1POUA

The solution structure of the oct-1 pou-specific domain reveals a striking similarity to the bacteriophage lambda repressor dna-binding domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
71
structure length
71
Chain Sequence
DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords OCT-1
publication title The solution structure of the Oct-1 POU-specific domain reveals a striking similarity to the bacteriophage lambda repressor DNA-binding domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1993-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1pouA00
2PPXA 3GN5A 3FYAA 1ZPQA 4Z5DA 4Y42A 1GT0C 3JXDL 4MCTA 2OR1L 2LYLA 2IU7A 3QQ6A 2LYPA 1WH6A 3QF3A 3R1FA 2XSDC 4IWRA 1NEQA 1PNRA 3JXCL 1R63A 2AW6A 2IVGA 1ZZBA 4FN3A 2PUDA 2KZ8A 1QPZA 1POUA 2CROA 2JVLA 4Z59A 2PE5A 2BJCA 1PERL 1ZZ9A 3KJXA 1Y7YA 1PRAA 3IVPA 3OQMA 3ZKCA 3EUSA 4O8BA 2PUCA 3F52A 2ICTA 1QP0A 3MLFA 2GRLA 3ZHIA 1JFSA 2ICPA 2MQKA 1OSLA 1LQCA 1LLIA 2R1JL 2AUWA 2KEIA 2XIUA 1ZZ8A 1QQBA 1RZRD 2BNNA 3KXAA 1WIZA 4GQMA 1CJGA 1RPEL 1ZAYA 1B0NA 2BNMA 1DWKA 3F51A 4I6TA 4YG7B 4X4HA 4J1XA 1X2LA 2PIJA 3PXPA 1WETA 2AXUA 2B5AA 3S8QA 1PRVA 1JFTA 1R69A 2L49A 2EF8A 2IUOA 4Z5CA 3GN5B 1AU7A 2LYQA 1DW9A 2KEKA 2AWIA 2WUSR 2EBYA 2WIUB 1ZVVA 2KEJA 5A7LA 4NDWA 4OB4A 1LMB3 1QP4A 2AXZA 1OCTC 4PU8A 2LYJA 3BDNA 2KPJA 1IC8A 1NERA 1RZRA 2GZUA 2HINA 3B7HA 4PU7A 4IVZA 4X4DA 3VK0A 1QP7A 2EWTA 2A6CA 2IVBA 3CECA 3KZ3A 3OP9A 4X4CA 2XJ3A 1HF0A 1LCCA 3CLCA 3ZHMA 2CSFA 3OMTA 3GBFA 1ZZCA 3QWGA 3RZZA 2H8RA 2O49A 4F8DA 1L1MA 3CROL 3F6WA 1ZS4A 4I6RA 4YG4A 1JH9A 4JCYA 2FJRA 3L1PA 4X4GA 3UFDA 1WH8A 3D1NI 1CQTA 1JWLA 1YSEA 2LCVA 2OFYA 3BD1A 4MCXA 2GRMA 2O38A 1BDHA 3SCGA 1XWRA 2R63A 3U3WA 1QQAA 3H5TA 1UXDA 3G5GA 1X57A 2JCGA 1ADRA 1Y9QA 1VPWA 3DNVB 2D5VA 3SCHA 2XI8A 1RIOA 4PU4C 1ZZ7A 4JCXA 3FMYA 4JQDA 3FYMA 1LCDA 5K98B 4YG1A 4FBIA 3O9XA 3TRBA 4PU3C 1PRUA 3QYXA 3LISA 2PUEA 2O4AA 1RZSA 1EFAA 2LYSA 3JXBC 1ZZ6A 2LYKA 1O4XA 2LYRA 2AXVA 3HZIB 4IA8A 2MEZA 4YBAA 2PUFA 4GHJA 2IV1A 4YARA 1S7EA 1E3OC 2PUGA 1SQ8A 3OQOA 3BS3A 3OQNA 4I8TA 1UTXA 2PUAA 4X4IA 4J1WA 4I6UA 4X4EA 2PUBA 1BDIA 2L8NA 4Z58A 2IVQA 2BNOA 3G7DA 3SCFA 4Z5HA 2HSGA 2XCJA 4X4BA 1ZUGA 4X4FA 1UXCA 3LFPA
