1ZZ6A

Crystal structure of apo-hppe
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGNEFLFVLEGEIHMKWGDKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
total genus 45
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz6A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz6A02
4AQ6A 2PUFA 4IEOA 4BYYA 2GC3A 3PLQA 4LUKA 2XKPA 2L8NA 3I7DA 5JSOA 3B02A 4KU7A 4BHPA 1I5ZA 2WC2A 2WFPA 3BU7A 3ELNA 4I09A 1QXJA 4F7ZA 5K98B 1X2LA 3NJZA 4YSFA 3DNVB 3HT2A 4HVQA 3KJXA 2ATFA 4HVRA 1ZRDA 2PA7A 4WZCA 2HKXA 1ZX5A 4PIYA 2BEOA 5I0RA 2KEKA 4HN0A 1Y9QA 3B7HA 5BUVA 4I0AA 4QM8A 1IC8A 1ZVFA 2A6CA 1FXZA 2OYZA 3KMHA 4MH0E 3OMTA 4O9EA 3RPQA 2H6CA 1XWRA 3KZ3A 4LA2A 1RZSA 2ZKLA 2UYAA 3VK0A 4F8DA 2DCTA 1ZZCA 1LR5A 1PM7A 3WW2A 3CO2A 1POUA 1CAWB 4YARA 1O3TA 2PUGA 1PMIA 3O9XA 3H3ZA 4IEYA 2EBYA 2IVQA 4D7TA 3QQ6A 3CEWA 4I3PA 3FYAA 2P17A 2QJVA 1L3JA 1ZZ7A 3OCPA 4XFIA 3TNQA 1UCXA 2B9UA 2LYSA 4IVZA 4I0BA 2LYKA 3EUSA 3I59A 3QOPA 2IXHA 5FLHA 3OTFA 1YFYA 3ST7A 5I0UA 2MQKA 2IVGA 2UY9A 3EQEA 1CAVA 1SEFA 1U12A 4E2GA 2XJ3A 4X4FA 3L2HA 1B0NA 3DN7A 3FJSA 4Z07A 1HW5A 4F8AA 3HZIB 3M70A 5I8TA 4PJYA 3H1MA 4PU8A 4MZUA 3IDCB 4Z58A 1WLTA 4YRDA 1ZZBA 4MCTA 1PRUA 4JTOA 1R69A 3LFPA 4MX3A 1PNRA 2HINA 4JVAA 4Z82A 4ZU7A 2GH2A 1CGPA 4BH9A 2IXJA 4OFGA 3TRBA 1VPWA 4OB4A 3MDPA 3DL3A 4MV2A 4FT8A 4Y42A 1LMB3 4QGLA 2EWTA 1NZCA 3NKTA 5FQ0B 3QYXA 1H1MA 3E97A 2GU9A 2Q0AA 4RD7A 4IWRA 4AVAA 1QY4A 3H1WA 1ZZ9A 5A7LA 3BDNA 2BYVE 2PUEA 3CF6E 2PPXA 2KEJA 4AQ2A 1OCTC 3S7EA 4KWJA 4Q0QA 4MUVA 3E6CC 2EA7A 3CL1A 1CAUA 1TQ5A 3ES1A 2WUSR 2XCJA 1XRUA 5KHJA 3GN5A 2BGCA 5KHIA 3PVBB 4XETA 1X57A 1Q43A 4MGYE 3CLCA 2B5AA 5I0TA 3H5TA 4EWAA 4MGKE 1RC6A 4L2NA 2UY8A 4XFHA 2ET1A 3WW4A 1FT9A 3BALA 1RL3A 3WW1A 2IXCA 3G7DA 2XI8A 3CECA 4UBHA 3E5QA 1E3OC 4KWLA 4XEZA 3LA3A 2IVBA 2BNMA 4QGNA 3BS3A 1JWLA 4HVOA 4QM9A 1ZNPA 3NL1A 4X4CA 2CAVA 5I8SA 4FAHA 1J58A 4FN3A 4HSJA 2EAAA 1X7NA 2IXLA 1S7EA 4GQMA 3JXBC 2Q30A 4META 4Z5HA 4CYDA 3FE5A 5CVRA 2PE5A 3IDBB 4X4HA 1GT0C 3NW4A 1UXDA 1QP7A 3OGJA 3SCHA 3KXAA 4Z5CA 3JXDL 1QP0A 4Q0UA 3QACA 5FCCA 2PAMA 4E2QA 3U3WA 5LEJA 4AXOA 4DINB 3VHRA 3JXCL 1PRVA 1NYWA 5KBFA 3C3VA 5JSPA 1ZUGA 3SCFA 5I93A 3H8UA 4ZU5A 1RPEL 1DGWA 3KSCA 2PAEA 1UIJA 1YFWA 1WH6A 2VPVA 3LA7A 2K0GA 2OA2A 2KXLA 3OF1A 4HZFA 4XFAA 5K8SA 4IERA 3ACLA 5E16A 4IEXA 4IEUA 4IEWA 5KHHA 2AXZA 1ZS4A 3M3IA 4EWDA 2CV6A 4JCYA 4IA8A 3H3UA 5I0SA 4R8HA 1ZVVA 2OZJA 3NVCA 2PYTA 3FFQA 3U0ZA 1PRAA 2L49A 4EWEA 3BPZA 5JR7B 2H8RA 4UXAA 1O3SA 3G5GA 2MPFA 1YLLA 3FMYA 3MLFA 4IETA 2ICTA 1OMIA 3OQOA 4YG4A 1RGSA 2OZ6A 4H7LA 4Q0VA 3UKNA 3MYXA 2ET7A 1OD5A 2Q4SA 3MPBA 4X4BA 1Q3EA 5LRRA 2EF8A 3E6DA 2XIUA 2QNKA 2XLAA 2AW6A 4LULA 3SXWA 3PXPA 4XF0A 4XFCA 3SCGA 3ES4A 1J59A 2Y0OA 1WA4A 2Q1ZB 4I02A 1RZRD 2ICPA 1DZTA 3FYMA 4Z59A 4QMAA 5F1RA 3LISA 2PIJA 1ZZ6A 4I6RA 4WVZA 4NDWA 4N9IA 4X4DA 2B5HA 1DZRA 3NSTA 2AWIA 3SMHA 3R6SA 2IUOA 2QDRA 5JCTA 4YG7B 1SFNA 4ORFA 1OFNA 1ZRRA 5I8YA 1J1LA 2V09A 2BJCA 4O8BA 3UFDA 1X8MA 1NEQA 2GZUA 3OP9A 1RZRA 1BDIA 3H7YA 5LRSA 1WGPA 2PTMA 4D7SA 4I6TA 2JCGA 4IEZA 4FAGA 4L11A 2LYQA 1SQ8A 4KU8A 2CAUA 4P9GA 2R1JL 4K8FA 1J3PA 4FBIA 4Q29A 4X6RB 2IV1A 3CJXA 3LOIA 1O7FA 3FZ3A 5LEKA 4I2OA 3D0JA 2R63A 2WIUB 2OPKA 1UW8A 4PIZA 2CSFA 4QXKA 5EFUA 2CROA 5EZWA 2GRMA 2GC2A 5I91A 3S0MA 3U11A 2MEZA 4I01A 2D5FA 3RZZA 5J48A 1JUHA 2IU7A 3QWGA 1L1MA 2O8QA 3RNSA 2BNOA 2OR1L 3LAGA 4XFFA 2LYRA 1IPKA 5KHGA 5JAXA 1XE7A 2GC1A 4GULA 1ZREA 3S8QA 1CQTA 2AUWA 5FPXA 2LYLA 3QF3A 4I8TA 1LQCA 1JH9A 1O5LA 2GRLA 2Z69A 4KWKA 2PUCA 1EYBA 4IESA 1UTXA 3USSA 2VQAA 4XF1A 3DV8A 1Y7YA 1LB2A 4LEJA 2D5VA 1UD1A 5BXXA 3I59B 3GBFA 1VP6A 2XL7A 1O4TA 1V70A 1CAWA 1CAXA 2ZCWA 3H1YA 3U10A 5KHKA 1CAVB 1QWRA 1QQBA 1DW9A 2B8MA 4X4EA 4LTAA 1OI6A 2EVXA 2O1QA 5HI0A 3LA2A 1NERA 4MCXA 3EJKA 1NXMA 2N7GA 2PHLA 3HT1A 3CROL 2D5HA 2E9QA 4X4IA 2OFYA 4FBFA 1WIZA 2AXVA 1RIOA 3GYDA 1NE6A 2IC1A 3BD1A 1XE8A 5FLJA 4Z5DA 3EO6A 2KEIA 4ZU4A 5BY5A 2XKOA 4PU7A 1ZRCA 3HIFA 4EROA 1UXCA 2XL9A 2HJIA 3D0SA 1X82A 4E2SA 1O3QA 3ZKCA 4AVCA 2HSGA 4HLTA 2K9ZA 1LCCA 3KGZA 3BCWA 1YFUA 1ZZ8A 4YBAA 3N4MA 1WETA 1SQ4A 2D40A 2Z2SB 1EPZA 4O9GA 3JZVA 2PFWA 1O5UA 4ONUA 2KPJA 4JTNA 4N9HA 4BIFA 3L1PA 3E5UA 3F51A 3IIAA 1GQHA 4X6QB 3RYRA 1FI2A 1BDHA 1QXRA 1HF0A 4MGIE 1CAUB 2ETEA 3GN5B 2PUAA 2CGPA 5D1IA 1EFAA 2XSDC 1ZPQA 1O4XA 2I45A 1QP4A 3LZZA 5FQ0A 4KL1A 1CJGA 1Y3TA 5JSRA 4GHJA 4J1WA 4PU3C 5C8WA 3DKWA 2KZ8A 4EV0A 2VECA 1NE4A 1JFTA 2FMYA 4Q0PA 1J3RA 2GZWA 1CX4A 4AVBA 1QPZA 1JFSA 4JQDA 1DGRA 4YNIA 3EBRA 1YFXA 3S7IA 3ZHIA 4Q0SA 2AXUA 1IPJA 1CAXB 1G6NA 3IWZA 4X4GA 3R1FA 5BPXA 1YSEA 4I6UA 1ZAYA 5J7MA 1ZRFA 2XGXA 4IEPA 4NVPA 3RDIA 3O14A 1LKNA 2LCVA 1LLIA 1VR3A 4LA3A 4HBNA 4PU4C 4XF4A 1UIKA 5FLIA 4JCXA 2LYPA 1ADRA 5T3NA 3H50A 4OLLA 1LCDA 3D82A 1EP0A 4IEVA 4UBGA 2FQPA 2H0VA 2O38A 4A2UA 4HSLA 1AU7A 3ZDSA 2PUBA 4XFBA 4TLFA 3RYPA 5AVPA 1H1IA 3F6WA 4WBBA 3UKTA 1Q5OA 1R63A 2JVLA 2UYBA 3KCCA 3FWEA 3ETQA 3FHIB 2O49A 2XLGA 2PAKA 2MNGA 1RUOA 4QX5A 3IVPA 2XHKA 1GQGA 1QQAA 2LYJA 2BNNA 5CU1A 3WW3A 1EY2A 1PERL 1UPIA 3RYKA 4XF9A 5CADA 1YWKA 5E1RA 2XLFA 4XFGA 4J1XA 1LRHA 2QVSB 5FPZA 2F4PA 4YG1A 2IXIA 3KGLA 4R52A 2IXKA 4B29A 5C6CA 3I54A 4JV4A 5J3UA 3CLPA 1J3QA 2PUDA 5FDBA 2MHFA 2H6BA 3OD0A 3HQXA 4HMZA 2GC0A 3D1NI 3LWCA 2PHDA 3UKVA 1YHFA 3IBMA 3TNPB 2GAUA 4LUMA 3FX3A 1VJ2A 4IEQA 1I6XA 1YUDA 3H7JA 2D93A 3F52A 2FJRA 3E5XA 3MZHA 2C0ZA 4QGMA 1OSLA 4PIXA 3E6BA 3SHRA 2O4AA 4XF3A 1RTVA 4YYOA 3BB6A 1DWKA 3EHKA 5BV6A 3OQMA 3ROUA 1X8EA 3PNAA 4MGZE 4HN1A 1RUNA 3ZHMA 4LLOA 3OQNA 1WH8A 2QCSB 1O3RA 2PQQA 3H9AA
