1ZZ6A

Crystal structure of apo-hppe
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGNEFLFVLEGEIHMKWGDKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
total genus 45
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz6A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz6A02
1VJ2A 4TLFA 2P17A 1SFNA 1OMIA 2WC2A 4I6UA 4AQ6A 1WGPA 3I54A 4WZCA 3EQEA 4KU8A 4D7SA 1ZVFA 2IXHA 2UY9A 4Z5DA 2XGXA 4MH0E 1QWRA 3R6SA 3GN5B 1EYBA 2Y0OA 4EROA 4NDWA 1ZREA 3RPQA 5E1RA 2QDRA 3DKWA 4H7LA 1ZVVA 2PHDA 3EUSA 2PQQA 4GHJA 3L2HA 4JTNA 4E2GA 5CADA 5FPZA 4IVZA 1GQGA 4YNIA 4E2QA 2Q30A 3EJKA 4R8HA 3FWEA 2PUEA 4HVQA 1LMB3 3RYPA 4I6RA 3TNPB 5I0SA 5I0TA 4FBFA 3U3WA 3N4MA 3MYXA 1LB2A 2LYLA 2EA7A 4DINB 3ZDSA 4Z5CA 3CLCA 1L3JA 2CAUA 2ZCWA 3E6DA 4QGNA 3SMHA 1UXCA 3E5XA 3LAGA 4IA8A 3OF1A 1O3QA 3ZHIA 2B8MA 2B5HA 2HKXA 1NXMA 3ZHMA 4R52A 3OP9A 4KWJA 1TQ5A 2IC1A 4KL1A 1RZRD 3HZIB 4FT8A 4IEZA 5I0RA 1B0NA 1PERL 1RZSA 3QYXA 3GYDA 1JFSA 1QPZA 4XFBA 4LA2A 3FX3A 4BYYA 2AXZA 1QXJA 5LEJA 1CX4A 1R63A 1RTVA 1UW8A 5EFUA 1S7EA 4PU3C 3DV8A 3QF3A 4LTAA 1QXRA 4YRDA 2MEZA 4XF1A 1UTXA 4JCYA 1OSLA 2OR1L 1SQ8A 1VR3A 3ES1A 5JSOA 4LUMA 3O14A 5JSRA 3B7HA 3NW4A 3F51A 4IESA 4XF4A 3CJXA 4AVAA 3S8QA 3ST7A 5KHIA 4LULA 3LOIA 2PYTA 3C3VA 4HN0A 2HINA 3BDNA 3FFQA 4WVZA 1O7FA 1LCCA 4F8DA 4F8AA 2D5VA 3S0MA 4AQ2A 5KHGA 3BALA 1EFAA 3MZHA 2BJCA 4I0AA 2GRMA 4FN3A 3RDIA 2O8QA 1J1LA 4XFHA 1BDHA 4KU7A 2OZ6A 1J58A 1PMIA 4JV4A 4MX3A 4PIZA 4X6QB 3KZ3A 2D5FA 2V09A 1LCDA 5BY5A 4QMAA 3BS3A 5KHHA 4I3PA 2VPVA 3FYAA 1CAXA 5I8TA 1PRUA 4Z58A 1NYWA 3H3UA 3E6CC 4FAHA 2B9UA 5HI0A 1I6XA 2H8RA 2ETEA 4META 1X2LA 4AVBA 5J7MA 3JXBC 1WH6A 2ATFA 4XETA 4BH9A 5J3UA 5JR7B 5FQ0A 3KGZA 1NE4A 2D40A 2GC0A 1XE8A 1DZTA 1CAXB 1O3RA 4YARA 1QP4A 2CV6A 4EWEA 1VPWA 1J3PA 4K8FA 2PUFA 4YYOA 2IXLA 4P9GA 2ET1A 2MPFA 4MCXA 1RIOA 4HN1A 3CROL 4X4CA 3CL1A 4XF9A 1NERA 4UBHA 4J1WA 1AU7A 2LYRA 1RGSA 2Q0AA 4Q0PA 1R69A 2LYPA 1ZZ6A 1JH9A 3EHKA 3LFPA 1ZAYA 2EAAA 3ES4A 3PLQA 4HVRA 4ONUA 4YBAA 3I59B 2EF8A 3KJXA 4PU4C 4Z07A 4I01A 1JUHA 2AXUA 3ROUA 2CROA 2XCJA 4ZU5A 5J48A 4IEPA 1DWKA 2EWTA 5FLHA 3OQNA 4HSJA 3QWGA 1LR5A 1ZNPA 5I93A 3E5UA 3NJZA 3ZKCA 4KWKA 5I91A 1FT9A 3LWCA 3WW2A 1CAUA 4Z5HA 1IC8A 2QCSB 2Z69A 2O4AA 2QJVA 5C8WA 1CAWB 5EZWA 3RYKA 3TRBA 3PXPA 2GZUA 3FJSA 3OCPA 5K98B 4MCTA 3NKTA 2R1JL 2A6CA 3U11A 2ICPA 2XHKA 2H6BA 2I45A 3IDCB 1LLIA 1WA4A 3OQOA 3LA3A 5KHJA 2GRLA 4XFFA 3VHRA 3VK0A 1QQBA 4MGIE 3MLFA 3QOPA 1UD1A 4X4HA 3JXCL 4X4BA 1PNRA 4J1XA 3SCFA 3LA7A 3OD0A 3PVBB 4IEWA 4ORFA 5FPXA 1ADRA 1J3RA 4X4EA 2PIJA 4Q29A 2GH2A 3FHIB 3EBRA 2IXJA 3QACA 4UBGA 3WW4A 1YLLA 5KBFA 1SQ4A 4NVPA 2PUGA 3H8UA 3NVCA 4EV0A 4WBBA 3OGJA 2XIUA 1UPIA 3JZVA 3OMTA 2ZKLA 2IUOA 2XI8A 2UY8A 2GC2A 3ETQA 2WFPA 1RC6A 4IEYA 2IXKA 4HSLA 1LRHA 1O3SA 4IEXA 4QM8A 3MDPA 2H6CA 1PM7A 3RYRA 4IWRA 4OB4A 5K8SA 1Y9QA 4PIYA 1QQAA 1RL3A 2PAMA 3D82A 1FXZA 5I8YA 4GULA 4XEZA 5JAXA 4JVAA 1Y3TA 4QXKA 2PHLA 2FMYA 2PPXA 2KEKA 3OQMA 1X8EA 3GBFA 1LKNA 1X82A 4HBNA 4X4IA 1RPEL 2IVGA 1DW9A 5LEKA 3B02A 3HIFA 1X8MA 4N9HA 1O3TA 3L1PA 2Q4SA 1XRUA 2PTMA 3NL1A 1VP6A 4HMZA 4LLOA 2B5AA 2PUBA 4IEOA 2PAKA 2O38A 2O49A 1ZPQA 1O4TA 1YFUA 2HJIA 1ZUGA 3CEWA 2GC3A 2D5HA 1CQTA 4Q0SA 4X4DA 1ZZBA 2IXCA 4HLTA 1DZRA 2XSDC 4L11A 2IVQA 4JCXA 2OFYA 2JCGA 3S7IA 4ZU7A 1ZS4A 4UXAA 3CO2A 3SCHA 1CAUB 3F52A 4CYDA 2O1QA 5JCTA 4JTOA 2BYVE 1RUNA 4MZUA 2EBYA 2N7GA 2Z2SB 4I2OA 2PE5A 1WETA 2KXLA 1O5LA 3BD1A 3U10A 2XLGA 2LYKA 4MUVA 3M3IA 1POUA 2XKPA 1HF0A 3ELNA 3E97A 4B29A 1QP7A 2KEIA 1BDIA 1GT0C 3KGLA 5BXXA 1OFNA 4QGLA 3LISA 1XE7A 2L8NA 2H0VA 1Q3EA 2QVSB 2OYZA 3IWZA 3H7JA 1ZRFA 5FLJA 4Z82A 1EY2A 3H1MA 3RZZA 2AUWA 2XKOA 3H1WA 2E9QA 3FZ3A 1JFTA 1IPJA 3KSCA 3DNVB 3LZZA 3IDBB 1ZRDA 3D1NI 3DN7A 4QX5A 4AXOA 3KXAA 3CLPA 3CF6E 1YUDA 4LEJA 2AW6A 3I7DA 4AVCA 1ZZCA 1UIJA 5CU1A 1RZRA 3FYMA 2XL9A 2UYBA 5KHKA 3KMHA 4OLLA 4I8TA 3WW1A 2GAUA 3BCWA 1CGPA 2IXIA 1EPZA 5E16A 2KZ8A 3BPZA 1V70A 5LRRA 3TNQA 3IVPA 1CJGA 1NE6A 2ET7A 2UYAA 2K0GA 1WH8A 1HW5A 3KCCA 4Q0QA 2IU7A 1CAVB 3U0ZA 4HZFA 3PNAA 4X4FA 5FDBA 2BEOA 1X7NA 3HT2A 5D1IA 1L1MA 2KEJA 3O9XA 1YWKA 4FBIA 5BUVA 3GN5A 2CAVA 5CVRA 3G5GA 4XFAA 5LRSA 3DL3A 2PAEA 5I0UA 4O8BA 1JWLA 4MGYE 4PJYA 2PUDA 1NEQA 2WIUB 4OFGA 3CECA 2XJ3A 2DCTA 4EWDA 3ACLA 1ZRCA 4X6RB 4I09A 4L2NA 2PFWA 4O9EA 5T3NA 1ZRRA 3H1YA 1QY4A 1O5UA 2PA7A 3USSA 2IVBA 1DGWA 4KWLA 4Y42A 5C6CA 4YG1A 5BV6A 4YG4A 4QM9A 4IEVA 1I5ZA 2PUAA 4LUKA 3M70A 1ZZ8A 3R1FA 2EVXA 1YHFA 1CAWA 5BPXA 2D93A 3EO6A 2ICTA 3WW3A 1X57A 3FMYA 4D7TA 1UCXA 2OA2A 2CGPA 3BU7A 1ZZ7A 2BNMA 4BHPA 5FQ0B 2FQPA 2WUSR 2XL7A 4MGZE 2JVLA 4YG7B 2VQAA 1UIKA 1PRAA 1YFYA 2LYSA 2IV1A 1U12A 1QP0A 3UFDA 2PUCA 1ZX5A 2MHFA 2OPKA 5FLIA 3E5QA 2LYQA 5F1RA 2L49A 3H50A 1OCTC 4EWAA 3SCGA 4XF3A 2XLFA 2F4PA 3H7YA 4Z59A 4BIFA 3JXDL 3S7EA 1YSEA 4IETA 1ZZ9A 3UKNA 4FAGA 2BNNA 3G7DA 1OD5A 4QGMA 2K9ZA 3RNSA 5JSPA 2LCVA 2FJRA 1LQCA 1RUOA 3OTFA 1G6NA 1Q43A 3I59A 4I6TA 1IPKA 4MGKE 1DGRA 4XFIA 1H1MA 4GQMA 4JQDA 4MV2A 1E3OC 1WLTA 1J59A 2R63A 2XLAA 4A2UA 1NZCA 3NSTA 4N9IA 3LA2A 2HSGA 1OI6A 5FCCA 2Q1ZB 4XF0A 2C0ZA 3HQXA 3HT1A 2VECA 4IERA 2GZWA 1Q5OA 4XFGA 1XWRA 4PU7A 2BGCA 4I02A 3D0JA 4XFCA 1CAVA 4IEQA 3IBMA 3UKTA 4PU8A 1FI2A 1UXDA 1GQHA 4E2SA 2KPJA 4PIXA 4IEUA 1WIZA 4I0BA 4YSFA 2AXVA 3D0SA 3SXWA 4X4GA 5A7LA 2MQKA 1EP0A 3E6BA 4F7ZA 3H9AA 3IIAA 3MPBA 1YFWA 3UKVA 1H1IA 2MNGA 2GU9A 3F6WA 5I8SA 2QNKA 2BNOA 1SEFA 2CSFA 2LYJA 3QQ6A 1O4XA 1J3QA 1PRVA 2AWIA 3H5TA 4LA3A 1YFXA 4Q0UA 3H3ZA 3BB6A 2OZJA 3SHRA 1Y7YA 4Q0VA 4ZU4A 2GC1A 4O9GA 4HVOA 4RD7A 5AVPA 3FE5A
