3PXPA

Crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
292
structure length
292
Chain Sequence
GMERAAFGKLVQALRREHRDEKGRVWTQEVLAERTQLPKRTIERIENGSLAHLDADILLRLADALELTIGERREFFFAATGIIEQKSATYKRSPEESLQYLIDMIRNMNVPAFVTDQYVNIIAANMITIRFFNIPMELIETAPLLPHGYNLMRVVFGTEYDFRRVVGTMWDEVARHNMQLFRAISLRVRADGYFVELLDNLMQYREFKRFWERAHLETEDTSAENFWYQYTHPVYGLLSYVSSRSQIPTSMGLLSMHTYIPLSPATTDLFAKLSTVANQDVIRLAPWPRSNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes.
pubmed doi rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription regulator
molecule keywords Helix-turn-helix domain protein
total genus 85
structure length 292
sequence length 292
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
A PF17765 MLTR_LBD MmyB-like transcription regulator ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3pxpA01
3.30.450.180 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pxpA02
3OQNA 1X2LA 2R1JL 3TRBA 2GRLA 1ZZ7A 4X4GA 1ZZ8A 2KEJA 2EBYA 4YBAA 2XI8A 1OSLA 1WETA 3IVPA 2D5VA 2LYPA 4PU7A 3FMYA 3SCFA 4X4FA 1ZAYA 1ZS4A 3KXAA 3ZHIA 4GHJA 4MCTA 1JFTA 1ZVVA 2CSFA 3CLCA 3JXBC 2PUGA 1NEQA 2IVQA 2XIUA 4Z58A 3SCHA 3JXDL 3GN5B 5K98B 1WIZA 1RZSA 1B0NA 1Y9QA 3BS3A 3OQMA 1QPZA 4JCXA 4X4IA 1ZZ9A 1WH6A 2PUDA 3CROL 1QP0A 1VPWA 2LYJA 2BNNA 1SQ8A 1RZRA 2WIUB 3FYAA 2O38A 2EF8A 2IV1A 3MLFA 2AWIA 1PRAA 4PU8A 1HF0A 1DWKA 4GQMA 3D1NI 2ICTA 2GZUA 3HZIB 2PUCA 4FN3A 3R1FA 3RZZA 2XSDC 1JWLA 4IA8A 1ADRA 3KZ3A 2L49A 2O4AA 2AW6A 2LYSA 1CJGA 3ZHMA 3U3WA 2PIJA 2PPXA 3H5TA 2PUAA 2WUSR 3FYMA 3UFDA 3OP9A 4IWRA 4JCYA 4NDWA 1XWRA 4F8DA 1DW9A 2R63A 1ZUGA 1JH9A 1ZZCA 2BNOA 1GT0C 1RPEL 1PRUA 2GRMA 1JFSA 1EFAA 3CECA 2KEKA 3G7DA 3PXPA 2JCGA 3OQOA 4MCXA 1LMB3 2PUFA 4I8TA 3L1PA 4I6TA 1X57A 2OFYA 3QYXA 4FBIA 3KJXA 1BDIA 4X4CA 1ZPQA 4IVZA 2FJRA 4X4EA 4PU3C 3QWGA 1AU7A 1BDHA 2A6CA 1PERL 4X4HA 1OCTC 1RZRD 3DNVB 1L1MA 4OB4A 2LCVA 3BDNA 1UTXA 3O9XA 4YG4A 2EWTA 1QP7A 4Z5CA 3SCGA 1ZZBA 2LYQA 1YSEA 4J1XA 2IVGA 2AXUA 3ZKCA 1ZZ6A 2AXZA 3F51A 2JVLA 1CQTA 1LQCA 1LLIA 1QQBA 2H8RA 2IU7A 2HSGA 1POUA 2IVBA 1S7EA 2OR1L 2O49A 4Z59A 3B7HA 3OMTA 1UXDA 2LYKA 1QP4A 4JQDA 4PU4C 1NERA 2B5AA 3LISA 5A7LA 4O8BA 1RIOA 3G5GA 3QF3A 1WH8A 2AXVA 3EUSA 2KZ8A 3S8QA 1PRVA 3BD1A 3QQ6A 2PUBA 2CROA 4J1WA 2LYLA 3F52A 2KEIA 4X4DA 2PUEA 3JXCL 1UXCA 2HINA 2XJ3A 3LFPA 1QQAA 1R69A 1R63A 4YG7B 1Y7YA 3GBFA 4Z5DA 4Z5HA 2MEZA 2ICPA 4I6RA 2PE5A 1LCDA 2AUWA 2IUOA 4X4BA 1IC8A 2L8NA 4YG1A 2LYRA 3GN5A 3VK0A 2KPJA 2BJCA 4Y42A 1O4XA 4YARA 1LCCA 1PNRA 3F6WA 4I6UA 1E3OC 2BNMA 2XCJA 2MQKA
chains in the Genus database with same CATH superfamily
1X2LA 1H8ZA 2PD8A 1S1YA 2O9AA 1H5XA 3PBSA 3I7JA 2KEJA 2PD7A 3K2NA 1K56D 3C7UA 3D72A 2LLWA 1SDNA 1MXOA 1JFTA 2ZD8A 5KIZA 1Q2PA 4Y3IA 2H5SA 1FSYA 2HDQA 3QP1A 4LENA 3BQ8A 3MXSA 1U2ZA 3UPOA 1Z6FA 1VPWA 4ZJ1A 2WIUB 2LB5A 2UWXA 2PRFA 3OPRA 2EFXA 4I3IA 3Q82A 2PXFA 3OKZA 4YWZA 2O4AA 1J3WA 2G7UA 2EXAA 3E4OA 3Q7VB 3CHWP 2O9BA 1OT9A 1ESIA 3V50A 3PR6A 5G4YA 1GT0C 4DN0A 1PRUA 2PXVA 1EFAA 3CECA 2BASA 4DXBA 1K55A 1HVBA 4FH4A 4A5RA 1TF1A 4QU3A 3LCEA 5DTQA 2XFTA 4LRYC 1KE3A 3G2ZA 4QJGA 1T1AA 2QMIA 3R7WA 4JKTA 4MCWA 1XFNA 2OR1L 3SS3A 2C6WB 2VGLS 4O0PA 3MF0A 4RX3A 1ODVA 4AFIA 1LL5A 5DKLA 1SKOB 2OWJA 5JYPA 5F5YA 4DDSA 3FWLA 2CROA 5TFQA 4FUWA 1ERQA 5GHXA 1PI5A 4EUVA 1NW3A 4R4SA 4E3OA 1PW1A 5CGSA 3PBOA 4WN5A 2Q9MA 1YLTA 2OWHA 1W63Q 3GECA 4FD8A 3AGFA 1YSPA 2V20A 3KYEA 4JF5A 1VM1A 4GOGA 2HJEA 4PU7A 4R4RA 5L2FA 4B88A 3G30A 4MCTA 2JKTI 2W3EA 5F68A 4MMNA 5EVLA 1SZVA 2PUGA 3LI9A 3U4LP 3BJNA 3V3SA 2YBDA 3GN5B 5K98B 1MPLA 3TEPA 3IX3A 3T4SA 5FQIA 1HD8A 1VEUA 1RZRA 4JXVA 1BLHA 1TS7A 4Q2JA 4PU8A 5FASA 1CEFA 3E2KA 1HQ1A 2PUCA 4LV1A 1K55C 3IS2A 1W79A 1LI9A 5KMWA 3ZHMA 3H5TA 3FKWA 5GAGi 1G6OA 3WS5A 4CLCA 3UDIA 5AVFA 3H9WA 2PT7A 5IHVA 4HNBA 2ZQ7A 4IVKA 5FEGA 5GHYA 1QZXA 3MFXA 2WZXA 3IF6A 4PM7A 4GD6A 3RTYA 2IVGA 2FZ0A 3KYQA 2G2WA 4DE0A 3ZKCA 1L2SA 4XT2A 3NCKA 1ES2A 3A9ZA 2O49A 3G2YA 1PRQA 3MZFA 2W3DA 4JF6A 4OOMA 2JKGA 3S7PA 2BG1A 2AXVA 1RGYA 5E2GA 5FAPA 5L07A 5CRFA 4S2JA 2P9VB 5EFWA 4UEYA 2H10A 4QY6A 1E3UA 3T4LA 1TDGA 4FH2A 1E3UD 4YG1A 3F1NA 5FATA 1S0WA 5K5BA 3PAEA 3C4OA 1VETB 3UE6A 1ES4A 4E3IA 3MQ0A 5IT5A 3H7WB 3GZCA 3IF6C 1ES3A 3S7NA 2LYPA 3P09A 1PWDA 4HH3A 3AGDA 2CSFA 3VFHA 3N4IA 1UGUA 1QPZA 3TSGA 3FZCA 2XK1A 3V5MA 2XXAA 5L09A 4G3KA 4L9GA 2O38A 4C6YA 5HZHA 5EPHA 4KG6A 1PRAA 5JUWA 4GQMA 2EX8A 2LB9A 4GHIA 2VGKA 3ITBA 4HHDA 3N7WA 3MFDA 2ZM0A 3ZNTA 1RP5A 4JPMA 2PUAA 1DY6A 1L0DA 1K4EA 1S4RA 4GZBA 5FDSA 3MQQA 3IH9A 4NXFA 5GL9A 4MN7A 4R38A 2VJWA 2V1BA 3G34A 2W27A 4S2MA 1PERL 4X4HA 3EEAA 4IJGA 4PM5A 2B18A 2QJ7A 1P9RA 2OLVA 5HDCA 5HAQA 2P04A 1POUA 4U3TA 1T1CA 3MQOA 4GDNA 3LR5A 2P74A 3HLFA 2QKPA 1JWZA 1VETA 5A7LA 3M6HA 2H0YA 3Q81A 4UQIS 3LR3A 2XD1A 3IXBA 1MY8A 4XT2B 2ICPA 3D4FA 1HZOA 3NOPC 5FQQA 1S66L 1ES5A 4CJNA 1E3OC 2BNMA 3SCFA 2JN7A 2V8CA 4GKUA 2OV5A 2XI8A 3KO6A 4XUZA 4E6XA 4L0LA 2EX2A 3LO7A 3OCNA 4DXCA 3ZG9B 1XX2A 2HCSA 2IVQA 2R78A 2E8IA 2WAFA 4QPRA 3HCYA 2NUPC 4Q8IA 4BL3A 3M9LA 2B5RA 3FYZA 1MWTA 4N9LA 1FR6A 3A0RA 5FI7A 1JTGA 4ER0A 3OPPA 1C3BA 1S1ZA 4JXSA 3SZTA 1CK3A 2EXBA 3LR0A 4B93A 3OP9A 3DTIA 1W5DA 5FQJA 4S2IA 3T12B 4OOLA 2PU2A 4WEKA 1IKGA 3FC7A 2KEKA 2JCGA 4X68A 5GLCA 3CMZA 2Y79A 4OQHA 2Y59A 4BQMA 1MKIA 1WA9A 4FBIA 1ESUA 4IVZA 3VE3A 3T4OA 4O7DA 5HDDA 3PBQA 3VE4A 3CUEA 4OH0A 4LRXC 4S2NA 5FA7A 1H8YA 1NZOA 5A8BA 3WWXA 1NLZA 2Q9NA 2IU7A 1ZG6A 4Z59A 3MS6A 5IS1A 4JQDA 4CLCC 3PE5A 2JHEA 1PYYA 3CPTB 5F69A 1PRVA 3BD1A 1PFLA 1R69A 3S22A 2K7SA 5CEBA 1P97A 1OTBA 1HLUP 3QP2A 1VQQA 4KG2A 4RA7A 3LY3A 3A9YA 2XQZA 1LL8A 1ZC2A 4YOFA 1GHPA 3IHBA 5FDHA 1OTDA 5FI6A 2ZQDA 4DRTA 1TVFA 4EXOA 