1ZZ6A

Crystal structure of apo-hppe
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
193
structure length
181
Chain Sequence
b'TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGNEFLFVLEGEIHMKWGDKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 45
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz6A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz6A02
3ZHIA 1BDHA 4X4FA 4N9HA 1DZTA 3IIAA 2ZCWA 3EJKA 2A6CA 1ZZ6A 1FI2A 1QXRA 1UIKA 2GAUA 4AVBA 1CAVB 2H8RA 3S8QA 4XFGA 2DCTA 4MX3A 5BXXA 3ROUA 2OA2A 3KXAA 3SCGA 1VPWA 1DZRA 3DKWA 2LYPA 2HSGA 4TLFA 3LAGA 5FLJA 5J3UA 3QWGA 1RC6A 4CYDA 5LRRA 3I59A 5BY5A 2PUFA 3F52A 1YFWA 2ZKLA 1O5UA 3DV8A 3KCCA 3CECA 3DN7A 1ZAYA 1Q5OA 5AVPA 4JVAA 2PTMA 2GC1A 4XFAA 1UCXA 4X4EA 3PXPA 4AVAA 3EHKA 4Q0PA 1SEFA 3H9AA 1LKNA 1UPIA 5I0RA 3HQXA 3RPQA 2EA7A 2BNMA 5I8SA 1X57A 3U3WA 2XL9A 4IEPA 3OGJA 1R69A 1O3RA 1X7NA 1GQGA 3WW3A 4Z5CA 1X2LA 2O1QA 1ZZCA 1VP6A 4LA2A 3M70A 2L49A 2IXKA 3I7DA 3USSA 1EP0A 2WC2A 3ELNA 5BPXA 2LYKA 3MPBA 1CJGA 2HJIA 5KHIA 1G6NA 3H3UA 4WVZA 4KWJA 4YSFA 3RYRA 3FYMA 3SCFA 3U10A 1IC8A 1V70A 1SQ4A 3LA3A 4YNIA 2KPJA 1CAWB 2Z69A 1EFAA 4PIYA 3JZVA 1EPZA 4IEOA 3R6SA 4F8AA 2OFYA 3IDCB 2HKXA 3BCWA 3RYKA 2CGPA 4H7LA 4ORFA 4WBBA 3WW4A 1NE4A 1WIZA 2IUOA 4OB4A 1XE7A 3PLQA 2IXIA 2PHDA 4OFGA 4BH9A 1O3SA 2PAMA 2AXZA 2HINA 4YG1A 4AVCA 4NVPA 1OI6A 4I6RA 1RTVA 4KL1A 5JR7B 3OP9A 3WW1A 3G7DA 3NL1A 1Y3TA 2ET7A 2KXLA 1CAVA 1CX4A 3EQEA 5FQ0A 4ONUA 2PIJA 5FPXA 2D93A 4LA3A 2GC0A 4IESA 3MZHA 3UFDA 1NYWA 4XFIA 4B29A 4I6UA 2Z2SB 2VPVA 1IPJA 3IVPA 1WH8A 2K9ZA 3OMTA 2Q0AA 1LRHA 2UY9A 3LZZA 1S7EA 2PUDA 3ZDSA 4AXOA 5LEKA 2XSDC 1LMB3 1RZRD 1LR5A 1JWLA 2B5AA 3QACA 1ZS4A 2MEZA 3HT1A 3S0MA 1LCDA 2LCVA 1VR3A 1PMIA 3NVCA 5I8YA 5JCTA 1ZNPA 3PNAA 1DGRA 3KJXA 3LA7A 1J3QA 2PA7A 1O4TA 2AW6A 3JXBC 3ZHMA 5F1RA 4X4IA 4HBNA 2WFPA 4IETA 4YG4A 4X4DA 1QP7A 1NZCA 1TQ5A 1CQTA 1O7FA 4I02A 4IEYA 3TRBA 5I0UA 1WLTA 5J48A 2AXVA 4QM9A 2PUBA 4DINB 3HT2A 1PRVA 4MGYE 1UXDA 3D1NI 1CGPA 4J1WA 1WA4A 3E97A 3ZKCA 3DL3A 3LOIA 4IEXA 2P17A 3F51A 3DNVB 1L3JA 1DW9A 2FJRA 4MGIE 3VHRA 1RUOA 3E6BA 2JVLA 1UXCA 1I6XA 3FHIB 1Q43A 4O9GA 4QX5A 1OMIA 2GRMA 2BNOA 3JXDL 3H1YA 4KWKA 4X6QB 2BGCA 4Y42A 4ZU5A 5I8TA 1Q3EA 4F7ZA 1J3RA 2B8MA 1ZZ9A 1UTXA 2H6BA 3FE5A 3OD0A 5C6CA 2OR1L 3OQMA 1YFUA 2QNKA 1J1LA 4JTOA 2PAKA 1CAWA 5CU1A 1XE8A 2CROA 1QP0A 2CV6A 4Z5DA 4D7SA 3HIFA 2GC3A 1LCCA 1RZSA 2I45A 1NERA 3HZIB 4R52A 4YG7B 3ETQA 3H7YA 3ES1A 2OYZA 3OQNA 2IC1A 3KSCA 1J59A 2XLGA 3CO2A 1O5LA 5I0TA 4YBAA 1J3PA 2E9QA 1VJ2A 2IV1A 1J58A 2OPKA 4EV0A 2QCSB 3L1PA 4O9EA 1EYBA 2KEJA 5HI0A 5BV6A 4LUMA 1X8MA 1SFNA 3O14A 4R8HA 1RZRA 4AQ2A 2LYRA 4XFHA 5I93A 3CLPA 3MLFA 1GQHA 4HLTA 2EVXA 2IU7A 3MYXA 1DWKA 4FAGA 2D40A 4I6TA 4IA8A 2F4PA 4YRDA 4META 4IEVA 4XETA 4YYOA 2KZ8A 5J7MA 3OTFA 1JUHA 3KGZA 4HMZA 4E2GA 4HN1A 2XI8A 1RL3A 4XF3A 3UKTA 2UY8A 2Q30A 3H5TA 2BJCA 2Q1ZB 3B7HA 2KEKA 5KHKA 4UXAA 4YARA 1ZVVA 5C8WA 3ES4A 4PIZA 3B02A 3F6WA 3IDBB 2MPFA 2V09A 2FMYA 5JSPA 3CLCA 3BU7A 4IERA 1AU7A 3D82A 2OZJA 2XLFA 2XLAA 4WZCA 2XHKA 5I0SA 4HSLA 1ZREA 2IVBA 4KU8A 2LYJA 3SHRA 2D5HA 3BS3A 4XF1A 4XEZA 1SQ8A 4E2SA 2ET1A 3TNQA 1ADRA 5BUVA 4XF4A 4K8FA 4MGZE 2EF8A 1ZUGA 1QXJA 5KHJA 4KWLA 3ACLA 3BALA 4Z07A 3SCHA 4X4CA 4MCXA 1RUNA 1Y9QA 2R1JL 1JFSA 4P9GA 2AXUA 1O3QA 3D0SA 1L1MA 5CADA 2PFWA 3OF1A 3H3ZA 3H50A 1PM7A 4LTAA 1OD5A 5D1IA 5FCCA 1YFYA 1XWRA 3N4MA 4F8DA 1ZRRA 4X4HA 2PAEA 3CEWA 4LULA 4MUVA 4JTNA 4EROA 4HVRA 3QF3A 4XF9A 2XKOA 2EAAA 2N7GA 2QVSB 4GULA 3SMHA 3EBRA 2UYBA 4X4GA 2IVQA 3U11A 1HW5A 2WIUB 4Z58A 2MNGA 4XF0A 4XFFA 2L8NA 1JH9A 2Y0OA 2LYLA 3OCPA 4QMAA 4I0AA 5FLHA 2CAVA 3BB6A 5FPZA 4QGLA 3O9XA 4N9IA 1ZZBA 3FWEA 3RNSA 4KU7A 4HSJA 2C0ZA 4I01A 4ZU4A 4X6RB 3SXWA 5KHHA 4FAHA 1QWRA 1Y7YA 1PNRA 4QM8A 4PU3C 2MHFA 4HZFA 1PRUA 1CAXB 4PU7A 5LRSA 2MQKA 3E6DA 1YWKA 2QDRA 3H1MA 1OCTC 3CROL 4I3PA 3UKVA 2IXHA 3QYXA 4IEQA 3KZ3A 1UD1A 2IXCA 1QP4A 5K8SA 3GN5B 2XCJA 1QPZA 2H6CA 3G5GA 2O8QA 3D0JA 3NW4A 4X4BA 4MH0E 3CJXA 5FLIA 2XJ3A 2D5VA 3FJSA 4IVZA 4JV4A 3NSTA 3BD1A 3EUSA 5JSOA 1CAUB 5FQ0B 1RIOA 5CVRA 1ZZ8A 2XIUA 2O49A 2GZUA 4GQMA 4QGNA 4FT8A 3FMYA 2PHLA 3E5UA 4NDWA 1LQCA 4IEUA 4QXKA 5E1RA 4ZU7A 1JFTA 3CF6E 4JCXA 2XGXA 1RGSA 2AWIA 3GBFA 4JQDA 2PPXA 2ICPA 4RD7A 3S7IA 1U12A 1IPKA 1EY2A 2Q4SA 4A2UA 3U0ZA 3LISA 4LUKA 2GU9A 3FYAA 3H7JA 2AUWA 2ETEA 2IXLA 2ICTA 1LLIA 2LYSA 2PUCA 1I5ZA 1XRUA 2GZWA 3IWZA 3PVBB 3QOPA 1BDIA 1QQBA 3KGLA 1H1IA 3LWCA 3NKTA 1OSLA 2EWTA 3BPZA 3L2HA 1YHFA 4IWRA 1OFNA 4XFCA 3RDIA 4I09A 4PIXA 1ZPQA 4HN0A 1YUDA 1UW8A 2QJVA 4QGMA 4L2NA 2PYTA 1ZZ7A 2BYVE 2B5HA 4UBHA 2K0GA 2WUSR 1PERL 4PJYA 1ZRDA 4I8TA 4HVOA 2XL7A 3KMHA 2PQQA 3VK0A 3WW2A 1X82A 4IEWA 3CL1A 3E5QA 5T3NA 2GH2A 3FZ3A 4FBFA 4MV2A 5EZWA 4J1XA 2PE5A 1YFXA 1RPEL 2UYAA 4AQ6A 1H1MA 1QQAA 2H0VA 1POUA 2JCGA 1FXZA 2PUEA 4BHPA 1NE6A 5LEJA 1CAXA 1WETA 3I54A 4Q0QA 2GRLA 5FDBA 4Z59A 2PUGA 4JCYA 1UIJA 5KBFA 3I59B 4O8BA 2FQPA 2R63A 1E3OC 4IEZA 4BIFA 2O38A 1YSEA 4FN3A 3MDPA 5E16A 4EWEA 4EWDA 2VQAA 3RYPA 3FFQA 2O4AA 3OQOA 3GN5A 4PU4C 3QQ6A 3BDNA 4Q0SA 4I2OA 3M3IA 3C3VA 4Z5HA 2ATFA 2D5FA 2VECA 3RZZA 5K98B 2BNNA 1ZX5A 1DGWA 3E5XA 3E6CC 3GYDA 1CAUA 2PUAA 4Q29A 4PU8A 1FT9A 2GC2A 2OZ6A 5A7LA 5I91A 1ZRCA 2CAUA 4I0BA 2B9UA 3UKNA 2IVGA 1X8EA 1PRAA 4MCTA 1HF0A 3LA2A 4MZUA 1YLLA 2EBYA 5JSRA 1WGPA 2XKPA 4GHJA 3FX3A 3NJZA 4MGKE 3H1WA 4D7TA 4Z82A 1O3TA 1R63A 3S7EA 1ZVFA 4OLLA 4EWAA 2LYQA 1NXMA 1QY4A 3TNPB 4E2QA 2BEOA 1GT0C 4XFBA 2KEIA 2IXJA 3ST7A 4L11A 5EFUA 3IBMA 1B0NA 4Q0VA 1LB2A 1NEQA 3R1FA 4BYYA 1WH6A 2CSFA 3LFPA 4HVQA 1ZRFA 5KHGA 4LLOA 3JXCL 1O4XA 3H8UA 4LEJA 4FBIA 3EO6A 4Q0UA 4UBGA 5JAXA
