3GN5A

Structure of the e. coli protein mqsa (ygit/b3021)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator MQSA (YGIT/b3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2009-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3gn5A02
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gn5A01
1DW9A 3ZHIA 1QP0A 1HF0A 1ZZ6A 2IUOA 3CROL 3R1FA 4JCYA 4X4BA 2AXVA 1LMB3 2BNOA 1R63A 1O4XA 2JVLA 3GA8A 1OCTC 2AW6A 2IVGA 2PUCA 1PRUA 1JFSA 1VPWA 2OR1L 4PU8A 2KEKA 1PNRA 1S7EA 1LLIA 3KXAA 1ZS4A 4X4HA 1QQAA 3OMTA 4Z59A 5A7LA 2O38A 1ZZ9A 1SQ8A 2PPXA 3KJXA 1AU7A 2H8RA 3JXDL 4OB4A 1LCCA 3CLCA 2LYSA 2L8NA 3OQOA 4JCXA 3GN5B 4PU4C 3GBFA 3SCHA 4FBIA 2BJCA 2O49A 3F6WA 4YG7B 1PERL 1EFAA 2LYPA 1POUA 3FYMA 2EBYA 2IVQA 1RPEL 1CJGA 2PUDA 4F8DA 2LYQA 1X2LA 2LYRA 3QF3A 4Z5CA 4J1WA 2WIUB 4IA8A 3F52A 3FYAA 4YBAA 3PXPA 3ZKCA 1ZUGA 1ZZ7A 3O9XA 2AWIA 4YARA 1UXCA 1RIOA 4I6RA 1Y7YA 1ZZ8A 2GRLA 2KPJA 4PU3C 3LISA 2GRMA 1ZZBA 4Z58A 1B0NA 4I8TA 2AXZA 2OFYA 4IVZA 1R69A 4Z5HA 3JXBC 1ZZCA 1ZAYA 1JWLA 2BNNA 2PUBA 3S8QA 3EUSA 3OQMA 1L1MA 2CROA 1LQCA 2IU7A 1WH8A 3GN5A 4MCXA 2R63A 4GQMA 3HI2A 1NERA 2HINA 2MQKA 3QWGA 3BS3A 2JCGA 2A6CA 3JXCL 3FMYA 1Y9QA 3RZZA 2PUEA 2PUGA 2LCVA 1BDIA 3HZIB 4Z5DA 1ZPQA 2XIUA 3SCFA 4PU7A 1QQBA 2GZUA 4J1XA 3QYXA 3OP9A 4GHJA 3BD1A 4I6TA 1NEQA 4YG1A 3B7HA 3UFDA 3DNVB 2AXUA 2PIJA 1WETA 3OQNA 1RZSA 3CECA 2ICPA 4Y42A 4FN3A 4NDWA 1YSEA 1OSLA 2PUAA 3D1NI 2EWTA 1IC8A 2ICTA 1UXDA 2XJ3A 1ZVVA 2KZ8A 4YG4A 2LYJA 4X4CA 1E3OC 3MLFA 3QQ6A 2XSDC 4O8BA 2IV1A 3H5TA 2PE5A 1UTXA 1BDHA 4JQDA 2O4AA 3KZ3A 4I6UA 1CQTA 2R1JL 2HSGA 3IVPA 1X57A 4X4GA 1QP7A 3L1PA 3ZHMA 2AUWA 3F51A 1PRVA 2KEJA 1RZRA 2WUSR 2MEZA 1LCDA 4MCTA 2XI8A 4X4FA 1ADRA 1QP4A 2PUFA 2LYKA 3VK0A 2XCJA 2D5VA 2EF8A 4X4DA 2KEIA 2L49A 5K98B 2LYLA 1PRAA 4IWRA 1JH9A 2CSFA 2BNMA 2B5AA 3SCGA 1JFTA 1GT0C 4X4EA 1XWRA 4X4IA 3G5GA 3LFPA 3BDNA 1WIZA 2FJRA 1QPZA 3U3WA 3G7DA 2IVBA 1RZRD 1WH6A 1DWKA 3TRBA
chains in the Genus database with same CATH superfamily
2X9XA 4PK4A 5AQKB 4X4BA 4DV7T 4DMWA 2UUAT 1W9RA 4OYKA 2MOZA 2IVGA 1HS7A 5GONE 3T8OA 5H6QB 5AFUL 3IHRA 2LJLA 4HFIA 1KF6A 2DHRA 4YG7B 4I43B 2V7IA 1PERL 3F57A 4HRAA 3W15B 3ZEFB 3C51A 4HWDA 3LFMA 4A56A 3PUSA 4HTEA 4YBAA 4YFSA 2EHOC 2WAUA 3KBTA 1ZZ7A 3O9XA 5AQIB 3B57A 4TN7B 4YARA 2RP4A 4CQIA 1D1BA 3LISA 2GRMA 3NBXX 4UVBB 4DV1T 4UV8B 4WZXA 3AE2A 3OTOT 5ABEA 4JI8T 2CBJA 3MXZA 3TKLB 2FJAA 4V1Av 3UUMA 2W2UA 2JCGA 2UUBT 2F4VT 3AXJB 2N9DA 3AA7B 4PW8A 2GZUA 4GHJA 2Y6XA 2XAJB 2IW5B 1HQ1A 3BQIA 4Y42A 2RA1A 1Y64B 2CWYA 2PXPA 3QB5A 2HCNA 2ICTA 2HHHT 3QUJA 4JBWF 2NW9A 5L3BB 3TLUA 1QSDA 5JVDE 2M4HA 1CUNA 2KNDA 5FXXA 5IHYA 4P0AA 2XCJA 5JR9B 4X4DA 2KEIA 2B5AA 2BG9E 3DM5A 3RIUC 2J7UA 3NRYA 2YKSA 4AISA 1XWRA 4HWHA 1G73A 1UURA 2VKHA 1D0ZA 1HTJF 4DR5T 4B3MT 2J1DG 1I94T 3GZDC 4O2AE 3SOLA 5DTQA 4NPPA 1OCTC 1H7CA 1KNRA 1KEYA 2XM2A 1AU7A 2QA7A 1HG5A 2XQAA 5C8YE 1IJ6A 1B7TA 5LP6E 4YSYA 5FY7A 3TLWA 4YTPA 2Q9QA 2E2AA 4JUYA 2H88A 3LK2B 4LMJA 2WMNA 5FMNA 1IBLT 2K3WA 4I8TA 2BDEA 3M3ZB 1NW3A 2X9WA 2XQ9A 3AE4A 4DV0T 4O4JE 1IBMT 3TLVA 3OYZA 2J4GA 1QZXA 1Z8UA 4KI0F 1UCUA 3ME5A 3U78A 3OVUA 2CE7A 3AEBA 3PUWF 2MBGA 2X51A 2VQET 3CIRA 4IT4A 5HEGA 3OQNA 2WBLA 3RX6A 2K48A 4OHFA 2V7KA 4NXNT 2EHOD 4ER7A 4U2ZA 4ANJA 1FMVA 5HCJA 1D1CA 2R1JL 4X4GA 3PE5A 3KV4A 2KEJA 1IBKT 5DQWA 2MEZA 2XI8A 4PNIA 4YJ2E 5JREA 2NWBA 3RIAA 4IWRA 1JH9A 2KZ7B 2YDQA 5JUWA 3J7Yq 1ZEEA 3CVRA 5JDHA 2A9UA 2YDSA 4ILAA 3RKOA 4DR7T 3CROL 4JCYA 3KINB 2BNOA 4U33A 4PFPA 3L39A 2Q9QC 2PUCA 5HYAA 1XMQT 1UK5A 3NROA 1JNRA 3VR8A 1J1JA 1M62A 1M7KA 2LSGA 2LHNA 2L8NA 3ZMUB 3B5MA 4HGAA 3RIFA 4EB6E 1POUA 3O1JA 3AEEA 1CJGA 3ZCIA 1UX5A 4JI5T 3PUYF 2FJEA 3P4WA 2XQ4A 4GKKT 1FIOA 3CQXC 2YINA 2BNNA 2J47A 1R8IA 4EYYR 3EUSA 4DV5T 2PXTA 2VKOA 3RYHE 4JI6T 3N2OA 2PUEA 2C5KT 2LCVA 1BDIA 4J1XA 5C3JA 3OP9A 3CX6B 1U2ZA 1Z0PA 3I0QA 3AA1B 3UFEA 5E0OA 5EK4A 3D0TA 3VR9A 2NW8A 2W62A 2NR4A 4NIQA 5LOVE 4DE8A 1E3OC 3DTOA 3H37A 1CQTA 4I6UA 2UXNB 4YSZA 5FY0A 3SX0A 2JMHA 3KFWX 4E7ZA 2WSSV 5K98B 2D9DA 3PV0F 3ETVA 4EKIA 4U74A 3QOXA 5AQRB 2BVMA 2Q9QB 3DP7A 4GIWA 4JV5T 5ABGA 5L3EB 3OKQA 2X9HA 2KEKA 5FXZA 4LFAT 3C4ZA 4IE5A 4IREA 3ZMVB 4IL9A 1SQ8A 1XWMA 4GK0E 3ABVA 3H3MA 3I9YA 1S94A 1V9DA 5JRCA 3MZKB 3G06A 3MA9A 2L1PA 4DO0A 1VRBA 4Z5CA 4EOZB 4IIJE 4QX8B 3RKGA 2XY8B 4IE0A 1UXCA 4HFVA 1HCIA 1I6ZA 2AXZA 5L2LA 4HEAA 2DI4A 3TLTA 3JC6C 4CN4A 3VRBA 2Q9QD 5L47A 4U3CA 4GQMA 3I9WA 1U5PA 4Z5DA 1QQBA 3R09A 5C2TA 2AXUA 4H63H 2QVAA 4NDWA 2BS2A 3SS1A 2NTXA 3D1NI 4UR9A 5F8PA 3EI0A 5BMVE 2VL8A 4Q25A 2CPTA 5HXRA 3RH3A 2LYKA 4LF9T 3UQ4A 1OEDE 3RQWA 4ILUA 2MAWA 2L3LA 2V1DB 2V7JA 4Z8XA 5KMGP 1XDPA 2FJRA 1MIVA 3VWSA 5HEOA 3U3WA 4MALA 5CGMA 3FXDB 4ZI3D 2HH7A 2XHEB 3I0OA 2LSYA 3ZYKA 2D0UA 5GAGi 4B3RT 3UUBA 4TWFA 1LLIA 3KXAA 1LRZA 2XQ8A 2LYPA 4E7SA 3T1HT 3RLFF 3F52A 3ZKCA 4IDOA 2VEOA 2VKJA 2N1GA 2P9BA 3LSVA 3MACA 4DVDA 4O4LE 2C0SA 4WVLA 5FVKA 2CEAA 3NKZA 2XAHB 2LEHA 2J62A 3N5LA 3HZIB 4AQFC 3ZSTA 2XIUA 2WWVA 3N9PA 4AKIA 1NEQA 3RQUA 5FKYA 1YSEA 1YQ3A 2LM9A 2XQ7A 1US7B 5LA6E 2PG8A 3C4WA 2EWTA 2XQ6A 5ADXL 3Q5XA 4JI7T 4PFOA 5LJNA 1KK7A 1MFQC 3ZHMA 3TFLA 2EHOA 3JC6D 1PRVA 1J5WA 4U31A 2N2NA 3MEJA 3PUZF 3LQXA 3FZMB 5JRCB 4YTMA 4UVAB 4EQZA 3IA3A 3FZKB 3G5GA 3LFPA 3AAAB 3AA6B 3LK3B 5HXSA 1SUMB 4HFCA 2M67A 2X9YA 5DTRA 2ZMAA 2KWHA 1KNPA 5A1LA 1D0YA 4X4HA 2O38A 3ZN0B 1NENA 1WR6A 4OX9T 4CI2B 3P8CD 2XASB 3UU3A 3F2EA 5H6RB 2LYRA 3PXPA 1JNZA 4QH4A 2BG9C 5LHHB 4F6RC 4DV2T 3C4XA 1RIOA 4LMLA 4ZI2C 1XMOT 2FFHA 3RIUA 1ZZBA 4EXTA 2YN6A 3RC3A 4YJ3E 1LQCA 4M1PA 3UTKA 4I4TE 1NERA 2K5BB 2XXQA 3NRXA 3GZDA 2CBIA 1VCTA 3IF8B 4UEMA 1WETA 2PIJA 1N34T 4FN3A 4MLKA 2PXQA 4CZZB 5DT2A 2WZIA 5JDGA 3RGLA 4YY3T 2XSDC 4H9OC 1VPWA 1QP7A 4HFBA 2Y48B 3ZYLA 5KDMC 3N2GE 1VOMA 2E8IA 3WAKA 4EYUA 3QFIA 3RF1A 4EZIA 1WIZA 2WZHA 4H9QC 2ODUA 3RI5A 2JQEA 1QP0A 1BR4A 2LLWA 4B3ST 1KNZA 3AE8A 1X79A 2WU5A 4AKHA 3N9NA 3KV9A 2CWOA 4PU8A 5AQQB 4H9NC 3OYXA 5HAXA 