1ZZ6A

Crystal structure of apo-hppe
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGNEFLFVLEGEIHMKWGDKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 45
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz6A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz6A02
1NE4A 3BCWA 4X4HA 2GU9A 2O49A 4I6RA 1EP0A 2P17A 4PU4C 1O4XA 2PHLA 4HVRA 5JSRA 2BEOA 2XKPA 4ZU5A 1YWKA 4OLLA 5I8YA 2XLFA 4IEOA 2IVQA 3EJKA 4HLTA 1PMIA 1NEQA 4JV4A 2EAAA 2LYSA 2B8MA 1O4TA 4IVZA 2BGCA 3QYXA 4P9GA 4XFCA 3LA3A 4GQMA 4DINB 1ZZ7A 5EFUA 5C6CA 2MNGA 3OP9A 4FT8A 2PFWA 2LCVA 3QF3A 3GYDA 4Q0QA 4IESA 4UBGA 3VHRA 1Y7YA 1PRUA 2HINA 1CJGA 4E2QA 1RC6A 3D0SA 3MDPA 4MH0E 4NDWA 3OMTA 4JVAA 4R52A 1O5UA 2C0ZA 3IDBB 2KZ8A 1R63A 3OQMA 2D5HA 1O5LA 5KHHA 1CAUB 4YSFA 3E5QA 4I02A 3IBMA 4MZUA 3I7DA 2CROA 2PUGA 1ZVFA 3E97A 2PAKA 2AW6A 4LUMA 1GQGA 5CVRA 2OZ6A 4O9GA 1RZSA 3BALA 3ES4A 4FN3A 2IXIA 1X7NA 3SCHA 4FBIA 3LISA 2B5HA 2XLGA 4YG4A 4Q0SA 4QGLA 4X6RB 5JSPA 2Q30A 4XF1A 5J7MA 4XF4A 4O9EA 3NL1A 5T3NA 4N9HA 4TLFA 1YFXA 1FXZA 1G6NA 1LR5A 2Q1ZB 5HI0A 5EZWA 4I09A 1XRUA 3F52A 3MYXA 2IV1A 1CAWB 2MHFA 4IEWA 4LLOA 1LCDA 4QXKA 3MZHA 4Q0UA 4I6UA 1RUOA 2PQQA 1CX4A 4IEPA 3IIAA 1LMB3 1B0NA 1UW8A 3U11A 1CAVB 3I59B 4O8BA 3OCPA 2UY9A 4JCXA 3TNQA 1CAUA 1LQCA 3H8UA 3U10A 2GC3A 3BU7A 1QXRA 1J58A 4PIXA 3U3WA 1RL3A 4QM9A 3RZZA 4EROA 4HVQA 5I0TA 3B02A 4UBHA 2H6BA 1NERA 3VK0A 4GULA 1PRVA 4MCTA 3CEWA 4H7LA 4X4EA 2PUEA 5J48A 5I8TA 2XIUA 1RZRA 1FT9A 3FE5A 4XFFA 1J3RA 4EWEA 1QP0A 5JCTA 3BDNA 3SCFA 5BUVA 2O38A 3RYPA 4XEZA 4XF3A 3MLFA 2FJRA 5FQ0B 1XWRA 1ZRDA 4KWKA 2CGPA 2PAEA 5CU1A 4HZFA 1VJ2A 4PU3C 1UIJA 2ZCWA 3CF6E 1ZZ8A 4EWAA 1EFAA 2H0VA 4EWDA 4E2GA 4LUKA 1CAWA 3FWEA 1IPKA 3R1FA 2MEZA 3D0JA 4X4FA 3NKTA 3ZDSA 3H3UA 4X4DA 5FPXA 4IETA 1TQ5A 4XFBA 2H8RA 5AVPA 1V70A 1QWRA 3LWCA 4YG1A 3UFDA 3M70A 1CAVA 3I59A 4JTOA 1ZZBA 2HJIA 3CROL 2GH2A 2JCGA 1YLLA 1UXDA 3PVBB 4Y42A 4ZU4A 4OB4A 3QOPA 3ZKCA 1J3PA 4EV0A 2K0GA 4BIFA 2QNKA 1ZPQA 1NE6A 5FLHA 2XGXA 2WFPA 5I93A 2PUFA 4JQDA 2XSDC 1NYWA 3S7IA 4KU8A 3H7YA 4J1WA 3ELNA 4IERA 5A7LA 4LULA 1H1IA 4BYYA 3FYAA 1YSEA 1OI6A 2UY8A 4HBNA 2ET1A 4N9IA 3WW1A 3OF1A 2E9QA 1ZAYA 4R8HA 3SHRA 4BH9A 5FQ0A 1WH8A 3DL3A 5LRSA 4D7SA 1PRAA 4I6TA 3IWZA 4HMZA 2I45A 1RZRD 3ROUA 3H1WA 1LLIA 1PERL 2Y0OA 4XF9A 3NJZA 1JFSA 4X4GA 4IEZA 5KHKA 3LAGA 3JXDL 4I3PA 1DGWA 3OGJA 2OYZA 1LKNA 3N4MA 2O1QA 4XFHA 4JCYA 4Z5DA 1WA4A 3G7DA 2Z2SB 1ZZ6A 1EYBA 4RD7A 2GZUA 3S0MA 1H1MA 3FFQA 3FZ3A 1ZRFA 3JZVA 3CECA 3IVPA 3E6CC 1JWLA 5I0RA 4FAHA 2XHKA 4LA2A 2CSFA 3OQOA 1HW5A 1X82A 1QP7A 2ICPA 2FQPA 3E6DA 4MCXA 2HKXA 3DKWA 1X8MA 3RYRA 4AVAA 4QMAA 3D82A 4IEUA 2PUDA 2LYKA 4IA8A 5KHGA 1NZCA 2LYPA 2WC2A 2LYQA 2GC0A 2AWIA 3SXWA 3KGZA 5BV6A 1X57A 4QM8A 2QVSB 2KPJA 5KHJA 3LA2A 1O3SA 2DCTA 2XL9A 3H3ZA 2EF8A 3NSTA 2ICTA 2L8NA 2R1JL 5CADA 1JUHA 5JSOA 3IDCB 4X6QB 1I6XA 4YNIA 3USSA 2ATFA 1UD1A 4Q29A 1OSLA 2Z69A 1IPJA 1PNRA 4AVCA 4ZU7A 5BPXA 4I2OA 4Z82A 4OFGA 2PA7A 3FX3A 2IXKA 2V09A 1Q43A 2D40A 2VECA 2ZKLA 4NVPA 1OCTC 1ZZCA 3LFPA 2WUSR 2ET7A 2IVBA 3H7JA 2GRLA 3B7HA 4X4CA 2AXVA 1BDIA 4KU7A 1GT0C 1DZTA 3CLCA 4D7TA 2PUBA 4ORFA 4F7ZA 3S8QA 1RGSA 4LEJA 1QP4A 2EWTA 4KWJA 4MGIE 1HF0A 5I91A 1UXCA 1YUDA 4MGZE 1SFNA 1UTXA 1L1MA 1E3OC 3CL1A 4XFGA 5E16A 2QCSB 5I8SA 5FLIA 1RIOA 3RNSA 2XKOA 3CLPA 2B5AA 2XI8A 3BPZA 1CGPA 4MX3A 2CAVA 1EY2A 2GRMA 2IUOA 1WH6A 3DNVB 4HSLA 2XLAA 4I0AA 4JTNA 2PUAA 1VP6A 3E6BA 3ETQA 3ZHMA 1QXJA 3ACLA 3HT2A 4HN1A 2AXUA 3QWGA 1RTVA 1ZNPA 3HIFA 3JXBC 3PNAA 2O4AA 5C8WA 4QGMA 3U0ZA 1QY4A 4XETA 2QDRA 2VQAA 1IC8A 1J1LA 1EPZA 3HT1A 2OFYA 4YARA 1YFWA 1WETA 2XL7A 1J59A 3O9XA 1BDHA 1AU7A 1UIKA 2FMYA 3KZ3A 4Q0VA 2D5FA 3KGLA 1POUA 1VR3A 2H6CA 3GN5B 2BJCA 4MGKE 1WIZA 3UKVA 3DN7A 1ZRRA 4YRDA 5JAXA 1DZRA 4WVZA 3UKNA 4FAGA 2UYAA 1QPZA 3WW2A 2KEKA 2F4PA 4J1XA 3S7EA 3GBFA 1CAXB 2CAUA 4A2UA 4Z5CA 2GC2A 4X4BA 3KMHA 4XFIA 2PHDA 1XE7A 2B9UA 5F1RA 3LOIA 4PU7A 1X2LA 1O3RA 2PE5A 4X4IA 1DGRA 1JFTA 1OFNA 3H5TA 1Q3EA 4FBFA 1VPWA 2UYBA 3L2HA 1ZX5A 5J3UA 2CV6A 2IU7A 1RPEL 4PIZA 5I0SA 1JH9A 2KEJA 1PM7A 3F6WA 3RYKA 1YFYA 3BB6A 5D1IA 4HN0A 2AUWA 2MPFA 3E5UA 5LEJA 1SQ4A 1QQAA 1RUNA 2OZJA 1I5ZA 4HSJA 2EBYA 3EO6A 4L2NA 3C3VA 2IVGA 2IXLA 3ST7A 4PU8A 1OD5A 3CJXA 4PJYA 1DW9A 3KJXA 3SCGA 3M3IA 2OR1L 4GHJA 3HQXA 3NVCA 3KSCA 2D93A 4IEVA 4QX5A 2KXLA 3QQ6A 5K8SA 1ZVVA 3GN5A 1WGPA 3EUSA 1LRHA 5BXXA 2KEIA 3EQEA 2XJ3A 1J3QA 1ZRCA 2LYLA 1SEFA 2PUCA 5BY5A 2BNOA 2IXJA 1O7FA 2EVXA 3H1YA 4YG7B 4XF0A 2PIJA 1S7EA 5K98B 3KCCA 4E2SA 1ZREA 4Q0PA 1CAXA 3RPQA 3I54A 3FMYA 4QGNA 5FDBA 5JR7B 2N7GA 5KHIA 3H1MA 4Z59A 2GAUA 3FJSA 3ZHIA 4LTAA 2WIUB 4PIYA 5FLJA 1UCXA 4Z5HA 3LA7A 1O3QA 2PPXA 2PAMA 4F8AA 1LB2A 2K9ZA 1U12A 2JVLA 3LZZA 1QQBA 3EBRA 1O3TA 2ETEA 3O14A 3WW4A 3TRBA 4AQ6A 2R63A 4MUVA 4CYDA 4KWLA 4WZCA 2IC1A 1CQTA 3UKTA 4UXAA 1L3JA 3DV8A 3EHKA 1X8EA 2BNMA 1ADRA 2BYVE 2PTMA 4BHPA 2VPVA 3KXAA 1SQ8A 2D5VA 3D1NI 1UPIA 3QACA 4AQ2A 1Y3TA 3MPBA 4MGYE 2IXCA 5LEKA 3HZIB 3BD1A 2LYJA 4YBAA 3OD0A 3R6SA 5I0UA 4AVBA 4B29A 1ZZ9A 2LYRA 2OPKA 4IEYA 4ONUA 5E1RA 1Q5OA 5LRRA 2MQKA 2AXZA 3BS3A 4K8FA 4I01A 5KBFA 2BNNA 2A6CA 2GC1A 4I0BA 5FPZA 3NW4A 3F51A 3OQNA 3CO2A 3PXPA 1OMIA 1LCCA 1R69A 3ES1A 3H50A 1ZUGA 1Y9QA 1NXMA 1YHFA 3FHIB 3WW3A 4YYOA 3FYMA 3E5XA 3JXCL 4WBBA 2GZWA 2IXHA 3H9AA 2OA2A 3TNPB 4IEQA 2XCJA 4Z58A 2L49A 1GQHA 4IWRA 2O8QA 2EA7A 2Q4SA 3RDIA 1ZS4A 4XFAA 3G5GA 3OTFA 3PLQA 2Q0AA 2QJVA 3L1PA 2HSGA 4IEXA 4LA3A 4MV2A 4KL1A 4L11A 2PYTA 4F8DA 4META 4HVOA 1FI2A 5FCCA 1XE8A 4Z07A 1YFUA 1DWKA 3SMHA 1WLTA 4I8TA 4AXOA