chains in the Genus database with same CATH superfamily
4TLFA 5F2SA 5GM0A 3WV6A 1XBFA 3KV4A 3BODA 3K4DA 4JQTA 4WZCA 1HB4A 4KU8A 1NLRA 1S2BA 1ZVFA 5FXZA 1H2LA 1RUF1 3VZLA 5FWEA 1U5XA 4Z5DA 2QQKA 2UY9A 5FP7A 3R6SA 3T2PA 4CA9A 5JZGC 1S2EA 1BXHA 4QPYA 1W8TA 2MEV3 4P02B 3TEWA 4CDXA 3O1OA 1K5MC 3RPQA 5JWPA 4UAPA 1JZ7A 4U36A 4XTMA 1WCQA 5F6LB 2RR11 5F9TA 3O1RA 4JTNA 3MIBA 1VBD3 5IVJA 1YQ2A 3GZCA 2Q30A 2QDNA 2RE9A 3CMGA 3KWVA 1TNRA 1W6PB 3WF2A 1SCSA 4I6RA 1BEV2 4RR3C 2A75A 5I0SA 3OKZA 1HRV3 2AEYA 4YFWA 1EAH1 3NJYA 3WXPA 5FZ9A 4OULA 4MGQA 3MYXA 4QDRA 5IVEA 3GJBA 1RMU1 2G19A 2EA7A 3CLCA 1AR72 1C4RA 1L3JA 2Y6JA 2ZCWA 4QGNA 4UF0B 4NJ4A 4COWA 1W2NA 4HT1T 3VBSC 4CTEA 3HJRA 2LROA 4ARXA 1GFF2 1NZIA 3HMYA 4NMIA 4Y3OA 5LY2A 4FT8A 2CHHA 2C24A 4FXKB 4XUOA 4DOUA 2CL2A 5I0RA 2JDZA 5DUXA 4D94A 2ZGQA 3GYDA 5DXDA 4Q4Y1 2JD4A 3FUOA 1U0AA 1JFSA 5GZDA 5LY1A 1VBD1 1FOD2 3VLBB 1V9U1 5E8AA 2W52A 3ZVXA 2AXZA 3M2MA 3KF3A 4RFRB 2YFZA 2W08A 3AXEA 2VJXA 4GA9A 1R63A 1UW8A 3CDZB 1S7EA 1QJY2 1VMHA 4H55A 3QF3A 4UI9L 3LDBA 5A7WA 3T0AA 2WT0A 4INDA 4N53C 2DTWA 1QXRA 4COYA 1NY72 1ZBA1 2LW8A 2UURA 3AMHA 3OGGA 2MEZA 2GP5A 3BOWA 3H42B 1ASJ3 3J4UH 4FQ4A 4LITA 2ZA9A 5FP8A 1N1VA 2G4IA 5EJZB 1JHJA 4QKFA 5ABJA 2VUJA 4W50A 5APAA 2VUDA 3UT0A 1SQ8A 1VR3A 3VWSA 1WMFA 3VBFC 3LE0A 4BMEA 4DS0A 3B01A 1HQLA 4IESA 1RITA 2VZUA 4M3CB 1STMA 1PHMA 2J42A 3ST7A 2R062 1YEWA 3TRSB 4P14A 2JKBA 5CIRA 1REDA 2VTXJ 1O7FA 4GJZA 4F8AA 3O1MA 3WX5A 2LTNA 1RUI2 4TYSA 3S0MA 4JDMA 3BALA 1F5FA 4DXSA 4YM1A 1FOD3 2LM3A 1OPOA 1DCSA 5A6QA 2D98A 3DYPA 2VNVA 3WG1A 4FN3A 2B4KA 3GALA 4RA0A 4I0WB 5T55A 1E5SA 4L8QA 3K75B 4XHBA 3HNBM 1W28A 2DCKA 3MFAA 3UGFA 4MX3A 1ALYA 3PTYA 1A78A 1AR81 2D5FA 2VVDA 1LCDA 1VALA 5KHHA 1PVC1 2RDRA 2LNMA 4XVHA 2JDMA 2RMU2 2ZEXA 1QJU1 4Z58A 1IS3A 1FX5A 1ULFA 1XYOA 2BFUL 3NJXA 4FAHA 3LSEA 1D4M1 1JOBA 2B9UA 3AJZA 3CJIB 1S0FA 3BIWE 2ETEA 3TELA 5A6YA 1X2LA 4AVBA 3FLPA 3OB8A 5FMOS 4AR2A 3MICA 4LBQD 3KGZA 1NE4A 4GH4A 4EZIA 2ZOEB 3UJQA 2V5YA 1XE8A 1IZ3A 1POV1 4JRLA 2YC0A 4KGGA 4Z2WA 5IK5A 1UX6A 1QP4A 2HWC3 4MHRA 5C8CA 1R64A 2IFWA 1H0BA 3AZWA 3G0TA 1VBA1 2WNOA 4X8NA 1DU3D 3KB5A 5ERLA 1HN1A 3GCWA 1UNBA 1ZBA2 1PK6C 4XJUA 3WDVA 3CQOA 4P9GA 3VD5A 4CP0A 2HLEA 1RHI1 2MPFA 1QJX3 2RM23 3PVOA 1IQDC 5JZGB 1UZWA 4X4CA 2RJLA 1W0OA 5GZFA 3VGIA 4ER3A 1R1ZA 5FZBA 4UBHA 3C7EA 2LYRA 1RGSA 3C2UA 3NNMA 5CB7A 4HVRA 4XIOA 2O14A 1QDOA 3NKGA 3N36A 3KJXA 1KJRA 3RWKX 2C9AA 3ME5A 3ZDVA 1JBCA 3ZXJA 2X53S 4DUWA 2RS53 4I01A 2R32A 4Q4V1 1POQA 1LOBA 5FZEA 2CROA 4NAMA 3ZOIA 2VE1A 4BQ2A 4D8MA 4ZU5A 5J48A 2YBSA 4CU6A 1W9WA 1MS5A 5KXCA 1FPN1 4LJHA 1XNAA 2VXJA 4A7KA 4BLJA 2VZTA 1PIV2 2ODRD 3OYWB 2EXKA 3MHZA 5LZ6A 5CFDA 3VZMA 3OCPA 3ZYGA 3LGRA 4KG8A 2JG9C 5A1AA 1RUF2 3U11A 2XHKA 2H6BA 3IDCB 1LLIA 1NOVA 3I2FA 2Q8CA 3T2QA 1RUC1 5FZHA 4D0QA 3BGAA 4Y4YA 5K0UA 4IGOA 4TWTA 5J96B 3VK0A 2YC2A 3IN9A 2H0BA 4CCJA 1I3HA 3QOPA 5IVCA 2C26A 1MEC1 3LF7A 4NWWA 4Y20A 3VB9A 5DSXA 2C5DA 1MEC2 3AL5A 5FUNA 5KR7A 4J1XA 2AGSA 2RS51 2ZGTA 3WF1A 3LEIA 3GDBA 5FFOC 2RS33 1EUTA 3VDAA 1W8WA 4HG6B 3GJAA 2GH2A 3I2JA 1UY3A 2C4XA 4UBGA 1T6GC 4K20A 1SQ4A 1WW6A 4JKKA 4NVPA 1NQDA 3O1SA 4HKOA 3NNGA 1D7PM 4FXGB 4EKGA 5H9SA 4WBBA 5T5PA 3OGJA 1JZ5A 3AKRA 1HB3A 3EYPA 2PMWB 3AYEA 4CEWB 4F83A 5BNQA 2J1VA 3LEMA 4CCCA 1ST8A 1Z0HA 3ETQA 1BQPA 2GC2A 1XYNA 3KLSA 1RIRA 1NAEA 2WFPA 3MW3A 2IXKA 5IK8A 2OW4A 2EF6A 1V6OA 2DU1A 2JDAA 1O3SA 2XR4A 1S4CA 5GLTA 4IEXA 3AZZA 2VMEA 2HWD3 1QXPA 1GWKA 4CU9A 1H6XA 2XHNA 5C9AC 4U2AA 2ZAHA 4CCDA 2RJ2A 5IK7A 1GR3A 2NZ9A 1Y9QA 4AEJA 1QQAA 3I2IA 1AL23 4GULA 4XEZA 2JXAA 1RYYA 2Y6KA 5J1XA 5JAXA 5AFEA 2V5DA 1WW5A 4LT5A 5A33A 5EYYA 4QXKA 1DGWX 4XBQA 5FR3A 2WAAA 4GQ7A 4AZZA 4W4ZA 4AHWA 3SH3A 5ISLA 4P9IA 4XYXA 4NR1A 1RUE3 1Q8VA 1UMZA 3AKSA 5FJHA 2PHWA 1DW9A 5LEKA 5L19A 3HIFA 1A6CA 1O3TA 1XRUA 5B4NA 3NL1A 4XUQA 3WG2A 4EN7B 1B35A 1SG3A 1RUG1 2PUBA 4J25A 4D69A 1DQ2A 4AFCA 4CCNA 5AFBA 4Z92B 2GC3A 2D5HA 3WHTA 2Z5WA 3DKQA 3FUQA 4X4DA 1XPWA 3HD8B 2E7TA 4TN7A 4IV1C 5JDBA 1UU4A 1AX0A 2Y6FA 2ARBA 3AMMA 4FOYA 4UW6A 5D8AA 2VQUA 4AFDA 2HYKA 4NPMA 2DCZA 2P6HA 2VCAA 2X09A 5EIYB 4E4DX 1LENA 3WNPA 4XPVA 3ZSKA 4CP9B 2DBNA 4UFIA 2HCSA 1NX9A 1QU0A 5GLVA 1OVSA 3H8RA 2V4AA 4GB33 3WDXA 2VW0A 1UPSA 2Z2SB 2DUQA 2PE5A 3IT8A 2KXLA 4UF0A 3SISA 1G8WA 4NROA 4YG0A 3M3IA 1POUA 1QQP1 3ELNA 2Z79A 2BERA 3E97A 1EV13 2PXUA 4B29A 2KEIA 5A3UA 1QZXA 4YGCA 1TMF3 5C8CC 4RR3A 3Q9OA 4JGYB 5C4WA 3LISA 2ERFA 3VD9A 4OMDA 1H9WA 2E6VA 1NCQA 4XIKA 3T09A 3A9ZA 5BNPC 2H0VA 4QD2A 1OH3A 1G86A 1Q3EA 1QOTA 3B69A 2W1WA 3KVAA 