chains in the Genus database with same CATH superfamily
1KXGA 2PXJA 1UX7A 4P14A 4N9HA 4TSVA 4GD4A 2ZGNA 1QQP3 2ZCWA 4BQ2A 4CUGA 2JIGA 5FZ4A 1UY0A 2A1XA 1DHKB 1NLSA 1QJY2 2JG8B 2WNUA 3K75B 3OSDA 4PBPA 1VBE2 4AVBA 2BDRA 1CAVB 3ROUA 4XIKA 3MUY1 4XBNA 4CDWB 2P1BA 4Y5Z0 4ER5A 5LA9A 4Z2AA 1W06A 2LYPA 2HSGA 1KFXL 3POFA 2DTYA 1MS3A 1R092 1P8JA 2HWD1 3LAGA 5FLJA 3THCA 5J3UA 1S2EA 3QWGA 1VBD1 2RM21 1G9FA 5H9QA 1QF3A 4QB1A 5LRRA 5KXCA 1YRZA 3VB9A 4UF0A 1NCRB 2ZKLA 3LDBA 5F5AA 5CFCA 1O5UA 2D3PA 2R072 1RUJ2 3LQCA 3VD4A 2EXJA 1ZAYA 1E57A 1PK6A 3AKTA 2ZX3A 4JGZB 4YW3A 4DMIA 2WN2A 4LE3A 1IG0A 1VRH1 2GC1A 3POIA 5DABA 3Q8CA 2VOTA 1DGRN 3EHKA 4AEMA 4AVVA 3SH5A 1QMJA 3C7HA 4LIUA 3AL5A 2MXDA 2Z5WA 2EA7A 4XYXA 5EJ1B 4AFDA 3I8TA 5I8SA 2XJRA 2JKBA 5C5UA 1HRV1 3AZVA 1H9PA 2ZGTA 5FPAA 2HWD2 3N9LA 5F39A 4CEWB 2V5DA 1CESA 2RM22 2VR4A 3N36A 3ZFGB 2IXKA 4CCJA 1RB8G 1EP0A 4YM0A 3AVSA 2W1WA 1G9AA 1IS3A 3USUB 2HJIA 1T6GC 2P3JA 3J8F3 3KT1A 1G6NA 1UXZA 3ZXEA 3GALA 3AYDA 5CISA 5A6ZA 3FYMA 2AEZA 5H9PA 4DZGA 2PELA 1PO22 3A0NA 3KV5A 5A7WA 4DUVA 3VBOC 3ZYHA 1BBT2 1VRH2 4YNIA 3VDAA 4PCRA 4DE8A 2VOKA 4GMP1 5A80A 2YPDA 3WDTA 4FTEA 1C8NA 1O4ZA 2WT0A 3LEIA 3R6SA 2CGPA 1U5XA 3IDCB 4XURA 3RYKA 2WZ8A 1C5IA 1VBA3 2WBKA 3J7LA 4FPEA 4TXWA 2J22A 4FPLA 1ALYA 2JDUA 2R0HA 4LO6B 1FX5A 2YB7A 2JDMA 1QJU1 3PL0A 2HINA 5JIUA 4YG1A 4DUWA 4AOCA 1DFQA 1KDMA 1OI6A 4XOGA 5FO8B 4KL1A 3OP9A 2YPJA 1WKYA 3G0TA 1WA6X 1CAVA 3T4VA 4ONUA 4PDWC 4LA3A 2LLVA 1SCRA 2WIIB 4CDWA 5CFDC 3UFDA 5LK7B 3MICA 2Z2SB 1AR71 4RSUA 1GOHA 3Q9OA 3WP3A 1S0DA 1WH8A 4GWIA 2ENRA 1DU3D 4P08A 4YG3A 2PUDA 4ASLA 2XSDC 1LMB3 1LR5A 1ZRIA 2A6ZA 5E88A 1RUD1 3QACA 3HVDA 4GJYA 4WVMB 1JU3A 1QIQA 3UWPA 3S0MA 3JQWA 5I8YA 3NVCA 1Z7S3 1NCRA 1UYPA 5IWFA 3VDDB 1J3QA 2AW6A 3JXBC 5BNPC 1JZ8A 5GAGi 4HKWA 3A21A 4X4IA 1N3OA 3C7GA 2WFPA 5LB6A 4YZ2A 5FKBA 1X9TA 5DUWA 3U4XA 4XVHA 5IVVA 4JGZA 4D69A 1QDOA 1N1TA 1QJU2 3WQ1A 4KMQA 4RFRB 3TRBA 1SBDA 1UF2C 2W1UA 2JE9A 2AXVA 1W0OA 3H3LA 4LBOA 1EPWA 4QM9A 3AP5A 3BGAA 3NDBB 4W6WA 4N8MA 5IHRA 4P9XA 4QU2A 1GICA 3AP9A 3I2IA 1W6PB 4ZZ5A 4K7JA 3SISA 1LU2A 2FHRA 4J25A 3B9CA 4JC1A 2DVFA 4IEXA 1ZBA2 1COV1 1S0GA 2P17A 3INAA 3LFMA 1AR72 4XE9A 2ZKNA 4Y3OA 2F17A 2FDHA 4CEWA 3OBZA 4O9GA 1S1AA 1UXCA 4FP2A 2A3WA 2HWF1 3WF3A 5JLVA 4C8DA 4KGGA 3ZFGA 1RUD2 2RVAA 4RGAA 4YGCA 5KC5A 1JYIA 3WEZA 4ZU5A 4F7ZA 3USUA 3VBUB 2RS33 1UTXA 3LPFA 4CU8A 4K6BA 2Q8DA 3OQMA 2WNEA 3I3EA 4JTOA 1AF9A 2DUQA 4A41A 3VWSA 2CROA 4FVVA 3MEJA 2CV6A 3FBYA 4Y1VA 4Z5DA 3WQ7A 4C90A 3MW3A 4AI3A 1RZSA 1NERA 4OI2A 4ZPIA 2XQRA 2BJSA 4NWVA 3KT7A 1S2BA 5GLWA 3N35A 3BTZA 1ULEA 3RZJA 2WZR3 1H2NA 1MZ5A 1PO12 3JBG2 1VRBA 1CPMA 1LTEA 1AYM2 3QOXA 4QKNA 1VJ2A 5DZFA 1C8M1 1A8DA 2IV1A 3LQXA 2MEV1 2W3JA 2ZHMA 2VZRA 4QX1A 1D4M3 2YGMA 2QCSB 4BISA 1HX6A 2IVIB 3VV1A 2GDFA 3LSDA 4D6QA 4O9EA 1AL23 2ADDA 2AH2A 3QD6A 2F6BA 1DQ0A 3CJIB 2FBEA 1X8MA 3O14A 3OBTA 4R8HA 4AHXA 2YC4A 1VAMA 2LYRA 2E7QA 2QUOA 3FC0A 4UFMA 3M3CA 4Q26A 2OKXA 4L97A 4WVMA 5AFEA 3WHTA 2QQWA 3J4UH 3SR4A 4OVEA 5L19A 4I6TA 4IA8A 1RHI2 2C9KA 2CU5A 4Q4V3 1MS5A 4YRDA 2JDZA 3VDDA 1RUC2 3ZXJA 4AW7A 2D98A 3ZVXA 4XETA 1UZ0A 2E7AA 2PXUA 3M7AA 3HMYA 4FCAA 4NAMA 5GZDA 1XYPA 4CP0A 4GH4C 4E2GA 3WCRA 4RR3C 4H2AA 3PU8A 4LHNA 3WY6A 2XI8A 1S0JA 1WCQA 2NMNA 4G3YC 4XF3A 5IVFA 2BJCA 2Q1ZB 2MEV2 1W2TA 3ES4A 4HT1T 4PIZA 3HN3A 4DO0A 2HH9A 3M2MA 3F6WA 1NX9A 3WUCA 3ZFFA 2MPFA 2FMYA 5JSPA 4MXVA 5DPNA 1F5FA 5FYVA 4DFSA 1JYTA 5DAXA 2XLFA 1ZBE2 3CMGA 4GAZA 4K8RB 4QXHA 4CP9A 4EE2A 2XXZA 4DOUA 2WN3A 3J26N 1GYKA 2PXFA 4KU8A 1OA2A 1VMFA 2RV9A 5L7OC 2XMLA 4E2SA 1GOFA 2P3YA 3T2QA 5A6XA 1UL9A 1ADRA 1EUTA 2IUWA 5FZMA 1D2SA 4MGZE 3RVHA 3LIHA 2EXIA 1RUF3 3POBA 1AJOA 5JXJA 1H6YA 1NY71 5KHJA 3DM5A 3T2PA 1TME1 3DYMA 3VBUA 4YZ5A 2EICA 3WQ0A 3BALA 4CU7A 2X8KA 2X05A 1ULPA 1EV13 3IKWA 1FPN1 2R30A 1Y9QA 4CSWA 5C4WB 1DYOA 1W9FA 4ARYA 5LY1A 5ANQA 4ASMB 1L1MA 2ZX4A 5CADA 4ZKTB 5J09A 2PFWA 1F4HA 1R64A 1JOPA 1ODMA 1H6XA 1PM7A 2TNFA 4J6GA 5FCCA 1APNA 1IQDC 1ULFA 4BIOA 4X4HA 1CZTA 4UFJA 1XU1A 2CHHA 4BXFA 1SCSA 4FO9A 4LULA 4MUVA 4EROA 3TEPA 4N43C 5JI7A 5A32B 3VBSC 4C1WA 4HVRA 4H7MA 5ACA1 5C7GA 5LA2A 2XKOA 2ZHNA 4XDOA 4COYA 5CEHA 3EBRA 5J96B 2GNTA 4TLGA 1NG0A 3ZR6A 2Y0OA 2WFF1 2LYLA 4NRPA 3S6PA 3CJIA 3A9YA 2RS51 3WV6A 3MGUA 2RDNA 5DT2A 1NY72 2PHFA 3AZZA 2ZEYA 3EB7A 3J7MA 5FXWA 1PZ8A 3HQUA 3VD5A 5AC93 4QGLA 3O9XA 3UGHA 4WM7C 1FPN2 3RNSA 4ATFA 5CFDB 4RFT0 1G8WA 3WDXA 5C3RA 5FO9B 1UOFA 2DVDA 5DAVA 5KHHA 4OQ9A 3AP7A 