chains in the Genus database with same CATH superfamily
5AVAA 1V0AA 5A3UA 4X4HA 2JDPA 4OI0A 4I6RA 5IAVA 2P17A 3VZKA 5A33B 1PO22 5KC6A 3OEBA 4Y1XA 1MVQA 1RUC3 3JUUA 3LSEA 2WNVB 1YRZA 1DQ6A 2YMZA 5F6LB 3ZPYA 5IFPA 1POV3 2W3JA 2BEOA 3ME5A 4EKGA 2XKPA 1YWKA 5DTRA 4LE4A 4OLLA 5I8YA 4QB1A 4QQLA 5E89A 2XBO3 4AI9A 2IVQA 2RS12 3VKFC 5C3QA 3QCWA 5KC5A 2BZDA 3E1F1 1WCKA 4IVZA 3NJVA 5DDJ2 3WF3A 3QYXA 2EAKA 1RUE3 4H2AA 5FZOA 3ZM8A 2PHUA 4L99A 5C6CA 1ZZ7A 1WW7A 2ORZA 2X5IC 3JXSA 2MNGA 4KNCA 3T3YA 4BWOA 1S2EA 3ACHA 4PHZA 2PFWA 3HWJA 4H14A 4Q0QA 4IESA 2Q8EA 4QX2A 3JBG1 5GZEA 4XJUA 3D0SA 2D3RA 3CJIC 3MDPA 5GZCA 4MH0E 4ZS2A 3CZUA 5IHRA 4JVAA 2XDVA 3O1SA 4Q27A 2KZ8A 4YVSA 5FJKA 4AEDB 5ACA1 1O5LA 1QJU1 4NRMA 1CAUB 1W8NA 1R1A2 3ITQA 4YSFA 2H0BA 2ZEXA 4I02A 3N9LA 2IZWA 4GXLA 4LOSA 3WDYA 3IBMA 2SBAA 5JI9A 2PUGA 3E97A 2YXSA 4NPLA 2RS32 1YQ6A 3Q9OA 3CBNA 4L9BA 4OUMA 1TMF3 5CVRA 3ZFGB 1ND3C 2W1QA 1RHI2 1FPN2 2BQPA 2G4IA 3J7HA 4Y4YA 3IPVA 3K3NA 1MEC3 5FJHA 1BK1A 2XJUA 4CU8A 4ASLA 4FN3A 2WQ8A 1COV1 1UKGA 2DFBA 4C91A 3SCHA 4DZGA 2VNGA 2LW8A 2B5HA 4Q0SA 4YG4A 4HANA 4X6RB 3KT7A 1PX4A 1H30A 4O9EA 4N9HA 2E7AA 3I8TA 4XOGA 1AR92 1VBE1 1YFXA 1GR3A 2ENRA 1S4CA 3HBKA 3ZXLA 3GHNA 5M0TA 4I09A 3F52A 1BZWA 4PLOA 3W20A 1CAWB 1HB4A 2MHFA 1IHMA 2C26A 1Z7S3 3PIGA 3MZHA 1OLQA 2VD7A 3EYPA 4CCDA 4NHYA 4YM1A 2VZQA 4RHV2 3SISA 5GAGi 1K5JA 1ULOA 1UZZA 4GD4A 2R0HA 2Q8DA 2JG8B 4QWNA 1ZBE1 4I30A 2PQQA 1ZBA2 5DG2A 3T0DA 2GDFA 2WNEA 2BV4A 1MQTA 1SBFA 1CAVB 1HQNA 3I59B 1G9DA 1XU1A 4AQTA 4F3JA 1DG6A 3VWSA 3ILNA 2AR6A 3A9ZA 1D4M1 2X53S 1W9TA 2HWF2 3MFCA 1NA1B 2VOXA 2GP5A 3C7GA 4RS5C 3JQXA 1QOSA 4WVMA 5C9AA 1LQCA 2VE1A 2X8KA 5EJZB 3ZYBA 4KBZA 3KQ4B 5IFTA 5JZGB 4BIOA 1ASJ2 3ZOIA 3U3WA 1GANA 4ZONA 4JGYC 2VCBA 1SLCA 4XE9A 1XB9A 4K7JA 3W58A 1DHKB 2BWAA 4NIDA 3ZVXA 3VK0A 2JECA 1UXZA 4HKLA 2JQEA 5A3MA 1QXPA 1KD7A 1C8NA 4X4EA 2VULA 5IATA 5FZ3A 5FXXA 5I8TA 4AYUA 3A7QA 1FT9A 2PLV1 5A7OA 3ZXEA 4XFFA 1J3RA 2J7UA 1Y43B 1S0CA 3LQCA 4BJ0A 5CKNA 5BUVA 3VL8A 2EXHA 4JGZC 5DQ0A 4MADA 5DZEA 1W2TA 4Q4X1 3HAGA 2K2SA 2V3CC 4GA9A 5FXWA 5AC91 4IV3C 2PHTA 1LNSA 5C33A 1OKQA 2D6OX 1VJ2A 4HZFA 5IVFA 4PU3C 2K46A 2ZCWA 4DPNA 3H8RA 1NQDA 5A7NA 4EWAA 1EFAA 1X9TA 5A3NA 1SBDA 3JBG2 3ZFEC 1DGLA 1HB2A 5CZKA 1LAJA 3KF3A 1KFUL 2BOIA 3ZYFA 3AKPA 1OOPA 1OQEA 2J7WA 1ULEA 3NKTA 2ODRD 3R05A 5EXOA 3ZDSA 2I74A 3DECA 3T1MA 4Y3OA 1AXZA 5DZFA 2VZUA 4DY5A 1LESA 2ZX3A 1TQ5A 4IETA 3ZYGA 5ACA2 1H8TA 1QOOA 1V70A 1YXWA 2VVEA 2ZABA 3CU7A 4U2AA 3JB8A 3Q8FA 4YG1A 5F39A 3CMGA 2KR2A 2D98A 5FTTC 1ZZBA 1HDKA 2WKKA 4KBBA 3VBUB 3WP6A 2G9GA 5A7SA 1REDA 4ER7A 4CXWA 2RDSA 3DPRA 4GKXA 3KV5A 4K1YA 4ZU4A 1G9CA 2JD9A 3PHMA 2BBVA 1O8PA 2XXZA 5T52A 5GKAC 5T50A 5FZDA 1ZPQA 2XGXA 3AMMA 5L9BA 3AB0A 1NYWA 4GB31 5CG9A 3ZSJA 1WCQA 3ELNA 3ZXAC 4RR3B 4Q2JA 4EKIA 4CA9A 2DYCA 3ILRA 4NIHA 5DUWA 1VBC3 4XW3A 1VBE2 1H1IA 3T2PA 3WCRA 1JZ8A 2VW0A 1YSEA 1KJRA 1YC61 1Z0HA 1JODA 2A3YA 2ET1A 4HBNA 4N9IA 4YVWA 4JX0A 5CG8A 3JB4C 3TBDA 1OVPA 3ACGA 3DL3A 3BPSA 1PGW2 2R061 3C2UA 5EV7A 4D7SA 1US2A 5B2GB 4HMZA 4LHKA 1VBB2 3T09A 4P5YA 4HOOA 2O14A 3OBZA 3GJAA 1RUG3 5HCBA 5KHKA 5IK7A 2WZR3 5FOBB 3PUQA 1QJX1 3OGJA 1D2SA 1OH4A 2A6XA 3RRDA 1A8DA 2FDFA 2VXJA 2VTFA 4XFHA 5JWPA 2EXIA 4JCYA 5LBEA 3G7DA 2Z2SB 1ZZ6A 1EYBA 3NQHA 2Y6JA 4RD7A 2AEYA 3T30A 2QQLA 2VUAA 2V5YA 2ZEYA 3FZ3A 4RN5A 2WWSA 4EJRA 3CECA 4X8PA 1YJKA 4CP2A 4LORA 1HRV3 3AP9A 1JWLA 4KG8A 1XNDA 4JHZA 1IG3A 1SPPB 3AZYA 3ZO0B 3JD71 1PMJX 4LHSA 5A70A 3V0AA 4MCXA 1OD3A 3VHOA 5DSXA 1NCRA 2PLV2 2BFUS 1GOHA 2B4KA 4Q4Y2 4QMAA 4RQPA 3OYWA 4CVUA 2LYKA 3OD4A 1WA6X 3HOBA 3DUIA 3DYOA 4FXKB 4N8MA 2WC2A 4Q4X2 1AL21 2SLIA 2CWMA 4Q4V2 4M3CE 1VALA 2NZ9A 2Z5WA 2Y6GA 1GZWB 2PXDA 1GSLA 1RUH3 2W08A 4QD2A 5HV4A 5KWRA 1LOGA 4BA6A 1PZ7A 1UO9A 2X5IB 4GWNA 5FYTA 4INDA 4LITA 1DYPA 2J7MA 1HLCA 2AC1A 3NWKA 4GMP0 4EZ4A 3USSA 3N9PA 1AR81 2FCTA 3ZDVA 2DVAA 3CJIB 2WNUC 4LBQB 3J8F1 4QX7A 5JDBA 1GP6A 2Z69A 3TEPA 4ISRA 1YJLA 4NWVA 1CN1A 3FFZA 4OHZA 4I2OA 5FY7A 3VD3A 5HXMA 4Z82A 5D8AA 4E4SA 1PIV3 4Y22A 3MO4A 5FZ6A 4S2HA 4XPVA 2V09A 4CXYA 3POJA 4DXTA 3LFPA 4A42A 2WUSR 3NAPA 5FZBA 3RZJA 4EQVA 4A3ZA 3Q8EA 3A0NA 4CCLA 4LEJA 3RWKX 4FTSA 1LJ7A 1ND3B 2JG9A 2W47A 4XCAA 1NLSA 2A5ZA 3HPNA 1YUDA 5FK8A 4ATEA 2RR13 2ERFA 1A8MA 4FFIA 2L1PA 4MXWA 1LHWA 1UU5A 5LA0A 3K4ZA 5EP9A 4ASKA 3ZX7A 3RNSA 2DVDA 2XKOA 3SQOA 2CGOA 4CPBD 2XI8A 1RJ7A 2R071 5D2AA 4AVTA 2C9AA 4LT5A 4MX3A 1YQ5A 3DNVB 1JYIA 4I0AA 4MYEA 5IK4A 2PUAA 1VP6A 3GNEA 5C4WC 3ACLA 3WG4A 5LZ6A 1PO23 1RTVA 3JXBC 3PNAA 2O4AA 3A9YA 4K1ZA 4YFWA 4CU6A 