1ZZ6A

Crystal structure of apo-hppe
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
193
structure length
181
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGNEFLFVLEGEIHMKWGDKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
total genus 45
structure length 181
sequence length 193
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz6A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz6A02
1RUNA 3ZDSA 4NDWA 1ZREA 4PU8A 1QXJA 4XFBA 3SCFA 4O8BA 1ZS4A 3LA7A 4XETA 4FAHA 1RZSA 2EVXA 4IEQA 1O3SA 5BUVA 1RL3A 1X57A 1GQHA 3OTFA 5J48A 2OPKA 2A6CA 4Z07A 5KHJA 2K0GA 1QP0A 4I6UA 2Q1ZB 5I93A 2PUAA 1RIOA 2PA7A 1LB2A 2O8QA 3EQEA 4PU7A 4LA2A 3KZ3A 2GZUA 1UPIA 4AXOA 2AUWA 3B7HA 4QXKA 4JQDA 3WW3A 3H5TA 4I0BA 4LTAA 1XE7A 3CJXA 3R6SA 4ORFA 2XGXA 5A7LA 1CX4A 3HT1A 3JXCL 3QQ6A 1QP7A 3BALA 1Q3EA 1FI2A 3BCWA 2KZ8A 3DN7A 4RD7A 4YRDA 1E3OC 4Q0PA 3OQNA 4JCXA 3O9XA 2IXCA 1X8MA 2PUCA 4MCXA 2D40A 3SMHA 3U3WA 3TRBA 2PHDA 1UCXA 1UD1A 1IPKA 5JAXA 2PAEA 4OFGA 4ZU5A 4KL1A 5KHGA 4OB4A 2VECA 3D0JA 1CAWA 2PYTA 1SQ8A 2ICPA 3MDPA 4WBBA 4KWJA 3C3VA 4Q0UA 3GN5B 4LULA 1CAXA 5LRRA 4QM8A 4MCTA 3CF6E 1PERL 5FQ0A 1YSEA 4HN1A 1RC6A 4JTNA 3RYRA 1O5LA 4Q29A 4PJYA 3LWCA 1RPEL 2QNKA 1UXDA 4F7ZA 1Q5OA 2KEIA 3NW4A 5HI0A 3NL1A 4L2NA 3ZHMA 4META 4PU3C 3CO2A 2MPFA 3QF3A 4IETA 4O9GA 1ZRDA 2XI8A 2O49A 2VQAA 3DL3A 4I6RA 4HSJA 2OR1L 1YFYA 2QVSB 1EYBA 3KCCA 3OQOA 5K8SA 3UFDA 1NYWA 1ZX5A 2Q4SA 5LRSA 2IXHA 1QQBA 4BH9A 1CQTA 3FYMA 4E2GA 4GULA 2KEJA 5EZWA 2EWTA 1J3QA 1RGSA 2CGPA 4AVCA 2H6CA 1EPZA 3LA3A 1L3JA 4X6RB 3ZKCA 2R63A 1QQAA 1U12A 4I2OA 1DWKA 4KU7A 3LZZA 1LQCA 3ZHIA 5D1IA 4Y42A 2KPJA 2Q30A 1SEFA 1O5UA 1XRUA 2HINA 5C8WA 1ZZ8A 5C6CA 4DINB 4WVZA 4ZU7A 3UKNA 1UXCA 3LA2A 2BGCA 1CAUB 1AU7A 3L2HA 1J1LA 3F51A 5I91A 5BY5A 4X6QB 3ES1A 1JWLA 1TQ5A 3H9AA 4ONUA 2KEKA 1CAUA 3CLCA 2L8NA 5CU1A 4JTOA 2CAUA 3FHIB 3WW2A 3DV8A 3UKVA 2VPVA 1PRVA 1PRUA 4PIYA 3SCGA 2XHKA 2Z2SB 3R1FA 1UIKA 3E5UA 1ZZBA 4Z5HA 4N9IA 4IEZA 3SXWA 4X4FA 3E6DA 3MLFA 2B9UA 3H50A 3IIAA 4HBNA 3CROL 5I8TA 2N7GA 1I6XA 2LYPA 1LMB3 2XCJA 3JZVA 3H1WA 5LEJA 3S0MA 5JSPA 1JFTA 2EBYA 4R52A 1UIJA 5FDBA 3KJXA 5I0UA 4D7SA 3E6BA 2PUGA 1WETA 5BV6A 3M3IA 5T3NA 2UYAA 2HJIA 4J1WA 1ZZCA 2IXKA 4I02A 4XF3A 2PUDA 1DGRA 3RDIA 4ZU4A 3D1NI 1R63A 5I8SA 1LR5A 1YUDA 5BPXA 5KHHA 5CADA 3KXAA 4YG4A 4PIXA 4XFGA 2H6BA 4KWKA 3D0SA 4Q0QA 4WZCA 4BHPA 4YYOA 5J3UA 4MGYE 4E2QA 5KBFA 2PHLA 2MEZA 2O4AA 3S8QA 2GAUA 3I59A 3IWZA 4AQ2A 2XLGA 5KHKA 5I0SA 1EFAA 1CJGA 3EJKA 3BS3A 3I54A 1WIZA 2AXZA 4J1XA 4NVPA 3F52A 1JFSA 1CAVA 3PVBB 4D7TA 4YSFA 4YARA 4MUVA 3RNSA 3QOPA 2IVGA 1CAXB 2ICTA 2IV1A 1DZRA 2K9ZA 4YBAA 3HZIB 3JXDL 1X82A 1PNRA 1YLLA 3BD1A 2R1JL 1L1MA 1B0NA 4XFCA 4HVOA 5J7MA 3MPBA 3H8UA 1PM7A 3E5QA 3E6CC 4Z5CA 4I01A 2OFYA 2H0VA 4MGIE 1LCDA 1ZRFA 2QDRA 1J59A 4F8AA 2PQQA 3SCHA 2BNMA 4IEUA 2GC2A 4MZUA 2B5AA 3CEWA 1PRAA 5I8YA 1ZPQA 3IDBB 3FZ3A 4FBFA 3CECA 5JCTA 3M70A 1QPZA 1VR3A 2DCTA 3CL1A 2ATFA 4HN0A 3ST7A 3RYPA 1I5ZA 1WH8A 4I8TA 5AVPA 4IEXA 1X2LA 1OD5A 3G7DA 1Y3TA 1UTXA 3OF1A 3MYXA 4Z59A 3HIFA 5LEKA 3E5XA 3H3UA 2PAMA 3ETQA 2UY9A 3HQXA 3KGLA 1VP6A 3FJSA 4EWAA 4X4GA 2UY8A 2ET7A 2L49A 2UYBA 3PNAA 1RZRD 1O7FA 1Y9QA 2PE5A 4E2SA 5I0RA 4PU4C 1LRHA 3NKTA 1OI6A 1UW8A 2MHFA 2QJVA 4I0AA 3G5GA 2IXLA 1XWRA 4Q0VA 1POUA 2XKPA 3H1YA 1H1MA 1QP4A 1YWKA 1SQ4A 4KU8A 4HSLA 4KWLA 4H7LA 3OGJA 2CV6A 2PTMA 2PAKA 4MGZE 4IERA 4QGLA 2OZ6A 4XFAA 2CAVA 2D5HA 2ZCWA 2MQKA 1HF0A 2ZKLA 3NSTA 4LUKA 4HVQA 3I7DA 4IEOA 3RYKA 1S7EA 2B5HA 4PIZA 2FMYA 3BU7A 4BIFA 1DW9A 2PUBA 2JVLA 1G6NA 1ZZ9A 1LLIA 1ZUGA 1V70A 1DGWA 2IXIA 3KGZA 4JVAA 3FMYA 3E97A 2LYJA 4EROA 2LYRA 3QACA 3U10A 5FQ0B 2LYQA 4QGNA 4I6TA 1Y7YA 1O3TA 2PFWA 1ZVVA 4LLOA 1QY4A 4EWDA 4UBHA 3LISA 3HT2A 3S7EA 4OLLA 1O3QA 1LCCA 2EF8A 2IVQA 1NE6A 2LYSA 1ZVFA 2LCVA 3FE5A 1OSLA 1X7NA 4GQMA 1VPWA 1IPJA 4XFFA 4X4EA 1QWRA 2PIJA 3OMTA 1J3PA 2WC2A 1ZRRA 5FLJA 3U11A 5FLHA 4N9HA 1ADRA 2OA2A 3H1MA 3WW4A 4Z5DA 1YFWA 1WLTA 3VK0A 2Q0AA 3DKWA 1CAVB 2CSFA 2XKOA 3ROUA 4XF4A 3L1PA 3BPZA 2D93A 1O4TA 1LKNA 1J3RA 1OFNA 1PMIA 2IC1A 3NVCA 4XEZA 4FAGA 4HVRA 1CGPA 1FT9A 1ZAYA 1FXZA 2H8RA 1NE4A 2XL9A 3FX3A 5K98B 1BDHA 1R69A 2O38A 4HZFA 4AQ6A 3IVPA 3S7IA 4IEVA 3QWGA 4X4BA 2JCGA 4O9EA 1NZCA 4GHJA 3EBRA 2PUFA 1NEQA 3U0ZA 2O1QA 2EAAA 4FT8A 2AW6A 1GT0C 4JV4A 1YFXA 1YHFA 2KXLA 1WH6A 4UBGA 1NXMA 3KSCA 4XFIA 2E9QA 2XIUA 2QCSB 1O3RA 4IWRA 3PLQA 2WFPA 4XF0A 2AWIA 3N4MA 3O14A 4I09A 3UKTA 2C0ZA 3H3ZA 5BXXA 4A2UA 2XJ3A 4TLFA 2GU9A 5I0TA 2BNOA 3H7YA 4IEWA 4XF1A 5FLIA 2XL7A 4QM9A 3I59B 4R8HA 3GYDA 1OMIA 4X4HA 1JUHA 4CYDA 1O4XA 2FJRA 2HSGA 2EA7A 2XLFA 3OCPA 4LEJA 4LUMA 3EO6A 4B29A 4JCYA 2OYZA 4AVAA 3EUSA 2D5VA 2BEOA 3LFPA 4YG7B 5EFUA 4IA8A 1EP0A 4Q0SA 1QXRA 4Z58A 3D82A 1GQGA 1XE8A 3OD0A 3WW1A 2MNGA 1EY2A 1ZZ7A 4IEPA 1NERA 3TNQA 4MV2A 3QYXA 4K8FA 5FPXA 4QMAA 3GBFA 2P17A 2IUOA 3BDNA 4MH0E 3H7JA 4X4CA 5E16A 5JSOA 3VHRA 2GZWA 2LYLA 4EWEA 2GRLA 5JSRA 3JXBC 4F8DA 2LYKA 2IXJA 3B02A 2IU7A 4L11A 3GN5A 1ZRCA 2BNNA 3FYAA 2WUSR 1SFNA 3FFQA 4IESA 4XF9A 4FBIA 2ETEA 2PUEA 3OP9A 2BYVE 4BYYA 3DNVB 1BDIA 3PXPA 4QX5A 2XSDC 2V09A 3F6WA 2WIUB 3BB6A 4MGKE 4YNIA 2ET1A 4FN3A 3USSA 4HLTA 3EHKA 4IEYA 1HW5A 2I45A 5FCCA 5JR7B 2HKXA 2B8MA 3ES4A 2CROA 4XFHA 1J58A 3KMHA 2GC3A 4IVZA 3MZHA 2GC0A 5CVRA 2AXUA 1IC8A 3RPQA 1DZTA 1RZRA 1OCTC 5F1RA 3OQMA 2D5FA 3CLPA 3ACLA 3RZZA 2OZJA 3IDCB 2GC1A 5E1RA 1WA4A 2GH2A 4EV0A 4X4IA 1YFUA 2GRMA 4AVBA 4X4DA 4MX3A 1ZNPA 5FPZA 4LA3A 1RUOA 1VJ2A 1CAWB 3TNPB 4P9GA 4Z82A 2FQPA 4QGMA 2BJCA 1JH9A 2XLAA 2IVBA 1Q43A 2Y0OA 4HMZA 2PPXA 1X8EA 4YG1A 3ELNA 1RTVA 4I3PA 3LAGA 3IBMA 1H1IA 3NJZA 3LOIA 2F4PA 5KHIA 2Z69A 1WGPA 3SHRA 4UXAA 2AXVA 1ZZ6A 3FWEA