2FDKA 1WMDA 2X5IC 4Z82A 3H1MA 3M7AA 3H8XA 3ZR5A 2E9QA 1NLQA 4KNCA 4AWDA 1IPJA 3KSCA 3LZZA 3VBUC 3KVBA 4QX5A 2KM2A 1RUD1 1TME3 5CU1A 1UO9A 1RZRA 2W46A 3W59A 3SKVA 2ZGOA 4CUCA 4BQXA 2JB4A 3KMHA 1FPN2 5LA1A 3PDQA 5ACA3 4YW1A 2WS91 4FPHA 2ZHKA 5HV0A 5L36A 1CGPA 2IXIA 3RRDA 1Y4WA 2KZ8A 3WNNA 5LRRA 5T5LA 4DPNA 3IVPA 1CN1A 1RUE2 3N9MA 3WF3A 3BKZA 1HW5A 4XW3A 2M4HA 1OLME 2WA4A 4G4FA 3NV3A 5F5CA 1NCRA 1JZ6A 4CU8A 1KGYA 2VULA 3HT2A 3MW2A 4XXAA 4QPWA 3HAGA 5D1IA 4B4QA 5CBLA 4GWJA 5IWFA 3PURA 2HWF1 5BUVA 4SBVA 2CAVA 5F5AA 1EPWA 5CFCB 3M9LA 4XFAA 3R4DB 4GMP1 1KS4A 4ZHNA 4ES8A 4MGYE 3T1MA 2PUDA 1NEQA 3AP4A 3J8F2 3DPRB 3P3PA 5FZOB 5C4WC 5F5QA 2RDNA 5C3RA 3DXTA 3OBZA 1GWMA 4EWDA 2JENA 2JIJA 3JB8A 5KC6A 2PFWA 4O9EA 3C7FA 1VE0A 1ND3A 1ZRRA 1OLQA 1QY4A 1KEXA 1PZ7A 2PA7A 4QPIB 1KFUL 1UZ0A 4HONA 3FLTA 2SBAA 3HEIA 4QM9A 5FZ0A 3M3CA 1I5ZA 4DXRA 5C4WB 5KXBA 2BZDA 4LUKA 3Q8CA 1ONAA 4XABA 1CZTA 3ZN5A 2Q1MA 3IAPA 3AL6A 1GYKA 3R1FA 2EVXA 2FZ1A 1DQ6A 5BPXA 1NLSA 4BWOA 2D93A 4M4RA 1VBB3 3K77A 3CNAA 5A7OA 3MF9A 3OUIA 3OY8B 3ZXDA 1AR62 2WUSR 2XL7A 4MGZE 2JVLA 2VQAA 1UIKA 4KI5M 3VBFB 1VRH3 5AC93 1U12A 2ZEZA 3UFDA 1HJFA 1B35C 1P8JA 2L9LA 1OUSA 2ZGSA 3E5QA 5IYYA 2LYQA 1RMU2 2PELA 2L49A 2J22A 2JG8A 3H50A 2DTYA 1ZBE3 1YQ8A 3Q8EA 4AI9A 4ATEA 4EWAA 3M1HA 1A3KA 1OA4A 3K4AA 2F4PA 4A3XA 2XQXA 4R9DA 3LFMA 3H0OA 1K12A 3OBTA 4S2HA 1NY71 1YIPA 4TXWA 3OSDA 5EXOA 5FMCA 4BIFA 1YSEA 3VBHB 3MF6A 1H2MA 1AYM1 4FAGA 5SV5A 3RZLA 2ZHLA 5DAWA 2DYCA 2JE8A 3VBRA 2GNMA 1VBB2 2I74A 3ZXLA 4ZY9A 4GH4B 3LD8A 4MYEA 2JDHA 5FZDA 4JX0A 3I59A 1LNSA 3T4HB 4ZS2A 1DGRA 2I2SA 4XFIA 3PHMA 3VBHA 3PTRB 4JQDA 3UESA 1E3OC 1WLTA 4H2AA 5E6HA 5CG8A 4FPCA 4M4PA 5FK7A 4RQPB 1KQRA 5JUWA 1H4HA 1W9SA 4N9IA 3LA2A 1W9YA 1O4ZA 1ZBE2 3AMQA 2BUKA 3I3BA 1ZBE1 3QOXA 1OHFA 5JZGA 2BPA2 2VECA 1XSQA 1GMMA 4XFGA 5DRTA 4K40A 2LRPA 4DZGA 4FPLA 4QHZA 4YZ1A 3KF5A 4I02A 2XONA 4CE8A 3VD4A 4FPOB 1PIV1 3UKTA 5C3QA 1UXDA 2XUEA 1TMF1 4E2SA 1GOGA 2GMMA 1L7LA 2SLIA 2V72A 2ZGNA 4I0BA 4QXHA 1LHVA 1HRI3 1QJEA 2VBDA 2RDQA 3D0SA 2VMDA 1GUIA 2FDHA 3ACFA 3MIGA 3ZFFB 1GLHA 3E6BA 3IIAA 3MI8A 5I0DA 1JN2P 3WNXA 4ASKA 2KR2A 3KL4A 2OUHA 3BTAA 3K2OA 4Y4RA 3ZYPA 1MR5A 2JWPA 5T5JA 4R9AA 3P6BA 5LK5A 1W6OB 4CCLA 2XVLA 1CONA 3H5TA 3EB7A 2E7AA 1G9AA 1YFXA 3AK0A 3D8CA 2Z4FA 2P6CA 1HN0A 2OZJA 3H3ZA 3K48A 4YZ4A 4UFLA 3SHRA 1QHDA 4M3CF 4Q0VA 2GC1A 3AYDA 4HVOA 1UOJA 4OI1A 1VRH1 3T3YA 2YY1A 4LKFA 4RHV2 5SV8A 4PF5A 3TEYA 1RMU3 2WS92 3B9IA 1UYPA 1WGPA 3HQRA 1RHI2 4QHOA 5FZGA 4AE2A 3EQEA 5DABA 4BU2A 4D7SA 4QB1A 5DQ0A 1FNZA 2HWB1 2Y34A 2IXHA 2EXJA 2ZMNA 2OXBA 1U2ZA 5K0UC 1SBFA 2X05A 1EYBA 2Y0OA 1IKPA 3AKTA 1COV3 3WQ0A 1LJ7A 5EYXA 4D3WA 1JOPA 4AI0A 5DG1A 5A3MA 4NIGA 2W1UA 1GNHA 2B46X 4CUBA 1GZWB 2PHDA 1C8M1 4V2VA 4GHJA 3L2HA 4E2GA 2A73B 2BDRA 3POBA 4JGYA 1GQGA 4YNIA 2PXKA 1AYN3 5FMOL 2JKXA 3JB4C 4R8HA 3FWEA 3LQXA 2PUEA 2VBPA 1YI7A 1WD3A 4JAAA 5D2AA 5EQUA 4ZU7A 4GJYA 4FI9A 3U3WA 3IPVA 4DRRA 4WVMA 4AI2A 1LB2A 2LYLA 3MLJA 5GLWA 4BLIA 1QKQA 2AREA 4PLNA 4DINB 5GZCA 2ARAA 2WA3A 4Z5CA 4AFBA 3WG3A 2Y0IA 4BPZA 4ISRA 2QE3A 2VAUA 3V56A 1PVC3 1UYXA 3SMHA 1UXCA 3VKLA 1BVVA 4CDUC 4ZXKA 1AUYA 4OQ9A 5JOZA 5FYTA 3WDUA 4L9BA 1O3QA 1V6IA 3RSJA 1YJKA 3ZHIA 2J7WA 2UWCA 2B5HA 4QKBA 3ZHMA 4R52A 4PQQA 1CX1A 1OFSA 4KQ7A 3FHQA 4KWJA 2FDJA 3ALQA 5BNNB 2IC1A 2W5FA 1RZRD 4KL1A 1D4M2 3I2DA 5EJ1B 3RZKA 1F2NA 2XJUA 3OGRA 1LOFA 1D4VB 5J37A 1QPZA 4LA2A 1QJFA 2EALA 1OF4A 4UFJA 4CCOA 1NA1B 1SPPA 3ZMNA 3NNJA 4CDQA 5A1LA 1QXJA 1H2KA 2R043 2WZR1 1CX4A 1RTVA 5ANNA 1AXZA 1AXKA 5HCFA 2VQ0A 1JZ4A 2WO7A 5IVVA 1W8OA 3HQUA 2VCMA 2CTVA 4LTAA 4W6XA 3D6EA 1GV9A 3ZPOA 4XCAA 4Y22A 4LO5B 4AW7A 1NA1A 4YGEA 1SLIA 2A70A 3WR0A 5CFCC 2OR1L 2XMLA 4CXWA 1WKYA 2EXHA 5JSOA 3THDA 1M4WA 1DLLA 3HBZA 3PMSA 3B7HA 3NW4A 3RZMA 1FYUA 1VBC2 1ENQA 4XF4A 1XXNA 2BQPA 3CJXA 3U07A 1W8FA 1WBFA 3S8QA 2EIGA 4AVAA 5F3CA 1O6UA 1NCQC 2AC1A 2DFBA 3GCXA 3N9NA 5DN2A 5GKAC 2HINA 1AHSA 2BJSA 4HPKA 2Y64A 4CSWA 2E32A 4WVZA 5L7OB 1R091 2OS2A 4XZUG 1CWPA 1OQEA 2TBVA 4FPEA 4OI4A 3WT3A 3TFLA 1APNA 1PO22 3ZYIB 4YVSB 3WCRA 1POV3 3D3AA 2VMFA 2FCVA 4YM3A 2FDIA 1W06A 2BGPA 2VOXA 5FZ8A 3MZHA 4I0AA 1W8UA 3AZVA 3WUCA 1J1LA 4YVWB 1MQTC 1QEXA 5J98B 1BDHA 1SLBA 3NV1A 4FPJA 1F8VA 1AR71 1DLCA 3IMMA 5FZKA 5C70A 1R1A2 4NWVA 1XNKA 5HV4A 1XC6A 4IE4A 2CWSA 3FL7A 2WWUA 3HBKA 5BY5A 2XJSA 4QMAA 1OD3A 3RMYA 1JU4A 1TVGA 2A6ZA 2D3PA 5FP4A 3UGHA 4BQ1A 3S5QA 3I49A 2E33A 5FP3A 4EYUA 4X8PA 3E6CC 5BNOB 5CNAA 4Q4Y3 4CDUB 1TZOA 2YZ4A 3AFKA 3O0XA 1I6XA 4YW3A 2H8RA 3GZEA 2GSYA 4Q8LA 2GH8A 4NHXA 1HRV2 5JR7B 4QU2A 2R7EB 3MIFA 4JGYC 2D40A 1PMHX 4CUAA 2PLV1 2A6WA 5DPNA 1H8TB 2CV6A 4JC1A 3NROA 4K8FA 2VCBA 2PUFA 2ZX4A 1RXFA 2G9ZA 3HN1A 4YZ3A 3J26N 1W8ZA 2IXLA 4AQSA 2WABA 1QJU3 1U5ZA 1RIOA 2R16A 1CZVA 1C1FA 2XJVA 3TYJA 1IG3A 1W04A 3WOGA 3PIJA 3CL1A 4XF9A 5LWBA 3E1F1 2BU9A 4J1WA 1LOCA 2GNDA 3UYJA 2Q0AA 2NMOA 1JH9A 4Q0PA 1ZZ6A 3EHKA 1HLCA 3LFPA 4ASLA 2HWF2 1I5PA 5J09A 5DTMA 2WWSA 4OHVA 2EF8A 1F31A 2WFF3 2BOJA 2AXUA 2XPJA 1KITA 1LECA 3OYWA 4HKLA 4QKNA 2WINB 3FLRA 