chains in the Genus database with same CATH superfamily
3GN5A 3A9YA 1ZPQA 1GT0C 3JXDL 4MCTA 1WH6A 3QF3A 1NEQA 3JXCL 4ER7A 3OQMA 3KJXA 4O8BA 3TEPA 1JFSA 2ICPA 1LQCA 2VEOA 2AUWA 3OKZA 2XIUA 2PXPA 1WIZA 1CJGA 4X4HA 4J1XA 3QOXA 2L49A 4HRAA 1DW9A 2KEKA 1MFQC 2WUSR 2WIUB 1QB2A 3TELA 1ZVVA 2KEJA 1QP4A 4ER6A 1IC8A 1NERA 1RZRA 2ODRD 1QP7A 2PUFA 1L1MA 3F6WA 4I6RA 4YG4A 1JH9A 2FJRA 3L1PA 1WH8A 3D1NI 1CQTA 2OFYA 3BD1A 3NZLA 3TFLA 2R63A 3ME5A 2PXEA 1Y9QA 3DNVB 2L1PA 3SCHA 2PXVA 3LQXA 1LCDA 4YG1A 3TRBA 3KL4A 4EK9A 1EFAA 3JXBC 2AXVA 3G0TA 4GHJA 2IV1A 3OQOA 2PUAA 2PUBA 2XXPA 2BNOA 3G7DA 2HSGA 4JCYA 4Y42A 2IU7A 2LYPA 3R1FA 2XSDC 2HCSA 3NROA 1R63A 2IVGA 3NXHA 2PUDA 2KZ8A 1POUA 2CROA 2JVLA 2PE5A 1PRAA 3EUSA 1QP0A 2GRLA 3SX0A 1LLIA 2MQKA 5DSXA 2KEIA 1ZZ8A 3UWPA 5DRTA 5DT2A 3KXAA 4GQMA 3F51A 4I6TA 3QFIA 2B5AA 3S8QA 1PRVA 1JFTA 3A9ZA 2LLWA 2EF8A 2IUOA 4Z5CA 1AU7A 2AWIA 2PXTA 3OWQA 1LMB3 4NDWA 4OB4A 2AXZA 4PU8A 3BDNA 2GZUA 3VK0A 3OP9A 2A6CA 1HF0A 1LCCA 3ZHMA 3CROL 4ER3A 3A9XA 1DULA 1JWLA 2GRMA 3MEJA 2O38A 3SCGA 2JQEA 4EQZA 1XWRA 4JCXA 5K98B 2LLVA 4EKGA 4DE9A 2XXQA 2O4AA 4EKIA 2LYSA 1ZZ6A 3GUUA 1O4XA 4IA8A 4Q2JA 2PXBA 3QOWA 3OQNA 4X4IA 3SCFA 1UXCA 4Z5DA 2FFHA 2OR1L 3QQ6A 4DE8A 2PXFA 1QZXA 4IWRA 2AW6A 3ZKCA 3IVPA 2PUCA 3F52A 3MLFA 1OSLA 2R1JL 4ER0A 2PXLA 2M4HA 1QQBA 1RPEL 1ZAYA 1B0NA 2BNMA 1DWKA 3PXPA 5DTMA 1WETA 2AXUA 3ZPXA 1R69A 3GN5B 2LYQA 3SR4A 5A7LA 2LYJA 2PXKA 3B7HA 4PU7A 4IVZA 2EWTA 3CECA 3KZ3A 3OMTA 3GBFA 3QWGA 3RZZA 5GAHi 2H8RA 4F8DA 5DTRA 4X4GA 2MXDA 3UFDA 2LCVA 4MCXA 3GZDC 1BDHA 2YBDA 3H5TA 2JCGA 1ADRA 1RIOA 4PU4C 1ZZ7A 4EZIA 2J7UA 4JQDA 3R09A 4FBIA 4PU3C 1PRUA 3QYXA 2PUEA 4OBMA 3GZDA 3M9LA 2PXUA 3HZIB 2HCNA 2MEZA 5DRYA 1E3OC 4ER5A 2PUGA 1UTXA 4I6UA 4X4EA 2L8NA 2IVQA 2V3CC 2XCJA 4X4BA 1ZUGA 4X4FA 2PPXA 5GAGi 3FYAA 2LYLA 1PNRA 4FN3A 1ZZBA 1QPZA 1PERL 4Z59A 2BJCA 2HFZA 1ZZ9A 1Y7YA 1U2ZA 2ICTA 3ZHIA 3DM5A 3NDBB 1RZRD 2BNNA 2PXDA 4YG7B 