chains in the Genus database with same CATH superfamily
4K9SA 4NHLA 2NYYA 1RUJ2 4CA9A 4CDQA 5J1XA 1RUNA 1XYPA 4ER7A 2YBPA 5A3NA 1ZM1A 5F2WA 4CCMA 3F2ZA 2RR13 3M3QA 3W5MA 4XETA 3K3OA 1YQCA 2YUEA 4EQZA 4ZZ8A 5GLZA 4N7UA 4KG8A 4YVSA 1REEA 3VZJA 3W21A 5BUVA 1O3SA 4XJAA 5KWRA 3PUAA 3OTFA 5J48A 1REFA 2BOIA 2CHHA 2VZTA 5C4WB 4CUBA 2QQMA 2W08A 4I6UA 2Q1ZB 2VZ1A 2RS53 1RIOA 4QQHA 2O8QA 2CDPA 3KZ3A 3K4DA 2GZUA 1ULCA 2F17A 4AXOA 1YYNA 4OHVA 3D4KA 5FZHA 3O1SA 1I3HA 4QXKA 1NCQB 3AVSA 4JQDA 2CSGA 2VUJA 3QLQA 4JKKA 3ZN4A 4LO4B 4AOCA 4JZRA 1XE7A 4W6YA 4Y24A 5FXVA 2AGSA 5GJ6A 3R6SA 5CFDC 4Q4Y3 4D8MA 4ZHNA 3RZLA 2XGXA 5C71A 5A7LA 3HT1A 1AHSA 5FUPA 3J8F1 4PLOA 3BCWA 1RUI1 1VAKA 2KZ8A 1S0GA 4RD7A 5AC93 2JE7A 1RHI1 4Q0PA 4BQXA 4YW5A 5JZGB 1F8VA 4LO8A 4Y5Z0 1RINA 4CE8A 2WQ4A 5ANQA 4Y1UA 3RZGA 1UXXX 1X8MA 2VR4A 2ZKNA 5FYMA 1C57A 1IG0A 2Z5WA 3OG2A 1BMV2 2QE3A 4W8JA 4B7KA 5IT6A 3TRBA 2RG4A 3S5QA 1KJRA 4E8CA 5DG2A 2PHDA 1Z0HA 4OFGA 4ZU5A 5KHGA 2YY1A 3L9JT 1R083 2ZMLA 4NN0A 4OB4A 5FMBA 4KWUA 4NO4A 1CAWA 2PYTA 3JD72 3UYJA 1CONA 2W9XA 2ODRD 1CESA 2D3SA 3AYAA 3ON7A 4WBBA 4A7YA 4KWJA 2A70A 3ZYPA 2PXQA 1J1TA 3I97A 3PURA 2PXPA 2DUQA 2R063 3BVCA 2OUHA 2VD7A 3PTRB 4GKYA 5LRRA 4KMQA 5A3UA 3BI3A 4MCTA 3DM5A 1PVC1 1T6GC 4W4ZA 2JB8A 4JTNA 2YC0A 5HV4A 1PO21 4CDXC 1YCIA 2XH6A 1W6MA 4XIKA 2TEPA 5TSWA 2WNVB 4BISA 1Z78A 5FZEA 2FMDA 3ZSEA 4FPEA 1B35B 2RR11 2W2IA 3QF3A 3A4UA 3IPVA 5EV7A 3VLBB 3RZHA 2R073 3CJIB 2QQVA 2VVEA 4O9GA 5BNQA 1ZRDA 3FMGA 4GJYA 4DIQA 2BBVA 3DL3A 1S0JA 1QXPA 1SACA 1HN1A 2QQLA 1ZRIA 2HBTA 2R041 3C7OA 4HSJA 4UW6A 1COV1 5FREA 1EYBA 1NYWA 1ZX5A 2QQPA 1UN1A 5FPLA 4BH9A 2OVUA 4FTEA 3FYMA 2JG9C 4E2GA 2F4LA 1QJY2 1IKPA 4S2GA 1B35A 1FOD1 1UAIA 2CWSA 2ZZJA 3T0BA 2EIBA 4A4AA 5IVCA 1XNAA 1J3QA 1MS9A 4RYDA 3VDBA 1LOAA 2H6CA 1JZ6A 1LESA 2VUAA 3CDZB 1QJU1 4AQSA 3ZKCA 2R63A 4I2OA 2HH9A 4NPMA 3TAYA 1V9U3 1OH4A 4BQ4A 1RIRA 3ZHIA 5BNNA 2KPJA 2HWB2 1XRUA 2M4HA 3VHNA 1N1SA 4MXWB 1ZZ8A 1ODMA 2QFEA 5J37A 1W2TA 1YQ6A 4ZU7A 1UXCA 1HQNA 1PX4A 3IMNA 3LA2A 2L1PA 3A9YA 4Z8BA 1CAUB 1AU7A 3O1PA 1RUI3 1VBC2 1OA4A 5IW0A 2BDRA 4NOTA 5K0UA 4BQ5A 1MR5A 1LEDA 4AFBA 1AXZA 3WDVA 5K0UC 1Y9MA 2DU0A 2J1VA 1K12A 3KV5A 2RDNA 4YW1A 3UKVA 2Y33A 2JENA 1PRUA 1PVXA 3ACHA 2XHKA 4PIYA 3ZN6A 3B93A 2JG9A 5F3GA 1Y9GA 1XU1A 3GM8A 2BV4A 1VBD1 3AJYA 3MICA 2VGDA 3LQXA 4HANA 4IEZA 2RS12 4DRRA 3SXWA 4NRQA 2B9UA 4HBNA 2NQYA 5FYUA 5I8TA 2N7GA 2LYPA 1HRV2 2JG9B 3H1WA 3UT0A 4D0QA 5H9SA 3S0MA 5FZ9A 2JDNA 4XJ9A 4R52A 3IDEA 5CKMA 5FDBA 3VL8A 4FPOB 5CFDB 1W99A 2PUGA 3E6BA 1WETA 2RS11 4COYA 5T52A 4UAPA 2IXKA 2DDUA 4ZU4A 1F4AA 1STMA 5K4LA 5FK8A 1W8TA 1LR5A 5LA0A 2WO7A 1VMHA 5CADA 4CPBD 1SLLA 2X5IC 3KXAA 3GHMA 4GH4B 4P14A 1LU2A 1R093 4PIXA 3VBOA 4BDVB 5CKQA 2Z79A 2BJSA 3I3QA 2WZR1 5IATA 4AL9A 3AK0A 4E2QA 1JZ7A 1TNRA 3MGUA 3PMSA 4WZFA 2E53A 1D7PM 5FY9A 4CCOA 2HWD1 2MEZA 5DRTA 2YU1A 3PDQA 5KHKA 1ULGA 3WP5A 1D2QA 3R05A 1XC6A 3AP9A 4YW6A 3EJKA 4XUOA 5JUVA 4K8RB 1MACA 2YC2A 3WF4A 1J84A 1OURA 1WIZA 5EYYA 2AXZA 4CEWB 2GSYA 4J1XA 4MG2A 2UWAA 4D7TA 1QQP2 1URXA 3ZMOA 1ASJ3 3JBG1 4BM8A 1AL21 4E4ZA 4MUVA 3RNSA 2E51A 3QH6A 2IVGA 3DYMA 1V9U1 1DZRA 1LOBA 1PO11 1GBGA 3LIHA 3JXDL 1QOOA 2JD4A 2NN8A 3Q8EA 2EXKA 4DY5A 3K48A 2VCMA 2VO5A 1JYNA 4D7YA 1X50A 3PJYA 1PM7A 4Z5CA 3VL9A 3ZFGB 4XPVA 5JPNB 2ZHNA 1UWWA 5IVYA 2PXBA 4DRVA 3CNAA 1UMZA 2RJLA 1W05A 5K9YA 2RR12 1J59A 3SCHA 1W2UA 1AR73 4IEUA 2DFCA 4QPGC 2B5AA 2YHJA 4EZHA 3MW3A 5FZ8A 1PRAA 2WQZC 1PIV1 3I2GA 5IVVA 5JOXA 1DYOA 2GH8A 4FBFA 3VBUA 1UMIA 2VOTA 1VR3A 2RV9A 1VBA3 2ZS6B 1N3QA 3KM5A 5F2SA 3ZFGC 1F31A 4HN0A 4A44A 4EN9B 2JIGA 2LTNA 2TNFA 5L9VA 2Q8DA 1Y3TA 4ER3A 3G7DA 1JYCA 4K3UA 5K0UB 3J7LA 1QOTA 4KI5M 1YQ8A 2PAMA 5EJ1B 3J9SA 2J7WA 1JHNA 2UY9A 1LHVA 4Q4V1 3SKJE 3T2OA 3S6PA 4NROA 2VMDA 4NHXA 3AB0A 4CVUA 3PNAA 4HT1T 4GH4C 4COWA 5F8PA 1YI7A 2YPJA 1S0DA 4E2SA 3NKGA 4PU4C 1LRHA 4AYUA 4AI2A 2A3XA 1OI6A 1UW8A 1W90A 5A7NA 4YFWA 2V5DA 3GBWA 5FXWA 2GNTA 4A6SA 3QOXA 2ZA9A 1GP6A 3NAPA 1POUA 3NJYA 5GZFA 1QDOA 4TN7A 1SDWA 3N9MA 3WQ7A 1KFXL 2DU1A 3ZXGA 2XPJA 2PMWB 5KXBA 2VZOA 1XNTA 3U78A 2YYOA 2ZGNA 3WF0A 2E33A 3LB9A 4H7LA 1DQ6A 1K5MA 2CV6A 2IVIB 2ZMKA 4XJ8A 4F83A 1S55A 5JIUA 1VBE1 2PAKA 2NPIA 3UESA 3K46A 2D5HA 2ZKLA 2MQKA 1HF0A 5GM0A 3VBOB 1G9CA 1XNKA 4HVQA 4Q4X2 4Q4W2 4AFCA 2Y26A 4LE4A 4TWTA 3NO8A 2LLWA 2B5HA 2FMYA 1OOPC 3BU7A 5E88A 4PDWA 2JVLA 2CTVA 2JIJA 4O65A 3DXUA 1C1FA 3AYDA 1LLIA 4LLFA 1UPSA 3BIWE 4LT5A 1DGWA 1A6CA 