3ZMV B;  3FBL A;  2WMO A;  4G2A A;  1UX5 A;  3HZI B;  4YBA A;  5EK4 A;  5LHG B;  2YU2 A;  4DMW A;  1NAF A;  3IEE A;  2KXP B;  3AB3 B;  4YJ3 E;  2MTQ A;  3UTK A;  3ZN0 B;  2E8I A;  3SCG A;  1X57 A;  5FMN A;  5HYA A;  4PW8 A;  1WLX A;  4JEU B;  3OQM A;  1LCC A;  5JRE A;  1UCU A;  4WW0 A;  1KNZ A;  4I6R A;  1HCI A;  4ZI7 E;  1AU7 A;  1VRB A;  3KV9 A;  3LBX B;  4L9I A;  4XAX B;  1KK7 A;  1U4Q A;  5J2U E;  2XTL A;  2BVL A;  4GHJ A;  3PUG A;  4BAY B;  1D0X A;  1T98 A;  4BA9 A;  4CXY A;  3PDY A;  2D0T A;  3PU3 A;  4GQM A;  3F51 A;  3OMT A;  1PRA A;  2E9X C;  4H9Q C;  1MMG A;  5BMV E;  3BD1 A;  2XAH B;  2AWI A;  3A5X A;  2R1J L;  3C4W A;  2QA7 A;  2BNM A;  2GRM A;  3ETU A;  1AJ3 A;  4AKH A;  4X4C A;  5FNV E;  5L3C B;  1LRZ A;  2EHO A;  3HKB E;  1Y9Q A;  4QXH B;  1BR4 A;  2BDE A;  2RA1 A;  4JUY A;  4C91 A;  4Y42 A;  1ZPQ A;  3NRX A;  5L3B B;  3KBU A;  4IDZ A;  2VKH A;  4IGU A;  4QHO A;  2EF8 A;  1PER L;  4UIG A;  4JQD A;  2MYS A;  4KP3 C;  3HL6 A;  4HFV A;  3FXE B;  4KMC A;  5JDL A;  3CLC A;  3O1I A;  3L1P A;  3KV4 A;  2N1G A;  5HXC A;  4G63 A;  4GK0 E;  1WR6 A;  4MHC A;  5L3D B;  1EFA A;  1XWR A;  3RYI E;  2MOZ A;  1B0N A;  5DQV A;  4I55 E;  3PUS A;  2PBI A;  3FB2 A;  3LK2 B;  4P09 A;  5CB4 E;  2DWK A;  3PUQ A;  3SS1 A;  4CI3 B;  3RC3 A;  3H37 A;  1JWL A;  2XQY A;  3N9L A;  1X2L A;  4ZI3 D;  3QC9 A;  3I1A A;  4L5G A;  3E08 A;  4K0U A;  3AAI A;  2PE5 A;  5HXH A;  4Z5H A;  4Z5C A;  1MNE A;  2W61 A;  3NBX X;  4EYY R;  4IIJ E;  2IW5 B;  2V7L A;  4H9N C;  2NW7 A;  4N78 D;  4YJ2 E;  1WH6 A;  4JCX A;  2X0L B;  4AQG A;  2H7V C;  3MA9 A;  3ZLI A;  4ISS A;  1WET A;  4WNK A;  2HH7 A;  2RP4 A;  5IYZ E;  3UUM A;  1BR1 A;  3DNV B;  2GK9 A;  3ETV A;  3RPU A;  3ZMU B;  1IJ6 A;  5JDF A;  2L9Q A;  3ZCJ A;  3UT5 E;  5A7L A;  3RYC E;  3TKL B;  5DQW A;  3Q9D A;  4IE5 A;  2A3D A;  3OBV E;  4ZS2 A;  4X4E A;  2LSY A;  1RZR A;  3MK7 C;  2LOP A;  3NZQ A;  2LSG A;  5LHH B;  2PG8 A;  2Q9Q D;  4MCT A;  1US7 B;  5ADX L;  2FJR A;  2K5B B;  1HS7 A;  2X67 A;  4X4F A;  1ZS4 A;  3LJC A;  1LVF A;  4ZS3 A;  2LSI A;  3UUX B;  4O8B A;  4MAL A;  4JEH B;  2NW9 A;  1YD8 G;  1MIV A;  2K48 A;  5LHI B;  3FMY A;  1VPW A;  2W00 A;  4I6U A;  3LG7 A;  2HPJ A;  3ONX A;  2X9W A;  1D1A A;  1HFA A;  4TN7 B;  2PIJ A;  4X4I A;  1Y64 B;  2E9X D;  2WWU A;  4YFS A;  2W63 A;  4PK5 A;  2B5A A;  4ILU A;  2Q9Q C;  4AXP A;  3E0Z A;  1SHZ C;  3KZ3 A;  3BQK A;  3G7D A;  4H63 H;  2EHO D;  1QQA A;  1QP4 A;  4O4H E;  3IVP A;  4ZHQ E;  3AAE B;  4H9O C;  2KND A;  1G73 A;  5ETW A;  2VWA A;  3F57 A;  1MMD A;  3CKD A;  4H9R C;  1ZV4 X;  4X1I E;  4YAR A;  1B7T A;  3OP9 A;  3BS3 A;  5L2L A;  5JDM A;  3PTR B;  4PNI A;  1ZZC A;  2EHO C;  4PFP A;  4IE7 A;  2WIU B;  5FXW A;  2IAK A;  3RX6 A;  3RZZ A;  3F6W A;  4YG1 A;  1FMW A;  4BJN A;  2D5U A;  4DBQ A;  3WI3 A;  3Q5W A;  4YLH A;  2ES0 A;  3S8Q A;  2DNX A;  2H7O A;  2LYR A;  2Q9Q B;  4FN3 A;  2M67 A;  2HSG A;  4EB6 E;  3O4X E;  5L3F B;  5JRC A;  2V7I A;  1ZUG A;  1HF0 A;  2YU1 A;  2DI4 A;  3AVS A;  4ZI3 C;  1E1H B;  2NOX A;  2ZLY A;  3Q2M A;  1SA0 E;  2XI8 A;  2XUE A;  1SQ8 A;  3UFD A;  1ZZ9 A;  2AW6 A;  2E9X B;  1UX4 A;  2B1E A;  4O2A E;  1FIO A;  2C0S A;  3CWZ B;  4C90 A;  5C8Y E;  2HIN A;  3O9X A;  3U3I A;  2UXX B;  2XAQ B;  3ESL A;  2NWB A;  1JH9 A;  1QQB A;  2LM9 A;  5KMG P;  3K3Q C;  2HPL A;  2ODU A;  1RZS A;  5LJN A;  1ZAY A;  3CML A;  2I59 A;  4OB4 A;  3CX7 B;  2AXU A;  2Y8D A;  5FXV A;  2E9X A;  1RPE L;  4X1Y E;  2BVM A;  2IC9 A;  3AA6 B;  1V9D A;  2D2S A;  2X9Y A;  2ZM8 A;  4ZI2 D;  4X1K E;  2PUA A;  2LYQ A;  3DTO A;  2XIU A;  1PRU A;  2V7J A;  2MQK A;  4AKI A;  3C50 A;  1EZ3 A;  5LBM A;  2KZ8 A;  4I6T A;  5EK2 A;  2K24 A;  4TV9 E;  5DAB A;  2OFY A;  1QPZ A;  5L3E B;  3B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...