1ZZ6A

Crystal structure of apo-hppe
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGNEFLFVLEGEIHMKWGDKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 45
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz6A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz6A02
4Z82A 4B29A 1O4XA 1ZRFA 3F6WA 1O4TA 4XF9A 3D0JA 3R6SA 1HF0A 4MUVA 4FAGA 5FQ0B 3D1NI 5JSRA 4Q0VA 1QXRA 3E6DA 2GC3A 2XHKA 4KU7A 4E2GA 3GN5B 1NZCA 3QOPA 4OLLA 2R63A 2BJCA 4Q29A 1NE4A 3VK0A 1OI6A 5I0SA 2OZ6A 4F8DA 2IXHA 2PUDA 3CO2A 2Z69A 4F8AA 4Z58A 1JUHA 4FAHA 4HLTA 4Q0UA 3CEWA 1L1MA 3U11A 1HW5A 3JZVA 3F52A 3IDCB 3VHRA 1FI2A 2XLFA 2L8NA 4IEOA 3MYXA 3H50A 1QP0A 3NSTA 2LYSA 3DV8A 3ES1A 4IEZA 1DW9A 4K8FA 3CF6E 4X6QB 5J48A 4J1WA 1EYBA 3DN7A 4A2UA 3FX3A 1CAXA 1PNRA 1EY2A 3FMYA 1O3SA 4JVAA 4UBGA 3N4MA 1RPEL 2E9QA 3NVCA 2FQPA 2GC0A 1DZTA 1R63A 3O14A 2GRLA 3KJXA 2GAUA 3IWZA 2PUCA 2PUGA 4PJYA 4IETA 5JSOA 4XFIA 1NEQA 4UBHA 4PU3C 1LCCA 4QX5A 3S0MA 2IVGA 1V70A 2CAUA 5CADA 1PERL 4AVCA 1WIZA 3OTFA 1R69A 4QM9A 3U0ZA 1ZRDA 1GT0C 5J3UA 4OFGA 4I09A 1XRUA 5K98B 3KGZA 4I0BA 4D7SA 1BDIA 2CAVA 2UYBA 4Z5HA 4LTAA 2GC2A 3HT2A 2CV6A 3OP9A 1EPZA 4AQ6A 4KWKA 2LCVA 4YRDA 2PYTA 3NKTA 3WW2A 4LLOA 4XFCA 4X4FA 1ZAYA 3F51A 2XKOA 3FWEA 3KSCA 2ET7A 1UIJA 4N9IA 3L2HA 3EJKA 4I01A 3DKWA 3H1MA 2PQQA 1Y7YA 2UYAA 5BXXA 4H7LA 2QVSB 1CAVA 4X6RB 3OD0A 2PE5A 3BALA 2GH2A 3MZHA 3PVBB 2PIJA 5BY5A 4JQDA 2Q1ZB 3LFPA 5I91A 1ZZ6A 1UIKA 1IPJA 2Y0OA 3E97A 3L1PA 1LKNA 3NJZA 4IEXA 4IEPA 3RYRA 4FT8A 3BS3A 1CX4A 4XFHA 1RC6A 1CGPA 3ELNA 5HI0A 2D5VA 3EQEA 4XF1A 1XE7A 4FBFA 1TQ5A 2K9ZA 4YG7B 2IXKA 1ZVVA 3RNSA 3HQXA 3E6BA 3I59B 4EWEA 3R1FA 1RTVA 1WA4A 3DNVB 1CAWB 4I2OA 2FMYA 4WZCA 3OQMA 3O9XA 3OQOA 3H3ZA 4MV2A 4DINB 1X8MA 2QNKA 3MPBA 3I54A 4OB4A 3UKNA 4Z5DA 3GYDA 1YLLA 2I45A 1VP6A 4X4DA 4AXOA 2IVQA 4GULA 2IVBA 3BD1A 4XFFA 2KZ8A 4ZU5A 2XI8A 1O5LA 2BNOA 2EA7A 3RYKA 1NXMA 1B0NA 3S7IA 1CAUB 1PRUA 3NW4A 3RZZA 4JCXA 5BPXA 1QP7A 2BNMA 2VPVA 1Q5OA 3JXCL 4BYYA 1DGRA 1CQTA 2Q0AA 4HBNA 5FLIA 2MEZA 2MPFA 2XL9A 4HN0A 2OZJA 1E3OC 4JV4A 2O49A 1CJGA 1J3QA 3H7YA 1VJ2A 3IBMA 3LAGA 5KBFA 4Y42A 1LRHA 2ET1A 1WETA 3FZ3A 1YFXA 2Q30A 2H6BA 1H1MA 1ZS4A 1LQCA 1BDHA 1DGWA 5FLHA 1Y9QA 2HJIA 1SFNA 2ICTA 2EBYA 2VECA 1OFNA 4AVAA 2JVLA 2IXJA 1CAVB 2EVXA 4LA2A 5T3NA 5FCCA 1QQAA 1PM7A 2R1JL 4EWAA 1NERA 4O8BA 4IEWA 1QPZA 1LMB3 5CU1A 3BB6A 1YFWA 2CGPA 4XF3A 5A7LA 3ACLA 4P9GA 4ZU7A 2QCSB 2IV1A 1U12A 3CLPA 1UTXA 3SMHA 5CVRA 4I6TA 4PU8A 4ZU4A 1LB2A 2KEKA 1J3PA 4XF0A 1XWRA 3USSA 2IUOA 1Q43A 5I0RA 2HINA 4MCTA 4WVZA 1GQHA 3CL1A 3FE5A 4TLFA 1ZZCA 2D40A 5E16A 3S7EA 2QDRA 1LLIA 2GU9A 3B7HA 1LR5A 4HVQA 5JR7B 1XE8A 4YSFA 5J7MA 2XCJA 2AXZA 3BPZA 1DZRA 3FFQA 2EF8A 2O1QA 3HIFA 4META 4Z5CA 3LZZA 3LISA 2H8RA 2IXIA 4MZUA 2GC1A 1POUA 1WH8A 1RIOA 4MGKE 3PXPA 3OQNA 4NDWA 1O3RA 1QQBA 3H7JA 1UPIA 2QJVA 2LYRA 3TNQA 2GZWA 3ES4A 2PFWA 2B5HA 2IXCA 4MGIE 1ZZ9A 1WLTA 5KHGA 1ZRRA 1G6NA 1O3QA 1NYWA 5KHIA 4F7ZA 3D0SA 1OCTC 3KXAA 1O5UA 4MX3A 2D5HA 4R52A 3RPQA 3E6CC 1UCXA 3I7DA 1VPWA 4GHJA 2P17A 4ONUA 1YUDA 2PTMA 4PIXA 1JFSA 1UW8A 2PA7A 1PMIA 2H0VA 1ZVFA 4QGMA 4IA8A 1RZRA 2ETEA 5F1RA 4Z59A 4X4HA 2PAEA 1ZPQA 4KU8A 4X4EA 1GQGA 4X4IA 3ZDSA 4X4CA 5KHHA 5FQ0A 5EFUA 3E5XA 3H3UA 4HVRA 4UXAA 3SCFA 1DWKA 3NL1A 3GN5A 2PPXA 1SEFA 2B5AA 1CAXB 5I8SA 2IC1A 2XL7A 3G7DA 3H5TA 5LRRA 5I93A 2D93A 2MHFA 2KEJA 1SQ8A 3M70A 1YHFA 4QMAA 2MNGA 3E5UA 5AVPA 3U3WA 3H1WA 4MGYE 2O8QA 4I0AA 1NE6A 4QGNA 3CLCA 4WBBA 3LA2A 3WW4A 4YARA 3KGLA 4EWDA 2BEOA 3FJSA 2BNNA 2PUAA 4L11A 2BGCA 2KXLA 4YBAA 5LRSA 1PRAA 3FHIB 5I0UA 5FDBA 4BH9A 2DCTA 1JFTA 2LYKA 1PRVA 1J3RA 1J1LA 4LUMA 2XSDC 5D1IA 1X2LA 3CJXA 3EHKA 3E5QA 4QXKA 3OMTA 3ZHMA 1ADRA 2ZCWA 2XLGA 3MLFA 1ZNPA 5FPZA 2XGXA 2PAKA 4E2SA 3M3IA 2IXLA 2C0ZA 2Z2SB 4R8HA 1UD1A 5KHJA 4N9HA 4EV0A 4YYOA 4IESA 4X4BA 4KWLA 4IVZA 3CROL 4PU7A 2EAAA 1O7FA 3EO6A 1WH6A 1QP4A 4IEYA 5I0TA 4IEVA 2H6CA 4JTNA 1J58A 1X8EA 3LA3A 4NVPA 1EFAA 5K8SA 2AW6A 5E1RA 4LULA 4I02A 2WUSR 2OA2A 2O4AA 3QACA 2WC2A 2AXUA 3LWCA 2ICPA 1EP0A 3UFDA 2GRMA 3EUSA 3BCWA 4QM8A 1UXCA 4Q0SA 1ZZBA 2KPJA 3OCPA 5JCTA 1Y3TA 3H1YA 1ZRCA 1FT9A 3D82A 2LYQA 2UY8A 2PAMA 4AVBA 4CYDA 2AUWA 2Q4SA 2FJRA 3ETQA 3MDPA 2WIUB 2OFYA 4HVOA 4XETA 2PHLA 3H8UA 4IERA 3WW1A 1YSEA 1RZSA 1WGPA 4MH0E 1YFYA 1ZZ8A 2XJ3A 4E2QA 1ZX5A 2LYPA 3TNPB 2K0GA 4D7TA 3QWGA 4EROA 2JCGA 4JCYA 1YFUA 3SHRA 1RUOA 1QWRA 4KL1A 2ATFA 4IWRA 5BV6A 5EZWA 2HSGA 2CSFA 3SCGA 3QF3A 4Z07A 3ROUA 2LYJA 4RD7A 5FPXA 3SCHA 2AXVA 5BUVA 3I59A 5C8WA 4PIYA 2O38A 3KZ3A 4XEZA 1CAWA 4PU4C 2GZUA 1X57A 4YNIA 2AWIA 1L3JA 3JXDL 2KEIA 2XLAA 3PLQA 4MCXA 4Q0PA 4X4GA 1JWLA 3KCCA 3U10A 4I3PA 4Q0QA 3PNAA 3EBRA 5LEJA 3GBFA 4FN3A 5FLJA 3WW3A 4IEUA 4AQ2A 4BHPA 1RL3A 1ZUGA 3IDBB 4I6UA 3BDNA 1OMIA 3B02A 4BIFA 1Q3EA 2V09A 3HT1A 4QGLA 1CAUA 4XFAA 2MQKA 3G5GA 2XIUA 5C6CA 5JAXA 1QY4A 3HZIB 1OSLA 1IPKA 2OPKA 2OR1L 1I6XA 3S8QA 2CROA 2UY9A 3RYPA 4JTOA 4ORFA 5JSPA 4XF4A 4LUKA 2EWTA 1FXZA 3C3VA 4LEJA 4LA3A 3TRBA 2PUBA 1VR3A 3IIAA 3OF1A 3ST7A 1RGSA 2L49A 1O3TA 2WFPA 2PUEA 4YG4A 2ZKLA 3IVPA 4HSJA 2A6CA 1OD5A 1SQ4A 3RDIA 1LCDA 1X7NA 2B9UA 4O9EA 3CECA 4HN1A 4KWJA 3QQ6A 3SXWA 4GQMA 1I5ZA 1ZZ7A 2D5FA 4I8TA 2F4PA 4HSLA 3FYAA 4IEQA 3LA7A 2OYZA 3DL3A 3BU7A 1RZRD 3UKTA 1J59A 1QXJA 4HZFA 1IC8A 3JXBC 1AU7A 2LYLA 3FYMA 3UKVA 1S7EA 5LEKA 2B8MA 1UXDA 2PHDA 2XKPA 2N7GA 3KMHA 1H1IA 4O9GA 5I8YA 2HKXA 3ZKCA 3H9AA 4PIZA 3ZHIA 2IU7A 2VQAA 4FBIA 1YWKA 4L2NA 1ZREA 3LOIA 4YG1A 4MGZE 5I8TA 3OGJA 4XFGA 4XFBA 1X82A 4HMZA 1RUNA 3QYXA 4J1XA 2PUFA 2BYVE 5KHKA 4I6RA 1JH9A