1HQLA 4QPWA 3VHOA 4BQWA 2X5IA 4Y22A 4UWDA 5FQ0B 3GZDC 1OLQA 2LYQA 1MS1A 1ULFA 2ZOEB 1AR83 4QGNA 3NXHA 1A8DA 5JMOA 1Y7YA 2EAKA 1RUE3 1SCSA 1KD7A 1UX7A 5DAPA 3S7EA 4LBMA 4A7KA 1IS6A 4CUGA 3T0AA 2IVQA 1NE6A 1UZZA 5FY7A 1DIWA 2AEZA 3FE5A 3TFLA 4LR4A 3C7GA 3T1MA 2WFF3 4E4DX 2VCAA 4D6SA 5A7WB 5JSOA 2WZR2 3TRSB 1J3PA 2KA3A 1BKZA 2KM2A 1H2LA 4PQQA 3DPRA 1ZRRA 3GF6A 5FLJA 3OPWA 1HV0A 2HWE3 4N9HA 1X9PA 4R4XA 2DURA 1RJ8A 2ZPXA 1V6NA 4IDZA 4YM3A 1S0IA 1TMF3 2Q0AA 3VBSB 4QPYA 1W6OB 2XKOA 4CDWC 2JE9A 3VWSA 3EB7A 3GZTB 5LBBA 4QPIB 1O4TA 1IS4A 1J3RA 2JG8A 2VOVA 1PMIA 2R062 2WIIB 2HYXA 2XDVA 4AFAA 2EXIA 4B4PA 4FAGA 3GZDA 3AKSA 2H8RA 2HWD3 4FFHA 4GZ9A 3FX3A 3WP6A 1BDHA 5GALA 4KBBA 4JKLA 2WL1A 4IEVA 1D4VB 4AE2A 4X4BA 1HJGA 2JCGA 1NZCA 4N53A 4GHJA 1DQ5A 1MZ5A 4IE6A 4NHYA 4EJRA 5JI9A 3EBRA 5LA9A 5JDBA 1WLCA 3VBOC 2PLV3 1QF3A 2JDAA 2ZMNA 4CCNA 3G6JB 4UBGA 3NZLA 1NXMA 1DFQA 1TMF1 2BWAA 1FYUA 2R072 2XIUA 3KSCA 4K40A 5DDJ2 5FZFA 3T4VA 1O3RA 2D97A 1V6JA 4BLIA 1JYWA 1RHI2 4QQPA 2HWC1 1POV3 1VE0A 3M4FA 2TBVA 1APNA 3ORJA 1B35C 4DXZA 4C0HA 4I09A 1Z7S1 3UKTA 3UGHA 1ASJ2 1YI9A 4A2UA 1AVBA 4YZ3A 4TLFA 2DBNA 1CR7A 2BNOA 4XOGA 3WF3A 3ZPYA 2Y0IA 4YW2A 2XL7A 3MUZ1 2JICA 1XQNA 3OUJA 4K1ZA 1VBA1 5JVVA 4AEDB 4A7ZA 5GZCA 1HRI2 1PHMA 1JUHA 4XXPA 5FZ3A 3T08A 4CYDA 1E5SA 3IN9A 1GWKA 2V73A 3OY8B 1AJKA 2FJRA 5C3RA 4YZ4A 1RUE1 5F3EA 2ZTNA 4OI2A 1UOGA 1N1TA 4LEJA 3W20A 4MOAA 4B29A 3LGRA 3EUSA 3IAQA 2BEOA 3WLUA 3AP7A 5EFUA 4IA8A 3DECA 1QJFA 4Q0SA 1QXRA 5J98B 1AJOA 3JBG2 1U5IA 3OD0A 4OUSA 2G9GA 4N43A 2ES3A 3WW1A 3U37A 3O12A 2GMMA 2VNGA 1ZZ7A 1GZ9A 2DV9A 4XCAA 2EALA 4N90A 4QKNA 4V1PA 4GIQA 1WWYA 5FPXA 4L92A 1CX1A 3GBFA 1DG6A 2XBO2 5FZMA 5LATA 3FUOA 4TYSA 5CB7A 1VBE2 1X9TA 1VBB3 1AR63 1H2NA 2Y38A 3K3NA 3B3QE 5FP9A 3RG0A 4PHZA 4Y5SA 2DTYA 4X4CA 3M7AA 3RWNA 3V56A 2ZACA 4XABA 2VNRA 2LYLA 3FC0A 1PZ9A 4LITA 1UKRA 2ILMA 2UWBA 2WWUA 5FZ4A 1R082 5JXJA 4L11A 3WQ0A 2NMNA 2CNAA 5FO8B 3FUQA 2IFWA 2XWBB 3B00A 4JDMA 2WO1A 4Q8LA 5CFCA 3POIA 4BU2A 4XF9A 2WNUA 1K45A 4PF1A 3ZKUA 3DNVB 3Q8BA 2J1AA 5FZIA 2V09A 1DHKB 4MGKE 4D3WA 4YNIA 4URAA 5FYZA 2ET1A 4H2AA 5FZLA 1CN1A 4LIVA 5A7QA 1ZBA2 1WLDA 2I45A 5DDJ3 5JR7B 1CQ9A 3LEMA 5FUIA 5DMYA 5KXDA 3ES4A 5SV8A 1H0BA 5FZKA 1NA1B 3B5LB 4K7JA 4LO7A 4S2DA 3OEBA 3VBFA 4WM7C 2E63A 5GKAC 4NPRA 4IXLA 5BNNB 1JI6A 1PK6C 1NXD1 5AC92 4DE9A 3PU8A 4HKLA 2XVKA 3MEPA 5CVRA 2JDPA 1IOAA 1RB8G 4XCBA 3CLPA 4QT6A 2F6BA 2GC1A 5E1RA 1WA4A 2FZ1A 5C33A 3NDBB 3MUY1 3K75B 4PLMA 4C91A 4EV0A 3AFGA 4X4DA 2A1XA 1MS4A 2A73B 3O0WA 1IPSA 2G9FA 3ZYFA 5CA6A 1ULOA 2I74A 1NY71 2E32A 4KGQA 3ZLIA 3TEYA 5DUXA 1CAWB 3TNPB 2ZGLA 5D8AC 5LWBA 1JH9A 2XB6C 1Q43A 2Y0OA 4XDOA 3WXPA 3RQ0A 2ZX0A 3NJZA 1GOHA 2Z69A 3ZFEB 5EWSA 3EXUA 1IZ3A 4P5YA 1CJDA 1ND2A 1PX3A 5GLVA 3SHRA 4LO5B 3RI8A 4CXWA 1NQDA 2AXVA 1C8NA 2DVGA 3ECQA 4GQ7A 4I0WB 5A3WA 3RGBA 4AGRA 4D94A 4FTSA 1REDA 3MBWA 4NDWA 1ZREA 2IVJA 2GNMA 2W92A 4B7EA 1DULA 2WUHA 4LBKA 1L7LA 5IVBA 1AX2A 1PNFA 1SFPA 1RZSA 3ZIWA 3VZOA 3ZPOA 5C9AC 3VD4A 1PM4A 4Z1VA 4IEQA 4FPJA 1X57A 1UKGA 3GDBA 3NNMA 4FPHA 1GQHA 3T09A 2PXUA 4FP2A 4CPBA 4IE4A 4Z07A 1BEV2 1DQ1A 3I3BA 3MI8A 1Z7S2 5I93A 1ENQA 4OMCA 4QHZA 1PZ8A 4LA2A 1PO12 4OHXA 3CZJA 3B7HA 1JZ4A 3HNMA 1H6XA 4D6QA 1AR61 4E9KA 4OVEA 1O4ZA 4G9SB 2WRAA 5T54A 4I0BA 2JDZA 2JD9A 1M06G 1AL22 5FY1A 4YGEA 3VDCA 3WVJA 2FDHA 1CX4A 1RUE2 1SCRA 1V9U2 5FY4A 4UFKA 3QQ6A 2B42B 1QP7A 3H3LA 4FPCA 4JGYC 4CCDA 2E31A 1FV3A 2BUKA 4G3YC 1HKDA 1Q3EA 4H55A 1WBLA 4LIUA 1GMMA 3HMYA 1BXHA 4UFLA 3HN3A 4DUVA 1RUF1 4CU8A 3JUUA 3VKOA 2JDMA 3IDAA 1RMU3 2YGLA 3GBGA 3MFCA 1C1LA 4CDUB 3ZYGA 4BZ4A 4P02B 3KWVA 5CAZA 3TB0A 3U3WA 3A7QA 2ZGMA 1GZWB 2IFRA 1BCXA 1UCXA 1IPKA 2GP3A 4DOUA 2VTFA 5JAXA 2QDNA 3QFIA 2VCBA 4XJWA 2BFUL 3D0JA 3N9QA 3P5BA 3WEZA 4FOVA 2VMFA 3UL2A 3AX4A 3RWKX 2ICPA 2RE9A 3UJOA 4S2HA 3VBHB 1COV2 4LBLA 2VZ3A 2WNVC 2VBPA 3GJBA 5C5UA 1H2MA 1VBC1 2JXAA 4Y5TA 5EJ3A 3RJRA 3GN5B 3UGGA 1XNBA 2W68A 2BPA2 2C26A 3AMPA 3CMGA 1OBNA 1A78A 5D21A 2DYCA 2VY0A 3APBA 3N9PA 1LNSA 1PERL 5FQ0A 4AEKA 3UJQA 3RYRA 4DMIA 2Y34A 4Q29A 4I30A 3D8CA 3LWCA 1RPEL 5FAXA 1SMVA 1Q5OA 4BK5A 5C8CB 2KEIA 3NW4A 1SBEA 2XWJB 4L2NA 3ZHMA 2E6VA 1XYOA 2V5YA 3FLTA 4PU3C 2YBKA 4QX0A 3VKMA 4AWDA 4B3NA 1ZBA1 2HEVF 3TN93 1BYHA 1QGLA 5A3MA 4PF5A 2XI8A 4N43C 2O49A 2Q8EA 1VB2A 2VQAA 2WZPP 2JECA 2VQ0A 1G8WA 3RMYA 1YFYA 2VNVA 2YFZA 1XNCA 4Y4RA 3OQOA 4H3WA 1G7YA 4AFDA 3UFDA 1RUH3 5A32B 1C8M3 4Q1RA 2BW8A 3U75A 3R4UA 5FMOL 4CDUA 5FZGA 3I2FA 5EPAA 2HWE1 3USUB 1QDCA 2JE8A 1PNGA 5F7UA 5FZOA 1TEIA 4C90A 2DCYA 1EAH3 3BODA 3NAPB 1FMD2 5F5QA 3JB4C 2JG8C 3WV6A 1U12A 5L19A 1VMJA 1C5IA 1LQCA 1PZ7A 2Q30A 1OKOA 3LKJA 3VBRB 1O5UA 2G4IA 4QPIA 2HWC2 4BCUA 5C6CA 1W8FA 5JXIA 4BQ1A 1QIQA 2YV8A 2PQSA 3L2HA 4AEMA 1W8ZA 2XR4A 1JZ3A 3F51A 5ABJB 2VL4A 4X6QB 2VZUA 3ES1A 1JH5A 3GNEA 4ONUA 2VG9A 5JMCA 2VMGA 4IE5A 5EQUA 4WM7A 1H2KA 4JTOA 5CU1A 2XXPA 2VXJA 3I2DA 1NKGA 2CAUA 3WDYA 3WW2A 3KL4A 2VPVA 1PRVA 1OA2A 3J4UH 1W6PA 4QQOA 1O8SA 3R1FA 2GP5A 5T50A 2VW2A 1FPN1 5F9TA 2BTVC 3P3NA 1POV1 3IIAA 1XNDA 2VTXA 1GWMA 4LHSA 