1HQLA 1QWRA 2LUWA 1OPOA 1UU6A 2MHFA 4GIQA 3BIEA 1GLHA 1LNSA 1RUI2 1CAXB 1V6JA 4CDUC 2A6YA 4PU7A 4WVWA 2MQKA 1F5JA 1OLME 5E89A 5K7PA 5LRSA 1JXNA 2QDRA 4LR4A 4TN7A 1MQTC 2FCTA 3BOWA 1TNRA 3A9XA 3R05A 1UY2A 2AR6A 4M4PA 1V9U3 3WCSA 1X50A 3M3OA 1FV2A 1AYM3 3QYXA 4IEQA 5LK5A 3KZ3A 4ATEA 1UD1A 4CDQB 1ND2C 5B4NA 1QP4A 1IZ3A 1JN2P 2XCJA 1IPSA 2VCBA 4M01A 1BEV2 2RMU3 1LGBA 3D0JA 5M0TA 4AI1A 1W2NA 4MH0E 5FLIA 4R9BA 2RS52 3I2DA 2XXAA 2D5VA 1GP6A 4XACA 5FMBA 5BNOC 4A7YA 3PUIA 4BQ3A 1BMV1 3WLUA 3EUSA 3MO4A 2E26A 2X53S 4GQMA 3N7LA 1H4HA 2CGOA 1FMD3 5FYSA 3IB3A 5B4XA 4EZHA 3E5UA 4QKDA 5FY5A 2DU1A 1CR7A 3GZDA 3AYEA 1JZ4A 4DQAA 3IMMA 2Q8EA 4N7IA 1W8HA 1YC61 2BBVA 3B93A 3RMYA 4JQDA 2PPXA 2ICPA 4RD7A 4XQ4A 1AR62 4K1YA 5C4WA 2D6PA 3PMSA 4AEDB 1EY2A 4A2UA 1CZSA 1DGWX 2GU9A 3ZN6B 2A6XA 2Z4FA 3H7JA 2IXLA 1YJKA 2ICTA 1ULGA 2PUCA 3PVBB 4S2HA 5FXZA 2HBUA 3NKTA 5L36A 3VD3A 1XNTA 1ENQA 4UOJA 4P5HA 1QJX1 4K9SA 4XFCA 1JOJA 1Y43B 3VL9A 1EAH1 3ZX7A 3C8XA 2CWMA 5A32A 1ZPQA 3N9OA 3AKRA 4HN0A 4HPKB 5EJ3A 3MFCA 1DDLA 3VHPA 2VMIA 1G86A 2B5HA 3B9IA 5JPMB 2WUSR 2VTXA 4Q4Y2 5F3CA 3NRUA 5FK8A 1B35C 2G1MA 3AC0A 1PZ7A 1GSLA 5EQUA 4A6OA 5C8CA 3BOPA 5JZGC 2OVUA 1BQPA 4GWNA 4IE4A 4DEVA 2P4EA 4W6YA 4EK9A 1W04A 2GH2A 2ZEXA 2DYCA 2ZGRA 3CZUA 3O0WA 3P3PA 2P3IA 5CFDA 1RIRA 2A71A 1MS8A 1VBC2 4J1XA 2DUPA 3GGLA 3WDVA 3ZXDA 4B4PA 1LGNA 1YCIA 1QJZA 2UYAA 4DNYA 5BNNC 3VZOA 4PT6A 1IGOA 4AQ6A 1HV1A 2H0VA 5LCWL 4BMEA 2ODRD 3ZPYA 3DF0A 3TFLA 2VZSA 1PGL1 1HIXA 2M4HA 2PUEA 1FXZA 2XBO3 4BHPA 3ILNA 1CAXA 2XJPA 2RDQA 3QFIA 2R6QA 4Q0QA 5FPLA 3WVJA 4XW3A 1QJX2 5A3LA 2LLWA 4JCYA 3F2ZA 3M8LA 1Y9MA 5DDJ3 1VBB1 3B5LB 1UOBA 2OIIA 4IEZA 2O38A 1AYN1 5BYNA 1CIWA 1RUG1 4DRRA 3BVCA 4GH4B 2R043 2P2KA 4CDQA 2E6VA 2DCZA 3POWA 4YVSA 4MHRA 3T0AA 2DCYA 1OXCA 1AR93 3ZXAC 4PU4C 3QQ6A 2X10A 2XQXA 3TWIA 3MIFA 3M3IA 2YFZA 2P37A 1S55A 1UU5A 2R0FA 3NNLA 3RI8A 1GNHA 1DGWA 4CRQA 2R062 1ND3C 1PVC1 3NV2A 5FUIA 1V6NA 1UKGA 4IXLA 3BTYA 4OI4A 2GC2A 1FT9A 2OZ6A 3KS7A 5I91A 4E27A 1ZRCA 3MFAA 2EF6A 2C4XA 2C26A 4QQOA 4M00A 2B9UA 2W46A 2O8OA 1PRAA 3DYOA 4Q8KA 4LK7A 1L7LA 3AZYA 3O0VA 4QPIC 5JSRA 1HQNA 4XPVA 1PIV3 3B94A 4RN5A 1C4RA 5G05L 3DKQA 1PGL2 3B3QE 2HWC2 3NJZA 2TEPA 4JKLA 4WVLA 4MGKE 4IV1C 2YDEA 4QHZA 2EALA 2VM9A 4D7TA 2VBDA 4HXCA 2FDFA 5C9AB 4AEDA 4GWMA 1OF3A 1PVXA 2R7EB 4BXSV 1XYNA 1ONAA 3P1IA 4KNCA 1C1LA 1SDDB 2FMDA 3RZGA 4Q2JA 3ST7A 4Q1PA 3V56A 2RR12 2WAOA 4K1ZA 3B7MA 5T5LA 2QQPA 1LB2A 5C3PA 2WRAA 1F2NA 1X9PA 1PHMA 2D6MA 2WT1A 2RJ2A 1GOGA 4HPKA 5HV0A 1WUVA 2PXKA 1HRI2 4LO5B 4B3NA 2WDBA 1ZRFA 1TNFA 3DPRB 5A3OA 4A45A 4LXLA 5IYYA 2W1SA 3JXCL 3H8UA 3CIHA 1JHNA 2YC0A 1W9WA 3I97A 3MEPA 3HBKA 4LEJA 5C3SA 5DTRA 4JDMA 3ZHIA 1BDHA 2Y6FA 4YZ1A 5A6YA 1O8SA 1RUE3 1DZTA 3KVAA 3IIAA 1U2ZA 4BQ5A 2QQUA 2VUJA 3WF1A 4D94A 2A6CA 3JXSA 1QQP1 1QXRA 1UIKA 2GAUA 5HXVA 2I74A 4XFGA 4XJUA 3WP4A 1BK1A 1AR63 2DCTA 3PU3A 5BXXA 5FUPA 1AZDA 4P9LA 2E63A 1H2KA 2OA2A 1WLWA 3SCGA 2DWRA 3PMEA 4M0NA 1SFPA 4CUBA 1AR82 2KR2A 1REEA 4TLFA 4UW5A 5JXHA 2VQTA 1SMVA 2PLV2 3RWNA 3X29B 1RC6A 3MLLA 3KF5A 4ZONA 1KGYA 5GLTA 4NE9A 2CYFA 3A23A 2L1PA 4CYDA 2D6LX 2PN5A 1ASJ3 2DFBA 5T5OA 2D44A 4KG0A 5HPOA 3F52A 1YFWA 1LOGA 3NNFA 1Y9GA 3PDQA 1DG6A 3W9AA 1DP0A 1W2UA 2PMWB 3KCCA 1VB4A 3CECA 3AKSA 4PLOA 5AVPA 4JVAA 3N9QA 4XFAA 3WDUA 1POV3 4Y4YA 3UETA 1ND2B 1UCXA 1DQ2A 2FDJA 3KM5A 3PXPA 2XH6A 2PHRA 1UMHA 4JQTA 3PIGA 5IW0A 1LKNA 2ZACA 3FN9A 3UESA 1XBFA 3WNXA 5I0RA 2VO5A 3D6EA 2JKXA 3VKLA 1OA4A 4DPNA 3AFGA 3RPQA 1YIFA 4BWOA 2XONA 1O3RA 4IEPA 2V5YA 3RG0A 4H14A 1ODNA 1X7NA 5IVEA 4M3CF 3VD7A 1JYWA 1X2LA 4P9IA 2AENA 2O1QA 3KV9A 2VUAA 4XBQA 3VKNA 3JD72 3WF0A 4BA6A 2OUHA 3HR9A 4WVVA 5C9AA 2NLRA 2WC2A 3O12A 5ANNA 3GM8A 4PQ9A 2QZ2A 5FKCA 5FP3A 3HJRA 1BHGA 1R081 1SLTA 2JE8A 3ACHA 5JOXA 3H3UA 1AHSA 1H4GA 1O91A 3BODA 3J8F1 2ZEZA 1UMZA 4G9SB 1W6QB 4KWJA 4BMBA 4GKXA 4ZHNA 2OW4A 5IFPA 3LA3A 2VG9A 5DAQA 5T54A 4COZA 1N1VA 3POGA 3ACGA 4GWJA 4PIYA 3JZVA 1WCSA 1RVF1 1K5MB 4OBMA 1TMF3 4F8AA 3DPRA 3ZFEC 2HKXA 5A3UA 1DQ6A 3TEXA 4BOWA 4AFCA 1OQ1A 1SACA 4H7LA 4IL7A 4MXWB 4CDXC 1BJQA 1Q56A 1PNFA 1D0HA 1W2AX 1XE7A 3GDBA 2VVEA 3PLQA 4MLOA 4RL7A 2A73B 1QU0A 2AXZA 3MIBA 4QPGB 3SH3A 1G9DA 4HETA 1W9YA 4AVCA 5FZIA 4GMP0 1W6OB 5EHDA 3WX5A 4BB3A 4CCKA 1TG7A 3WW1A 5C8CB 1MR5A 3WP5A 2HWC3 3NL1A 4IGPA 1Y3TA 5ABJC 4ER3A 4LOSA 2GC0A 4IESA 3OG2A 5AVAA 5FZKA 2CNAA 3TB0A 4LPLA 4TWTA 1R082 3TAYA 1RUH2 4Q4X3 5FP7A 1GR3A 4DB5A 3PUQA 1IPJA 4FOYA 3PTRB 4NAOA 4N53C 2PQSA 4UFLA 2Q0AA 3ZYFA 2UY9A 1CD3G 2DVBA 1MS9A 5BNNB 3ZDSA 5LEKA 1A34A 1WLCA 1LHOA 2D43A 3OOXA 1ZS4A 4W65A 2G9ZA 3HT1A 3W20A 4YFWA 4NPMA 5FY4A 1RVF2 2Y6HA 1MZEA 2HWB3 1H8TB 3GBGA 1WCUA 3LA7A 3CU7A 1Z7S1 2PA7A 3PNAA 3VBRA 3VKFC 1HRI3 1S0EA 4TZDA 4O61A 4XAAA 4LLFA 1OLMA 4D6RA 4FOQA 4YG4A 2WINB 1UNBA 5FYCA 2NPIA 1GUIA 3HWJA 3T1MA 4DXSA 1TE1B 4CU6A 4XJZA 2YC2A 1CQTA 3SITA 3E1F1 3OUHA 5SV8A 4IEYA 1YQ5A 2VVDA 1S0BA 3MW4A 1JW6A 1ND2A 2JG9B 2WO3A 4XMIA 5APAA 2DF7A 1GWKA 4KBBA 3HT2A 1JHJA 2YY1A 5LWBA 1PRVA 4P00B 1R1A3 5D21A 1DYKA 2ZOEB 4J1WA 4MHUA 1WA4A 