4QGMA 3AP5A 1XNKA 1QY4A 4R9AA 4XETA 5LWBA 2LLVA 4AVSA 4LK7A 1JUIA 4DO0A 1YFWA 5BNNC 3M3EA 2RS13 1EAH1 2NN8A 4NROA 2CU5A 2GNDA 2ZTNA 4BXSV 4V2VA 4XUQA 2AEZA 3KZ3A 1B35A 2D5FA 4DUWA 2GP3A 3UV9A 5J98B 2I07B 4NOTA 1NXD1 1W6NB 2GN7A 1Z78A 4RS5B 4DUVA 1G86A 1POQA 1VMJA 4QPGA 4ARXA 3OPZA 3MGUA 1YO8A 3AKRA 4YW6A 5JAXA 3TAYA 3AK0A 1DZRA 4UW6A 2DV9A 4FCAA 4Q5OA 1R091 4JCKA 3USUB 4FAGA 1ZM1A 4JGYB 2BDRA 5FZEA 1W9YA 5A3LA 2O0OA 3VKLA 1CR7A 2F4PA 4B8EA 1W8TA 2ZKNA 3IB3A 4COWA 1DYOA 4E8CA 4YZ1A 1XE7A 4CEWC 5F1RA 4JDOA 3WNNA 3LEGA 3M1HA 1GYKA 3QOWA 1DDLA 1MFQC 4PU7A 1LODA 4EN7B 1R1A3 4HKOA 3U4XA 2YG0A 4JGZB 1ZYBA 2VU9A 2VZRA 3ZIWA 1L7RA 3ZYJB 1G9FA 1AL0G 5FY8A 4UFJA 4CE8A 4IV3B 4CCEA 1JFTA 2YBSA 3H5TA 1JZ2A 1C8M1 2V4AA 2RS33 4AOCA 5J3UA 3R0RA 1UMHA 2CV6A 4LIVA 4NHMA 1RHI3 1IOAA 1FPN3 3ZFEB 4CDUA 3F6WA 4CCNA 3J8F2 2WS92 5FIXA 3LIHA 4FTEA 3UGHA 1QH6A 1GLHA 5LEJA 4ER3A 1AX0A 2JXAA 3G0TA 3AJYA 4M3CA 1RUNA 3LOBA 2ZMKA 2XBO2 3EB7A 1KITA 2JE7A 2J1AA 3AXEA 4L2NA 4A7KA 2HCSA 2YZ4A 5C71A 1AR93 1PGSA 4PJYA 4HONA 1VBA1 4QX8A 4LA2A 4NR1A 2WT1A 4GHJA 2QZ2A 1LULA 2KXLA 3J7MA 4PBOA 5HXVA 3GJBA 5FBZA 2PELA 5BXXA 5FR3A 4OBMA 1HRI1 2KEIA 4U36A 2XJ3A 3BOWA 1C57A 2Q5TA 3T0AA 3SKVA 1WUVA 4RHV3 1FX5A 4SLIA 2PUCA 1QIQA 1ZBA3 2WSUA 3H1YA 5C8CA 4TWTA 4YGEA 4E2SA 1ZREA 1MZ6A 2RDRA 4M3CF 1BYHA 1VE0A 2VTXA 5JR7B 3RJ2X 4Z59A 1LCLA 5LBCA 3OGGA 4LKSA 5LASA 2HWF3 3H8OA 1MZFA 2DCKA 5H9SA 1W6QB 4PIYA 5FP9A 3CIHA 4CCOA 3SITA 1UCXA 4Z5HA 1ASJ3 1TME1 2PPXA 2WO1A 2ZHLA 1LB2A 2K9ZA 3UESA 4B7KA 2JVLA 2PHRA 2Y64A 2YU1A 4QPIC 1QQBA 1REEA 1O3TA 5CKQA 2E7TA 1TMF2 1F5JA 2ZA9A 4CZSA 3K77A 4XJ9A 3TRBA 1MEC2 3POYA 2NMOA 3WY6A 2R63A 2NMNA 2VAUA 2VMEA 2VTXJ 4A45A 4BM8A 4EE2A 3DKQA 2GMEA 3VBSA 1DZQA 1NX9A 1X8EA 3WQBA 1RUF1 3TOJA 4W6YA 1SQ8A 3D1NI 1UPIA 4AQ2A 4RGKA 3VLBB 1FV3A 3BD1A 3JBG3 3R6SA 4AVBA 3PJYA 1C3HA 4JRLA 5ANQA 1LU1A 1PZ9A 3BVCA 3L2YA 2VCMA 1M06G 1JU4A 1F2NA 4P9YA 1D0GA 3DPRB 5E1RA 2AXZA 2E53A 4IV1C 5APAA 3IN9A 3RQ0A 4XABA 1G8WA 5ACA3 3N7MA 4N43A 3QFIA 4I0BA 4GH4A 1XXNA 5CNAA 2QQOA 5F3IA 2RE9A 4MVTA 1ULCA 2CWSA 3THPA 2TBVA 2WRAA 2YUEA 2TUNA 1W90A 1R69A 3ES1A 3IDEA 4K20A 3WVJA 2P37A 1MS8A 2IFWA 1YHFA 4EN8B 3O1RA 5LA2A 3A23A 1LOFC 3MW2A 4P9XA 3VBHA 1HV1A 1K12A 2R32A 5CFDA 3TNPB 1W9FA 4A6OA 4FFGA 3UJOA 5GLVA 1GQHA 5JXJA 3O1PA 4IWRA 3ZPXA 2O8QA 4YW2A 3PU3A 2WNUB 4RGGA 3RDIA 2D6LX 4HK9A 2YGMA 4NRPA 4AF9A 2R49A 4UOJA 5LA1A 2CGNA 4QHZA 1HKDA 3L1PA 2PQSA 1OF3A 1U5ZA 1VBE3 5ANNA 4DEVA 4LO8A 3VBOA 1BEV1 2PYTA 4F8DA 4OZOA 4PT6A 3MIHA 3FBMA 1I1EA 2HWD1 3IMNA 4FXGB 2VNVA 4IDZA 3NNMA 1ULDA 5FCCA 5T5JA 3VZMA 1UU4A 4QQ2A 4F83A 3WP4A 1ONAA 2DCYA 2R1DA 3SMHA 4KGQA 2AUYA 3NO8A 1YEWA 4XJZA 2J1RA 2ZAAA 2HEYF 3N9QA 3KV9A 4PU4C 3POGA 5FOJB 2DDUA 2Y6LA 1DU3D 1W0PA 3OWQA 5FXZA 2DTWA 1H6YA 1QQP1 4A44A 1ODNA 3SH4A 1JYNA 4ZU5A 3AXDA 4XIOA 1WD4A 2RM21 4C8DA 1AYN1 2XLFA 4IEOA 2ARXA 3UJQA 1UY1A 2C24A 5A7PA 3ZXGA 1PMIA 2PXBA 1OH3A 5C4WB 2W0XA 1NEQA 5JUWA 1VMHA 2FFHA 2EAAA 2W95A 2LYSA 2GMPA 2HEWF 4OMCA 1O4TA 5FY1A 1OT5A 1QJY1 2BGCA 4AAPA 4GAZA 1QOTA 1MS1A 3VDDA 5A1LA 5FP4A 2TNFA 2YPDA 3B93A 4DINB 2WA3A 4OI4A 4BOWA 2DFCA 2PLV3 2BGOA 3B5LB 4Q4Y3 4UBGA 5BNNB 2NQYA 1N1VA 1PRUA 1AR61 2RJ2A 5KR7A 1LEDA 4QQOA 3WNKA 3QLQA 4W6XA 3NROA 4Q4X3 4AR2A 5AC93 1I5PA 3GZCA 1NW3A 1LU2A 4JZRA 4NDWA 1VBC2 3OMTA 1VPHA 3VHPA 4R52A 1GZTA 4CCCA 1O5UA 2C0ZA 3IMMA 3OQMA 4TLGA 5KHHA 4ATFA 3MPPG 3I97A 3VKMA 3X29B 1NT0A 3E5QA 4LJHA 4M4RA 1PK6A 2WINB 4HETA 1ULPA 4MZUA 1MVEA 1DF0A 3T0BA 2CROA 5GAHi 5CBLA 2PAKA 1WWYA 4DE8A 2XJTA 2XXPA 3SEEA 3BTYA 1RUG2 5L73A 1K5MA 1GQGA 5TSWA 5CA6A 1HB1A 3WCSA 2WZR2 1SLTA 4D6QA 2XONA 2W1SA 4CEWB 2YFUA 3WF4A 3MHZA 1UZWA 1DFQA 1U5IA 4FBIA 4KG0A 2JICA 1CESA 2XLGA 3KM5A 1NZIA 2JB8A 3MI8A 1K45A 3QBQA 2MEV1 3NL1A 5T3NA 3NKGA 1XYPA 3UYJA 1OUXA 5L7OC 1HRV2 2XR4A 4ZKTB 4OHYA 2D43A 4EYUA 3WXPA 1WCUA 1BBT2 4LOTA 3FUQA 4LLOA 1JTZX 2XH6A 2JDAA 5A32B 3OY8B 1W6OA 4Y20A 3DCQA 3PVOA 4FFHA 4OQ8A 2HWD2 4CCMA 2CDOA 3J26N 4O8BA 5JOYA 4CDXA 2YBPA 1QMJA 1K3IA 1AR71 1RUH2 3GCXA 4JCXA 3OCPA 4WM8A 4YM0A 2Y6HA 1RUJ2 1IKQA 2BPA2 3U10A 3POSA 1H9WA 4CDQA 3ZSLA 1QXRA 2VMCA 2YC2A 2YU2A 4PIXA 4G3YC 5T55A 1FOD1 1DBNA 1QJFA 1XU2A 2ZZJA 1HXS2 2ARBA 3B02A 3WEZA 2CL2A 3C7EA 1S55A 2RM22 1AYN2 3AMHA 3KZ4C 3THDA 1JOBA 4MCTA 2PXQA 3K2OA 1WKYA 4H7LA 5FFOC 4COVA 2PUEA 4XURA 5F3CA 5FREA 4RGAA 5J48A 2JDKA 2XIUA 1Y4WA 2M4HA 3AVRA 3I2HA 2P6HA 5JMOA 4EWEA 1OA3A 1QP0A 5JCTA 4TXWA 1UPSA 1XNTA 2QQVA 3ZFFC 3RMYA 4BLIA 1XWRA 1ZRDA 2QUOA 4QPIB 1SACA 3FHQA 2VZTA 1DQ0A 4W4ZA 1UYXA 2C6SA 1ENQA 3NNFA 5SV8A 1AR62 4YZ5A 1OKOA 4E2GA 5ISLA 5DN2A 5E6HA 1AL23 4B4PA 4PLMA 4ER5A 3AP6A 4EK9A 3VBFC 4NAOA 1H2MA 3MLJA 3ZR6A 3H3UA 1V6LA 3SR4A 4X4DA 2E6VA 2JDZA 4DOUA 2ZJCA 3APBA 3LWCA 5JR2A 3O1MA 3HNYM 4LBLA 4JTOA 2HJIA 2GH2A 3WQ7A 3POWA 1YLLA 4C90A 2HYKA 4AGGA 3J8F3 2WS93 3PVBB 1LHOA 2VUCA 4OB4A 2YC4A 4IV1B 5KXDA 1GZ9A 2VMFA 5JIAA 2K0GA 4BIFA 2QNKA 4COYA 1NE6A 4XC9A 2NM1A 2A73B 2PUFA 1OA4A 1Q8PA 3H7YA 4P9JA 5GZGA 4IERA 1HV0A 4CSWA 2XHNA 3OGSA 2MEV2 4R4ZA 