3ZFEA 3MV11 4AQTA 5A3NA 3QOWA 1OA2A 1DWKA 4N90A 2EWTA 5HBAA 4HSJA 1LHWA 1LR5A 1NCRC 1VB4A 2D43A 2W1QA 3MIEA 4MO3M 1B09A 3E5UA 3EMRA 1Q56A 3R4UA 3ZKCA 4KWKA 4NPRA 5I91A 1FATA 4N53A 2W2IA 3LWCA 3WW2A 1IC8A 1W0NA 2Z69A 2O4AA 2YPDA 1HQNA 1Y9MA 1OBNA 1QH6A 1JHNA 2J1EA 1HB1A 2QQLA 5EZWA 5C8WA 1UZYA 4FSJA 3ZFEB 3TRBA 3ME2A 3PXPA 2VC9A 4LO7A 4KWUA 4EN6B 3NKTA 4W65A 1RVF1 3VZJA 2IUWA 2HEVF 2ICPA 5L9BA 5JPMB 4Y1UA 1WA4A 1W8HA 2ZEWA 4P9XA 4HK8A 4YW6A 1OURA 4BB3A 2GRLA 1MS9A 1YQCA 2RMU3 3VHRA 1BKZA 1QQBA 5LASA 2BVBA 4K7JA 4W8JA 1ACCA 4X4HA 3JXCL 2HWE2 4ORFA 3PVBB 4N7IA 1PX4A 1OH4A 3USUA 5M0TA 3LOBA 1FNYA 2OQ6A 1HRV1 4X4EA 4BQWA 3A22A 4Q29A 5DRYA 3FHIB 1J84A 1LOGA 2IXJA 2ZGUA 4Q2JA 3EBRA 1QNWA 4YRDA 5KBFA 4FPKA 4LO6B 2VU9A 3H8UA 3VZOA 3NVCA 4MXWA 4FCAA 1C5IA 4P00B 1CZSA 1OQ1A 1MQTA 4GD4A 4PDWC 3OMTA 1ASJ1 4TLGA 3SC7X 2PXLA 2IUOA 2BV4A 2XVGA 2XI8A 1PZ9A 2PXVA 2BWCA 2YB7A 4IV3A 4AEDC 4WVMB 4XUPA 3TWIA 4DXTA 1IOAA 3POWA 1GKBA 3WF4A 1VBC3 4AGVA 1JYXA 1VAVA 3PUSA 2XBO3 4OI0A 2VNRA 2H6CA 2PHXA 4Y24A 1PM7A 3T2TA 3VBHC 2J7UA 5A7SA 5L7OC 1AX1A 4DUXA 4MOAA 5DAQA 4RGKA 5C7GA 3JXSA 5B4XA 4ZZ8A 1RL3A 2CNAA 1PO21 4PI2A 2VZOA 3Q8FA 2YU2A 5FZ3A 5FP9A 4CEWC 3TBDA 4LHLA 5CFCA 1AR92 5JI9A 3THCA 1Y3TA 4HK9A 4IW3A 1RJ7A 3I4IA 3N9LA 5FREA 2JDUA 1X8EA 1RUH3 1OLRA 1UWWA 1RUI3 1LKNA 1UQXA 2OPWA 1JODA 4OHXA 5KXEA 2HEYF 2WRAA 2WBKA 4X4IA 2WNVC 4DXZA 1DULA 1YO8A 3PMEA 3B02A 4OZXA 3VHPA 4N9HA 1AL0G 1MS1A 3C7OA 3INAA 4XBLA 3U37A 5JXGA 1V6KA 1Z7S3 4QPGC 4Y5Z0 4HMZA 4LLOA 3WP4A 1LCLA 2AH2A 2P2KA 2PAKA 1GNZA 2L1PA 1DBNA 2CSGA 3CEWA 1YFUA 4M01A 5C71A 4CP9A 1CQTA 4CXYA 2DVGA 5FBJA 5FY4A 4Y5TA 5H9PA 4DQAA 1ZZBA 5FZLA 4LO4B 1DZRA 4A6OA 4MLOA 4Q4Y2 3TN92 2Y6LA 5FYUA 2IVQA 1IGOA 2JCGA 4ER5A 2BW8A 4NRMA 5IHRA 2HWC2 2YDEA 4A3ZA 1BCXA 1ULCA 2RS32 4FP3A 2C1FA 5BNPA 1V00A 3J9SA 3VDBA 1RUI1 4QXCA 4WVLA 3B00A 1VRH2 5LA2A 4JTOA 1GOHA 1RUG3 4BXFA 4C0BA 4GB31 4AG4A 1QJX1 2RM21 2XH6A 4J6GA 1Z7S2 4PT6A 3O1VA 2WIIB 4JQRA 2XLGA 4MUVA 4IV1B 4CEWA 2XKPA 4P9LA 1DYKA 1HF0A 4Q8KA 1ULPA 3PVNA 2Q8EA 1HRI2 3CHXA 1VBB1 5A3TA 3KGLA 5BXXA 2ZX3A 3R05A 2XXAA 4XDPA 3PJQA 1VIWB 3ZXGA 4QQOA 4BK4A 2W95A 3C7HA 3CJIC 4DFSA 1BMV2 2QQIA 4PBOA 4EN8B 3ACHA 2GALA 5AC91 3DYMA 2E26A 3T0DA 4A41A 4EQVA 3IMNA 3IDBB 2J1SA 1AR91 4CDQB 5LA9A 3DN7A 5A80A 1NQJA 2WUHA 3NNFA 1ZRDA 1DZQA 4ER6A 3I7DA 4LHNA 3AVRA 1MVQA 1WZXA 3FYMA 2XL9A 3HVDA 2FCTA 4QB2A 4K6BA 4I8TA 4G3YC 1X36A 4UOJA 5FMDA 3CKHA 2GAUA 5C3PA 3DYOA 5BNNA 1VBA3 1SLCA 1EPZA 4MXVA 3BPZA 3VHOA 2UYAA 1CJGA 2VOTA 2Y26A 2K0GA 2ZX2A 2V3CC 1W90A 1VBE2 3KCCA 3IDAA 4EQZA 2VM9A 2IU7A 1RUC2 3SITA 4DUVA 1PGL2 2WAOA 3QH6A 3GZDC 2AZ5A 4FQZA 3PUQA 4RFT0 3O9XA 4XURA 1YWKA 2JD9A 1C5HA 3A0KA 4LK6A 3GN5A 5CVRA 3PU8A 1PX3A 3G5GA 5L7OA 1JYNA 1JOJA 5DT2A 3B3QE 4GMP3 1SLAA 2PAEA 2X8KA 3D4KA 4O8BA 1YYNA 1NW3A 3OUJA 3ZFFC 2PLV2 4OFGA 4JDNA 1UY0A 1S1AA 4Y22B 4F3JA 3APBA 3CECA 3ON7A 2XJ3A 5FY1A 5GALA 2DCTA 2XXZA 4O61A 4QWNA 3I3MA 1XE0A 3VDDA 2HBUA 4I09A 5T3NA 1E5HA 1O5UA 4N43A 2O0OA 5DUVA 4KWLA 2VW2A 2IZWA 3LIGA 4IEVA 4HOOA 3MUY1 2WNEA 2PXFA 2PUAA 1GP6A 2J1UA 2JG8C 3N7JA 4LBOA 1AYM3 2R49A 1ND2C 1VBC1 1ZZ8A 1Y43B 3I3EA 4DEQA 3BI3A 3NO8A 2ICTA 2VY0A 3SEEA 3FMYA 3ZYBA 4D7TA 5F37A 1K5MA 1HXS2 1V9U3 4COVA 1OPMA 4GALA 1ZZ7A 1NUKA 4BHPA 4QX2A 3MBWA 3UL2A 4CXXA 3KHBA 3VBRC 4BK5A 5EPAA 1XJAA 1PRAA 2OIIA 4NHLA 2LYSA 1GZWA 3PUIA 2IV1A 2OPKA 2YBPA 1E57A 2RDSA 4RGGA 3W21A 3KHCA 3VHNA 4B8EA 2WZR2 1OCTC 1JYVA 1ZBA3 4WVWA 5IJRA 3WDTA 4AVSA 1REEA 2BBAA 4BQ3A 3V0BB 5F6KA 1MZ6A 2WO2A 3BN6A 3ZPXA 3TEXA 1AYM2 4IE6A 1W03A 1AX2A 1V0AA 4KG0A 4XBNA 1OD5A 4DIQA 4BISA 3W5NA 3RNSA 5FZ6A 2LCVA 2RMU1 5JSPA 1J83A 2LLVA 3ZIWA 4BJ0A 1JI6A 5DDJ2 4HANA 3JUUA 1Q43A 1IPKA 2DCJA 2NLRA 1W6NB 2R061 5FZMA 3VL8A 4EJRA 3O1UA 3HWJA 1W6OA 2VGDA 3WINE 4GQMA 1OVPA 3AVSA 4IEYA 3POIA 4MV2A 2XBO1 4NN0A 4RS5B 2RR13 5CYYA 5AVAA 1J59A 2YUEA 4FOWA 5DMYA 2WSVA 2WT2A 2XLAA 3SKJE 4EN9B 1OI6A 3ZKUA 5DAVA 1W8NA 4W6YA 4E4SA 2R30A 1BEV1 3PVEA 4XF0A 1EUUA 4K9SA 2AYHA 5H9RA 3HT1A 1W6NA 4K8RB 1O8PA 3LCPA 3WP6A 3ZFGC 2VZSA 2YROA 3K51A 1XWRA 1OUXA 2VO5A 4Q2FA 5CKQA 2BGCA 5CFDB 1ODNA 4BOWA 3MIDA 4XQDA 5FPBA 1FI2A 1N1SA 4YZ2A 5JMCA 3W20A 5FXVA 2EICA 2Y6GA 4PIXA 2ZMKA 5LBBA 5FOJB 4YSFA 3ZYHA 1H30A 2ZAAA 3R4SA 5A7LA 2MQKA 5A3OA 4CDXC 4P08A 4F7ZA 3MPBA 2KD7A 1HV1A 1AR93 5LATA 2QNKA 2XWJB 1MZ5A 3POEA 1LOFC 4NOTA 4R9CA 3VBOB 4ATFA 2MEV1 1LOEA 1OOPA 1SEFA 2WN2A 4XMIA 1GZ9A 1PRVA 4PBPA 1SFYA 2DUPA 4Q0UA 3SH4A 4NO4A 3A21A 2WQZC 1QJY1 1Y7YA 4ZU4A 5JIAA 1TME2 5F3EA 5AVPA 5L73A 1VJ2A 2R072 2JX9A 1SFNA 2P17A 4CDWB 2A5ZA 1RUH2 2VOVA 1W2UA 1HJGA 2D6KA 3PUHA 5EWSA 3DF0A 2VTXA 1BBT3 5FYVA 3ZO0B 2XGXA 3ZSEA 1VBE1 4PDWA 1QWRA 2PQSA 1OT5A 5HCAA 1PGL1 1S0DA 2A3WA 1VLNA 2P3KA 5J36A 4QX3A 4PF1A 1QJU2 4IUGA 4EROA 4WM7B 2WNUA 3IDEA 3J7HA 4YM2A 1DG6A 2ZS6B 3IPVB 1ZREA 4Q4W2 3GGLA 3ILRA 3WCSA 2ARXA 3AC0A 2XG3A 5E1RA 5C9AA 2QDRA 4H7LA 4SLIA 1ZVVA 4D6QA 3EUSA 5CADA 5T52A 5D8AC 3VZKA 4IVZA 1S55A 5IVBA 3W9AA 4CDUA 4ER0A 4HVQA 3KT7A 2YV8A 2PXEA 1LMB3 3RJRA 3RI9A 