3E97A 1M06G 3TELA 1UKRA 5FY1A 1Z78A 3DL3A 2ZMLA 2RE9A 1OOPB 4JGYC 2TUNA 5IVCA 2FJRA 2HYXA 4PLMA 3ZYBA 1RUOA 1AR83 3N3HA 3E6BA 2FFHA 2IVJA 2YFUA 5EXOA 4YPJA 2BGPA 1W8OA 2VZTA 4QX5A 3MHZA 3ZXLA 2UURA 2BNOA 2ZHKA 3JXDL 2HEVF 2BOJA 4QPIB 3ZKYA 5K9YA 3M4FA 4X6QB 1HB2A 2BGCA 4Y42A 3QBQA 1J3RA 3K77A 4CCDA 2SLIA 4MO3M 3FE5A 1U5YA 1YXWA 3OD0A 5D2AA 5FWEA 2RS31 4SLIA 1BKZA 3NKGA 1UZYA 2GMMA 5EJZB 2ZX0A 4B4RA 1JYXA 1KDKA 5CU1A 1XE8A 5L9VA 1QP0A 4RA0A 4D7SA 5J1XA 1K5MA 2A3XA 2GC3A 3LEGA 1UU4A 2DFCA 4MXWA 2LRPA 3H7YA 3I2JA 4R4XA 3OQNA 3SKJE 3KSCA 5DUUA 4WM8B 3MIHA 1H2MA 4MVTA 4YWAA 4QPGA 3OUJA 1SLCA 4JDNA 4QDSA 4E8CA 1J3PA 4FPJA 2Y0IA 4YW6A 1W6OA 1US2A 4RQPB 3M1HA 4FSJA 3FFZA 3DEMA 1J58A 3IPVB 3CHXA 2OPKA 4NHMA 3THTA 4EV0A 2ZZQA 1GZWA 5H9SA 4CCMA 1D4M1 1E5IA 3RZLA 2CDPA 3VZLA 3OGSA 1W3VA 2JE7A 2YMZA 4M3CA 2KEJA 1AL21 1V6OA 3M9LA 3AM2A 5KR7A 1SDWA 4AVSA 3JQXA 3VBHB 1SFNA 2WL1A 1C5HA 3TRSB 4AQ2A 1DBNA 1NXD1 2Y38A 2VEOA 3SEPA 5BNNA 4MGTA 1MEC3 3OEBA 3W5NA 3MLFA 3NAPC 2VNRA 1GANA 2Y64A 1OLRA 1NCQB 2IU7A 5EWSA 1VBD2 1HXS3 2LS6A 3MYXA 1DWKA 1MFQC 2D40A 3RS6A 2J1UA 3OBRA 3I2OA 5GZEA 2F4PA 1H8TA 3GCWA 4Q4V1 4META 4YYOA 4HANA 4ER6A 5J7MA 2OXBA 4W4ZA 4K40A 2VMEA 1LHWA 4HMZA 3WG3A 5FWJA 5FK7A 1LEMA 1YNAA 4LKSA 1RL3A 2Q30A 1WBFA 2A70A 2JG9A 3B7HA 2RS13 5CNAA 1CONA 1LOFC 4IE7A 3B00A 3IDBB 3LDRA 5FIXA 1YI9A 3WD5A 2YU2A 1AJKA 2RHPA 3M3EA 3MUZ1 3NWKA 1OOPA 2OZJA 2XLAA 5I0SA 5CA6A 3JB4C 1JTZX 4UFIA 1OVSA 4NHXA 1HRV2 3ALQA 2D5HA 2AACA 4AI2A 2WS91 1SQ8A 5FBZA 4YVWB 4QPIA 2BRTA 3TNQA 2IFRA 2JG8A 5BUVA 4XF4A 1ULDA 3A0KA 1WLDA 5FZ6A 5K4LA 1RUF1 3AMNA 4IGQA 4ZS2A 1QHDA 5FZGA 2UWAA 1UMIA 2QQVA 3ETPA 4COVA 5FZOB 4Z07A 3IDAA 3KLSA 1E5SA 1EV11 4Z2WA 2ZAHA 1YJLA 2R1JL 1IKPA 4WZFA 1JFSA 1GP4A 4FPGA 3D0SA 4XIOA 5FPVA 3SH4A 1FOD3 5FUNA 5F9TA 4U36A 3H50A 1PMHX 4HK9A 3T09A 3VBRB 4I30A 3U78A 1YFYA 1XWRA 2FZ1A 2VW2A 3IM0A 1ZRRA 1MVQA 1R1ZA 2WKKA 1AXYA 3CEWA 3QLQA 4UYBA 4WM8A 2PHWA 5DZGA 3ZFEB 2BWCA 3RZKA 1AXZA 5FFOC 3FLPA 5LBBA 4AI8A 4Y1YA 1T2XA 3QF3A 4RQPA 2N7GA 4Y1XA 2QVSB 5JUWA 4X4GA 1PGSA 5B2GB 1OHFA 5FZCA 4XFFA 1CVNA 2HWE1 1DCSA 3OCPA 4FPHA 3R09A 5FZAA 2W87A 3AX4A 1QJY3 2XWJB 3OPTA 4GZ9A 4RS5C 1VBE3 1F35A 4ASKA 4Q5OA 3VBHA 1NLRA 2CAVA 3B01A 3PUAA 3BB6A 5A70A 1XB9A 3HNYM 1ZZBA 1W8WA 5AC91 4KU7A 1HQ1A 5JIAA 3ON7A 1NCQA 1R093 3R4DB 3SKVA 1W05A 2BZDA 2DVAA 4OUEA 4X6RB 4ZU4A 4CEYB 4FAHA 1Y7YA 1N47A 3WF2A 1UZWA 3T0BA 3T2TA 2EIDA 2NYYA 3FMGA 3JUUA 1LECA 2R073 1RUJ3 3H1MA 3MV01 3GCXA 1QOSA 3CROL 2BFUL 2WR9A 3K4AA 4JKMA 3T0DA 3UKVA 4JDOA 2UU8A 1Q8VA 2NP0A 1V9U1 3K3OA 3ITQA 5F32A 2IXCA 3BKZA 3ZMOA 3GN5B 1XNDA 5K8SA 1BCXA 4KH9A 1QPZA 2HWE2 2O8QA 5FMOS 4Z1VA 3NW4A 2A6WA 3ORJA 3CJXA 2XJ3A 2D6NA 1CIYA 4JV4A 3VZKA 4AEKA 4CP2A 2YUEA 5C70A 1COV2 5FQ0B 3I3QA 4XDPA 2XIUA 5CB7A 2O49A 2DBNA 4FT8A 1W8TA 2PHLA 3LEMA 4YVWA 4LO8A 2HWF2 4NDWA 2HWD3 1LQCA 5F3EA 3UJQA 1MACA 2ARXA 5E1RA 2HBTA 2RM23 4LOTA 5A7QA 3CF6E 2AWIA 4AFMA 2WNVC 5T52A 2YV8A 3MIEA 2A6VA 4HFSA 1PGW1 5FZOA 4BK4A 5DTQA 3S7IA 5FZ3A 4V2VA 3FYAA 1GNYA 1PO23 2VZQA 4C1XA 3NNGA 2AUWA 5A1LA 1BBT3 1VRH3 1XRUA 3FLRA 3LEKA 1OURA 4W50A 1QQBA 3LWCA 1F4AA 4XJWA 1L7RA 3C7EA 1OSLA 2QQIA 3RDIA 3O1SA 2CWSA 3ZFEA 1QJEA 2VXJA 4BDVB 4QAWA 2ZMKA 4PIXA 1YUDA 1W39A 2BVBA 4E4HA 2K0GA 3HBZA 1PERL 3OGVA 3THPA 3VBFC 1K42A 3FLTA 1C8M2 4O65A 4QB6A 1SBFA 4GXLA 1C3HA 1W6PA 3KMHA 3VK0A 3TN91 3WW2A 3R4SA 5K0UC 1X82A 3FUOA 2P6HA 1OKOA 5JXGA 4EN9B 5T3NA 5CKQA 4FFFA 1V6LA 3FZ3A 1GWLA 2WLPA 2ZZJA 4QKFA 3POSA 3VZJA 5A7SA 1OKQA 1YFXA 4FTBA 1VMJA 3G6JB 4ES9A 4CEYA 4S2DA 4HK8A 2W52A 5FXXA 3S5QA 4P9WA 2VOXA 1POUA 1WWYA 3GXUA 2XJUA 5LEJA 4O7XA 4R9AA 5FZ0A 2XBO1 2OQ6A 5HCBA 4XJ8A 4Z59A 3RMXA 5KBFA 3DCQA 2FQPA 3WG4A 4W8JA 3WT3A 1WZXA 2DBIA 2J7MA 5E16A 2W2IA 5DDJ1 1MS0A 1SPPB 1W9TA 4Q27A 4EWDA 1QJU3 2XB6C 3UT0A 5A3MA 3W58A 1PZ9A 4Y5TA 3OQOA 3GN5A 5FYZA 2NM1A 1QEXA 1W90A 3WP6A 3BDNA 3ZM8A 1JZ7A 3VBOB 1WW5A 3C3VA 1AR91 2VECA 2D5FA 3KHBA 3OGGA 4IV3C 3TN92 4Y20B 1ZX5A 3HNBM 4URAA 3POYA 4AGGA 3E6CC 3GYDA 3L2YA 5FZ7A 4E4DX 1ZBA3 1NOVA 1UYXA 1AR73 1DF0A 1J1TA 2CAUA 4UI9L 3DECA 4YLZA 3UKNA 2IVGA 2A75A 2PXLA 2WSVA 2RJKA 3POEA 1D4VB 3IIIA 1HF0A 3LA2A 2XVLA 1YLLA 2QE3A 1RUD3 1YEWA 3AP6A 1WGPA 2XKPA 3ENRA 2E7TA 1Q8OA 1UZZA 1PIV1 3H1WA 1F15A 1LOCA 1TME2 1YQ2A 4LNVA 1HN0A 1BVVA 5FYYA 1O3TA 1BZWA 2XR4A 4OULA 2LYQA 4PDWB 3JB8A 2E33A 4I3GA 1XXNA 2ZGSA 2ZHLA 3TNPB 5GLVA 3GNEA 1G9CA 4LMFA 1GT0C 4XFBA 3AZXA 4EN8B 5TSWA 2KEIA 1U5IA 3C7OA 4L99A 3ACIA 3THDA 2JIJA 3IBMA 3ZN6A 4RHV1 4DY5A 1VB2A 4GB31 5GKAC 1NEQA 2ZX2A 1DLCA 3H42B 4OZOA 2GMEA 3SLIA 4BZ4A 5BNPB 2WYFA 4NROA 4CCLA 2LM3A 4MGSA 5ACA2 1PO13 4JRLA 3JBG3 2B45X 4UBGA 4Q0UA 4AL9A 1GZCA 4EN7B 1E5HA 3DYPA 1BLZA 1JYVA 1MPXA 3K51A 2AYHA 4AR2A 3AYCA 3OBAA 1LOBA 2WFF2 1S2KA 3WNNA 1RUE1 3EJKA 3VDBA 3AKPA 2JB4A 1LCLA 1JYCA 2VBPA 2WO1A 2ZEWA 3H0OA 4RS5B 4BQWA 1OF4A 5C71A 2H8RA 3S8QA 1Y7BA 3S57A 4MX3A 3WSOA 1Q8QA 4LBQB 5FP4A 4GA9A 1DZRA 3DKWA 1RMU1 2HFZA 5JOWA 2G19A 1VAKA 3NXHA 4XAEA 1XQNA 5HCFA 4M4RA 4RHV2 1KS4A 4CP9B 1RHI3 1YQ8A 2GP3A 