1X2LA 2PIJA 1HQ1A 2EBYA 4WVLA 2KPJA 3GZCA 2HINA 4X4DA 2IVBA 3CLCA 4X4CA 2XJ3A 1NW3A 2CSFA 5JUWA 1ZZCA 2O49A 1ZS4A 2PXQA 1YSEA 3U3WA 1QQAA 2LNMA 1UXDA 3G5GA 1X57A 1VPWA 2D5VA 2XI8A 5DTQA 3FMYA 3FYMA 2J7WA 3O9XA 3LISA 1RZSA 2LYKA 2LYRA 4YBAA 4YARA 1S7EA 1SQ8A 3BS3A 4I8TA 4J1WA 2XXAA 3VWSA 1BDIA 4Z58A 4Z5HA 3PE5A 1OCTC 3LFPA
chains in the Genus database with same CATH topology
2PPXA 3GN5A 3FYAA 1ZPQA 4Z5DA 4Y42A 1GT0C 3JXDL 4MCTA 2OR1L 2LYLA 2IU7A 3QQ6A 2LYPA 1WH6A 3QF3A 3R1FA 2XSDC 4IWRA 1NEQA 1PNRA 3JXCL 1R63A 2AW6A 2IVGA 1ZZBA 4FN3A 2PUDA 2KZ8A 1QPZA 1POUA 2CROA 2JVLA 4Z59A 2PE5A 2BJCA 1PERL 1ZZ9A 3KJXA 1Y7YA 1PRAA 3IVPA 3OQMA 3ZKCA 3EUSA 4O8BA 2PUCA 3F52A 2ICTA 1QP0A 3MLFA 2GRLA 3ZHIA 1JFSA 2ICPA 2MQKA 1OSLA 1LQCA 1LLIA 2R1JL 2AUWA 2KEIA 2XIUA 1ZZ8A 1QQBA 1RZRD 2BNNA 3KXAA 1WIZA 4GQMA 1CJGA 1RPEL 1ZAYA 1B0NA 2BNMA 1DWKA 3F51A 4I6TA 4YG7B 4X4HA 4J1XA 1X2LA 2PIJA 3PXPA 1WETA 2AXUA 2B5AA 3S8QA 1PRVA 1JFTA 1R69A 2L49A 2EF8A 2IUOA 4Z5CA 3GN5B 1AU7A 2LYQA 1DW9A 2KEKA 2AWIA 2WUSR 2EBYA 2WIUB 1ZVVA 2KEJA 5A7LA 4NDWA 4OB4A 1LMB3 1QP4A 2AXZA 1OCTC 4PU8A 2LYJA 3BDNA 2KPJA 1IC8A 1NERA 1RZRA 2GZUA 2HINA 3B7HA 4PU7A 4IVZA 4X4DA 3VK0A 1QP7A 2EWTA 2A6CA 2IVBA 3CECA 3KZ3A 3OP9A 4X4CA 2XJ3A 1HF0A 1LCCA 3CLCA 3ZHMA 2CSFA 3OMTA 3GBFA 1ZZCA 3QWGA 3RZZA 2H8RA 2O49A 4F8DA 1L1MA 3CROL 3F6WA 1ZS4A 4I6RA 4YG4A 1JH9A 4JCYA 2FJRA 3L1PA 4X4GA 3UFDA 1WH8A 3D1NI 1CQTA 1JWLA 1YSEA 2LCVA 2OFYA 3BD1A 4MCXA 2GRMA 2O38A 1BDHA 3SCGA 1XWRA 2R63A 3U3WA 1QQAA 3H5TA 1UXDA 3G5GA 1X57A 2JCGA 1ADRA 1Y9QA 1VPWA 3DNVB 2D5VA 3SCHA 2XI8A 1RIOA 4PU4C 1ZZ7A 4JCXA 3FMYA 4JQDA 3FYMA 1LCDA 5K98B 4YG1A 4FBIA 3O9XA 3TRBA 4PU3C 1PRUA 3QYXA 3LISA 2PUEA 2O4AA 1RZSA 1EFAA 2LYSA 3JXBC 1ZZ6A 2LYKA 1O4XA 2LYRA 2AXVA 3HZIB 4IA8A 2MEZA 4YBAA 2PUFA 4GHJA 2IV1A 4YARA 1S7EA 1E3OC 2PUGA 1SQ8A 3OQOA 3BS3A 3OQNA 4I8TA 1UTXA 2PUAA 4X4IA 4J1WA 4I6UA 4X4EA 2PUBA 1BDIA 2L8NA 4Z58A 2IVQA 2BNOA 3G7DA 3SCFA 4Z5HA 2HSGA 2XCJA 4X4BA 1ZUGA 4X4FA 1UXCA 3LFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPX A;  3GN5 A;  