2JB8A 1GWLA 2LALA 3RYPA 1H8TC 4D7YA 2VZVA 2WNUC 5L9RA 4FBFA 3DECA 2VTFA 3AZXA 3N4MA 2FDFA 1WUVA 3N9OA 3U1XA 1REFA 2CGOA 2BVVA 2RV9A 4P5HA 3ORJA 1C3HA 2TNFA 5CKNA 1OXCA 3THTA 1R081 4JZRA 4LKEA 3DPRA 1B35B 1UOFA 3LAGA 5GLUA 2BGOA 5F39A 4IA8A 1UKGA 1Q8SA 5EP9A 4Y26A 1PO13 1NXMA 3OP9A 2JICA 5FYYA 3CU7A 5LBFA 4CRQA 1W6QB 3UJOA 1ND2B 3KCYA 3M3EA 3T1LA 4XHXA 4JHZA 1SHWB 1IQAA 1SDDB 2GNBA 1PERL 1B0NA 1RZSA 3QYXA 2JEMA 2ZX0A 4LXLA 3TN93 2MEV2 4AOCA 1A34A 1JXNA 4XFBA 1WA6X 3W58A 3KZ4C 5K0UB 4BYYA 3VZNA 1KJLA 1US2A 4LIVA 1ZA4A 4A42A 2R041 2WZR3 5EFUA 1ND2A 1VBA2 3V0AB 4PU3C 1NT0A 3DV8A 3JBG3 4XJAA 1RUH1 4CCKA 4LBQA 3UNPA 5DAPA 3JD71 5LBCA 1AJOA 1N3OA 3VV1A 1XNBA 4M0HA 2PHFA 2X5IB 2XJRA 5LB6A 3RGBA 2E53A 1QB2A 5A7QA 5T54A 3ES1A 4FPFA 1QF3A 1W9TA 1UYZA 2IVIB 3OJBA 3O14A 5C3SA 2HWD2 4LIUA 5A33B 4L99A 3HN3A 5KHIA 3HNYM 4LULA 3JQXA 1JW6A 1H2NA 2PYTA 3C3VA 3DGTA 3LOIA 4HN0A 4BXSV 1T6BX 2XBO2 3VKFC 4K1YA 1LCCA 3RWNA 5C33A 1S2KA 3KM5A 1OOPC 3NV4A 2D5VA 1SDWA 5KHGA 5JPNB 1DP0A 2PXTA 3AXDA 3OD4A 3UGGA 5IFTA 3RDIA 2O8QA 3OUHA 1MVEA 1RVF3 2PXQA 4MGTA 1J58A 2AR6A 1QJY3 4ZONA 3AX4A 1DYOA 2J1AA 2AEZA 3MIHA 4PIZA 3N3HA 1BVP1 3KZ3A 1O59A 4KBZA 2QTWB 2C6SA 5FPUA 2XJPA 3B5LB 3BS3A 4P9JA 5JI7A 5K9YA 1QMJA 1EV11 1LGBA 4YVSC 4NIHA 4XQWA 5I8TA 1W2OA 1NYWA 2P5BA 4MVTA 1RUJ2 4B1MA 2VUAA 4NE9A 5FYBA 5J7MA 1JUIA 4FFGA 3JXBC 1WH6A 1RINA 1W6MA 2R0HA 4OCTA 5J3UA 3N35A 2BBVA 1WBLA 4BA6A 2YHJA 2BFUS 1DZTA 2RS31 2QKDA 3J7LA 1CAXB 2BOIA 1O3RA 3IM0A 4YARA 4EWEA 3AKQA 3AMNA 1VPWA 2DDUA 5GZGA 1J3PA 3PU3A 3O7OA 5IAVA 4AF9A 5FUIA 3RZHA 5FPLA 4CCMA 2EXIA 4R4XA 3BTXA 3SEPA 3JD72 1ND3C 2ET1A 1YCIA 4XACA 4O65A 4MCXA 2FZ2A 1RUG2 3BYWA 4HN1A 2JE9A 1LGCA 4K3UA 5LW9A 4MHUA 3ZYJB 1NERA 2V73A 1AU7A 1AVBA 1S0JA 2P34A 3CZUA 3OPTA 4S2FA 4XJWA 2LYPA 5FYCA 2UU8A 2YG0A 1BJQA 3ES4A 2NN8A 2EAAA 3J7MA 4FOVA 4LHKA 4JGZC 4XTPA 3USUB 3I3DA 4YBAA 4LBLA 1JYTA 2ILMA 1HX6A 2WZ8A 4Z07A 1JUHA 3ROUA 2XB6C 2ZZJA 4G9SB 4CEYA 5JXIA 4WV8A 5ANQA 1BYHA 3S57A 1FV2A 3I2OA 2BTVC 1MFQC 1X9TA 4IV3C 4FTSA 5FAXA 3OQNA 5FLHA 3QWGA 1SLTA 3Q8BA 1X33A 1ZNPA 4YVSA 5FY7A 5I93A 2QBXA 3GUUA 5LCWL 1VAKA 1FT9A 1SCRA 3B9CA 4AI1A 3TEZA 3T0BA 1Z7S1 1IPSA 3RFRA 2JQEA 1HKDA 2DBIA 2LUWA 4ZXEA 1JZ8A 1CAWB 4XC9A 5CA6A 1R082 3B94A 3RYKA 3RS6A 2GP3A 3RMXA 4CEYB 1UU5A 3QD6A 3NAPB 4MCTA 5FY0A 4TSVA 5FXXA 2R1JL 3POFA 3VBOC 2I45A 1TEIA 3NXHA 1K5JA 4R9BA 1F15A 5FKCA 1S0BA 4PCRA 5KHJA 4OHZA 3WNMA 1LAJA 3OGVA 3WLUA 1G9DA 1IS6A 1RUJ1 2FMDA 5JXJA 1AL22 4MGIE 3ZM8A 5IT6A 5F32A 1U5IA 4LLFA 2P4EA 4X4BA 1M06G 3SCFA 3OD0A 3LA7A 4B3NA 4WM7A 3LKJA 1ADRA 1DGLA 1RXGA 1T2XA 2F4LA 3HR9A 1PK6B 4XAEA 4B4RA 2JDKA 2PIJA 1UZZA 2IWGB 2ID4A 4QX7A 4COZA 4M00A 4NRQA 1KFXL 1JYWA 3TB0A 1PVXA 3WW4A 1YLLA 4GWNA 4XOGA 4A45A 2QZ2A 1PIV3 3ZSMA 4E27A 4EV0A 4QQPA 4CP2A 1ENRA 2XIUA 1W3VA 3FBYA 1UPIA 3U75A 3JZVA 2OKXA 1UL9A 2DURA 1D0GA 2ZKLA 3ZFGA 1UY4A 3BOPA 1HQWA 3I3QA 1PK6A 2UY8A 4JKLA 3CIHA 3NNLA 4OHYA 5A1FA 4UFKA 1Y9GA 1S0CA 1O8SA 1CJPA 1LRHA 4BDVB 3VDDC 2XUMA 4HPKB 4LR4A 2DVBA 3GBWA 4S2DA 3SR4A 4C8DA 2E51A 2TEPA 1DDLA 4GKXA 4QM8A 3GHMA 4XJ8A 3BIEA 4EZHA 5BYNA 5K8SA 1F4HA 5DTQA 1YQ5A 2X10A 3RG0A 3LB9A 3H8OA 1UAIA 4OBMA 1AXYA 1FXZA 3X29B 4D6SA 4NIIA 4Z2AA 3B7MA 4JVAA 2Y60A 5EJ3A 4AEDB 2VW1A 2PHLA 2P37A 5JR2A 4OI2A 4RHV3 3JQWA 1X82A 3A23A 4K1ZA 4LO8A 2X29A 1DFQA 1RPEL 4PLOA 2VMHA 4L0PA 3L1PA 3F95A 3M8LA 3KS7A 4OHWA 3N9QA 4LE3A 2JG8B 1PO11 1VP6A 4AAPA 2B5AA 3QBQA 4IEOA 1I9RA 3IAQA 5KHKA 2ZGMA 2O49A 5DDJ3 4H3WA 5HXVA 3VKOA 1ZUGA 1D2QA 1UOBA 1XB9A 1XOYA 3OEBA 3AYCA 4IE0A 4YVWA 2IXCA 3NJVA 4L11A 2X5IA 1H6YA 4JCXA 4KGQA 2OFYA 2YYOA 4LE4A 3RQ0A 3VBRB 1C8M2 3S7IA 2A71A 4AHYA 1TE1B 5FPAA 3ZX7A 2W91A 1ODMA 5CZKA 2D6NA 1K3IA 1WCDJ 3POYA 4LOSA 1CAUB 3QH7A 3B93A 2IFRA 3L2YA 1N47A 1AYN2 1UF2C 2VZ3A 3DXUA 3OGSA 2W68A 5DUUA 3WQ7A 5JCTA 1RUNA 3GZDA 2VVEA 2HH9A 1V6LA 1LTEA 4NHKA 5A7NA 1Q8OA 3Q8AA 3JD73 1WETA 1XNTA 4H7MA 1MQTB 4C90A 1NCRB 1HRI1 2ZMLA 2NPIA 2ZBJA 4RL7A 4DY3A 2VVFA 1H8TA 1UMHA 5FXWA 5C5UA 3L9JT 2L8NA 2IVJA 3DUIA 4UW5A 4AEKA 3POSA 2QVSB 2OYZA 4M3CA 3HNMA 3IWZA 2WFF1 4OUEA 4KMQA 1ZRFA 3O5SA 3C7GA 4UW3A 5FLJA 1EY2A 4QQLA 3RZZA 2AUWA 2XKOA 3H1WA 2BWAA 5AC92 3FZ3A 4AEMA 2JDNA 2Y33A 1CESA 3UK9A 5FOBB 1SPPB 1ULGA 4A4AA 1YIFA 3CLPA 4AVCA 1YUDA 3ENRA 4URAA 1ZZCA 1RUD2 1UIJA 2Q5TA 4QPIA 1AZDA 4GKYA 3TOJA 2MXDA 2VD7A 4URTA 1WLCA 2DWRA 2PLV3 3PUAA 3WDWA 1LEMA 4D6RA 4KH9A 2WS93 2G9GA 4XUNA 3BCWA 1YRZA 4YG3A 1R1A1 5E16A 4DEVA 2Y38A 5FYIA 1UKRA 2RS13 5GJ6A 4MADA 4JRAA 1PGSA 1RUJ3 1JH5A 1UMIA 2QQJA 5FWJA 3PNAA 4LOTA 1WCUA 2KEJA 3AB0A 2YPJA 1MZFA 3S6PA 4K21A 2VMIA 2W1SA 4AL9A 3ASIA 1HIXA 4QX8A 3ZYFA 4YZ5A 5FV3A 2WO3A 4QB6A 3ZIXA 3AP7A 3T30A 3DEMA 3ZSJA 2EIBA 2ZEYA 3I2KA 4GH4C 2FHRA 4CDXB 5HCHA 4Y1YA 2QQMA 2B7YA 2Y6HA 4I3GA 4X6RB 1AR73 2EIDA 1CIYA 1JZ3A 2WLQA 3IIIA 5DZEA 3H1YA 3LPGA 1PMJX 1LEDA 3USSA 1DGWA 2D97A 3LPFA 2QUOA 3RVHA 4R4ZA 4YG1A 5BV6A 2AACA 1WCKA 4A7YA 4XJ9A 4ZPIA 4WM8A 2WDBA 3O12A 1DYPA 1AR82 2PHRA 4FPGA 2YXSA 4LNVA 5FTTC 2ZX1A 4UT5A 1CAWA 1COV1 3VBUB 