5JOZA 3PHMA 3ZSEA 4LO4B 1RUC3 4YZ4A 5GALA 1I1EA 1SLBA 5D8AC 5FYMA 2PHTA 5BY5A 2PUFA 1KJRA 3RJ2X 1FAYA 2I2SA 2R49A 2D3SA 1ASJ1 3MV11 4QX8A 4AI9A 3DV8A 4ITCA 1LOAA 2VCAA 4FFGA 3ZIXA 1PM4A 3DN7A 5ISLA 3WNPA 5LBCA 3VBOA 3IN9A 3I2GA 2MEV3 3OJBA 1SBEA 4IQPA 2X5IC 4NHKA 4XUPA 2GNMA 3GHMA 4Y20A 5KWRA 1POV1 4YZ3A 4BJ0A 1MZFA 1SEFA 3PVOA 4BQYA 1BMV2 2BBAA 2WNUC 3K3NA 1ZBE3 3WQBA 3MBWA 2KA3A 4DXZA 1FYUA 2BNMA 2JDHA 3U3WA 1QDCA 2XL9A 4YW4A 1GQGA 5FZ8A 5LATA 4A6SA 5E8AA 1YI7A 4AAPA 4COUA 4COWA 3O1TA 1VP6A 5F7UA 3L9JT 3FHAA 3I7DA 4AG4A 1TZOA 3O1MA 4PDWA 3ELNA 2OT7A 4S2FA 4G4FA 2JD4A 2WSUA 3NJXA 3MPBA 3LOBA 5FMCA 3OD4A 1CX1A 3SX0A 5CFCC 4OI0A 4GQ7A 5F37A 4WVZA 4KQ7A 3RSJA 1WW4A 5GLUA 4YSFA 3GJBA 5DXDA 1UQXA 1PK6C 4XJ9A 5FZ9A 1NKGA 1IC8A 2YBPA 5FY8A 2JDPA 1AUYA 4INDA 3RQ0A 2KPJA 3VLBB 3BI3A 1EFAA 3A7QA 4LHLA 1ZYBA 3PURA 4GALA 2JXAA 2Q8CA 2VZVA 1EAH2 4IEOA 4YM2A 5GZFA 4NWWA 5BNPA 3BCWA 5DMYA 1TMF1 2XJQA 4ORFA 1NE4A 2XVKA 1WIZA 2E53A 4RR3B 1JZ3A 1F9KA 1O3SA 5JWPA 1PMJX 2W9XA 2QQJA 4FFIA 4FQZA 4BQ4A 1V6MA 4NVPA 2B39A 4Y5SA 4I6RA 1OC1A 1IS6A 5JR7B 2B9VA 1G7YA 4B1LA 1JUIA 2ET7A 1S0FA 2KXLA 4MOAA 4A3XA 4C0HA 3GF6A 3BTAA 3KB5A 3CDZB 5FZBA 3ILRA 3MZHA 3V0BB 1RYYA 2X09A 2ZGQA 4LBQA 4LBMA 4XFIA 1FPN3 3U37A 4D8MA 5LA0A 2VPVA 1GKBA 1V0AA 2Y60A 5L7OB 4Q4X1 2K9ZA 1IS4A 3OMTA 4Y1UA 1LRHA 1MS1A 1WMXA 1S7EA 2E31A 5F2WA 4AXOA 3PE5A 1WD3A 2B5AA 1O59A 2MEZA 2GH8A 2GSYA 3MF6A 1UPSA 2Q1MA 1VIWB 4YW7A 3ZYRA 4JKKA 1RUI3 1VR3A 1LCDA 2LCVA 3GUUA 1PMIA 2WQZC 4QXBA 2PXEA 1ZNPA 1DGRA 1KQRA 5FZ1A 4CXWA 2VE1A 2VZPA 3ZHMA 2HWB1 3CNAA 1VBB2 3HOBA 3VKOA 4HBNA 1AYN2 4IETA 1RUG2 1T6BX 4XQWA 3AK0A 1TQ5A 4Q4W1 2XG3A 2XJSA 4H55A 1NUKA 4QX7A 1O7FA 4YW2A 2GP5A 5I0UA 4CPBA 3RZMA 1WLTA 3MIGA 1XU2A 1NQDA 2Z42A 3Q8BA 3ECQA 5E6HA 1BEV3 4Y24A 2VTXJ 1UXDA 3D1NI 2BWAA 1CGPA 2RS53 1R1A1 4IV3B 1PX3A 2C1FA 1PVC2 2AZ5A 3OB8A 1W6MB 2CY6A 1RITA 5JOYA 1U0AA 3AL6A 3LOIA 1G9BA 1VLNA 1OVPA 3F51A 4FPCA 2YXSA 4N43B 1OH3A 3VBSB 4CDWC 5C33A 1DW9A 3ZSMA 5IK8A 4LHSA 1UZVA 3HPNA 3NMBA 5C3QA 5JMOA 5HBAA 2OPWA 2VOWA 5A7PA 4OUMA 4OZXA 5I8TA 2R1DA 3KF3A 2B4KA 1JMUB 1JH5A 1NCRC 2B8MA 4KI5M 3O5SA 2H6BA 2DUOA 2Y34A 4DXTA 4NIGA 5H9RA 5IATA 3PVEA 1LEDA 4NHLA 4WM7B 4NIDA 3JU9A 2VAUA 2NN8A 1FATA 4HL0A 2E51A 4JGZC 2W39A 5JR2A 2PAKA 2JECA 3W21A 4EWAA 2VCCA 5FZFA 1I5PA 5L9RA 1DQ5A 4CCCA 2P3KA 2VULA 4R52A 5FJKA 1A8MA 4YG7B 2EIEA 4GH4A 1C28A 5FMDA 1W8ZA 4CDUB 3NV4A 4RR3A 5DUXA 5KC6A 3T4HB 1MQTB 3CO2A 3IDEA 4Q4Y3 1O5LA 5KXBA 3T3YA 1NA1C 4YBAA 1IHMA 1KS5A 3J7NA 1UYYA 1U5ZA 4CEWC 1HN1A 1LENA 4BK5A 2WQ8A 3ZFGC 1W9SA 1EYBA 1QQP2 4QD2A 5A6QA 3V0BA 4PQQA 3CQOA 2BVVA 4HOOA 4NR1A 1RJ7A 5BNOB 5HI0A 1VBC3 3TYJA 4LUMA 2HEYF 1RZRA 5L7OA 4BQXA 4YM3A 1DLLA 2YHJA 3S30A 5IJRA 1KITA 1D2QA 3O0XA 3CLPA 1GQHA 4HLTA 3D4KA 4QQHA 2EVXA 4EQVA 1MEC1 4FAGA 4XUQA 2ES3A 3HQRA 3ME2A 4XTMA 5DG1A 5FYBA 5C3OA 1QJX3 1JZ6A 4IEVA 1HJGA 2LNMA 2KZ8A 2A3YA 3OTFA 2VGDA 1JUHA 3AMQA 3MLJA 2ZGMA 1IKQA 4HN1A 2K2SA 3GZUC 5L73A 3HAGA 2WT2A 2KEKA 4A7KA 2SBAA 2V73A 1TVGA 4YARA 2RS11 3LD8A 4UXAA 5EYXA 5FY0A 1V6IA 3ZR5A 4DIQA 4IV3A 3B02A 4HONA 5CYYA 5JUVA 2QQKA 2R063 2VUDA 5A3PA 3BU7A 2NZ9A 3D82A 3B69A 1VBA1 4N43A 1WBLA 3VBSA 2FDIA 4WZCA 2WNUB 4NIIA 3WF4A 4HSLA 5IK5A 2RG4A 2IVBA 4XBLA 2B42B 4ET7A 2LYJA 3SHRA 4XEZA 3BS3A 3IAPA 1OQDA 1W8FA 4YM1A 4Q1RA 3GZEA 1B35B 2CGNA 4LKFA 3P5BA 5KXEA 4K8FA 3ZN4A 2EF8A 4JQRA 1ZUGA 5JZGB 2C5DA 3AMMA 1K5JA 1XE0A 2D7FA 5FYUA 3VDDC 5A3WA 4AI0A 3F95A 4KWLA 4Q2FA 5G04L 1FNZA 3O1UA 1LODA 5T5JA 4WM7A 3SCHA 3I2FA 4MCXA 1RUNA 4CUAA 4AWDA 4LITA 3J8F2 3BU0A 3CKHA 2RR13 4BM8A 5J48A 2NMOA 4P9GA 3SNMA 2QQNA 2WLQA 3H3ZA 4CDUA 3VZNA 1OD5A 2DTWA 2O0OA 3ZFFC 3N4MA 5F6LB 5IFTA 1MQTA 4ER0A 4JTNA 2FCVA 3LFIA 4AF9A 1IOAA 4XZUG 4XF9A 5T50A 3AJYA 2JB8A 3BUCA 3OWQA 4FPFA 3SMHA 3U14A 3O1RA 2JDAA 1S4CA 2IVQA 3U11A 2AUYA 2WIUB 2MNGA 2WWJA 3WDWA 2L8NA 1AXKA 4EYUA 4HG6B 4QMAA 2ORXA 3WINE 5FLHA 2VW0A 1EUUA 5BNOA 1ND3B 1QJY1 1JODA 1XSQA 4PF5A 1VBE1 5FPZA 3VBUC 3NNJA 3IMNA 4OQ8A 4FPOB 2DV9A 3FWEA 3ZSKA 1GZ9A 4HSJA 5IAXA 3U75A 2C0ZA 4I01A 2UWCA 3LF7A 1VMHA 1R091 2PLV3 1PX4A 1CJPA 5LZ6A 2XPJA 2XUMA 2RDSA 4E8DA 4OHYA 1PNRA 4IE6A 1ENSA 4PU3C 1O4YA 4HZFA 1PRUA 4IV1B 4AFAA 5LBFA 1Z7S2 2XJVA 1OA3A 2ZGKA 3GHNA 3IT8A 5IK7A 3E6DA 4Z8BA 3UGFA 1YWKA 2XVGA 1OCTC 2R1BA 1W6QA 2R071 4CUCA 3UNPA 4R9CA 1RUJ1 1STMA 4KBZA 4A42A 2ADEA 4K21A 4CE8A 2CTVA 3KCXA 4LK6A 2BGOA 3MI8A 4IW3A 1BYHA 4P5YA 3J9SA 2HYKA 4R4ZA 3N9PA 4QPWA 3G5GA 5F5CA 4X4BA 2V4AA 3CJIC 5FO7B 4IVZA 4Y22B 2JEMA 1A6CA 2IZWA 3NSTA 4ZXEA 3LIGA 1RIOA 2VQUA 1LOEA 3OKZA 2WZR1 4V2WA 4QGNA 3FMYA 1B35A 4QXKA 1VAVA 1N3QA 3JD73 5JZGA 3AKQA 3WNKA 1OBNA 5HV4A 4ZS3A 4ARXA 1W0NA 1UYZA 2VL4A 3WOGA 1J84A 2JQEA 1DIWA 2Y26A 3TEWA 2J7WA 1LAJA 2KM2A 4L8QA 1FV3A 3WNLA 1W6NB 1U12A 2RS32 1IPKA 1CPNA 4JZRA 5CIRA 2AGSA 2ORZA 3U0ZA 3LISA 4LUKA 1BVP1 2VZ3A 2ETEA 1PO21 1LLIA 3N7KA 3QOPA 4NHYA 4OUSA 4XF1A 3SEEA 4AGVA 1QH7A 3O1OA 5A1FA 1BBT1 1LGCA 1OSGA 1REFA 4HRAA 1XNCA 2P34A 3BPZA 3LGRA 2XHNA 1XNAA 2Y8KA 4I09A 2BOIA 5FRAA 2Y6LA 1H1AA 