1D7EA 4HI4A 3KX0X 1XJ3A 4M4XA 2OAP1 4EK9A 3UPPA 2B02A 3T4QA 5FQKA 1E4DA 2Y2MA 5HWVA 1D06A 2NUTC 3CZDA 3HLGA 2B95A 3UB5P 1SKOA 4JBFA 1ZUGA 1YM1A 2BNOA 2P9VA 5FSRA 4MBKA 4P87A 2GRMA 3K3DA 3BRMA 1K6RA 5DRYA 1YPRA 3QP5A 4KUOA 2PUFA 2ZOHA 1D1JA 1K0KA 4PKYA 5LBRA 2QZ6A 1BDHA 4JCYA 1G68A 4ETXA 3QWGA 2JQEA 2VV7A 4YG4A 2EWTA 3Q1FA 4LCLA 4J1XA 1XXMA 4KZAA 4CLCE 3NROA 4P0MA 3MBZA 4NXEA 3P7NA 1FR1A 5AJGA 2H8RA 4H8RA 4HESA 1TS8A 2Q0OA 3E2LA 1UXDA 3Q7ZA 4ER6A 4ETZA 3KSIA 4HBTA 2BLSA 2PYPA 5AQ7A 2X02A 1XJ4A 3BYDA 1AWIA 2V3CC 1BLPA 2KEIA 1SKFA 3MSHA 3T1SA 1UXCA 3CAXA 1Y7YA 2PXBA 1MFQC 3ZQ5A 2PE5A 4DJ2A 3JPUA 2L8NA 1DP8A 2L1PA 1WYCA 4BBVA 4PHTA 3QP4A 1Q2QA 2H28A 3JYIA 4FSFA 4Y15A 4DMZA 2OOLA 5E43A 4KUKA 3W4QA 1XPBA 2O9CA 3IHAA 4ME4A 2WADA 3KSGA 3EEHA 1EWZA 4GHJA 1ZVVA 2VEAA 4GNUA 3A3DA 3VP1A 3SCHA 4JGPA 1Y9QA 4KZ9A 3WS2A 1WH6A 3CROL 3C4PA 1QP0A 1GSVA 3G31A 2V0UA 2CC1A 2ICTA 3PBRA 1F9IA 2XSDC 4OQ0A 4GS9B 3QNCA 4ZJ2A 4EKIA 2WUSR 4IUKA 3SW1A 3QOXA 4DKIA 4F8DA 3SS4A 3SS5A 2R63A 3SH9A 4EEPA 5CERA 2J7VA 5E2FA 4WL9A 4KENB 1FCOA 4S2LA 4DJ3A 2HV1A 2V2FF 1FCMA 3ZVTA 1RZRD 3LEZA 3FKVA 3S1YA 1BZAA 4Y0TA 3F51A 1OTEA 1CQTA 1YAXA 5F82A 2O0YA 3PBTA 4ID4A 2HP5A 3BQAA 1L0GA 3LISA 4ZJ3A 2XLNA 2IA2A 3NHQA 4WMCA 4BD0A 5A93A 2LYLA 3IX8A 3S7QA 4GN2A 2QJ5A 4WF0A 3HLDA 4X4BA 2D01A 4N1XA 5HDSA 4UA9A 3OQNA 2GRLA 4ZDXA 4NETA 2EBYA 5GLDA 5JYOA 2PXLA 5CECA 1PWCA 3HJKA 4MLLA 4QY5A 3ZHIA 4WYYA 3Q07A 2ZC3B 4Q0IA 3UE0A 3BW6A 4Z58A 3BLSA 5FAQA 4UAAA 3CLOA 5F1FA 3N8RA 3KL4A 3L9KA 3OOVA 5KZHA 3HZIB 3IX4A 4FN3A 1NLYA 1O07A 1ADRA 1SHVA 2J9PA 1HTZA 1K57C 1GHMA 3NXHA 4IWRA 3OWQA 2PYRA 2PBDP 2PBYA 2JCHA 4RYEA 2J7UA 1ZZCA 4B9OA 3GZDC 3JVUA 1Y4OA 4EETB 2G2UA 1JFSA 2L1MA 4HP4A 4I39A 1X57A 2FJRA 3DAVA 3M2JA 2QPNA 1L0FA 4EV4A 4WUJA 5HW3A 3MEJA 4Z5CA 1H0MA 1XJ6A 3B33A 1ZZ6A 4S2OA 2INWA 4MNRA 3IBRA 3LIDA 3S4XA 3GTCA 5FL3A 1ZG4A 2Y2IA 1KDSA 1QP4A 5FI2A 1ONGA 2GX5A 4FCFA 4O8BA 4BBTA 2KZ8A 2Y91A 2WK0A 2EX9A 1YLJA 3A3IA 5HAIA 1CI9A 1DP9A 1YQSA 4YG7B 4KZ5A 1H8MA 1LHYA 4M3KA 4X69A 3WS0A 2W1TA 4Y42A 1IYQA 3OCLA 2MQKA 4PKYG 1BT5A 3CITA 1NYYA 5DF9A 3BFCA 1WETA 2D5VA 4F3LB 3FMYA 1MC0A 4X4FA 4C3QA 1ZS4A 3MZEA 4KG5A 1YLZA 2PXKA 2Y8HA 4IBRA 2XROA 4WZ4A 5CGWA 2VA0A 2DNSA 5F6AA 4UA7A 3WS4A 2LYJA 2XFSA 1DULA 4N1HA 4EEUA 5HSQA 2EF8A 2EFUA 4CPKA 3MLFA 3F1PB 3D1NI 3EOIA 3GRJA 1STZA 2GZUA 3CWFA 4OQGA 3MMHA 5EVIA 1P9WA 5CTMA 4CQHA 5DJTA 3VSLA 4OP8A 5CHUA 2V8FA 4I3JA 4YINA 2J3WA 1U60A 1OJGA 2HFZA 3H82A 3OQOA 4UHUA 3R09A 3IWQA 3QNBA 3OLOA 1DP6A 1FSWA 3NC8A 2ZC6B 1PNRA 1P0ZA 2WKIA 1BULA 1KVMA 2P7JA 1V9YA 5TBMB 2WZZA 5DKKA 3UE3A 3SCGA 5HWTA 5EVIC 3HUNA 4EQZA 4PM9A 2Y2HA 1S7EA 1XJ2A 1G6AA 3NECA 2ODRD 2LYKA 3C7VA 3A0SA 4JGQA 3TG9A 2B5AA 2WAEA 2RCXA 4CLCD 1EI5A 1NRFA 3ZG8B 5A91A 4B4XA 4GHIB 4OPRA 3GBFA 3CUEC 4OPZA 2BJCA 1N9NA 4KQDA 3O3VA 3O86A 3F1OA 2XCJA 3ZNYA 2XGNA 4ZAMA 3W4PA 3NJAA 1NRJA 4X4GA 2Z2MB 2YKHA 2L0WA 4YBAA 1L3LA 5DFXA 4Y17A 4X6TA 2DMWA 3CLCA 1IKIA 4BLMA 2JC7A 2J7WA 4HIAA 5DF8A 3C2WA 2ZL1A 5DTMA 4Y5FA 3QFIA 2Y2NA 3CJMA 2ZM2A 4IA8A 5AQ9A 1JWPA 3UMEA 2AW6A 3BFGA 4KQOA 3NI9A 3FYMA 4BWIA 2XR0A 1SCWA 3JVVA 4JF4A 2WYXA 4EQ1A 3WRZA 4NXBA 3ME5A 2C5WB 3K3CA 3IWIA 2WGVA 4KZ7A 3T4TA 2OFYA 1BDIA 4X4CA 3IS2B 3KSHA 3WRTA 4Z9QA 3A3JA 3HL9A 4WM9A 3C5AA 4OPYA 5HPIA 2ZQAA 3HUMA 4R1GA 3EQVA 5TGFA 2HDUA 1OT6A 2AXUA 4MDZA 3TELA 3G6OA 2R9WA 1LQCA 1N9OA 4E3JA 2A24A 3UN7A 3HVFA 3VP2A 3N6IA 1RIOA 5E2HA 4EESA 3G5GA 1MWUA 4JXWA 3GQZA 5HD3A 2VK3A 4CLCB 3F52A 4HOIA 4I38A 4F94A 3UB6A 2HINA 3LFPA 3OC2A 3GUUA 2W3HA 5CTNA 3VOLA 1LCDA 3BWLA 4DE1A 3ZFZA 2IUOA 1LSWA 3A3FA 3MXQA 1PIOA 2Z2LB 3W4OA 3ULFA 1IYOA 3FPWA 4E6WA 2VKSA 1S4SA 4BJPA 3GMWA 1TDLA 1OJ5A 1ZZ8A 3IXDA 4HJ4A 5F83A 3T1XA 1OSLA 3SR4A 1FIKA 4KZ6A 3NDBB 4GS9A 1E25A 4K91A 4QWOA 1UWNX 3BFEA 3MZDA 3TOIA 1RGZA 5C5KA 4WVLA 1N4OA 1RZSA 3BLMA 2BNNA 1QMFA 5AVEA 2AWIA 4PMAA 2WGIA 5DTRA 2QHKA 4R70A 3FG8A 3WS1A 2K31A 2FFYA 4HEFA 4KZBA 1CI8A 2VEOA 3IT9A 3DM5A 3UO9A 4ZBEA 5EE8A 3LFVA 2W0NA 2I72A 3DBAA 3D9YA 3R7WB 1LT0A 4BENA 3DTEA 3W8KA 1GCEA 4MCXA 2JKFA 3RJUA 4BD1A 3L1PA 3IXGA 3LEQA 1YKDA 5HD5A 1OCTC 1LI0A 1YMSA 2A49A 4K0XA 1IELA 1FOFA 1GA0A 4OP5A 3F1PA 3OZHA 3FV7A 4DDYA 1LLIA 1A0KA 1QQBA 3EGDC 4MBFA 3IH8A 3UY6A 5DRTA 4I3AA 3PAGA 3EUSA 5CXWA 2UV0E 1MWRA 5HPFA 4C75A 2XJ3A 5A90A 2ZLYA 4Y0OA 1PZOA 3E4PA 3RH8B 2PXTA 4H6JA 3HLCA 1VB6A 3TE8A 1I2WA 2WKQA 1K54A 3VFFA 4L9FA 4X25A 3TRBA 3NZLA 4ARZB 4OQIA 3IVPA 1IYPA 1GSXA 1MZUA 2JKTM 3DWZA 3R4KA 4N92A 3GV9A 4K0WA 2Y2QA 4NK3A 4OLDA 3GVBA 1BYWA 1IEMA 2BTFP 4JCXA 2LLVA 2W1RA 2W3GA 2EX6A 5EVID 5M18A 3FYAA 3ZVWA 1SDEA 1DJAA 1DWKA 1LSVA 3C8CA 1FILA 3VV4A 4Y7PA 3KZ3A 3HLBA 2Y2JA 2PIJA 3LQXA 3DWKA 1ACFA 4HP9A 4OPQA 2XD5A 4D2OA 1VEUB 4X56A 3KSFA 1CF0A 3UB8A 5J8XA 4HQAA 4PAUA 1TS6A 3HJIA 1YLWA 1G5UA 3KJXA 4LV3A 2XH9A 2CMNA 1CQAA 4G3WA 2J80A 4OB4A 2LCVA 3T4KA 2MJ6A 1F5MA 5L10A 2KDKA 1OPXA 4EERA 2JBFA 3VSKA 2VGJA 3E0YA 4KZ8A 1LSXA 2M4HA 1YT4A 1DRMA 2FFHA 1Z09A 4S2NC 2KLIA 2W1TB 3VWSA 5CGXA 3OMTA 4Q0JA 5EM0A 3IF5A 1T1BA 1NERA 1CJFA 4GCZA 4E3LA 1T18A 1UWPX 4S2KA 3QQ6A 2V9AA 4J1WA 4X4DA 1LL9A 4DF6A 1QQAA 1YMXA 4IBXA 3IBJA 2MEZA 1IYSA 3UE1A 3Q7VA 3F6WA 3PTEA 3S8QA 2OAQ1 2MXDA 2R1JL 3N8SA 1K6SA 3UPNA 1IFQA 1XA7A 2E8JA 5CEDA 1JWVA 3H82B 5BOHA 1ZAYA 5EVIB 3V67A 3VP4A 4ZRRA 3UDXA 1NEQA 2PHYA 5AQAA 4X4IA 4HH2A 4NEED 2ZJ9A 2EA9A 2J3TC 3HBRA 4LCMA 1ALQA 4EBPA 3R1FA 4DE8A 2IWDA 3BY8A 3L7HA 5DTKA 2X71A 4IUHA 4R23A 4Y13A 1NZUA 4OKPA 5GLBA 1XWRA 1PI4A 4RX2A 3U2AA 2HP9A 2OLUA 1YLPA 3HREA 4FOFA 3T1RA 3T4JA 4E3KA 4EWFA 1MKMA 3PXPA 4E3NA 4I6TA 5FQMA 2Y2PA 3EGXC 5DFYA 4X4EA 4PU3C 1XGIA 1M40A 3NOTC 4WZ5C 1L1MA 3BDNA 4S2PA 