chains in the Genus database with same CATH superfamily
4B7KA 2PUFA 5EJ3A 4D0QA 2XKPA 2R073 3I7DA 4LR4A 1UWWA 3B02A 3VKFC 4BHPA 1OLQA 1KFUL 1B35B 4PDWB 4QPYA 3BU7A 3NV3A 1PO13 1QXJA 2RM23 4YVWB 1X2LA 4F7ZA 4RHV3 1PO22 1F8VA 3HT2A 3N9MA 3GZCA 4HVQA 4IGQA 3CJIA 2DTWA 4OMCA 1OOPB 4IV3B 4A3ZA 5T5LA 1ZX5A 4BQ4A 2YPJA 1RHI1 1APNA 3ORJA 3DECA 3TOJA 1VAMA 5BNOB 1RUF1 4LBMA 5FZAA 3OGRA 1O4YA 1XBFA 4XJUA 3SLIA 3ZIXA 2HWE2 1WW7A 2WNVA 1QJU3 2OYZA 4XPVA 1RUJ3 4AQTA 1O91A 4QHOA 4XZPA 1XWRA 3KZ3A 5JOWA 4LA2A 5DDJ2 3ILFA 1F5FA 4F8DA 1OC1A 3MUY1 5K7PA 5A6YA 2G19A 1LR5A 1Q8PA 1LNSA 4YGEA 2DU0A 1UAIA 2JQEA 1W6MB 5FMOL 5FZKA 5JIUA 4QPIA 3E1F1 4K20A 5JXHA 1CAWB 2WA3A 3NV2A 1QH6A 1DQ5A 2EIEA 3GDBA 3BTXA 2R0HA 2OQ6A 4KBZA 1UPSA 3BODA 1Q8QA 2XB6C 3WUCA 3LSEA 3WP6A 4NROA 3H3ZA 5FPAA 4BQXA 4CEWC 5F9TA 3SEPA 4QPIC 2IVQA 4IQPA 3ZYGA 3QQ6A 3R4SA 5FWJA 4E4HA 2WNUC 4WVLA 1SFYA 2QJVA 3OEBA 4JGYA 4CCEA 1L3JA 2JG9C 1ZZ7A 3OB8A 1UCXA 2RS11 4I0BA 5DTRA 5LBFA 2QQOA 2ZHMA 4LE4A 1YFYA 2PXLA 1O59A 2E26A 2UY9A 3EQEA 4AI8A 1M4WA 3KHCA 1U12A 2ZGUA 1JODA 1JHNA 4GH4A 1V6OA 2W39A 4X4FA 1PIV2 3EYPA 2Z4FA 3KD4A 2P37A 1V6MA 1B0NA 3DN7A 1VE0A 4UAPA 1HW5A 3N9PA 3M70A 4Z07A 4Y20B 2WZR1 3GZDA 3PVEA 3H1MA 3FUQA 4Q27A 3IZOA 1MR5A 1KEXA 4CZSA 4DY3A 3NDBB 4FP2A 2PN5A 2WSUA 3ZN6B 1REEA 3LFPA 5FXXA 5FZOB 4MX3A 4AG4A 2HINA 1C1FA 1ULOA 2EXKA 2ZACA 1AR73 1TME2 1U5YA 2VOWA 5C7GA 2MEV1 4XABA 4CPBD 1NXD1 2J42A 2W1QA 5L7OA 3VLBB 2VZ3A 2I07B 1LOBA 1OT5A 4HXCA 4JQTA 2C1FA 4KI5M 2Q8DA 3WP5A 1IS4A 3MDPA 4GB31 2JKXA 4MV2A 1LMB3 1DULA 4QGLA 2EWTA 1NZCA 4FXGB 5FQ0B 3URFA 1ULFA 5H9SA 5F3CA 2E51A 1OSGA 1SBFA 5L7OC 2Q0AA 1VB2A 4RD7A 1RUI2 2XVKA 1QY4A 3SITA 1Z7S2 3H1WA 3SH4A 1ZZ9A 1WLDA 5DQ0A 4F83A 2RMU2 3BDNA 4JQRA 4BE3A 2BYVE 4XMIA 2PUEA 1K5MB 4Y4RA 3VDDA 1IZ3A 1KS4A 1PO21 2VG9A 2DVGA 3U78A 5FZ8A 2PELA 1AR93 4E4SA 4Q4V3 1FMD3 4LHSA 1CAUA 1E5SA 1UMZA 4YFWA 2ZMLA 5KHJA 3GN5A 1A8DA 1I9RA 4ATEA 1Y9MA 3PVBB 1JTZX 1EUUA 2E31A 1YCIA 4JHZA 2B5AA 2P3JA 1V0AA 2P34A 2Y6LA 2A6YA 3H8OA 2HWE1 2UU8A 4M3CE 5F3EA 2YV8A 3ZFFB 1FT9A 1XJAA 4HL0A 5DAVA 5FP4A 2GN3A 3LEKA 1MFQC 4OZXA 4AW7A 4CDXB 4CU9A 4LBOA 5DDJ1 4RSUA 1IKPA 5DUWA 1SBEA 3N7JA 1JWLA 2BVVA 4LO4B 5T5PA 5FPLA 5SV8A 3RQ0A 2QQVA 5CFDA 4LLFA 5K0UB 4GQMA 3ZFGB 2FCUA 3N3HA 4QQ2A 2WT1A 5IVJA 2PE5A 4ER0A 4XHBA 1BZWA 2LS6A 1OH4A 1G9FA 2XJPA 3IDEA 1CESA 3MPPG 5LK5A 2JG8A 3O0VA 1BHGA 1LOAA 2VH9A 3JXDL 5I91A 4KBBA 3TB0A 2W2IA 2QFEA 3GZAA 4XURA 4AXOA 1VMJA 2VZVA 3VHRA 5EYXA 4UOJA 1NYWA 3C3VA 4HOOA 1QXPA 3WV6A 2GP3A 3ENRA 1WZXA 2P6HA 3KSCA 4LORA 2PAEA 1UIJA 5FFOC 3AMHA 2VUAA 1LGBA 1UMHA 3O0WA 2VPVA 2WO2A 3WQBA 5F5IA 4MADA 4IERA 4YW2A 3M4FA 4OUEA 2Y0IA 4YZ2A 2PHWA 2BFUL 5IK7A 4IEWA 3VBUC 2XBO2 3IPVA 3M3IA 2B39A 4G4FA 4NHLA 1XC6A 5IFPA 4IA8A 4LBJA 2DF7A 2JXAA 4CDWA 4R8HA 1NCRA 2OZJA 2HYKA 5GLTA 5A7QA 1D4M2 3ZYFA 2L49A 4A3XA 4P9IA 4Q4X2 3VV1A 1O3SA 1HXS3 1H9WA 1R083 5IVBA 1O4ZA 3FMYA 1TME1 3JD72 5C4WB 5LCWL 2ICTA 2EICA 2VZSA 3JQWA 4YG4A 2VZPA 3CIHA 4Q0VA 1TE1B 5FZ4A 3UKNA 5DRTA 2X5IA 2ZGMA 3ZYJB 3VBRC 4OHXA 4LBKA 1N3PA 1V6KA 2CTVA 3QCWA 2KD7A 4PCRA 4C1WA 5LRRA 2EF8A 2WR9A 5A3TA 2AW6A 3GALA 4FPLA 4EZIA 1BVP1 1GR3A 1RUI1 4R4XA 4XFCA 2X5IC 4XF0A 5FUPA 4DXTA 2J1TA 3QH6A 1WA4A 2Q1ZB 2RMU1 1RZRD 3MEJA 3LDBA 4ZS3A 2ODRD 3FYMA 5GZGA 3I8TA 5EQUA 5F1RA 3LISA 2PIJA 1JZ8A 2ZS6B 4WVZA 1U0AA 2FBEA 3AJZA 3NSTA 4CCCA 2D97A 2IUOA 2QDRA 1SFNA 4LO6B 4ORFA 4YZ1A 1OFNA 2QQJA 2DBIA 4Q4W2 3O1PA 4XAAA 5BNPA 2BJCA 4E8CA 3AK0A 3RZMA 2Y8KA 1JYIA 1Y7BA 2GZUA 3OP9A 1H1AA 1KS5A 2YBKA 3OUHA 5FK7A 1WGPA 3AKSA 1PVC3 1S2KA 3PUAA 3B00A 3WD5A 3IAPA 3WHUA 4AF9A 1NUKA 1IS6A 4WVVA 4I6TA 3I3MA 2JCGA 2LYQA 1RMU2 4QX2A 1DZQA 1OA3A 3AMQA 3U75A 2VMGA 4BQWA 4NWVA 3RS6A 2R1JL 2R30A 2B46X 2YU1A 1TG7A 4X6RB 5E6HA 4CCNA 3LOIA 4OHVA 3BYWA 4HFSA 5LEKA 1E5RA 2R63A 1UY0A 4K21A 3JBG2 2OPKA 5L9BA 3HBZA 4UFLA 5CBLA 1MS3A 5EZWA 2GC2A 1CPNA 1SLBA 2OT7A 4PHZA 2VZTA 4GKXA 1B35A 4FOWA 4JGZB 4PDWA 3T08A 1KXGA 4KH9A 1H6XA 3GHNA 4YVWA 3UK9A 5F2SA 1U2ZA 2LUWA 1CJDA 4YG3A 4DOUA 5LW9A 3J7LA 2A1XA 3WDVA 2FDIA 2IU7A 1OOPA 2D6PA 4IV3A 1OD3A 4MXVA 4YLZA 1UZWA 1L1MA 2ZX4A 3VBRB 1AXZA 5J96B 2BNOA 3LAGA 3AP9A 5KHGA 2HLEA 4YVWC 3NNJA 5BNOA 3ZN5A 3GCXA 3ZDVA 4D8MA 1L7QA 4GULA 2J7UA 1A34A 3S8QA 5FP7A 5KC6A 2CDPA 4XYXA 3U07A 4XUQA 2P2KA 3USUB 5CISA 2XBO1 1LHNA 2R063 5A7SA 1O5LA 1FNZA 4I0WB 2GRLA 4MXWB 3ZYBA 5B4NA 5BNOC 3QH7A 3AP5A 5F3GA 4OI1A 1QEXA 3WINE 2TEPA 5FPUA 3DV8A 1BEV2 3EMRA 3HJRA 2QQMA 1DQ0A 4CA9A 3O1RA 5KXDA 1LEDA 5BXXA 1GWKA 1W6MA 2CHHA 1X9PA 