1UW8A 2DCKA 2JD9A 2QJVA 4BE3A 3AJZA 5FOBB 3VGIA 1O6UA 4L2NA 2PYTA 1UY3A 4XZPA 4UBHA 1ENRA 2YYOA 2V72A 4K3UA 2WZR2 1NLQA 2B7YA 4JRAA 4PJYA 4I8TA 1NA1B 2VC9A 4HVOA 2XL7A 2O14A 2PQQA 3GZDC 4XMAA 4BQ1A 2J1EA 5HXMA 1CQ9A 1D4M2 4LBLA 1ND3A 2VVFA 5IVYA 3E5QA 5FPBA 4CVUA 1REDA 2NQYA 1A3KA 4D7YA 1AL22 1S0IA 1SLIA 2Z79A 4MV2A 5EZWA 1UY4A 1R083 3PJYA 1BXHA 2PE5A 1RUH3 4NIHA 5FZHA 5C4WC 2D6KA 3KT4A 2ZGLA 2ZX1A 5DG2A 5DN2A 2W5FA 1Z0HA 3VD9A 3K46A 2VTFA 1CWPA 1H1MA 4JHZA 5FZLA 2A7AA 2B46X 4D0QA 1AX2A 1SHWB 2JCGA 1KD7A 4P9JA 1KJLA 4IV1A 1ULCA 2VNOA 1RVF3 1MS4A 4Q4V2 4MG2A 4X8NA 1SZBA 2J1SA 5FDBA 2PUGA 2BQPA 4OHXA 3C7FA 3I59B 3UV9A 3AMPA 2R63A 4P02B 4WV8A 3A9ZA 4BCUA 3MDPA 4QHBA 1XSRA 2WJSA 5LW9A 2VQAA 4SBVA 3FFQA 3IAQA 3RYPA 2O4AA 2VNVA 3MIDA 1NAEA 4IE5A 4LBKA 4Q0SA 5FYHA 3U07A 4I2OA 1XYOA 3K4ZA 2ATFA 1UXXX 2Q5TA 1KRIA 3RZZA 5K98B 2BNNA 2WWUA 2BV4A 4Y22A 4PF1A 4XXAA 1ZA7A 1POQA 1JS9A 2QQMA 2JX9A 3KV6A 2OS2A 4Q29A 3H8XA 4AAXA 2OQ7A 4L0PA 4CDXB 4AQSA 1ZBA1 2A5ZA 2QDNA 3IPVA 4AE2A 3TBDA 1X8EA 2WS92 4AHYA 5DRTA 2WYSA 4NIAA 4QDRA 1N1YA 4OHVA 1XNBA 4JX0A 2IFWA 3K48A 3NNMA 3FX3A 1LU1A 1OLQA 1RUF2 3ZDVA 1R63A 1QNYA 5ABJB 2JJ6A 1WD4A 1W6NA 1HV0A 1OD3A 1A78A 2VZUA 1PNGA 4FI9A 2UWBA 4M0HA 2ZXQA 4E2QA 5JVVA 1EV12 2D6OX 4EZ4A 2IXJA 3AXEA 3ZIWA 2VZOA 4N53B 2FCUA 4CDQC 1AL0G 1RXGA 4YVSC 1GV9A 1B0NA 4FP3A 2CSGA 5CKNA 4YFZA 3UGGA 3H8OA 1MZ6A 4NPLA 3GZAA 5A7OA 4BYYA 1WH6A 2CSFA 4QDQA 3LPGA 4W6XA 4LO7A 5FYTA 5KHGA 3ZFFB 4V1PA 2Y6KA 5FREA 2WO2A 4XUNA 2BP6A 4UAPA 4CTEA 5DAWA 3EYPA 1PO11 5GZGA 1NA1A 3JBG1 2TBVA 1AYM1 3WNMA 4AZZA 4X4FA 3VHNA 3VHOA 3ACFA 3WR0A 2RMU1 1HLCA 1UY1A 2Y6GA 3POJA 1GBGA 4QQPA 2J1TA 1ZZ6A 1FI2A 2ARCA 4XHBA 4HKLA 3UYJA 5DAPA 1WCDJ 2VZ1A 2VJXA 4QKBA 4AEDC 5AC92 4N7UA 3KXAA 5FZEA 2QZ3A 1VPWA 1ULOA 4JGYB 4B7KA 1FMD1 3I4IA 4CCNA 2VXRA 1W0PA 4NRQA 1VBD3 4U2AA 1HQWA 1H0BA 1NT0A 2BUKA 2VNGA 4LBQD 5DRYA 1JYNA 2Q8OA 1YO8A 3ZLIA 2DU0A 4LJHA 3WNOA 1RHI1 3I59A 1RUC1 2HCNA 4ZXKA 4OMDA 3U4SA 4AVTA 1JZ5A 4DE9A 2ZA9A 1QXPA 1ENXA 5DZEA 4QQLA 4L9BA 1SFYA 2VBBA 1DZQA 1QGLA 3GJAA 2YBSA 2EXHA 4UWDA 1Q5OA 1V9U2 2PTMA 2VOVA 4LBNA 3UJOA 3R4UA 4EKGA 5F3IA 3TEZA 4X4EA 1OQEA 5DSXA 4AVAA 1OFSA 1Y4WA 4Q0PA 1E5RA 2RMU2 3H9AA 4Y33A 4NOTA 4CPBD 1UPIA 4XTPA 3EXUA 4XUOA 3HQXA 4CDXA 1DGLA 2RDRA 4FXKB 1DYPA 3I3BA 3H8RA 4ER7A 2PXTA 1ZBE1 4DRVA 1X57A 3OGJA 1R69A 1HRV3 1Q8PA 4XQDA 3WW3A 1C57A 4Z5CA 1FMD2 2AREA 3V64A 2FDGA 2WA3A 4A7ZA 1ZZCA 2IWGB 4LA2A 3M70A 4BLJA 2L49A 1POV0 4RGKA 1JOBA 1ST8A 3V0AB 4NMIA 1H2LA 5ABJA 4JCKA 3USSA 5DUVA 4IGOA 1PGW2 5BPXA 1W99A 1UX6A 2LYKA 4OMCA 2QKDA 4CP1A 1NW3A 1CJGA 2ZGPA 1C1FA 2ZPXA 3ABZA 4KG8A 5KHIA 1GWMA 4LE4A 1L7QA 1QH6A 4N53A 3URFA 3ZYJB 1AX0A 3RYRA 3NAPB 3SCFA 2R16A 3U10A 2PHUA 1QKQA 2PXDA 1LULA 5EV7A 1V70A 1SQ4A 4GMP3 5IVJA 2ZGUA 1CAWB 2DVGA 2WABA 2Z69A 3ZSLA 3JCIA 2QBXA 3RWKX 1GMMA 3PIJA 3VUOA 1EPZA 3NV1A 2OFYA 4LHKA 5HCAA 3RGBA 1H9WA 3Q8FA 2VMDA 4PHZA 3V65A 2VU9A 1MVEA 4WBBA 3WW4A 2IUOA 4OB4A 3KQ4B 2IXIA 1DULA 2PHDA 3AXDA 4OFGA 4BH9A 3BIWE 2BU9A 2R041 2PAMA 3ATGA 5IUQA 1LESA 2WS93 2VH9A 3BTXA 2VD7A 3VDCA 4RYDA 4UW4A 1D7PM 1URXA 4PI2A 3UK9A 3DGTA 1RTVA 2K46A 5EIYB 4A4AA 5LA1A 3G7DA 2JDNA 1CX4A 3EQEA 3RZHA 5FQ0A 2PIJA 5C9AC 5FPXA 2D93A 4JHTA 4Y4RA 1NYWA 4JGYA 4B29A 4I6UA 1XC6A 4YGDA 3KL4A 2DURA 5IVBA 3O1VA 3ZXKA 3IVPA 3N7MA 3KCYA 1HB3A 3LZZA 4XCBA 1RZRD 2J42A 1WCKA 1JWLA 2GNBA 4AEJA 3NROA 2XBO2 5JCTA 3O7OA 1UWWA 3RJRA 3ZXFA 1CZVA 1VPHA 2ILMA 4CA9A 1RUI1 3KJXA 1X36A 1O4TA 2WAAA 2ZAAA 3DPRC 2VY0A 3DXTA 5F1RA 1SLAA 4X4DA 1QP7A 1NZCA 4YG0A 5DDJ2 1DQ4A 3N9NA 3ME5A 5CG8A 4XJAA 4URTA 3KVBA 4I02A 2R042 3D5OA 3NJVA 5FOJB 2VMHA 2C24A 2PUBA 2KD7A 1AR92 4UW3A 4DINB 4F83A 5A3NA 2ID4A 3LE0A 1J83A 2HWE3 4B8EA 4MGYE 4AHWA 1BEV1 1S0CA 1RINA 3WHUA 3GZTB 3ZKCA 1ZM1A 1COV3 4OHWA 4FTSA 4QX3A 3APBA 2C6SA 2ZABA 3DNVB 1L3JA 4OYUA 4MGIE 3VHRA 5LY2A 2PXVA 2HLEA 2HWF3 4YW1A 1W8NA 2JVLA 1I6XA 3FHIB 1QOTA 1Q43A 3HNMA 3N7JA 5SV5A 3V0AA 3S5AA 3LKJA 5EYYA 1OMIA 2GRMA 2YBDA 1KFUL 3CBNA 3AMHA 3H1YA 1PIV2 3KD4A 3WUDA 4KWKA 4CZSA 4EN0A 2ARAA 1K45A 1Q3EA 5GAHi 3DXUA 1ZZ9A 3T2OA 1AR61 3MPPG 3AP4A 1QZXA 1CN1A 2YBKA 4S2GA 4B4QA 3NAPA 2OR1L 5C6CA 3TEYA 1YFUA 2QNKA 1I9RA 4OCTA 1J1LA 4P9YA 5JI9A 3SC7X 3ZYGA 2W08A 5KXDA 1HDKA 1GFF2 1CAWA 1UOGA 5GM0A 3KZ4C 4GB32 3GBWA 4YVSB 3HIFA 1LCCA 4XILA 2I45A 2VQ0A 3HZIB 2VMGA 3WXPA 1GZTA 1SPPA 3ETQA 3NZLA 4AFBA 2OYZA 1US3A 3ES1A 2IC1A 2YGLA 3IZOA 4I0WB 4IUGA 4N90A 5CKMA 5GJ6A 4B7EA 1J59A 2XLGA 2DCJA 2JWPA 1YIPA 3PVNA 3LDKA 5I0TA 1C8M3 4Q4Y1 1LOFA 2E9QA 2CDOA 2JDKA 4NJ4A 3CZJA 4XCAA 1ZA4A 4DEQA 1RUE2 2GN3A 3L1PA 3P6BA 4QWNA 4YG6A 1LHUA 2W92A 1N3PA 3OY8B 4MADA 4CCEA 4ES8A 3NJYA 1VALA 5BV6A 3AB0A 3O1PA 2FZ2A 1GU3A 1VBC1 1QJFA 1X33A 2LROA 4XFHA 5I93A 5IK4A 1RMU2 2JENA 4QXCA 1F8VA 4H3WA 4YW5A 4QX2A 5F3GA 4XDQA 2PXPA 4A44A 2L9LA 4AHZA 1OT5A 2G4IA 3FHQA 5FBJA 4HKOA 1B09A 1K5MC 2WNVB 5JDBA 2PXQA 1ASJ2 2XWBB 4GKYA 4OHZA 2W94A 4LKDA 4Z92B 3KGZA 1I3HA 5FP9A 1IG3A 4Y26A 4PI0A 4EN6B 3UKTA 2UY8A 5LASA 3W5MA 1O8PA 3H5TA 1JBCA 3OPWA 4QPYA 4QPGC 