3VBUB 5IYYA 2W46A 3POWA 1I6XA 1AYN2 4LHNA 5T5JA 3VHPA 2HWF2 3ZOIA 5FYYA 3VDDC 3WCSA 2R061 2X5IB 4YZ2A 3KJXA 1W0OA 1V00A 5I0UA 1SFYA 4D7SA 5DG1A 4N53C 1E57A 4JRAA 1ALYA 1ZZCA 2JQEA 2W1QA 4I02A 4B1LA 1UU5A 4N43B 1DGRA 1WD4A 1GWLA 1JMUB 4QQ2A 1R63A 5I8SA 1YUDA 2Y64A 5IAVA 2QQNA 4NHKA 4A3XA 5C4WA 1R64A 1DQ0A 2D3RA 3ASIA 2VUDA 3D0SA 4HFSA 1VPHA 5IFPA 5J3UA 1V6LA 4MGYE 3W59A 4ZXEA 4UF0A 4Q8KA 2VMHA 2Y6LA 2PHLA 1OH3A 4P08A 3LIGA 1W2NA 3MV01 1AR92 3IWZA 4AQ2A 3VD9A 2OUJA 4EKGA 2XBO3 5H9RA 3ZVXA 4ASKA 3V0AA 3VBHC 5KR7A 4GWNA 4L0PA 2A75A 1WZXA 3H42B 1D0GA 3B9CA 4NVPA 3F52A 4M3CF 3SC7X 3VBSA 5FOBB 2ZGQA 1O6UA 5DZGA 3OKZA 1BJQA 4YSFA 2Y8KA 1KDKA 4Q2JA 1YXWA 4BPZA 1D4M1 5L7OB 2ICTA 2IV1A 2PHUA 1OFSA 3MF9A 1F5JA 2K9ZA 5CIRA 3MW4A 3ZN6B 5LK7B 4FO9A 1X82A 4UW3A 1W9WA 2ZX3A 1B0NA 4QD2A 5J7MA 2ZGOA 3F95A 3MPBA 3E6CC 1RUC1 2FCTA 1A34A 4I01A 1XOYA 1NAEA 4C1WA 3A21A 4QKFA 1HV1A 2H0VA 4DY3A 1NY72 1LCDA 2YBSA 3HBZA 2A3YA 3I3DA 4W6WA 1SPPA 1N3OA 5DAXA 3WX5A 5CKNA 3NV1A 1HB1A 3CJIC 2J42A 2A3WA 1GFF2 3CEWA 1NQJA 1ODNA 1QOSA 4EKIA 2HEWF 4XMAA 3VZMA 5I8YA 1PIV2 2DUPA 1X33A 5IK8A 3M70A 1QPZA 1VBD2 2DCTA 1AF9A 2QBXA 3GCWA 2ATFA 4HOOA 1I5ZA 2V4VA 1U2ZA 4I8TA 1XSRA 5A6XA 1X2LA 1OD5A 3OUHA 4XDQA 1RUH1 5LEKA 4NPLA 2RMU2 2HWE2 3IB3A 5A3TA 1HQWA 1RJ7A 4R9CA 5FYSA 2O8OA 1DLCA 4LPLA 1XU2A 1JZ8A 4Z2AA 2I07B 2L49A 4ZXKA 2RS32 1N47A 4IV1A 5FYTA 1KS4A 4AFMA 3URFA 5FR3A 5I0RA 1MEC3 2PELA 4FQ4A 4N8MA 3KZ4C 5DRYA 5L7OA 2WABA 3I2KA 2VQUA 4I0AA 4JRLA 3G5GA 4KQ7A 4CU6A 4RL7A 5ABJC 2MEV1 4DNYA 5FBJA 1XWRA 4MXWA 2DVAA 4Q0VA 5F6KA 2JWPA 3OYWB 3PVNA 1GQPA 1QJU2 1RMU1 1LCLA 3H1YA 5DN2A 1H4HA 1S2EA 1VIWB 4BXSV 4CDXB 1US3A 4GB32 4CP1A 1H1MA 4JQTA 4RHV3 4HSLA 5FZAA 3T4HB 3TOJA 1UY0A 1LODA 2GMPA 2J1EA 2V72A 4XQDA 1QNWA 2PTMA 3KD4A 4MGZE 3MW2A 1R1ZA 5A3OA 4IERA 4JGZA 4PI0A 2OZ6A 3RI9A 1IHMA 4OUMA 2EXJA 4K21A 1GICA 1HXS1 2ZCWA 2ZGRA 3NSTA 4MSVA 2AYHA 4RN5A 4XJUA 4BJ0A 2GN3A 2NZ9A 3DXTA 5DT2A 2ENRA 1OOPA 1EAH2 1Q8QA 1S7EA 3OBZA 3PUQA 4IEOA 4XBNA 5D8AA 1FMD3 4PIZA 1XBFA 4A45A 4OZXA 1S2KA 1JXNA 4S2FA 1IS5A 1P8JA 2OIIA 4N53B 1WMFA 4FTBA 3OUIA 4ZPIA 2YBDA 3D3AA 5IHRA 2WLQA 2X05A 2VCCA 2XXAA 3E97A 3RZJA 2LYJA 1F15A 3J8F2 3QACA 3U10A 2OXBA 1RUD3 2JX9A 4C0BA 2J22A 3PVEA 1O3TA 4BIOA 3KVAA 2R0FA 4LLOA 1QY4A 1AR72 3JQXA 2WN2A 2XXQA 3LISA 1PGW1 3HT2A 2YGMA 3JB8A 5F39A 5B4XA 3DF0A 4OI4A 1O3QA 4RR3C 3U1XA 3B94A 4AEJA 2C4XA 2LCVA 1SBDA 4UFMA 4CP9B 4Y4YA 2ARBA 1LHWA 2D6PA 4NIDA 1VPWA 3AMQA 1ZA7A 2O14A 3B9IA 3N9NA 3B69A 2PIJA 1T6BX 1VRH2 3P3PA 3T0DA 3RVHA 1OQDA 4C1XA 1H8VA 1UZWA 4FP3A 2W3JA 4AHWA 4QX3A 4R9DA 1OC1A 2IWGB 3H1MA 3WW4A 2CU5A 2WLPA 4W50A 3MIGA 4Q27A 4EZIA 2RS33 3DKWA 3BUCA 1BEV3 1DDLA 4J25A 5FUNA 3ROUA 4XUNA 4CEWA 3AVRA 4YVSB 1EV12 2D93A 4CCKA 4E27A 3SQOA 1DCSA 1MS3A 4FPLA 2QQIA 3NVCA 2WS92 4HVRA 3K77A 1FT9A 2EXHA 1FXZA 1NE4A 2G1MA 3T3YA 2XL9A 3BU0A 4AQ6A 1RXFA 1TNFA 4HZFA 3VUOA 3IVPA 2JEMA 3A22A 3AZYA 2J1SA 3QWGA 1WA6X 2XBO1 4QU1A 4O9EA 3ZX7A 5IK4A 5JXHA 3ZXEA 4FPKA 1AXKA 1QJX2 4ZS3A 4AI8A 2PUFA 4PDWB 4DZGA 3W58A 3U0ZA 2EAAA 3M3OA 5FBZA 5F37A 5F3CA 3VD7A 5DTMA 3TN92 3KB5A 4AG4A 1H30A 2WJSA 2E9QA 4XTPA 3WHUA 4LOSA 1RUF2 2YB7A 1D4M3 3ZFFC 1DGWX 2A6VA 1LENA 4FFGA 1F35A 1OD3A 2YXSA 4XTMA 4EK9A 1QJX1 3ZXFA 2AWIA 3O14A 1MS0A 4QXBA 5IWFA 2C0ZA 3PL0A 5A1AA 3H3ZA 1OT5A 4H14A 4IV3C 1C28A 4XF1A 1CZSA 2UU8A 2XOMA 4R8HA 4Y1YA 3EYPA 1OMIA 1G9FA 3LOBA 2BZDA 3N9LA 4L9BA 3VD3A 2C1FA 4L97A 4CDQB 2ERFA 4CTEA 1FV2A 4GMP0 4M4RA 5AC91 2HWB3 4JGYB 3RJ2X 4U36A 4GXLA 1C4RA 2D5VA 4IV1C 1OOPB 4P9LA 4E4SA 4YG7B 3SEEA 3T2TA 1UY2A 3D82A 1VBC3 2XVGA 2WZEA 3KVBA 5A7PA 1GYKA 3GALA 5GLUA 5C3PA 5BNOA 4XIOA 2YFUA 3NWKA 3OBRA 1NERA 1GKBA 4IL7A 1N1VA 1OLMA 3ME2A 4U2AA 3QYXA 4K8FA 1DYPA 4QMAA 1OPOA 4RQPC 3UV9A 1H4GA 2VW0A 3THCA 2P17A 4LE3A 2QUOA 3BDNA 4MGQA 5CG9A 5B2GB 2B45X 1VMFA 2E7QA 3H7JA 3THDA 3ILNA 3CQOA 4BA6A 1MFQC 1K42A 1UO9A 3K51A 2B39A 4YFZA 2W1WA 2LYKA 5H9QA 3B02A 3WSOA 2IU7A 1AYN3 3GN5A 1YQ2A 3K4AA 3BOWA 1UQXA 4RHV1 4LBNA 1JOBA 2WUSR 2J1TA 2W5FA 4DXSA 3WNOA 2ETEA 1JTZX 5J36A 3KT7A 1BDIA 1V6MA 4NUBA 1BMV1 3NV2A 2WIUB 2ZX2A 2WT1A 2ZGSA 4Q4X1 5FPUA 3USSA 2Q1MA 5C70A 3EHKA 1HW5A 3OGRA 5DUVA 2D44A 4UT5A 1AR71 4RHV2 1J58A 3IPVB 5EIYB 1D4M2 1AXYA 1B09A 2WKKA 3AC0A 2GC3A 3KMHA 5IUQA 3PUHA 5BNOC 2FZ2A 2ZABA 1HN0A 1D0HA 3ZPXA 4J6GA 2BOJA 2AXUA 1FPN2 2LW8A 2UWCA 4NAMA 3SKVA 4P9IA 3A9ZA 1OCTC 5F1RA 1GV9A 4UFIA 2D5FA 3WG3A 2OZJA 5FYCA 3I3MA 2GH2A 2ARCA 1PGL1 2GRMA 1ZNPA 4R4ZA 5FPZA 3S57A 3ZYHA 2YMZA 5BNNC 1VRBA 4LA3A 1RITA 1Q8OA 4Q26A 4WM7B 1RUOA 4JX0A 4P9GA 4XMIA 3U4XA 2CDOA 1H6YA 1K3IA 3MV11 5FY5A 2BJCA 2W91A 2XLAA 4CCLA 5ACA1 1X8EA 3KHBA 2P37A 4WM8C 3AM2A 4I3PA 4EE2A 4LHLA 2FDFA 5FYIA 4CDWA 3WNMA 3LOIA 3M1HA 3WDXA 5A7OA 5A6QA 5KHIA 3KHCA 2JB4A 1WGPA 3ACIA 2PLV2 4GALA 3JQWA 3WG2A 1SG3A 3SISA 4AVTA 5C3OA 1ZZ6A 5C4WC 2AENA 5EYXA 2ZX1A 3LF7A 4Y3OA 1H8TB 5C8CA 3ZDSA 5DSXA 5FZ7A 3LFMA 4IGPA 4XFBA 5GAHi 2W47A 4XHXA 4YG3A 4EN0A 4CXYA 4AHXA 2WNEA 3LA7A 2D3PA 3VZKA 3OGGA 4UF0B 1OQ1A 4FAHA 5ERLA 1HXS3 5T5PA 5DTRA 2WDBA 