4ILCA 1FEWA 2LYSA 3ZPXA 3OKZA 3AE5A 4U72A 3ZT7A 3SCHA 4FBIA 3AEAA 2CXFA 2V5DA 2PXVA 3PURA 2PXEA 1YXRA 2JRKA 4ISSA 4CXYA 3F31A 2MPKA 3NDBB 1AJ3A 3OBVE 4A5XA 2WM9A 4DMVA 1CHUA 1R69A 1JWLA 2PXFA 5ETWA 4DV4T 4HFHA 5FVLA 2EHOB 2LKHA 3OQMA 5JDNA 4I0UA 3QWGA 3CX7B 2JIWA 3JXCL 1Y9QA 3RZZA 1FJGT 4FI5A 3WAJA 3KVAA 2W0GA 3JAEA 4QH5A 3AVRA 4JI3T 5LJMA 3K8PC 2LT3A 5KX5E 1N33T 1HNZT 2C5IT 4ZI2D 4CXWA 3RYCE 1T7SA 4ZOLE 2YDRA 2HSGA 4O4IE 1RZRA 3FB2A 4MCTA 2LM2A 2WDVA 1QP4A 2EF8A 4IDQA 3SCGA 3CQGB 2DL1A 3NXHA 2GK9A 4PJNA 2J7WA 1YKEB 1ZHCA 1OWAA 1DWKA 4G63A 1D0XA 4IDNA 3FZHB 3PUXF 3RHWA 2JVLA 2DNXA 4UF0A 4CN1A 1MMGA 3ANWA 2XQ5A 1ZS4A 3OMTA 3FBZA 2PPXA 3N9OA 2LLYA 4ZS3A 4I50E 2DLRA 2JJ9A 4QXCB 3EHZA 2X66A 2IHR1 3RYIE 2IVQA 4TV8E 5AQFB 5JDMA 2K9AA 3KL4A 5IWAT 2LOSA 3JADA 5AQPB 4BJNA 3P4QA 5L4EA 4HWIB 3KBUA 1WYBA 4EAHA 1E7PA 5IUXA 2NOXA 2OFYA 2UXXB 5HEJA 4Z5HA 2QRXA 2A3DA 1QUUA 2LHRA 2MTQA 4EZHA 2DWKA 3EVYA 2W63A 2WP9A 3AECA 4X64T 2L9QA 3O1IA 4LF8T 2WB5A 3UU5A 1MMDA 4MBQA 5HEUA 1HR0T 1HF8A 3CWZB 3NZQA 1IAPA 2X0LB 3AEGA 4Z90A 3ONXA 4DR6T 2PXBA 3DJBA 1J5ET 3F51A 3AE7A 3N9QA 4HKAA 2PTFA 4K0KT 2BNMA 5DRYA 2XSAA 4X4IA 4BJMA 4ER3A 4C91A 3EABA 4DR1T 1WH6A 3TRBA 3AAIA 4C90A 3GA8A 5J1GA 2AW6A 4X1YE 1JFSA 1SA0E 4X66T 3R6NA 1UGOA 2R6GF 3AVSA 1HX1B 2WWUA 1ZZ9A 4WNKA 3CLCA 4PU4C 2W66A 2FJBA 3Q5EA 2A72A 1SHZC 3OPCA 2H3RA 1X2LA 3IBPA 1OEDC 4IA8A 5ABHA 4IDPA 3UQ7A 2E5LT 5LCYA 3VU7H 2YU2A 4DR4T 2NTYA 2WY2A 4IVZA 4XBFB 1ZZCA 2WS3A 4WBNE 2M6BA 2XXAA 3VHLA 4QWNB 2A6CA 4MFRA 4UELA 2BZBA 4HE8A 3QYXA 5JQGE 2VASA 5JDLA 4P09A 4U7YA 4JEUB 5L3CB 1WFDA 3CECA 4QXHB 3MJXA 4YG4A 4UF0B 2HFZA 2ZLYA 1IZNB 2IV1A 3ANWB 4DV6T 3M9LA 3FZFB 2LSKA 4X4FA 3ETUA 4DUZT 3UULA 2LYLA 3K1SA 2ES0A 3ZC1A 1GT0C 4X4EA 3A8YC 3I1AA 5DABA 2CHOA 3ZCJA 5J0ZA 1RZRD 4EV6A 4HWCA 5FNVE 3L09A 1YKHB 4G2AA 2AXVA 3N9MA 5F3JA 4AQFA 3UT5E 3CPZA 5AQVB 4YLHA 2XZEA 2OR1L 3HL6A 1QLBA 2BS3A 1W0AA 3KJXA 2VL0A 3C64A 2FBWA 2V7MA 3P7IA 4JCXA 4FJOA 5AQUB 3GBFA 2YBDA 5LB7B 2BJCA 3ZT6A 3E22E 3F6WA 4P1NA 2V7LA 4B6XA 3KVBA 2PUDA 5AQLB 1ZP0A 2KWIB 5HWYA 4XAXB 3UFGA 2WIUB 2H7OA 2Y8DA 4J2CA 4IHJE 2GRLA 2CM0A 4LF5T 4QH1A 3TLSA 1GQEA 3PU3A 3S8QA 4LMKA 4YSXA 4CXXA 5AQHB 4TWDA 2CMRA 2HPJA 2IAKA 1MNDA 2W67A 3B13A 3UFDA 4N78D 3LBXA 1VCSA 1LKXA 3GMIA 4H9PC 4ERRA 5BR8T 1T98A 2UU9T 3MLFA 3QQ6A 1BDHA 4JQDA 5L3DB 3QNUA 1BR2A 3FHNA 2BG9A 2WCAA 4EEDA 2YK0A 3VK0A 2XJ7A 2WMOA 3MKDA 1HNXT 2PXDA 2CCQA 2D0TA 3UWPA 1QPZA 2CXDA 3QC9A 2FJDA 4TZ4C 5GAHi 2LYJA 3Q9DA 1ZZ6A 1WCRA 3MK7C 3V5SA 1G8XA 1D1AA 2AE9A 3JAFA 4LFCT 3RPUA 4NUVA 5A7LA 3GUUA 2H8RA 3ZPOA 3ZLIA 2XXPA 3ZMSB 4LFBT 3ZMTB 5DJQC 3FYMA 4DR2T 4AI6A 3VKGA 2LYQA 4X1IE 2VB6A 2WDRA 3P4RA 4UXNB 3ZC0A 1ZZ8A 4IL4A 1KFYA 4GYRA 4DR3T 3SR4A 5J2UE 1ZAYA 2PUBA 2H89A 4F8HA 3QOWA 2XAQB 4IE6A 1WH8A 2I0MA 3N2KE 3WI3A 3HI2A 4OFZA 3TEPA 2V3CC 2HN2A 4X65T 3T1YT 3PJAJ 2LOPA 4PU7A 2XUEA 3OJAA 4YT0A 2JQQA 3PJAA 5AQJB 4EGWA 2V6YA 3K3OA 5LYJE 4O8SA 3BQLA 4WBOA 3TELA 4H9RC 5LG3A 4BA9A 4AKGA 4LF7T 5JR9C 1IC8A 4X4CA 3KV5A 1UTXA 3AE9A 1X57A 3HKCE 3RC8A 2JQ9A 4GOUA 4ZZBA 2XAGB 3SRZA 4Z91A 1MMNA 4QX7B 1PRAA 4TUYE 2KSRA 2YEVC 4EEBA 1JFTA 4H63V 5CFBA 4JI4T 2BS4A 2IVBA 4UV9B 3ZHIA 2PXKA 5AQGB 2IUOA 5LGUB 4DIDB 5L3GB 4X62T 1R63A 4JI1T 3H3AA 4QXBB 2KT9A 5AQOB 3E08A 5HEHA 4ZXLA 3PUVF 5LMUT 5LHIB 3ONJA 5LHGB 4ER6A 5EZYE 2UXBT 4HWFA 2O49A 4JYAT 3LK42 2MXDA 2QGSA 3CK6A 5JDFA 2X0HA 3FBLA 3LBXB 4TNVA 3UUNA 2VURA 5IYZE 2AWIA 1L0VA 3RRWA 4Z58A 2I6HA 4PAGA 2BBJA 1UUSA 5JDQA 2CRBA 1N32T 2BG9B 3FXEB 1O3XA 4X5TA 4AKLA 2BBHA 2R63A 2XM1A 3JCFA 1E1HB 2HINA 4AQGA 2PXLA 2B1EA 3FMYA 4IE4A 3J9X1 3ZT5A 3LJCA 3SWHA 4BAYB 3B7HA 1XZYA 5HXCA 1OSLA 2UUCT 2PUAA 2IDOB 4A97A 5HWXA 4JEHB 4JI2T 4LF4T 5ABFA 4NXMT 4X20E 3H5TA 4ZS2A 5AQNB 3S4UA 2E9XA 4EIWA 4ADZA 4KMCA 2DWGA 3GWHA 1ZKEA 4DV3T 5KXJA 4GYSA 2LNMA 4O2BE 2CHNA 4DBQA 3AEDA 2KXPB 3Q5DA 1MNEA 2IC9A 4KP3C 4MHCA 3O1HA 3AE3A 1DULA 5CA1E 3L8RA 5FYMA 5JH7E 5LGNB 2VQFT 2AXDS 3AEFA 5JTGA 1WRDA 4K0UA 5L3FB 2K24A 1PRUA 5HXHA 4Z59A 2W4XA 5HCMA 1Y01A 2OA5A 3OQOA 4CI1B 1NWMX 1N36T 3CMLA 2PBIA 2JPFA 3PUAA 3AE6A 1RPEL 5LGTB 3EAMA 4I55E 3P4SA 2D5UA 3BQKA 3HKDE 2V6YB 2HPLA 4UIGA 2HCSA 2OLTA 3ZSSA 4PU3C 2I59A 2LE8A 4ILBA 2W00A 2V5CA 3A5XA 3GN5A 4MCXA 5LBQB 2JQKA 3K3NA 1QB2A 2HN1A 2E9XC 2ZM2A 3ESLA 4ZEYA 2VVSA 3E0ZA 4ZZCA 1UXDA 2KZ8A 5DRTA 2KLQA 3KV6A 1OEDA 4JLEA 3KZ3A 4QKNA 3IVPA 3OWQA 3ZYMA 4EZ4A 4PJJA 4KX6A 5AQMB 3SFDA 1ADRA 1LCDA 3QB5K 2PUFA 2KMFA 4QHOA 3AAEB 2W61A 3PU8A 3N9LA 3EDUA 2G0UA 3A9ZA 4HFDA 1XDOA 2SPCA 2NP9A 1DW9A 4GK5E 2XQYA 3R1FA 1S35A 1W0BA 2CXLA 3R84B 5J2TE 3JXDL 1NEKA 2IC6A 3CQCB 4PJLA 4GKJT 2VVNA 3HKBE 3PTRB 4U7IA 1WYCA 4AIUA 3PE0A 1HFAA 4L5GA 5CB4E 3NZPA 3CX8B 1NAFA 4Q2JA 2L8KA 4ZI3C 3UU6A 2B76A 1XNQT 4TV9E 4EKGA 2ODVA 2JQHA 4OK0A 1B0NA 1EZ3A 2LSJA 3GZCA 5ABFB 1MIWA 2X0YA 2MYSA 3AA0B 2E9XB 5FY1A 5FP3A 2IU7A 2VKDA 2MQKA 4YHJA 4WYVA 4OYJA 3QK6A 3SCFA 5FL0A 5L4HA 5AQSB 2Z6EA 2M6IA 4DBRA 3M65A 2IUBA 2ZM6T 1ZVVA 2VWAA 4PK6A 4YHHT 4O8BA 4U2YA 4HN9A 3K3QC 2AUWA 3LG7A 1YQ4A 2IMLA 4IDZA 2WUSR 3ZN1B 2ACZA 2D5VA 2IIUA 2C5JA 3ZJ2A 2XQ3A 3U3IA 4IE7A 3G0TA 2OV9A 3IEEA 1YW0A 1ZOYA 4KUMB 2E9XD 3JXBC 4H9SE 1HF0A 3NZLA 3X1DA 2WU2A 3UU4A 1LMB3 1O4XA 3EDVA 4TWHA 2PFVA 4L0RA 1U4QA 4KHZF 1PNRA 1HX8A 3ZJ1A 2LRLA 4HFEA 2FUPA 1DU2A 3GN5B 1T8BA 4PJMA 2CA5A 1XNRT 5EK2A 4CI3B 5LMNT 4XZCA 2WQYA 4ASKA 4AKRB 1EFAA 2EBYA 2A2FX 3QF3A 3HR0A 3VKHA 4TX5A 1ZUGA 4ER0A 5TAOA 3RYFE 2UXCT 3A9XA 4I6RA 3Q2MA 2KPJA 2PXUA 3L3PA 4DUYT 1FMWA 5HXEA 1OEDB 3NVOA 4COFA 4AQYT 3SFEA 3BK9A 4B3TT 1L1MA 2CROA 1X9BA 2ACXA 1E2AA 2BKNA 2H7VC 3PUQA 3EUHA 4YXDA 2V6XA 5LG4A 1WR0A 5M4YA 3QOFA 2D2SA 3BD1A 4I6TA 2X67A 4YG1A 4AXPA 3A7MA 4KHPT 3HA4A 4YTNA 3ZMZB 3C50A 2XJ3A 2V26A 3CKDA 1LVFA 2CLYC 1YD8G 3L1PA 3P50A 5CA0E 2LKGA 4A98A 2XAFB 4ER5A 5FL1A 2UXDT 2VK9A 3NWIA 5LBMA 2CSFA 3PUGA 4P0BA 3AXJA 3VRAA 2YU1A 5DTMA 4PK5A 5EK3A 3G7DA 3V5UA 2YOEA 4X1KE 4ZI7E 4LF6T 3PDYA 4TNWA 1MIYA 2BKPA 2E5VA 1S7EA 1QQAA 2ZM8A 4OB4A 1LCCA 4KBMB 3FZLB 5JR9A 4OBMA 5FXVA 4DE9A 5FXWA 3UUXB 4F8DA 5LNKA 2LSIA 4J1WA 1T72A 4ZHQE 3ONLC 3UU8A 3RRCA 3FYAA 1W09A 4EK9A 2PJQA 1Y7YA 3O4XE 4L9IA 2XTLA 1BR0A 1WLXA 5DQVA 3Q5WA 1MMAA 2LRKA 3AB3B 2NW7A 4WW0A 4UVCB 3HKEE 1ZV4X 3BS3A 1BR1A 2ODRD 2XPKA 2QYWA 2PUGA 1ZPQA 1UX4A 2X68A 5LXTE 2ZM0A 3DNVB 2CLYB 1RZSA 2ICPA 1IJ5A 4JI0T 3ZKRA 1HNWT 4O4HE 1OXZA 1HG2A 3KDSE 2DCFA 4NUUA 4ISTA 3A9YA 3LDQB 4CN6A 2PE5A 2XSBA 4DNDA 2O4AA 2RPAA 5F5WA 2KINB 2WDQA 3C98B 2V8SV 2LLVA 3AE1A 3P4PA 2L49A 5CJ5A 1SE7A 2JMKA 2BVLA 4IGUA 3BDNA 2BKOA 5DSXA 5AQTB 1LVKA