5E89A 3GNEA 5BNOA 2CWMA 3EO6A 4HL0A 2VQTA 4Q4X1 3WW3A 3O1TA 1X57A 2WYSA 4Y5SA 1UCXA 5FYZA 4E4HA 2R0FA 1AR61 3AP6A 2BNMA 2FQPA 2RS52 5EV7A 3N7LA 1QP0A 1ZX5A 2PUCA 4ARYA 1H9PA 4NUBA 5FKBA 3JBG2 3MW4A 5JOWA 2GMPA 1RHI3 2XVKA 4ZS3A 4YW5A 1GP4A 4E8DA 2R073 2A6XA 5IATA 3SCGA 4XF3A 2XLFA 3ZXEA 3LQCA 1WMXA 4QDSA 5JVVA 3H7YA 3VN4A 1KD7A 2ORZA 1YI9A 2FFHA 4QX1A 1ZZ9A 3VKNA 1SBEA 4QGMA 2DFCA 2K9ZA 2CY6A 1LOAA 5FIXA 3WZ1A 2ZGLA 3C8XA 2QQPA 1LQCA 1MS8A 1ZA7A 3K3NA 3JU9A 4QXBA 3URFA 4GWMA 3WUDA 3OTFA 1RUOA 1JTZX 4I6TA 3ZKYA 4MGKE 4AI8A 1GBGA 2VCCA 3AYAA 4MGSA 4CPBD 2VH9A 1GZCA 1NG0A 4Y20B 1C8M3 5G04L 1PNFA 1UYYA 2YFUA 4Q4V2 5A7PA 3QFIA 1E5IA 1NZCA 1R092 2UWBA 5A6ZA 2OX0A 5FCCA 4XQ4A 1F5JA 4NHMA 5FY9A 2C0ZA 1EAH2 3HQXA 4IE5A 3RI8A 3WDYA 3WSOA 4GB32 3VDDB 4FO9A 2GZWA 1Q5OA 2E31A 5KC5A 4W6WA 2HBTA 2ES3A 4UWDA 2WLPA 1NKGA 3M3OA 2XDVA 3D0JA 4XFCA 1CAVA 2XXQA 4IEQA 3IBMA 5FYHA 1IG0A 1JU3A 1LULA 1WLDA 2XXPA 5F3GA 2PXJA 2RG4A 1V6JA 4RS5C 2W87A 5EHDA 5FJKA 1TMF2 1WIZA 2AXVA 1QQP3 3SXWA 1YXWA 4NAOA 4AFMA 4LBKA 1COV2 3K4ZA 1HDKA 5IVYA 1YFWA 3UKVA 5A6XA 2HWE3 3FC0A 3M3QA 4I30A 1H1IA 1W99A 2J1RA 3GBGA 1JMUB 2GU9A 4IV1A 5I8SA 1OF3A 1MPXA 2BNOA 2J1TA 2TUNA 1N3QA 2CSFA 1VRBA 3LIHA 4GXLA 1XSRA 4YWAA 5A32B 3D5OA 3QQ6A 1J3QA 4CCEA 4LA3A 2AWIA 4PDWB 4NPLA 3BB6A 4AHZA 3CJIA 3WVJA 2GNTA 2NP0A 2A6VA 1AYN1 3MEPA 5CAZA 4RD7A 5F1RA 3FE5A 3AP5A 1OMIA 2WC2A 5FY8A 4I6UA 2WNVA 4LQRA 5GAHi 1GQPA 4AQ6A 3I54A 3I2GA 2ZHNA 4IV3B 2DVAA 1IS4A 4IXLA 1RVF2 4RGAA 4TZDA 2JECA 4CVUA 1D4M3 2D6OX 4MH0E 2A7AA 3GN5B 5IAXA 1ULOA 5KWRA 1K42A 2FDGA 1LGNA 5CKMA 1DQ0A 5IUQA 3RJ2X 4NDWA 4EK9A 3ZFEC 1WW4A 5A3PA 1F4AA 3DKWA 4YW4A 2HWE1 2PQQA 3SH5A 1SZBA 1DQ4A 2WFF2 1HXS1 2HWC1 2VZPA 5FPZA 4DMIA 1WWYA 4RS5A 4E2QA 1CVNA 3EJKA 3ITQA 3H3LA 3K3OA 4HXCA 5CEHA 4Y1XA 3K46A 3PL0A 1CPNA 3ETPA 3N7MA 3TNPB 3UV9A 5I0TA 4AI3A 1N1YA 2ZZQA 4QPGB 2CDPA 4BQ5A 2W0XA 1IS5A 5LK7B 3ZDSA 1Q8QA 3NV2A 1ULDA 1RUF3 1L7QA 2K2SA 2CAUA 3E6DA 5T50A 3ILFA 4GMP0 3E5XA 2E63A 4Q4W3 4Q26A 3OF1A 1OC1A 1AR83 2B8MA 4AVTA 1J1TA 2HKXA 2Z42A 1G9FA 1ENSA 1TQ5A 1MS0A 3ILNA 1ND3B 2O8OA 3OBRA 4JGZB 3U4XA 3HZIB 2VZQA 3ZSLA 4C91A 4IEZA 4MXWB 4QU1A 4UFHA 1OQDA 1AL21 1BLZA 2W39A 1G9CA 4A7ZA 3ZLIA 5CISA 2J7MA 1HXS3 1V9U2 2C9KA 3HOBA 3VDCA 1VBD2 3VBOA 3FX3A 3S5AA 3QCWA 3HPNA 2JIGA 1LHUA 1V6MA 5LBEA 2DV9A 1JS9A 3KT4A 5DZFA 5BNOC 3KT1A 4JHTA 5DUWA 5LEJA 5GAGi 2VNOA 2WQ8A 2XWBB 4H14A 5FUPA 5F3IA 4YW7A 4RHV1 4OQ8A 4LORA 1BZWA 1O4YA 4XF1A 2W92A 1UTXA 4JCYA 1OSLA 2I07B 4QKDA 3OPWA 1DGRN 2OVUA 5JUVA 2RS12 3SLIA 3WP3A 3LDKA 2AENA 4LUMA 4BM8A 5JSRA 1D0HA 3NAPA 4FVVA 5IFPA 3F51A 3KV5A 4QHBA 5DDJ1 4P9YA 2ZHMA 4QQ2A 2OQ7A 4WM8B 4BCUA 1BMV1 1MACA 3MGUA 4E8CA 1UN1A 2WN3A 3NRUA 3V64A 2VZRA 3BDNA 4Q4X3 5H9QA 5HCBA 3FFQA 2VOWA 2GN3A 4F8DA 1S0IA 1GICA 2A3YA 3T4VA 3VBUA 5DZGA 4BQ4A 5FZOA 3WP5A 4AQ2A 1VPHA 2CYFA 2VG9A 4CU7A 1GSLA 1EFAA 4YVWC 2NQYA 4XDQA 2YBDA 2BJCA 2GRMA 4B1LA 3MUZ1 4XFHA 4N7UA 2VMCA 3I2HA 1C57A 3BVCA 4KU7A 1R083 2OZ6A 5FK8A 4HRAA 5BNNC 1PMIA 4JV4A 1URXA 4X6QB 5A7WB 3ACIA 4M0NA 3UETA 1W39A 3ACGA 1W6MB 2V09A 4AGRA 2XQRA 4AAXA 1OLMA 3GM8A 1PVC2 4Z8BA 1KXGA 2Q1FA 3FYAA 2VPVA 1YJLA 1OOPB 4I3PA 1CAXA 2NM1A 4QPIC 1PRUA 3H3UA 5FZ7A 4WVVA 1W9FA 1VBE3 3TN91 5HI0A 1SLLA 3BTZA 4META 4LK7A 1PM4A 3OY8A 4BH9A 2ATFA 4XETA 2WJSA 1VMJA 2VZ1A 2YU1A 5FQ0A 4LKSA 1RB8G 1K45A 3N7KA 2GC0A 4QQHA 5HPOA 4QAWA 4CP1A 1V6NA 5LA0A 5ACA1 1TNFA 1PGW1 4RR3B 1VAMA 5A70A 1QNYA 4NIDA 3J7NA 4N43B 1ZYBA 3V0AA 2B42B 2R1BA 4YLZA 4YYOA 1QOSA 4AK3A 1H4GA 3MLLA 5C3OA 3UWPA 5JOXA 4ISQA 2CU5A 5A3WA 5FMBA 1ASJ2 1DIWA 5KXDA 1LHOA 3CROL 3R09A 2VUCA 4YGDA 4RSUA 3VD3A 5C5TA 4FTBA 3DM5A 1BBT2 1KS5A 4P5YA 2W94A 2ZGKA 1R69A 3GZUC 1Z78A 2WT1A 4ONUA 1ZAYA 3SQOA 3PLQA 4JCKA 4AVVA 2HEWF 4Q4W1 3WNOA 3I59B 2WO1A 4PU4C 3AJYA 1FMD3 3VUOA 3J8F1 1AR63 4XAAA 5FBZA 3IKWA 2XCJA 1W2AX 4FFFA 4L97A 5IVFA 4Y33A 4IEPA 1FAYA 1JYCA 4B7EA 4FPYA 1GZTA 1ULEA 1UU6A 2W47A 4Y1VA 5FRAA 1KDKA 3NJZA 4HFSA 4CDWC 1CAUA 4Z5HA 1W0PA 2QCSB 4RN5A 1CQ9A 4DNYA 5ABJB 3V0BA 2CGNA 1H8VA 2QJVA 3M4FA 2R071 2ENRA 5FYMA 4DB5A 1WW7A 2P3JA 4HKWA 4AFAA 3FJSA 2GZUA 2ZGRA 5K98B 4FTEA 1D2SA 3P5BA 2A6CA 3NZLA 1WLWA 1OKQA 4IGPA 3OQOA 1RUC3 2WNVB 3LA3A 3LSDA 2WWJA 4XFFA 2P1BA 2XJTA 5GZEA 1YC61 3TEPA 1UOGA 3MLFA 2W9XA 1UD1A 5D8AB 4IE7A 3J8F3 5FYSA 4XE9A 4OUMA 2Q8OA 3A4UA 1PNRA 2JJ6A 3FMGA 4IEWA 1FMD1 2ORXA 3LFIA 5FPXA 3MFCA 3BTYA 3OG2A 1CPMA 4OYUA 3ZFGB 4EZ4A 1J3RA 2JG9A 4LBJA 3VBSA 3T2OA 4XCBA 2DF7A 5CFDC 3U0ZA 3NAPC 2W3JA 3QACA 4FOQA 2PUGA 1CIWA 3FBMA 4IQPA 5DAXA 5E88A 4UYBA 1RJ8A 3GZTB 4YPJA 3ZN6A 4V2WA 4ZKTB 2EAKA 1GOFA 4EKIA 5JMOA 2XJQA 2HYXA 1L7RA 2G9FA 1W6PA 4FFHA 5FZCA 4EE2A 3RZJA 2EIEA 1JZ2A 2QQOA 2JG9B 1LESA 3MLKA 4YG6A 4BQYA 2WZPP 4QPGA 1RC6A 2ADEA 1XNDA 1UXZA 1GU3A 1E5RA 2RS11 3NMBA 1QOOA 4HSLA 3IB3A 4LPLA 4BZ4A 4IDZA 4E9KA 3RZGA 2E7QA 1BBT1 4LMFA 5TSWA 2QZ3A 3ZXFA 2ZJCA 4B7KA 5DG2A 5HXMA 1N1TA 1WCSA 1XU1A 2B39A 3MDPA 3QLQA 2QFEA 4LHSA 3RYRA 3O0VA 4IWRA 4OB4A 2JDYA 2YMZA 3A0NA 3LDRA 2FCUA 4YW2A 2R063 1OSGA 5FPVA 