3FYA A;  1ZPQ A;  4Z5D A;  4Y42 A;  1GT0 C;  3JXD L;  4MCT A;  2OR1 L;  2LYL A;  2IU7 A;  3QQ6 A;  2LYP A;  1WH6 A;  3QF3 A;  3R1F A;  2XSD C;  4IWR A;  1NEQ A;  1PNR A;  3JXC L;  1R63 A;  2AW6 A;  2IVG A;  1ZZB A;  4FN3 A;  2PUD A;  2KZ8 A;  1QPZ A;  1POU A;  2CRO A;  2JVL A;  4Z59 A;  2PE5 A;  2BJC A;  1PER L;  1ZZ9 A;  3KJX A;  1Y7Y A;  1PRA A;  3IVP A;  3OQM A;  3ZKC A;  3EUS A;  4O8B A;  2PUC A;  3F52 A;  2ICT A;  1QP0 A;  3MLF A;  2GRL A;  3ZHI A;  1JFS A;  2ICP A;  2MQK A;  1OSL A;  1LQC A;  1LLI A;  2R1J L;  2AUW A;  2KEI A;  2XIU A;  1ZZ8 A;  1QQB A;  1RZR D;  2BNN A;  3KXA A;  1WIZ A;  4GQM A;  1CJG A;  1RPE L;  1ZAY A;  1B0N A;  2BNM A;  1DWK A;  3F51 A;  4I6T A;  4YG7 B;  4X4H A;  4J1X A;  1X2L A;  2PIJ A;  3PXP A;  1WET A;  2AXU A;  2B5A A;  3S8Q A;  1PRV A;  1JFT A;  1R69 A;  2L49 A;  2EF8 A;  2IUO A;  4Z5C A;  3GN5 B;  1AU7 A;  2LYQ A;  1DW9 A;  2KEK A;  2AWI A;  2WUS R;  2EBY A;  2WIU B;  1ZVV A;  2KEJ A;  5A7L A;  4NDW A;  4OB4 A;  1LMB 3;  1QP4 A;  2AXZ A;  1OCT C;  4PU8 A;  2LYJ A;  3BDN A;  2KPJ A;  1IC8 A;  1NER A;  1RZR A;  2GZU A;  2HIN A;  3B7H A;  4PU7 A;  4IVZ A;  4X4D A;  3VK0 A;  1QP7 A;  2EWT A;  2A6C A;  2IVB A;  3CEC A;  3KZ3 A;  3OP9 A;  4X4C A;  2XJ3 A;  1HF0 A;  1LCC A;  3CLC A;  3ZHM A;  2CSF A;  3OMT A;  3GBF A;  1ZZC A;  3QWG A;  3RZZ A;  2H8R A;  2O49 A;  4F8D A;  1L1M A;  3CRO L;  3F6W A;  1ZS4 A;  4I6R A;  4YG4 A;  1JH9 A;  4JCY A;  2FJR A;  3L1P A;  4X4G A;  3UFD A;  1WH8 A;  3D1N I;  1CQT A;  1JWL A;  1YSE A;  2LCV A;  2OFY A;  3BD1 A;  4MCX A;  2GRM A;  2O38 A;  1BDH A;  3SCG A;  1XWR A;  2R63 A;  3U3W A;  1QQA A;  3H5T A;  1UXD A;  3G5G A;  1X57 A;  2JCG A;  1ADR A;  1Y9Q A;  1VPW A;  3DNV B;  2D5V A;  3SCH A;  2XI8 A;  1RIO A;  4PU4 C;  1ZZ7 A;  4JCX A;  3FMY A;  4JQD A;  3FYM A;  1LCD A;  5K98 B;  4YG1 A;  4FBI A;  3O9X A;  3TRB A;  4PU3 C;  1PRU A;  3QYX A;  3LIS A;  2PUE A;  2O4A A;  1RZS A;  1EFA A;  2LYS A;  3JXB C;  1ZZ6 A;  2LYK A;  1O4X A;  2LYR A;  2AXV A;  3HZI B;  4IA8 A;  2MEZ A;  4YBA A;  