1WW7A 2WN3A 2H0BA 1WUVA 4Q4W3 2RDSA 3CIHA 1NCQA 3W9AA 2YC4A 3M2MA 4A6OA 4CXXA 2K0GA 1QP0A 3A9XA 2E7AA 1C8M2 3N35A 4AQTA 2PUAA 1JBCA 4DS0A 1LB2A 2PA7A 2RS13 3EQEA 5A6YA 5BNPC 3GZCA 2DVFA 2Q5TA 1G9DA 2AUWA 4PLNA 4XACA 2QTWB 1NT0A 4CEWC 3CZUA 2WNUB 2DCKA 2VU9A 3WW3A 3T1LA 4YVWC 1TVGA 3PVOA 1DQ4A 3NROA 1W03A 3AKQA 3AYCA 4HONA 1BBT3 4R9BA 3VBRA 3O1UA 5CYYA 1ASJ1 3JBG3 1L7RA 1WBFA 4FQZA 4ES9A 1LECA 3ZXKA 1RVF2 2OS2A 1WLWA 3BOPA 3ACGA 3BALA 3IZOA 1LHUA 4MO3M 1LJ7A 1FI2A 2I2SA 2W95A 3TEZA 1W2AX 3DN7A 2AACA 2RJ2A 4YRDA 1E3OC 1FPN3 3BTZA 4LKDA 1ULEA 3OQNA 5G04L 4DEVA 5DPNA 5FP8A 3LDKA 1IQAA 2IXCA 4MCXA 4XDPA 2XVLA 3O1OA 3WQ1A 2D40A 4HK9A 3SMHA 2P3JA 2ZHMA 2GALA 3J7NA 4PBPA 3VB9A 3A0KA 5ANNA 2XXZA 3OPZA 4PT6A 4ARXA 1CZVA 5CISA 3LEIA 4O7XA 2Q8CA 2VMIA 1HRI3 4EYUA 2VQTA 1RUG1 3O7OA 4Q0UA 4LULA 1CAXA 2XUEA 3HQRA 3PIJA 4M3CA 5IJRA 4XYXA 4MGTA 1YSEA 1BQPA 2VC9A 1RC6A 1IQDC 5FZ6A 3PE5A 1BK0A 2BGOA 4B1MA 4LBQA 5FP7A 2P3IA 3OBAA 3KF5A 3NL1A 1AR82 4NIIA 3VBFC 5HI0A 4LBJA 2FDKA 1DZQA 2MPFA 2NM1A 2ZAHA 2D6KA 3NNLA 3Q9OA 4LXLA 3RFRA 5LASA 1QEXA 2P5BA 2D6MA 2WQ8A 4NE9A 1MEC1 1ZBE3 4RSUA 3KV9A 2QVSB 4QX7A 4XQ4A 1OQEA 1W8OA 3ILFA 5DZFA 4BLJA 5LRSA 5A80A 5JOZA 1Z7S3 2IXHA 1QQBA 3KT4A 3VZNA 3CJIA 5C3QA 4RGKA 4ITCA 1PK6A 3AZZA 4JDNA 1PO13 3R0RA 1QJEA 4ASMB 1F4HA 1WW4A 3V0AB 1E5HA 4RS5A 5GZEA 4YVWA 1PGL2 2CGPA 4AVCA 3QH7A 1EPZA 1HRV1 2PXEA 4E4HA 4CRQA 3LA3A 1AL23 4X6RB 2GNBA 5EJZB 2AREA 4Y20A 1QQAA 5LW9A 2JKXA 2RMU3 1R1A3 3QD6A 1MVEA 3LZZA 3B01A 4Y42A 5ISLA 2HINA 3ABZA 4XUPA 4YWAA 4XURA 3AZVA 5LB6A 3KS7A 4DINB 3SNMA 1W9SA 3UKNA 2P3YA 2R49A 2GDFA 3OGSA 4AZZA 4YZ1A 5KC6A 2FHRA 4DXTA 3WDUA 1IG3A 5BY5A 4XBQA 4LK6A 3POJA 3GXUA 1TQ5A 3H9AA 4Y1VA 3U14A 1UYXA 4AHYA 1SDDB 4PCRA 1LGCA 4URTA 2VUCA 2VM9A 1U5XA 2JDKA 3FHIB 5A3LA 2XQXA 2X29A 1LEMA 1Q8PA 4Y1ZA 1UIKA 4GMP3 5JR2A 3E5UA 5FIXA 1ZZBA 1RUF3 4N9IA 3LQCA 2KR2A 3P6BA 5FYVA 3BGAA 4BWOA 4LOTA 3CKHA 1TG7A 2BQPA 2LALA 2OT7A 3H50A 3OSDA 5F5IA 5C9AA 4B8EA 5EHDA 1UZVA 3ZM8A 2D6NA 4Q2FA 3JZVA 1ND3A 5FXZA 3DYPA 4MGSA 1JFTA 2EICA 3MHZA 4AI3A 2AZ5A 1YIFA 3POFA 4AR2A 1UZ0A 2VTXJ 3WHTA 5BV6A 4YVWB 2UYAA 4Q4V3 2HJIA 4J1WA 3WNLA 1RVF3 2P4EA 5T5LA 3D1NI 1SZBA 2HEYF 4DE8A 1BEV1 3RS6A 5BPXA 4JQRA 2QQOA 4AF9A 4YG4A 3BKZA 2RVAA 3VDDB 4YGCA 1OSGA 4Q4W1 2W0XA 4XFGA 3KCYA 1PO23 2H6BA 1WMDA 5CBLA 1DLLA 1RUH2 1LGNA 2JDUA 4Q0QA 2HCNA 3MO4A 4BHPA 1W3XA 1KS5A 3N36A 5KBFA 4MADA 4Y1XA 4W65A 4OHZA 1SLBA 2O4AA 1KJLA 3I59A 2XLGA 4LKFA 4RGAA 4INDA 4AEDA 5I0SA 3H8XA 1CJGA 1VRH3 1RYYA 3CU7A 2ZEYA 3NNJA 3BS3A 3I54A 2PLV1 1VBE3 4FPGA 4XBLA 3ZIXA 1NCQC 4P5HA 1G86A 3AFKA 1XE0A 2BRTA 1NCRC 3PVBB 3ZFEA 2MEV2 3NJVA 3LDRA 1CAXB 1OUXA 1A3KA 1R1A1 3T2PA 3H8OA 1WCKA 5FY8A 4QB1A 2RM23 4OHWA 5AVAA 1PNRA 3K4ZA 1FX5A 1GNYA 3BD1A 1YLLA 4HPKA 1JZ2A 2PXVA 1L1MA 5FZBA 2CGOA 2WS93 4V2WA 4TTGA 3OWQA 3H8UA 1W6NA 3E5QA 4KGGA 1XPWA 1NX9A 5FZ0A 1S2BA 4FCAA 2OFYA 2RJKA 2X53S 3BN6A 1W0NA 2QDRA 5FY0A 3AL5A 2PQQA 2V4AA 3THPA 4F8AA 2PXFA 5FTTC 3KQ4B 3SX0A 3WDWA 2SBAA 2WFF1 1K5JA 1RUJ1 4AAXA 4B4RA 2JG8B 2ORXA 4DUWA 2WSUA 1V6IA 1ZPQA 3KQRA 3FZ3A 1JW6A 4LBOA 3CHXA 1V6OA 5JCTA 1ZBE1 3ST7A 3RYPA 4OYUA 1WH8A 4RS5B 4IEXA 4IUGA 5JPMB 2PHWA 2Z42A 2ARXA 4IGQA 3H3UA 1U5ZA 4XILA 3ETQA 2NLRA 4NJ4A 3HQXA 2W1SA 3WF2A 5BNPA 3KGLA 4GJZA 3FJSA 4EWAA 4X4GA 2XJVA 2PHFA 4BQYA 1O7FA 1Y9QA 1F2NA 1TMF2 1WD3A 1BBT2 2R071 2PE5A 4P00B 4AI1A 1EAH1 4XAEA 1GOFA 1RUI2 3FL7A 3NKTA 4QXCA 4DQAA 1DBNA 3ZSMA 3FLPA 4SBVA 2HWD2 4DUXA 2ZJCA 5APAA 2XKPA 2ZGUA 3FBYA 1JODA 4FSJA 4COZA 1AYM1 1RMU2 2JKBA 3SH4A 5FKBA 3FN9A 4LBQB 5IVFA 4DPNA 3POEA 2YPDA 4NHMA 1QP4A 2VZPA 4AW7A 5LK5A 3IAPA 2VVFA 3LCPA 4XAAA 3ZXDA 1RUD1 1YC61 3WF1A 4M3CB 3C7EA 4QGLA 2CAVA 3OGVA 4LUKA 4UW5A 3AXDA 3W5NA 3I7DA 2QQWA 3DPRB 3J7HA 4Y33A 3RYKA 3K2OA 2LRPA 3TBDA 1UOFA 1S1AA 4MXVA 4CEYB 2W1UA 3LEGA 2ZHKA 2PUBA 2OX0A 1JYVA 4Q4V2 4XE9A 5SV5A 1G9AA 4TZDA 2P2KA 1EPWA 1ZUGA 2D6LX 3HVDA 5HCFA 2Z4FA 5JIAA 2IXIA 1JUIA 5FXXA 4COVA 3H8RA 3FMYA 2LYRA 1X36A 3I3EA 3ITQA 4MHRA 1PVC2 2Y6JA 3HNYM 5JUWA 1RUC3 1PO22 2PFWA 4QPGA 4EWDA 4UBHA 3ZR5A 4OLLA 1UOJA 5L73A 1NLRA 3DYOA 3VKFC 2LYSA 1PIV3 2XMLA 4M00A 2LLVA 5FMCA 4XUTA 4FOQA 1UX6A 4QAWA 4YG6A 1IPJA 2ORZA 1CWPA 5GLWA 4X4EA 2R0HA 2ZGKA 4IV1B 1OA3A 2FCUA 2WC2A 3SLIA 4LBQD 4HPKB 3POBA 3T2QA 5DAVA 2R042 5JWPA 3U11A 1W2OA 1CJPA 1ADRA 2OA2A 3NRUA 3KF3A 1WLTA 2HWF3 3AZXA 3AYEA 3VK0A 3IMMA 3MFAA 4YG0A 2OKXA 1KFUL 3OBTA 2AC1A 1OVPA 1YQ5A 4IQPA 3WP4A 1CAVB 2CSFA 1JHJA 1WCQA 1D2SA 4YW3A 4BB3A 1OF4A 1HRI1 3NMBA 3L1PA 1XJAA 4D6RA 1W9TA 4ATFA 4LHKA 1EV11 1LKNA 3O0VA 2HWC3 5LY2A 1CGPA 4FOYA 3VBFB 2XQRA 5FPAA 4PI2A 3WG1A 2HYKA 5DTQA 2DVDA 2O38A 2VE1A 4K1YA 4FXGB 4Z92B 3FLRA 2VBBA 1QMJA 2RM21 4ATEA 1JYXA 4LMFA 4RR3A 1TE1B 2ZEXA 1NEQA 4CP0A 1QNYA 3PU3A 4HETA 1GT0C 1FAYA 3O1MA 2KXLA 1WH6A 1ZBA3 3TN91 3GGLA 1GP4A 2QCSB 5F3IA 2CY6A 2W94A 2RDQA 4YW4A 4IWRA 3VZLA 5FJKA 2P6HA 2A71A 1ZA4A 2UURA 4BQ2A 3BTAA 2NP0A 4XF0A 1UYPA 3MIDA 3N4MA 5LZ6A 3ME5A 1NOVA 4JCKA 1UOBA 1LHOA 3LPFA 3WNNA 4D69A 1FMD1 1WCUA 2W39A 2GU9A 4OUEA 2CL2A 1Y7BA 