chains in the Genus database with same CATH topology
2XHEB 3I0OA 5CA1E 2LSYA 2X9XA 3AAIA 5FYMA 4PK4A 5JH7E 3ZYKA 5LGNB 4X4BA 4DMWA 2D0UA 4C90A 3GA8A 1WRDA 4K0UA 4OYKA 2MOZA 5J1GA 5L3FB 2AW6A 2K24A 2IVGA 4X1YE 1PRUA 1JFSA 1SA0E 3R6NA 1HS7A 5HXHA 5GONE 1LLIA 3KXAA 3T8OA 5H6QB 5AFUL 1LRZA 4Z59A 2WWUA 3AVSA 3IHRA 2LJLA 1ZZ9A 4WNKA 3CLCA 2OA5A 3OQOA 4PU4C 4CI1B 1NWMX 3CMLA 2DHRA 4YG7B 2PBIA 2V7IA 4I43B 1PERL 3F57A 2JPFA 3ZEFB 2A72A 1SHZC 2LYPA 3PUAA 3W15B 3C51A 1RPEL 5LGTB 4E7SA 3LFMA 2H3RA 4I55E 4A56A 3PUSA 1X2LA 2D5UA 4HTEA 3IBPA 3BQKA 3HKDE 4IA8A 3F52A 4YBAA 3ZKCA 4YFSA 2EHOC 2WAUA 2HPLA 3KBTA 4UIGA 1ZZ7A 3O9XA 3B57A 4TN7B 4YARA 2VKJA 2RP4A 5LCYA 4CQIA 3VU7H 2YU2A 1D1BA 4PU3C 3LISA 2GRMA 2I59A 3NBXX 2NTYA 4UVBB 4UV8B 2LE8A 2W00A 4IVZA 4XBFB 1ZZCA 2N1GA 2P9BA 3A5XA 3MACA 4DVDA 4O4LE 4WBNE 3VHLA 2C0SA 2CEAA 3MXZA 3TKLB 4V1Av 3GN5A 4QWNB 4MCXA 3UUMA 5LBQB 2JCGA 2A6CA 2XAHB 4MFRA 2LEHA 2N9DA 3K3NA 3HZIB 3AA7B 3N5LA 2BZBA 4HE8A 4UELA 4AQFC 2XIUA 4PW8A 2GZUA 3QYXA 2E9XC 2ZM2A 4GHJA 3N9PA 2Y6XA 5JQGE 2VASA 5JDLA 4AKIA 1NEQA 4P09A 4JEUB 3ESLA 5L3CB 2XAJB 2IW5B 3BQIA 3CECA 4Y42A 3E0ZA 2RA1A 1Y64B 4QXHB 1YSEA 2CWYA 2LM9A 1US7B 5LA6E 2PG8A 3C4WA 2EWTA 2ICTA 1UXDA 3MJXA 2KZ8A 4YG4A 2KLQA 4UF0B 3KV6A 5ADXL 2ZLYA 1IZNB 2IV1A 3ANWB 3Q5XA 3QUJA 4JLEA 4PFOA 2NW9A 5L3BB 3KZ3A 4QKNA 1KK7A 1QSDA 5JVDE 3IVPA 5LJNA 3ZYMA 3ZHMA 2EHOA 4EZ4A 3JC6D 1PRVA 4PJJA 1CUNA 2KNDA 1ADRA 1LCDA 2LSKA 4X4FA 2N2NA 3ETUA 2PUFA 5FXXA 5IHYA 4P0AA 2XCJA 2KMFA 4QHOA 3AAEB 5JR9B 3UULA 4X4DA 2W61A 5JRCB 2KEIA 4UVAB 2LYLA 3PU8A 3N9LA 2B5AA 2ES0A 3ZC1A 3NRYA 3EDUA 1GT0C 4X4EA 1XWRA 2G0UA 3G5GA 3LFPA 3AAAB 3AA6B 3I1AA 5DABA 3ZCJA 3LK3B 2SPCA 5HXSA 1G73A 1RZRD 5FNVE 2NP9A 1DW9A 2VKHA 4GK5E 2XQYA 3L09A 3R1FA 1S35A 1YKHB 1D0ZA 2M67A 1HTJF 2AXVA 3N9MA 2J1DG 4G2AA 5F3JA 4AQFA 3SOLA 4O2AE 2X9YA 3UT5E 3CPZA 2CXLA 4YLHA 1OCTC 2ZMAA 2KWHA 1H7CA 2OR1L 3R84B 5J2TE 3HL6A 5A1LA 1D0YA 4X4HA 2O38A 3KJXA 3P7IA 3C64A 1AU7A 2V7MA 3JXDL 4JCXA 4FJOA 2IC6A 3ZN0B 3CQCB 4PJLA 1WR6A 3GBFA 3HKBE 2BJCA 2QA7A 3E22E 3PTRB 3F6WA 4CI2B 3P8CD 2V7LA 2XASB 1HG5A 1WYCA 4B6XA 5C8YE 3PE0A 1IJ6A 1B7TA 1HFAA 3F2EA 3KVBA 5H6RB 2PUDA 5LP6E 5FY7A 2KWIB 4L5GA 2LYRA 5CB4E 3NZPA 4XAXB 5HWYA 2WIUB 2Q9QA 2H7OA 2Y8DA 3CX8B 1NAFA 3PXPA 5LHHB 4J2CA 4JUYA 2L8KA 3LK2B 4IHJE 4ZI3C 4F6RC 3C4XA 2WMNA 4TV9E 1RIOA 2GRLA 2CM0A 5FMNA 4ZI2C 2ODVA 1ZZBA 4OK0A 1B0NA 4I8TA 1EZ3A 2LSJA 2BDEA 4EXTA 3PU3A 1MIWA 2X9WA 4O4JE 3S8QA 2MYSA 3OYZA 3AA0B 4CXXA 2E9XB 3RC3A 5FY1A 4YJ3E 5FP3A 1LQCA 2IU7A 2VKDA 4M1PA 4I4TE 3UTKA 1NERA 2K5BB 2MQKA 3NRXA 1UCUA 4YHJA 3U78A 2CE7A 4OYJA 3IF8B 2CMRA 3QK6A 3SCFA 4UEMA 2HPJA 2IAKA 2MBGA 1MNDA 2X51A 3B13A 3UFDA 4N78D 1WETA 2PIJA 3LBXA 3OQNA 2Z6EA 2WBLA 4FN3A 3RX6A 2K48A 1LKXA 4MLKA 3GMIA 4OHFA 4H9PC 2V7KA 4CZZB 4DBRA 4ERRA 2EHOD 3M65A 4ANJA 1T98A 5JDGA 1ZVVA 1FMVA 2VWAA 4PK6A 3MLFA 3QQ6A 2XSDC 4O8BA 1BDHA 1D1CA 4JQDA 4H9OC 5L3DB 1BR2A 1VPWA 4HN9A 2R1JL 4X4GA 3K3QC 1QP7A 3FHNA 3KV4A 2AUWA 2KEJA 2Y48B 3LG7A 4IDZA 2WUSR 5DQWA 2MEZA 3ZYLA 2YK0A 2XI8A 3ZN1B 4PNIA 5KDMC 3VK0A 3N2GE 2D5VA 2WMOA 4YJ2E 5JREA 1VOMA 2E8IA 2NWBA 3MKDA 4IWRA 2C5JA 3ZJ2A 1JH9A 3WAKA 2KZ7B 3U3IA 4EYUA 4IE7A 3J7Yq 1ZEEA 3IEEA 1WIZA 1YW0A 3CVRA 5JDHA 2CCQA 2D0TA 4H9QC 1QPZA 2ODUA 2CXDA 3QC9A 4TZ4C 4KUMB 2E9XD 2LYJA 3JXBC 3Q9DA 1QP0A 3RKOA 4H9SE 1HF0A 1ZZ6A 1BR4A 3CROL 4JCYA 1KNZA 3MK7C 3KINB 1LMB3 2BNOA 1X79A 1O4XA 3EDVA 3V5SA 4AKHA 4PFPA 2PFVA 1G8XA 2Q9QC 1D1AA 3N9NA 2PUCA 3KV9A 4L0RA 1U4QA 2CWOA 5HYAA 4PU8A 1PNRA 1HX8A 4H9NC 3OYXA 3RPUA 3ZJ1A 4NUVA 5A7LA 5HAXA 2H8RA 2LSGA 1FEWA 2LYSA 2L8NA 2LHNA 3ZPOA 3GN5B 3ZMUB 3ZLIA 4U72A 4PJMA 3SCHA 4FBIA 2CA5A 5EK2A 3ZMSB 4CI3B 3ZMTB 4HGAA 2CXFA 4XZCA 4EB6E 4ASKA 4AKRB 1EFAA 1POUA 5DJQC 3FYMA 3O1JA 2EBYA 3PURA 1CJGA 3ZCIA 2A2FX 4AI6A 3VKGA 2LYQA 1UX5A 4X1IE 2JRKA 4ISSA 4CXYA 3QF3A 3HR0A 3VKHA 3F31A 4TX5A 1AJ3A 1ZUGA 2VB6A 3RYFE 5TAOA 3OBVE 4UXNB 3ZC0A 4I6RA 1ZZ8A 3Q2MA 2KPJA 3L3PA 2WM9A 1FIOA 4GYRA 4DMVA 3CQXC 2YINA 5J2UE 1R69A 1FMWA 5HXEA 1ZAYA 1JWLA 2BNNA 2PUBA 5ETWA 4EYYR 2EHOB 3EUSA 3OQMA 3BK9A 2XAQB 1L1MA 4IE6A 5JDNA 2CROA 1WH8A 2VKOA 3RYHE 3N2KE 3WI3A 2ACXA 3HI2A 3N2OA 4OFZA 3QWGA 2H7VC 3CX7B 3PUQA 3JXCL 3EUHA 1Y9QA 3RZZA 2PUEA 2C5KT 2LCVA 1BDIA 4FI5A 2LOPA 5LG4A 3KVAA 5M4YA 3WAJA 2D2SA 4PU7A 2XUEA 4J1XA 3OJAA 3OP9A 3BD1A 2JQQA 4I6TA 1Z0PA 2W0GA 3CX6B 3AA1B 2X67A 4YG1A 3I0QA 4AXPA 3UFEA 3K3OA 5E0OA 5LYJE 4O8SA 5EK4A 3BQLA 3AVRA 3HA4A 4WBOA 3D0TA 4H9RC 4BA9A 2NW8A 3ZMZB 2W62A 3K8PC 5LJMA 4AKGA 2LT3A 5JR9C 1IC8A 3C50A 2XJ3A 5KX5E 2V26A 5LOVE 3CKDA 4X4CA 1E3OC 2C5IT 1LVFA 3DTOA 3RYCE 2CLYC 3KV5A 4CXWA 1UTXA 4ZOLE 3H37A 1CQTA 4I6UA 1YD8G 4O4IE 2HSGA 1X57A 2UXNB 3L1PA 3HKCE 5CA0E 3RC8A 5FY0A 1RZRA 3FB2A 2JMHA 3KFWX 4E7ZA 4MCTA 1QP4A 4GOUA 2XAFB 2XAGB 2EF8A 3SRZA 2WSSV 1MMNA 2VK9A 4QX7B 5K98B 1PRAA 4TUYE 5LBMA 2CSFA 3PUGA 3ETVA 3SCGA 2YEVC 4P0BA 1JFTA 4U74A 3CQGB 2YU1A 4H63V 4PK5A 5EK3A 2BVMA 2Q9QB 3G7DA 2GK9A 4PJNA 2IVBA 4UV9B 3V5UA 1YKEB 1ZHCA 1OWAA 1DWKA 3ZHIA 4G63A 1D0XA 4X1KE 2IUOA 3DP7A 5LGUB 4ZI7E 4GIWA 3PDYA 5L3GB 1R63A 2JVLA 1MIYA 3H3AA 5L3EB 3OKQA 4QXBB 2DNXA 4UF0A 2KT9A 2X9HA 3E08A 1MMGA 2KEKA 5FXZA 3ANWA 1S7EA 3C4ZA 4IE5A 3ZMVB 1ZS4A 1QQAA 5LHIB 3OMTA 2ZM8A 3FBZA 5LHGB 1SQ8A 2PPXA 3N9OA 4ZS3A 4OB4A 