4R9CA 4CU9A 2OVUA 2P3IA 1W2NA 3POIA 2BP6A 4NAMA 2VZPA 1NCQC 2LNMA 1IGOA 2V72A 5BNOA 4W8JA 3SHRA 2ZEZA 2FZ2A 4BH9A 5FQ0A 2YC0A 1PRAA 2VEOA 4I6TA 2QQKA 2W52A 4CUGA 1H4GA 1TEIA 4E4ZA 2A3WA 2I45A 3OGRA 4IUGA 2ZHMA 3H1WA 1UKRA 1LLIA 2R073 2Y0OA 4XF9A 3ROUA 1JYWA 3NJZA 1JFSA 4X4GA 4IEZA 3WNLA 2OQ7A 1FNZA 3ECQA 1UOFA 1J83A 1LECA 2XJQA 3LIGA 3VBRC 3VDCA 4ES9A 5CFCC 1I9RA 1LKNA 1C28A 1TG7A 1URXA 3FUOA 3MF6A 3U07A 2QQUA 4Z5DA 3U78A 4ASMB 2E31A 2OX0A 1H1MA 1ST8A 4B7EA 1WMFA 3FFQA 5IAXA 2D44A 4CPBA 1PVC1 3JZVA 1FOD2 5FMBA 2A7AA 3IVPA 4R9DA 5GJ6A 3ACIA 5SV5A 3WHTA 3V0BA 1SCRA 3LKJA 4GKYA 4PDWA 1H0BA 3JCIA 4QB2A 2CSFA 1HW5A 1KS5A 1X82A 4D6SA 5CEHA 2A6YA 1HN0A 2FQPA 2WBKA 3CDZB 1QNWA 1UU6A 2PXVA 2Y6KA 3DKWA 1OQ1A 1X8MA 3DYMA 4N53A 4ZPIA 4Z92B 3H42B 4QX0A 3D82A 2PUDA 1J1TA 3VZOA 3ZXKA 2Y6FA 1NZCA 2R6QA 4CP9A 1R093 3MIBA 5JOZA 4UW3A 4DB5A 4QKFA 1BLZA 3IM0A 2AWIA 3OB8A 3I3MA 4Q4W2 2DTYA 4CDWA 1HJFA 4I3GA 2QVSB 3GUUA 5FZHA 4BCUA 5DMYA 2HLEA 1UZYA 5AFEA 1O3SA 3MLKA 2XL9A 4Y5Z0 1ENSA 2WJSA 3ENRA 1E5IA 4FPGA 4A4AA 5CADA 2YDEA 4FPJA 4WM7A 3IDCB 1ND2A 2DF7A 4X6QB 4YNIA 2G1MA 5JXGA 2PXUA 1BMV1 4TN7A 4ZS3A 4GWJA 1PNRA 5BPXA 2ZGNA 1F8VA 4K40A 4YZ4A 4YVSC 5IVJA 2EF6A 5GM0A 1JHJA 3OSDA 2W91A 2D40A 1XE0A 2WZEA 1WMDA 5LBFA 4CU7A 1ZZCA 2ET7A 1S0EA 2GRLA 2ZGRA 1BDIA 4GZ9A 5T54A 1O6UA 1GT0C 2PXTA 4FVVA 5A7WA 3CLCA 1UXXX 2EIBA 4AGRA 1JN2P 4ORFA 2WSVA 3C8XA 2W92A 4Y1ZA 4Y24A 3BTZA 3MICA 1PVXA 3MF9A 4FP3A 4XMAA 3RMXA 4CP1A 1UYZA 5FZ4A 4ZXKA 1DP0A 1C1FA 1OF4A 1UY4A 5I91A 1VBA3 4MGZE 3K75B 4BQWA 1L1MA 4LBKA 1V6OA 5F5IA 3T08A 3WT3A 2HBTA 1WBLA 4XVHA 3AP4A 5I8SA 1PHMA 1WW5A 4LBJA 1HRI3 1W8HA 1Q8VA 4N7UA 4WV8A 2VZOA 4FPKA 4EN6B 1DQ1A 1WCSA 1SLBA 2JE8A 1K42A 4Z8BA 1D2QA 1EY2A 1W39A 3RZLA 1WH6A 1DYKA 2OQ6A 2XLAA 5L7OB 1RXGA 3E6BA 3HT2A 2WNOA 1JU3A 3QWGA 4ER6A 1JZ7A 1OPMA 1S0FA 3G6JB 4BK5A 1W6MA 5C8WA 3AZVA 4DUXA 2VZ1A 5FMOL 5FP7A 3U0ZA 1RB8G 1VRBA 1QJU2 1IC8A 4XACA 1J1LA 1OXCA 1VBD1 2DCZA 2OFYA 4GJYA 4E27A 1J59A 1NKGA 3ZN6A 3O9XA 1TME3 4BQ3A 2WIIB 4Y1UA 1O8SA 1UIKA 1MQTC 4R4XA 3KGLA 4LR4A 3FLRA 2H6CA 4QPYA 5A3OA 4NO4A 1MZ5A 3AM2A 4UFIA 1WIZA 1PX3A 3DN7A 3KT1A 2E33A 5JXIA 4JRAA 5GLTA 1FYUA 4FO9A 1COV2 5FY4A 1Q8OA 1JYTA 3ATGA 5EPAA 2WFF1 1QPZA 2KEKA 2UURA 3M3QA 1NG0A 5FYBA 5F32A 3I3BA 4X4BA 3KMHA 4XQDA 2ZGKA 3FL7A 2JENA 3P1IA 3C7OA 2DUPA 1S2BA 2JDNA 4GMP3 4BQYA 2QDNA 3Q8AA 4X4IA 1AX2A 1MZEA 3ZFFB 4M00A 4UF0B 1DGRA 1OFNA 5K4LA 4ZY9A 4IGPA 5DRTA 3DXTA 5BNPA 1R081 1ZBE2 3L2HA 4YM3A 4HPKA 1ZX5A 4AHZA 4IE0A 1D4VB 2IU7A 2VH9A 5I0SA 1JH9A 2KEJA 4TTGA 1YFYA 3WF1A 3BB6A 4IE4A 2AUWA 1D4M2 1N1TA 3VBFB 1OOPC 1NLQA 1EV11 4QB6A 4L8QA 5FUIA 3VGIA 1I5ZA 2EBYA 2WAOA 1H8TC 5FYYA 1X50A 1RMU1 2QFEA 3ST7A 4B1LA 4PU8A 1OD5A 4DEQA 1W6PB 2F4LA 1U0AA 3SCGA 1IPSA 1XYOA 4DRRA 4FPYA 3GN5A 1BBT3 4QU2A 3DPRC 3KT4A 4HFSA 1ZRCA 3I2KA 4A41A 5K0UA 2Q8CA 4OHXA 1BEV3 3I2FA 3VL9A 2G9ZA 4IE6A 2HWD3 2DURA 3VD9A 3S57A 2EVXA 4YG7B 1SMVA 4YM2A 1C5HA 3KCCA 5EHDA 3WP3A 5AC92 3TEZA 5F5CA 4MG2A 1CAXA 3RPQA 1GNZA 2FMDA 5FDBA 2PHFA 2WAAA 4XUNA 3S30A 4PQ9A 3ZR5A 4IE7A 1JHNA 4C1XA 1RUJ3 1NCQB 1OFSA 4LTAA 5F3EA 5FWEA 2WIUB 1LHVA 2JJ6A 4LKDA 5FLJA 4YVWC 4K6BA 4BB3A 2PAMA 4JKMA 4YW4A 1LOEA 5FP8A 3VN4A 1HXS3 4F8AA 1QQP3 1VB4A 1Q8SA 4G9SB 4FPEA 2P3KA 2RM23 3W5NA 1AYN3 1PNFA 1VBD2 3POEA 4MOAA 3HN3A 3O14A 4XJ8A 5ABJA 3WW4A 2ZGUA 4XQ4A 3VBRB 2DBNA 3DEMA 2QQNA 4AQ6A 1QDCA 4FPFA 4CYDA 5CFCB 3NZLA 1CPMA 4LO5B 4WZCA 3MEJA 1CD3G 2R041 4JAAA 4LXLA 3DV8A 3LDBA 2ILMA 1A78A 4P02B 4XILA 3ZYHA 2FCVA 2BNMA 2GH8A 2PTMA 1UY3A 1AJOA 2ZGOA 2EXJA 5IVYA 5LW9A 4CP0A 4E8DA 3OKZA 1SG3A 3DGTA 3LQXA 1Y3TA 4MGYE 1AR63 4GB32 4K21A 3HZIB 4L92A 4LHNA 4S2GA 2VZ3A 2LYJA 3OD0A 4CEYA 3ORJA 4A6SA 1RUC1 3HJRA 5HCFA 2JD4A 2LYRA 2OPKA 4IEYA 4HRAA 1POV1 1OLRA 1Q5OA 4ONUA 4Q26A 3GHMA 4RA0A 5LRRA 1LGBA 2BNNA 2J1VA 4YGDA 2Q1MA 1NCRC 3BOPA 4V1PA 5C9AC 4RQPC 4NHKA 3LEMA 5FPZA 4OHWA 2R062 3PXPA 1HQLA 2ZGSA 1RUE1 2QKDA 1LCCA 2UWBA 2ZBJA 3RS6A 2YGLA 5CB7A 3H50A 5A7QA 5FZOB 1YCIA 2C1FA 3AVSA 1IKPA 2RMU1 1BXHA 2XXAA 2BBAA 3GGLA 1QJX2 3FYMA 2IFRA 4YYOA 3WW3A 3AYCA 4Z2WA 4WBBA 4O61A 5LB6A 2IXHA 3ZPOA 4MSVA 2E26A 4IEQA 5CIRA 2L49A 1OVSA 3KL4A 3WD5A 1W06A 4LO4B 1UF2C 1JZ3A 5EYXA 1PMHX 1GU3A 2MEV3 3GDBA 3G5GA 3OTFA 4COUA 1KXGA 4XXAA 5FUNA 4IEXA 3W21A 4CCKA 3MUY1 2WYSA 2Y34A 4YVSB 5D8AC 1BVP1 4D69A 1R64A 2B42B 3NRUA 2WR9A 3NV2A 2PXLA 2X10A 1GNHA 3JD72 1Q56A 1ACCA 1AYM1 1JXNA 2Y33A 3NAPC 5FWJA 3KV4A 4PI0A 1GP5A 5FYZA 4ET7A 2JEMA 4AEJA 1NE4A 3BCWA 5DG1A 2GU9A 2IVIB 4BPZA 4CUCA 3WDTA 2YHJA 1QJZA 1AL22 1EP0A 2JG9C 2D97A 3IPVB 1LOAA 5FAXA 1O4XA 2PHLA 4FI9A 5JSRA 2D6NA 2EALA 3HEIA 1RUI1 1V6MA 2XG3A 1RUD1 1XOYA 1PM4A 1US3A 2AYHA 1FOD3 2NYYA 2YBDA 1W3VA 1TNFA 4JV4A 1AR82 2PMWB 2ZZQA 4B3NA 5IVVA 4D0QA 4DFSA 3HNBM 5DUUA 4FQZA 4DY3A 2WWJA 4P9GA 4XFCA 1NAEA 1NUKA 2FHRA 3LA3A 4GQMA 4Q2FA 4CTEA 5EFUA 3WP5A 1ODMA 4XDQA 4FT8A 5HPOA 3QF3A 4GJZA 4RFT0 1H6XA 3RI8A 1I3HA 2L9LA 2HINA 1CJGA 2R042 4K9SA 5JIUA 3ZMNA 1L7QA 1MQTB 2HWE1 5G05L 4Y33A 2VUJA 4Q4W3 1B35C 4P14A 