2PUF A;  4GHJ A;  2IV1 A;  4YAR A;  1S7E A;  1E3O C;  2PUG A;  1SQ8 A;  3OQO A;  3BS3 A;  3OQN A;  4I8T A;  1UTX A;  2PUA A;  4X4I A;  4J1W A;  4I6U A;  4X4E A;  2PUB A;  1BDI A;  2L8N A;  4Z58 A;  2IVQ A;  2BNO A;  3G7D A;  3SCF A;  4Z5H A;  2HSG A;  2XCJ A;  4X4B A;  1ZUG A;  4X4F A;  1UXC A;  3LFP A; 
#chains in the Genus database with same CATH topology
 3GN5 A;  3A9Y A;  1ZPQ A;  1GT0 C;  3JXD L;  4MCT A;  1WH6 A;  3QF3 A;  1NEQ A;  3JXC L;  4ER7 A;  3OQM A;  3KJX A;  4O8B A;  3TEP A;  1JFS A;  2ICP A;  1LQC A;  2VEO A;  2AUW A;  3OKZ A;  2XIU A;  2PXP A;  1WIZ A;  1CJG A;  4X4H A;  4J1X A;  3QOX A;  2L49 A;  4HRA A;  1DW9 A;  2KEK A;  1MFQ C;  2WUS R;  2WIU B;  1QB2 A;  3TEL A;  1ZVV A;  2KEJ A;  1QP4 A;  4ER6 A;  1IC8 A;  1NER A;  1RZR A;  2ODR D;  1QP7 A;  2PUF A;  1L1M A;  3F6W A;  4I6R A;  4YG4 A;  1JH9 A;  2FJR A;  3L1P A;  1WH8 A;  3D1N I;  1CQT A;  2OFY A;  3BD1 A;  3NZL A;  3TFL A;  2R63 A;  3ME5 A;  2PXE A;  1Y9Q A;  3DNV B;  2L1P A;  3SCH A;  2PXV A;  3LQX A;  1LCD A;  4YG1 A;  3TRB A;  3KL4 A;  4EK9 A;  1EFA A;  3JXB C;  2AXV A;  3G0T A;  4GHJ A;  2IV1 A;  3OQO A;  2PUA A;  2PUB A;  2XXP A;  2BNO A;  3G7D A;  2HSG A;  4JCY A;  4Y42 A;  2IU7 A;  2LYP A;  3R1F A;  2XSD C;  2HCS A;  3NRO A;  1R63 A;  2IVG A;  3NXH A;  2PUD A;  2KZ8 A;  1POU A;  2CRO A;  2JVL A;  2PE5 A;  1PRA A;  3EUS A;  1QP0 A;  2GRL A;  3SX0 A;  1LLI A;  2MQK A;  5DSX A;  2KEI A;  1ZZ8 A;  3UWP A;  5DRT A;  5DT2 A;  3KXA A;  4GQM A;  3F51 A;  4I6T A;  3QFI A;  2B5A A;  3S8Q A;  1PRV A;  1JFT A;  3A9Z A;  2LLW A;  2EF8 A;  2IUO A;  4Z5C A;  1AU7 A;  2AWI A;  2PXT A;  3OWQ A;  1LMB 3;  4NDW A;  4OB4 A;  2AXZ A;  4PU8 A;  3BDN A;  2GZU A;  3VK0 A;  3OP9 A;  2A6C A;  1HF0 A;  1LCC A;  3ZHM A;  3CRO L;  4ER3 A;  3A9X A;  1DUL A;  1JWL A;  2GRM A;  3MEJ A;  2O38 A;  3SCG A;  2JQE A;  4EQZ A;  1XWR A;  4JCX A;  5K98 B;  2LLV A;  4EKG A;  4DE9 A;  2XXQ A;  2O4A A;  4EKI A;  2LYS A;  1ZZ6 A;  3GUU A;  1O4X A;  4IA8 A;  4Q2J A;  2PXB A;  3QOW A;  3OQN A;  4X4I A;  3SCF A;  1UXC