3HUOA 3SOIA 2WKPA 5EECA 4BL2A 3PYPA 4O01A 3C38A 1JVJA 2JKRI 1GSWA 5TJJA 2JKRM 2X01A 4IHQA 4JXGA 2KOIA 5DT2A 4KQRA 3TJZC 1N9LA 4R6LA 2D02A 2ZBBA 4FTXA 3C30A 1QB2A 5MC7A 1W8QA 4Z5DA 3OPHA 3ZGAB 3S7OA 4GJ4A 1LCCA 4JGRA 4QD4A 4I5SA 3P01A 2RL3A 5HFOA 3VP3A 1CEGA 1BTLA 4RQ9A 1BSGA 3ZHHA 3RFBA 1KGGA 4EBNA 4MBHA 3ZCZA 4Z1WA 4ER7A 1GA9A 3JXDL 3MJQA 2PUDA 4OBMA 4JLFA 3ZPXA 5EVEA 4U0XA 4R3BA 4B4ZA 2IV1A 4KZ3A 1WYBA 1OMEA 3BECA 4R3AA 3O87A 3UB9A 4EU0A 1K54C 2EWWA 2VGLM 5HL1A 2VLGA 2KX6A 4E3MA 1S67L 3N8LA 3DW0A 1ERMA 3SH8A 3CI6A 4EZIA 1DJCA 1RCJA 3IQAA 1LMB3 3LI8A 2A24B 2EWVA 1AU7A 3UWPA 1ZKJA 2ZMVA 1UTXA 3CPTA 2WGWB 1NWZA 4YFMA 5TR7A 2ZM8A 3KYZA 4WZ5A 2AXZA 1KDWA 1WE4A 2ZQ8A 4KQQA 4LGWA 3NULA 2PXEA 3B7HA 5DJUA 1IOUA 1H3QA 3ZYTA 2HDRA 5HX9A 5I5LA 4PU4C 4UQIM 3E4QA 2WUQA 4IEDA 2HJ9C 2K2NA 1PNEA 3OPLA 4HY8A 2Y2GA 2ZC4B 3PHYA 2J8YA 4Z5HA 3BFDA 5HL6A 5DTSA 4I6RA 3G0TA 4R0QA 5L8MA 2LYRA 3GN5A 3G4PA 1O4XA 4YARA 1BLSA 2HZ5A 5E2EA 4ER5A 5TBMA 3MXRA 2QWSA 2ACGA 2R9XA 1XFQA 2PU4A 3E98A 3UB7A 5FAOA 1MBLA 2Y2LA 2PAVP 2GZAA 2PXDA 4QHCA 1N9BA 1GHIA 1XA1A 2XIUA 1VHMA 3GSGA 1WIZA 3T1QB 1XKZA 3ISGA 1ZZ9A 1EROA 2WGWA 3W2ZA 4ESPA 3LIAA 4D60A 3UDFA 4MN6A 1DJBA 4EW7A 1ONHA 4UA6A 5HARA 1XP4A 2OSUA 3M2KA 2ZOIA 4OLGA 4ER3A 4R3JA 2L49A 2WKEA 3NBLA 2LYSA 3UFDA 2HGVA 3TRCA 4NDWA 2GDNA 5HAPA 3F1OB 2Y55A 2XXQA 1JH9A 4WMCD 4KZ4A 4II7A 5DSXA 3LIFA 5EM1A 2XSSA 4P6ZM 3M6BA 1KVLA 3F1NB 3QOWA 2XF3A 2P08A 3V39A 3DNVB 5EUAA 3DTMA 4GW9A 5M19A 3PBNA 2Y2KA 5M1AA 2IWCA 3IWOA 2ZL1B 1KGEA 3H7WA 4EUZA 4WELA 3HLWA 2Y4AA 4NKPA 2M1CA 1KOUA 2AVXA 4P85A 5AQBA 2Z6CA 5CHJA 3B42A 2FH5A 3QF3A 1FCNA 1PWGA 1NY0A 3NOUC 5G4ZA 2PUBA 2HPBA 3LIEA 4LLOB 2HP6A 3D3OA 1ZTUA 4L9EA 5CX7A 2HF6A 1W63M 4MN5A 3LGOA 2ZQ9A 3VK0A 2A2LA 3QHYA 4WBGA 2I9VA 3QP6A 4LV2A 3UNWA 3ZG7B 4EQIA 1ZZ7A 3FPVA 3EQUA 3VMAA 3LICA 5J7EA 4Q0HA 4LPZA 2H0TA 3JXBC 1OTIA 1NXYA 1B0NA 3BS3A 3OQMA 2L4RA 4GDBA 4PPRA 1G28A 1TD5A 1TEMA 1YLYA 4OVDA 1ZHHB 1Y28A 1FQGA 3B47A 5F1GA 1BUEA 3RZZA 1JWLA 4E04A 3LUQA 1X0OA 1CJGA 2PR5A 4DE3A 3ZG5A 5FEFA 1W7FA 2XRNA 3A0VA 3G35A 2Z6DA 5FQ9A 3LR4A 2PDRA 4NG2A 4IVIA 1S6RA 3QP8A 1K56A 1K25A 4Y0UA 2XDMA 4F3LA 4X1MA 4I8TA 5D3OA 4ZTKA 3QYXA 5EOEA 1ZPQA 2ZMAA 4GLQA 3TFLA 1J9MA 1M6KA 2ZC7A 4DE9A 3HLEA 2DRWA 3V3RA 2O99A 1QP7A 3OBFA 1TS0A 5DVAA 1PZPA 3DTKA 4BMWA 4XXRA 2VZWA 5EV0A 3AGEA 2GJ3A 1I5QA 1EW0A 5KSHA 4LV0A 1F2KA 3T50A 2VV8A 4GB7A 1KE0A 1I2SA 4DE2A 3GZDA 5GAHi 1OTAA 2V1ZA 1K57A 5EOOA 2Y2OA 3CG5A 4LFUA 2XXPA 1K38A 3JXCL 2W3FA 1R63A 4JGOA 2ZQCA 3NY4A 3RXWA 3BFFA 2AUWA 4N9KA 4PM6A 2M7UA 2KPJA 4X1LA 5CHMA 4I6UA 1RPEL 2JE5A 4X55A 1JNUA 1AXBA 3O5YA 2VV6A 4EKGA 2PXPA 1XGJA 2FFFB 1NJ4A 2J9OA 2ZMFA 3EWKA 3A3EA 4BBUA 4OONA 3MKFA 3KXAA 3ICYA 4O8GA 4GD8A 4WLAA 3B3XA 3ZDJA 5KSCA 1L0EA 3IF6B 1MWSA 2V1AA 2XA7S 4P6BA 2M7VA 4G3VA 1SQ8A 3LY4A 5DF7A 4HRAA 2V0WA 3VOYA 3IXHA 1HF0A 2YKFA 2WKHA 4XUXA 3O88A 1Y54A 3U3WA 2PPXA 4H6JB 2GNXA 3MKEA 1DW9A 2VX8A 3BY9A 4WEJA 2PXUA 1QMEA 1YSQA 3LIBA 3BM6A 4YNRA 5A92A 4ARZA 2J3TD 3G7DA 4QB8A 4HJ3A 5GLAA 5GHZA 3LYXA 4EBLA 1KGFA 3TW8A 5J4EA 2QYBA 2A6CA 3GR2A 2IWBA 3A9XA 3NDGA 3O9XA 4Y2FA 4RVAA 3ITAA 1ZZBA 2LYQA 1YSEA 3G32A 3RXXA 1JTDA 1O7EA 2LNMA 2JVLA 4U0TA 1PW8A 4HBUA 2HSGA 5G18A 2IVBA 5HWWA 2HCNA 1BLCA 3SH7A 1K4FA 4HJ6A 2A3UA 3VOZA 3VP0A 4X53A 2ZC5B 4PM8A 5DTTA 3ZG0A 1WH8A 2HDSA 4MEZA 5IU1A 2XEPA 2PR6A 2PXQA 3SX0A 2XA7M 5U47A 3P98A 1W8YA 2PUEA 4K08A 3GDIA 3NDEA 4OOYA 3UMDA 4LRZE 1KE4A 2DCFA 5J3WA 3NIAA 1IC8A 5I94A 4P6ZS 1LLBA 2WKRA 1F98A 1NYMA 3BEBA 3MR0A 1V9ZA 1T19A 4NXGA
chains in the Genus database with same CATH topology
1X2LA 2PD8A 3P01A 1S1YA 2O9AA 3PBSA 4RQ9A 3NJAA 1NRJA 4X4GA 1LL8A 2KEJA 2L0WA 2YKHA 4YBAA 2PD7A 4YOFA 5DFXA 3K2NA 3RFBA 1OTDA 3D72A 1JFTA 2DMWA 5KIZA 4EXOA 3CLCA 1D7EA 4HI4A 4Z1WA 4Y3IA 3KX0X 3JXDL 3MJQA 3BQ8A 1XJ3A 4M4XA 2PUDA 2OAP1 4HIAA 1VPWA 3C2WA 2WIUB 2LB5A 2IV1A 2B02A 3T4QA 4Y5FA 5HWVA 1D06A 4R3AA 4I3IA 2NUTC 4IA8A 3UB9A 4EU0A 4YWZA 3UMEA 2O4AA 2AW6A 2G7UA 4KQOA 2EWWA 3FYMA 2VGLM 2VLGA 4BWIA 2KX6A 3E4OA 1S67L 2O9BA 1OT9A 1ZUGA 3PR6A 2BNOA 5G4YA 1GT0C 3CI6A 3JVVA 4DN0A 1PRUA 2GRMA 1EFAA 4EQ1A 3CECA 3K3DA 4NXBA 2BASA 4KUOA 3K3CA 1LMB3 2PUFA 3LI8A 2ZOHA 2A24B 3T4TA 2OFYA 1BDIA 4PKYA 4X4CA 3IS2B 5LBRA 1BDHA 4JCYA 2EWVA 1TF1A 3QWGA 1AU7A 3KSHA 4ETXA 2ZMVA 1UTXA 5HPIA 2VV7A 4YG4A 2EWTA 1NWZA 4LRYC 4J1XA 3EQVA 4CLCE 3KYZA 1OT6A 2AXUA 4MDZA 2AXZA 1T1AA 3G6OA 4NXEA 1LQCA 3R7WA 3P7NA 5AJGA 2H8RA 4MCWA 1N9OA 1XFNA 2OR1L 2VGLS 4O0PA 3B7HA 2A24A 5DJUA 1IOUA 1TS8A 3MF0A 1H3QA 1UXDA 3ZYTA 1ODVA 4AFIA 5I5LA 4ETZA 4PU4C 3KSIA 5DKLA 1RIOA 2PYPA 4UQIM 4EESA 2OWJA 3G5GA 3E4QA 5HD3A 5F5YA 1XJ4A 2CROA 4CLCB 2HJ9C 3F52A 2KEIA 4HOIA 2K2NA 4I38A 4HY8A 4EUVA 3UB6A 1UXCA 2HINA 3LFPA 3OC2A 2W3HA 3CAXA 3PHYA 1Y7YA 4Z5HA 5HL6A 3VOLA 3ZQ5A 3PBOA 4WN5A 4I6RA 1LCDA 2PE5A 3BWLA 4DJ2A 2IUOA 2L8NA 1DP8A 2OWHA 5L8MA 4BBVA 2LYRA 1W63Q 3GN5A 1LSWA 3GECA 3MXQA 1O4XA 2H28A 4YARA 4FSFA 4PHTA 4DMZA 5TBMA 1YSPA 2OOLA 3ULFA 4KUKA 2QWSA 3FPWA 2VKSA 1S4SA 4BJPA 1OJ5A 1ZZ8A 2O9CA 4HJ4A 1XFQA 3E98A 4ME4A 1OSLA 2HJEA 3UB7A 4PU7A 3KSGA 4GS9A 3EEHA 4F3LB 2GZAA 4GHJA 4MCTA 1ZVVA 2JKTI 2VEAA 1UWNX 2W3EA 5F68A 4MMNA 2PUGA 2XIUA 3LI9A 3BJNA 5C5KA 3SCHA 1VHMA 3GN5B 5K98B 1WIZA 1RZSA 1Y9QA 4JGPA 3T4SA 1ZZ9A 1WH6A 3W2ZA 3CROL 1QP0A 2BNNA 1GSVA 3LIAA 1RZRA 5AVEA 2V0UA 1TS7A 4MN6A 2AWIA 4PU8A 2ICTA 3PBRA 4EW7A 2QHKA 2PUCA 1F9IA 4R70A 2XSDC 2ZOIA 3IS2A 4GS9B 3FG8A 2K31A 2L49A 2LYSA 3ZHMA 3H5TA 2WUSR 4IUKA 3UFDA 2HGVA 3SW1A 3TRCA 4NDWA 4F8DA 1G6OA 3F1OB 2R63A 1JH9A 4EEPA 4II7A 3LFVA 4CLCA 2W0NA 3LIFA 3DBAA 5AVFA 3H9WA 3R7WB 2XSSA 1LT0A 2PT7A 4HNBA 4MCXA 