3ZSMA 3VBOC 2DURA 1UU6A 3ILNA 1O4TA 3J8F2 1CAWA 2ZCWA 3JD71 3U10A 2RJLA 1CAVB 4AI9A 3NJVA 4X4EA 2BUKA 2RDRA 1OI6A 2HBTA 2W1SA 2ZEXA 3VD5A 5HI0A 3LA2A 1ZA4A 2KM2A 3EJKA 4FPHA 5CFCB 3VD3A 2A3WA 3VDAA 3ZN4A 3HT1A 2E9QA 4GMP0 2Y6KA 2Z42A 4KG8A 3I49A 5DUUA 4YW6A 3WQ0A 2V3CC 1IS5A 1RUG1 4IE7A 2M4HA 5FUNA 4YVSB 1ALYA 4GWIA 1OLRA 2IC1A 1COV3 1XE8A 3QLQA 4COZA 2YBSA 2R042 4IGOA 4NR1A 3EO6A 5BY5A 3GXUA 2O0OA 3FUOA 4PU7A 4R9BA 4EROA 5A3LA 4BZ4A 2XL9A 3WUDA 3UGHA 2PLV3 4E2SA 4FO9A 4DEQA 1ZBA3 1ENRA 2D6OX 4GQ7A 4NRQA 3T1LA 4AHXA 1HDKA 1W2UA 4Y20A 1JYCA 1TMF2 1JYWA 2HSGA 5A1FA 1CZVA 1GV9A 3ZSKA 1WLWA 1HJFA 1SLTA 4KGQA 5ERLA 2O8OA 1SQ4A 2D40A 3MFAA 2Z2SB 3ZN6A 1JYNA 1EPZA 2P6CA 1HRI3 1VRBA 4O9GA 4R9DA 3JZVA 5FZOA 3UETA 1NKGA 1O5UA 2KPJA 3FHAA 5F5QA 3ON7A 5A6QA 1WCDJ 5LK7B 2VO5A 1GQHA 4LIVA 4X6QB 1KQRA 1RMU1 1FI2A 5JXJA 5FZMA 1BDHA 1GP5A 2A5ZA 2RDNA 1AYN2 4S2GA 1CX1A 4UFJA 4MGIE 4HANA 1UL9A 4OHWA 2C6SA 4CCMA 4JX0A 2PUAA 3D6EA 1RUE3 3LZZA 2I45A 4OI0A 3I2OA 5FQ0A 3IIIA 3JBG1 4OULA 5JMCA 1W03A 4GHJA 4J1WA 4YG6A 4D69A 3U4SA 4GWJA 1V6IA 4XOGA 4DXZA 4PT6A 4R9AA 4BPZA 4L8QA 5FJHA 5KXBA 4Z92B 4OQ8A 4EV0A 3ZSLA 1JFTA 3I4IA 2VQUA 1S4CA 4AHWA 3UJOA 1HKDA 4IE6A 5F8PA 3B5LB 1ENSA 4FFGA 5GKAC 4JQDA 4G3YC 5F5CA 5FIXA 2B7YA 3S7IA 3ZHIA 4Q0SA 2AXUA 1NLRA 4Q4Y1 1AXKA 2RS33 4V2VA 3NWKA 1G6NA 3VBHB 3R1FA 3TFLA 2B42B 1X36A 1ZRFA 4I6UA 1I1EA 4CCJA 1MEC2 1S2EA 4UFHA 5DZFA 3DM5A 4FOVA 1LLIA 3ZFFA 3WF1A 1G9CA 2IFRA 3N9QA 4CDXA 2DCZA 1KGYA 5DRYA 5GAHi 2A70A 1URXA 2D3SA 2YFZA 1KITA 3H50A 3ITQA 2Y64A 5HCBA 4W8JA 1N3OA 1H8TB 2VTFA 2W1WA 1BEV1 3ZPXA 2GDFA 1S0JA 4OLLA 3D82A 3MLKA 4BXFA 4MVTA 1LU2A 1VBB2 1RHI3 2NZ9A 5A6ZA 1WW6A 5K0UA 3ZFGA 4INDA 4H7MA 3X29B 1IGOA 1RUF3 3F2ZA 4BJ0A 3WCSA 3ACIA 5F6LB 1JZ4A 4XUOA 3DUIA 3RYPA 2XXAA 1UX6A 1H1IA 5IWFA 4CCOA 1Q5OA 4P08A 3KCCA 5K0UC 5DPNA 3FHIB 3ME5A 4AEKA 3HN3A 2O49A 2XLGA 2J1UA 2ZGTA 2IZWA 4FOQA 4PBPA 1C8NA 2PAKA 2XDVA 1NY72 4QX5A 3MGUA 5LBCA 2R041 3PE5A 2DFCA 2WABA 2XHKA 4XE9A 1W9WA 3WF4A 2BNNA 1EY2A 1UPIA 2R0FA 5IVFA 2IFWA 2ERFA 3WDUA 1YWKA 1H2NA 3BOWA 3MV01 2XLFA 2QVSB 5FPZA 5FWEA 4BMEA 1E57A 1TMF1 1UF2C 3INAA 4HETA 4XIKA 5FMDA 3ZLIA 2IVJA 3ZYRA 5C6CA 5J3UA 3AB0A 3LIGA 2PUDA 2QQUA 5K4LA 2VNVA 3HQXA 3JQXA 4CP2A 2ZPXA 2GC0A 2AC1A 3R0RA 1DF0A 2WL1A 2HEYF 3KZ4C 4DXRA 2J1AA 2RS13 5T54A 5C4WA 1Q8VA 4QQHA 3J26N 4LBNA 4YM0A 5D8AB 1F5JA 1RUH3 3UKVA 3ZXGA 1AYN1 1ULGA 4FXKB 3TAYA 3WNXA 3TNPB 4MSVA 4ES8A 2DVAA 4LUMA 4PI0A 5FXZA 4W6YA 1K5JA 4IEQA 5L36A 4QB2A 5C4WC 2VVFA 2D3PA 3U4XA 2WZR3 4CP1A 1UZVA 2D98A 3PUQA 4S2HA 2JD9A 1CZSA 2HWF2 3G0TA 1CN1A 5DAPA 4PIXA 1PK6C 5FZ7A 1M06G 4RS5C 1EV12 5JOYA 1DWKA 2ES3A 4ASLA 5C5UA 1B09A 2VM9A 2ZXQA 5FP3A 2MEV3 1X8EA 2VZOA 4MGZE 4YWAA 2Q1FA 4HN1A 3T3YA 2LNMA 1I3HA 1V6JA 3ZHMA 3P1IA 4WM8C 5CA6A 1WH8A 4GB33 3HOBA 2VZRA 3H9AA 3KV6A 2FZ2A 3ZKUA 4AQ6A 3EB7A 4IEOA 3UT0A 1MEC1 2GC3A 3PLQA 4LUKA 3ZR5A 2R1DA 4ZKTB 3NAPB 2V73A 2G9FA 5DZGA 4FTSA 3KL4A 1QJEA 4KU7A 5CNAA 5ACA2 1I5ZA 5KXCA 1QJY2 4EZHA 4UT5A 2YXSA 4NRMA 4C90A 2RJKA 4XJAA 2JDMA 3ZXEA 1PO23 2ATFA 2PHUA 4HVRA 4CP0A 3RRDA 1UY2A 3TEPA 4PIYA 2CNAA 5IUQA 1ZBE2 4P5HA 4AEJA 3CKHA 1VBE1 4C0HA 3B7HA 2J22A 4BM8A 1DFQA 3AVRA 4EN9B 5FAXA 1LHUA 1IC8A 3VBFC 5L19A 2UWAA 1ZVFA 2HWE3 3WNKA 4FCAA 3CZJA 4JGZA 3MIHA 5BNQA 3BKZA 3H42B 2RG4A 4BLJA 1VLNA 2E33A 4NIGA 1SG3A 2ZKLA 5DDJ3 2QDNA 3VBRA 2DCTA 3H8RA 1NY71 4JGZC 2EIDA 3HEIA 4QX0A 4AOCA 2WJSA 3PTRB 4PF1A 3LQXA 4AE2A 3POBA 2YUEA 2H0BA 1QZXA 3HAGA 4IE4A 1O3TA 3USUA 4OI2A 2P1BA 4I30A 5HXVA 2BBAA 4IEYA 3UNPA 4MXWA 3SX0A 2EBYA 1JU3A 1FNYA 3CEWA 4LIUA 4QT6A 1F9KA 2OUHA 4KQ7A 1QHDA 2XQRA 1X33A 3OCPA 3WNOA 4IVZA 3EUSA 4RR3B 2DYCA 3OTFA 2E63A 4HK8A 5JXIA 1A78A 5I0UA 3S5AA 3VL8A 1BKZA 2IVGA 4AVVA 4AHZA 1CAVA 3MLLA 3N7KA 5FY1A 3WDXA 1JOJA 2FHRA 3RZHA 1DGWX 4N90A 1PIV3 4Q1PA 2VGDA 1LCLA 4IDZA 4XQ4A 4AVSA 4SLIA 4PJYA 4BQ2A 4AVTA 4PU8A 2XJTA 2RS52 4Z58A 3M7AA 1QNWA 2HWF1 4N7IA 4YVSA 4FVVA 3O1VA 4LITA 1ZZBA 4MCTA 1NCQB 4CEYC 1R69A 1OLME 4XUPA 4XQDA 2X05A 1XSQA 3ALQA 1BXHA 1EV11 1OH3A 1G86A 1PX3A 1SCSA 4ZHNA 3MW2A 4A4AA 4ZU7A 2GH2A 2AREA 1CGPA 1TME3 2IXJA 3TRBA 1VPWA 3L9JT 2O14A 4OB4A 3L2YA 4XUTA 4YGBA 5CIRA 4XDPA 3SR4A 4FT8A 2P3IA 1GWLA 4FI9A 3NKTA 5GLUA 3AXEA 2BGOA 1DGLA 2JE9A 3GZTB 5CKMA 2QE3A 1GZTA 3WG3A 2FCTA 1RUI3 3B3QE 1N1SA 5ACA1 4NOTA 2JIGA 3POGA 4NIDA 1QJY1 1W3XA 2RMU3 4QKDA 2QQPA 2NP0A 4XW3A 5C5TA 1OCTC 1MQTB 4CXWA 4KWJA 4ER6A 4MUVA 4ZY9A 1OPOA 3CL1A 3MF6A 1GZCA 4RFT0 1XRUA 4IUGA 4DIQA 3V0AB 2BGCA 4JC1A 1POV0 4JAAA 4MLOA 5KHIA 5JUWA 1ZBE1 1X57A 1UZYA 2Z5WA 1MZ6A 2YHJA 3QOXA 4NAOA 4XETA 5I0TA 5FBJA 2ZGPA 1MACA 5DXDA 2XJSA 2UY8A 4L2NA 4EQZA 2W95A 4Y22B 5A32B 4D6SA 4LK6A 4IXLA 3N35A 1DIWA 5LWBA 4DE8A 1RL3A 3WW1A 2XI8A 5L73A 2J7MA 1ENQA 3MO4A 3AP6A 3BOPA 3E5QA 1UYYA 4ASKA 1QQP2 2UWCA 1K45A 2IVBA 2BNMA 4QGNA 1JN2P 1D0GA 1OUSA 2ARBA 5EXOA 3ZIWA 1JXNA 2VXRA 5CG8A 1GFF2 2DU1A 3AZVA 3VBHA 4COYA 4FN3A 2EAAA 1PMHX 3PUSA 1FYUA 1MS9A 1RITA 4Z5HA 4QQPA 4QPGC 3FE5A 3AMPA 4WM7C 3IDBB 4FPOB 1UY1A 3I2DA 4P9JA 5CVRA 