3ZPOA 5KHKA 3Q8AA 2FDKA 1ZVVA 3AFKA 3D8CA 4XUTA 2J1RA 2BW8A 3TN93 5C8WA 3WG1A 5JPNB 5C8CC 4ZY9A 4C91A 2C9AA 2V09A 5F6KA 3VKMA 3ZOIA 2R061 3OYWB 4M3CE 3FBMA 3CLCA 4IERA 1AU7A 1W03A 1ZREA 2XHKA 5FMOL 2YROA 1Q8SA 1F31A 3K2OA 3K4DA 4FXGB 3QOWA 2WA4A 4FOVA 4PLNA 5J98B 3VBFB 1AVBA 2WO7A 4MSVA 2ET1A 2VCMA 2VUCA 2J1VA 5L9BA 1CJDA 4QQ2A 3OUIA 5K0UB 3A4UA 4RS5A 3OPZA 1TME3 2XJTA 4D6SA 1LJ7A 1QXJA 2HWC1 3J7HA 3I3MA 1H8TC 2BTVC 5FJHA 4BU2A 3I49A 2E32A 1W2OA 3ACLA 4UFKA 2D3RA 3ZSJA 4A3ZA 4X4CA 3NO8A 5GLZA 2Y33A 4YGBA 1UO9A 4QX0A 1NZIA 2JG9C 2AXUA 2RR11 1IQAA 2ZJCA 1O3QA 3KV4A 4NRMA 4UFHA 3M3QA 2HCSA 4NN0A 5IAVA 3OF1A 5HCHA 1QOOA 4LTAA 5D1IA 3R0RA 2ZGOA 2PHXA 4F8DA 1TMF2 3MF9A 2PAEA 5F8PA 4ZZ8A 1HRI1 3OGRA 5EP9A 4DY3A 5ACA3 3SQOA 4XHXA 1OOPC 2V3CC 1WMEA 5FTTC 4LQRA 2EAAA 3KWVA 4GULA 3NV3A 2UYBA 2HEWF 4DXRA 1HW5A 4Z58A 2XXPA 2WFF3 4ISQA 2W0XA 4QB2A 4FOWA 4XF0A 4CXXA 5FR3A 1JH9A 2JG8C 3DUIA 4I0AA 3OY8A 2XDVA 3N9MA 4E4SA 5JXIA 2EIBA 4QU1A 5JMCA 5A1AA 4N9IA 5DTMA 1RXFA 1JI6A 3T30A 4Y1ZA 5J37A 4Q4X2 1AR81 2DDUA 1H30A 2BPA2 1H8VA 5FYIA 3FUQA 2GMPA 4RHV3 3SXWA 4B1MA 4AYUA 1OH4A 1GNZA 2PLV1 4GB33 2WNVA 1WW7A 1YQ6A 2ARBA 3AVRA 4QM8A 2QQLA 1ACCA 2GN7A 3QH7A 3EMRA 2HWB2 2WZPP 3TOJA 4CXYA 2I07B 2XOMA 4WM8C 4KGQA 2XXQA 4Q4W2 4I3PA 1NQJA 3QCWA 4AK3A 4EZIA 2ZBJA 2IXHA 3BYWA 4XABA 3ZYIB 1AX1A 4BLIA 4RQPC 3LB9A 4UT5A 4EJRA 5FZDA 3VL8A 2LW8A 1UAIA 1V00A 2YU1A 2XUEA 4XXPA 3RFRA 3WG2A 5I0DA 2H6CA 3OYWA 1R1A2 5BNQA 1FNYA 2P5BA 4NO4A 3HEIA 3FJSA 4MYEA 2ERFA 3VBHC 1D0GA 3BD1A 3PUSA 3QH6A 1CAUB 5JSOA 5CVRA 1ZZ8A 2GZUA 4YGEA 5FPUA 1W28A 3VBFA 3WZ1A 1JZ2A 1RMU3 5A3TA 1NCQC 5K0UA 3RRDA 4IEUA 1W8UA 1OUSA 4ZU7A 1JFTA 4JCXA 2XGXA 1RGSA 3JD71 4QT6A 2WNOA 3PJQA 3ZN5A 4CU9A 3GBFA 4FPYA 5ERLA 1WMDA 3MW2A 2WZEA 3BN6A 3WDYA 2JICA 4DS0A 1HKDA 3AYAA 3LCPA 1UN1A 2ZMNA 2X29A 2Q4SA 2W95A 5A33B 5GZCA 2G9FA 5EPAA 2YG0A 5FP8A 2PXBA 3IWZA 2P6CA 2GZWA 2LYSA 1I5ZA 4GJZA 1HXS1 1XPWA 5FY9A 1BDIA 3KGLA 3BPSA 1H1IA 1EAH3 2EWTA 1K12A 1YHFA 4IWRA 2J7UA 1OFNA 2JDYA 2OUJA 3L2HA 3OEAA 5D8AB 1LHVA 2EXKA 5CG9A 5F5IA 3A22A 4LIVA 3KQRA 4QGMA 2Y6JA 4KWUA 1GQPA 4AQTA 1ZZ7A 2BYVE 2GNDA 2V4VA 2R32A 1YYNA 4FQ4A 4E9KA 1QNWA 1OUXA 2AC1A 2Q1FA 1VE0A 1BK0A 1ZRDA 1TEIA 4YVWC 5F2SA 4IDZA 3RI9A 3ZPXA 1WW6A 2X5IB 3ZMNA 3KHCA 2BERA 4IEWA 1W6MA 2FD8A 3CL1A 3T1LA 4F3JA 3UL2A 2CL2A 2AEYA 2VMFA 3MLKA 4FBFA 4NUBA 3I3DA 3HN1A 2EIGA 5FXVA 1RPEL 1RUH1 4IE0A 4K20A 1MEC2 5IT6A 1QQAA 2W91A 3HD8B 3Q8EA 3AZWA 1HXS2 2D97A 1NE6A 1XNKA 5FV3A 3VBRC 1WETA 3I54A 2BFUS 2GRLA 2ZTNA 4QHOA 3W59A 1HB1A 1UIJA 1VBB3 2GALA 2QQOA 4O8BA 4LBJA 5CZKA 1E3OC 1AYN3 1RUG3 2W47A 2QTWB 4UF0B 3VN4A 1QB2A 2VMCA 3LSEA 1YSEA 4FN3A 1SLLA 4FFHA 4BIFA 4EWEA 1YQCA 4C0BA 5T55A 5CFCB 1LHNA 4LORA 4EQZA 1OPMA 2W1QA 3ZO0B 3ILFA 3ZYPA 5CAZA 3VZMA 2RS12 1PK6B 3D3AA 5CBLA 1HJFA 1FOD1 4Z5HA 4AGRA 1WMFA 3NQHA 1PVC3 5J36A 4DUXA 5F5QA 1HB4A 5A7NA 3E5XA 1GZWB 1CAUA 2PUAA 1VBA2 2LALA 1UOJA 2YZ4A 4PU8A 4XC9A 4D3WA 4TTGA 5A7LA 4M3CB 3PTYA 1W3XA 2QFEA 4JAAA 4R9DA 3ZKUA 4BPZA 1DQ1A 1JU4A 4I0BA 4MGQA 2H0BA 5C5TA 3T08A 4X8PA 4Q8LA 5FY7A 4MCTA 4EKIA 1IS5A 1GP5A 3I2HA 4MZUA 2EBYA 4UW6A 5LBEA 4CEYC 2WWSA 1KEXA 4GHJA 2J1AA 2W68A 4Z82A 3S7EA 3PUHA 5FAXA 1ZVFA 4OLLA 1XOYA 2G9GA 4TYSA 2LTNA 2VW1A 2ZS6B 1V6KA 1N1SA 3FL7A 5DQ0A 1NXMA 1QY4A 4NPRA 3I2KA 2BEOA 5A33A 4LKEA 5AFBA 1XJAA 2RJLA 4Q4W3 4E4ZA 4CCOA 2F4LA 5T5PA 1K3IA 4L11A 5EFUA 4RGGA 1M4WA 3P3NA 4Q0VA 1FOD2 3R1FA 5D8AA 2EAKA 5A7WB 4OI1A 3U1XA 2WQ4A 3C2UA 1RJ8A 3LFPA 4HVQA 4LT5A 2WUHA 1SG3A 4FPKA 4PBOA 3GZCA 4LLOA 3ASIA 1O4XA 4ISRA 4FBIA 2OX0A 4L92A 3EO6A 3ZXGA 5JAXA 2X5IA
chains in the Genus database with same CATH topology
1KXGA 4P14A 4N9HA 4TSVA 2ZGNA 1QQP3 2ZCWA 2JG8B 1DHKB 1NLSA 1QJY2 2WNUA 4PBPA 4AVBA 1VBE2 1CAVB 3ROUA 4XIKA 4XBNA 4CDWB 4Y5Z0 2LYPA 2HSGA 1KFXL 2DTYA 1MS3A 1R092 3LAGA 2HWD1 5FLJA 5J3UA 1VBD1 3QWGA 2RM21 1G9FA 5H9QA 1QF3A 5LRRA 5KXCA 1YRZA 1NCRB 2ZKLA 5CFCA 1O5UA 2D3PA 2R072 1RUJ2 2EXJA 1ZAYA 1E57A 1PK6A 3AKTA 2ZX3A 4JGZB 4YW3A 4DMIA 4LE3A 1VRH1 2GC1A 1DGRN 3EHKA 4AEMA 4AVVA 3SH5A 1QMJA 2Z5WA 2EA7A 4XYXA 4AFDA 3I8TA 5I8SA 2XJRA 2JKBA 1HRV1 3AZVA 1H9PA 2ZGTA 2HWD2 4CEWB 1CESA 2RM22 3N36A 3ZFGB 2IXKA 1RB8G 1EP0A 4YM0A 1G9AA 1IS3A 3USUB 2HJIA 1T6GC 2P3JA 3J8F3 3KT1A 1G6NA 3ZXEA 3GALA 3AYDA 3FYMA 5H9PA 4DZGA 2PELA 1PO22 3A0NA 3VBOC 1BBT2 1VRH2 4YNIA 4PCRA 2VOKA 4GMP1 3WDTA 4FTEA 1C8NA 1O4ZA 2WT0A 3R6SA 2CGPA 1U5XA 3IDCB 3RYKA 4FPEA 1C5IA 1VBA3 4FPLA 1ALYA 2R0HA 4LO6B 1FX5A 1QJU1 2HINA 5JIUA 4YG1A 1DFQA 1KDMA 1OI6A 4XOGA 5FO8B 4KL1A 3OP9A 2YPJA 1CAVA 4ONUA 4PDWC 4LA3A 1SCRA 2WIIB 4CDWA 5CFDC 3UFDA 5LK7B 3MICA 2Z2SB 1AR71 4RSUA 3Q9OA 3WP3A 1S0DA 1WH8A 2ENRA 1DU3D 4YG3A 2PUDA 4ASLA 2XSDC 1LMB3 1LR5A 2A6ZA 5E88A 1RUD1 3QACA 4WVMB 3S0MA 3JQWA 5I8YA 3NVCA 1Z7S3 1NCRA 3VDDB 1J3QA 2AW6A 3JXBC 5BNPC 4HKWA 4X4IA 1N3OA 2WFPA 4YZ2A 5DUWA 3U4XA 4JGZA 4D69A 1QDOA 1N1TA 1QJU2 3WQ1A 3TRBA 1SBDA 1UF2C 5I0UA 2JE9A 2AXVA 1W0OA 4LBOA 4QM9A 1EPWA 3AP5A 4W6WA 4P9XA 4QU2A 1GICA 3AP9A 1W6PB 4K7JA 3SISA 1LU2A 2FHRA 