4WL9A 4P6ZM 3L1PA 4DJ3A 1YKDA 5HD5A 2HV1A 3F1NB 1OCTC 3MFXA 2P08A 1RZRD 3DNVB 4GW9A 3PBNA 3RTYA 2IVGA 2FZ0A 3H7WA 3KYQA 4WELA 3ZKCA 3F1PA 4NKPA 3F51A 1OTEA 4XT2A 1CQTA 1LLIA 1QQBA 2M1CA 1YAXA 1KOUA 2O49A 3EGDC 2O0YA 3PBTA 2Z6CA 2W3DA 3BQAA 3B42A 3LISA 4I3AA 4OOMA 3S7PA 2FH5A 3QF3A 2AXVA 2IA2A 3EUSA 3NOUC 5G4ZA 3NHQA 2PUBA 5EFWA 2LYLA 4UEYA 4I5SA 3LIEA 4LLOB 3S7QA 5HPFA 2XJ3A 3D3OA 1ZTUA 3T4LA 4L9EA 2QJ5A 4WF0A 5CX7A 2HF6A 1W63M 4X4BA 3E4PA 2D01A 4MN5A 4YG1A 5HDSA 3RH8B 3F1NA 3VK0A 2A2LA 4H6JA 1VB6A 5K5BA 3TE8A 2I9VA 2WKQA 3UE6A 3OQNA 4L9FA 3MQ0A 3TRBA 5IT5A 2GRLA 1ZZ7A 3H7WB 3FPVA 3EQUA 2EBYA 4ARZB 3IVPA 3R4KA 1GSXA 1MZUA 2JKTM 3S7NA 2LYPA 3LICA 5J7EA 3HJKA 4Q0HA 4HH3A 4LPZA 3ZHIA 2CSFA 1BYWA 4Q0IA 3JXBC 1OTIA 3BW6A 4Z58A 1UGUA 1QPZA 4JCXA 1B0NA 3BS3A 3OQMA 2L4RA 1G28A 1TD5A 2W1RA 2W3GA 3CLOA 4G3KA 4L9GA 3FYAA 2O38A 1ZHHB 5HZHA 1PRAA 3OOVA 1DWKA 4GQMA 1Y28A 2LB9A 1LSVA 4GHIA 3B47A 3HZIB 3C8CA 4FN3A 3RZZA 1NLYA 4HHDA 3VV4A 1JWLA 1ADRA 3KZ3A 4E04A 3LUQA 1X0OA 1CJGA 2PIJA 2PUAA 2PR5A 4IWRA 2PYRA 2XRNA 3A0VA 4HP9A 2Z6DA 1S4RA 3LR4A 1ZZCA 2PDRA 3MQQA 4B9OA 3JVUA 4NXFA 4EETB 1JFSA 4MN7A 2L1MA 3KSFA 4R38A 4F3LA 3UB8A 2VJWA 4I8TA 4HP4A 4HQAA 4PAUA 2V1BA 4I39A 1TS6A 1X57A 3HJIA 3QYXA 3KJXA 1ZPQA 4GLQA 2FJRA 2CMNA 2W27A 1PERL 4G3WA 4X4HA 2J80A 4OB4A 2LCVA 3T4KA 2MJ6A 3EEAA 2O99A 1QP7A 1F5MA 4Z5CA 1TS0A 1OPXA 2KDKA 3OBFA 4IJGA 4WUJA 4EERA 2B18A 1XJ6A 3E0YA 4BMWA 1LSXA 2QJ7A 2VZWA 3B33A 1ZZ6A 1DRMA 2INWA 1P9RA 5HDCA 2GJ3A 3IBRA 3LIDA 2P04A 1EW0A 1POUA 2KLIA 5KSHA 2W1TB 5FL3A 1T1CA 3MQOA 3T50A 3LR5A 3OMTA 4Q0JA 2VV8A 1QP4A 2QKPA 1OTAA 1T1BA 1NERA 2GX5A 5A7LA 4O8BA 4GCZA 4BBTA 2KZ8A 1T18A 1UWPX 3QQ6A 2V9AA 4J1WA 4UQIS 3LR3A 4X4DA 1DP9A 3JXCL 1QQAA 2W3FA 4YG7B 1R63A 4JGOA 4XT2B 1H8MA 3IBJA 2MEZA 2ICPA 2AUWA 2W1TA 3NOPC 2M7UA 1S66L 2KPJA 4Y42A 3F6WA 4I6UA 3OCLA 1E3OC 2BNMA 1RPEL 3SCFA 3S8QA 2MQKA 2OAQ1 4PKYG 2JN7A 2R1JL 3CITA 5DF9A 1JNUA 3O5YA 1IFQA 2VV6A 1WETA 2XI8A 3KO6A 2D5VA 2ZMFA 3H82B 3EWKA 4L0LA 3FMYA 1MC0A 4X4FA 1ZAYA 1ZS4A 4BBUA 3V67A 4ZRRA 3KXAA 2Y8HA 3ICYA 3OCNA 2XROA 4O8GA 4WLAA 2VA0A 1NEQA 2IVQA 2R78A 2PHYA 2V1AA 4QPRA 5F6AA 4X4IA 2XA7S 3HCYA 2NUPC 2M7VA 4G3VA 2LYJA 1SQ8A 5HSQA 4EEUA 2EF8A 2V0WA 3MLFA 3A0RA 3F1PB 4HH2A 4NEED 1HF0A 3D1NI 2YKFA 3EOIA 1STZA 2EA9A 2J3TC 2GZUA 3CWFA 3R1FA 3BY8A 3MMHA 1P9WA 4CQHA 1S1ZA 5DJTA 3U3WA 2PPXA 3LR0A 4IUHA 4B93A 4H6JB 3OP9A 1XWRA 2GNXA 4I3JA 3U2AA 2J3WA 1DW9A 4FOFA 2VX8A 3BY9A 3T4JA 4WEJA 1MKMA 4OOLA 4WEKA 1YSQA 3LIBA 4YNRA 3FC7A 4ARZA 1OJGA 2KEKA 2J3TD 3G7DA 3PXPA 2JCGA 3H82A 3OQOA 2Y79A 3OLOA 4HJ3A 1DP6A 4I6TA 3LYXA 1WA9A 4FBIA 3EGXC 5DFYA 4IVZA 1PNRA 4X4EA 4PU3C 3TW8A 3VE3A 1P0ZA 2A6CA 2QYBA 3NOTC 3T4OA 5J4EA 5HDDA 1L1MA 2P7JA 3BDNA 1V9YA 3PBQA 3VE4A 5TBMB 3O9XA 3CUEA 5DKKA 3UE3A 2WKPA 4Y2FA 3SCGA 1ZZBA 2LYQA 3PYPA 1YSEA 4LRXC 4O01A 3C38A 5HWTA 2JKRI 1GSWA 5A8BA 2JVLA 1NLZA 5TJJA 2IU7A 2JKRM 2HSGA 2IVBA 1S7EA 4IHQA 1XJ2A 4Z59A 2KOIA 5HWWA 5IS1A 4HJ6A 3TJZC 2LYKA 3A0SA 4JQDA 4CLCC 4JGQA 1N9LA 2B5AA 2JHEA 2D02A 4R6LA 2ZBBA 1WH8A 3C30A 5F69A 5IU1A 2PR6A 4CLCD 1PRVA 3BD1A 2XA7M 5MC7A 2PUEA 4K08A 4GHIB 3GDIA 3UMDA 4LRZE 1R69A 3GBFA 4Z5DA 2K7SA 5J3WA 3CUEC 1IC8A 1P97A 1OTBA 4P6ZS 2BJCA 3S7OA 2WKRA 1LCCA 1F98A 1N9NA 4GJ4A 3MR0A 4KQDA 3F1OA 4JGRA 1V9ZA 1T19A 2XCJA 4NXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OQN A;  1X2L A;  2R1J L;  3TRB A;  2GRL A;  1ZZ7 A;  4X4G A;  1ZZ8 A;  2KEJ A;  2EBY A;  4YBA A;  2XI8 A;  1OSL A;  1WET A;  3IVP A;  2D5V A;  2LYP A;  4PU7 A;  3FMY A;  3SCF A;  4X4F A;  1ZAY A;  1ZS4 A;  3KXA A;  3ZHI A;  4GHJ A;  4MCT A;  1JFT A;  1ZVV A;  2CSF A;  3CLC A;  3JXB C;  2PUG A;  1NEQ A;  2IVQ A;  2XIU A;  4Z58 A;  3SCH A;  3JXD L;  3GN5 B;  5K98 B;  1WIZ A;  1RZS A;  1B0N A;  1Y9Q A;  3BS3 A;  3OQM A;  1QPZ A;  4JCX A;  4X4I A;  1ZZ9 A;  1WH6 A;  2PUD A;  3CRO L;  1QP0 A;  1VPW A;  2LYJ A;  2BNN A;  1SQ8 A;  1RZR A;  2WIU B;  3FYA A;  2O38 A;  2EF8 A;  2IV1 A;  3MLF A;  2AWI A;  1PRA A;  4PU8 A;  1HF0 A;  1DWK A;  4GQM A;  3D1N I;  2ICT A;  2GZU A;  3HZI B;  2PUC A;  4FN3 A;  3R1F A;  3RZZ A;  2XSD C;  1JWL A;  4IA8 A;  1ADR A;  3KZ3 A;  2L49 A;  2O4A A;  2AW6 A;  2LYS A;  1CJG A;  3ZHM A;  3U3W A;  2PIJ A;  2PPX A;  3H5T A;  2PUA A;  2WUS R;  3FYM A;  3UFD A;  3OP9 A;  4IWR A;  4JCY A;  4NDW A;  1XWR A;  4F8D A;  1DW9 A;  2R63 A;  1ZUG A;  1JH9 A;  1ZZC A;  2BNO A;  1GT0 C;  1RPE L;  1PRU A;  2GRM A;  1JFS A;  1EFA A;  3CEC A;  2KEK A;  3G7D A;  3PXP A;  2JCG A;  3OQO A;  4MCX A;  1LMB 3;  2PUF A;  4I8T A;  3L1P A;  4I6T A;  1X57 A;  2OFY A;  3QYX A;  4FBI A;  3KJX A;  1BDI A;  4X4C A;  1ZPQ A;  4IVZ A;  2FJR A;  4X4E A;  4PU3 C;  3QWG A;  1AU7 A;  1BDH A;  2A6C A;  1PER L;  4X4H A;  1OCT C;  1RZR D;  3DNV B;  1L1M A;  4OB4 A;  2LCV A;  3BDN A;  1UTX A;  3O9X A;  4YG4 A;  2EWT A;  1QP7 A;  4Z5C A;  3SCG A;  1ZZB A;  2LYQ A;  1YSE A;  4J1X A;  2IVG A;  2AXU A;  3ZKC A;  1ZZ6 A;  2AXZ A;  3F51 A;  2JVL A;  1CQT A;  1LQC A;  1LLI A;  1QQB A;  2H8R A;  2IU7 A;  2HSG A;  1POU A;  2IVB A;  1S7E A;  2OR1 L;  2O49 A;  4Z59 A;  3B7H A;  3OMT A;  1UXD A;  2LYK A;  1QP4 A;  4JQD A;  4PU4 C;  1NER A;  2B5A A;  3LIS A;  5A7L A;  4O8B A;  1RIO A;  3G5G A;  3QF3 A;  1WH8 A;  2AXV A;  3EUS A;  2KZ8 A;  3S8Q A;  1PRV A;  3BD1 A;  3QQ6 A;  2PUB A;  2CRO A;  4J1W A;  2LYL A;  3F52 A;  2KEI A;  4X4D A;  2PUE A;  3JXC L;  1UXC A;  2HIN A;  2XJ3 A;  3LFP A;  1QQA A;  1R69 A;  1R63 A;  4YG7 B;  1Y7Y A;  3GBF A;  4Z5D A;  4Z5H A;  2MEZ A;  2ICP A;  4I6R A;  2PE5 A;  1LCD A;  2AUW A;  2IUO A;  4X4B A;  1IC8 A;  2L8N A;  4YG1 A;  2LYR A;  3GN5 A;  3VK0 A;  2KPJ A;  2BJC A;  4Y42 A;  1O4X A;  4YAR A;  1LCC A;  1PNR A;  3F6W A;  4I6U A;  1E3O C;  2BNM A;  2XCJ A;  2MQK A; 