4DRVA 3NW4A 1UXDA 1QP7A 2VNRA 4QB6A 2XUMA 3OGJA 4YM2A 1LHWA 5L9VA 2VEOA 4Y4YA 2C9KA 4Q0UA 1E5IA 3QACA 4H3WA 4GAZA 3SH3A 2DV9A 1H8TA 3OPTA 1XNCA 4S2FA 4DINB 1G9BA 4OHZA 1A6CA 5DTQA 3SC7X 3UGFA 2WWUA 1K3IA 5LZ6A 2PXUA 1GP4A 4ZU5A 2CSGA 1VRH2 4FPEA 4V1PA 1YFWA 4XAEA 4GWNA 2OA2A 2KXLA 2YY1A 4HZFA 4XXPA 5K8SA 3ACLA 4W50A 1GWMA 4Y1ZA 1MS1A 1R1ZA 1WD3A 2HWC2 3CJIC 4LBQD 3WLUA 4CDQB 1LU1A 2CV6A 2XBO3 3HNBM 1KRIA 1MS5A 2RHPA 4YGCA 5I0SA 1ZVVA 1UZ0A 1SLCA 1RUD2 2OUJA 2RS51 1H4HA 1YI7A 2GN7A 1JZ2A 2A7AA 4XMAA 3FFQA 4C91A 3FLPA 3WNLA 3BPZA 1D4M3 3I97A 2ZZQA 4GXLA 3JCIA 1DP0A 1W99A 3ZMOA 5DT2A 4Q4X3 3S57A 1YLLA 2VMFA 2WNVC 5GJ6A 3NNLA 4IETA 3I3QA 3OQOA 3JD73 4H7LA 2JIJA 2VR4A 1OD5A 2WBKA 1PHMA 2Q4SA 3O5SA 4M3CF 4X4BA 3BIWE 4N43B 2Z79A 4QDRA 1AXYA 2HWD1 1FX5A 3E6DA 4N7UA 3VKOA 2XIUA 2QNKA 2W94A 4LULA 3SXWA 5KC5A 4RQPB 4Q2FA 1OURA 2ZMKA 4Y24A 2OIIA 2VCMA 4I02A 2E32A 2XJUA 2ICPA 4Z59A 5A6XA 1QGLA 5D8AA 5KR7A 3A0NA 1VALA 1PM4A 3FFZA 3A9YA 4K9SA 3RJ2X 4N9IA 2VMHA 1QMJA 4X4DA 2B5HA 3WG1A 3SMHA 2AWIA 2FDHA 2VTXJ 2B45X 4JGYC 3ABZA 5FXVA 5JCTA 2X10A 4Q4W3 3KS7A 1NA1B 2V09A 2P4EA 1IQAA 1UYXA 3ATGA 5A7PA 4BK4A 3UFDA 1NEQA 1PNGA 5LRSA 1RZRA 4NO4A 3FLRA 4GH4C 3EXUA 4EQVA 2PTMA 1EPWA 4TTGA 4Y33A 5IYYA 3Q8FA 1QQP1 4DFSA 4FAGA 4L11A 1JYTA 3GZDC 1R092 1SQ8A 1YIFA 1RMU3 4KU8A 4EN8B 3NRUA 4FBIA 1KDKA 1O8PA 1C8M2 2AH2A 2ZBJA 2IV1A 2W5FA 4FPJA 1WMEA 3FZ3A 4EN0A 3ZXFA 4PBOA 3D0JA 4I2OA 3BTYA 1Y43B 5H9PA 1RJ7A 2YDEA 1D4VB 3KF5A 5LA9A 2CSFA 4A7KA 1JW6A 3JBG3 5EFUA 3ZXLA 3WDYA 4EKIA 2NYYA 3NAPA 1XB9A 5A3WA 4WZFA 1PZ8A 3RI8A 3MI8A 1GNHA 3RZZA 1HRV2 1NOVA 3OUIA 5JI7A 5ABJB 2ZGKA 3Q8EA 3JB4C 2BOJA 4N53B 3UWPA 5FY9A 3N36A 2OX0A 4Q2JA 1VRH1 3POYA 3OY8B 2PXBA 1SLLA 2P3KA 2ZAHA 5CYYA 3VDDC 3K2OA 2P3YA 4IV1B 1RXGA 2WS91 1YJLA 5FZIA 2HCSA 1W6PB 5FK8A 3SISA 2HWC1 1XYOA 1LQCA 1WLCA 3PTYA 5FZ0A 1C5IA 2C5DA 1GNZA 2UURA 1PNFA 2Z69A 1RUD1 1W6NB 4IESA 3JUUA 1SBDA 2VQAA 2DCKA 4XF1A 1CIYA 1Y7YA 3MF9A 4LEJA 1UD1A 1BEV3 4LXLA 2HCNA 1XNAA 1F4HA 4B4PA 4AL9A 4FFIA 3VGIA 1VBD2 3GBFA 2XL7A 1CAXA 3T0DA 2D6LX 3J8F3 5KHKA 1QWRA 1QQBA 1DW9A 3K3OA 4D6RA 3B94A 2BOIA 2O1QA 4EYUA 5IW0A 1NERA 4MCXA 1QOOA 3ZPOA 1GANA 2WWJA 4CCKA 1QJFA 4PLNA 3CROL 3J9SA 1RINA 3POSA 4GWMA 4U36A 2CDOA 4NHKA 4FBFA 1IQDC 1WIZA 5CFDC 1DDLA 5C3RA 2ZHNA 5GZDA 3BD1A 5HBAA 2AGSA 2PXTA 1BK0A 2RDQA 4RR3A 2KEIA 2G1MA 4AZZA 2R043 2XKOA 2JG8C 5LA0A 1GKBA 3O12A 3D0SA 1ND2B 4FPKA 2VVDA 3CHXA 4DUXA 4URTA 3NQHA 2LLVA 1O3QA 5EV7A 2VOXA 4MGSA 1DQ1A 5HCHA 4DRRA 3ZKCA 4AVCA 2A3XA 2K9ZA 1TMF3 1LEMA 4NIHA 3KGZA 3BCWA 3KVAA 1YFUA 1ZZ8A 3N4MA 2HH9A 3RFRA 1NZIA 3NNMA 1NCQA 3KCYA 2IWGB 2PFWA 3FMGA 5FUIA 4Y5Z0 2AEYA 1PZ9A 1LECA 3FN9A 1R091 4CDWC 2NMNA 3MFCA 1NCRC 4R4ZA 3OBZA 2WN3A 1AYN3 4PLMA 3O1MA 1C8M1 2L1PA 1N3QA 2CGPA 4GKYA 1ZPQA 1SLIA 1W6OA 3PUIA 3TEZA 5C8WA 1W28A 2VULA 3A9XA 2XHNA 1RUG2 3C7OA 2YU2A 5FYZA 1J3RA 3S30A 1UZZA 1HRV1 1QOSA 4J25A 1XU1A 5EHDA 2OXBA 5T5OA 4ZZ8A 1MQTA 1JFSA 3KT7A 1DGRA 4FOYA 4MOAA 5FO9B 1YFXA 5E88A 4ES9A 3V0AA 2QQIA 2WDBA 1UX7A 1VBA2 5JZGB 2ZGRA 5T50A 1UKGA 1OHFA 1JZ5A 5IATA 5F6KA 1ZAYA 5JMOA 4NVPA 4Y22A 3O14A 1YYNA 4UF0B 4CCLA 5A32A 1LKNA 1UOGA 1XPWA 2A6ZA 1MEC3 3POWA 4LA3A 3AMMA 3B93A 4XF4A 4P9WA 3RJRA 5D2AA 3LOBA 4JCXA 4FPGA 5T3NA 2WINB 3P5BA 5JLVA 3T0AA 3CQOA 1VAKA 3Q8AA 3U37A 5BNPC 1YIPA 1DG6A 2WQZC 2WT0A 3LDKA 4UFMA 5C70A 2BU9A 4JRLA 1UY3A 2LLWA 4AFMA 3IN9A 2DUOA 3WF2A 4CUAA 4FTBA 1CWPA 1VBD1 5FZEA 5CKQA 4QQLA 4D7YA 5AFBA 4LO7A 1VBB3 1JZ6A 2CYFA 5HXMA 4IW3A 1ULCA 1D2QA 4HKLA 1WW4A 2WNEA 1J1TA 4XFBA 3F6WA 2VBDA 3ZXDA 1NW3A 4RA0A 2JVLA 2TNFA 4TZDA 1W2TA 3N7MA 4PLOA 1G8WA 3MBWA 3RWNA 5FOBB 4MG2A 1PX4A 1BK1A 1HQNA 2MNGA 1N1TA 3OBRA 2FCVA 1C3HA 4Q4Y2 5CU1A 5DAWA 1B35C 3THCA 4PDWC 3UJQA 1N1VA 3MIDA 4NMIA 4XFGA 3AXDA 4LBQB 2WQ4A 4YG1A 1OOPC 2IXIA 3AYAA 2A3YA 2EXJA 2X8KA 3JU9A 2ZHLA 4IV3C 4CDQA 3I54A 4JV4A 2R071 4ISQA 1GP6A 5FDBA 2H6BA 3IB3A 2BWCA 2RM21 3MIEA 1QJZA 4BOWA 2JDYA 2VCBA 4Z8BA 1FV3A 3LWCA 5FZ9A 4MGTA 1RB8G 1HQ1A 3MUZ1 4Q1RA 4XJ8A 4AGGA 4CXXA 5JUVA 4XXAA 2VQ0A 2KR2A 3O1UA 2JICA 3IBMA 2PHRA 2XH6A 1JU4A 1GOGA 1DQ4A 5A1LA 1VJ2A 2BBVA 4O7XA 1NX9A 4N43A 5LBBA 4C0BA 2OQ7A 4K7JA 4CVUA 2Y6FA 2GP5A 3H7JA 2Q8CA 3WXPA 5FY0A 3KWVA 1DYOA 1SMVA 4QXHA 4RQPA 1SHWB 3BTZA 1CQ9A 2HWF3 2FJRA 1OLMA 1NG0A 3R4DB 4MO3M 5IVEA 1OSLA 4P02B 2EXHA 4OVEA 3NO8A 3SHRA 4XJWA 2DCYA 1XNKA 2VNGA 5DZEA 4DMIA 1EV13 1Q8OA 2B9VA 4P5YA 3OQMA 1VB4A 3J7HA 2WZEA 1VBA1 3CNAA 4LLOA 3OQNA 5FMOS 5J09A 5CG9A 2EALA 3GCWA 5FYVA 4XC9A 3CZUA 3G6JB 2L8NA 1PGL2 3PUHA 3C7GA 1LHVA 1PVXA 3Q9OA 4TN7A 2DUPA 1W8FA 1ODNA 3GHMA 4YW5A 3VB9A 3WG2A 4Q8KA 5ACA3 1QJY3 4XJZA 3NJZA 4YSFA 4ER5A 2WN2A 2R1BA 5C8CB 1WBLA 3HD8B 3KJXA 1GMMA 2WKKA 5E89A 4OYUA 5GLVA 2XWJB 1OF4A 5APAA 5FYMA 2YG0A 5IK5A 5I0RA 4CUBA 2KEKA 2WO3A 1AL22 3PIGA 4LOSA 1ZBE3 1S55A 2XOMA 5BUVA 5JXGA 2CWMA 2GALA 3D5OA 4GMP1 3ZR6A 1A3KA 2WUHA 4CXYA 4AWDA 3WZ1A 5GZEA 2A6CA 1FXZA 2W1UA 4K3UA 3KMHA 4LOTA 3OMTA 3A21A 1LJ7A 4MH0E 3RPQA 1REFA 5ABJA 1Z78A 1K5MA 5HV0A 3Q8CA 3RZKA 3WNPA 1RZSA 