1LCCA 4GK0E 4KBMB 4I50E 2DLRA 3I9YA 5EZYE 1S94A 5JR9A 2JJ9A 2O49A 1V9DA 4QXCB 5JRCA 3MZKB 2X66A 3MA9A 5FXVA 3LK42 5FXWA 3RYIE 2QGSA 2IVQA 3UUXB 4TV8E 4F8DA 4DO0A 5LNKA 5JDMA 1VRBA 4Z5CA 2LSIA 4J1WA 4EOZB 2K9AA 4IIJE 4ZHQE 5JDFA 2LOSA 3FBLA 3FYAA 3LBXB 4QX8B 3RRCA 3UUNA 5IYZE 2AWIA 4BJNA 4IE0A 2PJQA 1UXCA 1Y7YA 4HFVA 3KBUA 3O4XE 4L9IA 1WYBA 4EAHA 3RRWA 4Z58A 2XTLA 2NOXA 1HCIA 1BR0A 2AXZA 2OFYA 2UXXB 4HEAA 4PAGA 5L2LA 2DI4A 4Z5HA 3JC6C 5JDQA 1WLXA 2A3DA 5DQVA 3Q5WA 1MMAA 1QUUA 2Q9QD 3AB3B 2NW7A 3FXEB 2LHRA 2MTQA 1O3XA 4WW0A 4UVCB 4AKLA 3HKEE 1ZV4X 4EZHA 2DWKA 2R63A 4GQMA 1E1HB 3EVYA 2HINA 2W63A 3BS3A 4AQGA 1BR1A 2B1EA 3FMYA 2L9QA 3O1IA 2PUGA 3I9WA 4IE4A 1U5PA 4Z5DA 1ZPQA 3J9X1 1QQBA 1UX4A 2X68A 1MMDA 4MBQA 3LJCA 3SWHA 4BAYB 5LXTE 2ZM0A 3B7HA 3DNVB 2AXUA 2CLYB 1HF8A 4H63H 3CWZB 1RZSA 2ICPA 5HXCA 4NDWA 1IJ5A 1OSLA 3NZQA 2PUAA 1IAPA 2NTXA 3SS1A 3D1NI 5HWXA 2X0LB 4JEHB 4O4HE 5F8PA 1OXZA 1HG2A 3KDSE 2DCFA 4NUUA 4ISTA 5BMVE 2PE5A 4X20E 3H5TA 2VL8A 3ONXA 4ZS2A 4DNDA 2O4AA 3DJBA 3S4UA 3F51A 2E9XA 5HXRA 2KINB 4EIWA 3C98B 3RH3A 3N9QA 2LYKA 4ADZA 4KMCA 2DWGA 3GWHA 1ZKEA 4HKAA 2L49A 4ILUA 4GYSA 2BNMA 4O2BE 2JMKA 4DBQA 2L3LA 2V1DB 2V7JA 4Z8XA 2BVLA 5KMGP 4X4IA 4IGUA 3BDNA 2FJRA 4BJMA 2KXPB 1MIVA 1MNEA 3U3WA 2IC9A 4KP3C 4MALA 4MHCA 1LVKA 4C91A 3O1HA 3FXDB 4ZI3D 1WH6A 2HH7A 4ZI2D 3TRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DW9 A;  3ZHI A;  1QP0 A;  1HF0 A;  1ZZ6 A;  2IUO A;  3CRO L;  3R1F A;  4JCY A;  4X4B A;  2AXV A;  1LMB 3;  2BNO A;  1R63 A;  1O4X A;  2JVL A;  3GA8 A;  1OCT C;  2AW6 A;  2IVG A;  2PUC A;  1PRU A;  1JFS A;  1VPW A;  2OR1 L;  4PU8 A;  2KEK A;  1PNR A;  1S7E A;  1LLI A;  3KXA A;  1ZS4 A;  4X4H A;  1QQA A;  3OMT A;  4Z59 A;  5A7L A;  2O38 A;  1ZZ9 A;  1SQ8 A;  2PPX A;  3KJX A;  1AU7 A;  2H8R A;  3JXD L;  4OB4 A;  1LCC A;  3CLC A;  2LYS A;  2L8N A;  3OQO A;  4JCX A;  3GN5 B;  4PU4 C;  3GBF A;  3SCH A;  4FBI A;  2BJC A;  2O49 A;  3F6W A;  4YG7 B;  1PER L;  1EFA A;  2LYP A;  1POU A;  3FYM A;  2EBY A;  2IVQ A;  1RPE L;  1CJG A;  2PUD A;  4F8D A;  2LYQ A;  1X2L A;  2LYR A;  3QF3 A;  4Z5C A;  4J1W A;  2WIU B;  4IA8 A;  3F52 A;  3FYA A;  4YBA A;  3PXP A;  3ZKC A;  1ZUG A;  1ZZ7 A;  3O9X A;  2AWI A;  4YAR A;  1UXC A;  1RIO A;  4I6R A;  1Y7Y A;  1ZZ8 A;  2GRL A;  2KPJ A;  4PU3 C;  3LIS A;  2GRM A;  1ZZB A;  4Z58 A;  1B0N A;  4I8T A;  2AXZ A;  2OFY A;  4IVZ A;  1R69 A;  4Z5H A;  3JXB C;  1ZZC A;  1ZAY A;  1JWL A;  2BNN A;  2PUB A;  3S8Q A;  3EUS A;  3OQM A;  1L1M A;  2CRO A;  1LQC A;  2IU7 A;  1WH8 A;  3GN5 A;  4MCX A;  2R63 A;  4GQM A;  3HI2 A;  1NER A;  2HIN A;  2MQK A;  3QWG A;  3BS3 A;  2JCG A;  2A6C A;  3JXC L;  3FMY A;  1Y9Q A;  3RZZ A;  2PUE A;  2PUG A;  2LCV A;  1BDI A;  3HZI B;  4Z5D A;  1ZPQ A;  2XIU A;  3SCF A;  4PU7 A;  1QQB A;  2GZU A;  4J1X A;  3QYX A;  3OP9 A;  4GHJ A;  3BD1 A;  4I6T A;  1NEQ A;  4YG1 A;  3B7H A;  3UFD A;  3DNV B;  2AXU A;  2PIJ A;  1WET A;  3OQN A;  1RZS A;  3CEC A;  2ICP A;  4Y42 A;  4FN3 A;  4NDW A;  1YSE A;  1OSL A;  2PUA A;  3D1N I;  2EWT A;  1IC8 A;  2ICT A;  1UXD A;  2XJ3 A;  1ZVV A;  2KZ8 A;  4YG4 A;  2LYJ A;  4X4C A;  1E3O C;  3MLF A;  3QQ6 A;  2XSD C;  4O8B A;  2IV1 A;  3H5T A;  2PE5 A;  1UTX A;  1BDH A;  4JQD A;  2O4A A;  3KZ3 A;  4I6U A;  1CQT A;  2R1J L;  2HSG A;  3IVP A;  1X57 A;  4X4G A;  1QP7 A;  3L1P A;  3ZHM A;  2AUW A;  3F51 A;  1PRV A;  2KEJ A;  1RZR A;  2WUS R;  2MEZ A;  1LCD A;  4MCT A;  2XI8 A;  4X4F A;  1ADR A;  1QP4 A;  2PUF A;  2LYK A;  3VK0 A;  2XCJ A;  2D5V A;  2EF8 A;  4X4D A;  2KEI A;  2L49 A;  5K98 B;  2LYL A;  1PRA A;  4IWR A;  1JH9 A;  2CSF A;  2BNM A;  2B5A A;  3SCG A;  1JFT A;  1GT0 C;  4X4E A;  1XWR A;  4X4I A;  3G5G A;  3LFP A;  3BDN A;  1WIZ A;  2FJR A;  1QPZ A;  3U3W A;  3G7D A;  2IVB A;  1RZR D;  1WH6 A;  1DWK A;  3TRB A; 
#chains in the Genus database with same CATH topology
 2X9X A;  4PK4 A;  5AQK B;  4X4B A;  4DV7 T;  4DMW A;  2UUA T;  1W9R A;  4OYK A;  2MOZ A;  2IVG A;  1HS7 A;  5GON E;  3T8O A;  5H6Q B;  5AFU L;  3IHR A;  2LJL A;  4HFI A;  1KF6 A;  2DHR A;  4YG7 B;  4I43 B;  2V7I A;  1PER L;  3F57 A;  4HRA A;  3W15 B;  3ZEF B;  3C51 A;  4HWD A;  3LFM A;  4A56 A;  3PUS A;  4HTE A;  4YBA A;  4YFS A;  2EHO C;  2WAU A;  3KBT A;  1ZZ7 A;  3O9X A;  5AQI B;  3B57 A;  4TN7 B;  4YAR A;  2RP4 A;  4CQI A;  1D1B A;  3LIS A;  2GRM A;  3NBX X;  4UVB B;  4DV1 T;  4UV8 B;  4WZX A;  3AE2 A;  3OTO T;  5ABE A;  4JI8 T;  2CBJ A;  3MXZ A;  3TKL B;  2FJA A;  4V1A v;  3UUM A;  2W2U A;  2JCG A;  2UUB T;  2F4V T;  3AXJ B;  2N9D A;  3AA7 B;  4PW8 A;  2GZU A;  4GHJ A;  2Y6X A;  2XAJ B;  2IW5 B;  1HQ1 A;  3BQI A;  4Y42 A;  2RA1 A;  1Y64 B;  2CWY A;  2PXP A;  3QB5 A;  2HCN A;  2ICT A;  2HHH T;  3QUJ A;  4JBW F;  2NW9 A;  5L3B B;  3TLU A;  1QSD A;  5JVD E;  2M4H A;  1CUN A;  2KND A;  5FXX A;  5IHY A;  4P0A A;  2XCJ A;  5JR9 B;  4X4D A;  2KEI A;  2B5A A;  2BG9 E;  3DM5 A;  3RIU C;  2J7U A;  3NRY A;  2YKS A;  4AIS A;  1XWR A;  4HWH A;  1G73 A;  1UUR A;  2VKH A;  1D0Z A;  1HTJ F;  4DR5 T;  4B3M T;  2J1D G;  1I94 T;  3GZD C;  4O2A E;  3SOL A;  5DTQ A;  4NPP A;  1OCT C;  1H7C A;  1KNR A;  1KEY A;  2XM2 A;  1AU7 A;  2QA7 A;  1HG5 A;  2XQA A;  5C8Y E;  1IJ6 A;  1B7T A;  5LP6 E;  4YSY A;  5FY7 A;  3TLW A;  4YTP A;  2Q9Q A;  2E2A A;  4JUY A;  2H88 A;  3LK2 B;  4LMJ A;  2WMN A;  5FMN A;  1IBL T;  2K3W A;  4I8T A;  2BDE A;  3M3Z B;  1NW3 A;  2X9W A;  2XQ9 A;  3AE4 A;  4DV0 T;  4O4J E;  1IBM T;  3TLV A;  3OYZ A;  2J4G A;  1QZX A;  1Z8U A;  4KI0 F;  1UCU A;  3ME5 A;  3U78 A;  3OVU A;  2CE7 A;  3AEB A;  3PUW F;  2MBG A;  2X51 A;  2VQE T;  3CIR A;  4IT4 A;  5HEG A;  3OQN A;  2WBL A;  3RX6 A;  2K48 A;  4OHF A;  2V7K A;  4NXN T;  2EHO D;  4ER7 A;  4U2Z A;  4ANJ A;  1FMV A;  5HCJ A;  1D1C A;  2R1J L;  4X4G A;  3PE5 A;  3KV4 A;  2KEJ A;  1IBK T;  5DQW A;  2MEZ A;  2XI8 A;  4PNI A;  4YJ2 E;  