#chains in the Genus database with same CATH topology
 1X2L A;  1H8Z A;  2PD8 A;  1S1Y A;  2O9A A;  1H5X A;  3PBS A;  3I7J A;  2KEJ A;  2PD7 A;  3K2N A;  1K56 D;  3C7U A;  3D72 A;  2LLW A;  1SDN A;  1MXO A;  1JFT A;  2ZD8 A;  5KIZ A;  1Q2P A;  4Y3I A;  2H5S A;  1FSY A;  2HDQ A;  3QP1 A;  4LEN A;  3BQ8 A;  3MXS A;  1U2Z A;  3UPO A;  1Z6F A;  1VPW A;  4ZJ1 A;  2WIU B;  2LB5 A;  2UWX A;  2PRF A;  3OPR A;  2EFX A;  4I3I A;  3Q82 A;  2PXF A;  3OKZ A;  4YWZ A;  2O4A A;  1J3W A;  2G7U A;  2EXA A;  3E4O A;  3Q7V B;  3CHW P;  2O9B A;  1OT9 A;  1ESI A;  3V50 A;  3PR6 A;  5G4Y A;  1GT0 C;  4DN0 A;  1PRU A;  2PXV A;  1EFA A;  3CEC A;  2BAS A;  4DXB A;  1K55 A;  1HVB A;  4FH4 A;  4A5R A;  1TF1 A;  4QU3 A;  3LCE A;  5DTQ A;  2XFT A;  4LRY C;  1KE3 A;  3G2Z A;  4QJG A;  1T1A A;  2QMI A;  3R7W A;  4JKT A;  4MCW A;  1XFN A;  2OR1 L;  3SS3 A;  2C6W B;  2VGL S;  4O0P A;  3MF0 A;  4RX3 A;  1ODV A;  4AFI A;  1LL5 A;  5DKL A;  1SKO B;  2OWJ A;  5JYP A;  5F5Y A;  4DDS A;  3FWL A;  2CRO A;  5TFQ A;  4FUW A;  1ERQ A;  5GHX A;  1PI5 A;  4EUV A;  1NW3 A;  4R4S A;  4E3O A;  1PW1 A;  5CGS A;  3PBO A;  4WN5 A;  2Q9M A;  1YLT A;  2OWH A;  1W63 Q;  3GEC A;  4FD8 A;  3AGF A;  1YSP A;  2V20 A;  3KYE A;  4JF5 A;  1VM1 A;  4GOG A;  2HJE A;  4PU7 A;  4R4R A;  5L2F A;  4B88 A;  3G30 A;  4MCT A;  2JKT I;  2W3E A;  5F68 A;  4MMN A;  5EVL A;  1SZV A;  2PUG A;  3LI9 A;  3U4L P;  3BJN A;  3V3S A;  2YBD A;  3GN5 B;  5K98 B;  1MPL A;  3TEP A;  3IX3 A;  3T4S A;  5FQI A;  1HD8 A;  1VEU A;  1RZR A;  4JXV A;  1BLH A;  1TS7 A;  4Q2J A;  4PU8 A;  5FAS A;  1CEF A;  3E2K A;  1HQ1 A;  2PUC A;  4LV1 A;  1K55 C;  3IS2 A;  1W79 A;  1LI9 A;  5KMW A;  3ZHM A;  3H5T A;  3FKW A;  5GAG i;  1G6O A;  3WS5 A;  4CLC A;  3UDI A;  5AVF A;  3H9W A;  2PT7 A;  5IHV A;  4HNB A;  2ZQ7 A;  4IVK A;  5FEG A;  5GHY A;  1QZX A;  3MFX A;  2WZX A;  3IF6 A;  4PM7 A;  4GD6 A;  3RTY A;  2IVG A;  2FZ0 A;  3KYQ A;  2G2W A;  4DE0 A;  3ZKC A;  1L2S A;  4XT2 A;  3NCK A;  1ES2 A;  3A9Z A;  2O49 A;  3G2Y A;  1PRQ A;  3MZF A;  2W3D A;  4JF6 A;  4OOM A;  2JKG A;  3S7P A;  2BG1 A;  2AXV A;  1RGY A;  5E2G A;  5FAP A;  5L07 A;  5CRF A;  4S2J A;  2P9V B;  5EFW A;  4UEY A;  2H10 A;  4QY6 A;  1E3U A;  3T4L A;  1TDG A;  4FH2 A;  1E3U D;  4YG1 A;  3F1N A;  5FAT A;  1S0W A;  5K5B A;  3PAE A;  3C4O A;  1VET B;  3UE6 A;  1ES4 A;  4E3I A;  3MQ0 A;  5IT5 A;  3H7W B;  3GZC A;  3IF6 C;  1ES3 A;  3S7N A;  2LYP A;  3P09 A;  1PWD A;  4HH3 A;  3AGD A;  2CSF A;  3VFH A;  3N4I A;  1UGU A;  1QPZ A;  3TSG A;  3FZC A;  2XK1 A;  3V5M A;  2XXA A;  5L09 A;  4G3K A;  4L9G A;  2O38 A;  4C6Y A;  5HZH A;  5EPH A;  4KG6 A;  1PRA A;  5JUW A;  4GQM A;  2EX8 A;  2LB9 A;  4GHI A;  2VGK A;  3ITB A;  4HHD A;  3N7W A;  3MFD A;  2ZM0 A;  3ZNT A;  1RP5 A;  4JPM A;  2PUA A;  1DY6 A;  1L0D A;  1K4E A;  1S4R A;  4GZB A;  5FDS A;  3MQQ A;  3IH9 A;  4NXF A;  5GL9 A;  4MN7 A;  4R38 A;  2VJW A;  2V1B A;  3G34 A;  2W27 A;  4S2M A;  1PER L;  4X4H A;  3EEA A;  4IJG A;  4PM5 A;  2B18 A;  2QJ7 A;  1P9R A;  2OLV A;  5HDC A;  5HAQ A;  2P04 A;  1POU A;  4U3T A;  1T1C A;  3MQO A;  4GDN A;  3LR5 A;  2P74 A;  3HLF A;  2QKP A;  1JWZ A;  1VET A;  5A7L A;  3M6H A;  2H0Y A;  3Q81 A;  4UQI S;  3LR3 A;  2XD1 A;  3IXB A;  1MY8 A;  4XT2 B;  2ICP A;  3D4F A;  1HZO A;  3NOP C;  5FQQ A;  1S66 L;  1ES5 A;  4CJN A;  1E3O C;  2BNM A;  3SCF A;  2JN7 A;  2V8C A;  4GKU A;  2OV5 A;  2XI8 A;  3KO6 A;  4XUZ A;  4E6X A;  4L0L A;  2EX2 A;  3LO7 A;  3OCN A;  4DXC A;  3ZG9 B;  1XX2 A;  2HCS A;  2IVQ A;  2R78 A;  2E8I A;  2WAF A;  4QPR A;  3HCY A;  2NUP C;  4Q8I A;  4BL3 A;  3M9L A;  2B5R A;  3FYZ A;  1MWT A;  4N9L A;  1FR6 A;  3A0R A;  5FI7 A;  1JTG A;  4ER0 A;  3OPP A;  1C3B A;  1S1Z A;  4JXS A;  3SZT A;  1CK3 A;  2EXB A;  3LR0 A;  4B93 A;  3OP9 A;  3DTI A;  1W5D A;  5FQJ A;  4S2I A;  3T12 B;  4OOL A;  2PU2 A;  4WEK A;  1IKG A;  3FC7 A;  2KEK A;  2JCG A;  4X68 A;  5GLC A;  3CMZ A;  2Y79 A;  4OQH A;  2Y59 A;  4BQM A;  1MKI A;  1WA9 A;  4FBI A;  1ESU A;  4IVZ A;  3VE3 A;  3T4O A;  4O7D A;  5HDD A;  3PBQ A;  3VE4 A;  3CUE A;  4OH0 A;  4LRX C;  4S2N A;  5FA7 A;  1H8Y A;  1NZO A;  5A8B A;  3WWX A;  1NLZ A;  2Q9N A;  2IU7 A;  1ZG6 A;  4Z59 A;  3MS6 A;  5IS1 A;  4JQD A;  4CLC C;  3PE5 A;  2JHE A;  1PYY A;  3CPT B;  5F69 A;  1PRV A;  3BD1 A;  1PFL A;  1R69 A;  3S22 A;  2K7S A;  5CEB A;  1P97 A;  1OTB A;  1HLU P;  3QP2 A;  1VQQ A;  4KG2 A;  4RA7 A;  3LY3 A;  3A9Y A;  2XQZ A;  1LL8 A;  1ZC2 A;  4YOF A;  1GHP A;  3IHB A;  5FDH A;  1OTD A;  5FI6 A;  2ZQD A;  4DRT A;  1TVF A;  4EXO A;  1D7E A;  4HI4 A;  3KX0 X;  1XJ3 A;  4M4X A;  2OAP 1;  4EK9 A;  3UPP A;  2B02 A;  3T4Q A;  5FQK A;  1E4D A;  2Y2M A;  5HWV A;  1D06 A;  2NUT C;  3CZD A;  3HLG A;  2B95 A;  3UB5 P;  1SKO A;  4JBF A;  1ZUG A;  1YM1 A;  2BNO A;  2P9V A;  5FSR A;  4MBK A;  4P87 A;  2GRM A;  3K3D A;  3BRM A;  1K6R A;  5DRY A;  1YPR A;  3QP5 A;  4KUO A;  2PUF A;  2ZOH A;  1D1J A;  1K0K A;  4PKY A;  5LBR A;  2QZ6 A;  1BDH A;  4JCY A;  1G68 A;  4ETX A;  3QWG A;  2JQE A;  2VV7 A;  4YG4 A;  2EWT A;  3Q1F A;  4LCL A;  4J1X A;  1XXM A;  4KZA A;  4CLC E;  3NRO A;  4P0M A;  3MBZ A;  4NXE A;  3P7N A;  1FR1 A;  5AJG A;  2H8R A;  4H8R A;  4HES A;  1TS8 A;  2Q0O A;  3E2L A;  1UXD A;  3Q7Z A;  4ER6 A;  4ETZ A;  3KSI A;  4HBT A;  2BLS A;  2PYP A;  5AQ7 A;  2X02 A;  1XJ4 A;  3BYD A;  1AWI A;  2V3C C;  1BLP A;  2KEI A;  1SKF A;  3MSH A;  3T1S A;  1UXC A;  3CAX