A;  4Z5D A;  2FFH A;  2OR1 L;  3QQ6 A;  4DE8 A;  2PXF A;  1QZX A;  4IWR A;  2AW6 A;  3ZKC A;  3IVP A;  2PUC A;  3F52 A;  3MLF A;  1OSL A;  2R1J L;  4ER0 A;  2PXL A;  2M4H A;  1QQB A;  1RPE L;  1ZAY A;  1B0N A;  2BNM A;  1DWK A;  3PXP A;  5DTM A;  1WET A;  2AXU A;  3ZPX A;  1R69 A;  3GN5 B;  2LYQ A;  3SR4 A;  5A7L A;  2LYJ A;  2PXK A;  3B7H A;  4PU7 A;  4IVZ A;  2EWT A;  3CEC A;  3KZ3 A;  3OMT A;  3GBF A;  3QWG A;  3RZZ A;  5GAH i;  2H8R A;  4F8D A;  5DTR A;  4X4G A;  2MXD A;  3UFD A;  2LCV A;  4MCX A;  3GZD C;  1BDH A;  2YBD A;  3H5T A;  2JCG A;  1ADR A;  1RIO A;  4PU4 C;  1ZZ7 A;  4EZI A;  2J7U A;  4JQD A;  3R09 A;  4FBI A;  4PU3 C;  1PRU A;  3QYX A;  2PUE A;  4OBM A;  3GZD A;  3M9L A;  2PXU A;  3HZI B;  2HCN A;  2MEZ A;  5DRY A;  1E3O C;  4ER5 A;  2PUG A;  1UTX A;  4I6U A;  4X4E A;  2L8N A;  2IVQ A;  2V3C C;  2XCJ A;  4X4B A;  1ZUG A;  4X4F A;  2PPX A;  5GAG i;  3FYA A;  2LYL A;  1PNR A;  4FN3 A;  1ZZB A;  1QPZ A;  1PER L;  4Z59 A;  2BJC A;  2HFZ A;  1ZZ9 A;  1Y7Y A;  1U2Z A;  2ICT A;  3ZHI A;  3DM5 A;  3NDB B;  1RZR D;  2BNN A;  2PXD A;  4YG7 B;  1X2L A;  2PIJ A;  1HQ1 A;  2EBY A;  4WVL A;  2KPJ A;  3GZC A;  2HIN A;  4X4D A;  2IVB A;  3CLC A;  4X4C A;  2XJ3 A;  1NW3 A;  2CSF A;  5JUW A;  1ZZC A;  2O49 A;  1ZS4 A;  2PXQ A;  1YSE A;  3U3W A;  1QQA A;  2LNM A;  1UXD A;  3G5G A;  1X57 A;  1VPW A;  2D5V A;  2XI8 A;  5DTQ A;  3FMY A;  3FYM A;  2J7W A;  3O9X A;  3LIS A;  1RZS A;  2LYK A;  2LYR A;  4YBA A;  4YAR A;  1S7E A;  1SQ8 A;  3BS3 A;  4I8T A;  4J1W A;  2XXA A;  3VWS A;  1BDI A;  4Z58 A;  4Z5H A;  3PE5 A;  1OCT C;  3LFP A; 
#chains in the Genus database with same CATH homology
 2PPX A;  3GN5 A;  3FYA A;  1ZPQ A;  4Z5D A;  4Y42 A;  1GT0 C;  3JXD L;  4MCT A;  2OR1 L;  2LYL A;  2IU7 A;  3QQ6 A;  2LYP A;  1WH6 A;  3QF3 A;  3R1F A;  2XSD C;  4IWR A;  1NEQ A;  1PNR A;  3JXC L;  1R63 A;  2AW6 A;  2IVG A;  1ZZB A;  4FN3 A;  2PUD A;  2KZ8 A;  1QPZ A;  1POU A;  2CRO A;  2JVL A;  4Z59 A;  2PE5 A;  2BJC A;  1PER L;  1ZZ9 A;  3KJX A;  1Y7Y A;  1PRA A;  3IVP