5JRE A;  2NWB A;  3RIA A;  4IWR A;  1JH9 A;  2KZ7 B;  2YDQ A;  5JUW A;  3J7Y q;  1ZEE A;  3CVR A;  5JDH A;  2A9U A;  2YDS A;  4ILA A;  3RKO A;  4DR7 T;  3CRO L;  4JCY A;  3KIN B;  2BNO A;  4U33 A;  4PFP A;  3L39 A;  2Q9Q C;  2PUC A;  5HYA A;  1XMQ T;  1UK5 A;  3NRO A;  1JNR A;  3VR8 A;  1J1J A;  1M62 A;  1M7K A;  2LSG A;  2LHN A;  2L8N A;  3ZMU B;  3B5M A;  4HGA A;  3RIF A;  4EB6 E;  1POU A;  3O1J A;  3AEE A;  1CJG A;  3ZCI A;  1UX5 A;  4JI5 T;  3PUY F;  2FJE A;  3P4W A;  2XQ4 A;  4GKK T;  1FIO A;  3CQX C;  2YIN A;  2BNN A;  2J47 A;  1R8I A;  4EYY R;  3EUS A;  4DV5 T;  2PXT A;  2VKO A;  3RYH E;  4JI6 T;  3N2O A;  2PUE A;  2C5K T;  2LCV A;  1BDI A;  4J1X A;  5C3J A;  3OP9 A;  3CX6 B;  1U2Z A;  1Z0P A;  3I0Q A;  3AA1 B;  3UFE A;  5E0O A;  5EK4 A;  3D0T A;  3VR9 A;  2NW8 A;  2W62 A;  2NR4 A;  4NIQ A;  5LOV E;  4DE8 A;  1E3O C;  3DTO A;  3H37 A;  1CQT A;  4I6U A;  2UXN B;  4YSZ A;  5FY0 A;  3SX0 A;  2JMH A;  3KFW X;  4E7Z A;  2WSS V;  5K98 B;  2D9D A;  3PV0 F;  3ETV A;  4EKI A;  4U74 A;  3QOX A;  5AQR B;  2BVM A;  2Q9Q B;  3DP7 A;  4GIW A;  4JV5 T;  5ABG A;  5L3E B;  3OKQ A;  2X9H A;  2KEK A;  5FXZ A;  4LFA T;  3C4Z A;  4IE5 A;  4IRE A;  3ZMV B;  4IL9 A;  1SQ8 A;  1XWM A;  4GK0 E;  3ABV A;  3H3M A;  3I9Y A;  1S94 A;  1V9D A;  5JRC A;  3MZK B;  3G06 A;  3MA9 A;  2L1P A;  4DO0 A;  1VRB A;  4Z5C A;  4EOZ B;  4IIJ E;  4QX8 B;  3RKG A;  2XY8 B;  4IE0 A;  1UXC A;  4HFV A;  1HCI A;  1I6Z A;  2AXZ A;  5L2L A;  4HEA A;  2DI4 A;  3TLT A;  3JC6 C;  4CN4 A;  3VRB A;  2Q9Q D;  5L47 A;  4U3C A;  4GQM A;  3I9W A;  1U5P A;  4Z5D A;  1QQB A;  3R09 A;  5C2T A;  2AXU A;  4H63 H;  2QVA A;  4NDW A;  2BS2 A;  3SS1 A;  2NTX A;  3D1N I;  4UR9 A;  5F8P A;  3EI0 A;  5BMV E;  2VL8 A;  4Q25 A;  2CPT A;  5HXR A;  3RH3 A;  2LYK A;  4LF9 T;  3UQ4 A;  1OED E;  3RQW A;  4ILU A;  2MAW A;  2L3L A;  2V1D B;  2V7J A;  4Z8X A;  5KMG P;  1XDP A;  2FJR A;  1MIV A;  3VWS A;  5HEO A;  3U3W A;  4MAL A;  5CGM A;  3FXD B;  4ZI3 D;  2HH7 A;  2XHE B;  3I0O A;  2LSY A;  3ZYK A;  2D0U A;  5GAG i;  4B3R T;  3UUB A;  4TWF A;  1LLI A;  3KXA A;  1LRZ A;  2XQ8 A;  2LYP A;  4E7S A;  3T1H T;  3RLF F;  3F52 A;  3ZKC A;  4IDO A;  2VEO A;  2VKJ A;  2N1G A;  2P9B A;  3LSV A;  3MAC A;  4DVD A;  4O4L E;  2C0S A;  4WVL A;  5FVK A;  2CEA A;  3NKZ A;  2XAH B;  2LEH A;  2J62 A;  3N5L A;  3HZI B;  4AQF C;  3ZST A;  2XIU A;  2WWV A;  3N9P A;  4AKI A;  1NEQ A;  3RQU A;  5FKY A;  1YSE A;  1YQ3 A;  2LM9 A;  2XQ7 A;  1US7 B;  5LA6 E;  2PG8 A;  3C4W A;  2EWT A;  2XQ6 A;  5ADX L;  3Q5X A;  4JI7 T;  4PFO A;  5LJN A;  1KK7 A;  1MFQ C;  3ZHM A;  3TFL A;  2EHO A;  3JC6 D;  1PRV A;  1J5W A;  4U31 A;  2N2N A;  3MEJ A;  3PUZ F;  3LQX A;  3FZM B;  5JRC B;  4YTM A;  4UVA B;  4EQZ A;  3IA3 A;  3FZK B;  3G5G A;  3LFP A;  3AAA B;  3AA6 B;  3LK3 B;  5HXS A;  1SUM B;  4HFC A;  2M67 A;  2X9Y A;  5DTR A;  2ZMA A;  2KWH A;  1KNP A;  5A1L A;  1D0Y A;  4X4H A;  2O38 A;  3ZN0 B;  1NEN A;  1WR6 A;  4OX9 T;  4CI2 B;  3P8C D;  2XAS B;  3UU3 A;  3F2E A;  5H6R B;  2LYR A;  3PXP A;  1JNZ A;  4QH4 A;  2BG9 C;  5LHH B;  4F6R C;  4DV2 T;  3C4X A;  1RIO A;  4LML A;  4ZI2 C;  1XMO T;  2FFH A;  3RIU A;  1ZZB A;  4EXT A;  2YN6 A;  3RC3 A;  4YJ3 E;  1LQC A;  4M1P A;  3UTK A;  4I4T E;  1NER A;  2K5B B;  2XXQ A;  3NRX A;  3GZD A;  2CBI A;  1VCT A;  3IF8 B;  4UEM A;  1WET A;  2PIJ A;  1N34 T;  4FN3 A;  4MLK A;  2PXQ A;  4CZZ B;  5DT2 A;  2WZI A;  5JDG A;  3RGL A;  4YY3 T;  2XSD C;  4H9O C;  1VPW A;  1QP7 A;  4HFB A;  2Y48 B;  3ZYL A;  5KDM C;  3N2G E;  1VOM A;  2E8I A;  3WAK A;  4EYU A;  3QFI A;  3RF1 A;  4EZI A;  1WIZ A;  2WZH A;  4H9Q C;  2ODU A;  3RI5 A;  2JQE A;  1QP0 A;  1BR4 A;  2LLW A;  4B3S T;  1KNZ A;  3AE8 A;  1X79 A;  2WU5 A;  4AKH A;  3N9N A;  3KV9 A;  2CWO A;  4PU8 A;  5AQQ B;  4H9N C;  3OYX A;  5HAX A;  4ILC A;  1FEW A;  2LYS A;  3ZPX A;  3OKZ A;  3AE5 A;  4U72 A;  3ZT7 A;  3SCH A;  4FBI A;  3AEA A;  2CXF A;  2V5D A;  2PXV A;  3PUR A;  2PXE A;  1YXR A;  2JRK A;  4ISS A;  4CXY A;  3F31 A;  2MPK A;  3NDB B;  1AJ3 A;  3OBV E;  4A5X A;  2WM9 A;  4DMV A;  1CHU A;  1R69 A;  1JWL A;  2PXF A;  5ETW A;  4DV4 T;  4HFH A;  5FVL A;  2EHO B;  2LKH A;  3OQM A;  5JDN A;  4I0U A;  3QWG A;  3CX7 B;  2JIW A;  3JXC L;  1Y9Q A;  3RZZ A;  1FJG T;  4FI5 A;  3WAJ A;  3KVA A;  2W0G A;  3JAE A;  4QH5 A;  3AVR A;  4JI3 T;  5LJM A;  3K8P C;  2LT3 A;  5KX5 E;  1N33 T;  1HNZ T;  2C5I T;  4ZI2 D;  4CXW A;  3RYC E;  1T7S A;  4ZOL E;  2YDR A;  2HSG A;  4O4I E;  1RZR A;  3FB2 A;  4MCT A;  2LM2 A;  2WDV A;  1QP4 A;  2EF8 A;  4IDQ A;  3SCG A;  3CQG B;  2DL1 A;  3NXH A;  2GK9 A;  4PJN A;  2J7W A;  1YKE B;  1ZHC A;  1OWA A;  1DWK A;  4G63 A;  1D0X A;  4IDN A;  3FZH B;  3PUX F;  3RHW A;  2JVL A;  2DNX A;  4UF0 A;  4CN1 A;  1MMG A;  3ANW A;  2XQ5 A;  1ZS4 A;  3OMT A;  3FBZ A;  2PPX A;  3N9O A;  2LLY A;  4ZS3 A;  4I50 E;  2DLR A;  2JJ9 A;  4QXC B;  3EHZ A;  2X66 A;  2IHR 1;  3RYI E;  2IVQ A;  4TV8 E;  5AQF B;  5JDM A;  2K9A A;  3KL4 A;  5IWA T;  2LOS A;  3JAD A;  5AQP B;  4BJN A;  3P4Q A;  5L4E A;  4HWI B;  3KBU A;  1WYB A;  4EAH A;  1E7P A;  5IUX A;  2NOX A;  2OFY A;  2UXX B;  5HEJ A;  4Z5H A;  2QRX A;  2A3D A;  1QUU A;  2LHR A;  2MTQ A;  4EZH A;  2DWK A;  3EVY A;  2W63 A;  2WP9 A;  3AEC A;  4X64 T;  2L9Q A;  3O1I A;  4LF8 T;  2WB5 A;  3UU5 A;  1MMD A;  4MBQ A;  5HEU A;  1HR0 T;  1HF8 A;  3CWZ B;  3NZQ A;  1IAP A;  2X0L B;  3AEG A;  4Z90 A;  3ONX A;  4DR6 T;  2PXB A;  3DJB A;  1J5E T;  3F51 A;  3AE7 A;  3N9Q A;  4HKA A;  2PTF A;  4K0K T;  2BNM A;  5DRY A;  2XSA A;  4X4I A;  4BJM A;  4ER3 A;  4C91 A;  3EAB A;  4DR1 T;  1WH6 A;  3TRB A;  3AAI A;  4C90 A;  3GA8 A;  5J1G A;  2AW6 A;  4X1Y E;  1JFS A;  1SA0 E;  4X66 T;  3R6N A;  1UGO A;  2R6G F;  3AVS A;  1HX1 B;  2WWU A;  1ZZ9 A;  4WNK A;  3CLC A;  4PU4 C;  2W66 A;  2FJB A;  3Q5E A;  2A72 A;  1SHZ C;  3OPC A;  2H3R