1CQ9A 3IDBB 1R63A 3WHUA 4AK3A 1BKZA 2ZHKA 5BYNA 4QPGC 4FOQA 4UW5A 4WVMB 3GBGA 4ES8A 3WNMA 3RG0A 4NJ4A 2YFZA 3J4UH 1ZVFA 3T2TA 5G04L 2AW6A 1T6GC 2P34A 2R072 3UT0A 5C7GA 3KLSA 2AENA 2JDYA 1V6NA 3GZDA 4O9GA 4XTMA 2OUJA 4XCBA 4XXPA 5A33A 1RZSA 3BALA 3U14A 3FLTA 1F35A 3ES4A 2WNVA 1X7NA 2VJXA 3ZSKA 4QKBA 3LISA 4QGLA 3F2ZA 2AACA 2F6BA 5CKMA 2RMU2 5JSPA 3ZSMA 2DUQA 4XF4A 3OGVA 4TLFA 4HG6B 2R0FA 1EAH2 5KXBA 2Q1ZB 4OUSA 4D8MA 5HI0A 1N3QA 3AFGA 3M2MA 1XRUA 2Y26A 3MYXA 4CDUC 2IV1A 5FUPA 2WLQA 3AZZA 4KMQA 1FMD1 4QXKA 1G7YA 1OOPB 3AP7A 1W2UA 4DXSA 4Q0UA 4AE2A 4I6UA 1X9PA 2Q8OA 1C1LA 1W2OA 5C3SA 3VD4A 1QNYA 4QKDA 1H8TB 4UFMA 1CX4A 1OPOA 1R092 3IIAA 1B0NA 1OA2A 1UW8A 4M4PA 1W05A 4XBLA 5EIYB 1AYM2 2BJSA 2WL1A 3QH6A 2J42A 3OUJA 2CDPA 2VUDA 3VUOA 1UAIA 1UY0A 4AEDA 4DE9A 1CAUA 2IWGB 5KXEA 1GP4A 3H8UA 2GC3A 4NMIA 4MGSA 4NRQA 4P00B 1QJU3 1S0GA 3OOXA 1J58A 3VZJA 4KI5M 2HBUA 4TZDA 1RL3A 1IQAA 3RZZA 4XHXA 4QHOA 4EROA 4HVQA 5I0TA 3NXHA 3GZEA 4LQRA 2H6BA 5C8CC 2R30A 1RUI2 3BN6A 3FC0A 4GULA 4Z2AA 1C8M2 3CQOA 4YZ2A 3CEWA 3ZFGA 4XYXA 1RINA 1RUD2 1V9U1 2EICA 2PXFA 3T4HB 2JB4A 1XYNA 3FE5A 5E8AA 1LGCA 1QKQA 3TEYA 1QZXA 3BDNA 1R1ZA 1XQNA 3MIGA 4YVWB 2W68A 3N9OA 1JOPA 3WZ1A 2I2SA 3RYPA 1COV3 5FYUA 4XF3A 5C3PA 5CAZA 3N36A 5JPMB 1MACA 2PAEA 2VOKA 2ZGTA 4IL7A 3CHXA 3CF6E 3I2GA 1ZZ8A 2D6KA 2QE3A 2H0VA 2WN2A 1VLNA 3Q8CA 4CCJA 2XB6C 4EWDA 4LLFA 1VBA2 4OI2A 3HVDA 1CAWA 2VMHA 3LEIA 4QHBA 4QKNA 2WQZC 4QAWA 1IPKA 3R1FA 3LDRA 4HXCA 3W5MA 3D0JA 4X4FA 5KXCA 2ADEA 1HRI2 2VOVA 1DQ4A 4XZPA 4FTBA 2GNBA 5FPXA 4EN0A 3VBSC 4XFBA 1FV2A 1WCDJ 2JG8A 2DVGA 3K4DA 3TN91 4WVLA 1QWRA 2LTNA 1N1YA 4A7YA 3UFDA 3M70A 2XXQA 1WMEA 1ZBE3 1CAVA 4QDRA 5EYYA 3I59A 4WVVA 3ZXDA 1WD3A 3CROL 1DQ5A 1UXDA 4ZHNA 4B4RA 1NA1A 4KQ7A 4HT1T 1AX1A 2WA4A 3VZNA 2FDKA 1D4M3 3ZKCA 3MV11 3V0AB 5A3PA 2TEPA 4EV0A 5FO9B 5JZGA 2XMLA 3PVNA 3HBZA 3QD6A 3PJQA 1NCRB 5C9AB 5FLHA 1F5FA 3FLPA 2BTVC 2LUWA 2WFPA 3AJZA 3OYWB 4IW3A 4JQDA 1TME2 4N43C 4RQPB 5IUQA 4KU8A 2FCUA 4GH4C 2RDQA 1O4ZA 3S7IA 5A1FA 4W6WA 2OIIA 1ZA7A 2NPIA 4FFFA 5A7LA 2JDUA 4FP2A 4LULA 1U5YA 4BYYA 3FYAA 2QQMA 5LK7B 2UY8A 3WW1A 1W0OA 3RFRA 2DCJA 5FMCA 1XBFA 1DCSA 1ZAYA 2E9QA 4R8HA 1PNGA 3VBHC 5CFDC 4L0PA 1WH8A 1TVGA 3RWNA 4XHBA 1LGNA 3IWZA 3KVBA 1RUF2 1RZRD 2VY0A 1PERL 2WLPA 3NV4A 3P3NA 2UWAA 5JMCA 3U37A 4UFHA 2XJVA 1HN1A 4I3PA 1DGWA 5D8AB 2OYZA 4WZFA 4Y22B 1LHUA 3VBOC 3R4DB 5J37A 1QU0A 3UL2A 2ZOEB 1JYVA 1WA4A 5FZIA 2LM3A 3WQ0A 1W9SA 4AL9A 4YWAA 2GZUA 3NAPB 5F2WA 1SLAA 3S0MA 1RVF1 4M0HA 3GALA 2ZXQA 3WG1A 1UQXA 1VBD3 1GQPA 1VMFA 3ZYIB 1WMXA 1HX6A 3ILFA 3VBUA 3LF7A 2BU9A 1F9KA 2QZ3A 3E6CC 2JG9B 5LCWL 4D6RA 4LNVA 4YFZA 3GF6A 4FAHA 1UYPA 5IVBA 3SEPA 3SH3A 2D3PA 3AMNA 4MXWB 2ICPA 3E6DA 3THTA 3RZGA 5FZMA 4AVAA 1CVNA 2R7EB 4URTA 1TE1B 2XJSA 3N7LA 5K9YA 4LK6A 1A34A 2WDBA 4ISQA 5KHGA 2VOWA 1KGYA 2PHXA 3T2QA 2LYQA 4RR3A 1VAKA 4GB33 3TYJA 4EN9B 2WO3A 2WFF3 3SXWA 3KGZA 5BV6A 2C9KA 4LBMA 3N3HA 3CNAA 1WLCA 2KPJA 3VDDC 5KHJA 4Y26A 1OSGA 3LA2A 4NN0A 4W50A 1W3XA 4QQHA 2YV8A 1BEV2 1N47A 2DCTA 2EF8A 3DXUA 3H3ZA 1FAYA 2RS11 2R1JL 3NSTA 4QPWA 1S1AA 5JSOA 1JUHA 3LD8A 2WQ4A 5GZDA 1I6XA 3ETPA 2R063 2ATFA 3P5BA 3NJYA 3PE5A 1ENXA 1GZCA 4Q29A 1B35B 5DDJ1 5DZGA 3NJXA 5GLWA 1BJQA 1OUSA 1R083 3OBAA 4OFGA 5DRYA 2J1TA 2HWC1 3BODA 3FX3A 1QJX3 3MV01 4QPGB 4QQPA 3NNGA 2VECA 3R09A 2ZKLA 3KV6A 1IS4A 4NVPA 3DM5A 4AI1A 3LCPA 1KFXL 1PO11 1QQP2 3B7HA 1PK6C 4X4CA 2PXPA 3H7JA 3LFIA 1M4WA 5FY5A 1IZ3A 1EV13 5E88A 5H9PA 1OHFA 4F7ZA 3ALQA 3S8QA 2W87A 1RGSA 3THCA 1QP4A 2EWTA 1K5MC 3WDUA 4KWJA 1O91A 3WF2A 1HF0A 1RMU3 4A3XA 4DXRA 2XPJA 1UXCA 1SPPA 1VRH1 1QJY2 1SFNA 1B09A 1E3OC 3M7AA 4XFGA 5E16A 4J25A 2QCSB 1RIOA 5FKBA 1SBEA 3TELA 1E5RA 1JH5A 3JD73 3P6BA 2B5AA 4BQ4A 5HV0A 1TZOA 3BPZA 4RL7A 4Q1PA 1XSRA 2GRMA 2IUOA 3BTAA 1V6KA 3KCXA 3NNLA 4HSLA 4JTNA 5CYYA 3ZN5A 5A1AA 1FPN1 3ZHMA 1QXJA 3RI9A 1V00A 4JHTA 1VB2A 2AXUA 4CDUB 3HIFA 1GZWA 1ZNPA 2FDGA 2ORXA 1L7LA 3SC7X 4NHXA 2X5IA 3VZLA 3BGAA 1BVVA 1BHGA 5LY1A 3B9IA 4LO6B 3CZJA 2Z4FA 5DT2A 4M3CB 3HT1A 3S5AA 4XUTA 5FZCA 1AR91 2D7FA 2DBIA 2EIGA 2XL7A 3CJIA 1BDHA 1WW6A 3DYPA 1AU7A 4LBQA 5FKCA 2VBPA 3WINE 1AR83 1RVF2 1IS6A 4Q0VA 1STMA 1VR3A 5FPBA 4CDXC 4CUBA 3I3QA 1WLDA 2WN3A 2YB7A 5FYVA 3UKVA 1ZRRA 3OBTA 4RHV1 3K3OA 4CDQC 1U2ZA 1ZBA1 1ENRA 1H9PA 3WNXA 2UYAA 2R043 3IKWA 4RYDA 3WW2A 5C8CB 3VB9A 3KD4A 1UOBA 2CNAA 4QT6A 4NWWA 2YYOA 2RV9A 3UK9A 1ND3A 5F2SA 2HWF1 4Z5CA 2GC2A 4A2UA 1GUIA 2VBBA 2PHDA 2B9UA 3LOIA 4OULA 4XJAA 3NV3A 1ASJ1 1CJPA 1X2LA 1O3RA 4LBOA 4O65A 5HCAA 4UI9L 4XTPA 1GOGA 4FBFA 1Q3EA 4S2DA 1GFF2 5JI7A 2CY6A 4LHLA 1VPWA 2UYBA 1W8OA 3VDAA 4Y4RA 3OEAA 4BDVB 4EZHA 4SBVA 2ZMLA 2ZS6B 3GZTB 3VKNA 2VM9A 5FZGA 2WT2A 1AR72 2V4VA 4HN0A 4XJWA 2MPFA 4DNYA 4UT5A 5DAQA 2QQIA 4Y1YA 1JZ4A 1NY71 2OZJA 3LEKA 2RMU3 4HSJA 2HWC2 4QX3A 1AUYA 3VBSB 3WLUA 1DULA 3EO6A 1DQ2A 4DQAA 3I2OA 5C3OA 3C3VA 2JWPA 5F9TA 3ACFA 2B7YA 5I0DA 1EAH3 1GICA 1PO12 3CJXA 4FPCA 1DW9A 2V73A 3M3IA 4QX5A 2OR1L 3HQXA 5K8SA 4IEVA 2B39A 3KSCA 4D3WA 3WUCA 5HCHA 3QQ6A 4LKFA 1ZVVA 3OBRA 1W6NA 