chains in the Genus database with same CATH superfamily
1RUC3 1JUIA 3N9OA 4Q8KA 3SC7X 5L7OB 5FZ7A 1O4XA 1ZRFA 3F6WA 1U5YA 4XF9A 5FQ0B 3K4ZA 5JSRA 1AR63 1AYN3 5JMOA 3E6DA 1W05A 4JGYA 2DUOA 3M3CA 4B1LA 3C7HA 4GMP1 2XHKA 1W6PA 4G3YC 4E2GA 1QJZA 3GN5B 4LK6A 1GLHA 2DUPA 3OSDA 3P1IA 4YW2A 3A23A 5FP9A 1B35C 2JX9A 2WNVA 1BZWA 2WT0A 4Q29A 5JIUA 2P4EA 4TLGA 2YPJA 5A33B 1VMJA 1GANA 5IFPA 4K20A 2IXHA 4XPVA 3MUY1 1JXNA 4RGKA 5FWEA 1CZVA 1V6JA 4F8AA 2Z69A 2A5ZA 5FYMA 4AHXA 5JUVA 1HRV2 1JUHA 2WA3A 2YY1A 1AR93 1YC61 2W5FA 4MGQA 5K4LA 3TEPA 2X53S 1Z0HA 4LBNA 3F52A 4Q4X2 3UJQA 2L8NA 1AYM1 3H50A 3MICA 4QT6A 3GHNA 3NSTA 3W9AA 2LYSA 1AHSA 2ZMNA 1DW9A 2ZABA 2XJTA 3NWKA 1WD3A 3CF6E 2BPA2 2ZX1A 4ASKA 4J1WA 1EYBA 2VU9A 3N7MA 3WQ1A 3BOPA 4A2UA 1LAJA 1EV13 2RM22 2YROA 3FX3A 1EY2A 2LUWA 4HKOA 3AJYA 2A3WA 3ZPYA 5FOJB 2VQUA 2E32A 3ZLIA 3MIBA 3N4MA 1WW7A 3ZN4A 3PE5A 2HWC3 2GC0A 2VTFA 5EJZB 4JGYC 2DCYA 4UF0B 2PUGA 1YQ5A 2R062 2VZUA 2IFWA 1IG3A 4LLFA 4NE9A 4UT5A 5FPVA 4E4HA 4XFIA 1NEQA 1NA1A 2WNVC 5GJ6A 4AWDA 4L8QA 2EIDA 1V70A 2RMU2 4XBLA 5CADA 3T2TA 1UKGA 2MEV1 5F8PA 4QKDA 2D6LX 4CUBA 1Q8PA 4QKNA 2PHUA 4OULA 3RMYA 5HCAA 2LRPA 5FPLA 3O0VA 3WR0A 3JU9A 5C5TA 3HBZA 4LIVA 4JHZA 2CAVA 2VY0A 4XXPA 5C9AC 2VE1A 3NMBA 1JOPA 3LQXA 1PIV3 1V6LA 3MIHA 1N1VA 4ZS2A 5FO7B 2Q8EA 3HT2A 2NMOA 2W1SA 1AL22 3THDA 3J8F3 4K7JA 3OWQA 1ASJ1 4AFCA 3CZUA 4M4PA 3WP6A 3ZXDA 1WBFA 2PYTA 1QF3A 2R32A 2HWF1 1ZAYA 4LJHA 2R1DA 1NLSA 2XKOA 3KSCA 1E5HA 3N36A 5FY7A 2WAAA 2EICA 2ET7A 1UIJA 3AZYA 3BVCA 1BKZA 3GBGA 1G9CA 3TELA 3ZXKA 4I01A 3DKWA 3H1MA 1KXGA 4LR4A 3FLTA 1RITA 1AR71 1Y7YA 1POV3 2UYAA 1XBFA 3B9CA 1S0DA 3D8CA 2JE8A 5GM0A 4QB2A 3IMNA 1NA1C 1NG0A 2B9VA 2PE5A 3OD0A 3BALA 4ARYA 5C9AB 2QDNA 5T55A 2QQLA 3VKMA 2E51A 2PIJA 3WNMA 4BXSV 5BY5A 3LFPA 1BMV1 1ZZ6A 4IXLA 1W6MA 2GNMA 2Y6JA 4LQRA 4FQ4A 1ZBE1 2AYHA 1RUI1 4IEXA 5DDJ1 4CPBA 3RYRA 3AL5A 1CESA 1DGLA 1UO9A 3IT8A 4XFHA 3QOWA 4XZUG 1O8PA 1QZXA 1JW6A 1DP0A 2R16A 2FHRA 1TQ5A 3MEPA 5FZCA 5J09A 4YG7B 1ZVVA 3ACHA 3I59B 3L9JT 2J42A 4EWEA 5F2WA 3DNVB 4WZCA 3WDTA 2NQYA 1GR3A 4RL7A 3ZSKA 5A32A 1ULCA 1PZ9A 2ARBA 3NV3A 4FPKA 1X8MA 1NAEA 2OKXA 3I54A 1YYNA 4Z5DA 2A6WA 2R7EB 3GYDA 4RS5B 2I45A 2XUMA 1VP6A 1RMU2 4KGQA 1TME1 2IVQA 4KMQA 3O1UA 2Y6LA 4Y1XA 1OVSA 3BD1A 1VBA3 4LNVA 2RS12 2ZBJA 2XI8A 1O5LA 4CUCA 4OHZA 1V6IA 1NXD1 3RYKA 5JOZA 2WLPA 1NXMA 3PUQA 3AC0A 2VOVA 2R073 3KT1A 4LHSA 3VBFB 3WVJA 4AVSA 3TEZA 1BQPA 3LPGA 3OJBA 3OYWA 4XMAA 3S57A 5KXEA 4WV8A 2Q5TA 1QP7A 4Q27A 4AL9A 3JXCL 2YUEA 4KWUA 2ZEXA 3HWJA 2MPFA 2XL9A 2W1QA 2LLWA 5FLIA 2ZKNA 5LK7B 2O49A 1J3QA 2FCUA 3H7YA 1VJ2A 1XSRA 2XXZA 1SBEA 2WO3A 1W6OB 4GAZA 4XIKA 2E7AA 1GZ9A 4F3JA 1YFXA 1CJPA 3GGLA 5A6ZA 1H1MA 1ZS4A 4GALA 1JYIA 1MPXA 1NX9A 4R4XA 2XBO3 5FLHA 3QCWA 1Y9QA 2CWSA 2HLEA 5I0DA 1JYNA 4X8PA 3ZDVA 4XJZA 4NHXA 2EVXA 4DE9A 1QXPA 1ZM1A 2X8KA 3ACFA 3LSEA 4QPIB 5FCCA 5F5QA 3AKTA 2R1JL 4MADA 1R083 1LMB3 3C2UA 4XACA 4ASMB 3WQBA 2FDHA 2YYOA 1DZQA 2XJUA 4KG8A 2C24A 1TNRA 5EIYB 3URFA 2YHJA 1EAH1 5HPOA 3SMHA 2UURA 1NQJA 4PU8A 1QQP3 1LB2A 3POGA 2EXKA 3T2PA 3TEYA 1D4M2 1Q43A 2YBDA 1LOAA 4GH4B 4MCTA 2X5IA 5I0RA 3CL1A 4K1ZA 4KBZA 2KA3A 3BGAA 1FV3A 5ANNA 5C8CB 2XXQA 2IZWA 4ZONA 3D6EA 1WMEA 1TMF1 1LR5A 1FPN1 3ZXJA 4LHLA 4CCCA 1XE8A 3ZR5A 5DMYA 2ZX3A 1YJLA 2AXZA 1JH5A 3EYPA 1GV9A 1ENQA 2QQOA 2BOJA 3PVEA 5DUVA 4C90A 2YFUA 3LISA 3OUJA 5G04L 3POBA 1NLQA 2ZGMA 3V0AB 4QX7A 2XQRA 5FWJA 1SLIA 1W9SA 3H0OA 3NO8A 3WG3A 2J22A 1WH8A 1RIOA 5KXCA 2BP6A 2WO1A 3E1F1 3DUIA 2RR12 4NDWA 2VVEA 1QQBA 1UPIA 3KB5A 4XJ9A 1ND2C 1OUSA 2QJVA 4JGZA 2Z42A 4YG6A 5FRAA 3S5QA 3T09A 2PXTA 3UL2A 5FZGA 3VBSA 4B7EA 1SCRA 3IDAA 4UOJA 1ENXA 1UL9A 4ZY9A 2YZ4A 3LIGA 5A3LA 5KHGA 1G6NA 1NYWA 4SLIA 1RUH2 3BYWA 2AZ5A 4UFIA 4OUMA 4XIOA 3EB7A 4MX3A 4R52A 3ZN5A 2LW8A 4NJ4A 1AX1A 2HEVF 3MIDA 3ORJA 2X5IC 1UCXA 1UOGA 2VNGA 1VPWA 1VBC3 4QD2A 2PTMA 3MUZ1 4LXLA 1RZRA 4Z59A 4X4HA 1TZOA 3NNJA 3HPNA 3PTRB 4KU8A 4NWVA 4OVEA 1K5MA 4QU1A 2FCTA 5IAXA 2VJXA 1ND2B 3KV4A 4XBQA 2A3XA 4Y26A 4YWAA 3ZDSA 2PXQA 1L7LA 1OQDA 5ISLA 1L7RA 5CIRA 3E5XA 5EFUA 5FZHA 4HVRA 4JC1A 1OLQA 2Q8OA 4UXAA 4CU6A 2V3CC 4BDVB 4DUXA 3ZSMA 2B5AA 4A7YA 2A6VA 1AUYA 1CAXB 1UPSA 1PX4A 4L9BA 4JGZC 4LO4B 4M0HA 5A7NA 4G9SB 4A3XA 4QXCA 3VBSC 5FP4A 2XL7A 5A1LA 3AJZA 3IN9A 2VGDA 5A7OA 5ABJA 5DUXA 1HRV3 4AI8A 4QPGB 3T3YA 3M70A 3ZXGA 1Q8VA 5J36A 4BQXA 3M3OA 4AGVA 1OH4A 2RS52 4Q4X3 2VNRA 5JXHA 3H1WA 4MHUA 4FOQA 1C5IA 3VKLA 2QFEA 4YG3A 1IS6A 3AYAA 1RXFA 3JUUA 2RM23 3KGLA 3MV11 1UOJA 2P6CA 3AP9A 3QLQA 2VCAA 4QQHA 3SEPA 3FJSA 2BNNA 2JQEA 