2D7FA 4PIYA 4WM8C 5A32A 2PAMA 3D82A 1LU1A 1UZVA 3VD7A 5I8YA 1DHKB 5F8PA 2D6MA 2Y8KA 5FZAA 1F35A 2PXBA 1S0EA 2A3XA 2F17A 2QQUA 3PJYA 4RQPC 4LBMA 2BP6A 2D3SA 2FMYA 2PPXA 2KEKA 3OQMA 2RJKA 3WEZA 4GIQA 4YGBA 3GBFA 2ZACA 4MSVA 1A8DA 4HBNA 4AYUA 3A9XA 1W3XA 1US3A 4C1XA 2IVGA 5GLZA 3G6JB 3MV01 1X8MA 1GANA 1GNYA 2Q4SA 3WG4A 4UW4A 3U14A 5FZ4A 2PTMA 3ZR6A 2YBKA 1OA3A 1OKOA 3KCXA 4RQPA 5T5OA 2O38A 4GWIA 1ZPQA 1FV3A 1O4TA 2HJIA 3VL9A 3FN9A 1QH7A 2D6PA 4PLMA 4Q0SA 2QQNA 4FFIA 5C9AB 4HLTA 1DQ5A 1MZEA 4GAZA 4NRPA 2XSDC 2VOKA 5FY5A 1UY1A 3AFGA 1R093 2F6BA 2ZPXA 3ABZA 3CZJA 4IGQA 4Q4V3 5L9VA 4MG2A 2RR12 2ZGPA 3ZMOA 2NMNA 4AGGA 1ZS4A 3GHNA 1C1LA 3CO2A 3GXUA 1BEV3 3SCHA 4UXAA 4LKDA 1QJZA 3IZOA 4Y1ZA 1KDMA 2WSUA 3F52A 3ZYRA 3SX0A 4XMAA 1FPN3 4CYDA 2O1QA 1A8MA 2BYVE 4RYDA 3U78A 2AUYA 3ZXAC 4BE3A 1QJX2 2RM22 2HFZA 4MZUA 1S0GA 1ZM1A 3LEKA 4C1WA 2EBYA 1W05A 1NA1C 2N7GA 1VB2A 4N43C 4O7XA 3BUCA 2D6LX 4I2OA 1O5LA 2GDFA 2HWB2 3BD1A 2UWAA 3U10A 1Y7BA 2LYKA 3PIGA 2RVAA 1HV0A 3GF6A 3WQBA 1QQP2 1QP7A 4QX0A 1BDIA 3ZPYA 1GT0C 1MS3A 1OFNA 4QGLA 1XE7A 2P3IA 5F5IA 1H1AA 3P3NA 4Q4X2 2WYFA 4NIAA 4PHZA 2FBEA 2FD8A 3AZYA 3KQRA 3PE5A 2VMGA 1HQ1A 2ZABA 3AM2A 3H7JA 4AHXA 3KD4A 3ATGA 3VBSB 5IK4A 2G1MA 1MS4A 4ES9A 1JFTA 3NDBB 1IHMA 3DNVB 4TTGA 2DVDA 3D1NI 1UX7A 4AXOA 3KXAA 4LEJA 3CF6E 1BK0A 2AW6A 5FZIA 4A44A 1LODA 3THPA 2WQ4A 1NCQB 2HCNA 4OUSA 4CZSA 2VL4A 2R1DA 5FO8B 1CR7A 1PGW2 2UYBA 3F2ZA 2A1XA 2WKKA 4S2GA 1PZ8A 4OLLA 4XJZA 3WQ1A 5FO9B 3WW1A 4BIOA 5CG9A 5K4LA 2WR9A 3OPZA 2OUJA 4FP2A 4N8MA 3DPRC 3TNQA 1V70A 1N3PA 2ET7A 1NE6A 4KBBA 5C8CB 4Q1RA 3DCQA 1RUE1 2CDOA 3MEJA 1WH8A 1EV12 2D44A 4Q0QA 1CAVB 4CDWA 2HWB3 1K5MB 3ECQA 1I1EA 4HZFA 4N53B 4X4FA 5K7PA 5FDBA 3N9PA 2BEOA 1X7NA 3POGA 4V1PA 1L1MA 1BHGA 2PHTA 4HETA 3WF0A 3LEGA 1CJDA 4FBIA 4EN0A 5JXHA 2ZXQA 4Q27A 1XQNA 1QDCA 3KV9A 3DL3A 4ITCA 2JE7A 4M3CE 5LRSA 3POJA 1MEC3 4UFMA 1JWLA 3NWKA 4PJYA 3A9YA 2B45X 4WZFA 5I0UA 5ACA2 2WIUB 4JKMA 3U4SA 2DVFA 1TME1 3ACLA 1EAH3 1ZRCA 4ZZ5A 4L2NA 3EXUA 4PQ9A 1IKQA 2OT7A 4DY5A 1O91A 3OBAA 3I8TA 1SBDA 2NYYA 4CUGA 2IVBA 4Y42A 2K46A 5C6CA 4YG4A 4ASMB 4IL7A 5F7UA 4JDOA 3I97A 3A7QA 1X9PA 2PXPA 2YGLA 1PO12 3M70A 1ENXA 4E4ZA 4B4PA 3OEAA 2Q8DA 2WZEA 1YHFA 3ZFFA 2DUOA 2DU0A 4CDQC 5JLVA 4DE9A 1Q8PA 3T08A 4OMCA 2OA2A 3BU0A 3KV6A 3AMPA 3WNKA 4C0HA 2HWF3 1SACA 2CGPA 3CBNA 3BU7A 2YC4A 1F9KA 5FQ0B 4LBQB 4YG7B 1ZRIA 5ABJC 4LBNA 1FMD2 2ZTNA 1FOD1 1YFYA 1HB2A 4NHYA 1W6QA 4PI0A 4XDOA 1DQ1A 3AP9A 1WMEA 2MHFA 1YQ6A 1C28A 5FLIA 1C8NA 3JBG1 3SNMA 4XUTA 4Z1VA 2VEOA 2PN5A 5B2GB 2D3RA 3FHAA 5DTRA 4ER7A 2YGMA 4QDQA 4GZ9A 2VNGA 3WHUA 1SFPA 2GMEA 1G7YA 5JIUA 4Z59A 3JXDL 3S7EA 4IETA 1NXD1 4DE8A 1DF0A 3WNLA 3FFZA 3WD5A 4P9WA 3ZXKA 5D21A 3UKNA 4AEDA 2BNNA 3G7DA 1POV0 3O0WA 4ET7A 2FJRA 2V4VA 3VKMA 3ZN4A 1X50A 5F2WA 4DRVA 2VXRA 3JCIA 2LLWA 1G6NA 1U5YA 1JYIA 2PXDA 2WL1A 5BNPB 1G9BA 5FO7B 4XXPA 2PHUA 1H1MA 2LS6A 4JGZA 1YNAA 2R63A 2ADDA 4WM7C 2ARCA 1KRIA 4A2UA 1QIQA 4YM0A 5FZFA 1BK1A 1VMFA 3NSTA 4OZOA 2HSGA 1AF9A 3W5MA 4OVEA 2Q1ZB 3VBFA 1LU2A 1CD3G 2BRTA 4Q1PA 2VR4A 4XILA 2R6QA 4IERA 4XZPA 3OOXA 3O1PA 2GN7A 4PU7A 3P1IA 2QQWA 2ZKNA 5A3LA 4QT6A 2XOMA 3BPSA 1QGLA 4PU8A 2WNUB 4CEYC 3AKPA 3NQHA 1GQHA 2KPJA 2DCYA 4IEUA 2B9VA 2HWD1 3V65A 3KQ4B 3GZAA 2VBBA 3S30A 4Q5OA 4A6SA 4X4GA 4DO0A 3R0RA 1EP0A 1R1A3 1LHNA 2JDPA 3OWQA 3H9AA 1WD4A 5IW0A 5FZ1A 2QQVA 1XNCA 2MNGA 3F6WA 2P3YA 1UXXX 3WY6A 4YFZA 2A6YA 1XYPA 1UY2A 2RHPA 2KA3A 2LYJA 1XU2A 1O4XA 3TAYA 4COUA 1AJKA 1SMVA 3MO4A 2R042 1PNGA 1PO23 3MPPG 5G05L 4BMBA 1TG7A 3ZN6B 4O9GA 1W2TA 1RUD3 4CPBA 5JOYA 4L92A 1GP5A
chains in the Genus database with same CATH topology
4TLFA 3WV6A 5GM0A 3BODA 4WZCA 4KU8A 1NLRA 1S2BA 1ZVFA 3VZLA 1H2LA 1RUF1 1U5XA 4Z5DA 2UY9A 3R6SA 5JZGC 1BXHA 4QPYA 2MEV3 4CDXA 1K5MC 3RPQA 5JWPA 4U36A 4XTMA 5F6LB 2RR11 5F9TA 4JTNA 3MIBA 1VBD3 2Q30A 2QDNA 2RE9A 1TNRA 1W6PB 1SCSA 4I6RA 1BEV2 4RR3C 2A75A 5I0SA 1HRV3 4YFWA 1EAH1 3WXPA 4OULA 3MYXA 1RMU1 2EA7A 3CLCA 1AR72 1C4RA 1L3JA 2ZCWA 4QGNA 4COWA 4HT1T 3VBSC 4CTEA 1GFF2 3HMYA 4FT8A 4FXKB 4DOUA 2CL2A 5I0RA 2JDZA 5DUXA 4D94A 2ZGQA 3GYDA 5DXDA 4Q4Y1 2JD4A 3FUOA 1U0AA 1JFSA 5GZDA 1VBD1 1FOD2 3VLBB 1V9U1 5E8AA 2W52A 3ZVXA 2AXZA 3M2MA 2W08A 3AXEA 4GA9A 1R63A 1UW8A 1S7EA 1QJY2 4H55A 3QF3A 2WT0A 4INDA 4N53C 2DTWA 1QXRA 4COYA 1NY72 1ZBA1 2UURA 3AMHA 3OGGA 4YRDA 2MEZA 3BOWA 3J4UH 1ASJ3 4AHYA 4FQ4A 2ZA9A 1N1VA 2G4IA 5ABJA 2VUJA 4BMEA 1SQ8A 1VR3A 3VBFC 1WMFA 4DS0A 3B01A 1HQLA 4IESA 1RITA 4M3CB 1PHMA 3ST7A 2R062 3TRSB 4P14A 2JKBA 5CIRA 1REDA 1O7FA 4F8AA 3WX5A 2LTNA 1RUI2 4TYSA 3S0MA 4JDMA 3BALA 1F5FA 4YM1A 1FOD3 2LM3A 1OPOA 2D98A 3WG1A 4FN3A 3GALA 4RA0A 4I0WB 5T55A 4XHBA 4L8QA 2DCKA 3MFAA 4MX3A 1ALYA 3PTYA 1A78A 1AR81 2D5FA 2VVDA 1LCDA 1VALA 5KHHA 1PVC1 2RMU2 1QJU1 4Z58A 1IS3A 1FX5A 1ULFA 1XYOA 2BFUL 4FAHA 3LSEA 1D4M1 2B9UA 3AJZA 3CJIB 1S0FA 3BIWE 2ETEA 1X2LA 4AVBA 3FLPA 5FMOS 3MICA 4LBQD 3KGZA 1NE4A 4GH4A 2ZOEB 3UJQA 2V5YA 1XE8A 1IZ3A 1POV1 4JRLA 2YC0A 4KGGA 4Z2WA 5IK5A 1UX6A 1QP4A 2HWC3 5C8CA 3AZWA 2IFWA 1H0BA 1VBA1 