A;  1Y7Y A;  2PXB A;  1MFQ C;  3ZQ5 A;  2PE5 A;  4DJ2 A;  3JPU A;  2L8N A;  1DP8 A;  2L1P A;  1WYC A;  4BBV A;  4PHT A;  3QP4 A;  1Q2Q A;  2H28 A;  3JYI A;  4FSF A;  4Y15 A;  4DMZ A;  2OOL A;  5E43 A;  4KUK A;  3W4Q A;  1XPB A;  2O9C A;  3IHA A;  4ME4 A;  2WAD A;  3KSG A;  3EEH A;  1EWZ A;  4GHJ A;  1ZVV A;  2VEA A;  4GNU A;  3A3D A;  3VP1 A;  3SCH A;  4JGP A;  1Y9Q A;  4KZ9 A;  3WS2 A;  1WH6 A;  3CRO L;  3C4P A;  1QP0 A;  1GSV A;  3G31 A;  2V0U A;  2CC1 A;  2ICT A;  3PBR A;  1F9I A;  2XSD C;  4OQ0 A;  4GS9 B;  3QNC A;  4ZJ2 A;  4EKI A;  2WUS R;  4IUK A;  3SW1 A;  3QOX A;  4DKI A;  4F8D A;  3SS4 A;  3SS5 A;  2R63 A;  3SH9 A;  4EEP A;  5CER A;  2J7V A;  5E2F A;  4WL9 A;  4KEN B;  1FCO A;  4S2L A;  4DJ3 A;  2HV1 A;  2V2F F;  1FCM A;  3ZVT A;  1RZR D;  3LEZ A;  3FKV A;  3S1Y A;  1BZA A;  4Y0T A;  3F51 A;  1OTE A;  1CQT A;  1YAX A;  5F82 A;  2O0Y A;  3PBT A;  4ID4 A;  2HP5 A;  3BQA A;  1L0G A;  3LIS A;  4ZJ3 A;  2XLN A;  2IA2 A;  3NHQ A;  4WMC A;  4BD0 A;  5A93 A;  2LYL A;  3IX8 A;  3S7Q A;  4GN2 A;  2QJ5 A;  4WF0 A;  3HLD A;  4X4B A;  2D01 A;  4N1X A;  5HDS A;  4UA9 A;  3OQN A;  2GRL A;  4ZDX A;  4NET A;  2EBY A;  5GLD A;  5JYO A;  2PXL A;  5CEC A;  1PWC A;  3HJK A;  4MLL A;  4QY5 A;  3ZHI A;  4WYY A;  3Q07 A;  2ZC3 B;  4Q0I A;  3UE0 A;  3BW6 A;  4Z58 A;  3BLS A;  5FAQ A;  4UAA A;  3CLO A;  5F1F A;  3N8R A;  3KL4 A;  3L9K A;  3OOV A;  5KZH A;  3HZI B;  3IX4 A;  4FN3 A;  1NLY A;  1O07 A;  1ADR A;  1SHV A;  2J9P A;  1HTZ A;  1K57 C;  1GHM A;  3NXH A;  4IWR A;  3OWQ A;  2PYR A;  2PBD P;  2PBY A;  2JCH A;  4RYE A;  2J7U A;  1ZZC A;  4B9O A;  3GZD C;  3JVU A;  1Y4O A;  4EET B;  2G2U A;  1JFS A;  2L1M A;  4HP4 A;  4I39 A;  1X57 A;  2FJR A;  3DAV A;  3M2J A;  2QPN A;  1L0F A;  4EV4 A;  4WUJ A;  5HW3 A;  3MEJ A;  4Z5C A;  1H0M A;  1XJ6 A;  3B33 A;  1ZZ6 A;  4S2O A;  2INW A;  4MNR A;  3IBR A;  3LID A;  3S4X A;  3GTC A;  5FL3 A;  1ZG4 A;  2Y2I A;  1KDS A;  1QP4 A;  5FI2 A;  1ONG A;  2GX5 A;  4FCF A;  4O8B A;  4BBT A;  2KZ8 A;  2Y91 A;  2WK0 A;  2EX9 A;  1YLJ A;  3A3I A;  5HAI A;  1CI9 A;  1DP9 A;  1YQS A;  4YG7 B;  4KZ5 A;  1H8M A;  1LHY A;  4M3K A;  4X69 A;  3WS0 A;  2W1T A;  4Y42 A;  1IYQ A;  3OCL A;  2MQK A;  4PKY G;  1BT5 A;  3CIT A;  1NYY A;  5DF9 A;  3BFC A;  1WET A;  2D5V A;  4F3L B;  3FMY A;  1MC0 A;  4X4F A;  4C3Q A;  1ZS4 A;  3MZE A;  4KG5 A;  1YLZ A;  2PXK A;  2Y8H A;  4IBR A;  2XRO A;  4WZ4 A;  5CGW A;  2VA0 A;  2DNS A;  5F6A A;  4UA7 A;  3WS4 A;  2LYJ A;  2XFS A;  1DUL A;  4N1H A;  4EEU A;  5HSQ A;  2EF8 A;  2EFU A;  4CPK A;  3MLF A;  3F1P B;  3D1N I;  3EOI A;  3GRJ A;  1STZ A;  2GZU A;  3CWF A;  4OQG A;  3MMH A;  5EVI A;  1P9W A;  5CTM A;  4CQH A;  5DJT A;  3VSL A;  4OP8 A;  5CHU A;  2V8F A;  4I3J A;  4YIN A;  2J3W A;  1U60 A;  1OJG A;  2HFZ A;  3H82 A;  3OQO A;  4UHU A;  3R09 A;  3IWQ A;  3QNB A;  3OLO A;  1DP6 A;  1FSW A;  3NC8 A;  2ZC6 B;  1PNR A;  1P0Z A;  2WKI A;  1BUL A;  1KVM A;  2P7J A;  1V9Y A;  5TBM B;  2WZZ A;  5DKK A;  3UE3 A;  3SCG A;  5HWT A;  5EVI C;  3HUN A;  4EQZ A;  4PM9 A;  2Y2H A;  1S7E A;  1XJ2 A;  1G6A A;  3NEC A;  2ODR D;  2LYK A;  3C7V A;  3A0S A;  4JGQ A;  3TG9 A;  2B5A A;  2WAE A;  2RCX A;  4CLC D;  1EI5 A;  1NRF A;  3ZG8 B;  5A91 A;  4B4X A;  4GHI B;  4OPR A;  3GBF A;  3CUE C;  4OPZ A;  2BJC A;  1N9N A;  4KQD A;  3O3V A;  3O86 A;  3F1O A;  2XCJ A;  3ZNY A;  2XGN A;  4ZAM A;  3W4P A;  3NJA A;  1NRJ A;  4X4G A;  2Z2M B;  2YKH A;  2L0W A;  4YBA A;  1L3L A;  5DFX A;  4Y17 A;  4X6T A;  2DMW A;  3CLC A;  1IKI A;  4BLM A;  2JC7 A;  2J7W A;  4HIA A;  5DF8 A;  3C2W A;  2ZL1 A;  5DTM A;  4Y5F A;  3QFI A;  2Y2N A;  3CJM A;  2ZM2 A;  4IA8 A;  5AQ9 A;  1JWP A;  3UME A;  2AW6 A;  3BFG A;  4KQO A;  3NI9 A;  3FYM A;  4BWI A;  2XR0 A;  1SCW A;  3JVV A;  4JF4 A;  2WYX A;  4EQ1 A;  3WRZ A;  4NXB A;  3ME5 A;  2C5W B;  3K3C A;  3IWI A;  2WGV A;  4KZ7 A;  3T4T A;  2OFY A;  1BDI A;  4X4C A;  3IS2 B;  3KSH A;  3WRT A;  4Z9Q A;  3A3J A;  3HL9 A;  4WM9 A;  3C5A A;  4OPY A;  5HPI A;  2ZQA A;  3HUM A;  4R1G A;  3EQV A;  5TGF A;  2HDU A;  1OT6 A;  2AXU A;  4MDZ A;  3TEL A;  3G6O A;  2R9W A;  1LQC A;  1N9O A;  4E3J A;  2A24 A;  3UN7 A;  3HVF A;  3VP2 A;  3N6I A;  1RIO A;  5E2H A;  4EES A;  3G5G A;  1MWU A;  4JXW A;  3GQZ A;  5HD3 A;  2VK3 A;  4CLC B;  3F52 A;  4HOI A;  4I38 A;  4F94 A;  3UB6 A;  2HIN A;  3LFP A;  3OC2 A;  3GUU A;  2W3H A;  5CTN A;  3VOL A;  1LCD A;  3BWL A;  4DE1 A;  3ZFZ A;  2IUO A;  1LSW A;  3A3F A;  3MXQ A;  1PIO A;  2Z2L B;  3W4O A;  3ULF A;  1IYO A;  3FPW A;  4E6W A;  2VKS A;  1S4S A;  4BJP A;  3GMW A;  1TDL A;  1OJ5 A;  1ZZ8 A;  3IXD A;  4HJ4 A;  5F83 A;  3T1X A;  1OSL A;  3SR4 A;  1FIK A;  4KZ6 A;  3NDB B;  4GS9 A;  1E25 A;  4K91 A;  4QWO A;  1UWN X;  3BFE A;  3MZD A;  3TOI A;  1RGZ A;  5C5K A;  4WVL A;  1N4O A;  1RZS A;  3BLM A;  2BNN A;  1QMF A;  5AVE A;  2AWI A;  4PMA A;  2WGI A;  5DTR A;  2QHK A;  4R70 A;  3FG8 A;  3WS1 A;  2K31 A;  2FFY A;  4HEF A;  4KZB A;  1CI8 A;  2VEO A;  3IT9 A;  3DM5 A;  3UO9 A;  4ZBE A;  5EE8 A;  3LFV A;  2W0N A;  2I72 A;  3DBA A;  3D9Y A;  3R7W B;  1LT0 A;  4BEN A;  3DTE A;  3W8K A;  1GCE A;  4MCX A;  2JKF A;  3RJU A;  4BD1 A;  3L1P A;  3IXG A;  3LEQ A;  1YKD A;  5HD5 A;  1OCT C;  1LI0 A;  1YMS A;  2A49 A;  4K0X A;  1IEL A;  1FOF A;  1GA0 A;  4OP5 A;  3F1P A;  3OZH A;  3FV7 A;  4DDY A;  1LLI A;  1A0K A;  1QQB A;  3EGD C;  4MBF A;  3IH8 A;  3UY6 A;  5DRT A;  4I3A A;  3PAG A;  3EUS A;  5CXW A;  2UV0 E;  1MWR A;  5HPF A;  4C75 A;  2XJ3 A;  5A90 A;  2ZLY A;  4Y0O A;  1PZO A;  3E4P A;  3RH8 B;  2PXT A;  4H6J A;  