5IUQA 4D6SA 1K5MC 5I0UA 4IGPA 4IE0A 1J3RA 2BVBA 1J1LA 4N43A 4DE8A 1X2LA 4JDOA 2Y8KA 3E5QA 1LOBA 5DTQA 5DUWA 4EN6B 1OH3A 2JENA 3OMTA 2P5BA 1ADRA 2ZCWA 1QU0A 3EXUA 3MLFA 4QXKA 5FZOB 5LASA 5FY9A 2O14A 5F3GA 5GZEA 2KM2A 4CEWA 4CP1A 1OXCA 1T2XA 2P37A 4N9HA 3WQ0A 4IESA 4XJAA 2Q8DA 1PO23 3LCPA 4JQRA 1RVF1 3GF6A 1DQ0A 4LOTA 5ABJC 5GZCA 4IE7A 4IVZA 3UWPA 3SEEA 1N3PA 4A7KA 2EAAA 3WSOA 1K5MB 5F2SA 3EO6A 4N8MA 1WH6A 2TNFA 4CCMA 4F83A 4ER5A 1QP4A 2VZRA 1AL23 3B9IA 1JU3A 2VCCA 3QD6A 4IEYA 4IEVA 5DPNA 3AYCA 4RHV1 3LB9A 1J58A 3LA3A 4H7MA 2JDYA 1S2KA 2OIIA 3U07A 4A4AA 4YGBA 1NT0A 2J1RA 2R041 2XWBB 5T5PA 1MEC2 1DG6A 1VBD2 2A7AA 2HBTA 1WZXA 4LULA 4WVVA 4XILA 5E89A 3O1MA 5FZ1A 2ZHNA 3M3EA 1I9RA 4P9YA 2ICPA 1AXYA 3B01A 1EP0A 3TB0A 5DG2A 1VBE1 2BJSA 1AF9A 2PHXA 4GWJA 4QM8A 1H2KA 1X9PA 4Q0SA 3FHAA 2FDFA 5IT6A 1ZZBA 4N43C 2KPJA 4Q26A 3AYDA 1NY71 5GAHi 4B3NA 2LYQA 4Q4V2 3I2DA 2AUWA 1W0NA 1NCQA 3BUCA 3ETQA 2H0BA 3KHBA 4CEWC 3TN92 5C71A 2DTWA 3WDWA 5JOYA 1RB8G 5IAVA 2PHLA 1YSEA 2ZXQA 1DGWX 1GP6A 4CCKA 1ZZ8A 2XJ3A 1G8WA 1ULDA 5GLTA 1AX0A 4DNYA 4E2QA 1QEXA 5FZBA 5LA1A 3TNPB 1JYTA 1NOVA 2CGNA 4P9XA 4ER3A 2HWE1 4EKGA 1YFUA 1V9U2 5F3IA 5G05L 5H9QA 4Y1VA 5HXVA 2CNAA 4CDXA 2I07B 1URXA 2QQUA 4CCOA 3SCGA 2C1FA 2TBVA 2D98A 2LYJA 5DAPA 4N43B 3IAPA 3ZO0B 1I1EA 1F8VA 2CSGA 2O38A 1SBFA 2JKXA 2W91A 4XEZA 4Y20A 1CAWA 4PU4C 2ZX4A 1TE1B 5FZ3A 1Q8QA 1W8UA 4MCXA 4GXLA 4CEWB 3ALQA 3D5OA 2AEZA 2WAOA 3AZWA 3HOBA 3VDDA 3PDQA 3W5NA 2Z79A 2SLIA 2WYFA 4P00B 2D6KA 5LEJA 3RZKA 2RS13 4MYEA 4PHZA 4IEUA 5ACA1 1NCQC 5FJKA 1VALA 3IDBB 2XJSA 1OC1A 2XOMA 1UX7A 3BDNA 3IIIA 4PBOA 3WLUA 3ZN6B 2WINB 4QGLA 4BIFA 2PXUA 4W6XA 5DRTA 1GWKA 2WWJA 5A70A 5JR2A 5JAXA 4HPKB 4NRQA 5FYBA 1WCDJ 3HZIB 1IPKA 3K3NA 4QQLA 1ACCA 2OPWA 3ZYJB 3K46A 4YW1A 2UY9A 3MPPG 2BU9A 4PF1A 4CDXC 1NCRB 2E26A 1HRI1 4LK7A 1G7YA 3J9SA 4XCAA 3WF0A 3HNBM 4I30A 2RE9A 3M8LA 3MLLA 4KGGA 4UYBA 1W0OA 1WMDA 3IIAA 4GB31 3ST7A 5IK4A 1CX1A 2JIGA 3I2KA 4W50A 1NCQB 3K77A 3OD4A 1VMHA 4YVWB 5IK7A 2W92A 2PUEA 1W8FA 2ZKLA 5FK7A 5FPAA 2ZZQA 3GZTB 4YZ2A 4AI2A 3IVPA 3VDDC 3AP6A 2ZMKA 4G4FA 1XYNA 4Q2JA 5F5CA 3VZLA 3ZYPA 1OD3A 1X7NA 4ZXEA 3CECA 4L0PA 3QQ6A 4OMDA 3SXWA 3EMRA 4O7XA 4W8JA 4KG0A 2FDIA 2D5FA 3C7FA 1QJX1 3IPVB 5E6HA 3S6PA 1RZRD 4XMIA 3FBMA 1OA2A 1F4AA 1QXJA 5A1AA 5LA2A 2JIJA 4NPMA 3VWSA 4HZFA 1IC8A 2FDKA 2ZGLA 3FYMA 3MW4A 5FO8B 3UKVA 1S7EA 5LEKA 3LF7A 1EV11 5F7UA 4K40A 2AEYA 3M4FA 4YZ4A 4MOAA 4Q5OA 2WUHA 1BXHA 4AFAA 1Y7BA 3WNNA 4O9GA 2KR2A 4NUBA 1POV0 2RS32 3AL6A 4NOTA 3S5AA 3LOIA 3OGJA 4XFGA 1YQ2A 3KV6A 3CJIA 1QJU1 3WG1A 2QZ2A 4JDNA 1RJ8A 2WR9A 3IMMA 2VMHA 5FY4A 2YPDA 3LFMA 5FZIA 3OPZA 5F6KA 5A3NA 2O0OA 4Y4YA 4LT5A 5CG8A 4FTBA 2VTXJ 1R1ZA 3DYOA 3LIHA 4QHBA 1DQ4A 1S1AA 1MR5A 1MS4A 1OOPA 1QXRA 4MSVA 3JCIA 1PIV1 4LITA 2GC3A 3OGSA 5GZDA 3LSDA 1SHWB 2AGSA 3OGGA 4D69A 2GN3A 3J8F1 2R63A 4OLLA 2VUDA 1HQLA 2MXDA 2VVDA 4TWTA 3VK0A 1RXGA 5C33A 1EPWA 1QDCA 1STMA 1XB9A 2C9KA 4IE4A 5I0SA 2OZ6A 4F8DA 3I3EA 2RJKA 3V64A 4PLOA 3GCXA 3BOWA 1BJQA 3ZXEA 2GDFA 2W39A 2PLV3 5F3EA 3VBOA 3CEWA 4DY3A 3A4UA 3U11A 1HW5A 1LGCA 3KL4A 4CE8A 1K5JA 1FNZA 1FI2A 1POV1 4P5HA 3NAPB 3GNEA 3POYA 2EXHA 1S0JA 3CJIC 3KS7A 1AL0G 2R0HA 3DN7A 2NPIA 3WZ1A 2ZGNA 4KBBA 2A1XA 4RYDA 5KC6A 5IVCA 4Q4W1 3O0XA 3U14A 3AX4A 2UU8A 2RV9A 1OOPC 1FYUA 4K3UA 4Y1UA 3O14A 3WHUA 2GAUA 2HWD2 1C8M3 3CHXA 2PUCA 1LGBA 5JSOA 3NNFA 4IETA 3VL8A 1SCSA 1A34A 4LBJA 2J1UA 4UBHA 2WYSA 3P3NA 1GU3A 5EYYA 2IVGA 4AQSA 2ZGKA 4INDA 4AVCA 1UY3A 1WIZA 1OUXA 2W52A 2VZSA 2WWSA 2YC0A 3OTFA 5FUPA 1SLAA 4AHYA 5CAZA 5J3UA 1XRUA 3U0ZA 2JDNA 5T50A 3F2ZA 4LO6B 3ILNA 1BBT1 1OHFA 5A6YA 3OY8A 3VBOC 4U36A 2PXJA 1VBB2 1LODA 4LBKA 2UYBA 4Z5HA 4XE9A 4CDQA 4COYA 2EALA 1BHGA 2GNTA 2CV6A 5C4WA 4FSJA 1EPZA 2V72A 4HANA 2RJ2A 2WT1A 1OOPB 2AH2A 3MI8A 4LOSA 4AQ6A 3K48A 2A6XA 2R071 1PVC1 2VOWA 1W6NA 4IGQA 5AC91 4CDWA 3SQOA 3WW2A 4LLOA 4OI0A 3HQRA 3L2YA 5B4NA 2GP3A 3FWEA 4DUWA 4UW4A 5FY1A 1W39A 1GYKA 3KLSA 1S2EA 4P02B 4XHXA 5BNPB 3WDUA 2PQQA 1O4YA 4AEDA 5JOWA 1GNYA 5BXXA 3AZVA 4H7LA 4AFBA 2QVSB 5J37A 4GKXA 4Y1YA 2VR4A 2XBO1 2QZ3A 5FIXA 2GH2A 3A0KA 4I3GA 3ZMOA 4BU2A 3PVBB 3MZHA 1Y4WA 1UNBA 2WL1A 3WCRA 1VBD3 1UIKA 2WDBA 2JG9B 4JRLA 1PGW1 4XJUA 5LA0A 1QGLA 1HXS2 1OKQA 1KFUL 1R081 3LDKA 3JD71 1W2UA 1NW3A 2L1PA 1CX4A 1MACA 4FQZA 2ZGTA 4LPLA 4DRRA 5HXMA 4CP0A 4CDQC 5HI0A 5C4WC 4Q4V3 4JHTA 2IXKA 1E5RA 1Y43B 1QQP1 2V4VA 3FLRA 1MQTA 1SFYA 3GCWA 3FFZA 2QUOA 2P2KA 2RG4A 3R1FA 1RTVA 2YDEA 2ARXA 3MBWA 3MHZA 5HCFA 4CXYA 3C7OA 3PVOA 3O9XA 3TN93 4CDWC 1LULA 3VD9A 2ZEZA 4AAXA 1JHJA 1JZ2A 1MFQC 2WNOA 1RJ7A 1WMFA 2WO7A 4GD4A 4P5YA 4JKMA 2JD4A 4X4DA 2W1WA 4AEDC 3DM5A 3ACGA 1H8VA 2B42B 2IVBA 4XFFA 2KZ8A 4V1PA 4ZU5A 1JZ3A 2BNOA 1SLCA 2VOTA 2EA7A 5F9TA 2ZJCA 1CAUB 2HEYF 3RZJA 4IQPA 1W9FA 3T4VA 4LKEA 1UU6A 2PXFA 1RUG3 2WSVA 4DXSA 1FAYA 2WZR1 4CDUB 5D8AC 3WHTA 1GOGA 2Q0AA 2ZZJA 1W9WA 1UY4A 2E7TA 4HN0A 2OZJA 1E3OC 4NAMA 3IBMA 3LAGA 2Y38A 3VZMA 4LHKA 4HL0A 1LHVA 1SFPA 2ZX2A 4N53B 5ERLA 2ET1A 3PL0A 1UZYA 1WD4A 1MQTC 4CCEA 2IUWA 1R093 1F5JA 4AEDB 