1D2SA 3ZFEB 4BISA 4Y1XA 1ZZCA 4N53A 5ANNA 2Y26A 3ASIA 3WW2A 1RUC2 2HFZA 3OY8A 1BVVA 1N47A 1K5MC 3I3DA 4K8RB 1ONAA 2JE7A 2WA4A 4IV1A 4YARA 3I2IA 2ADEA 3LEGA 1W6PA 1PMIA 2RVAA 1XYNA 4QDSA 4Q5OA 4Y5TA 1G9DA 3BVCA 3R09A 1VBC2 4YW7A 4D7TA 1W6NA 5LA1A 2E6VA 2P17A 4I3PA 4XIOA 2JB8A 1ACCA 4XVHA 3T2TA 4DEVA 3BPSA 4XFIA 1US2A 1O8SA 1YEWA 2B4KA 3AL5A 3B9CA 1TEIA 1AR91 1D7PM 2JDKA 3KQ4B 3ZFFC 1BJQA 2XJQA 2VXJA 4CDXC 4NN0A 3LCPA 4B4RA 1DYKA 5LB6A 1SEFA 3DYOA 1FPN2 3M3QA 4NJ4A 1VBE2 2RV9A 4J6GA 4E2GA 1L7LA 1YQ6A 3L2HA 4F8AA 1S0IA 1XOYA 3HZIB 5FZGA 2WNOA 3HQRA 5I8TA 2BVBA 4Y3OA 5IK8A 4A42A 4P00B 4KWUA 3AMNA 1WLTA 3K75B 3ZFGC 4CRQA 2RS53 2Y6HA 4K1ZA 4YRDA 4F3JA 5JWPA 1K12A 1PRUA 1PGW2 4UI9L 3WSOA 2GSYA 4ARYA 3KQRA 1RIRA 1UOJA 3AZXA 4L9BA 4CU7A 3OPZA 5J37A 3P3PA 4JVAA 5F7UA 1ND2A 3W20A 4OFGA 3W21A 4BH9A 2YGLA 1H6YA 2ZGSA 3ETPA 2BRTA 3DL3A 2D3RA 2VJXA 4Y42A 1AR82 4UFIA 5GALA 1W2NA 5FKCA 2A6VA 1WMDA 1H1MA 2CL2A 3E97A 3AKPA 2GU9A 4P14A 5DSXA 4BMBA 1QJX2 1QOTA 1PGSA 1PGL1 1AL0G 2LRPA 2VW1A 2JWPA 2VU9A 3BTAA 2KEJA 3B69A 4AAXA 4W6XA 3S7EA 4Q0QA 3E6CC 3Q8BA 2EA7A 4IE0A 4S2DA 4XCAA 1BYHA 2WUSR 3ES1A 4OI4A 4CEWB 3V65A 1EAH2 3IMNA 1Q43A 1AL21 3CLCA 5FZFA 2WNUB 2J1RA 3H5TA 2JG9B 1D0HA 1RC6A 5AC92 2ZX0A 4XFHA 1P8JA 2ET1A 2VMCA 2A6WA 3WW4A 4X8PA 2BFUS 3BALA 1XE0A 3G7DA 2NQYA 3CECA 3VZOA 3UESA 5EPAA 1E3OC 4KWLA 2L9LA 2W9XA 4L99A 4XEZA 2VUCA 4RFRB 1NQJA 1QQP3 2ZGOA 2GNMA 3C2UA 3LIHA 4FPCA 4GJYA 4AFBA 4AI1A 2KA3A 4HVOA 4QM9A 4BK5A 5JZGA 1JZ7A 1RUC1 2E53A 5FP9A 1OA2A 4EE2A 2LALA 2OW4A 4X4CA 3MIGA 1BQPA 5I8SA 4FAHA 2LROA 4HSJA 1O3RA 1X7NA 2W47A 1S7EA 4NE9A 3JXBC 5A70A 2PXFA 4UF0A 4KMQA 5FYHA 2CY6A 4X4HA 1GT0C 2VY0A 4Y1YA 1QP0A 4Z5CA 1VBC1 2HEVF 3KT4A 3OBTA 5FCCA 2PAMA 5A33B 4BIOA 3JXCL 1PRVA 1HQWA 2Q1MA 4LMFA 1IOAA 4E27A 3A22A 1ZUGA 3SCFA 5I93A 3H8UA 1WMXA 1SACA 2ZX2A 1A8MA 1K42A 2SLIA 1WCKA 1S0GA 1IS3A 1O6UA 4RYDA 1VRH3 3LA7A 1FPN1 2K0GA 5A7OA 4PF5A 1BBT2 1GOHA 4LE3A 4OUSA 2ZJCA 1WBFA 2VW0A 2A73B 1UY4A 4IEXA 4IEUA 2AXZA 1ZS4A 3MIFA 5GZCA 4OQ9A 2C24A 3ZSJA 1STMA 2HWC3 2Y38A 3H3UA 4H14A 4QDQA 3O1SA 3FBMA 3H0OA 4QKNA 2XJRA 2WZ8A 1H9PA 3NVCA 3SEEA 2PYTA 1RUD3 1PRAA 2LM3A 3AL6A 2R6QA 4EWEA 1BLZA 1PGW1 2H8RA 4NPMA 1S0DA 4EWDA 1JI6A 3UYJA 1ST8A 3MLFA 2V72A 3HBKA 4P9YA 1W8TA 2MXDA 2OZ6A 1S0FA 3T0BA 3WHTA 5IFTA 2ET7A 4LBQA 4QHZA 1WCUA 2VQTA 1ND3B 2R49A 1JBCA 2R32A 3ILRA 1LTEA 3K4AA 1AR81 1WWYA 3O1OA 1Q3EA 4LKSA 3QBQA 2BP6A 5FZ3A 1QJX1 4QKFA 3ES4A 1J59A 3KT1A 4K40A 5LATA 1SCRA 2QBXA 1VMHA 4PQQA 5D21A 1MS4A 3LPGA 4K1YA 4QMAA 2ARXA 3OYWB 4XBQA 3AVSA 4NDWA 4Z1VA 2E7QA 4ZONA 1Q8SA 3VHPA 4CP9B 4YZ5A 2W68A 3R6SA 3J4UH 4E9KA 4V2WA 1EAH1 1TNRA 1V6NA 4W4ZA 5I8YA 5FZ6A 5CFCA 2BGPA 2D7FA 2NPIA 3RI9A 2CU5A 1DHKB 1XNBA 1ZM1A 1DCSA 2ZHKA 2WWSA 4O8BA 5AC91 4Y1UA 3AYEA 2R061 4RN5A 1X8MA 3H7YA 1BDIA 3C8XA 3T2OA 3CBNA 1MVEA 3ZMNA 5FO8B 1AUYA 2DTYA 4EK9A 2V4VA 4D7SA 5CFCC 4IEZA 1OXCA 4XCBA 5FTTC 4Z2WA 2ZX3A 4LKFA 3OOXA 1JUIA 2OKXA 1AYM2 2HBUA 3LEMA 1SZBA 3LE0A 1R093 1J3PA 1RVF2 3VBUB 3VKLA 4YVSC 2HWB2 5CB7A 2J1VA 1O7FA 1C8M3 5G04L 4ET7A 3MHZA 1AR62 1AJKA 1DYPA 1UW8A 2ZGLA 3KM5A 5A3OA 1OA4A 4QXKA 4CU8A 2HWD2 3N7LA 4HRAA 3O0XA 1MZFA 2GRMA 3IPVB 2YMZA 3U11A 1QH7A 3WDWA 4I01A 2D5FA 1LENA 3OGSA 1YC61 3LGRA 1F15A 4GJZA 1HN0A 1W9SA 5JIAA 4WV8A 1HRV3 4AEDB 3HN1A 4ZS2A 5C8CA 3RSJA 1ZA7A 3OBAA 1H2LA 1YI9A 4D3WA 3RNSA 1W39A 4EN7B 2OR1L 1JYXA 4XFFA 4ER3A 2E7TA 5JAXA 3LD8A 1ZBA1 3GJBA 5IAXA 1US3A 2GC1A 2YBDA 2V5YA 1ZREA 5J1XA 2VMEA 3M8LA 3AFKA 1BBT1 3AZZA 3ZX7A 4A44A 5FPXA 2JJ6A 2LYLA 4I8TA 5FZHA 4XILA 3THPA 5FOJB 4FQZA 1JH9A 1MZEA 5FZCA 2PUCA 2VBBA 3HWJA 1UTXA 3OUJA 1WW5A 4YW1A 3ZFEA 1LB2A 2WYSA 2ZGNA 1YQCA 4EJRA 3DXUA 3M3EA 1PMJX 2FDFA 1DU3D 2VUDA 5LASA 3DXTA 3I59B 3H1YA 5FZDA 1V70A 1VBD3 1KJLA 3HMYA 5FXWA 3BIEA 2GNDA 1EUTA 1U5ZA 5DG1A 4MHRA 3B7MA 1W05A 2WLPA 2EVXA 4URAA 3TEWA 2WO7A 4XQWA 1F2NA 5A3MA 4OHYA 4LHLA 2N7GA 4BB3A 2PHLA 3K46A 2D5HA 4Y5SA 4X4IA 1W9TA 3VBHC 1U5IA 4WVWA 1W06A 1R1A2 2EIGA 2YYOA 1UYPA 4E8DA 2AXVA 4AEMA 4YW4A 3GYDA 2C9AA 3OEAA 2ZEYA 3ECQA 3LFIA 1UYZA 3APBA 1POV1 4ZU4A 1X9TA 1ASJ2 2JEMA 2ARCA 4JRAA 1QIQA 4RGKA 2HJIA 1H8TC 1R64A 2EIBA 4ISRA 1AVBA 1DBNA 2WS92 3A7QA 5FY7A 5F2WA 4HLTA 3T30A 1LCCA 3C7EA 4HPKB 1GZ9A 3ZM8A 2K46A 1QU0A 4YBAA 4BWOA 1WETA 5EJ1B 1PZ7A 5FMCA 4QXBA 4MHUA 4IGPA 1JZ3A 4CDUB 3MEPA 2QKDA 1W2OA 5FYIA 4ONUA 4JTNA 4BIFA 5M0TA 3TN92 4CTEA 2ZAAA 4ZPIA 3RYRA 3DKQA 1AYM1 1QXRA 4YGDA 1HF0A 4A6SA 5BYNA 1RVF1 3WNNA 2HWB1 2ETEA 2VAUA 2WAAA 5DABA 3BU0A 4YPJA 2FMDA 3NXHA 2XSDC 2Y33A 4NPLA 1AR61 4EZ4A 4L97A 4KL1A 1CJGA 4ZXKA 4B3NA 2ZEWA 4FTEA 5JSRA 2C4XA 1CPMA 2BV4A 3VKMA 1UU5A 1YQ8A 5FP8A 4TLGA 3ACHA 1H8VA 2XR4A 2SBAA 2VNOA 5HPOA 3PVOA 3A9ZA 3VBOB 2AZ5A 2AENA 1RUG3 3SNMA 3V64A 3ZXJA 5HV4A 1UMIA 1YO8A 3UV9A 5JOXA 4AFAA 5F3IA 1QPZA 4YNIA 3HVDA 5GLWA 4COVA 1YJKA 1IPJA 2ARAA 4CEWA 2ORXA 3LF7A 2YC4A 1LOEA 1VBA3 5IVCA 3IWZA 4X4GA 1WKYA 2WNUA 1LGNA 1YSEA 4IL7A 2JG9A 4DZGA 5J7MA 3VUOA 5D8AC 4IEPA 4B7EA 3I2KA 4A41A 2J1SA 2LCVA 1TVGA 1VR3A 4HBNA 1HB2A 