3HLC A;  1VB6 A;  3TE8 A;  1I2W A;  2WKQ A;  1K54 A;  3VFF A;  4L9F A;  4X25 A;  3TRB A;  3NZL A;  4ARZ B;  4OQI A;  3IVP A;  1IYP A;  1GSX A;  1MZU A;  2JKT M;  3DWZ A;  3R4K A;  4N92 A;  3GV9 A;  4K0W A;  2Y2Q A;  4NK3 A;  4OLD A;  3GVB A;  1BYW A;  1IEM A;  2BTF P;  4JCX A;  2LLV A;  2W1R A;  2W3G A;  2EX6 A;  5EVI D;  5M18 A;  3FYA A;  3ZVW A;  1SDE A;  1DJA A;  1DWK A;  1LSV A;  3C8C A;  1FIL A;  3VV4 A;  4Y7P A;  3KZ3 A;  3HLB A;  2Y2J A;  2PIJ A;  3LQX A;  3DWK A;  1ACF A;  4HP9 A;  4OPQ A;  2XD5 A;  4D2O A;  1VEU B;  4X56 A;  3KSF A;  1CF0 A;  3UB8 A;  5J8X A;  4HQA A;  4PAU A;  1TS6 A;  3HJI A;  1YLW A;  1G5U A;  3KJX A;  4LV3 A;  2XH9 A;  2CMN A;  1CQA A;  4G3W A;  2J80 A;  4OB4 A;  2LCV A;  3T4K A;  2MJ6 A;  1F5M A;  5L10 A;  2KDK A;  1OPX A;  4EER A;  2JBF A;  3VSK A;  2VGJ A;  3E0Y A;  4KZ8 A;  1LSX A;  2M4H A;  1YT4 A;  1DRM A;  2FFH A;  1Z09 A;  4S2N C;  2KLI A;  2W1T B;  3VWS A;  5CGX A;  3OMT A;  4Q0J A;  5EM0 A;  3IF5 A;  1T1B A;  1NER A;  1CJF A;  4GCZ A;  4E3L A;  1T18 A;  1UWP X;  4S2K A;  3QQ6 A;  2V9A A;  4J1W A;  4X4D A;  1LL9 A;  4DF6 A;  1QQA A;  1YMX A;  4IBX A;  3IBJ A;  2MEZ A;  1IYS A;  3UE1 A;  3Q7V A;  3F6W A;  3PTE A;  3S8Q A;  2OAQ 1;  2MXD A;  2R1J L;  3N8S A;  1K6S A;  3UPN A;  1IFQ A;  1XA7 A;  2E8J A;  5CED A;  1JWV A;  3H82 B;  5BOH A;  1ZAY A;  5EVI B;  3V67 A;  3VP4 A;  4ZRR A;  3UDX A;  1NEQ A;  2PHY A;  5AQA A;  4X4I A;  4HH2 A;  4NEE D;  2ZJ9 A;  2EA9 A;  2J3T C;  3HBR A;  4LCM A;  1ALQ A;  4EBP A;  3R1F A;  4DE8 A;  2IWD A;  3BY8 A;  3L7H A;  5DTK A;  2X71 A;  4IUH A;  4R23 A;  4Y13 A;  1NZU A;  4OKP A;  5GLB A;  1XWR A;  1PI4 A;  4RX2 A;  3U2A A;  2HP9 A;  2OLU A;  1YLP A;  3HRE A;  4FOF A;  3T1R A;  3T4J A;  4E3K A;  4EWF A;  1MKM A;  3PXP A;  4E3N A;  4I6T A;  5FQM A;  2Y2P A;  3EGX C;  5DFY A;  4X4E A;  4PU3 C;  1XGI A;  1M40 A;  3NOT C;  4WZ5 C;  1L1M A;  3BDN A;  4S2P A;  3HUO A;  3SOI A;  2WKP A;  5EEC A;  4BL2 A;  3PYP A;  4O01 A;  3C38 A;  1JVJ A;  2JKR I;  1GSW A;  5TJJ A;  2JKR M;  2X01 A;  4IHQ A;  4JXG A;  2KOI A;  5DT2 A;  4KQR A;  3TJZ C;  1N9L A;  4R6L A;  2D02 A;  2ZBB A;  4FTX A;  3C30 A;  1QB2 A;  5MC7 A;  1W8Q A;  4Z5D A;  3OPH A;  3ZGA B;  3S7O A;  4GJ4 A;  1LCC A;  4JGR A;  4QD4 A;  4I5S A;  3P01 A;  2RL3 A;  5HFO A;  3VP3 A;  1CEG A;  1BTL A;  4RQ9 A;  1BSG A;  3ZHH A;  3RFB A;  1KGG A;  4EBN A;  4MBH A;  3ZCZ A;  4Z1W A;  4ER7 A;  1GA9 A;  3JXD L;  3MJQ A;  2PUD A;  4OBM A;  4JLF A;  3ZPX A;  5EVE A;  4U0X A;  4R3B A;  4B4Z A;  2IV1 A;  4KZ3 A;  1WYB A;  1OME A;  3BEC A;  4R3A A;  3O87 A;  3UB9 A;  4EU0 A;  1K54 C;  2EWW A;  2VGL M;  5HL1 A;  2VLG A;  2KX6 A;  4E3M A;  1S67 L;  3N8L A;  3DW0 A;  1ERM A;  3SH8 A;  3CI6 A;  4EZI A;  1DJC A;  1RCJ A;  3IQA A;  1LMB 3;  3LI8 A;  2A24 B;  2EWV A;  1AU7 A;  3UWP A;  1ZKJ A;  2ZMV A;  1UTX A;  3CPT A;  2WGW B;  1NWZ A;  4YFM A;  5TR7 A;  2ZM8 A;  3KYZ A;  4WZ5 A;  2AXZ A;  1KDW A;  1WE4 A;  2ZQ8 A;  4KQQ A;  4LGW A;  3NUL A;  2PXE A;  3B7H A;  5DJU A;  1IOU A;  1H3Q A;  3ZYT A;  2HDR A;  5HX9 A;  5I5L A;  4PU4 C;  4UQI M;  3E4Q A;  2WUQ A;  4IED A;  2HJ9 C;  2K2N A;  1PNE A;  3OPL A;  4HY8 A;  2Y2G A;  2ZC4 B;  3PHY A;  2J8Y A;  4Z5H A;  3BFD A;  5HL6 A;  5DTS A;  4I6R A;  3G0T A;  4R0Q A;  5L8M A;  2LYR A;  3GN5 A;  3G4P A;  1O4X A;  4YAR A;  1BLS A;  2HZ5 A;  5E2E A;  4ER5 A;  5TBM A;  3MXR A;  2QWS A;  2ACG A;  2R9X A;  1XFQ A;  2PU4 A;  3E98 A;  3UB7 A;  5FAO A;  1MBL A;  2Y2L A;  2PAV P;  2GZA A;  2PXD A;  4QHC A;  1N9B A;  1GHI A;  1XA1 A;  2XIU A;  1VHM A;  3GSG A;  1WIZ A;  3T1Q B;  1XKZ A;  3ISG A;  1ZZ9 A;  1ERO A;  2WGW A;  3W2Z A;  4ESP A;  3LIA A;  4D60 A;  3UDF A;  4MN6 A;  1DJB A;  4EW7 A;  1ONH A;  4UA6 A;  5HAR A;  1XP4 A;  2OSU A;  3M2K A;  2ZOI A;  4OLG A;  4ER3 A;  4R3J A;  2L49 A;  2WKE A;  3NBL A;  2LYS A;  3UFD A;  2HGV A;  3TRC A;  4NDW A;  2GDN A;  5HAP A;  3F1O B;  2Y55 A;  2XXQ A;  1JH9 A;  4WMC D;  4KZ4 A;  4II7 A;  5DSX A;  3LIF A;  5EM1 A;  2XSS A;  4P6Z M;  3M6B A;  1KVL A;  3F1N B;  3QOW A;  2XF3 A;  2P08 A;  3V39 A;  3DNV B;  5EUA A;  3DTM A;  4GW9 A;  5M19 A;  3PBN A;  2Y2K A;  5M1A A;  2IWC A;  3IWO A;  2ZL1 B;  1KGE A;  3H7W A;  4EUZ A;  4WEL A;  3HLW A;  2Y4A A;  4NKP A;  2M1C A;  1KOU A;  2AVX A;  4P85 A;  5AQB A;  2Z6C A;  5CHJ A;  3B42 A;  2FH5 A;  3QF3 A;  1FCN A;  1PWG A;  1NY0 A;  3NOU C;  5G4Z A;  2PUB A;  2HPB A;  3LIE A;  4LLO B;  2HP6 A;  3D3O A;  1ZTU A;  4L9E A;  5CX7 A;  2HF6 A;  1W63 M;  4MN5 A;  3LGO A;  2ZQ9 A;  3VK0 A;  2A2L A;  3QHY A;  4WBG A;  2I9V A;  3QP6 A;  4LV2 A;  3UNW A;  3ZG7 B;  4EQI A;  1ZZ7 A;  3FPV A;  3EQU A;  3VMA A;  3LIC A;  5J7E A;  4Q0H A;  4LPZ A;  2H0T A;  3JXB C;  1OTI A;  1NXY A;  1B0N A;  3BS3 A;  3OQM A;  2L4R A;  4GDB A;  4PPR A;  1G28 A;  1TD5 A;  1TEM A;  1YLY A;  4OVD A;  1ZHH B;  1Y28 A;  1FQG A;  3B47 A;  5F1G A;  1BUE A;  3RZZ A;  1JWL A;  4E04 A;  3LUQ A;  1X0O A;  1CJG A;  2PR5 A;  4DE3 A;  3ZG5 A;  5FEF A;  1W7F A;  2XRN A;  3A0V A;  3G35 A;  2Z6D A;  5FQ9 A;  3LR4 A;  2PDR A;  4NG2 A;  4IVI A;  1S6R A;  3QP8 A;  1K56 A;  1K25 A;  4Y0U A;  2XDM A;  4F3L A;  4X1M A;  4I8T A;  5D3O A;  4ZTK A;  3QYX A;  5EOE A;  1ZPQ A;  2ZMA A;  4GLQ A;  3TFL A;  1J9M A;  1M6K A;  2ZC7 A;  4DE9 A;  3HLE A;  2DRW A;  3V3R A;  2O99 A;  1QP7 A;  3OBF A;  1TS0 A;  5DVA A;  1PZP A;  3DTK A;  4BMW A;  4XXR A;  2VZW A;  5EV0 A;  3AGE A;  2GJ3 A;  1I5Q A;  1EW0 A;  5KSH A;  4LV0 A;  1F2K A;  3T50 A;  2VV8 A;  4GB7 A;  1KE0 A;  1I2S A;  4DE2 A;  3GZD A;  5GAH i;  1OTA A;  2V1Z A;  1K57 