1AR83 4Q4Y1 4WM8A 2PXPA 2WFF3 4B8EA 3DPRA 4LA2A 5T3NA 5F3CA 5F5IA 1UYXA 1JZ5A 1QQAA 1LJ7A 1AYM2 4O65A 1W04A 3POFA 4EWAA 3AKQA 4O8BA 4M3CA 4IEWA 4QX2A 1QPZA 1JTZX 3LDRA 4NIAA 5FPUA 5CU1A 2Y34A 3I2JA 2CGPA 2FDJA 1D2QA 1SG3A 1LU1A 3ACLA 3PHMA 4WVWA 5FZ9A 4ASLA 2QCSB 5T52A 3N9MA 5D8AB 1YI7A 4COUA 5KC5A 4DZGA 2RJLA 3OPTA 2JEMA 1RUF1 2KEKA 1MS1A 4XHBA 3VHPA 3ZFFA 1XWRA 1LECA 1V0AA 2VC9A 5L9BA 1B35B 4WVZA 1HQNA 2KD7A 3FE5A 4B1MA 5FMOL 3NQHA 3WF1A 4UFHA 4NPLA 1CONA 4JAAA 1H6YA 2BWCA 4URAA 2YC4A 2D44A 1KDMA 1YJKA 1D0HA 1HLCA 4EQZA 4A3ZA 3T0AA 2CHHA 4TN7A 1PO13 5JR7B 4HVQA 2MEV2 4YSFA 5J7MA 1GFF2 2NP0A 4C1XA 1CPNA 5FOBB 1DZRA 4WVMA 2EF8A 5EWSA 3HIFA 4META 3LZZA 4PT6A 4BK4A 1PNGA 4WM8C 2H8RA 4BWOA 2IXIA 2CL2A 3BN6A 1H9WA 1F4HA 3DPRC 2YGMA 4MZUA 2PHFA 3PXPA 3LEGA 1JYCA 2DVAA 1O3RA 2XVKA 2W2IA 3ME5A 4AAPA 1FV2A 5T5OA 4D7YA 2LYRA 1ASJ2 2GZWA 2WSUA 3ES4A 1QOSA 3I4IA 4AR2A 5A6QA 3BKZA 4Y5TA 2V5YA 3K75B 2HWF2 1HB4A 1WLTA 5CBLA 1ONAA 4QB6A 4JGYB 2RS33 4WM7A 3HNMA 2W46A 4YVSA 3D0SA 4AI3A 4F7ZA 2K2SA 1H4HA 1W6PB 4KI5M 3ZFFC 2D5HA 3U4XA 1MZFA 4IV3A 5HV0A 3HJRA 3LDBA 3RPQA 3C7EA 3UGHA 2WNVB 3I7DA 1AR72 3ZSJA 5DTMA 2HYKA 4AOCA 1EUUA 4EZ4A 3QH7A 5T54A 3W5MA 1TEIA 1YUDA 2YU1A 3J7NA 4YPJA 3ILFA 1PMIA 3MF9A 2PELA 5FMBA 2PAEA 2VUCA 1ZBA1 2VMGA 1UAIA 2K46A 2VUAA 4QPYA 4W6YA 1BMV2 3POSA 4NRPA 1PO21 1W8NA 5T5JA 1US3A 4X4EA 1RHI3 1VB4A 1ZBE2 4W65A 4X4CA 3AMPA 5KHHA 1RUI2 5DDJ2 2XB6C 4ISRA 3MGUA 1W90A 2DUQA 4ES8A 2YFZA 4QX0A 1M06G 3K4DA 4GJYA 4BQYA 2B39A 4PDWA 1IHMA 2EXJA 5JI7A 4OI4A 3ZFFB 4Z1VA 1U5ZA 3OKZA 1J83A 1HQ1A 1H8TA 1O6UA 4PF5A 5C3SA 2E31A 1Q8SA 5IVYA 4R9DA 3G7DA 1OFSA 4XUQA 4HONA 3WP5A 5F37A 3H5TA 1LHWA 2WT2A 4QKFA 5LRRA 4PQ9A 2ADEA 2MHFA 4WM7C 1W3XA 1SQ8A 1OPMA 4YVSC 2VXJA 4GIQA 1GOFA 2CGOA 1YHFA 2VMFA 3E5UA 1YO8A 5JXIA 3TFLA 4IV3C 2VNVA 1NA1B 1W2AX 5FMOS 1JZ6A 1TME2 5FY5A 2WQ4A 1NE6A 1AJKA 4QGNA 4WVMB 4DXRA 5JLVA 1VPHA 4WBBA 4CXXA 1J1TA 3BTAA 2WNEA 3M3QA 1JYXA 2D7FA 2YGLA 4NIIA 2QQPA 4Q8LA 3VBHA 4EWDA 5FYTA 3IDEA 3TAYA 5KR7A 2PUAA 2A6ZA 3BODA 2W68A 4L11A 4LMFA 4YBAA 2TUNA 4QDRA 1UY2A 2BDRA 2RVAA 3CKHA 3VD7A 5LRSA 5FZ4A 1JFTA 3ILRA 2ZEYA 2WWUA 1PRVA 2HWD3 2P3IA 2J7UA 5D1IA 2D6MA 3CJXA 3ZR6A 4WM7B 2B45X 4PDWC 4Z2AA 1RUE3 4KQ7A 1YIFA 1DYOA 4S2FA 4E2SA 1W0PA 4UI9L 2F17A 3M2MA 2BGPA 1QNYA 1H8TC 2Z2SB 5A7WA 1BLZA 4ZZ5A 5KHJA 1HB2A 3FC0A 4RQPA 5FPBA 1T6GC 3JB8A 4KWLA 3VKNA 3GJAA 4CUAA 3WOGA 2ZPXA 3KF5A 1VBB3 2VZPA 3CROL 4QX8A 1O7FA 3R4SA 2HWB3 4K9SA 1IS4A 2BV4A 4AI0A 3AB0A 1UYZA 4QDSA 2H6CA 1EAH2 1DFQA 2F6BA 5DZFA 5IVJA 4JTNA 4MXVA 1V00A 1R1A3 1X8EA 3PURA 1CIYA 3ABZA 5SV5A 3TEXA 1W6MB 3VBHC 2NN8A 2WQZC 5A3UA 3ITQA 5E1RA 5FXWA 4ER6A 1OSGA 1SZBA 4PDWB 4AYUA 2WUSR 1WWYA 3GZEA 4FPOB 3QACA 4E8CA 3GHMA 4QX3A 3DXUA 1A8MA 3ETPA 2CDOA 5JXGA 2GRMA 1S0FA 4FPYA 4LHNA 4ES9A 1UXCA 1COV1 5A6XA 3WNOA 1VRH1 3I8TA 3OCPA 1TMF2 4BMEA 1UZVA 2QQIA 1FPN2 1RUJ1 4EE2A 3D82A 4CYDA 4NHLA 5LZ6A 2Q4SA 2XWJB 3DYPA 4AHWA 2R49A 5A32B 3WQ7A 1DBNA 1N1YA 2QKDA 4OCTA 2XJRA 2WIUB 4HVOA 4Y24A 3DGTA 1IS3A 3WW1A 5FYVA 1PGL1 1HXS3 1WGPA 5CKNA 3PJYA 4RQPC 3USUA 1RIRA 3CZJA 4LBOA 2ZGQA 3VBHB 3QFIA 4BPZA 4BQ3A 3VZJA 4YFWA 3V56A 4EROA 1S2BA 3SHRA 3O1TA 4IWRA 2Y33A 5EZWA 2HSGA 5FBJA 3WUCA 1QHDA 2ZGRA 3QF3A 4QX1A 3OYWB 3PUSA 5FPXA 4RD7A 1OA3A 1JN2P 2WS91 3MLJA 4PIYA 1IZ3A 2RDSA 5C8WA 2CU5A 1X57A 3AYEA 4H55A 3MO4A 4A6OA 4BLIA 3JXDL 2KEIA 3HQUA 2P6HA 1PVXA 3PLQA 3JBG1 2OX0A 1QDOA 4Q0PA 4X4GA 5CEHA 4JZRA 4Q0QA 3QH6A 2BWAA 5DTRA 1Z7S2 2W0XA 3G0TA 4QB1A 1HDKA 2WJSA 2VMDA 4OMCA 4FN3A 3HR9A 5FLJA 3ZFEA 3NDBB 5BNOA 4AQ2A 1QJY3 1ZUGA 5H9PA 4I6UA 1Z7S1 2G19A 1LESA 4ZPIA 1OMIA 1UXXX 4FFGA 2V09A 3KHCA 2DU0A 1YIPA 4NR1A 1A3KA 1K45A 3VDAA 3UGGA 3O1OA 1OSLA 2PN5A 2OR1L 4KH9A 2B4KA 1I6XA 4EN9B 2CROA 4LBQA 5F5AA 2Y6GA 5JVVA 1FATA 3RYPA 4LBLA 4JTOA 4YGEA 3AFGA 4XF4A 1JS9A 4PLMA 2Y6FA 5F6LB 5CFDA 1FXZA 5FJHA 3C3VA 2X5IB 1W8TA 3TRBA 1VR3A 4HT1T 4YW6A 4DEVA 4HOOA 3V0BA 1VAMA 1AYM3 2L49A 1RINA 4XTPA 1OQEA 4OQ8A 1C28A 1T6BX 4YG4A 1IOAA 3OGVA 4EYUA 1R64A 4AW7A 1UX6A 2E33A 2ID4A 3ZPOA 2B9UA 1N3QA 2VZ3A 4KWJA 1WKYA 4AVTA 3ZVXA 4DMIA 2FDGA 2R30A 4N90A 1I5ZA 1ZZ7A 3AFKA 4HSLA 4B4QA 4MGTA 3FYAA 3LA7A 5LWBA 2Y64A 1DDLA 2OQ7A 3UKTA 4AGRA 3RZLA 2HFZA 4FXKB 4AG4A 5B2GB 1W9YA 5FZAA 4QHZA 5CZKA 2CY6A 1AU7A 2ZHLA 3HN1A 4JGZB 1GICA 3AMNA 1WLCA 1REFA 5FMCA 1BVP1 1VRBA 3VBSB 2PHDA 4FPFA 4XUNA 4EN7B 5BNQA 2GP5A 4IDZA 2R063 2N7GA 2XKPA 4ZZ8A 5KWRA 5F39A 5DXDA 1C3HA 1H1IA 3PUAA 2OS2A 5IHRA 1MZ5A 3KZ4C 3ZKCA 4PIZA 4RR3A 4CPBD 1ND3A 2RMU3 1RVF2 3IAQA 3MFCA 3UK9A 1C8M1 2VQAA 2PHRA 4A45A 5CFDC 4L2NA 3T1LA 4YG1A 2RDNA 2P3KA 1OQ1A 4MGSA 4XFBA 3CIHA 2FFHA 3Q9OA 4AHZA 4J1XA 4QU2A 4D94A 1XPWA 3GALA 4RHV2 2VCBA 4JKKA 1MZEA 2VUJA 4C91A 2FZ2A 3FMGA 5DABA 2YC2A 2R042 2HWF3 2ZGPA 5EQUA 2PXDA 3D0JA 4MUVA 1NKGA 2J1SA 3LPFA 5EYXA 4FAGA 3H8XA 3D1NI 1LENA 1TNFA 2A3YA 2Q1FA 3SISA 3N9QA 4PCRA 3B3QE 2WRAA 2WIIB 1VBE2 3RJ2X 2JG8A 2R0FA 1AR73 1CZTA 1NZCA 2G4IA 3WY6A 1AVBA 2BJCA 4XDQA 2WZPP 3T1MA 4YZ5A 1NY72 2EIGA 5CFDB 1NE4A 5FXZA 