2J1UA 3MPPG 4IEWA 1NUKA 1NZIA 4P9XA 4X8NA 3QCWA 5FLIA 3ZO0B 3I59B 4OZOA 4Q4Y1 1H8TC 4WVMA 2XONA 3ZXJA 4OQ8A 1I5PA 3VBRC 1SPPB 4M0HA 4ER6A 3SH5A 1O4XA 2YU2A 2HSGA 4CCCA 2R7EB 1E5IA 2PXTA 5K7PA 3X29B 3ZSJA 3WUDA 3EO6A 4JCYA 2OYZA 4AHZA 5J96B 4FOWA 2VH9A 5HXMA 2W87A 3MIHA 3O0XA 2ZX4A 4RFRB 3ZSKA 1EP0A 4YM2A 2ZHLA 2ZBJA 1GQGA 1XE8A 4JGYA 1O91A 5FFOC 3WINE 1DQ2A 1GSLA 2RHPA 4NMIA 3MLLA 5E8AA 3WNXA 2FDIA 2MNGA 3N7MA 1AR81 1AX1A 1EY2A 2VZSA 2B7YA 1UZYA 3LDBA 4IEPA 5DXDA 4MV2A 5A1FA 2K46A 2OPWA 5IVEA 3GHNA 2P6CA 1W39A 3V0BB 3DEMA 5HXVA 1ND3B 1JU4A 2IUOA 4QHOA 1GANA 1OPMA 5LBFA 1DF0A 2WAAA 5EP9A 2BWCA 4AK3A 2MEV3 3HR9A 3VHRA 5A33B 4UI9L 4YZ5A 4MVTA 3JXBC 1CIWA 4JKMA 1BVP1 1LOGA 3ZFGA 1NA1C 4P9JA 5HCHA 1ZRCA 3J8F3 2DF7A 4XXAA 4NRPA 1W6OA 3T30A 2Y6HA 1SFNA 1NW3A 4FBIA 1YNAA 2DTWA 4GH4A 3OP9A 4OI0A 2C6SA 5BNOB 2BYVE 3AKRA 5BNPB 4ET7A 3VN4A 4QX5A 4YM0A 5JLVA 1Q8SA 4CUCA 5IK5A 1GUIA 1QJU3 5F32A 4EZ4A 4HLTA 3VKNA 5ABJA 1IGOA 4IEYA 3O1TA 2B8MA 3FFZA 3HNBM 1WMXA 3IIIA 4XVHA 2Y6FA 5A6ZA 1YIPA 4E8DA 3LEKA 2BGPA 1NLQA 1GOGA 1AR91 2DCZA 3KV4A 5JI7A 3RMXA 3RSJA 1KGYA 5JZGA 3WR0A 3MZHA 4KH9A 1IC8A 2WT0A 4AEDC 4LJHA 4IE7A 2PXJA 4LORA 3SEPA 4QXHA 1IS3A 5F5AA 1WMEA 3ACLA 3C2UA 2XJTA 1Q56A 4A3ZA 5A1LA 1EUTA 1YFUA 4AVBA 4Y22B 1J83A 2O0OA 4YPJA 1QZXA 1UY1A 3V0BA 4MX3A 2QQJA 3BTYA 4NRMA 1C5HA 4EN7B 1UL9A 2WWSA 3OEAA 5DDJ1 4CDWB 1OF3A 2WWJA 2QKDA 1YO8A 4GMP1 3FBMA 3JD73 2R1DA 2R16A 1HIXA 2ZEWA 4QGMA 4R9AA 2IVBA 3VDAA 4XJZA 1RUD2 4YG1A 2VAUA 1BZWA 3ELNA 1PVC3 3HOBA 2OQ7A 3SR4A 3L2YA 4JC1A 4OHYA 5D2AA 5GZGA 2WAOA 2E7TA 1HLCA 1UY3A 3M3CA 4QPIC 1GZCA 4JGZB 3JXCL 4HL0A 1ZYBA 1DYKA 5KXEA 1LOEA 3OYWA 4PU8A 1QXJA 5LA1A 3SCFA 3OD4A 4O8BA 4L8QA 4XUQA 3ENRA 3HD8B 1ZS4A 1O59A 1VBB1 1LULA 4MYEA 1BBT1 2QQKA 3IKWA 1LTEA 3KLSA 1HQ1A 2EVXA 1RL3A 3VBSC 4WVLA 1CPMA 3FHQA 1LHNA 1VALA 3ZFFB 2L9LA 2OPKA 3ZXAC 2A6CA 1FOD2 4IV3B 3ZMNA 5KHJA 1KEXA 3VDDA 4QX8A 1BLZA 4AGGA 1POQA 3C8XA 3DPRC 3LSEA 4CP2A 1TME1 3ATGA 3H0OA 1MZEA 1MZ6A 3HAGA 4PU7A 3POYA 4AAPA 1UPIA 2R1BA 1T2XA 4FXKB 1XB9A 3A23A 1W8UA 4OI1A 3ZDVA 4IV3A 4BQ3A 1U5YA 2WO2A 1F9KA 2RMU1 5LCWL 3H5TA 4CZSA 2LM3A 4LTAA 3HN1A 3CJXA 2E26A 1KXGA 2G9ZA 4KBZA 4ORFA 1R091 1R1A2 3MIBA 1QJX3 1KDMA 1M4WA 3PIGA 3M8LA 3JU9A 1W9FA 2RDRA 5A33A 3AZWA 4CDQC 5JXGA 5FWJA 2WFF2 3MEJA 1YEWA 3IM0A 4JCXA 2A6ZA 3O9XA 2C9AA 2TUNA 1DU3D 1DGLA 1R092 4ISRA 1SBFA 2PUCA 3DKQA 3PMEA 5FYBA 1UXZA 1GNZA 1UMHA 5DZEA 4YVSC 1C3HA 3VBHA 4F3JA 4OBMA 1JU3A 4XZPA 1UD1A 4Q1PA 2HFZA 1I9RA 2FFHA 2BU9A 2P34A 2PAEA 2JDYA 3I2HA 4CEYC 4KL1A 3KCXA 1QKQA 4Y26A 1PMHX 3AMNA 1AR93 2VECA 4CEYA 1SQ8A 1VBD3 5CFCC 3MDPA 2G19A 1GU3A 1QH6A 3C3VA 3LFIA 3UNPA 4ER5A 4YLZA 1SLTA 4QM8A 2BBAA 4AVVA 3CF6E 4JHZA 5G05L 2D43A 4HN1A 4QX1A 2VZRA 3ZYIB 1O5LA 1XXNA 1CIYA 3TEPA 4PJYA 3WNPA 4QPGB 2QNKA 1UXDA 4F7ZA 2FDGA 4CDXA 1Y4WA 4BE3A 5FZ1A 1AYM2 3QBQA 4FFIA 4RA0A 4CCJA 4META 5F5CA 3CO2A 4IETA 2QZ3A 3V65A 1TZOA 1QU0A 2BERA 1ENRA 3OB8A 1VRH1 2V3CC 2EIGA 1JOPA 4I6RA 1WCDJ 2ZGPA 4M0NA 2OR1L 4NIHA 3N7LA 4NWVA 2VOWA 1S0EA 3KCCA 2C9KA 2XJRA 4ZZ5A 5K8SA 2Q4SA 2D7FA 2R6QA 1V0AA 1WCSA 1BVVA 1CQTA 3I8TA 3R4DB 4TLGA 4QDRA 1W8NA 4GA9A 4QQLA 5FRAA 3AJZA 3NQHA 4GULA 4RS5C 3PUIA 2KEJA 5EZWA 3VBUC 2WNVA 4EQVA 2EWTA 1MZFA 1RGSA 4HRAA 1QHDA 3P1IA 2HWF1 4IW3A 3UGFA 5FMOS 3O1RA 1L3JA 5FOJB 2OQ6A 4CSWA 1OVSA 3VKLA 1DWKA 2P3KA 3A0NA 4KU7A 3MIFA 5C3SA 3MLJA 5CEHA 5D1IA 2YG0A 1JYTA 5FO9B 1SEFA 4CUAA 2J1RA 5C8WA 2A5ZA 4C8DA 1HB3A 4SLIA 4WVZA 4FPYA 5DAQA 3TWIA 3JD71 1RUJ3 2JDHA 4GD4A 2BGCA 4AI0A 2A6YA 4DO0A 1J1LA 1H9WA 4QX2A 2D6OX 5I91A 1CVNA 2A6XA 2WBKA 4G4FA 5DQ0A 1JWLA 3GZAA 4NR1A 3TEWA 2KEKA 1VB4A 1FNZA 3ACFA 1CAUA 3RZMA 3CLCA 2L8NA 3DV8A 1VBB2 3SCGA 2YDEA 2Z2SB 3POGA 4OULA 4UW4A 2WYSA 2WT2A 4Z5HA 1RHI3 3PHMA 4A41A 3MIEA 5FZDA 4X4FA 1R081 4YW7A 3E6DA 3MLFA 4QDQA 1I1EA 3WQBA 5C7GA 2XG3A 2ADEA 1W8WA 3CROL 2ARAA 4LQRA 2LS6A 2ZGTA 1LOCA 4WVMB 3ZKYA 4AGVA 1HJFA 1LMB3 4L99A 2XCJA 4H7MA 5LEJA 5IAXA 3HPNA 4X8PA 2XJSA 3CBNA 2EBYA 1XYNA 1UIJA 1RUG2 4GAZA 2XJPA 1N1YA 2VMEA 1NA1A 3IT8A 4I3GA 1TME3 3LSDA 2WZ8A 3M3IA 1AYM3 5T3NA 1FATA 2QQUA 3WOGA 2A7AA 4PBOA 4XF3A 2PUDA 3RDIA 2PN5A 4P9WA 3AKPA 1MS5A 1H9PA 4ZKTB 3NNGA 3WNKA 3PTYA 2CGNA 1ZBE2 5CNAA 1QH7A 5KC5A 5A70A 5FWEA 5J09A 2YROA 4KWKA 4ER0A 2IUWA 4UYBA 1ND2C 5B4NA 4WZCA 5DAWA 3BPSA 4YYOA 4HK8A 2ZAAA 2VNOA 2VZVA 1QJY3 4GWJA 1JN2P 3S30A 4HKOA 2R32A 1FOD3 1POV0 3WY6A 3S8QA 2GAUA 4FI9A 3UWPA 3C7HA 3WG4A 1EFAA 5L9BA 1PGSA 1YJKA 1RVF1 3LPGA 4GB31 3OJBA 3DUIA 2R043 2D98A 4KNCA 3FHAA 4JGZC 4BOWA 2PHRA 1JFSA 1ND2B 1CAVA 1JZ5A 1NLSA 4YARA 2DBIA 1EUUA 5JOWA 3QOPA 5HBAA 2VJXA 4HG6B 4K20A 1CZTA 3JCIA 4YBAA 3HZIB 2GNDA 1OXCA 1Q8VA 2R1JL 3ZYRA 4XFCA 4HVOA 1RXGA 3N7JA 3ZN5A 4M4PA 5A3PA 4YGDA 5FKCA 2B9VA 2Q1FA 1OLME 1ULPA 1GNHA 3N3HA 3Q8FA 4IGOA 4MGIE 4RFT0 4W6XA 2VULA 4FPFA 1ZRFA 1UY4A 4QB6A 2BNMA 1GZTA 2GC2A 3POSA 1N3PA 1SHWB 4MZUA 1O8PA 4BMEA 3B7MA 5DABA 5E6HA 1PGW2 2X09A 3DCQA 4O61A 5IVJA 1KITA 2WYFA 3IDBB 1S0BA 3CECA 5KXCA 5L9RA 5GZDA 3Q8CA 4ZONA 3CL1A 2LROA 5AVPA 5JSPA 1AR62 