1WGPA 3EUSA 1LRHA 4RS5A 2XVLA 4PQQA 1J3QA 1W8ZA 3PU8A 3B00A 1HB3A 4NIIA 3W9AA 4AZZA 1VRH2 3USUA 4BISA 2A6VA 1SEFA 4JGYA 4N43B 1GWLA 4Y5TA 2OKXA 4AFBA 4GALA 2IXJA 1O7FA 4MXVA 4GH4B 1JI6A 1E57A 1LOBA 5K98B 1AYM3 3I3DA 4RSUA 4XF0A 5FP3A 4Q0PA 4EQZA 5FPUA 3I54A 3FMYA 2W46A 1X36A 4LPLA 3KHBA 2VMIA 2N7GA 4NIAA 1V6IA 3FJSA 1T2XA 4EZIA 1MS9A 3H1MA 4BK4A 2CHHA 2FDIA 5F5AA 3ZHIA 4E9KA 1XNAA 5FZAA 2J1EA 4Q8LA 3RZMA 2XJRA 4JGZA 2RG4A 5GZFA 5BNOC 3LA7A 1O3QA 3VBHB 5CFDB 4DIQA 1PGL1 4IV3A 5FY9A 1MS3A 1POV0 3VDBA 2P6CA 3TEXA 1O4YA 1RUI3 2ETEA 3JQWA 2IVJA 1C8M3 2VW1A 4KWUA 3N7KA 4AEMA 4UAPA 1UL9A 3VHNA 1REFA 1RUD3 3ZFEA 2FDJA 1GOFA 1RYYA 2JE9A 3ZIXA 1AJKA 3T2OA 3O1UA 1JMUB 3VBOB 4BMBA 3UKTA 1CQTA 3I4IA 4UXAA 4A7ZA 4I0WB 1PGW1 3NNJA 4OUEA 1RXFA 1W8WA 1OURA 3MIEA 1SCSA 1ADRA 1N3PA 1VBB1 2VPVA 2AREA 2D5VA 2LALA 3HNMA 4JKLA 5IK5A 3IAPA 2RJLA 2W39A 2HYXA 5L9VA 4YBAA 2P3YA 5IWFA 4JDNA 3WUDA 2W2IA 4B29A 5JOWA 2HWE3 2G19A 4ZZ5A 1DGRN 4PDWC 4QU1A 3O0XA 5A6QA 5H9QA 4AFMA 4MO3M 2MQKA 2ZX2A 4HK8A 5HBAA 3BS3A 3D5OA 1CZTA 3BKZA 4N53C 2VCAA 2MXDA 2GC1A 1AVBA 1NOVA 1WBFA 2D3SA 3AYAA 3O0VA 2GN3A 3NW4A 4BLJA 2VCCA 5FYMA 2ZPXA 2OW4A 2VOTA 4X8NA 3K51A 3CO2A 3INAA 3MW4A 2FD8A 3ZKUA 1PZ8A 5FZ9A 2XUMA 3IAQA 1MS5A 4CDWC 1ZA4A 3AZXA 1Y9QA 1NXMA 2E63A 3VDDB 4YG6A 3FHIB 1W6QA 3BYWA 5F7UA 1HIXA 3VKOA 1UYYA 2BFUL 3E5XA 3KVAA 4Q4Y1 3J7LA 2HWB1 2XCJA 3AKTA 1XC6A 4WM7C 4Q4V1 2Q4SA 1ND2C 1NY72 1BCXA 5LRSA 1KQRA 1S0BA 2HH9A 1DIWA 1PVC2 3PLQA 2QJVA 5JLVA 2HSGA 4UFKA 2VVFA 5FYCA 3WR0A 5C5TA 4BQ5A 4R9BA 2W9XA 3V56A 4AI8A 1F4AA 3KWVA 4C0BA 2X29A 2PN5A 2BUKA 4HVOA 4IE5A 5A6YA 2FDHA 3PVEA 3WG2A 3ZN4A 1XE8A 5B4NA 1PK6B 1FMD3 1YQ8A 3MFAA 4XZUG 1YFUA 1DWKA 4YW7A 5A3WA 3D3AA 1RUF3 3BTXA 3ME2A 3WDWA 4I8TA 1K5MB 3D4KA 2O49A 2E51A 3B9CA 2JDMA 4UFLA 1A3KA 2A6WA 1CPNA 4BXFA 3GCWA 3GZAA 1FATA 4AHWA 3N35A 4C0HA 2VBDA 1JOJA 4J6GA 4HVRA 4K8RB 3AKSA 4CRQA 3J9SA 2VQTA 5K7PA 5EJ3A 5EJ1B 3U1XA 4HLTA 3EJKA 4H3WA 4YW5A 1OC1A 1UMIA 3LPGA 4DS0A 1PGL2 3IT8A 1UNBA 4FOWA 4CXXA 5T5OA 2B8MA 4Z1VA 1BMV2 3M4FA 5F37A 1S0IA 4ZXEA 2RS51 1RIRA 4YLZA 1W2AX 1V9U3 4LKEA 5IJRA 3PUIA 1W6OB 3OP9A 4COZA 2ARCA 5DAVA 2RHPA 3HMYA 2LCVA 1J84A 3GYDA 1QJEA 2ZGMA 4Y20B 4IGOA 1Y7YA 1S0DA 5LBBA 3VHRA 1YIPA 4K3UA 1KRIA 3JU9A 4E2QA 1CONA 2WNUA 1RC6A 5FPLA 4AI3A 4S2FA 4M01A 3O1VA 1VAMA 4CDXB 1EUTA 3ON7A 3POFA 2WZPP 2ZACA 4WM8B 3WQ1A 2D5HA 4FPHA 4CDQB 5LATA 1T6BX 4LBQD 3UWPA 3KCYA 3BI3A 3I7DA 4AHYA 1ULGA 4QXBA 1MS0A 4LUMA 2ID4A 2ZX4A 3TN93 2OZ6A 1NLRA 2BW8A 2YBKA 4FPOB 3S6PA 2VL4A 3LSDA 3T1LA 2BVBA 5JUVA 4E4DX 1UY2A 3OPTA 5F8PA 2IXIA 3PURA 5EWSA 3PMSA 5FMOS 5JOXA 5FV3A 2Q30A 3WNPA 4XF1A 1OQDA 4D7YA 5J7MA 2VZSA 4JC1A 1KS4A 2XJPA 5JVVA 2XWBB 5C4WA 2DU0A 3M3CA 1ULFA 4HL0A 4BU2A 2HWB2 5BNPC 1FXZA 1G6NA 1LR5A 2JX9A 2UU8A 5J09A 5L9RA 5EZWA 2HFZA 4H7MA 4MLOA 2WWUA 2Y8KA 4MGTA 4XIKA 1QJY3 4P08A 4IEWA 2VG9A 1LCDA 4P9WA 2FZ1A 1RITA 2KD7A 3UGFA 5C70A 3R4SA 4XBNA 5BNNA 1RUOA 1SHWB 4IEPA 1LMB3 2VXRA 3VD5A 5H9RA 1G9AA 1SLLA 3U11A 2EXKA 2WFF2 3QH7A 4BMEA 5DAWA 2ZX0A 3B69A 2WS91 4YPJA 5FZFA 2UY9A 2EIDA 3WDVA 4AHXA 3TNQA 1UZ0A 1W99A 3OG2A 2NP0A 4UYBA 2XBO1 2BERA 3BU7A 1AZDA 1Y9GA 2DWRA 2ZEWA 4B4QA 5K0UC 1YI7A 4QM9A 1JBCA 4UBHA 2XOMA 1NERA 1PRVA 3WX5A 4ER0A 1H1AA 1RVF3 2OS2A 4QDSA 5JPNB 3M8LA 1R082 5ERLA 4P9LA 3PTYA 4CEWA 3M9LA 4CUAA 4NIGA 2WYFA 1RZRA 2WUHA 3WNOA 3V65A 5FZ8A 3SCFA 4BZ4A 5BNOB 1HJGA 3OPWA 3BUCA 2O38A 1W8UA 2RS52 4XEZA 4AWDA 3MLFA 2PXKA 2FJRA 1E5HA 5FQ0B 1EV12 2PHWA 4KWKA 4C1WA 2CGPA 1ZRIA 5CU1A 3GZUC 1UIJA 4YW3A 2VR4A 2VO5A 3GBWA 1RMU2 3O12A 3ASIA 4O7XA 2YPJA 4YG3A 5ABJC 4LUKA 3AYEA 3FWEA 5F5QA 1Y9MA 2MEZA 2CYFA 5A32A 2E32A 3OY8A 1F4HA 2VNRA 4GWIA 1H2NA 3A0KA 3TWIA 1CZSA 5AVPA 2H8RA 3TRSB 4LMFA 2C5DA 1TMF1 3IIIA 4Y5SA 4AI0A 4AQSA 3HQRA 1E5SA 1GV9A 5L36A 1KDKA 4FOYA 4JQRA 1MEC1 3H8XA 3A22A 2JCGA 3KB5A 4PLNA 2Q1FA 3FBYA 3ZYRA 4CEYC 3V0BB 4PDWB 5DDJ3 1SFYA 4Y42A 5L19A 1AR73 2VVDA 3KS7A 3QOPA 4OHVA 4E4HA 3ZXJA 1J3PA 5FYIA 5IVCA 4N53B 3OUIA 1AHSA 2P4EA 4AG4A 2RJKA 1MPXA 1XJAA 2HWC3 3D8CA 1UX6A 5I93A 1WW4A 3MBWA 2DU1A 2XSDC 1UWWA 2JIGA 5AFBA 5IVEA 4PCRA 4CP9B 1AXKA 4J1WA 1PO13 3K48A 5FPVA 4OYUA 1JZ6A 4NPMA 4XUOA 1Z7S1 4CDWB 3QOXA 2LLWA 4UWDA 1W0NA 1DLCA 3PIJA 2GNTA 4AXOA 1OI6A 3H0OA 3U4SA 3KQRA 2W1UA 3EXUA 3BU0A 3OF1A 2VMGA 4N90A 2B45X 4D94A 1VRH3 1OLME 4DMIA 3PUSA 1W03A 1YI9A 4QPIA 3VV1A 1QGLA 4DXZA 4WM7B 1APNA 1ND2B 3HQUA 3WF0A 3SNMA 4AFAA 3R4UA 5J96B 3MLLA 2A71A 3JXDL 3LAGA 5FZ7A 5GALA 1XNCA 1VAVA 1SLIA 4FQ4A 3N4MA 3MIDA 5FPAA 1RUC2 1W9WA 1GWMA 2O1QA 3B7MA 2XQRA 4OQ9A 1C5IA 4AFCA 3GXUA 3ZMOA 2RVAA 1UMZA 3UETA 1LENA 3I3EA 5A7WB 1ZRFA 5FK7A 4XQWA 1F15A 1S0JA 2ES3A 1W28A 4MHUA 1UOJA 4Q8KA 5I0RA 2WZ8A 2XHKA 3N9MA 1RUE2 4FPLA 3RZHA 3OQOA 1QHDA 1QP7A 4IV1A 3IDAA 3TB0A 1UX7A 2HKXA 5DUVA 3RYRA 1SZBA 4YG0A 5FYHA 3I2JA 4IEUA 4XBQA 3LDKA 1WLWA 1IS5A 4IA8A 1IQDC 2LYPA 4ARYA 2GC0A 2Y38A 3U75A 2Y0IA 2B9VA 2WO7A 3AMPA 5B4XA 4AI2A 1X57A 2WABA 2XQXA 3DF0A 4QM8A 3SH5A 3RZKA 1UZVA 1QH7A 1W6MB 5J36A 2VMDA 3N7JA 3PTRB 1LOFA 