2PXEA 1F31A 3N7KA 5FYYA 1CPMA 1H6XA 3WNXA 5ABJB 4DFSA 1K42A 1FNYA 3CO2A 3VHNA 4Z58A 4RR3C 4FAHA 4HLTA 1L1MA 1ND3C 1SPPA 1RUI3 2D3PA 3JZVA 3N7JA 3IDCB 5DDJ3 4S2HA 3KD4A 3ATGA 3RMXA 4CU8A 4IEOA 1QP0A 2CWMA 3OEAA 4PI2A 3A0NA 2HWE2 3ES1A 1RUD1 1UZWA 1AXZA 2QTWB 5K7PA 2E7QA 3KT7A 3OBAA 3LEIA 4ATEA 5J48A 3MIGA 3A9YA 1ULOA 3WNLA 4AZZA 5C3OA 2G9ZA 1JZ4A 3CBNA 4AK3A 3FMYA 1O91A 4JVAA 2JECA 5GAGi 2NYYA 2E9QA 2FQPA 1YCIA 4QQ2A 3WP4A 1DZTA 1R63A 4PQQA 3IWZA 4COVA 2BGOA 3F95A 2JG8C 2LROA 1TME3 3R05A 2PHTA 3HAGA 4FPGA 1FOD2 4PU3C 3N7LA 2FZ1A 4QXHA 3OBTA 4QX5A 2LS6A 1RMU3 4MXWA 3KQRA 2CAUA 5K0UA 5ACA2 5BYNA 1ZRDA 5HV4A 4FTSA 5EP9A 1FOD1 3WF2A 1R69A 1BEV1 3B94A 1GT0C 1N3OA 1D4VB 1PX3A 4OFGA 4U2AA 1FMD1 2NLRA 4I0BA 4D7SA 1V6OA 1SDWA 1BDIA 2JDPA 4XOGA 3ZYGA 3ZYFA 2P1BA 2WNUA 3O1RA 3APBA 4CZSA 2J1TA 1YEWA 1S4CA 2GC2A 3ZYIB 4A42A 5A80A 4LKDA 3M7AA 5TSWA 2D43A 3AM2A 1RUC1 4N7IA 2LCVA 5D21A 4IV1A 3VBUA 1GP4A 1AYN2 1HRI2 1UMZA 4P9LA 3NKTA 1HV1A 4YRDA 3F51A 2GNBA 1E5IA 5CG9A 1RUG1 5JPNB 4HKLA 4NHYA 4GB32 1AR61 4N9IA 1AYN1 3BI3A 2B7YA 5FZDA 1QOOA 3EJKA 5AVAA 1W28A 4P9JA 5CISA 4GQ7A 4UW3A 2C26A 1IQAA 4OUSA 4J25A 4Y1ZA 2JDHA 3TEWA 3MW3A 5C3RA 1GMMA 3ZIWA 2XDVA 1R091 3A22A 1UXZA 1ZRIA 2WFF1 1W2OA 4TXWA 4JQDA 1QJX2 3AZXA 2P3YA 1IPJA 3M1HA 3ON7A 4TTGA 1F35A 3E97A 3L1PA 2VW2A 1AR91 3NJZA 4IEPA 1HQWA 3NNLA 2HEWF 1SDDB 2XXAA 5A7SA 1D4M3 4FP2A 4FT8A 2WNUC 5LW9A 1RC6A 4XXAA 4CDXB 1EV12 1TMF3 2D5VA 5IVFA 4XF1A 2B46X 2K9ZA 1YQ8A 2GMEA 3RNSA 3HQXA 4LE4A 4NHMA 4P08A 1REEA 1N47A 4Y20B 1CAWB 4EZHA 4IV1C 3VBUC 3OQMA 4K8RB 4XURA 2X10A 3H3ZA 3ZFGA 2A73B 4MV2A 4PLNA 1DHKB 1HJGA 5A7PA 3SITA 2HWC1 2QNKA 3I2OA 4AGGA 3VDDB 4DO0A 1GUIA 2XQXA 4M4RA 1QJU2 2DTYA 4FTEA 2J1EA 2RHPA 2C9AA 2WN2A 3LKJA 1PO11 2XVLA 5A3TA 2VZVA 4GULA 4YW7A 2X09A 2RR13 4V2VA 2JDMA 1XNDA 5DAXA 1H2NA 1ZA7A 2X05A 2OT7A 3S7IA 3AVSA 4JQTA 4Y5Z0 1QMJA 5GLZA 3RZZA 2D97A 5BPXA 1PIV2 1KFXL 4EJRA 4OHYA 2BNMA 3WDXA 1VE0A 1Q5OA 3NXHA 2ES3A 4JRAA 1RUH3 1DGRA 1JI6A 3J8F2 1DU3D 2MEZA 3DEMA 5KBFA 1CJGA 1VB2A 5L9VA 3LOBA 2RDQA 1LRHA 4YM1A 2UWBA 1OF3A 5DQ0A 4CRQA 1WETA 3Q8FA 3FUQA 2QQWA 3IKWA 5FZLA 2H6BA 1UOBA 2WA4A 2QQNA 1LQCA 3HEIA 2RDRA 1BDHA 4I0WB 1DGWA 4M3CE 4NN0A 4BE3A 1SFNA 2EBYA 2VECA 1OFNA 1LOCA 5H9SA 4AVAA 3VD5A 3WCSA 5K9YA 4FXGB 1XOYA 3ZFGC 1DF0A 1KJLA 3PUHA 5FV3A 3T08A 2E63A 1Z78A 3NROA 1XXNA 1YFWA 4BZ4A 2OVUA 4UAPA 4ZU7A 3POWA 4LBMA 4P9GA 4JCKA 1U12A 1UTXA 1GZWA 1RHI1 5CVRA 4I6TA 2WQ8A 4UFLA 4ZU4A 3O7OA 4Q4W2 2UWAA 4P9WA 3VHOA 1LOEA 4AFDA 4AEMA 2P3JA 4XF0A 1AJOA 1C57A 5DZEA 4D6QA 1D7PM 2ZHKA 2NZ9A 1GQHA 1ULPA 2IVJA 4FOWA 3WEZA 1ZZCA 5E16A 1DQ5A 4Z2WA 3S7EA 3CNAA 4XQDA 1OLRA 2RS53 3ASIA 4XVHA 3NNMA 4BB3A 4LKFA 3WXPA 3WP3A 1PHMA 1X33A 1IPSA 4EN8B 5L19A 3DECA 1WBLA 3FFQA 1XNTA 1MZ6A 4Y22A 4M0NA 2GMMA 5M0TA 1BBT2 3GBWA 4BA6A 3CJIB 2IFRA 1HB1A 1LNSA 2EF6A 2GC1A 1UZZA 1OA4A 4MGKE 4DB5A 2A75A 2VMIA 5CFCA 5JOXA 4A44A 3TNQA 2JJ6A 1VBA1 1PVC2 2R072 2PFWA 5AC92 4NMIA 2B5HA 4XYXA 1UKRA 2QE3A 1ZRRA 1KEXA 4YM2A 5DUUA 1O3QA 1XNKA 1IKPA 2HH9A 5KHIA 1HIXA 4NIGA 2C6SA 2JE7A 1RVF3 4FFHA 3P6BA 4EKIA 5FYSA 4D0QA 1RUE1 5FZKA 1BK1A 2P17A 4ONUA 4PI0A 4FFFA 4PIXA 2PA7A 1UW8A 4QGMA 4NRMA 3ZM8A 3ZPXA 1HV0A 4IA8A 1WW5A 1ZVFA 1XC6A 2BVVA 2ETEA 2JD9A 2VTXA 2XBO2 1CJDA 1XU1A 4CTEA 2R043 4UFKA 4ET7A 4ARXA 5L7OA 4H14A 3VBOB 4QWNA 1GQGA 4X4IA 1PGW2 1YRZA 2L9LA 2ZACA 4CA9A 1R082 3I3MA 5FQ0A 3JD72 4ER7A 3CMGA 1MEC3 5EXOA 3LEMA 1QIQA 4XQWA 4A41A 1GZWB 1OF4A 3RS6A 1DWKA 3DXTA 5CNAA 3LE0A 3O1VA 3VZOA 3NL1A 3UGFA 4BQ4A 1IKQA 3GN5A 2PPXA 1R1A1 1SEFA 5CFCC 2E53A 1QQP2 5A1FA 5IFTA 3RI9A 1NLRA 3FN9A 1GZTA 3ZYRA 5IYYA 1UF2C 4RSUA 2P34A 5A33A 4L99A 4X8NA 5I93A 2D93A 3JQWA 1DQ2A 1Y9MA 2KEJA 2FCVA 2WN3A 1APNA 2ZGUA 3FLPA 4LO5B 5DZGA 2MNGA 4ZS3A 3I49A 3U3WA 1MS8A 2XJQA 4BXFA 4O61A 4QQPA 5L9RA 5LY1A 2WZEA 2ORZA 1G86A 4CP2A 3KQ4B 3LA2A 2VXRA 4YARA 4MLOA 5FMDA 2PXKA 2I74A 1SMVA 1LHNA 3MLKA 1V9U3 1XQNA 2BEOA 3I3DA 4WVLA 5L7OC 2LNMA 3OY8B 3FHIB 5FDBA 2WZR2 2OW4A 4CDQB 1DQ1A 5APAA 4S2GA 5C4WB 1TG7A 3U4SA 4LUMA 3GUUA 1RYYA 4M00A 5J1XA 2DWRA 3EHKA 1MVEA 3ZHMA 1W6NB 2W9XA 3SH5A 5FPZA 4CDWB 3OEBA 2R6QA 2XGXA 3I2FA 3M3IA 2DV9A 2IVIB 1O8SA 4K1YA 5ACA3 2C0ZA 3INAA 4R8HA 3SKJE 1UD1A 4Q4Y2 3LD8A 2VNOA 5SV8A 5C7GA 4AEKA 3NJXA 3OB8A 4X4BA 1DIWA 3ACIA 5IK8A 2HYXA 2Z5WA 4UWDA 1XJAA 2JKBA 3VLBB 4PU7A 2XJVA 4DPNA 1OLMA 1VBC1 4QXBA 4XC9A 5I0TA 3VZNA 1UY0A 1QJY1 3N35A 1KS4A 2GSYA 2VMEA 1HRI3 3OGRA 1RUF2 2Y6HA 5K8SA 1AXKA 2YBPA 2OUJA 4GB33 5LBFA 4R9BA 2AXUA 3VKFC 5H9RA 2CDPA 1V6KA 5IJRA 2C4XA 1ODNA 1LU2A 5EJ1B 5JCTA 1MQTB 3HNYM 1Y3TA 3H1YA 1MS5A 2UY8A 2PAMA 2Y60A 4XCBA 3RG0A 5E8AA 4AVBA 4C0HA 4HK8A 5FYUA 4ATFA 1QJX3 4XJ8A 5C9AA 3TRSB 2M4HA 2E6VA 1E57A 1HRV1 1RZSA 3GZDA 4MH0E 1YQ6A 3AZZA 2PHWA 4OYUA 1WW6A 1ZX5A 5HCBA 4Q4X1 3I3QA 1GZCA 4IL7A 3GM8A 3Q8AA 4Q1PA 3RFRA 3GDBA 4D7TA 2LALA 2D3SA 2VQTA 5GLVA 1XYPA 2VBBA 2WBKA 4UFJA 1W9TA 3O1PA 1QWRA 4KL1A 2ATFA 1RUOA 2C5DA 4GKYA 2CSFA 1PNFA 4Q2FA 4RGGA 3ROUA 2JDAA 2RM21 1UOFA 3SCHA 3UV9A 3ZYBA 4CU7A 3I59A 1W8OA 