4X8NA 1DU3D 3KB5A 1ZBA2 1PK6C 4XJUA 3WDVA 4P9GA 4CP0A 1RHI1 2MPFA 1QJX3 2RM23 3PVOA 5JZGB 4X4CA 2RJLA 1W0OA 5GZFA 3VGIA 1R1ZA 4UBHA 2LYRA 1RGSA 3C2UA 5CB7A 4HVRA 4XIOA 1QDOA 3NKGA 3N36A 3KJXA 1KJRA 2C9AA 3ZXJA 1JBCA 2X53S 2RS53 4I01A 2R32A 4Q4V1 1LOBA 2CROA 4ZU5A 5J48A 1MS5A 5KXCA 1FPN1 4A7KA 4BLJA 1PIV2 3OYWB 2EXKA 5CFDA 3VZMA 3OCPA 3ZYGA 3LGRA 4KG8A 2JG9C 1RUF2 3U11A 2XHKA 2H6BA 3IDCB 1LLIA 1NOVA 1RUC1 4Y4YA 5J96B 5K0UA 4TWTA 3VK0A 3IN9A 2H0BA 1I3HA 3QOPA 4NWWA 1MEC1 4Y20A 2C5DA 1MEC2 4J1XA 2AGSA 2RS51 2ZGTA 5FFOC 2RS33 2GH2A 4UBGA 1T6GC 4K20A 1SQ4A 1WW6A 4NVPA 1NQDA 4HKOA 4FXGB 5H9SA 4WBBA 5T5PA 3OGJA 3AKRA 3AYEA 4CEWB 4F83A 5BNQA 1Z0HA 3ETQA 1BQPA 2GC2A 1XYNA 3KLSA 1RIRA 2WFPA 3MW3A 5IK8A 2IXKA 2OW4A 2EF6A 1V6OA 2DU1A 1O3SA 5GLTA 4IEXA 3AZZA 2HWD3 1QXPA 5C9AC 4U2AA 2ZAHA 5IK7A 2NZ9A 1GR3A 1Y9QA 4AEJA 1QQAA 1AL23 4GULA 4XEZA 2JXAA 5JAXA 5AFEA 4LT5A 1WW5A 5A33A 5EYYA 4QXKA 1DGWX 4XBQA 4GQ7A 4AHWA 3SH3A 4P9IA 4XYXA 4NR1A 1RUE3 1Q8VA 1UMZA 3AKSA 2PHWA 1DW9A 5LEKA 5L19A 3HIFA 1A6CA 1O3TA 1XRUA 3NL1A 4EN7B 3WG2A 1B35A 1RUG1 2PUBA 4D69A 1DQ2A 4AFCA 5AFBA 4Z92B 2GC3A 2D5HA 3WHTA 2Z5WA 3FUQA 4X4DA 3HD8B 2E7TA 4IV1C 5JDBA 1UU4A 1AX0A 2ARBA 3AMMA 4FOYA 4UW6A 5D8AA 4AFDA 2HYKA 2DCZA 4E4DX 1LENA 3ZSKA 4XPVA 1QU0A 5GLVA 4GB33 3WDXA 2VW0A 1UPSA 2Z2SB 2DUQA 2PE5A 3IT8A 2KXLA 3SISA 1G8WA 4YG0A 3M3IA 1POUA 1QQP1 3ELNA 2Z79A 3E97A 4B29A 1EV13 2KEIA 4YGCA 1TMF3 5C8CC 4RR3A 3Q9OA 4JGYB 5C4WA 3LISA 2ERFA 1H9WA 2E6VA 1NCQA 4XIKA 5BNPC 2H0VA 4QD2A 1Q3EA 1G86A 1QOTA 3B69A 1WMDA 2X5IC 4Z82A 3H1MA 3M7AA 2E9QA 4AWDA 4KNCA 1IPJA 3KSCA 3LZZA 3VBUC 4QX5A 2KM2A 1RUD1 1TME3 5CU1A 1RZRA 3W59A 2ZGOA 3KMHA 1FPN2 5ACA3 4YW1A 2WS91 4FPHA 2ZHKA 5L36A 1CGPA 2IXIA 3RRDA 4DPNA 2KZ8A 5LRRA 5T5LA 3IVPA 1CN1A 1RUE2 1HW5A 4XW3A 2WA4A 4G4FA 3NV3A 1NCRA 2VULA 3HT2A 3MW2A 4XXAA 5D1IA 3HAGA 4B4QA 5CBLA 5BUVA 2HWF1 4SBVA 2CAVA 5CFCB 1EPWA 4XFAA 3R4DB 4GMP1 1KS4A 4ES8A 4MGYE 3T1MA 2PUDA 1NEQA 3AP4A 3J8F2 3DPRB 3P3PA 5C4WC 5F5QA 4EWDA 2JENA 3JB8A 5KC6A 2PFWA 4O9EA 1ND3A 1ZRRA 1OLQA 1QY4A 1PZ7A 2PA7A 4QPIB 1KFUL 3FLTA 2SBAA 4QM9A 3M3CA 1I5ZA 5KXBA 4LUKA 1ONAA 3ZN5A 2Q1MA 1GYKA 2EVXA 2FZ1A 3R1FA 1DQ6A 5BPXA 1NLSA 4BWOA 2D93A 1VBB3 3CNAA 3MF9A 3OY8B 3ZXDA 1AR62 2WUSR 2XL7A 4MGZE 2JVLA 2VQAA 1UIKA 3VBFB 1VRH3 5AC93 1U12A 3UFDA 1B35C 2ZGSA 3E5QA 2LYQA 1RMU2 2PELA 2L49A 3H50A 2JG8A 4ATEA 2DTYA 1ZBE3 4EWAA 3M1HA 1A3KA 1OA4A 4A3XA 2F4PA 4R9DA 3H0OA 5EXOA 3OBTA 4S2HA 1NY71 1YIPA 4BIFA 1YSEA 3VBHB 3MF6A 1H2MA 1AYM1 4FAGA 5SV5A 2ZHLA 2DYCA 3VBRA 2GNMA 1VBB2 2I74A 3ZXLA 4GH4B 4MYEA 3I59A 1DGRA 2I2SA 4XFIA 3PHMA 3VBHA 4JQDA 1E3OC 1WLTA 5CG8A 4FPCA 4RQPB 1KQRA 1H4HA 4N9IA 3LA2A 3AMQA 1O4ZA 1ZBE2 2BUKA 1ZBE1 1OHFA 5JZGA 2BPA2 2VECA 4XFGA 4K40A 4DZGA 4FPLA 4YZ1A 4I02A 4FPOB 1PIV1 3UKTA 1UXDA 1TMF1 4E2SA 2GMMA 2SLIA 2ZGNA 4I0BA 1LHVA 1HRI3 3D0SA 3MIGA 3ZFFB 1GLHA 3E6BA 3IIAA 3MI8A 1JN2P 3WNXA 2OUHA 3BTAA 3ZYPA 1MR5A 5T5JA 4R9AA 5LK5A 1W6OB 2XVLA 1CONA 3H5TA 1G9AA 2E7AA 1YFXA 3AK0A 3D8CA 3H3ZA 3K48A 4YZ4A 2OZJA 3SHRA 1QHDA 4M3CF 4Q0VA 2GC1A 3AYDA 4HVOA 4OI1A 1VRH1 2YY1A 4RHV2 5SV8A 4PF5A 1RMU3 2WS92 3B9IA 1WGPA 1RHI2 4AE2A 3EQEA 4D7SA 1FNZA 2HWB1 2IXHA 2EXJA 2ZMNA 1SBFA 1EYBA 2Y0OA 1IKPA 3AKTA 1COV3 3WQ0A 1LJ7A 5EYXA 4D3WA 4AI0A 5DG1A 5A3MA 1GNHA 2B46X 1GZWB 2PHDA 1C8M1 4E2GA 4GHJA 3L2HA 2A73B 4JGYA 1GQGA 4YNIA 1AYN3 5FMOL 5C4WB 3JB4C 4R8HA 3FWEA 2PUEA 1YI7A 1WD3A 4JAAA 3U3WA 3IPVA 4DRRA 4WVMA 4AI2A 1LB2A 2LYLA 3MLJA 5GLWA 4BLIA 1QKQA 2AREA 4PLNA 4DINB 5GZCA 2WA3A 4Z5CA 4AFBA 3WG3A 2Y0IA 4BPZA 4ISRA 2QE3A 3V56A 1PVC3 3SMHA 1UXCA 3VKLA 1BVVA 4CDUC 4ZXKA 1AUYA 5JOZA 3WDUA 4L9BA 1O3QA 1V6IA 3RSJA 1YJKA 3ZHIA 2UWCA 2B5HA 3ZHMA 4R52A 1OFSA 4KQ7A 4KWJA 3ALQA 5BNNB 2IC1A 4KL1A 1RZRD 1D4M2 3I2DA 1F2NA 2XJUA 1LOFA 1D4VB 5J37A 1QPZA 4LA2A 2EALA 1NA1B 3ZMNA 4CDQA 1QXJA 1H2KA 2R043 2WZR1 1CX4A 1RTVA 1AXZA 1AXKA 5HCFA 2VQ0A 2CTVA 4LTAA 4W6XA 3D6EA 1GV9A 4Y22A 4LO5B 4AW7A 1NA1A 4YGEA 1SLIA 2A70A 3WR0A 5CFCC 2OR1L 2EXHA 5JSOA 1M4WA 1DLLA 3HBZA 3PMSA 3B7HA 3NW4A 1FYUA 1VBC2 1ENQA 4XF4A 1XXNA 2BQPA 3CJXA 3U07A 1WBFA 4AVAA 3S8QA 2EIGA 1NCQC 2DFBA 5GKAC 2HINA 1AHSA 4HPKA 4WVZA 5L7OB 1R091 1OQEA 2TBVA 4FPEA 4OI4A 3WT3A 1APNA 1PO22 3ZYIB 4YVSB 3WCRA 1POV3 4YM3A 2VOXA 3MZHA 4I0AA 3AZVA 3WUCA 1J1LA 4YVWB 1MQTC 5J98B 1BDHA 1SLBA 3NV1A 4FPJA 1F8VA 1AR71 1R1A2 4NWVA 1XNKA 2CWSA 5BY5A 2XJSA 4QMAA 3RMYA 2D3PA 2A6ZA 4BQ1A 4X8PA 3E6CC 5BNOB 5CNAA 4Q4Y3 4CDUB 2YZ4A 3O0XA 3AFKA 1I6XA 4YW3A 2H8RA 2GSYA 4Q8LA 2GH8A 1HRV2 5JR7B 4QU2A 3MIFA 4JGYC 2D40A 2PLV1 2A6WA 1H8TB 2CV6A 4JC1A 4K8FA 2PUFA 2ZX4A 3HN1A 4YZ3A 3J26N 2IXLA 4AQSA 1QJU3 1U5ZA 1RIOA 2R16A 1C1FA 2XJVA 3TYJA 3WOGA 3CL1A 4XF9A 4J1WA 1LOCA 2GNDA 2Q0AA 2NMOA 1JH9A 4Q0PA 1ZZ6A 3EHKA 1HLCA 3LFPA 4ASLA 2HWF2 5J09A 2WWSA 4OHVA 2EF8A 1F31A 2WFF3 2AXUA 2XPJA 1KITA 1LECA 3OYWA 4HKLA 4AQTA 2WINB 3FLRA 3ZFEA 1OA2A 1DWKA 4N90A 2EWTA 5HBAA 4HSJA 2D43A 1LHWA 1LR5A 1NCRC 1VB4A 3MIEA 1B09A 3E5UA 1Q56A 3R4UA 3ZKCA 4KWKA 4NPRA 5I91A 1FATA 4N53A 3LWCA 3WW2A