A;  1X2L A;  3IBP A;  1OED C;  4IA8 A;  5ABH A;  4IDP A;  3UQ7 A;  2E5L T;  5LCY A;  3VU7 H;  2YU2 A;  4DR4 T;  2NTY A;  2WY2 A;  4IVZ A;  4XBF B;  1ZZC A;  2WS3 A;  4WBN E;  2M6B A;  2XXA A;  3VHL A;  4QWN B;  2A6C A;  4MFR A;  4UEL A;  2BZB A;  4HE8 A;  3QYX A;  5JQG E;  2VAS A;  5JDL A;  4P09 A;  4U7Y A;  4JEU B;  5L3C B;  1WFD A;  3CEC A;  4QXH B;  3MJX A;  4YG4 A;  4UF0 B;  2HFZ A;  2ZLY A;  1IZN B;  2IV1 A;  3ANW B;  4DV6 T;  3M9L A;  3FZF B;  2LSK A;  4X4F A;  3ETU A;  4DUZ T;  3UUL A;  2LYL A;  3K1S A;  2ES0 A;  3ZC1 A;  1GT0 C;  4X4E A;  3A8Y C;  3I1A A;  5DAB A;  2CHO A;  3ZCJ A;  5J0Z A;  1RZR D;  4EV6 A;  4HWC A;  5FNV E;  3L09 A;  1YKH B;  4G2A A;  2AXV A;  3N9M A;  5F3J A;  4AQF A;  3UT5 E;  3CPZ A;  5AQV B;  4YLH A;  2XZE A;  2OR1 L;  3HL6 A;  1QLB A;  2BS3 A;  1W0A A;  3KJX A;  2VL0 A;  3C64 A;  2FBW A;  2V7M A;  3P7I A;  4JCX A;  4FJO A;  5AQU B;  3GBF A;  2YBD A;  5LB7 B;  2BJC A;  3ZT6 A;  3E22 E;  3F6W A;  4P1N A;  2V7L A;  4B6X A;  3KVB A;  2PUD A;  5AQL B;  1ZP0 A;  2KWI B;  5HWY A;  4XAX B;  3UFG A;  2WIU B;  2H7O A;  2Y8D A;  4J2C A;  4IHJ E;  2GRL A;  2CM0 A;  4LF5 T;  4QH1 A;  3TLS A;  1GQE A;  3PU3 A;  3S8Q A;  4LMK A;  4YSX A;  4CXX A;  5AQH B;  4TWD A;  2CMR A;  2HPJ A;  2IAK A;  1MND A;  2W67 A;  3B13 A;  3UFD A;  4N78 D;  3LBX A;  1VCS A;  1LKX A;  3GMI A;  4H9P C;  4ERR A;  5BR8 T;  1T98 A;  2UU9 T;  3MLF A;  3QQ6 A;  1BDH A;  4JQD A;  5L3D B;  3QNU A;  1BR2 A;  3FHN A;  2BG9 A;  2WCA A;  4EED A;  2YK0 A;  3VK0 A;  2XJ7 A;  2WMO A;  3MKD A;  1HNX T;  2PXD A;  2CCQ A;  2D0T A;  3UWP A;  1QPZ A;  2CXD A;  3QC9 A;  2FJD A;  4TZ4 C;  5GAH i;  2LYJ A;  3Q9D A;  1ZZ6 A;  1WCR A;  3MK7 C;  3V5S A;  1G8X A;  1D1A A;  2AE9 A;  3JAF A;  4LFC T;  3RPU A;  4NUV A;  5A7L A;  3GUU A;  2H8R A;  3ZPO A;  3ZLI A;  2XXP A;  3ZMS B;  4LFB T;  3ZMT B;  5DJQ C;  3FYM A;  4DR2 T;  4AI6 A;  3VKG A;  2LYQ A;  4X1I E;  2VB6 A;  2WDR A;  3P4R A;  4UXN B;  3ZC0 A;  1ZZ8 A;  4IL4 A;  1KFY A;  4GYR A;  4DR3 T;  3SR4 A;  5J2U E;  1ZAY A;  2PUB A;  2H89 A;  4F8H A;  3QOW A;  2XAQ B;  4IE6 A;  1WH8 A;  2I0M A;  3N2K E;  3WI3 A;  3HI2 A;  4OFZ A;  3TEP A;  2V3C C;  2HN2 A;  4X65 T;  3T1Y T;  3PJA J;  2LOP A;  4PU7 A;  2XUE A;  3OJA A;  4YT0 A;  2JQQ A;  3PJA A;  5AQJ B;  4EGW A;  2V6Y A;  3K3O A;  5LYJ E;  4O8S A;  3BQL A;  4WBO A;  3TEL A;  4H9R C;  5LG3 A;  4BA9 A;  4AKG A;  4LF7 T;  5JR9 C;  1IC8 A;  4X4C A;  3KV5 A;  1UTX A;  3AE9 A;  1X57 A;  3HKC E;  3RC8 A;  2JQ9 A;  4GOU A;  4ZZB A;  2XAG B;  3SRZ A;  4Z91 A;  1MMN A;  4QX7 B;  1PRA A;  4TUY E;  2KSR A;  2YEV C;  4EEB A;  1JFT A;  4H63 V;  5CFB A;  4JI4 T;  2BS4 A;  2IVB A;  4UV9 B;  3ZHI A;  2PXK A;  5AQG B;  2IUO A;  5LGU B;  4DID B;  5L3G B;  4X62 T;  1R63 A;  4JI1 T;  3H3A A;  4QXB B;  2KT9 A;  5AQO B;  3E08 A;  5HEH A;  4ZXL A;  3PUV F;  5LMU T;  5LHI B;  3ONJ A;  5LHG B;  4ER6 A;  5EZY E;  2UXB T;  4HWF A;  2O49 A;  4JYA T;  3LK4 2;  2MXD A;  2QGS A;  3CK6 A;  5JDF A;  2X0H A;  3FBL A;  3LBX B;  4TNV A;  3UUN A;  2VUR A;  5IYZ E;  2AWI A;  1L0V A;  3RRW A;  4Z58 A;  2I6H A;  4PAG A;  2BBJ A;  1UUS A;  5JDQ A;  2CRB A;  1N32 T;  2BG9 B;  3FXE B;  1O3X A;  4X5T A;  4AKL A;  2BBH A;  2R63 A;  2XM1 A;  3JCF A;  1E1H B;  2HIN A;  4AQG A;  2PXL A;  2B1E A;  3FMY A;  4IE4 A;  3J9X 1;  3ZT5 A;  3LJC A;  3SWH A;  4BAY B;  3B7H A;  1XZY A;  5HXC A;  1OSL A;  2UUC T;  2PUA A;  2IDO B;  4A97 A;  5HWX A;  4JEH B;  4JI2 T;  4LF4 T;  5ABF A;  4NXM T;  4X20 E;  3H5T A;  4ZS2 A;  5AQN B;  3S4U A;  2E9X A;  4EIW A;  4ADZ A;  4KMC A;  2DWG A;  3GWH A;  1ZKE A;  4DV3 T;  5KXJ A;  4GYS A;  2LNM A;  4O2B E;  2CHN A;  4DBQ A;  3AED A;  2KXP B;  3Q5D A;  1MNE A;  2IC9 A;  4KP3 C;  4MHC A;  3O1H A;  3AE3 A;  1DUL A;  5CA1 E;  3L8R A;  5FYM A;  5JH7 E;  5LGN B;  2VQF T;  2AXD S;  3AEF A;  5JTG A;  1WRD A;  4K0U A;  5L3F B;  2K24 A;  1PRU A;  5HXH A;  4Z59 A;  2W4X A;  5HCM A;  1Y01 A;  2OA5 A;  3OQO A;  4CI1 B;  1NWM X;  1N36 T;  3CML A;  2PBI A;  2JPF A;  3PUA A;  3AE6 A;  1RPE L;  5LGT B;  3EAM A;  4I55 E;  3P4S A;  2D5U A;  3BQK A;  3HKD E;  2V6Y B;  2HPL A;  4UIG A;  2HCS A;  2OLT A;  3ZSS A;  4PU3 C;  2I59 A;  2LE8 A;  4ILB A;  2W00 A;  2V5C A;  3A5X A;  3GN5 A;  4MCX A;  5LBQ B;  2JQK A;  3K3N A;  1QB2 A;  2HN1 A;  2E9X C;  2ZM2 A;  3ESL A;  4ZEY A;  2VVS A;  3E0Z A;  4ZZC A;  1UXD A;  2KZ8 A;  5DRT A;  2KLQ A;  3KV6 A;  1OED A;  4JLE A;  3KZ3 A;  4QKN A;  3IVP A;  3OWQ A;  3ZYM A;  4EZ4 A;  4PJJ A;  4KX6 A;  5AQM B;  3SFD A;  1ADR A;  1LCD A;  3QB5 K;  2PUF A;  2KMF A;  4QHO A;  3AAE B;  2W61 A;  3PU8 A;  3N9L A;  3EDU A;  2G0U A;  3A9Z A;  4HFD A;  1XDO A;  2SPC A;  2NP9 A;  1DW9 A;  4GK5 E;  2XQY A;  3R1F A;  1S35 A;  1W0B A;  2CXL A;  3R84 B;  5J2T E;  3JXD L;  1NEK A;  2IC6 A;  3CQC B;  4PJL A;  4GKJ T;  2VVN A;  3HKB E;  3PTR B;  4U7I A;  1WYC A;  4AIU A;  3PE0 A;  1HFA A;  4L5G A;  5CB4 E;  3NZP A;  3CX8 B;  1NAF A;  4Q2J A;  2L8K A;  4ZI3 C;  3UU6 A;  2B76 A;  1XNQ T;  4TV9 E;  4EKG A;  2ODV A;  2JQH A;  4OK0 A;  1B0N A;  1EZ3 A;  2LSJ A;  3GZC A;  5ABF B;  1MIW A;  2X0Y A;  2MYS A;  3AA0 B;  2E9X B;  5FY1 A;  5FP3 A;  2IU7 A;  2VKD A;  2MQK A;  4YHJ A;  4WYV A;  4OYJ A;  3QK6 A;  3SCF A;  5FL0 A;  5L4H A;  5AQS B;  2Z6E A;  2M6I A;  4DBR A;  3M65 A;  2IUB A;  2ZM6 T;  1ZVV A;  2VWA A;  4PK6 A;  4YHH T;  4O8B A;  4U2Y A;  4HN9 A;  3K3Q C;  2AUW A;  3LG7 A;  1YQ4 A;  2IML A;  4IDZ A;  2WUS R;  3ZN1 B;  2ACZ A;  2D5V A;  2IIU A;  2C5J A;  3ZJ2 A;  2XQ3 A;  3U3I A;  4IE7 A;  3G0T A;  2OV9 A;  3IEE A;  1YW0 A;  1ZOY A;  4KUM B;  2E9X D;  3JXB C;  4H9S E;  1HF0 A;  3NZL A;  3X1D A;  2WU2 A;  3UU4 A;  1LMB 3;  1O4X A;  3EDV A;  4TWH A;  2PFV A;  4L0R A;  1U4Q A;  4KHZ F;  1PNR A;  1HX8 A;  3ZJ1 A;  2LRL A;  4HFE A;  2FUP A;  1DU2 A;  3GN5 B;  1T8B A;  4PJM A;  2CA5 A;  1XNR T;  