3AMQA 3O1SA 3AVRA 4CP9A 2V73A 2V4AA 2GZUA 5FP3A 4LO8A 3A9ZA 3LFIA 2DU1A 1C1LA 3J7HA 4Y5SA 1JZ7A 4CUGA 1QJU3 4FPHA 5T5LA 3T4HB 5DAVA 1JWLA 2DBIA 3KCCA 3U10A 2R061 3BPSA 4I3PA 3PNAA 2YXSA 4RS5A 3D3AA 1ZBA2 3W20A 3N9NA 2AREA 5FR3A 1LTEA 4WM8B 2UWCA 1PO22 2RMU1 4YGCA 4UW6A 4BHPA 5JUWA 3DPRB 4GWMA 3B02A 1QH6A 4YZ1A 1KS5A 1Q3EA 1W6QA 3VBFA 4BJ0A 4M3CB 3RWKX 2MQKA 3G5GA 2XIUA 5FZ6A 3GZDC 2Z4FA 5FFOC 1QY4A 4H2AA 5CKMA 2D6NA 3C7GA 2JXAA 2VMCA 2OPKA 3UESA 4WZFA 1AL21 4AVVA 4ORFA 3VV1A 5FBZA 1W6OA 5FP8A 4LUKA 2BW8A 3R4DB 4K21A 3UJOA 2EWTA 1S0BA 4LA3A 2PUBA 3AKSA 4JX0A 2AENA 4ER0A 1W8WA 1DYKA 1QJEA 2DVGA 2FBEA 3OOXA 2NMNA 1X50A 3LGRA 3POEA 3U1XA 4DXTA 4QPIA 1UWWA 4E27A 3WV6A 1O3TA 4FCAA 3W58A 1PGSA 2VULA 2A6CA 4QHOA 4W4ZA 1OD5A 1SQ4A 3U78A 4CEYA 2ARAA 3RDIA 2VG9A 4RS5C 3B00A 3GXUA 1A8DA 3K2OA 4NIDA 1MVQA 1A78A 4IEQA 4K6BA 4Q4W3 3UETA 1IQDC 5KXDA 1KITA 1GWLA 4PBPA 2ADDA 2EXIA 4YLZA 4ZKTB 5CKQA 2HBUA 5FXVA 1U5IA 3VBFC 1KD7A 2ZGSA 1SBDA 2W47A 3JXBC 2VAUA 4GH4A 2TEPA 3WD5A 5C8CA 5DT2A 2B8MA 3I97A 4CP9B 1UU4A 2ZMLA 3WG4A 5JXJA 4YVSB 1ULGA 4BQWA 3BTZA 3H9AA 3ZHIA 1VIWB 3ZXAC 4IV3B 4M3CF 1BBT3 1LEDA 5CA6A 4DY5A 3QBQA 1YWKA 1F2NA 4QDQA 1ZREA 4OUEA 5FYCA 3ZIXA 1JBCA 2VO5A 3V0AA 1SLBA 1QOTA 1LOFA 3J7MA 4HG6B 3QYXA 4QPIC 2BYVE 3MIFA 1RMU1 5CB7A 4I6RA 1JH9A 4K8FA 3X29B 3THTA 1W6QB 1PVC3 4Z82A 2J7MA 4B29A 1TVGA 5AC93 5C70A 2RS11 3JB4C 4C8DA 4ITCA 4CEYC 1O4TA 5DRYA 2DFCA 1PMHX 1HF0A 3C8XA 4NHKA 5FUNA 1EUTA 3R6SA 4DUVA 2Y0IA 4Q0VA 1H2MA 1DQ6A 2BBVA 1KDKA 5AFBA 1B09A 3OUIA 2ZA9A 4NO4A 1U2ZA 2JE9A 2QQMA 1COV2 2FMDA 4KU7A 4NROA 3QOPA 1VRH2 3P3PA 4XAAA 4GH4C 2J1VA 1RUJ2 1H8TB 3O12A 1GNZA 5C8CC 4XZPA 5EV7A 1W99A 2JB4A 4H3WA 1OI6A 1W2TA 2DDUA 2PUDA 2ILMA 3LQCA 3NKGA 5GALA 2VD7A 1PGL2 2GMPA 3KVAA 2BUKA 4XUOA 2NM1A 4Q0UA 3JD73 1ND2A 1LCLA 3VHRA 3ZYHA 4CEYB 2XLFA 3MYXA 2GNDA 3NRUA 1OURA 1JOJA 1JOBA 3RZHA 3VUOA 3DV8A 1LOFC 4IEZA 4CSWA 2AC1A 3AP5A 3CU7A 5HCHA 4X6QB 4XBNA 4FI9A 3SR4A 2DVBA 2VM9A 4Y33A 4MG2A 1CAXA 1PNRA 3KM5A 1JU4A 2WS92 1G9FA 3ZXFA 3ZXLA 1O3SA 4UBGA 1RPEL 1QB2A 3NVCA 5FY0A 3NNGA 1D4M1 2EIBA 3BIWE 2VQ0A 2GRLA 3KJXA 2XHNA 4QPGA 1G9BA 2ODRD 3JBG2 4GA9A 3U75A 1CD3G 3BTXA 3J26N 4PJYA 4L97A 3OUHA 1KRIA 1LCCA 4HRAA 1GP5A 3S0MA 5A7WB 2XR4A 1YNAA 1PERL 4RQPB 4HK9A 4QM9A 4DRVA 4Y3OA 2JWPA 2VZOA 4I09A 5K98B 4CCLA 3KGZA 1W2NA 3KT4A 2WZR3 1DLCA 5LBEA 2PQSA 2YB7A 3Q8EA 3JQXA 3AK0A 1SLLA 4GMP3 4JKLA 4LTAA 2RR11 3OP9A 2XJPA 3I3BA 2PXVA 4KWKA 4BQ1A 2VW1A 1BK0A 5FZOA 2I2SA 4XFCA 4X4FA 1C5HA 4Q4Y3 3VB9A 4ISQA 5A3WA 3KV5A 1U0AA 1RUH1 2ZAHA 1IGOA 3PTYA 5L73A 3L2HA 5FYZA 1A6CA 4QPGC 2YV8A 4IE5A 5DAWA 4YW5A 1ULFA 1CAVA 1CR7A 2BRTA 4X6RB 3W21A 2VL4A 1H1AA 5DN2A 2VCMA 1LHUA 1RUF3 2EAKA 2PLV2 3ZSLA 1YXWA 3R0RA 2Q1ZB 5A3OA 2PXLA 5I91A 2ARCA 5IWFA 5GKAC 3USUB 1W06A 2DVDA 2Y0OA 3J4UH 3POIA 3RVHA 3V65A 3ZFEC 4EQVA 2PLV1 1LKNA 4XTMA 2WO2A 4OI2A 4LIUA 5BNOC 3OPWA 2PXBA 2OXBA 4YW4A 1NZIA 3BS3A 1CGPA 4BM8A 3ELNA 2D3RA 3PU8A 3EQEA 1UMHA 1XE7A 2ZHMA 4FBFA 4AFMA 4CCNA 3CQOA 1X36A 3E6BA 4C1WA 4KNCA 4YZ3A 1BCXA 1WA4A 3AP7A 4I2OA 2FMYA 3OQOA 5FY8A 5FZEA 1C8NA 2MEV3 4R9AA 1C8M2 4FPEA 4NAOA 2O8OA 2G9FA 4XUPA 4DINB 4E8DA 3IM0A 1Q8OA 1QJFA 2ZS6B 3FL7A 4QAWA 3MPBA 2RS51 4OB4A 3B93A 3UKNA 5IK5A 2BQPA 2G1MA 2JICA 3A21A 5ANQA 4J6GA 5FZ0A 4YM3A 1YLLA 5GZGA 2W95A 4AXOA 1LOGA 4YGDA 3ZFEB 1YQCA 3GZUC 4E4ZA 5LBBA 5JWPA 5BNOB 2F4LA 2ZX0A 3WDVA 1HN0A 2ZAAA 3DCQA 3NV2A 1REDA 4AI9A 5AFEA 4XUTA 2JDUA 2XMLA 1B0NA 1ASJ3 5L36A 4D3WA 1PRUA 3NW4A 2DVFA 3WG2A 4DXZA 4JCXA 1ULEA 1S0CA 4OI1A 4IW3A 2VPVA 3T2QA 3TWIA 1OVPA 2VH9A 1K3IA 4A7ZA 3B7MA 3FHQA 1ODMA 3ECQA 4BYYA 1CQTA 4HBNA 4NIHA 4LBQB 4URTA 4JV4A 3T0BA 3VN4A 5FZMA 1H30A 4Y42A 2CTVA 1XNCA 1ZBA3 3FZ3A 4AQTA 1DLLA 4LKSA 3HVDA 2Q30A 4XW3A 4C0BA 2DCJA 5IVBA 3V0BB 2GN7A 2HJIA 5FZ8A 2ICTA 1LGNA 1CQ9A 4AI1A 2HCSA 1GWMA 5FYHA 2JVLA 1XSQA 1CAVB 1JODA 2IXJA 3AXEA 2XONA 3DKQA 3KVBA 4HKWA 4DOUA 1S55A 1PM7A 1ZBE3 3ZN6A 1NERA 4CCDA 2LM3A 1H9PA 1RUD2 5J98B 3B5LB 3BB6A 2AACA 2GH8A 3JXSA 3NV4A 4HPKA 4XF3A 5A7LA 1JYWA 4Z92B 2IV1A 1ST8A 1NQDA 3CLPA 4GWIA 3WUDA 2YU2A 1NCRA 1J3PA 1MEC1 1VBD1 3USSA 2VVFA 3K4AA 5LK5A 4OQ9A 2IUOA 1MS9A 1W03A 2HINA 4RFRB 2ZTNA 2FD8A 5E88A 3BTYA 3SKVA 4TLFA 5FKBA 2D40A 1W3VA 3KF3A 3SH4A 2YMZA 3UYJA 2W87A 1HN1A 1CZSA 3PIGA 2QDRA 4YVWA 1C4RA 1LLIA 2GU9A 5B4XA 2VEOA 3B7HA 1ENSA 1UY1A 1WCSA 3N9PA 4UW5A 2D6OX 4BQ5A 4BIOA 4YG0A 3RRDA 4Q4V1 3VGIA 1VAKA 4RR3B 4DS0A 5FKCA 2XCJA 3BPZA 1ND3B 3SH3A 1BEV2 1H4GA 2O1QA 4Z5CA 1UN1A 4QKBA 1FMD2 3TN91 2XXPA 1F15A 1F9KA 1AX2A 3IPVA 3OBZA 5GZFA 5EPAA 4COZA 1POUA 1QH7A 4B4RA 1V6MA 5JI9A 1XU2A 3OQNA 2LLVA 3VD3A 4DIQA 4E9KA 3H7JA 5FUIA 4DEQA 5C3PA 4BQ2A 1LEMA 3WNPA 1V9U1 1HKDA 1RUC2 1UYYA 5A7QA 2A71A 2R1BA 2IXCA 2BBAA 2BERA 2Y6KA 4MGIE 1ZZ9A 4IUGA 5LY2A 1PK6A 1RUG2 4GWNA 1G9AA 1OCTC 3KXAA 2JG8B 1O4ZA 1NCRC 1O5UA 1AR62 4R9CA 4Q1RA 3THCA 5IVEA 3E6CC 3DYMA 4GHJA 4NPRA 4GJZA 4HXCA 5JDBA 5GLWA 1UQXA 3OG2A 2DBNA 1JFSA 4IGOA 2Q8CA 2H0VA 3WF4A 4YVWC 5F1RA 3PJQA 1R092 4YW3A 1AR82 3Q8CA 2WFF2 1QKQA 