4B1MA 2LROA 1YNAA 2Z42A 5EQUA 2D6MA 1W8FA 4OMDA 2ICTA 2L8NA 3I2IA 5DPNA 2W94A 1QF3A 2C4XA 1C4RA 3WOGA 3WSOA 2IUWA 1DGWX 3ZN6B 2XUEA 3O7OA 1UD1A 4LIUA 1OSLA 5DUXA 2KM2A 1IPJA 1V6JA 4P5HA 5FRAA 4XAEA 5LK5A 4AVCA 4ZU7A 2ZGLA 3O1OA 3BIEA 2HEVF 5T5PA 5FMDA 4ZZ8A 2R1BA 2PA7A 4PI2A 4MGQA 1H2KA 3RVHA 2IXKA 4BE3A 1Q43A 3AZWA 4JQTA 3MEPA 3TFLA 1OCTC 2ARAA 2IVBA 4KU7A 2AXVA 4AAXA 5A6ZA 3LGRA 1DZTA 3ZKYA 2J1SA 4D7TA 5FY0A 2PUBA 1VBC1 1CIYA 1SDWA 3OJBA 2GSYA 2VC9A 1PVC3 4MGIE 3GZDC 2LRPA 5DAXA 2QBXA 1NQJA 2R16A 3CL1A 1UTXA 4GMP1 5GLUA 1Z7S2 3KF5A 5FZKA 2WNVC 5FLIA 5DTQA 1D0HA 3CLPA 4FOVA 1W04A 2CSGA 2NLRA 1DLLA 3V64A 1S2KA 1TNRA 2ZMNA 1RUG1 1CGPA 2CAVA 4BQ1A 3NMBA 3WG3A 2KA3A 1XNBA 2WZR1 4JDMA 5BNPB 3ETQA 4HKWA 3AFKA 3BIWE 4HPKB 2JIJA 4MHRA 4HN1A 2HWE2 2W1WA 4XAAA 2QQWA 3N9NA 1GBGA 1XSQA 3FHAA 1QDOA 4LO7A 3IZOA 3WDXA 3J7NA 2QDRA 1H8VA 3AL6A 2VQAA 2VNOA 2X05A 1EPZA 4YARA 3WV6A 1WZXA 4DRVA 1H4HA 1HRV1 2DVBA 1WETA 4M0NA 1QEXA 1YIFA 5D21A 1HQWA 2FMYA 2HCNA 2JKXA 2WT0A 1POUA 1BBT1 1OLMA 1LOCA 2WO2A 3GN5B 2BJCA 2ZAHA 3F95A 4MGKE 4AEDC 2QQPA 2QTWB 3CKHA 2BGPA 4TYSA 4YRDA 2BWCA 3EMRA 2BOJA 2O8OA 3AC0A 5K0UB 4WVZA 4AEKA 3UKNA 5DTMA 1CIWA 4KH9A 1XPWA 5IT6A 4FSJA 2ZX1A 2GMMA 3LFMA 5DABA 4J1XA 1YYNA 3S7EA 3GBFA 1VBB3 1CAXB 1RUH1 2CAUA 2VQUA 3O0WA 3ZFGC 3PDQA 3ZLIA 4XFIA 2B46X 1RUJ1 2ADDA 1VIWB 3I49A 1LHNA 4URAA 2XVGA 5IW0A 2A1XA 1LEMA 3AL5A 4GIQA 4YGCA 3PUAA 2PE5A 1HXS1 1FMD2 2AZ5A 2DUOA 2OT7A 3P3PA 4QXHA 1HQ1A 5A80A 2X09A 3TEWA 1BK0A 3GM8A 5GLZA 3AMQA 4LBNA 5L7OA 3A4UA 4OI1A 2GNMA 1KDMA 3O1TA 3MUZ1 4UW4A 1PIV1 5ABJB 1CJDA 4PIZA 1RPEL 3HN1A 4P9IA 1PM7A 5T5LA 2J22A 5FZLA 3RYKA 1KEXA 1QB2A 1AF9A 4NUBA 5D1IA 4XMIA 4OZXA 2YROA 3E5UA 1SQ4A 1QQAA 1KJLA 4AVVA 1LTEA 2AGSA 1YQ2A 5FO8B 1YQCA 4AW7A 2E7QA 1JZ5A 4JKKA 2JG8C 1FNYA 2J1UA 3RSJA 4BQXA 1Q8QA 2IVGA 1RJ8A 2IXLA 5F3GA 1N3OA 2YY1A 2HWB3 5FO7B 1X33A 4RFRB 3AX4A 4OVEA 3KJXA 2RR11 1CWPA 3NVCA 4H55A 1N1SA 2FBEA 2D93A 4OCTA 2XVKA 4Q4V3 2LS6A 4CEYB 5C5UA 3KHCA 1U5XA 1NA1C 4L97A 4YZ3A 3EQEA 4WVWA 1V9U2 4YGBA 2VQ0A 3SKJE 1AXYA 4IXLA 5JZGC 2LYLA 3L9JT 2P1BA 3FMGA 4QXCA 2PXEA 4KGGA 1SDDB 5BY5A 2BNOA 2PIJA 1S7EA 1JW6A 1OBNA 1PO21 3HD8B 4G4FA 2AH2A 4QDQA 5FZ0A 1EPWA 3MW3A 1H2LA 4QGNA 3T4VA 3B3QE 3OUHA 5KHIA 2GAUA 3B01A 4Y1VA 3ABZA 2EIEA 1P8JA 2V5DA 4XDPA 3VD7A 4BQ2A 3ZXFA 4QX1A 3PMEA 2DVFA 1IS3A 5FBJA 3ZFFA 2XWJB 4UF0A 5LY2A 1U12A 5FZ1A 3LZZA 2UWCA 4W65A 3EBRA 1JS9A 5IYYA 4AFDA 3SX0A 4LE3A 3TN92 2QQJA 2VZVA 1Y7BA 2VW2A 4YW1A 4XDOA 2ZGQA 3NV1A 5A6XA 5DXDA 4MUVA 5IK8A 3RGBA 1UN1A 1EUUA 1D7PM 2ZHNA 3AYDA 2IC1A 4KWLA 4NPRA 2P5BA 3PUHA 5FYSA 3VBFA 4NHLA 1IG0A 1L3JA 4XUPA 3A9XA 2RS53 3EHKA 2ZGPA 1JYCA 3S5QA 2BYVE 1SFPA 4BHPA 2G9FA 2F17A 3KXAA 3PL0A 4GWMA 5LA9A 3QACA 5J1XA 1W6PA 2P3JA 1MS4A 3MPBA 4ITCA 2IXCA 5LEKA 2OUHA 1O59A 3VBUC 3LB9A 2A3XA 5I0UA 3FN9A 2A6ZA 1GKBA 2Z79A 1R1A1 1ZZ9A 3AKQA 5DAPA 2GALA 2RDNA 4AGVA 2Y60A 4IQPA 3M3OA 4I01A 4K8FA 5KBFA 4PF5A 2OXBA 2RS31 2A6CA 3SLIA 3URFA 3ZYPA 1GNYA 4IGQA 2A75A 3RJRA 3UNPA 1RHI1 3F51A 3OQNA 3NDBB 2A70A 4V2WA 5F6KA 1OMIA 4RR3C 2JDHA 5CISA 3B94A 1ZUGA 3W59A 1JYXA 4N7IA 1NCQA 1PIV2 1F31A 3JXCL 2JKBA 2GZWA 3H9AA 1A6CA 2OA2A 5JXHA 1GWKA 4Z58A 5C3RA 2BVVA 2D6PA 3O5SA 3A21A 3K46A 3C7FA 2EA7A 4Q4W1 1ZS4A 3LPFA 1CX1A 3Q8BA 3POBA 2P2KA 1GMMA 2CTVA 4NE9A 4XFAA 3VBRA 2PXJA 1UOGA 2OPWA 2Q0AA 3I2DA 4MV2A 4LA3A 3K4AA 4KL1A 4L11A 4WM8C 5CFCA 2RR12 4TSVA 3ZSEA 5A3TA 4META 3UGGA 3H3LA 5FXVA 1FI2A 4GQ7A 2BRTA 2VGDA 3D6EA 1CZVA 3LE0A 4PF1A 2W5FA 4Z07A 5BNQA 3HR9A 1MR5A 4PBPA 1ALYA 3MIFA 3C7HA 1G9BA 4Q1RA 1WLTA 1BQPA
chains in the Genus database with same CATH topology
5AVAA 4X4HA 4OI0A 4I6RA 2P17A 3VZKA 5A33B 1PO22 5KC6A 4Y1XA 1MVQA 1RUC3 3JUUA 3LSEA 2WNVB 1YRZA 1DQ6A 2YMZA 5F6LB 3ZPYA 1POV3 2BEOA 2XKPA 1YWKA 4LE4A 4OLLA 5I8YA 5E89A 4QQLA 2XBO3 2IVQA 2RS12 3VKFC 3QCWA 5KC5A 1WCKA 4IVZA 5DDJ2 3QYXA 2EAKA 1RUE3 2PHUA 4L99A 5C6CA 1ZZ7A 1WW7A 2X5IC 4KNCA 4BWOA 2MNGA 2PFWA 3HWJA 4H14A 4Q0QA 4IESA 3JBG1 5GZEA 4XJUA 3D0SA 2D3RA 3CJIC 3MDPA 5GZCA 4MH0E 4JVAA 4Q27A 2KZ8A 4YVSA 4AEDB 5ACA1 1O5LA 1QJU1 1CAUB 1R1A2 4YSFA 2H0BA 4I02A 2IZWA 4GXLA 3WDYA 3IBMA 2SBAA 5JI9A 2PUGA 3E97A 2YXSA 2RS32 3Q9OA 4L9BA 4OUMA 1TMF3 5CVRA 3ZFGB 1ND3C 1RHI2 1FPN2 2BQPA 2G4IA 4Y4YA 3IPVA 1MEC3 1BK1A 2XJUA 4ASLA 4FN3A 4C91A 1COV1 1UKGA 2DFBA 4DZGA 3SCHA 2VNGA 4Q0SA 2B5HA 4YG4A 4HANA 4X6RB 3KT7A 1H30A 4O9EA 4N9HA 2E7AA 3I8TA 4XOGA 1AR92 1VBE1 1YFXA 1GR3A 2ENRA 3ZXLA 3GHNA 4I09A 3F52A 1BZWA 4PLOA 1CAWB 2MHFA 1IHMA 1Z7S3 3MZHA 1OLQA 4YM1A 4RHV2 3SISA 1UZZA 1G9AA 2R0HA 2JG8B 1ZBE1 4I30A 2PQQA 1ZBA2 5DG2A 2GDFA 2WNEA 1MQTA 1SBFA 1CAVB 1HQNA 3I59B 1XU1A 4AQTA 4F3JA 1DG6A 3ILNA 2AR6A 1D4M1 2X53S 3MFCA 2HWF2 1NA1B 2VOXA 4RS5C 3JQXA 1QOSA 4WVMA 1LQCA 2X8KA 5JZGB 4BIOA 1ASJ2 3U3WA 1GANA 4JGYC 1SLCA 4XE9A 4K7JA 3W58A 1DHKB 2BWAA 3ZVXA 3VK0A 2JECA 4HKLA 5A3MA 1QXPA 1KD7A 1C8NA 4X4EA 2VULA 5I8TA 4AYUA 1FT9A 2PLV1 3ZXEA 4XFFA 1J3RA 1Y43B 1S0CA 5BUVA 3VL8A 2EXHA 4JGZC 5DZEA 4Q4X1 3HAGA 2K2SA 4GA9A 5AC91 4IV3C 2PHTA 