5EK2 A;  4CI3 B;  5LMN T;  4XZC A;  2WQY A;  4ASK A;  4AKR B;  1EFA A;  2EBY A;  2A2F X;  3QF3 A;  3HR0 A;  3VKH A;  4TX5 A;  1ZUG A;  4ER0 A;  5TAO A;  3RYF E;  2UXC T;  3A9X A;  4I6R A;  3Q2M A;  2KPJ A;  2PXU A;  3L3P A;  4DUY T;  1FMW A;  5HXE A;  1OED B;  3NVO A;  4COF A;  4AQY T;  3SFE A;  3BK9 A;  4B3T T;  1L1M A;  2CRO A;  1X9B A;  2ACX A;  1E2A A;  2BKN A;  2H7V C;  3PUQ A;  3EUH A;  4YXD A;  2V6X A;  5LG4 A;  1WR0 A;  5M4Y A;  3QOF A;  2D2S A;  3BD1 A;  4I6T A;  2X67 A;  4YG1 A;  4AXP A;  3A7M A;  4KHP T;  3HA4 A;  4YTN A;  3ZMZ B;  3C50 A;  2XJ3 A;  2V26 A;  3CKD A;  1LVF A;  2CLY C;  1YD8 G;  3L1P A;  3P50 A;  5CA0 E;  2LKG A;  4A98 A;  2XAF B;  4ER5 A;  5FL1 A;  2UXD T;  2VK9 A;  3NWI A;  5LBM A;  2CSF A;  3PUG A;  4P0B A;  3AXJ A;  3VRA A;  2YU1 A;  5DTM A;  4PK5 A;  5EK3 A;  3G7D A;  3V5U A;  2YOE A;  4X1K E;  4ZI7 E;  4LF6 T;  3PDY A;  4TNW A;  1MIY A;  2BKP A;  2E5V A;  1S7E A;  1QQA A;  2ZM8 A;  4OB4 A;  1LCC A;  4KBM B;  3FZL B;  5JR9 A;  4OBM A;  5FXV A;  4DE9 A;  5FXW A;  3UUX B;  4F8D A;  5LNK A;  2LSI A;  4J1W A;  1T72 A;  4ZHQ E;  3ONL C;  3UU8 A;  3RRC A;  3FYA A;  1W09 A;  4EK9 A;  2PJQ A;  1Y7Y A;  3O4X E;  4L9I A;  2XTL A;  1BR0 A;  1WLX A;  5DQV A;  3Q5W A;  1MMA A;  2LRK A;  3AB3 B;  2NW7 A;  4WW0 A;  4UVC B;  3HKE E;  1ZV4 X;  3BS3 A;  1BR1 A;  2ODR D;  2XPK A;  2QYW A;  2PUG A;  1ZPQ A;  1UX4 A;  2X68 A;  5LXT E;  2ZM0 A;  3DNV B;  2CLY B;  1RZS A;  2ICP A;  1IJ5 A;  4JI0 T;  3ZKR A;  1HNW T;  4O4H E;  1OXZ A;  1HG2 A;  3KDS E;  2DCF A;  4NUU A;  4IST A;  3A9Y A;  3LDQ B;  4CN6 A;  2PE5 A;  2XSB A;  4DND A;  2O4A A;  2RPA A;  5F5W A;  2KIN B;  2WDQ A;  3C98 B;  2V8S V;  2LLV A;  3AE1 A;  3P4P A;  2L49 A;  5CJ5 A;  1SE7 A;  2JMK A;  2BVL A;  4IGU A;  3BDN A;  2BKO A;  5DSX A;  5AQT B;  1LVK A; 
#chains in the Genus database with same CATH homology
 2XHE B;  3I0O A;  5CA1 E;  2LSY A;  2X9X A;  3AAI A;  5FYM A;  4PK4 A;  5JH7 E;  3ZYK A;  5LGN B;  4X4B A;  4DMW A;  2D0U A;  4C90 A;  3GA8 A;  1WRD A;  4K0U A;  4OYK A;  2MOZ A;  5J1G A;  5L3F B;  2AW6 A;  2K24 A;  2IVG A;  4X1Y E;  1PRU A;  1JFS A;  1SA0 E;  3R6N A;  1HS7 A;  5HXH A;  5GON E;  1LLI A;  3KXA A;  3T8O A;  5H6Q B;  5AFU L;  1LRZ A;  4Z59 A;  2WWU A;  3AVS A;  3IHR A;  2LJL A;  1ZZ9 A;  4WNK A;  3CLC A;  2OA5 A;  3OQO A;  4PU4 C;  4CI1 B;  1NWM X;  3CML A;  2DHR A;  4YG7 B;  2PBI A;  2V7I A;  4I43 B;  1PER L;  3F57 A;  2JPF A;  3ZEF B;  2A72 A;  1SHZ C;  2LYP A;  3PUA A;  3W15 B;  3C51 A;  1RPE L;  5LGT B;  4E7S A;  3LFM A;  2H3R A;  4I55 E;  4A56 A;  3PUS A;  1X2L A;  2D5U A;  4HTE A;  3IBP A;  3BQK A;  3HKD E;  4IA8 A;  3F52 A;  4YBA A;  3ZKC A;  4YFS A;  2EHO C;  2WAU A;  2HPL A;  3KBT A;  4UIG A;  1ZZ7 A;  3O9X A;  3B57 A;  4TN7 B;  4YAR A;  2VKJ A;  2RP4 A;  5LCY A;  4CQI A;  3VU7 H;  2YU2 A;  1D1B A;  4PU3 C;  3LIS A;  2GRM A;  2I59 A;  3NBX X;  2NTY A;  4UVB B;  4UV8 B;  2LE8 A;  2W00 A;  4IVZ A;  4XBF B;  1ZZC A;  2N1G A;  2P9B A;  3A5X A;  3MAC A;  4DVD A;  4O4L E;  4WBN E;  3VHL A;  2C0S A;  2CEA A;  3MXZ A;  3TKL B;  4V1A v;  3GN5 A;  4QWN B;  4MCX A;  3UUM A;  5LBQ B;  2JCG A;  2A6C A;  2XAH B;  4MFR A;  2LEH A;  2N9D A;  3K3N A;  3HZI B;  3AA7 B;  3N5L A;  2BZB A;  4HE8 A;  4UEL A;  4AQF C;  2XIU A;  4PW8 A;  2GZU A;  3QYX A;  2E9X C;  2ZM2 A;  4GHJ A;  3N9P A;  2Y6X A;  5JQG E;  2VAS A;  5JDL A;  4AKI A;  1NEQ A;  4P09 A;  4JEU B;  3ESL A;  5L3C B;  2XAJ B;  2IW5 B;  3BQI A;  3CEC A;  4Y42 A;  3E0Z A;  2RA1 A;  1Y64 B;  4QXH B;  1YSE A;  2CWY A;  2LM9 A;  1US7 B;  5LA6 E;  2PG8 A;  3C4W A;  2EWT A;  2ICT A;  1UXD A;  3MJX A;  2KZ8 A;  4YG4 A;  2KLQ A;  4UF0 B;  3KV6 A;  5ADX L;  2ZLY A;  1IZN B;  2IV1 A;  3ANW B;  3Q5X A;  3QUJ A;  4JLE A;  4PFO A;  2NW9 A;  5L3B B;  3KZ3 A;  4QKN A;  1KK7 A;  1QSD A;  5JVD E;  3IVP A;  5LJN A;  3ZYM A;  3ZHM A;  2EHO A;  4EZ4 A;  3JC6 D;  1PRV A;  4PJJ A;  1CUN A;  2KND A;  1ADR A;  1LCD A;  2LSK A;  4X4F A;  2N2N A;  3ETU A;  2PUF A;  5FXX A;  5IHY A;  4P0A A;  2XCJ A;  2KMF A;  4QHO A;  3AAE B;  5JR9 B;  3UUL A;  4X4D A;  2W61 A;  5JRC B;  2KEI A;  4UVA B;  2LYL A;  3PU8 A;  3N9L A;  2B5A A;  2ES0 A;  3ZC1 A;  3NRY A;  3EDU A;  1GT0 C;  4X4E A;  1XWR A;  2G0U A;  3G5G A;  3LFP A;  3AAA B;  3AA6 B;  3I1A A;  5DAB A;  3ZCJ A;  3LK3 B;  2SPC A;  5HXS A;  1G73 A;  1RZR D;  5FNV E;  2NP9 A;  1DW9 A;  2VKH A;  4GK5 E;  2XQY A;  3L09 A;  3R1F A;  1S35 A;  1YKH B;  1D0Z A;  2M67 A;  1HTJ F;  2AXV A;  3N9M A;  2J1D G;  4G2A A;  5F3J A;  4AQF A;  3SOL A;  4O2A E;  2X9Y A;  3UT5 E;  3CPZ A;  2CXL A;  4YLH A;  1OCT C;  2ZMA A;  2KWH A;  1H7C A;  2OR1 L;  3R84 B;  5J2T E;  3HL6 A;  5A1L A;  1D0Y A;  4X4H A;  2O38 A;  3KJX A;  3P7I A;  3C64 A;  1AU7 A;  2V7M A;  3JXD L;  4JCX A;  4FJO A;  2IC6 A;  3ZN0 B;  3CQC B;  4PJL A;  1WR6 A;  3GBF A;  3HKB E;  2BJC A;  2QA7 A;  3E22 E;  3PTR B;  3F6W A;  4CI2 B;  3P8C D;  2V7L A;  2XAS B;  1HG5 A;  1WYC A;  4B6X A;  5C8Y E;  3PE0 A;  1IJ6 A;  1B7T A;  1HFA A;  3F2E A;  3KVB A;  5H6R B;  2PUD A;  5LP6 E;  5FY7 A;  2KWI B;  4L5G A;  2LYR A;  5CB4 E;  3NZP A;  4XAX B;  5HWY A;  2WIU B;  2Q9Q A;  2H7O A;  2Y8D A;  3CX8 B;  1NAF A;  3PXP A;  5LHH B;  4J2C A;  4JUY A;  2L8K A;  3LK2 B;  4IHJ E;  4ZI3 C;  4F6R C;  3C4X A;  2WMN A;  4TV9 E;  1RIO A;  2GRL A;  2CM0 A;  5FMN A;  4ZI2 C;  2ODV A;  1ZZB A;  4OK0 A;  1B0N A;  4I8T A;  1EZ3 A;  2LSJ A;  2BDE A;  4EXT A;  3PU3 A;  1MIW A;  2X9W A;  4O4J E;  3S8Q A;  2MYS A;  3OYZ A;  3AA0 B;  4CXX A;  2E9X B;  3RC3 A;  5FY1 A;  4YJ3 E;  5FP3 A;  1LQC A;  2IU7 A;  2VKD A;  4M1P A;  4I4T E;  3UTK A;  1NER A;  2K5B B;  2MQK A;  3NRX A;  1UCU A;  4YHJ A;  3U78 A;  2CE7 A;  4OYJ A;  3IF8 B;  2CMR A;  3QK6 A;  3SCF A;  4UEM A;  2HPJ A;  2IAK A;  2MBG A;  1MND A;  2X51 A;  3B13 A;  3UFD A;  4N78 D;  1WET A;  2PIJ A;  3LBX A;  