4XJWA 1ZPQA 4E4SA 4QQOA 1EAH3 3SNMA 2OUHA 4YM0A 1Y9GA 4FOYA 3U37A 1SPPB 3BIEA 1CWPA 1OT5A 1AR81 3TYJA 1AR92 2WABA 3KCXA 5K0UC 3H3UA 2J7WA 3NJYA 5D2AA 3RGBA 1COV3 2XPJA 3SCFA 1KJRA 1VRH3 1OBNA 2BZDA 4V2WA 3H3LA 1BVVA 3AMHA 1RUJ3 2VZ1A 3RQ0A 4B4PA 2YG0A 4ZXKA 4UFMA 1FX5A 2EIEA 3IZOA 4BCUA 5FO9B 1OKOA 4BISA 3OBRA 1J84A 5I8SA 2IC1A 1FPN3 3ZX7A 4B7KA 3VD4A 2XH6A 2ENRA 5DG1A 3TOJA 3A7QA 1PK6C 3HN3A 2VBPA 3ZMNA 2LTNA 2HWC2 4QMAA 3AMMA 1VLNA 3AXDA 5AVPA 3H8OA 4LBQD 4A6SA 4FPJA 4MGYE 1ENRA 1PO12 2O8QA 4I0AA 4XDPA 5FTTC 3NAPA 3WT3A 2A70A 5FZFA 4MXWB 3CLCA 5K0UB 3WW4A 4LO7A 2YBKA 2DURA 1KQRA 5LB6A 1ZYBA 1WLWA 1PM4A 2WS93 1XNBA 3P5BA 1YI9A 2BGCA 2KXLA 1LHOA 1PRAA 2BFUL 1K12A 2WNUB 1L7QA 3O5SA 5FP7A 1WMXA 2DCTA 4BH9A 1UU5A 2LYKA 4RN5A 1JZ8A 3K51A 4OHVA 2ZEWA 1HJFA 3JBG3 2AR6A 4IE6A 2XSDC 4R4ZA 4MVTA 1KGYA 5A3MA 1PK6B 3RI8A 2W08A 2JDKA 4IV1B 3VBUB 2XLGA 1SACA 1ZNPA 1WA6X 1IG0A 2DCKA 3J7LA 4XQ4A 2PAKA 4CVUA 3Q8BA 4BMBA 2IXLA 3WNKA 1Z7S3 1H0BA 3ZSEA 1XNAA 3R09A 2DF7A 2JDZA 1OLME 4FPLA 3T30A 3IB3A 4E4DX 2RS31 4YYOA 3THPA 4EV0A 1G9DA 3RZGA 2XUEA 5LCWL 2QQVA 4S2DA 3NZLA 4TYSA 3K3OA 2W3JA 2QQJA 4JDMA 1N1TA 1U5XA 2VZQA 4FPCA 4OHXA 3RJRA 3VZKA 3POJA 3MF6A 4RA0A 1PZ8A 3I2IA 2ZOEB 4FP3A 3NAPC 4XABA 3VBRA 5JZGA 2QQKA 1RHI2 2Q1MA 3CDZB 4NVPA 2VOKA 1MS0A 2W94A 1EFAA 4NWWA 4XDOA 2AW6A 3ZKYA 2DCZA 2OQ6A 4I02A 1D2SA 1WCKA 3A9XA 2O4AA 2OA2A 1X9TA 2WC2A 2XG3A 5A3PA 3LWCA 2WKKA 1JHNA 2Y26A 1F5FA 1W8HA 3UFDA 3EUSA 3BCWA 3NJVA 5HBAA 3H8RA 2GALA 4AEJA 3M9LA 3GJBA 4BOWA 1DULA 4ZHNA 4TZDA 2HCNA 1P8JA 3T0DA 5LA9A 5BNPA 5JIAA 4HETA 3UNPA 1ZRCA 5BNPC 1FT9A 2IWGB 4GZ9A 5JPMB 2SBAA 4SBVA 2BOIA 3R4UA 3VL9A 2FJRA 1HX6A 2VW0A 4P9IA 1AZDA 3ZFGB 4MO3M 1CVNA 3BU0A 3MDPA 2OFYA 4XETA 3MEJA 3H8UA 4FOVA 4IERA 2G9GA 1US2A 4Y4RA 1GOHA 1MS3A 1YFYA 2JG9A 2WZ8A 2LYPA 2K0GA 2YBSA 3QWGA 1XYOA 2A6YA 3H42B 3WINE 2JCGA 3ME2A 4JCYA 1UMIA 1V6NA 1VBA2 5FK8A 5LATA 3UT0A 1HB3A 3VBRC 5BV6A 5JZGC 2ERFA 4Z07A 3VDCA 2AXVA 5BUVA 5KXBA 1SLTA 5J96B 2J1AA 3KZ3A 1WUVA 2CYFA 1OPOA 2VZTA 3PMEA 4FO9A 4YNIA 2AWIA 2BFUS 1L3JA 1WW4A 2ORXA 4FFIA 2XLAA 1O59A 4OZOA 5BNNA 5FREA 3N3HA 1GKBA 1RUE2 2HWD1 3KWVA 4TSVA 4D6RA 3MW2A 4DQAA 3DF0A 1CN1A 4YFZA 4COWA 2VOXA 5IVVA 4HFSA 3EBRA 1NUKA 1BYHA 3GBFA 1I3HA 1PMJX 1VMFA 5GLUA 1E5SA 4BK5A 3MFAA 1S0GA 2XVGA 4N7UA 2DFBA 3WW3A 3N9LA 3MV01 4CCJA 4QPWA 1RL3A 1GNHA 1GSLA 1UZ0A 3KCYA 4RHV3 3VKOA 4Z8BA 3NV1A 1QNWA 3HT1A 1D0GA 1CAUA 2X29A 4XFAA 3VBRB 2HWB2 5JZGB 4RGAA 5C6CA 2JB8A 4L92A 1WCUA 5C3QA 2JG9C 5IATA 1Q56A 1VBB1 4EN0A 1VBE3 1R1A2 4CDUA 2HWB1 2V5DA 3HD8B 4MHRA 3S8QA 3RSJA 4CU9A 5FXXA 3PIJA 3WF3A 4EK9A 4FVVA 4N53A 5IW0A 3PMSA 3RZMA 4AF9A 3VDBA 5JSPA 5DAQA 4LE3A 3FBYA 1GBGA 2ZGOA 3PUIA 1W8ZA 4LEJA 4P14A 3WX5A 1CIWA 1JMUB 1M4WA 3OF1A 1POQA 1RGSA 3GZCA 3LEKA 4BLJA 1C1FA 1VAVA 4D8MA 3S30A 3SLIA 5BNNC 2WFPA 1RUD3 4EZIA 4M01A 5EJ3A 3AP4A 1GQPA 3GZAA 4HSJA 1WLDA 1WCQA 1UYPA 1XE0A 5C5UA 1LCDA 2QBXA 2HWE3 4HN1A 4O9EA 4Y22B 3MIEA 3TBDA 1DYPA 3HBKA 3I2HA 4GQMA 1ALYA 4OZXA 2F4PA 1DCSA 4I8TA 5LBCA 1JYVA 4GMP0 5D8AA 4XAEA 2OYZA 3DL3A 5DSXA 3BU7A 3HMYA 2AUYA 5FYIA 1J59A 5EHDA 1HXS1 5CFCB 3SX0A 3WDYA 3G6JB 4CXWA 1B35A 1S0IA 2LYLA 1S0EA 3T2OA 3AKPA 2W1UA 2BTVC 1UXDA 2D6PA 3ENRA 5CYYA 4CDUC 1N1SA 5JMCA 4W6WA 2VBDA 3RWNA 5F32A 4UF0A 3I2GA 1ZA4A 3KMHA 1FOD3 3PVNA 4LORA 4N53C 1BEV3 3ZKUA 5BNNB 4OBMA 2HKXA 5I8YA 3D4KA 1FMD3 5FAXA 2IU7A 1PZ7A 2PMWB 3AKRA 4FBIA 3B69A 1H2LA 1DGRN 3W59A 1I5PA 4MGZE 5I8TA 4OHWA 1X82A 2WLQA 4HMZA 4AE2A 1RUNA 1VBC2 1IS5A 3FUOA 2PUFA 3PU3A 5KHKA 3ZOIA 3QOXA 4RFT0 3O0WA 1QJY2 2DYCA 3KV9A
chains in the Genus database with same CATH topology
1RUC3 1JUIA 5L7OB 4Q8KA 1O4XA 1ZRFA 3F6WA 1U5YA 4XF9A 5FQ0B 5JSRA 1AR63 1AYN3 3E6DA 4JGYA 2DUOA 3M3CA 4GMP1 2XHKA 1W6PA 4G3YC 4E2GA 1QJZA 3GN5B 1GLHA 2DUPA 4YW2A 1B35C 2JX9A 2WNVA 1BZWA 2WT0A 4Q29A 5JIUA 2YPJA 5A33B 1GANA 4K20A 2IXHA 4XPVA 1JXNA 1V6JA 4F8AA 2Z69A 2A5ZA 4AHXA 1HRV2 1JUHA 2WA3A 2YY1A 1AR93 2X53S 1Z0HA 4LBNA 3F52A 4Q4X2 3UJQA 2L8NA 1AYM1 3H50A 3MICA 4QT6A 3GHNA 3NSTA 3W9AA 2LYSA 1AHSA 2ZMNA 1DW9A 2ZABA 2XJTA 3NWKA 1WD3A 3CF6E 2BPA2 2ZX1A 4J1WA 1EYBA 2VU9A 3N7MA 3WQ1A 3BOPA 4A2UA 1EV13 2RM22 2YROA 3FX3A 1EY2A 2LUWA 4HKOA 3AJYA 2A3WA 3ZPYA 5FOJB 3MIBA 3N4MA 1WW7A 3ZN4A 2HWC3 2GC0A 4JGYC 2DCYA 2PUGA 2R062 2IFWA 4LLFA 4XFIA 1NEQA 1NA1A 2WNVC 5GJ6A 4AWDA 4L8QA 1V70A 2RMU2 4XBLA 5CADA 3T2TA 1UKGA 2MEV1 2D6LX 1Q8PA 2PHUA 4OULA 3RMYA 5HCAA 3O0VA 3WR0A 3JU9A 3HBZA 4XXPA 2CAVA 2VY0A 5C9AC 1PIV3 3MIHA 1V6LA 5FO7B 1N1VA 3HT2A 2NMOA 1AL22 3J8F3 4K7JA 1ASJ1 4AFCA 3ZXDA 1WBFA 2PYTA 1QF3A 2R32A 2HWF1 1ZAYA 2R1DA 1NLSA 2XKOA 3KSCA 3N36A 2ET7A 1UIJA 3AZYA 1BKZA 3GBGA 1G9CA 3ZXKA 4I01A 3DKWA 3H1MA 1KXGA 4LR4A 3FLTA 1RITA 1AR71 1Y7YA 1POV3 2UYAA 3B9CA 1S0DA 3D8CA 5GM0A 3IMNA 1NA1C 1NG0A 3OD0A 2PE5A 3BALA 5C9AB 2QDNA 5T55A 3VKMA 2E51A 2PIJA 5BY5A 3LFPA 1BMV1 1ZZ6A 4IXLA 1W6MA 2GNMA 4FQ4A 1ZBE1 2AYHA 1RUI1 4IEXA 5DDJ1 3RYRA 1CESA 1DGLA 3IT8A 4XFHA 1JW6A 2R16A 2FHRA 1TQ5A 3MEPA 5J09A 4YG7B 1ZVVA 3L9JT 3I59B 4EWEA 