4NAMA 2XG3A 1UIKA 2BZDA 4Y1VA 1ADRA 4QX8A 3VZLA 3PMSA 3A23A 3VZMA 3WNMA 1FAYA 5GLZA 4JKLA 1EP0A 5FZ1A 1HV0A 4A6OA 2TUNA 1RUH1 2FQPA 3WQ7A 2WFF2 2H0VA 3FBYA 1QNYA 5DUVA 4A2UA 5C3QA 4XJ9A 2RR12 4HSLA 1AU7A 1S0BA 4ARXA 2XMLA 1OPMA 4GMP3 1QF3A 3C7HA 1XYPA 4LNVA 5T55A 4TLFA 5F5AA 1W2AX 3NZLA 1UO9A 1UXZA 3UKTA 5A33A 3NNFA 1R63A 1WCSA 1R1A1 3SH5A 1BCXA 1UOFA 4DUWA 2WSVA 4JZRA 4E4DX 1HB3A 3ZXKA 1RUOA 3NAPC 3ZYIB 3FLTA 2F4LA 2D6KA 2AEZA 1QQAA 1UOBA 4BCUA 4D6QA 2FD8A 1ASJ1 1PERL 4CU6A 3GM8A 4Q4Y3 4QB1A 5C71A 5FR3A 3RYKA 1H4GA 1H2KA 3VHNA 1GOFA 4L92A 4YFZA 3IKWA 1FOD2 3AKRA 1GBGA 2XPJA 1LRHA 2XONA 2F4PA 5F37A 3DYPA 5FPVA 1F31A 2IXKA 4B29A 4CSWA 2ZKNA 1I5PA 1IHMA 2PXQA 3LB9A 2MHFA 2BQPA 1IKQA 1IG0A 4NIIA 2YROA 1GUIA 1W8WA 3DPRB 2PXEA 4ER7A 2PMWB 4FPFA 2PHDA 4U2AA 2G4IA 5F39A 3TN91 2W46A 4LKEA 5FZLA 3T09A 3ZXAC 4NIAA 4AFCA 2PXPA 2GAUA 3KV9A 4TYSA 1ND3A 1AX1A 3C7FA 2V5DA 1T6GC 1YUDA 2BTVC 3N9NA 4XUNA 2EF6A 5FKBA 1CD3G 1NLSA 3OD4A 1OQDA 3CU7A 3ZVXA 2HEWF 1ND3C 1T2XA 3MZHA 3E5XA 1OVSA 4FFHA 3OYWA 5FO7B 2R7EB 3BB6A 4QAWA 5EWSA 4CP9A 2BWAA 3ROUA 1V00A 1WUVA 1MVQA 3W59A 3PJQA 3SQOA 2WZPP 1V9U2 4AI3A 3THTA 2QCSB 1N1YA 3TEXA 2PQQA 4M4PA 4RR3C 3B9IA 2YB7A 2XVGA 4BYYA 1S1AA 3HNMA 2R072 3OGVA 5DUXA 4XBNA 2JD4A 5JSOA 2JECA 3LSDA 2C26A 1PO12 2RM22 2WC2A 2WFPA 5GM0A 3VZNA 4RHV2 3W5MA 3ELNA 4I09A 5K98B 3OPWA 2NMOA 5A3UA 3DNVB 1KDMA 3HNYM 4QX3A 3RVHA 3VBUA 4LT5A 4FP3A 1ZRDA 2PA7A 4WZCA 2HKXA 2QZ2A 2OS2A 1NCQC 2WFF1 2BEOA 1SDDB 3WF0A 2VBPA 3WEZA 3WF3A 1LESA 1Y9QA 2J7WA 1QDCA 4HN0A 4R9CA 4AK3A 1PIV1 1TZOA 3HPNA 1AL23 3KV5A 4I0AA 2RR11 4DB5A 4QM8A 5B4XA 2D44A 1W0NA 3GJAA 1QJU2 2HYXA 1GLHA 1RUJ2 1XU2A 1NAEA 5DAXA 4O9EA 5DMYA 2UWBA 2H6CA 1X50A 3PURA 3SKVA 4AEDA 5FMBA 3M9LA 1AF9A 1IPSA 2UYAA 3VK0A 1GQPA 2V4AA 4CUGA 1PM7A 1S0CA 3DYMA 4XDQA 5BNNB 1C4RA 3CO2A 5SV5A 4JKKA 1POUA 1RUC3 3WX5A 5I0DA 5GZFA 4AEDC 4NUBA 5ISLA 1FOD1 5IVYA 5A7NA 1MQTC 2PUGA 1CONA 2NN8A 1PK6B 1MS0A 4BQ5A 4RS5B 3O9XA 4COUA 3NJXA 4UFKA 4BA6A 2W08A 3LEIA 5A7WB 3FYAA 1VBC3 4TWTA 4DY5A 1OKQA 1OFSA 1Z7S1 1LHOA 5AFEA 3O1TA 1UKRA 1JOPA 2DDUA 4DXSA 3TNQA 3H8XA 2B9UA 2LYSA 4WM8B 5CKNA 2LYKA 3KLSA 2DVBA 2ZABA 2NM1A 1REDA 2IXHA 3I59A 2ORZA 3QOPA 5E8AA 5FLHA 1GICA 3ST7A 3VD9A 4G9SB 2MQKA 2QZ3A 2VZQA 3WP3A 2AR6A 5A3NA 4LQRA 2JDZA 2WLQA 3V0BB 2XJ3A 1FPN3 1VBE3 3WY6A 3FJSA 3IDAA 4NHMA 1JHJA 4WVMB 5C9AB 3RMYA 3IM0A 2ZOEB 5K9YA 4MZUA 3IDCB 2VOTA 2VMDA 2W0XA 4GIQA 1SLAA 2X09A 4BXSV 4LPLA 3ZSEA 4LHKA 4JTOA 5FRAA 1AHSA 1PNRA 1AR72 4Z82A 3I2GA 3RMXA 4DQAA 3VBFB 2J1EA 1LULA 4NHYA 4AAPA 1POQA 2YBPA 1JYVA 3AYDA 1JOBA 5FYBA 4AI2A 1J84A 1GNYA 1V9U1 3OSDA 1UXXX 2OVUA 2VZ1A 2IUWA 2ZX1A 4JDNA 2DFBA 3AYCA 5FYYA 3PIJA 4OUMA 2BJSA 1AR83 3QYXA 4HPKA 5FYCA 5CZKA 4M3CB 2VW2A 3MV11 4UW5A 4IWRA 3OWQA 1UNBA 4AVAA 3V56A 4XBLA 5FY8A 1QJX3 2FDJA 4CDUA 5IVVA 5A7LA 1PO11 3AKQA 3CDZB 3ZYPA 4A45A 1XSRA 4RHV1 2Q5TA 2TBVA 2PPXA 3CF6E 3JB8A 2PXDA 4CDQC 2WRAA 5JPNB 1AR92 4AQ2A 4Q4V2 1FMD2 5EJZB 4DNYA 4NWWA 1W6QB 1BMV2 3WT3A 3K4ZA 1TQ5A 2W52A 3A0KA 4MGQA 2XCJA 2XUEA 3DGTA 5FZBA 4CDUC 5CEHA 4UW4A 4AR2A 3POEA 1OKOA 3TRSB 4DPNA 1EAH3 3VWSA 2RJ2A 1Y9GA 2YC0A 3D4KA 4MGYE 5C33A 2VUJA 4BU2A 4EWAA 2AACA 4A7ZA 4MGKE 1G9AA 1AZDA 5LA2A 5TSWA 5AC93 1QJU1 5JVVA 1RUJ1 1E5HA 4XHXA 2XWBB 3O7OA 3VBOA 1Z0HA 2IXCA 5EIYB 3K4DA 4UBHA 1ZRIA 2LTNA 2W91A 4AI0A 1W8HA 2I2SA 4N43C 1D4M1 3LA3A 5FJKA 5F32A 2XXQA 5IAVA 3BS3A 3GBGA 4Q4X1 3VD4A 4Q8LA 3TYJA 3J7MA 3WOGA 4JDOA 1ZNPA 3H3LA 4LHNA 3NL1A 4RQPC 3WQ1A 2XJVA 4UW3A 3QD6A 2A6XA 4D94A 1CVNA 2CAVA 4LK7A 4LKDA 2BDRA 1J58A 1W90A 2IXLA 2Q30A 3R05A 2ZGQA 4META 3AKTA 4YM1A 1C1LA 1NA1A 4CYDA 4CEYB 5FYSA 1LGCA 4NPRA 2GH8A 3ZYHA 3ZKYA 3GGLA 5LBEA 4BQ3A 5IT6A 3SCHA 3KXAA 1VIWB 4O61A 1ZYBA 1RYYA 1UU4A 4E2QA 5LEJA 3U3WA 1HV1A 3M2MA 3VZJA 4ASMB 5C3PA 5LY1A 2IVIB 1NA1C 1YQ5A 2NLRA 3AP4A 3HQUA 3PHMA 4YW3A 3VBSB 5KBFA 5JSPA 2G9ZA 2ZEZA 1RPEL 1DGWA 2DCJA 5C3OA 1S0EA 4P9LA 1H2MA 2VE1A 1CR7A 2BW8A 1WH6A 2D6MA 2LW8A 3LQCA 3OF1A 3VL9A 4XFAA 5J36A 3IT8A 1NT0A 4YG0A 4JKMA 3ACFA 2VOVA 1W3VA 2VCAA 4Q4W1 2JDAA 5E16A 1BBT3 4GALA 5KHHA 2OPWA 4JCYA 2RDSA 5JR2A 4W65A 4OBMA 2VOKA 1Y4WA 2PXKA 3U0ZA 4XTMA 2FFHA 1ENXA 2W87A 5JR7B 4HT1T 5DN2A 1HXS2 2ZA9A 4UXAA 1R082 3POJA 3G5GA 3PVNA 1AR71 2MPFA 3VDBA 4GA9A 3PU8A 2X29A 1OMIA 2WIIB 1RGSA 2JDHA 1RJ8A 5ABJC 3MYXA 2YZ4A 2WYFA 3TBDA 5ANQA 4LO8A 3RZJA 3MPBA 4N53C 4UWDA 2XXZA 4RGAA 3T2QA 1OVPA 4CUCA 1LOFA 2XLAA 3S5QA 4B8EA 5LY2A 1MPXA 3PXPA 3OKZA 1W0PA 1SPPB 3SCGA 2A75A 2EXIA 3OG2A 5FYTA 5A3PA 4E4ZA 2Y0OA 3NV1A 4IV1C 3DPRA 1GZWB 3POFA 1DZTA 1H0BA 4UW6A 3RZLA 3FHQA 1W8OA 4X8NA 5T5JA 4Y26A 1ZZ6A 4I6RA 1ODMA 1FMD1 1LOFC 1POV3 3CMGA 4Q4V1 4QPGB 4WM7B 4PI2A 1DZRA 3T1MA 2JENA 1BMV1 5JOZA 4YG7B 3DPRC 3KV4A 1C57A 4JCKA 1ZRRA 1J1LA 5DAQA 2WAOA 3WP4A 1AX2A 1GYKA 5L9RA 1XXNA 1YXWA 1SDWA 1PVC2 4RGGA 3TEYA 4M0NA 4BQYA 2E7AA 3B01A 4C8DA 1HIXA 2JKBA 4QXCA 2VTXA 3WR0A 2DUQA 1QDOA 4ATFA 4M00A 2GNBA 2DBNA 3MIBA 4GD4A 4P9GA 2CAUA 1KFXL 4XZUG 3CJIB 1AYM3 1HB4A 4K8FA 1T6BX 4Q29A 1DQ2A 1ULPA 3J8F1 1RVF3 