3B9CA 4JC1A 2DVFA 4IEXA 1ZBA2 1COV1 1S0GA 2P17A 3INAA 4XE9A 1AR72 2ZKNA 4CEWA 4O9GA 1S1AA 1UXCA 4FP2A 2A3WA 2HWF1 5JLVA 4KGGA 3ZFGA 1RUD2 4RGAA 4YGCA 5KC5A 1JYIA 4ZU5A 4F7ZA 3USUA 3VBUB 2RS33 1UTXA 4K6BA 3OQMA 2WNEA 4JTOA 1AF9A 2DUQA 2CROA 4FVVA 2CV6A 3FBYA 4Y1VA 3WQ7A 4Z5DA 4C90A 3MW3A 4AI3A 1RZSA 1NERA 4OI2A 4NWVA 3KT7A 1S2BA 5GLWA 3N35A 1ULEA 2WZR3 1H2NA 1MZ5A 1PO12 3JBG2 1CPMA 1LTEA 1AYM2 1VJ2A 5DZFA 1C8M1 1A8DA 2IV1A 2MEV1 2ZHMA 1D4M3 2YGMA 2QCSB 1HX6A 3VV1A 2GDFA 3LSDA 4O9EA 1AL23 2AH2A 3QD6A 2F6BA 1DQ0A 3CJIB 2FBEA 1X8MA 3O14A 3OBTA 4R8HA 4AHXA 1VAMA 2LYRA 2E7QA 2QUOA 3FC0A 3M3CA 4Q26A 4L97A 4WVMA 3WHTA 3J4UH 4OVEA 5L19A 4I6TA 4IA8A 1RHI2 4Q4V3 4YRDA 3VDDA 1MS5A 2JDZA 1RUC2 3ZXJA 4AW7A 2D98A 3ZVXA 4XETA 2E7AA 3M7AA 3HMYA 4FCAA 4CP0A 5GZDA 1XYPA 4GH4C 4E2GA 3WCRA 4RR3C 3WY6A 4LHNA 2XI8A 1S0JA 2NMNA 4G3YC 4XF3A 2BJCA 2Q1ZB 2MEV2 3ES4A 4HT1T 4PIZA 3M2MA 3F6WA 3WUCA 3ZFFA 2MPFA 2FMYA 5JSPA 4MXVA 1F5FA 4DFSA 2XLFA 1ZBE2 4DOUA 3J26N 1GYKA 5L7OC 4KU8A 1OA2A 4E2SA 1UL9A 1ADRA 1D2SA 4MGZE 2EXIA 1RUF3 1AJOA 1NY71 5KHJA 4YZ5A 1TME1 3VBUA 3WQ0A 3BALA 2X8KA 1EV13 3IKWA 1FPN1 2R30A 1Y9QA 5C4WB 4ASMB 1L1MA 2ZX4A 5CADA 4ZKTB 5J09A 2PFWA 1PM7A 4J6GA 2TNFA 5FCCA 1APNA 1ULFA 4BIOA 4X4HA 1XU1A 1SCSA 4FO9A 4LULA 4MUVA 4EROA 5JI7A 4N43C 5A32B 3VBSC 4C1WA 4HVRA 4H7MA 5ACA1 2XKOA 2ZHNA 4COYA 3EBRA 5J96B 2GNTA 1NG0A 2Y0OA 2WFF1 2LYLA 3S6PA 3CJIA 3WV6A 2RS51 3MGUA 1NY72 2PHFA 3AZZA 1PZ8A 5AC93 4QGLA 3O9XA 4WM7C 1FPN2 3RNSA 4ATFA 5CFDB 4RFT0 1G8WA 3WDXA 5FO9B 2DVDA 5KHHA 3AP7A 1HQLA 1QWRA 2LUWA 1OPOA 1UU6A 2MHFA 4GIQA 1GLHA 1RUI2 1CAXB 1V6JA 4CDUC 2A6YA 4PU7A 4WVWA 2MQKA 1F5JA 5K7PA 5E89A 5LRSA 1JXNA 2QDRA 4LR4A 1MQTC 3BOWA 1TNRA 3R05A 2AR6A 1V9U3 3WCSA 1X50A 3M3OA 1FV2A 1AYM3 3QYXA 4IEQA 5LK5A 3KZ3A 4ATEA 1UD1A 4CDQB 1ND2C 1QP4A 1IZ3A 1JN2P 2XCJA 4M01A 1BEV2 2RMU3 1LGBA 3D0JA 4AI1A 4MH0E 5FLIA 4R9BA 2RS52 3I2DA 2D5VA 1BMV1 5BNOC 4A7YA 3WLUA 3EUSA 2X53S 4GQMA 3N7LA 1H4HA 2CGOA 1FMD3 3E5UA 2DU1A 1CR7A 3AYEA 4DQAA 4N7IA 2BBVA 3B93A 3RMYA 4JQDA 2PPXA 2ICPA 4RD7A 4XQ4A 1AR62 4K1YA 5C4WA 2D6PA 3PMSA 4AEDB 1EY2A 4A2UA 1DGWX 2GU9A 2A6XA 3H7JA 2IXLA 1YJKA 2ICTA 1ULGA 2PUCA 3PVBB 4S2HA 3NKTA 5L36A 1ENQA 4P5HA 1QJX1 4K9SA 4XFCA 1JOJA 1Y43B 3VL9A 1EAH1 3ZX7A 2CWMA 5A32A 1ZPQA 4HN0A 3AKRA 4HPKB 5EJ3A 3MFCA 1DDLA 3VHPA 2VMIA 1G86A 2B5HA 3B9IA 5JPMB 2WUSR 4Q4Y2 1B35C 1PZ7A 1GSLA 3BOPA 5JZGC 2OVUA 1BQPA 4GWNA 4W6YA 2GH2A 2ZGRA 3O0WA 2DYCA 3P3PA 2P3IA 5CFDA 1RIRA 2A71A 1MS8A 1VBC2 4J1XA 2DUPA 3WDVA 3ZXDA 4B4PA 1LGNA 1YCIA 1QJZA 2UYAA 4DNYA 5BNNC 3VZOA 1IGOA 4AQ6A 1HV1A 2H0VA 4BMEA 3ZPYA 3DF0A 1PGL1 1HIXA 1FXZA 2PUEA 2XBO3 4BHPA 3ILNA 1CAXA 2XJPA 2R6QA 4Q0QA 3WVJA 4XW3A 1QJX2 5A3LA 4JCYA 3M8LA 5DDJ3 1VBB1 3B5LB 4IEZA 2OIIA 5BYNA 2O38A 1AYN1 1CIWA 1RUG1 4DRRA 4GH4B 2R043 2P2KA 4CDQA 2E6VA 2DCZA 3POWA 4YVSA 3ZXAC 2DCYA 1AR93 4PU4C 3QQ6A 3TWIA 3MIFA 3M3IA 2P37A 1S55A 1UU5A 2R0FA 3RI8A 1GNHA 1DGWA 4CRQA 2R062 1ND3C 1PVC1 3NV2A 1V6NA 1UKGA 4IXLA 4OI4A 2GC2A 1FT9A 2OZ6A 3KS7A 5I91A 4E27A 1ZRCA 3MFAA 2EF6A 4QQOA 4M00A 2B9UA 2O8OA 1PRAA 4Q8KA 3AZYA 3O0VA 4QPIC 5JSRA 1HQNA 4XPVA 1PIV3 3B94A 1PGL2 1C4RA 3B3QE 2HWC2 3NJZA 2TEPA 4MGKE 3ZMOA 4D7TA 4IV1C 2YDEA 2EALA 5C9AB 4AEDA 4GWMA 1PVXA 1XYNA 1ONAA 4KNCA 1C1LA 2FMDA 3ST7A 4Q1PA 3V56A 2RR12 4K1ZA 3B7MA 5T5LA 2QQPA 1LB2A 1F2NA 2D6MA 1PHMA 2WT1A 4HPKA 1WUVA 4LO5B 1HRI2 4B3NA 1ZRFA 1TNFA 3DPRB 3JXCL 3H8UA 3MEPA 1JHNA 2YC0A 4LEJA 4JDMA 3ZHIA 1BDHA 4YZ1A 1RUE3 1DZTA 3IIAA 2VUJA 4D94A 2A6CA 1QQP1 1QXRA 1UIKA 2GAUA 5HXVA 2I74A 4XFGA 4XJUA 3WP4A 1BK1A 1AR63 2DCTA 5BXXA 1AZDA 4P9LA 2E63A 1H2KA 2OA2A 1WLWA 3SCGA 2DWRA 3PMEA 4M0NA 1AR82 1REEA 4TLFA 4UW5A 1SMVA 2PLV2 3RWNA 3X29B 1RC6A 3MLLA 5GLTA 4CYDA 2CYFA 2D6LX 2PN5A 1ASJ3 2DFBA 5T5OA 2D44A 4KG0A 3F52A 1YFWA 1LOGA 1DG6A 3W9AA 1W2UA 3KCCA 1VB4A 3CECA 3AKSA 4PLOA 5AVPA 4JVAA 4XFAA 3WDUA 1POV3 4Y4YA 1ND2B 1UCXA 1DQ2A 3KM5A 3PXPA 2XH6A 2PHRA 1LKNA 2ZACA 3WNXA 5I0RA 3D6EA 3VKLA 1OA4A 4DPNA 3AFGA 3RPQA 1YIFA 4BWOA 1O3RA 4IEPA 2V5YA 3RG0A 4H14A 1X7NA 4M3CF 1X2LA 4P9IA 2AENA 2O1QA 2VUAA 4XBQA 3VKNA 3JD72 4BA6A 2OUHA 3HR9A 4WVVA 5C9AA 2NLRA 2WC2A 3O12A 4PQ9A 2QZ2A 1R081 1SLTA 5JOXA 3H3UA 1AHSA 1H4GA 1O91A 3BODA 3J8F1 4G9SB 1UMZA 4KWJA 1W6QB 4BMBA 4GKXA 2OW4A 3LA3A 2VG9A 4COZA 5T54A 1N1VA 4PIYA 3JZVA 1WCSA 1RVF1 1K5MB 1TMF3 4F8AA 3DPRA 3ZFEC 2HKXA 1DQ6A 4BOWA 4AFCA 1OQ1A 1SACA 4H7LA 4IL7A 4MXWB 4CDXC 1BJQA 1Q56A 1PNFA 1D0HA 1XE7A 2VVEA 3PLQA 4MLOA 4RL7A 2A73B 1QU0A 2AXZA 3MIBA 4QPGB 3SH3A 1G9DA 4HETA 4AVCA 4GMP0 1W6OB 3WX5A 3WW1A 5C8CB 1MR5A 3WP5A 2HWC3 3NL1A 1Y3TA 5ABJC 2GC0A 4IESA 5AVAA 2CNAA 3TB0A 4TWTA 1R082 3TAYA 1RUH2 4Q4X3 1GR3A 4DB5A 1IPJA 4FOYA 4N53C 2Q0AA 5BNNB 2UY9A 1CD3G 2DVBA 1MS9A 3ZDSA 5LEKA 1WLCA 1LHOA 2D43A 1ZS4A 4W65A 3HT1A 4YFWA 1RVF2 1MZEA 2HWB3 1H8TB 3GBGA 3LA7A 3PNAA 3CU7A 1Z7S1 2PA7A 3VKFC 4TZDA 1HRI3 1S0EA 4LLFA 4FOQA 4YG4A 2WINB 3T1MA 2NPIA 3HWJA 1TE1B 4XJZA 1CQTA 3SITA 5SV8A 4IEYA 5J48A 2VVDA 1S0BA 3MW4A 1JW6A 1ND2A 2JG9B 4XMIA 2DF7A 4KBBA 3HT2A 2YY1A