3OF1A 1UTXA 4QB2A 3MYXA 4Z59A 1E5RA 3HIFA 4Q5OA 3BIEA 3E5XA 3WP3A 2ADDA 1FNYA 4QHBA 1HX6A 1VAVA 2PXKA 1VP6A 1GR3A 4DXRA 2UY8A 2ET7A 1Y43B 2UYBA 4YGBA 1RZRD 2X8KA 3AKTA 2LUWA 1V6KA 4KG0A 5A7WA 2W52A 5T55A 5L7OC 1HB2A 2FCVA 2BVVA 4AI9A 2AUYA 2VEOA 1ONAA 3HQUA 3LD8A 3NV4A 5M0TA 1EV13 4XHBA 2QJVA 2MHFA 2XUMA 3WD5A 2EF6A 3GJAA 2DFBA 5CG8A 2LNMA 1DP0A 1AYN1 2CYFA 2IXLA 4CU9A 3ZSLA 5LY1A 1WW6A 4CU7A 5FV3A 3I2OA 1KQRA 3J26N 1LAJA 3ALQA 4TSVA 3WCRA 5C5TA 3USUA 3SH3A 5JZGC 4JAAA 1YWKA 2WR9A 4GKXA 1SQ4A 4KU8A 4KWLA 3O5SA 3OGJA 3OOXA 2C5DA 1U0AA 3AP4A 4COUA 1NCRA 4XFAA 3KV6A 3ZFEC 2VVDA 4Z2WA 1IKQA 2QZ2A 3I2JA 2EIDA 4M01A 5A32A 1QJY1 1RUG3 1W6QA 4BIFA 2RM22 1DW9A 1WW5A 2RS52 5T5OA 3C7FA 1H1AA 1G6NA 2P1BA 2XJQA 1ZZ9A 1AX0A 5FPVA 2AH2A 2HLEA 1V70A 1ULDA 5CFDA 3WZ1A 2WS91 4JHTA 5HV0A 1JS9A 3KGZA 3OY8A 4JVAA 2WO3A 4ZS2A 3ZR6A 1UF2C 2FBEA 3AP5A 3PJQA 4EROA 1UNBA 2FD8A 3GCXA 5DUUA 5FZCA 3O1VA 2HWB1 4JDOA 3TEXA 3DGTA 4I6TA 4LK7A 5H9PA 3UK9A 3VGIA 1ZVVA 5F6LB 3WT3A 4AVSA 1JYIA 2YZ4A 1AZDA 2ZZQA 4K6BA 1LCCA 2EF8A 5C8CC 1ZVFA 1CPNA 2HCSA 4XC9A 1OSLA 1X7NA 4GQMA 4UFHA 2VMCA 2B46X 4BK4A 4XFFA 5LBCA 1QWRA 4HXCA 3OMTA 3I2IA 1NG0A 2NMOA 1LOFC 2GMEA 4LO6B 3QOWA 5FLHA 1ACCA 3TELA 1HXS2 4NAOA 4RR3B 3G0TA 4EN8B 4Z5DA 1GZWA 1YFWA 4FFFA 1HRV3 3M9LA 4RQPA 3AL6A 4WM8B 1ENXA 4DFSA 3I49A 1K5MB 1VAMA 2DUOA 1UU6A 1ND3C 4NIGA 4XF4A 4YM1A 1S4CA 3S5AA 3BPZA 5GLTA 4GWIA 4WVWA 1SLCA 1OFNA 1UYZA 2IC1A 2Y60A 1BK1A 4XEZA 3NAPC 3VD5A 1ZAYA 1QJZA 1W04A 4ARYA 2Y6KA 5K98B 1A8MA 1R69A 3GZEA 2J7UA 2DCJA 2XHNA 4PQ9A 3S7IA 4DB5A 4NWWA 4Q4Y2 4GB33 4RGGA 5CZKA 1QB2A 2K2SA 1W6NB 3RZKA 2CWMA 3UETA 2ZEZA 2SLIA 4IE0A 2O1QA 4FT8A 2AW6A 1AUYA 3I4IA 4JV4A 1YFXA 1GLHA 1YHFA 1OHFA 1O4YA 3BYWA 4XFIA 2RS31 4B4QA 4QWNA 5CFCB 4LNVA 2WINB 1LOFA 3NJXA 3KT1A 2KD7A 3PLQA 1US2A 4OCTA 4DEQA 5ACA2 4OMDA 2WFPA 1MQTB 1QQP1 2C24A 1DGRN 4CP9A 3N7KA 4BXFA 5L36A 4XQWA 2PHTA 5HCAA 2WNOA 5BXXA 2XJ3A 4CCEA 1H8TA 3H7YA 1CD3G 3NV3A 4ZY9A 1HB4A 1SLAA 1W6MB 1YRZA 2VXRA 4QM9A 1OKQA 3GYDA 1SLIA 5AFEA 2AR6A 4X4HA 1HDKA 5C9AB 5HCBA 2ZXQA 1W28A 5LBEA 2EA7A 1MQTA 3WDTA 2XLFA 5IK7A 2XJUA 3OCPA 3INAA 4LUMA 1W6QB 4AVAA 1W06A 4HKWA 5FPBA 2JJ6A 4FVVA 3LFPA 5FK7A 5I0TA 1YJLA 5D8AB 1MVQA 5FYHA 4Z58A 2GN7A 2WZR3 1ENSA 5EXOA 5GAGi 4MLOA 4QKDA 4MHUA 4QU2A 3MF6A 4GWMA 4XW3A 4CDUC 3ILRA 3TNQA 2WSVA 3HJRA 4EN6B 1VBA2 1ST8A 2BVBA 2ID4A 4Q4X3 1XSQA 1BHGA 3R09A 1UYYA 4MH0E 3NNFA 2PXLA 2PHXA 4Y20B 2VBDA 2VOKA 5E16A 5FJHA 1PMJX 3TYJA 2GZWA 3U07A 5FMDA 4EWEA 2GRLA 1W3VA 5LA2A 3EMRA 4XZUG 2WA4A 5FZOB 3RRDA 5JSRA 2EIEA 4F8DA 5DUWA 2OW4A 2IXJA 4RQPB 1W6PB 3GZUC 2FDJA 2BNNA 3FYAA 2RS51 2X10A 5E89A 1COV3 3OPTA 1S0CA 4OQ9A 1MS8A 1PK6B 2HBUA 3FFQA 4IESA 5AFBA 1C8M1 2PUEA 1RUC2 3HWJA 4TXWA 1GP5A 4WM8A 4WV8A 1S0FA 3PXPA 4BYYA 2XSDC 3ZYJB 3F6WA 3BB6A 4WVVA 4FN3A 1W9YA 3N9OA 1WKYA 2DVBA 3MLKA 2B4KA 5FCCA 2HKXA 1W0PA 2MXDA 3ZYBA 2CROA 2J7MA 3AXEA 3E1F1 4QKBA 4XFHA 3THTA 3WUCA 3ZFFA 5ACA3 1UU4A 1VLNA 1W8HA 3LE0A 4IVZA 2DWRA 3AP6A 4ISQA 3ZXLA 5I0DA 1JOJA 2GC0A 2WA3A 4N7IA 5FO7B 4BMBA 4LKSA 4NIAA 3RPQA 3V64A 2BP6A 1DZTA 3ETPA 2IZWA 1RZRA 5JOYA 1F5FA 5BYNA 3OQMA 3D5OA 3D6EA 1AL0G 3AMMA 2Q8OA 3RZZA 2VOXA 3IDCB 3U4SA 3M3EA 5FP3A 1KRIA 2Y6GA 1K5MC 4X4IA 1LGBA 1OLRA 2R30A 1G9BA 1MQTC 3Q8AA 4V2VA 3AMHA 1VJ2A 1QQP3 4PDWC 3HBKA 4Z82A 1LU1A 2FQPA 4LKEA 2VZQA 4UOJA 1L7QA 5A7SA 4HMZA 4QDSA 4ES8A 3HEIA 2WNUC 2PPXA 1MEC2 4P9YA 3JXSA 1RTVA 3BTXA 2AEYA 3LAGA 3IBMA 1H1IA 1MPXA 3J7MA 3GUUA 2F4PA 1OUSA 3SITA 1TME2 3R4SA 3PUSA 4A42A 4ASLA 4M3CE 5HPOA 5IFTA 4UXAA 1NCRB 2BFUS 2A6WA 4UFJA 5KHHA 3VV1A 3FWEA 5FP4A 2PXDA 2VW1A
chains in the Genus database with same CATH topology
4K9SA 4NHLA 2NYYA 1RUJ2 4CDQA 1RUNA 1XYPA 1ZM1A 2RR13 3M3QA 4XETA 2YUEA 5GLZA 4N7UA 4KG8A 4YVSA 1REEA 3VZJA 5BUVA 1O3SA 4XJAA 5KWRA 3OTFA 5J48A 1REFA 5C4WB 2W08A 4I6UA 2Q1ZB 2RS53 1RIOA 4QQHA 2O8QA 3KZ3A 2GZUA 1ULCA 4AXOA 1YYNA 4OHVA 3D4KA 1I3HA 4QXKA 1NCQB 3ZN4A 4JQDA 2VUJA 3QLQA 4LO4B 4W6YA 1XE7A 4Y24A 5GJ6A 3R6SA 2AGSA 5CFDC 4Q4Y3 2XGXA 5A7LA 3HT1A 1AHSA 3J8F1 4PLOA 3BCWA 1RUI1 1VAKA 2KZ8A 1S0GA 4RD7A 5AC93 2JE7A 1RHI1 4Q0PA 1F8VA 4YW5A 5JZGB 4LO8A 4Y5Z0 1RINA 2WQ4A 4Y1UA 1X8MA 2ZKNA 1C57A 2Z5WA 1BMV2 2QE3A 4B7KA 5IT6A 3TRBA 1KJRA 5DG2A 2PHDA 1Z0HA 4OFGA 4ZU5A 5KHGA 2YY1A 3L9JT 1R083 2ZMLA 4NN0A 4OB4A 4NO4A 1CAWA 2PYTA 3JD72 1CONA 1CESA 2D3SA 3AYAA 4A7YA 4WBBA 4KWJA 2A70A 3ZYPA 1J1TA 2R063 2DUQA 4GKYA 5LRRA 2OUHA 4MCTA 1PVC1 1T6GC 4JTNA 2YC0A 1PO21 4CDXC 1YCIA 2XH6A 1W6MA 4XIKA 2TEPA 5TSWA 2WNVB 1Z78A 2FMDA 3ZSEA 4FPEA 1B35B 2RR11 3A4UA 3QF3A 3IPVA 5EV7A 3VLBB 2R073 3CJIB 4O9GA 2VVEA 1ZRDA 3FMGA 2BBVA 3DL3A 1S0JA 1QXPA 1SACA 4UW6A 2R041 4HSJA 5FREA 1COV1 1EYBA 1NYWA 1ZX5A 2QQPA 1UN1A 4BH9A 2OVUA 4FTEA 3FYMA 2JG9C 4E2GA 1QJY2 1IKPA 4S2GA 1B35A 1FOD1 1UAIA 2CWSA 2ZZJA 1J3QA 1MS9A 1LOAA 2H6CA 1LESA 2VUAA 1QJU1 4AQSA 3ZKCA 2R63A 4I2OA 3TAYA 1V9U3 1RIRA 3ZHIA 5BNNA 2KPJA 2HWB2 1XRUA 3VHNA 1N1SA 4MXWB 1ZZ8A 2QFEA 5J37A 4ZU7A 1UXCA 1HQNA 3LA2A 3IMNA 4Z8BA 1CAUB 1AU7A 1RUI3 1VBC2 1OA4A 4NOTA 