3BGAA 3CJXA 4DE9A 2HWB3 5HCAA 1VPHA 2WIUB 4DO0A 1H30A 4M4RA 3FC0A 1AR63 1SFPA 1W9FA 4PIZA 3OGGA 5IK4A 2CROA 4QQOA 3NJYA 3AP7A 1ND2C 5IJRA 2HWD3 3MW4A 3S0MA 2VVEA 5FV3A 2DVFA 4L0PA 2MEZA 2WNVB 3PDQA 2JDNA 2PXVA 3DF0A 4C1XA 2DVDA 5J48A 1Q56A 5HCFA 4EKGA 3KF3A 3KB5A 3AM2A 1JUHA 1U5XA 2YPDA 4JDMA 3T2PA 3QWGA 2WQ8A 2O8QA 3I3BA 3KCXA 4HK9A 2LYRA 1IPKA 5FY4A 2QQNA 1F35A 1XE7A 4QPIB 5J98B 1QB2A 4W6WA 4B1MA 5DTMA 2W3JA 2D6NA 1CQTA 2AUWA 1UN1A 1W8ZA 1DQ6A 2QTWB 3QF3A 2WT2A 2R062 4SBVA 2DWRA 5FYUA 3LDRA 3UGGA 1FATA 3DCQA 3LKJA 2QQLA 3I3EA 2WO1A 4YZ4A 4KWKA 5FPBA 5A1AA 3M1HA 3W5NA 1EYBA 3LFMA 4UYBA 3USSA 2GNTA 3ZOIA 2K2SA 3AX4A 1MS8A 3GZUC 1VMFA 4JGYB 3AJYA 2QUOA 1HN1A 2D5VA 3MICA 1HXS1 3DEMA 1R081 5BNNA 3R4UA 2BPA2 4RL7A 2P5BA 4TXWA 3GBWA 1VP6A 2JX9A 4OMDA 4AHYA 3WG4A 1HJGA 3NROA 3UL2A 2W92A 1LOCA 2B8MA 4LTAA 4QPWA 3M3CA 4GH4B 4XDOA 3W58A 5FBZA 1PK6A 4FSJA 5BNNC 2X53S 3IAQA 4QU1A 4RS5A 1NXMA 2Y6JA 4XTPA 4EN6B 5JZGC 5A7WA 1YRZA 2OFYA 1RIOA 2VC9A 1COV2 1R1A3 3NKGA 1NE6A 2XXPA 3QFIA 3K3NA 3D8CA 3I2FA 4QX7A 4WM8A 3U14A 5CAZA 1GU3A 5FLJA 4Z5DA 1J83A 1OBNA 3MW3A 4QHBA 2XQXA 3K48A 1LOGA 1ZRCA 3HIFA 2PLV2 1JMUB 2XVLA 1ASJ3 1UXCA 3D3AA 3I2JA 4O65A 1X82A 1ZBA2 5L7OB 4LO5B 1V6LA 3SKJE 4A7YA 3V0BA 3PU3A 4ZZ5A 4NHXA 1WMFA 2ZTNA 2ZZJA 3AC0A 4K6BA 4YM3A 4MYEA 4WVMA 5C9AA 4LBLA 2YFUA 2WS93 3AZWA 3HR9A 2CGOA 4HKWA 1XNTA 4B1LA 1IG3A 2AYHA 1JH5A 3A4UA 1QKQA 3J7NA 1HRI2 2R16A 1PVC1 2PHTA 4PQ9A 4NRPA 4JHTA 2YGMA 5C9AC 4BQ1A 4N9HA 5GAGi 3L1PA 3E5UA 4BLIA 3F51A 3IIAA 3VDDB 1W8NA 5AVAA 5JI9A 3TN93 2CGNA 2F17A 2Y6GA 1CJPA 4HG6B 3VBFA 4Z2AA 2VD7A 5KWRA 2GMMA 2PXJA 1HQLA 1CAUB 2ADDA 1VBB1 1RUE2 3GN5B 1AX0A 4HONA 5EYYA 3BN6A 3VDCA 5D1IA 1EFAA 1O4XA 3BUCA 1QP4A 1CIWA 4AYUA 5B2GB 1Y3TA 4M3CA 2BERA 1KD7A 4PU3C 2PHFA 3ZO0B 4CE8A 3NNGA 2G9GA 1AJOA 4IE5A 3N9LA 3DKWA 1KJRA 1ULEA 2KZ8A 1OQEA 2VECA 1NE4A 2FMYA 4ITCA 4Q0PA 4COWA 4XACA 2GZWA 4AGVA 3KVBA 1LAJA 1CX4A 2F6BA 4AVBA 1W6QA 4Q26A 3EBRA 1XQNA 2RS32 1OQ1A 1HLCA 2ILMA 4KNCA 1CAXB 1XNDA 5BPXA 2QQKA 5CFDB 3T4HB 1F4AA 2XGXA 3THDA 3GZEA 3RDIA 4FQ4A 4FFFA 2PQSA 2QQWA 1UQXA 3VKNA 2GMEA 4PU4C 4DUVA 5KXEA 2VZUA 3P3NA 5EP9A 5FLIA 2JG8B 5JPMB 3IMMA 2LYPA 2YC2A 3M3OA 4AQSA 2I74A 1CZTA 1ULDA 1YQ2A 1WD4A 3GF6A 3RG0A 4KG0A 1LCDA 1DLCA 1W9YA 1S2BA 4IEVA 4UBGA 2GMPA 5H9QA 1RHI2 3S6PA 2O38A 1C28A 2WFF3 3PL0A 1RUF2 1OF3A 4CEYA 3T4VA 2JE8A 2RR13 3K51A 2RE9A 2PHXA 2PUBA 3ZDSA 3VN4A 3BI3A 1FV2A 1LODA 3KHBA 3ME2A 5AVPA 1WA6X 3K77A 4WBBA 2Y60A 2UYBA 1W8UA 2Q8OA 4CDWB 2D43A 3FWEA 1NCRB 3ETQA 3TWIA 2AUYA 4M0HA 3VBSA 1COV1 4B4QA 1NQDA 1WCQA 5T52A 2FDKA 3IVPA 1GQGA 2ID4A 2LYJA 3WW3A 1G7YA 2JB4A 2PLV1 3RWKX 3WCRA 4AGRA 1MZ5A 4XF9A 2VL4A 3VBSC 3VHOA 5CADA 5E1RA 3OJBA 1C5HA 3PMEA 2X5IB 4J1XA 5C8CC 1HB1A 1FOD3 3POIA 2ZMNA 1RXFA 4I3GA 5H9RA 5A80A 1OUXA 3FL7A 3LPFA 3KGLA 1W6OB 4R52A 5IHRA 4QWNA 3QOWA 1L7RA 3CLPA 4P9XA 1J3QA 1HRI1 3OD0A 1DGRN 4H2AA 1Z7S3 2ENRA 4HMZA 4KGGA 2Y34A 3ACGA 4LJHA 1W04A 4QD2A 2RS12 3D1NI 3ZPYA 4CPBA 5C3SA 3U1XA 1RUH2 3I2HA 3RGBA 2VCCA 1YHFA 4AFDA 5FREA 4BDVB 2JDUA 3NV4A 5DG2A 3FX3A 4OCTA 1RUE1 3F95A 1DLLA 1YNAA 3AFGA 3JXSA 4QX1A 4QKBA 1NLQA 4TSVA 3ZFEC 2FDGA 3WDTA 1HX6A 1I6XA 1W0OA 1TNFA 2WZR2 3GUUA 5BNPB 3N9OA 3TELA 1SPPA 2VMIA 2D93A 2FZ1A 4YZ3A 3F52A 1GZWA 3GNEA 2CWSA 3P6BA 2C0ZA 4M01A 4QGMA 2Q8EA 3W9AA 4DS0A 3E6BA 4H55A 5JDBA 2O4AA 4OZOA 4XF3A 1RTVA 4YYOA 3WVJA 3EHKA 4N8MA 4QPGA 4WM7A 5G05L 3RZGA 4HKOA 2MEV2 4GZ9A 1GSLA 2JDPA 2RS31 3NMBA 4FPYA 4QU2A 4ZXEA 5BV6A 2A71A 1JS9A 2EAKA 3PNAA 3PJYA 1VAVA 5FY5A 3VD7A 3VZKA 1RUNA 4GB32 3MLJA 3AZYA 1V9U3 4CCDA
chains in the Genus database with same CATH topology
4B7KA 2PUFA 5EJ3A 2XKPA 2R073 3I7DA 4LR4A 3VKFC 3B02A 4BHPA 1OLQA 1KFUL 1B35B 4PDWB 4QPYA 3BU7A 3NV3A 1PO13 1QXJA 2RM23 4YVWB 1X2LA 4F7ZA 4RHV3 1PO22 1F8VA 3HT2A 4HVQA 3CJIA 2DTWA 1OOPB 4IV3B 5T5LA 1ZX5A 2YPJA 1RHI1 1APNA 3TOJA 1VAMA 5BNOB 1RUF1 4LBMA 1O4YA 4XJUA 3SLIA 3ZIXA 2HWE2 1WW7A 2WNVA 1QJU3 2OYZA 4XPVA 1RUJ3 4AQTA 1O91A 4XZPA 1XWRA 3KZ3A 5JOWA 4LA2A 5DDJ2 3ILFA 1F5FA 4F8DA 5K7PA 1LR5A 1Q8PA 4YGEA 2DU0A 1UAIA 1W6MB 5FMOL 5JIUA 4QPIA 4K20A 1CAWB 2WA3A 3NV2A 1QH6A 1DQ5A 2R0HA 1UPSA 3BODA 1Q8QA 2XB6C 3WUCA 3LSEA 3WP6A 3H3ZA 4CEWC 5F9TA 4QPIC 2IVQA 4IQPA 3ZYGA 3QQ6A 3R4SA 2WNUC 1SFYA 2QJVA 4JGYA 1L3JA 2JG9C 1ZZ7A 1UCXA 2RS11 4I0BA 2ZHMA 4LE4A 1YFYA 2UY9A 3EQEA 4AI8A 1M4WA 1U12A 2ZGUA 1JHNA 4GH4A 1V6OA 2W39A 4X4FA 1PIV2 3KD4A 2P37A 1V6MA 1B0NA 3DN7A 4Z07A 1HW5A 3M70A 4Y20B 2WZR1 3PVEA 3H1MA 3FUQA 4Q27A 1MR5A 4CZSA 4DY3A 4FP2A 2PN5A 2WSUA 3ZN6B 1REEA 3LFPA 4MX3A 4AG4A 2HINA 1C1FA 2EXKA 2ZACA 1AR73 1TME2 1U5YA 2VOWA 2MEV1 1NXD1 5L7OA 3VLBB 2I07B 1LOBA 2C1FA 3WP5A 1IS4A 3MDPA 4GB31 4MV2A 1LMB3 4QGLA 2EWTA 1NZCA 4FXGB 5FQ0B 3URFA 1ULFA 5H9SA 2E51A 1OSGA 1SBFA 5L7OC 2Q0AA 1VB2A 4RD7A 1RUI2 2XVKA 1QY4A 3SITA 1Z7S2 3H1WA 3SH4A 1ZZ9A 1WLDA 4F83A 2RMU2 3BDNA 4JQRA 4BE3A 2BYVE 4XMIA 2PUEA 1K5MB 3VDDA 1IZ3A 1KS4A 1PO21 2VG9A 2DVGA 2PELA 1AR93 4E4SA 4Q4V3 1FMD3 1CAUA 1UMZA 4YFWA 2ZMLA 5KHJA 3GN5A 1A8DA 1I9RA 