3OQN A;  2Z6E A;  2WBL A;  4FN3 A;  3RX6 A;  2K48 A;  1LKX A;  4MLK A;  3GMI A;  4OHF A;  4H9P C;  2V7K A;  4CZZ B;  4DBR A;  4ERR A;  2EHO D;  3M65 A;  4ANJ A;  1T98 A;  5JDG A;  1ZVV A;  1FMV A;  2VWA A;  4PK6 A;  3MLF A;  3QQ6 A;  2XSD C;  4O8B A;  1BDH A;  1D1C A;  4JQD A;  4H9O C;  5L3D B;  1BR2 A;  1VPW A;  4HN9 A;  2R1J L;  4X4G A;  3K3Q C;  1QP7 A;  3FHN A;  3KV4 A;  2AUW A;  2KEJ A;  2Y48 B;  3LG7 A;  4IDZ A;  2WUS R;  5DQW A;  2MEZ A;  3ZYL A;  2YK0 A;  2XI8 A;  3ZN1 B;  4PNI A;  5KDM C;  3VK0 A;  3N2G E;  2D5V A;  2WMO A;  4YJ2 E;  5JRE A;  1VOM A;  2E8I A;  2NWB A;  3MKD A;  4IWR A;  2C5J A;  3ZJ2 A;  1JH9 A;  3WAK A;  2KZ7 B;  3U3I A;  4EYU A;  4IE7 A;  3J7Y q;  1ZEE A;  3IEE A;  1WIZ A;  1YW0 A;  3CVR A;  5JDH A;  2CCQ A;  2D0T A;  4H9Q C;  1QPZ A;  2ODU A;  2CXD A;  3QC9 A;  4TZ4 C;  4KUM B;  2E9X D;  2LYJ A;  3JXB C;  3Q9D A;  1QP0 A;  3RKO A;  4H9S E;  1HF0 A;  1ZZ6 A;  1BR4 A;  3CRO L;  4JCY A;  1KNZ A;  3MK7 C;  3KIN B;  1LMB 3;  2BNO A;  1X79 A;  1O4X A;  3EDV A;  3V5S A;  4AKH A;  4PFP A;  2PFV A;  1G8X A;  2Q9Q C;  1D1A A;  3N9N A;  2PUC A;  3KV9 A;  4L0R A;  1U4Q A;  2CWO A;  5HYA A;  4PU8 A;  1PNR A;  1HX8 A;  4H9N C;  3OYX A;  3RPU A;  3ZJ1 A;  4NUV A;  5A7L A;  5HAX A;  2H8R A;  2LSG A;  1FEW A;  2LYS A;  2L8N A;  2LHN A;  3ZPO A;  3GN5 B;  3ZMU B;  3ZLI A;  4U72 A;  4PJM A;  3SCH A;  4FBI A;  2CA5 A;  5EK2 A;  3ZMS B;  4CI3 B;  3ZMT B;  4HGA A;  2CXF A;  4XZC A;  4EB6 E;  4ASK A;  4AKR B;  1EFA A;  1POU A;  5DJQ C;  3FYM A;  3O1J A;  2EBY A;  3PUR A;  1CJG A;  3ZCI A;  2A2F X;  4AI6 A;  3VKG A;  2LYQ A;  1UX5 A;  4X1I E;  2JRK A;  4ISS A;  4CXY A;  3QF3 A;  3HR0 A;  3VKH A;  3F31 A;  4TX5 A;  1AJ3 A;  1ZUG A;  2VB6 A;  3RYF E;  5TAO A;  3OBV E;  4UXN B;  3ZC0 A;  4I6R A;  1ZZ8 A;  3Q2M A;  2KPJ A;  3L3P A;  2WM9 A;  1FIO A;  4GYR A;  4DMV A;  3CQX C;  2YIN A;  5J2U E;  1R69 A;  1FMW A;  5HXE A;  1ZAY A;  1JWL A;  2BNN A;  2PUB A;  5ETW A;  4EYY R;  2EHO B;  3EUS A;  3OQM A;  3BK9 A;  2XAQ B;  1L1M A;  4IE6 A;  5JDN A;  2CRO A;  1WH8 A;  2VKO A;  3RYH E;  3N2K E;  3WI3 A;  2ACX A;  3HI2 A;  3N2O A;  4OFZ A;  3QWG A;  2H7V C;  3CX7 B;  3PUQ A;  3JXC L;  3EUH A;  1Y9Q A;  3RZZ A;  2PUE A;  2C5K T;  2LCV A;  1BDI A;  4FI5 A;  2LOP A;  5LG4 A;  3KVA A;  5M4Y A;  3WAJ A;  2D2S A;  4PU7 A;  2XUE A;  4J1X A;  3OJA A;  3OP9 A;  3BD1 A;  2JQQ A;  4I6T A;  1Z0P A;  2W0G A;  3CX6 B;  3AA1 B;  2X67 A;  4YG1 A;  3I0Q A;  4AXP A;  3UFE A;  3K3O A;  5E0O A;  5LYJ E;  4O8S A;  5EK4 A;  3BQL A;  3AVR A;  3HA4 A;  4WBO A;  3D0T A;  4H9R C;  4BA9 A;  2NW8 A;  3ZMZ B;  2W62 A;  3K8P C;  5LJM A;  4AKG A;  2LT3 A;  5JR9 C;  1IC8 A;  3C50 A;  2XJ3 A;  5KX5 E;  2V26 A;  5LOV E;  3CKD A;  4X4C A;  1E3O C;  2C5I T;  1LVF A;  3DTO A;  3RYC E;  2CLY C;  3KV5 A;  4CXW A;  1UTX A;  4ZOL E;  3H37 A;  1CQT A;  4I6U A;  1YD8 G;  4O4I E;  2HSG A;  1X57 A;  2UXN B;  3L1P A;  3HKC E;  5CA0 E;  3RC8 A;  5FY0 A;  1RZR A;  3FB2 A;  2JMH A;  3KFW X;  4E7Z A;  4MCT A;  1QP4 A;  4GOU A;  2XAF B;  2XAG B;  2EF8 A;  3SRZ A;  2WSS V;  1MMN A;  2VK9 A;  4QX7 B;  5K98 B;  1PRA A;  4TUY E;  5LBM A;  2CSF A;  3PUG A;  3ETV A;  3SCG A;  2YEV C;  4P0B A;  1JFT A;  4U74 A;  3CQG B;  2YU1 A;  4H63 V;  4PK5 A;  5EK3 A;  2BVM A;  2Q9Q B;  3G7D A;  2GK9 A;  4PJN A;  2IVB A;  4UV9 B;  3V5U A;  1YKE B;  1ZHC A;  1OWA A;  1DWK A;  3ZHI A;  4G63 A;  1D0X A;  4X1K E;  2IUO A;  3DP7 A;  5LGU B;  4ZI7 E;  4GIW A;  3PDY A;  5L3G B;  1R63 A;  2JVL A;  1MIY A;  3H3A A;  5L3E B;  3OKQ A;  4QXB B;  2DNX A;  4UF0 A;  2KT9 A;  2X9H A;  3E08 A;  1MMG A;  2KEK A;  5FXZ A;  3ANW A;  1S7E A;  3C4Z A;  4IE5 A;  3ZMV B;  1ZS4 A;  1QQA A;  5LHI B;  3OMT A;  2ZM8 A;  3FBZ A;  5LHG B;  1SQ8 A;  2PPX A;  3N9O A;  4ZS3 A;  4OB4 A;  1LCC A;  4GK0 E;  4KBM B;  4I50 E;  2DLR A;  3I9Y A;  5EZY E;  1S94 A;  5JR9 A;  2JJ9 A;  2O49 A;  1V9D A;  4QXC B;  5JRC A;  3MZK B;  2X66 A;  3MA9 A;  5FXV A;  3LK4 2;  5FXW A;  3RYI E;  2QGS A;  2IVQ A;  3UUX B;  4TV8 E;  4F8D A;  4DO0 A;  5LNK A;  5JDM A;  1VRB A;  4Z5C A;  2LSI A;  4J1W A;  4EOZ B;  2K9A A;  4IIJ E;  4ZHQ E;  5JDF A;  2LOS A;  3FBL A;  3FYA A;  3LBX B;  4QX8 B;  3RRC A;  3UUN A;  5IYZ E;  2AWI A;  4BJN A;  4IE0 A;  2PJQ A;  1UXC A;  1Y7Y A;  4HFV A;  3KBU A;  3O4X E;  4L9I A;  1WYB A;  4EAH A;  3RRW A;  4Z58 A;  2XTL A;  2NOX A;  1HCI A;  1BR0 A;  2AXZ A;  2OFY A;  2UXX B;  4HEA A;  4PAG A;  5L2L A;  2DI4 A;  4Z5H A;  3JC6 C;  5JDQ A;  1WLX A;  2A3D A;  5DQV A;  3Q5W A;  1MMA A;  1QUU A;  2Q9Q D;  3AB3 B;  2NW7 A;  3FXE B;  2LHR A;  2MTQ A;  1O3X A;  4WW0 A;  4UVC B;  4AKL A;  3HKE E;  1ZV4 X;  4EZH A;  2DWK A;  2R63 A;  4GQM A;  1E1H B;  3EVY A;  2HIN A;  2W63 A;  3BS3 A;  4AQG A;  1BR1 A;  2B1E A;  3FMY A;  2L9Q A;  3O1I A;  2PUG A;  3I9W A;  4IE4 A;  1U5P A;  4Z5D A;  1ZPQ A;  3J9X 1;  1QQB A;  1UX4 A;  2X68 A;  1MMD A;  4MBQ A;  3LJC A;  3SWH A;  4BAY B;  5LXT E;  2ZM0 A;  3B7H A;  3DNV B;  2AXU A;  2CLY B;  1HF8 A;  4H63 H;  3CWZ B;  1RZS A;  2ICP A;  5HXC A;  4NDW A;  1IJ5 A;  1OSL A;  3NZQ A;  2PUA A;  1IAP A;  2NTX A;  3SS1 A;  3D1N I;  5HWX A;  2X0L B;  4JEH B;  4O4H E;  5F8P A;  1OXZ A;  1HG2 A;  3KDS E;  2DCF A;  4NUU A;  4IST A;  5BMV E;  2PE5 A;  4X20 E;  3H5T A;  2VL8 A;  3ONX A;  4ZS2 A;  4DND A;  2O4A A;  3DJB A;  3S4U A;  3F51 A;  2E9X A;  5HXR A;  2KIN B;  4EIW A;  3C98 B;  3RH3 A;  3N9Q A;  2LYK A;  4ADZ A;  4KMC A;  2DWG A;  3GWH A;  1ZKE A;  4HKA A;  2L49 A;  4ILU A;  4GYS A;  2BNM A;  4O2B E;  2JMK A;  4DBQ A;  2L3L A;  2V1D B;  2V7J A;  4Z8X A;  2BVL A;  5KMG P;  4X4I A;  4IGU A;  3BDN A;  2FJR A;  4BJM A;  2KXP B;  1MIV A;  1MNE A;  3U3W A;  2IC9 A;  4KP3 C;  4MAL A;  4MHC A;  1LVK A;  4C91 A;  3O1H A;  3FXD B;  4ZI3 D;  1WH6 A;  2HH7 A;  4ZI2 D;  3TRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...