5C33A 1OKQA 2D6OX 1VJ2A 4HZFA 4PU3C 2ZCWA 4DPNA 1NQDA 4EWAA 1EFAA 1SBDA 3JBG2 3ZFEC 1DGLA 1KFUL 3AKPA 1OOPA 1OQEA 5EXOA 1ULEA 3NKTA 3R05A 3ZDSA 2I74A 3T1MA 1AXZA 5DZFA 5ACA2 4DY5A 1LESA 2ZX3A 1TQ5A 4IETA 3ZYGA 1H8TA 1QOOA 1V70A 1YXWA 2VVEA 2ZABA 3CU7A 4U2AA 3JB8A 4YG1A 5FTTC 2D98A 3WP6A 1ZZBA 1HDKA 2WKKA 4KBBA 3VBUB 2G9GA 1REDA 4GKXA 3DPRA 4K1YA 4ZU4A 1G9CA 3PHMA 2BBVA 5T52A 5GKAC 5T50A 1ZPQA 2XGXA 3AMMA 3AB0A 1NYWA 4GB31 5CG9A 3ZSJA 3ELNA 3ZXAC 4RR3B 2DYCA 3ILRA 5DUWA 1VBC3 4XW3A 1VBE2 1H1IA 3WCRA 2VW0A 1YSEA 1KJRA 1Z0HA 2A3YA 2ET1A 4HBNA 4N9IA 4YVWA 5CG8A 3JB4C 3TBDA 3DL3A 5EV7A 5LRSA 1PGW2 2R061 3C2UA 4D7SA 5B2GB 4HMZA 4LHKA 1VBB2 5IK7A 1RUG3 5HCBA 5KHKA 2WZR3 5FOBB 1QJX1 3OGJA 1D2SA 2A6XA 3RRDA 1A8DA 5JWPA 4XFHA 2EXIA 4JCYA 3G7DA 2Z2SB 1ZZ6A 1EYBA 4RD7A 2VUAA 2V5YA 3FZ3A 2WWSA 4EJRA 3CECA 4X8PA 1YJKA 4CP2A 1HRV3 3AP9A 1JWLA 4KG8A 1XNDA 3ZO0B 3AZYA 3JD71 3V0AA 4MCXA 3VHOA 2PLV2 1NCRA 4QMAA 2BFUS 5C9AA 4Q4Y2 4RQPA 3OYWA 2LYKA 3OD4A 3DUIA 4FXKB 2WC2A 4Q4X2 1AL21 2SLIA 2CWMA 4Q4V2 4M3CE 1VALA 2NZ9A 2Z5WA 1GZWB 1GSLA 5KWRA 1RUH3 2W08A 4QD2A 1LOGA 4BA6A 1PZ7A 2X5IB 4GWNA 4INDA 1DYPA 1HLCA 3NWKA 4GMP0 3USSA 1AR81 2DVAA 3CJIB 2WNUC 4LBQB 3J8F1 5JDBA 2Z69A 4ISRA 1YJLA 4NWVA 1CN1A 3FFZA 4OHZA 4I2OA 4Z82A 5D8AA 4E4SA 1PIV3 4Y22A 4S2HA 4XPVA 2V09A 3LFPA 2WUSR 3NAPA 3A0NA 4LEJA 4FTSA 1LJ7A 1ND3B 2JG9A 1NLSA 2A5ZA 1YUDA 4ATEA 2RR13 2ERFA 1A8MA 4MXWA 1LHWA 1UU5A 3ZX7A 3RNSA 2DVDA 2XKOA 2CGOA 2XI8A 1RJ7A 2R071 4AVTA 2C9AA 4LT5A 4MX3A 3DNVB 1JYIA 4I0AA 4MYEA 5IK4A 2PUAA 1VP6A 3GNEA 5C4WC 3ACLA 3WG4A 1PO23 1RTVA 3JXBC 3PNAA 2O4AA 4K1ZA 4YFWA 4QGMA 3AP5A 1XNKA 1QY4A 4R9AA 4XETA 4AVSA 1JUIA 1YFWA 5BNNC 3M3EA 2RS13 1EAH1 2NN8A 2GNDA 2ZTNA 3KZ3A 1B35A 2D5FA 3UV9A 5J98B 2I07B 4NOTA 1NXD1 1W6NB 2GN7A 1Z78A 4RS5B 1G86A 4QPGA 3OPZA 3MGUA 1YO8A 3AKRA 5JAXA 3TAYA 3AK0A 1DZRA 4UW6A 2DV9A 4FCAA 1R091 4JCKA 3USUB 4FAGA 1ZM1A 4JGYB 5A3LA 2O0OA 3VKLA 1CR7A 2F4PA 4B8EA 2ZKNA 4COWA 4YZ1A 1XE7A 4CEWC 5F1RA 4JDOA 3M1HA 1GYKA 1DDLA 4PU7A 1LODA 4EN7B 1R1A3 4HKOA 3U4XA 4JGZB 1ZYBA 2VU9A 3ZIWA 3ZYJB 1G9FA 1AL0G 4IV3B 1JFTA 3H5TA 1C8M1 2RS33 5J3UA 3R0RA 2CV6A 4NHMA 3ZFEB 1RHI3 1IOAA 1FPN3 4CDUA 3F6WA 3J8F2 2WS92 4FTEA 1QH6A 1GLHA 5LEJA 1AX0A 2JXAA 3AJYA 4M3CA 1RUNA 3LOBA 2ZMKA 2XBO2 1KITA 2JE7A 3AXEA 4L2NA 4A7KA 2YZ4A 1AR93 1PGSA 4PJYA 1VBA1 4LA2A 4NR1A 2WT1A 4GHJA 2QZ2A 1LULA 2KXLA 4PBOA 5HXVA 5FBZA 2PELA 5BXXA 1HRI1 2KEIA 4U36A 2XJ3A 3BOWA 1C57A 2Q5TA 1WUVA 4RHV3 1FX5A 4SLIA 2PUCA 1ZBA3 2WSUA 3H1YA 5C8CA 4TWTA 4YGEA 4E2SA 1ZREA 1MZ6A 4M3CF 1BYHA 5JR7B 3RJ2X 4Z59A 1LCLA 3OGGA 2HWF3 1MZFA 2DCKA 5H9SA 1W6QB 4PIYA 3SITA 1UCXA 4Z5HA 1ASJ3 1TME1 2PPXA 2ZHLA 1LB2A 2K9ZA 4B7KA 2JVLA 2PHRA 4QPIC 1QQBA 1REEA 1O3TA 2E7TA 1TMF2 1F5JA 2ZA9A 4CZSA 4XJ9A 3TRBA 1MEC2 3POYA 2NMOA 3WY6A 2R63A 2NMNA 4BM8A 2GMEA 3VBSA 1DZQA 1X8EA 1RUF1 3TOJA 4W6YA 1SQ8A 3D1NI 1UPIA 4AQ2A 3VLBB 1FV3A 3BD1A 3JBG3 3R6SA 4AVBA 3PJYA 1C3HA 4JRLA 1LU1A 1PZ9A 3L2YA 1M06G 5E1RA 1F2NA 4P9YA 1D0GA 3DPRB 2AXZA 2E53A 4IV1C 3IN9A 1G8WA 5ACA3 3N7MA 4N43A 4I0BA 4GH4A 1XXNA 5CNAA 2RE9A 4MVTA 1ULCA 2CWSA 3THPA 2TBVA 2YUEA 2TUNA 1R69A 3ES1A 3IDEA 4K20A 3WVJA 2P37A 1MS8A 2IFWA 1YHFA 4EN8B 1LOFC 3MW2A 4P9XA 3VBHA 1HV1A 5CFDA 2R32A 3TNPB 3UJOA 5GLVA 1GQHA 4IWRA 2O8QA 4YW2A 2WNUB 4RGGA 3RDIA 2D6LX 4HK9A 2YGMA 4AF9A 2R49A 2CGNA 1HKDA 3L1PA 1U5ZA 1VBE3 4LO8A 3VBOA 1BEV1 2PYTA 4F8DA 3MIHA 3FBMA 1I1EA 2HWD1 3IMNA 4FXGB 5FCCA 5T5JA 1ULDA 3VZMA 1UU4A 4QQ2A 4F83A 3WP4A 1ONAA 2DCYA 2R1DA 3SMHA 4KGQA 2AUYA 3NO8A 4XJZA 2ZAAA 2HEYF 4PU4C 5FOJB 1DU3D 1W0PA 2DTWA 1QQP1 3SH4A 4ZU5A 3AXDA 4XIOA 1WD4A 2RM21 1AYN1 2XLFA 4IEOA 2ARXA 3UJQA 3ZXGA 1PMIA 5C4WB 2W0XA 1NEQA 2EAAA 2LYSA 2GMPA 2HEWF 1O4TA 1QJY1 2BGCA 1QOTA 1MS1A 3VDDA 2TNFA 3B93A 4DINB 2WA3A 4OI4A 4BOWA 2DFCA 2PLV3 3B5LB 4Q4Y3 4UBGA 5BNNB 2NQYA 1N1VA 1PRUA 1AR61 1LEDA 4QQOA 3QLQA 4W6XA 4Q4X3 5AC93 1LU2A 4NDWA 1VBC2 3OMTA 3VHPA 4R52A 1O5UA 2C0ZA 3OQMA 5KHHA 4ATFA 3MPPG 3VKMA 3X29B 3E5QA 1PK6A 2WINB 4HETA 4MZUA 1MVEA 1DF0A 2CROA 5CBLA 2PAKA 2XJTA 1RUG2 5L73A 1K5MA 1GQGA 5TSWA 5CA6A 3WCSA 2WZR2 1SLTA 4CEWB 1DFQA 1U5IA 4FBIA 4KG0A 2JICA 1CESA 2XLGA 3KM5A 3MI8A 3QBQA 2MEV1 3NL1A 5T3NA 3NKGA 1XYPA 5L7OC 1HRV2 4ZKTB 4OHYA 2D43A 3WXPA 1BBT2 3FUQA 4LLOA 1JTZX 2XH6A 5A32B 3OY8B 1W6OA 4Y20A 3PVOA 2HWD2 3J26N 4O8BA 5JOYA 4CDXA 1QMJA 1AR71 1RUH2 3OCPA 4JCXA 4WM8A 4YM0A 1RUJ2 1IKQA 2BPA2 3U10A 3POSA 1H9WA 4CDQA 3ZSLA 1QXRA 4PIXA 4G3YC 5T55A 1FOD1 1DBNA 1XU2A 2ZZJA 1HXS2 2ARBA 3B02A 2CL2A 1S55A 2RM22 1AYN2 3AMHA 3KZ4C 4MCTA 4H7LA 5FFOC 4COVA 2PUEA 5FREA 4RGAA 5J48A 2XIUA 4EWEA 1OA3A 1QP0A 5JCTA 1UPSA 3ZFFC 3RMYA 4BLIA 1XWRA 1ZRDA 2QUOA 4QPIB 1SACA 1DQ0A 1ENQA 5SV8A 1AR62 4YZ5A 4E2GA 1AL23 4B4PA 4PLMA 3AP6A 3VBFC 1H2MA 3MLJA 3H3UA 1V6LA 4X4DA 2E6VA 2JDZA 4DOUA 2ZJCA 3APBA 3LWCA 4LBLA 4JTOA 2HJIA 2GH2A 3WQ7A 3POWA 1YLLA 4C90A 2HYKA 4AGGA 3J8F3 2WS93 3PVBB 1LHOA 4OB4A 4IV1B 5KXDA 1GZ9A 5JIAA 2K0GA 4BIFA 2QNKA 4COYA 1NE6A 2NM1A 2A73B 2PUFA 1OA4A 1Q8PA 3H7YA 4P9JA 5GZG