4ATEA 3PVBB 1JTZX 1YCIA 2B5AA 2P3JA 2P34A 2A6YA 2HWE1 2UU8A 4M3CE 2YV8A 3ZFFB 1FT9A 4HL0A 2GN3A 4OZXA 4CDXB 4AW7A 4LBOA 5DDJ1 4RSUA 1IKPA 5DUWA 1SBEA 3N7JA 1JWLA 2BVVA 4LO4B 5T5PA 5SV8A 3RQ0A 5CFDA 4LLFA 5K0UB 4GQMA 3ZFGB 3N3HA 4QQ2A 2WT1A 2PE5A 4XHBA 1BZWA 1G9FA 2XJPA 3IDEA 1CESA 3MPPG 5LK5A 2JG8A 3O0VA 1LOAA 2VH9A 3JXDL 5I91A 4KBBA 3TB0A 3GZAA 2QFEA 4AXOA 3VHRA 5EYXA 1NYWA 3C3VA 1QXPA 3WV6A 3ENRA 3KSCA 2PAEA 1UIJA 5FFOC 3AMHA 2VUAA 1LGBA 3O0WA 2VPVA 4IERA 4YW2A 3M4FA 2Y0IA 4YZ2A 2PHWA 2BFUL 5IK7A 4IEWA 3VBUC 2XBO2 3IPVA 3M3IA 2B39A 4G4FA 4NHLA 4IA8A 4LBJA 2DF7A 2JXAA 4CDWA 4R8HA 1NCRA 2OZJA 2HYKA 5GLTA 1D4M2 2L49A 4A3XA 4P9IA 4Q4X2 3VV1A 1O3SA 1HXS3 1H9WA 1R083 1O4ZA 3FMYA 1TME1 3JD72 5C4WB 2ICTA 3JQWA 4YG4A 4Q0VA 3UKNA 1TE1B 2X5IA 2ZGMA 3ZYJB 4OHXA 4LBKA 1N3PA 1V6KA 2CTVA 3QCWA 4PCRA 4C1WA 5LRRA 2EF8A 2AW6A 3GALA 4FPLA 4EN9B 1BVP1 1GR3A 1RUI1 4R4XA 4XFCA 2X5IC 4XF0A 3QH6A 1WA4A 2Q1ZB 2RMU1 1RZRD 5GZGA 3FYMA 3I8TA 5F1RA 3LISA 2PIJA 2ZS6B 4WVZA 1U0AA 2FBEA 3AJZA 3NSTA 2D97A 2IUOA 2QDRA 1SFNA 4LO6B 4ORFA 4YZ1A 1OFNA 4Q4W2 5BNPA 2BJCA 3AK0A 1JYIA 1Y7BA 2GZUA 3OP9A 1H1AA 1KS5A 1WGPA 3AKSA 1PVC3 1S2KA 3WD5A 3B00A 4AF9A 3WHUA 1IS6A 4WVVA 4I6TA 2JCGA 2LYQA 1RMU2 1DZQA 1OA3A 3AMQA 2VMGA 4NWVA 3RS6A 2R1JL 2R30A 2B46X 4X6RB 3LOIA 4OHVA 4HFSA 5LEKA 2R63A 4K21A 3JBG2 2OPKA 3HBZA 5CBLA 1MS3A 5EZWA 2GC2A 1CPNA 1SLBA 4GKXA 1B35A 4FOWA 4JGZB 4PDWA 3UK9A 1KXGA 4KH9A 4YVWA 3GHNA 2LUWA 1CJDA 4YG3A 4DOUA 3WDVA 2IU7A 1OOPA 2D6PA 4IV3A 4MXVA 4YLZA 3VBRB 2ZX4A 1L1MA 5J96B 1AXZA 2BNOA 3LAGA 3AP9A 5KHGA 4YVWC 5BNOA 3ZN5A 4GULA 3S8QA 5KC6A 3U07A 4XYXA 2P2KA 3USUB 2XBO1 1LHNA 2R063 1O5LA 1FNZA 4I0WB 2GRLA 4MXWB 5BNOC 3QH7A 3AP5A 4OI1A 3WINE 2TEPA 3DV8A 1BEV2 1DQ0A 5KXDA 1LEDA 5BXXA 1W6MA 3ZSMA 3VBOC 2DURA 1UU6A 3ILNA 1O4TA 3J8F2 1CAWA 2ZCWA 3JD71 3U10A 2RJLA 1CAVB 4X4EA 2BUKA 1OI6A 5HI0A 3LA2A 1ZA4A 2KM2A 3EJKA 4FPHA 5CFCB 3ZN4A 2A3WA 3HT1A 2E9QA 4GMP0 4KG8A 2Z42A 5DUUA 3WQ0A 1IS5A 1RUG1 4YVSB 1ALYA 1OLRA 2IC1A 1COV3 1XE8A 3QLQA 4COZA 2R042 4NR1A 3EO6A 5BY5A 2O0OA 3FUOA 4PU7A 4R9BA 4EROA 5A3LA 4BZ4A 2XL9A 3WUDA 2PLV3 4E2SA 4FO9A 1ZBA3 1ENRA 2D6OX 4GQ7A 3T1LA 4AHXA 1HDKA 1W2UA 4Y20A 1JYCA 1TMF2 2HSGA 3ZSKA 1GV9A 1WLWA 1SLTA 4KGQA 2O8OA 1SQ4A 2D40A 3MFAA 2Z2SB 3ZN6A 1EPZA 1HRI3 4O9GA 4R9DA 3JZVA 1O5UA 2KPJA 5F5QA 5LK7B 1WCDJ 1GQHA 4X6QB 1KQRA 1RMU1 1FI2A 1BDHA 2A5ZA 4S2GA 1AYN2 4MGIE 4HANA 1UL9A 4OHWA 2PUAA 3D6EA 1RUE3 3LZZA 2I45A 4OI0A 5FQ0A 3JBG1 4OULA 5JMCA 4GHJA 4J1WA 4YG6A 4D69A 4DXZA 1V6IA 4XOGA 5KXBA 4R9AA 4BPZA 4L8QA 4Z92B 4EV0A 3ZSLA 1JFTA 3I4IA 4AHWA 3UJOA 1HKDA 3B5LB 1ENSA 5GKAC 4JQDA 4G3YC 2B7YA 3S7IA 3ZHIA 4Q0SA 2AXUA 1NLRA 4Q4Y1 1AXKA 2RS33 3NWKA 1G6NA 3VBHB 3R1FA 2B42B 1X36A 1ZRFA 4I6UA 1I1EA 1MEC2 5DZFA 4FOVA 1LLIA 3ZFFA 1G9CA 2IFRA 4CDXA 2DCZA 2A70A 1URXA 2D3SA 3H50A 1KITA 5HCBA 1N3OA 1H8TB 1BEV1 2GDFA 1S0JA 4OLLA 3D82A 3MLKA 4MVTA 1LU2A 1VBB2 1RHI3 2NZ9A 1WW6A 5K0UA 3ZFGA 4INDA 4H7MA 3X29B 1IGOA 1RUF3 3WCSA 5F6LB 3DUIA 3RYPA 1UX6A 1H1IA 1Q5OA 3KCCA 5K0UC 3FHIB 4AEKA 2O49A 2XLGA 2ZGTA 2IZWA 4FOQA 4PBPA 1C8NA 2PAKA 1NY72 4QX5A 3MGUA 2R041 2DFCA 2XHKA 4XE9A 2BNNA 1EY2A 1UPIA 2R0FA 2IFWA 2ERFA 3WDUA 1YWKA 1H2NA 3BOWA 2XLFA 2QVSB 5FPZA 4BMEA 1E57A 1TMF1 1UF2C 3INAA 4HETA 4XIKA 5C6CA 3ZYRA 5J3UA 3AB0A 2PUDA 4CP2A 3HQXA 3JQXA 2ZPXA 2GC0A 3R0RA 1DF0A 2WL1A 2HEYF 3KZ4C 2RS13 5T54A 5C4WA 1Q8VA 4QQHA 3J26N 4LBNA 4YM0A 5D8AB 1F5JA 1RUH3 3UKVA 3ZXGA 1AYN1 1ULGA 4FXKB 3TAYA 3WNXA 3TNPB 4MSVA 4ES8A 2DVAA 4LUMA 4W6YA 4IEQA 5L36A 5C4WC 2VVFA 2D3PA 3U4XA 2WZR3 4CP1A 2D98A 4S2HA 2HWF2 1CN1A 4PIXA 1PK6C 1M06G 4RS5C 1EV12 5JOYA 1DWKA 2ES3A 4ASLA 1B09A 2MEV3 1X8EA 4MGZE 4HN1A 1I3HA 1V6JA 3ZHMA 5CA6A 4WM8C 1WH8A 4GB33 3H9AA 2FZ2A 4AQ6A 4IEOA 1MEC1 2GC3A 3PLQA 4LUKA 4ZKTB 2R1DA 3NAPB 2V73A 2G9FA 5DZGA 4KU7A 5CNAA 5ACA2 1I5ZA 5KXCA 1QJY2 2YXSA 4C90A 2RJKA 4XJAA 3ZXEA 1PO23 2ATFA 2PHUA 4HVRA 4CP0A 3RRDA 4PIYA 2CNAA 5IUQA 1ZBE2 4P5HA 4AEJA 4C0HA 1VBE1 3B7HA 4BM8A 1DFQA 5FAXA 1LHUA 1IC8A 3VBFC 5L19A 2UWAA 1ZVFA 2HWE3 4FCAA 4JGZA 3MIHA 5BNQA 4BLJA 1VLNA 2ZKLA 5DDJ3 2QDNA 3VBRA 2DCTA 1NY71 4JGZC 2WJSA 4AE2A 2YUEA 2H0BA 3HAGA 1O3TA 3USUA 4OI2A 4I30A 5HXVA 4IEYA 4MXWA 2EBYA 1FNYA 3CEWA 4QT6A 1F9KA 2OUHA 4KQ7A 1QHDA 3OCPA 1X33A 4IVZA 3EUSA 4RR3B 2DYCA 3OTFA 2E63A 4HK8A 1A78A 5I0UA 3VL8A 1BKZA 2IVGA 4AVVA 4AHZA 1CAVA 3MLLA 3N7KA 3WDXA 1JOJA 2FHRA 1DGWX 4N90A 1PIV3 4Q1PA 2VGDA 1LCLA 4XQ4A 4AVSA 4SLIA 4PJYA 4AVTA 4PU8A 2XJTA 2RS52 4Z58A 3M7AA 1QNWA 2HWF1 4N7IA 4YVSA 4FVVA 1ZZBA 4MCTA 1NCQB 4CEYC 1R69A 4XQDA 3ALQA 1BXHA 1EV11 1G86A 1SCSA 3MW2A 4ZU7A 2GH2A 2AREA 1CGPA 1TME3 2IXJA 3TRBA 1VPWA 3L9JT 4OB4A 3L2YA 4YGBA 5CIRA 4FT8A 2P3IA 3NKTA 5GLUA 3AXEA 1DGLA 2JE9A 3GZTB 2QE3A 3WG3A 1RUI3 3B3QE 1N1SA 5ACA1 4NOTA 1QJY1 2RMU3 2QQPA 2NP0A 4XW3A 1OCTC 1MQTB 4KWJA 4MUVA 1OPOA 3CL1A 3MF6A 1GZCA 4RFT0 1XRUA 3V0AB 2BGCA 4JC1A 1POV0 4JAAA 4MLOA 5KHIA 1ZBE1 1X57A 1UZYA 2Z5WA 1MZ6A 2YHJA 4XETA 5I0TA 2ZGPA 1MACA 5DXDA 2XJSA 2UY8A 4L2NA 4Y22B 5A32B 4IXLA 3N35A