5K0UA 1MR5A 1LEDA 4AFBA 1AXZA 3WDVA 5K0UC 2DU0A 4YW1A 3UKVA 3ZN6A 2JENA 1PRUA 1PVXA 4PIYA 2XHKA 3B93A 2JG9A 3VV1A 1XU1A 1VBD1 3AJYA 3MICA 2VGDA 4HANA 4DRRA 4IEZA 2RS12 3SXWA 2B9UA 4HBNA 2NQYA 5I8TA 2N7GA 2LYPA 1HRV2 2JG9B 3H1WA 3S0MA 5H9SA 4XJ9A 4R52A 3IDEA 5FDBA 3VL8A 4FPOB 5CFDB 3E6BA 2PUGA 1WETA 2RS11 4COYA 5T52A 2IXKA 4ZU4A 1LR5A 5CADA 1SLLA 2X5IC 3KXAA 3GHMA 4GH4B 4P14A 1LU2A 1R093 4PIXA 3VBOA 2Z79A 2WZR1 3AK0A 4E2QA 1TNRA 3MGUA 3PMSA 4WZFA 2E53A 2HWD1 2MEZA 5KHKA 1ULGA 3WP5A 1D2QA 3R05A 3AP9A 3EJKA 1MACA 4CEWB 1WIZA 5EYYA 2AXZA 2GSYA 4J1XA 2UWAA 4D7TA 1QQP2 1URXA 3ZMOA 1ASJ3 3JBG1 4BM8A 1AL21 4E4ZA 4MUVA 3RNSA 2E51A 3QH6A 2IVGA 1V9U1 1DZRA 1LOBA 1PO11 1GBGA 3JXDL 1QOOA 2JD4A 2NN8A 2EXKA 4DY5A 3K48A 4D7YA 1X50A 3PJYA 1PM7A 4Z5CA 3VL9A 3ZFGB 4XPVA 5JPNB 2ZHNA 4DRVA 3CNAA 1UMZA 2RJLA 5K9YA 2RR12 1J59A 3SCHA 1W2UA 1AR73 4IEUA 2DFCA 4QPGC 2B5AA 2YHJA 3MW3A 1PRAA 2WQZC 1PIV1 5JOXA 2GH8A 4FBFA 3VBUA 1VR3A 2ZS6B 1VBA3 3KM5A 1N3QA 3ZFGC 1F31A 4HN0A 4EN9B 2LTNA 2TNFA 1Y3TA 3G7DA 1JYCA 4K3UA 5K0UB 1QOTA 2PAMA 3J9SA 1JHNA 2UY9A 1LHVA 4Q4V1 3S6PA 3AB0A 3PNAA 4HT1T 4GH4C 4COWA 1YI7A 2YPJA 1S0DA 4E2SA 3NKGA 4PU4C 1LRHA 4AYUA 4AI2A 2A3XA 1OI6A 1UW8A 4YFWA 3GBWA 2GNTA 3NAPA 2ZA9A 5GZFA 1POUA 1QDOA 1SDWA 3WQ7A 1KFXL 2DU1A 3ZXGA 2XPJA 5KXBA 2YYOA 2ZGNA 3LB9A 4H7LA 1DQ6A 1K5MA 2CV6A 4XJ8A 2ZMKA 4F83A 5JIUA 1S55A 1VBE1 2PAKA 2NPIA 2D5HA 2ZKLA 2MQKA 1HF0A 5GM0A 3VBOB 1G9CA 1XNKA 4HVQA 4Q4X2 4Q4W2 4AFCA 2Y26A 4LE4A 4TWTA 3NO8A 2B5HA 2FMYA 1OOPC 3BU7A 5E88A 4PDWA 2JVLA 2CTVA 1C1FA 3AYDA 1LLIA 4LLFA 1UPSA 3BIWE 4LT5A 1DGWA 1A6CA 1HQLA 3VHOA 2X5IA 4Y22A 5FQ0B 1OLQA 1ULFA 2LYQA 1MS1A 2ZOEB 1AR83 4QGNA 1A8DA 1Y7YA 2EAKA 1RUE3 1SCSA 1KD7A 3S7EA 4LBMA 4A7KA 1IS6A 2IVQA 1NE6A 1UZZA 1DIWA 3FE5A 4LR4A 3T1MA 2WFF3 4E4DX 2WZR2 3TRSB 1J3PA 2KA3A 1BKZA 2KM2A 1H2LA 3DPRA 1ZRRA 3GF6A 5FLJA 1HV0A 2HWE3 4N9HA 4R4XA 2DURA 1RJ8A 2ZPXA 1V6NA 4YM3A 1S0IA 1TMF3 2Q0AA 3VBSB 4QPYA 1W6OB 2XKOA 4CDWC 2JE9A 3GZTB 4QPIB 1O4TA 1IS4A 1J3RA 2JG8A 2VOVA 1PMIA 2R062 2WIIB 4B4PA 4FAGA 4AFAA 2EXIA 3AKSA 3WP6A 2H8RA 2HWD3 3FX3A 1BDHA 5GALA 4KBBA 2WL1A 4IEVA 1D4VB 4AE2A 4X4BA 2JCGA 1NZCA 4N53A 4GHJA 1DQ5A 1MZ5A 4EJRA 5JI9A 3EBRA 5JDBA 1WLCA 3VBOC 2PLV3 1QF3A 2ZMNA 3G6JB 4UBGA 1NXMA 1TMF1 1DFQA 2BWAA 2R072 1FYUA 3KSCA 2XIUA 4K40A 5DDJ2 1O3RA 2D97A 1V6JA 4BLIA 1RHI2 4QQPA 2HWC1 1POV3 3M4FA 2TBVA 1APNA 1B35C 4DXZA 4C0HA 4I09A 1Z7S1 3UKTA 1ASJ2 1YI9A 4A2UA 1AVBA 4YZ3A 4TLFA 1CR7A 2BNOA 4XOGA 3ZPYA 2Y0IA 4YW2A 2XL7A 2JICA 1XQNA 4K1ZA 1VBA1 5JVVA 4AEDB 4A7ZA 5GZCA 1HRI2 1PHMA 1JUHA 4XXPA 4CYDA 3IN9A 3OY8B 2V73A 1AJKA 2FJRA 4YZ4A 1RUE1 2ZTNA 4OI2A 1N1TA 4LEJA 4B29A 3LGRA 3EUSA 2BEOA 3WLUA 3AP7A 5EFUA 4IA8A 4Q0SA 5J98B 1QXRA 1AJOA 3JBG2 1U5IA 3OD0A 4OUSA 2G9GA 4N43A 2ES3A 3WW1A 3O12A 2GMMA 2VNGA 1ZZ7A 1GZ9A 2DV9A 2EALA 4N90A 4V1PA 4GIQA 5FPXA 4L92A 3GBFA 1DG6A 2XBO2 5CB7A 3FUOA 4TYSA 1VBE2 2Y38A 1VBB3 1AR63 1H2NA 3RG0A 3B3QE 3V56A 2DTYA 4X4CA 3M7AA 3RWNA 2ZACA 2VNRA 2LYLA 3FC0A 1PZ9A 1UKRA 2ILMA 2UWBA 1R082 4L11A 3WQ0A 2NMNA 2CNAA 5FO8B 3FUQA 2IFWA 2XWBB 3B00A 4JDMA 4Q8LA 5CFCA 4XF9A 2WNUA 3DNVB 2V09A 1DHKB 4MGKE 4D3WA 4YNIA 2ET1A 1CN1A 1ZBA2 1WLDA 2I45A 5DDJ3 5JR7B 1CQ9A 5KXDA 3ES4A 5SV8A 1H0BA 1NA1B 3B5LB 4K7JA 4LO7A 4S2DA 3VBFA 4WM7C 2E63A 5GKAC 4NPRA 4IXLA 5BNNB 1PK6C 1NXD1 5AC92 4HKLA 2XVKA 3MEPA 5CVRA 1IOAA 1RB8G 3CLPA 4QT6A 2F6BA 2GC1A 5E1RA 1WA4A 2FZ1A 5C33A 4PLMA 4C91A 4EV0A 3AFGA 4X4DA 2A73B 1MS4A 3O0WA 2G9FA 5CA6A 2I74A 1NY71 4KGQA 5DUXA 1CAWB 3TNPB 2ZGLA 5D8AC 1JH9A 2XB6C 1Q43A 2Y0OA 3WXPA 3RQ0A 2ZX0A 3NJZA 2Z69A 3ZFEB 5EWSA 3EXUA 1IZ3A 1CJDA 1ND2A 5GLVA 3SHRA 4LO5B 3RI8A 1NQDA 2AXVA 2DVGA 1C8NA 3ECQA 4GQ7A 4I0WB 4D94A 4AGRA 4FTSA 1REDA 4NDWA 1ZREA 2GNMA 4B7EA 4LBKA 1AX2A 1PNFA 1RZSA 3ZIWA 3VZOA 5C9AC 4Z1VA 4IEQA 4FPJA 1X57A 1UKGA 4FPHA 1GQHA 4FP2A 4Z07A 1BEV2 1DQ1A 3MI8A 1Z7S2 5I93A 1ENQA 1PZ8A 4LA2A 1PO12 4OHXA 3B7HA 4E9KA 1AR61 4OVEA 1O4ZA 4G9SB 5T54A 4I0BA 2JDZA 1M06G 1AL22 3WVJA 4YGEA 1CX4A 1RUE2 1SCRA 1V9U2 3QQ6A 2B42B 1QP7A 4FPCA 4JGYC 1FV3A 2BUKA 4G3YC 1HKDA 1Q3EA 4H55A 1WBLA 3HMYA 1BXHA 1RUF1 3JUUA 3VKOA 1RMU3 2YGLA 3GBGA 3MFCA 1C1LA 4CDUB 3ZYGA 4BZ4A 5CAZA 3TB0A 3U3WA 2ZGMA 1GZWB 2IFRA 1BCXA 1UCXA 1IPKA 4DOUA 5JAXA 2QDNA 4XJWA 2BFUL 3D0JA 4FOVA 3UL2A 3AX4A 2ICPA 2RE9A 3UJOA 4S2HA 3VBHB 1COV2 4LBLA 2WNVC 1H2MA 1VBC1 2JXAA 5EJ3A 3RJRA 3GN5B 1XNBA 2W68A 2BPA2 3AMPA 1A78A 2DYCA 2VY0A 3APBA 1PERL 5FQ0A 4AEKA 3UJQA 3RYRA 4DMIA 4Q29A 4I30A 3D8CA 3LWCA 1RPEL 5FAXA 1SMVA 1Q5OA 5C8CB 2KEIA 3NW4A 1SBEA 2XWJB 4L2NA 3ZHMA 2E6VA 1XYOA 2V5YA 3FLTA 4PU3C 3VKMA 4AWDA 4B3NA 1ZBA1 2HEVF 3TN93 1BYHA 1QGLA 5A3MA 4PF5A 2XI8A 4N43C 2O49A 1VB2A 2VQAA 2WZPP 2JECA 2VQ0A 1G8WA 3RMYA 1YFYA 1XNCA 3OQOA 4H3WA 1G7YA 4AFDA 3UFDA 1RUH3 5A32B 1C8M3 4Q1RA 2BW8A 3R4UA 5FMOL 4CDUA 2HWE1 3USUB 1QDCA 1PNGA 1TEIA 4C90A 2DCYA 1EAH3 3BODA 3NAPB 1FMD2 5F5QA 3JB4C 2JG8C 3WV6A 1U12A 5L19A 1C5IA 1LQCA 1PZ7A 2Q30A 3LKJA 3VBRB 1O5UA 2G4IA 4QPIA 2HWC2 4BCUA 5C6CA 4BQ1A 2YV8A 3L2HA 4AEMA 3F51A 5ABJB 4X6QB