3DNVB 4WZCA 3WDTA 2NQYA 1GR3A 4RL7A 3ZSKA 5A32A 1ULCA 1PZ9A 2ARBA 3NV3A 4FPKA 1X8MA 3I54A 1YYNA 4Z5DA 2A6WA 3GYDA 4RS5B 2I45A 2XUMA 1VP6A 1RMU2 4KGQA 1TME1 2IVQA 4Y1XA 1VBA3 3BD1A 4LNVA 2RS12 2ZBJA 2XI8A 1O5LA 4OHZA 1V6IA 1NXD1 3RYKA 5JOZA 2WLPA 1NXMA 4AVSA 3KT1A 2VOVA 2R073 3VBFB 3WVJA 1BQPA 3OYWA 3OJBA 4XMAA 5KXEA 4WV8A 2Q5TA 1QP7A 4Q27A 3JXCL 2YUEA 5FLIA 5LK7B 3HWJA 2MPFA 2XL9A 2ZKNA 2O49A 1J3QA 3H7YA 1VJ2A 1SBEA 1W6OB 4XIKA 2E7AA 1GZ9A 4F3JA 1YFXA 1CJPA 1H1MA 1ZS4A 4GALA 1JYIA 4R4XA 2XBO3 5FLHA 3QCWA 1Y9QA 2CWSA 4X8PA 4XJZA 2EVXA 1QXPA 1ZM1A 2X8KA 3LSEA 4QPIB 5FCCA 5F5QA 3AKTA 2R1JL 1R083 1LMB3 3C2UA 4ASMB 2YYOA 1DZQA 2XJUA 4KG8A 1TNRA 3URFA 2YHJA 1EAH1 3SMHA 2UURA 1NQJA 4PU8A 1QQP3 1LB2A 2EXKA 1D4M2 1Q43A 5I0RA 1LOAA 4GH4B 4MCTA 2X5IA 3CL1A 4K1ZA 2KA3A 5C8CB 1FV3A 2IZWA 3D6EA 1WMEA 1TMF1 1LR5A 1FPN1 4LHLA 1XE8A 2ZX3A 1YJLA 2AXZA 1JH5A 1GV9A 1ENQA 3PVEA 5DUVA 4C90A 3LISA 3V0AB 2ZGMA 1SLIA 3H0OA 3NO8A 3WG3A 1WH8A 1RIOA 5KXCA 3DUIA 2RR12 4NDWA 2VVEA 1QQBA 1UPIA 3KB5A 4XJ9A 1ND2C 2QJVA 4JGZA 4YG6A 2Z42A 5FRAA 3UL2A 3VBSA 4B7EA 1SCRA 1ENXA 1UL9A 2YZ4A 5A3LA 5KHGA 1G6NA 1NYWA 4SLIA 1RUH2 2AZ5A 4OUMA 4XIOA 4MX3A 4R52A 3ZN5A 1AX1A 2HEVF 3MIDA 2X5IC 1UCXA 2VNGA 1VPWA 1VBC3 4QD2A 2PTMA 1RZRA 4Z59A 4X4HA 4KU8A 4NWVA 4OVEA 1K5MA 1ND2B 4XBQA 4Y26A 2A3XA 3ZDSA 1OQDA 5CIRA 3E5XA 5EFUA 4HVRA 4JC1A 1OLQA 2Q8OA 4UXAA 3ZSMA 2B5AA 4A7YA 2A6VA 1AUYA 1CAXB 1UPSA 4L9BA 4JGZC 4LO4B 4M0HA 4G9SB 4A3XA 3VBSC 2XL7A 3AJZA 3IN9A 2VGDA 5ABJA 5DUXA 1HRV3 4AI8A 4QPGB 3M70A 3ZXGA 1Q8VA 5J36A 3M3OA 4AGVA 2RS52 4Q4X3 2VNRA 3H1WA 4FOQA 1C5IA 3VKLA 2QFEA 4YG3A 1IS6A 3AYAA 3JUUA 3KGLA 2RM23 3AP9A 3QLQA 4QQHA 3FJSA 2BNNA 5IUQA 1K5MC 5I0UA 1J3RA 2BVBA 1J1LA 4N43A 1X2LA 4JDOA 3E5QA 1LOBA 5DUWA 4EN6B 2JENA 4QXKA 3OMTA 2ZCWA 1ADRA 3EXUA 1QU0A 3MLFA 5GZEA 2KM2A 4CEWA 4CP1A 2P37A 4N9HA 3WQ0A 4IESA 4XJAA 1PO23 3LCPA 4JQRA 1RVF1 3GF6A 1DQ0A 5ABJC 5GZCA 4IVZA 1N3PA 4A7KA 2EAAA 1K5MB 3EO6A 1WH6A 2TNFA 4F83A 1QP4A 3B9IA 4AEJA 1AL23 3QD6A 4IEYA 4IEVA 3AYCA 4RHV1 3LB9A 1J58A 3LA3A 4H7MA 1S2KA 2OIIA 3U07A 4YGBA 2R041 2XWBB 5T5PA 1MEC2 1DG6A 1VBD2 2A7AA 4LULA 4WVVA 4XILA 5E89A 2ZHNA 3M3EA 1I9RA 4P9YA 2ICPA 1AXYA 3B01A 1EP0A 3TB0A 5DG2A 1VBE1 1AF9A 2PHXA 4QM8A 1H2KA 4Q0SA 1ZZBA 4N43C 2KPJA 4Q26A 3AYDA 1NY71 4B3NA 2LYQA 4Q4V2 3I2DA 2AUWA 1NCQA 3ETQA 2H0BA 4CEWC 3TN92 2DTWA 3WDWA 5JOYA 1RB8G 2PHLA 1YSEA 1DGWX 1ZZ8A 2XJ3A 1G8WA 1ULDA 5GLTA 1AX0A 4DNYA 4E2QA 3TNPB 1NOVA 2CGNA 4P9XA 2HWE1 1YFUA 1V9U2 5H9QA 4Y1VA 5HXVA 2CNAA 4CDXA 2I07B 1URXA 3SCGA 2C1FA 2TBVA 2D98A 2LYJA 4N43B 3ZO0B 1I1EA 1F8VA 2O38A 1SBFA 4XEZA 4Y20A 1CAWA 4PU4C 2ZX4A 1TE1B 1Q8QA 4CEWB 4MCXA 4GXLA 3ALQA 3D5OA 3VDDA 3AZWA 2Z79A 2SLIA 2D6KA 5LEJA 2RS13 4MYEA 4IEUA 5ACA1 1NCQC 1VALA 3IDBB 2XJSA 4PBOA 3BDNA 4BIFA 3WLUA 3ZN6B 2WINB 4QGLA 5JAXA 4HPKB 1WCDJ 3HZIB 1IPKA 4QQLA 3ZYJB 4YW1A 2UY9A 3MPPG 4CDXC 1NCRB 1HRI1 1G7YA 3J9SA 4I30A 2RE9A 3M8LA 3MLLA 4KGGA 1W0OA 1WMDA 3IIAA 4GB31 3ST7A 5IK4A 1NCQB 3OD4A 4YVWB 5IK7A 2ZKLA 2PUEA 4YZ2A 2ZZQA 3GZTB 4AI2A 3IVPA 3VDDC 3AP6A 2ZMKA 4G4FA 1XYNA 3VZLA 3ZYPA 1X7NA 3CECA 3QQ6A 3SXWA 4KG0A 2D5FA 1QJX1 3IPVB 3S6PA 1RZRD 4XMIA 3FBMA 1OA2A 1QXJA 4HZFA 1IC8A 2ZGLA 3FYMA 3MW4A 5FO8B 3UKVA 1S7EA 5LEKA 1EV11 4K40A 3M4FA 4YZ4A 1BXHA 4AFAA 1Y7BA 4O9GA 1POV0 2RS32 4NOTA 3LOIA 3OGJA 4XFGA 3CJIA 1QJU1 3WG1A 2QZ2A 4JDNA 1RJ8A 2VMHA 3OPZA 5F6KA 2O0OA 4Y4YA 4LT5A 5CG8A 4FTBA 1R1ZA 4QHBA 1DQ4A 1S1AA 1MR5A 1MS4A 1OOPA 1QXRA 4MSVA 3JCIA 1PIV1 2GC3A 5GZDA 3LSDA 2AGSA 3OGGA 4D69A 2GN3A 3J8F1 2R63A 4OLLA 1HQLA 2VVDA 4TWTA 3VK0A 5C33A 1EPWA 1QDCA 5I0SA 2OZ6A 4F8DA 2RJKA 3V64A 4PLOA 3BOWA 1BJQA 3ZXEA 2GDFA 2W39A 2PLV3 3VBOA 4DY3A 3CEWA 3A4UA 3U11A 1HW5A 1LGCA 1POV1 1FNZA 1FI2A 4P5HA 3NAPB 3GNEA 3POYA 2EXHA 1S0JA 3CJIC 3KS7A 1AL0G 2R0HA 3DN7A 2NPIA 3WZ1A 2ZGNA 4KBBA 5KC6A 4Q4W1 3O0XA 3AX4A 2UU8A 1OOPC 1FYUA 4K3UA 4Y1UA 3O14A 3WHUA 2GAUA 2HWD2 1C8M3 2PUCA 1LGBA 5JSOA 4IETA 3VL8A 1SCSA 4LBJA 4UBHA 3P3NA 5EYYA 2IVGA 4AQSA 2ZGKA 4INDA 4AVCA 2W52A 1WIZA 3OTFA 2WWSA 2YC0A 4AHYA 5BNPC 5CAZA 3U0ZA 1SLAA 5J3UA 1ZRDA 1XRUA 5T50A 4LO6B 3ILNA 1BBT1 1OHFA 3OY8A 3VBOC 4U36A 1VBB2 1LODA 4LBKA 2UYBA 4Z5HA 4XE9A 4CDQA 4COYA 2EALA 2GNTA 5C4WA 2CV6A 4FSJA 1EPZA 4HANA 2WT1A 1OOPB 2AH2A 3MI8A 4AQ6A 3K48A 2A6XA 2R071 1PVC1 2VOWA 1W6NA 5AC91 4CDWA 3WW2A 4LLOA 3L2YA 3FWEA 4UW4A 1W39A 1GYKA 3KLSA 4XHXA 5BNPB 3WDUA 2PQQA 1O4YA 4AEDA 5JOWA 5BXXA 3AZVA 4H7LA 4AFBA 2QVSB 5J37A 4GKXA 4Y1YA 2XBO1 2QZ3A 3ZMOA 2GH2A 3A0KA 4I3GA 3MZHA 3PVBB 2WL1A 3WCRA 1VBD3 1UIKA 2JG9B 4JRLA 1PGW1 4XJUA 1QGLA 1HXS2 1OKQA 1KFUL 1R081 3JD71 1W2UA 1MACA 1CX4A 4FQZA 2ZGTA 4DRRA 4CP0A 4CDQC 5HI0A 5C4WC 4Q4V3 2IXKA 1Y43B 1QQP1 3FLRA 1MQTA 1SFYA 3FFZA 2QUOA 2P2KA 5HCFA 3R1FA 1RTVA 2YDEA 2ARXA 3PVOA 4CDWC 3O9XA 3TN93 1LULA 1RJ7A 1WMFA 2JD4A 4X4DA 4AEDC 1H8VA 2B42B 2IVBA 4XFFA 2KZ8A 4V1PA 4ZU5A 2BNOA 1SLCA 2EA7A 5F9TA 2ZJCA 1CAUB 2HEYF 4IQPA 1UU6A 1RUG3 2WSVA 1FAYA 2WZR1 4CDUB 5D8AC 3WHTA 2Q0AA 2ZZJA 2E7TA 4HN0A 2OZJA 1E3OC 3IBMA 3LAG