A;  3OQM A;  3ZKC A;  3EUS A;  4O8B A;  2PUC A;  3F52 A;  2ICT A;  1QP0 A;  3MLF A;  2GRL A;  3ZHI A;  1JFS A;  2ICP A;  2MQK A;  1OSL A;  1LQC A;  1LLI A;  2R1J L;  2AUW A;  2KEI A;  2XIU A;  1ZZ8 A;  1QQB A;  1RZR D;  2BNN A;  3KXA A;  1WIZ A;  4GQM A;  1CJG A;  1RPE L;  1ZAY A;  1B0N A;  2BNM A;  1DWK A;  3F51 A;  4I6T A;  4YG7 B;  4X4H A;  4J1X A;  1X2L A;  2PIJ A;  3PXP A;  1WET A;  2AXU A;  2B5A A;  3S8Q A;  1PRV A;  1JFT A;  1R69 A;  2L49 A;  2EF8 A;  2IUO A;  4Z5C A;  3GN5 B;  1AU7 A;  2LYQ A;  1DW9 A;  2KEK A;  2AWI A;  2WUS R;  2EBY A;  2WIU B;  1ZVV A;  2KEJ A;  5A7L A;  4NDW A;  4OB4 A;  1LMB 3;  1QP4 A;  2AXZ A;  1OCT C;  4PU8 A;  2LYJ A;  3BDN A;  2KPJ A;  1IC8 A;  1NER A;  1RZR A;  2GZU A;  2HIN A;  3B7H A;  4PU7 A;  4IVZ A;  4X4D A;  3VK0 A;  1QP7 A;  2EWT A;  2A6C A;  2IVB A;  3CEC A;  3KZ3 A;  3OP9 A;  4X4C A;  2XJ3 A;  1HF0 A;  1LCC A;  3CLC A;  3ZHM A;  2CSF A;  3OMT A;  3GBF A;  1ZZC A;  3QWG A;  3RZZ A;  2H8R A;  2O49 A;  4F8D A;  1L1M A;  3CRO L;  3F6W A;  1ZS4 A;  4I6R A;  4YG4 A;  1JH9 A;  4JCY A;  2FJR A;  3L1P A;  4X4G A;  3UFD A;  1WH8 A;  3D1N I;  1CQT A;  1JWL A;  1YSE A;  2LCV A;  2OFY A;  3BD1 A;  4MCX A;  2GRM A;  2O38 A;  1BDH A;  3SCG A;  1XWR A;  2R63 A;  3U3W A;  1QQA A;  3H5T A;  1UXD A;  3G5G A;  1X57 A;  2JCG A;  1ADR A;  1Y9Q A;  1VPW A;  3DNV B;  2D5V A;  3SCH A;  2XI8 A;  1RIO A;  4PU4 C;  1ZZ7 A;  4JCX A;  3FMY A;  4JQD A;  3FYM A;  1LCD A;  5K98 B;  4YG1 A;  4FBI A;  3O9X A;  3TRB A;  4PU3 C;  1PRU A;  3QYX A;  3LIS A;  2PUE A;  2O4A A;  1RZS A;  1EFA A;  2LYS A;  3JXB C;  1ZZ6 A;  2LYK A;  1O4X A;  2LYR A;  2AXV A;  3HZI B;  4IA8 A;  2MEZ A;  4YBA A;  2PUF A;  4GHJ A;  2IV1 A;  4YAR A;  1S7E A;  1E3O C;  2PUG A;  1SQ8 A;  3OQO A;  3BS3 A;  3OQN A;  4I8T A;  1UTX A;  2PUA A;  4X4I A;  4J1W A;  4I6U A;  4X4E A;  2PUB A;  1BDI A;  2L8N A;  4Z58 A;  2IVQ A;  2BNO A;  3G7D A;  3SCF A;  4Z5H A;  2HSG A;  2XCJ A;  4X4B A;  1ZUG A;  4X4F A;  1UXC A;  3LFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...