A;  5EOO A;  2Y2O A;  3CG5 A;  4LFU A;  2XXP A;  1K38 A;  3JXC L;  2W3F A;  1R63 A;  4JGO A;  2ZQC A;  3NY4 A;  3RXW A;  3BFF A;  2AUW A;  4N9K A;  4PM6 A;  2M7U A;  2KPJ A;  4X1L A;  5CHM A;  4I6U A;  1RPE L;  2JE5 A;  4X55 A;  1JNU A;  1AXB A;  3O5Y A;  2VV6 A;  4EKG A;  2PXP A;  1XGJ A;  2FFF B;  1NJ4 A;  2J9O A;  2ZMF A;  3EWK A;  3A3E A;  4BBU A;  4OON A;  3MKF A;  3KXA A;  3ICY A;  4O8G A;  4GD8 A;  4WLA A;  3B3X A;  3ZDJ A;  5KSC A;  1L0E A;  3IF6 B;  1MWS A;  2V1A A;  2XA7 S;  4P6B A;  2M7V A;  4G3V A;  1SQ8 A;  3LY4 A;  5DF7 A;  4HRA A;  2V0W A;  3VOY A;  3IXH A;  1HF0 A;  2YKF A;  2WKH A;  4XUX A;  3O88 A;  1Y54 A;  3U3W A;  2PPX A;  4H6J B;  2GNX A;  3MKE A;  1DW9 A;  2VX8 A;  3BY9 A;  4WEJ A;  2PXU A;  1QME A;  1YSQ A;  3LIB A;  3BM6 A;  4YNR A;  5A92 A;  4ARZ A;  2J3T D;  3G7D A;  4QB8 A;  4HJ3 A;  5GLA A;  5GHZ A;  3LYX A;  4EBL A;  1KGF A;  3TW8 A;  5J4E A;  2QYB A;  2A6C A;  3GR2 A;  2IWB A;  3A9X A;  3NDG A;  3O9X A;  4Y2F A;  4RVA A;  3ITA A;  1ZZB A;  2LYQ A;  1YSE A;  3G32 A;  3RXX A;  1JTD A;  1O7E A;  2LNM A;  2JVL A;  4U0T A;  1PW8 A;  4HBU A;  2HSG A;  5G18 A;  2IVB A;  5HWW A;  2HCN A;  1BLC A;  3SH7 A;  1K4F A;  4HJ6 A;  2A3U A;  3VOZ A;  3VP0 A;  4X53 A;  2ZC5 B;  4PM8 A;  5DTT A;  3ZG0 A;  1WH8 A;  2HDS A;  4MEZ A;  5IU1 A;  2XEP A;  2PR6 A;  2PXQ A;  3SX0 A;  2XA7 M;  5U47 A;  3P98 A;  1W8Y A;  2PUE A;  4K08 A;  3GDI A;  3NDE A;  4OOY A;  3UMD A;  4LRZ E;  1KE4 A;  2DCF A;  5J3W A;  3NIA A;  1IC8 A;  5I94 A;  4P6Z S;  1LLB A;  2WKR A;  1F98 A;  1NYM A;  3BEB A;  3MR0 A;  1V9Z A;  1T19 A;  4NXG A; 
#chains in the Genus database with same CATH homology
 1X2L A;  2PD8 A;  3P01 A;  1S1Y A;  2O9A A;  3PBS A;  4RQ9 A;  3NJA A;  1NRJ A;  4X4G A;  1LL8 A;  2KEJ A;  2L0W A;  2YKH A;  4YBA A;  2PD7 A;  4YOF A;  5DFX A;  3K2N A;  3RFB A;  1OTD A;  3D72 A;  1JFT A;  2DMW A;  5KIZ A;  4EXO A;  3CLC A;  1D7E A;  4HI4 A;  4Z1W A;  4Y3I A;  3KX0 X;  3JXD L;  3MJQ A;  3BQ8 A;  1XJ3 A;  4M4X A;  2PUD A;  2OAP 1;  4HIA A;  1VPW A;  3C2W A;  2WIU B;  2LB5 A;  2IV1 A;  2B02 A;  3T4Q A;  4Y5F A;  5HWV A;  1D06 A;  4R3A A;  4I3I A;  2NUT C;  4IA8 A;  3UB9 A;  4EU0 A;  4YWZ A;  3UME A;  2O4A A;  2AW6 A;  2G7U A;  4KQO A;  2EWW A;  3FYM A;  2VGL M;  2VLG A;  4BWI A;  2KX6 A;  3E4O A;  1S67 L;  2O9B A;  1OT9 A;  1ZUG A;  3PR6 A;  2BNO A;  5G4Y A;  1GT0 C;  3CI6 A;  3JVV A;  4DN0 A;  1PRU A;  2GRM A;  1EFA A;  4EQ1 A;  3CEC A;  3K3D A;  4NXB A;  2BAS A;  4KUO A;  3K3C A;  1LMB 3;  2PUF A;  3LI8 A;  2ZOH A;  2A24 B;  3T4T A;  2OFY A;  1BDI A;  4PKY A;  4X4C A;  3IS2 B;  5LBR A;  1BDH A;  4JCY A;  2EWV A;  1TF1 A;  3QWG A;  1AU7 A;  3KSH A;  4ETX A;  2ZMV A;  1UTX A;  5HPI A;  2VV7 A;  4YG4 A;  2EWT A;  1NWZ A;  4LRY C;  4J1X A;  3EQV A;  4CLC E;  3KYZ A;  1OT6 A;  2AXU A;  4MDZ A;  2AXZ A;  1T1A A;  3G6O A;  4NXE A;  1LQC A;  3R7W A;  3P7N A;  5AJG A;  2H8R A;  4MCW A;  1N9O A;  1XFN A;  2OR1 L;  2VGL S;  4O0P A;  3B7H A;  2A24 A;  5DJU A;  1IOU A;  1TS8 A;  3MF0 A;  1H3Q A;  1UXD A;  3ZYT A;  1ODV A;  4AFI A;  5I5L A;  4ETZ A;  4PU4 C;  3KSI A;  5DKL A;  1RIO A;  2PYP A;  4UQI M;  4EES A;  2OWJ A;  3G5G A;  3E4Q A;  5HD3 A;  5F5Y A;  1XJ4 A;  2CRO A;  4CLC B;  2HJ9 C;  3F52 A;  2KEI A;  4HOI A;  2K2N A;  4I38 A;  4HY8 A;  4EUV A;  3UB6 A;  1UXC A;  2HIN A;  3LFP A;  3OC2 A;  2W3H A;  3CAX A;  3PHY A;  1Y7Y A;  4Z5H A;  5HL6 A;  3VOL A;  3ZQ5 A;  3PBO A;  4WN5 A;  4I6R A;  1LCD A;  2PE5 A;  3BWL A;  4DJ2 A;  2IUO A;  2L8N A;  1DP8 A;  2OWH A;  5L8M A;  4BBV A;  2LYR A;  1W63 Q;  3GN5 A;  1LSW A;  3GEC A;  3MXQ A;  1O4X A;  2H28 A;  4YAR A;  4FSF A;  4PHT A;  4DMZ A;  5TBM A;  1YSP A;  2OOL A;  3ULF A;  4KUK A;  2QWS A;  3FPW A;  2VKS A;  1S4S A;  4BJP A;  1OJ5 A;  1ZZ8 A;  2O9C A;  4HJ4 A;  1XFQ A;  3E98 A;  4ME4 A;  1OSL A;  2HJE A;  3UB7 A;  4PU7 A;  3KSG A;  4GS9 A;  3EEH A;  4F3L B;  2GZA A;  4GHJ A;  4MCT A;  1ZVV A;  2JKT I;  2VEA A;  1UWN X;  2W3E A;  5F68 A;  4MMN A;  2PUG A;  2XIU A;  3LI9 A;  3BJN A;  5C5K A;  3SCH A;  1VHM A;  3GN5 B;  5K98 B;  1WIZ A;  1RZS A;  1Y9Q A;  4JGP A;  3T4S A;  1ZZ9 A;  1WH6 A;  3W2Z A;  3CRO L;  1QP0 A;  2BNN A;  1GSV A;  3LIA A;  1RZR A;  5AVE A;  2V0U A;  1TS7 A;  4MN6 A;  2AWI A;  4PU8 A;  2ICT A;  3PBR A;  4EW7 A;  2QHK A;  2PUC A;  1F9I A;  4R70 A;  2XSD C;  2ZOI A;  3IS2 A;  4GS9 B;  3FG8 A;  2K31 A;  2L49 A;  2LYS A;  3ZHM A;  3H5T A;  2WUS R;  4IUK A;  3UFD A;  2HGV A;  3SW1 A;  3TRC A;  4NDW A;  4F8D A;  1G6O A;  3F1O B;  2R63 A;  1JH9 A;  4EEP A;  4II7 A;  3LFV A;  4CLC A;  2W0N A;  3LIF A;  3DBA A;  5AVF A;  3H9W A;  3R7W B;  2XSS A;  1LT0 A;  2PT7 A;  4HNB A;  4MCX A;  4WL9 A;  4P6Z M;  3L1P A;  4DJ3 A;  1YKD A;  5HD5 A;  2HV1 A;  3F1N B;  1OCT C;  3MFX A;  2P08 A;  1RZR D;  3DNV B;  4GW9 A;  3PBN A;  3RTY A;  2IVG A;  2FZ0 A;  3H7W A;  3KYQ A;  4WEL A;  3ZKC A;  3F1P A;  4NKP A;  3F51 A;  1OTE A;  4XT2 A;  1CQT A;  1LLI A;  1QQB A;  2M1C A;  1YAX A;  1KOU A;  2O49 A;  3EGD C;  2O0Y A;  3PBT A;  2Z6C A;  2W3D A;  3BQA A;  3B42 A;  3LIS A;  4I3A A;  4OOM A;  3S7P A;  2FH5 A;  3QF3 A;  2AXV A;  2IA2 A;  3EUS A;  3NOU C;  5G4Z A;  3NHQ A;  2PUB A;  5EFW A;  2LYL A;  4UEY A;  4I5S A;  3LIE A;  4LLO B;  3S7Q A;  5HPF A;  2XJ3 A;  3D3O A;  1ZTU A;  3T4L A;  4L9E A;  2QJ5 A;  4WF0 A;  5CX7 A;  2HF6 A;  1W63 M;  4X4B A;  3E4P A;  2D01 A;  4MN5 A;  4YG1 A;  5HDS A;  3RH8 B;  3F1N A;  3VK0 A;  2A2L A;  4H6J A;  1VB6 A;  5K5B A;  3TE8 A;  2I9V A;  2WKQ A;  3UE6 A;  3OQN A;  4L9F A;  3MQ0 A;  3TRB A;  5IT5 A;  2GRL A;  1ZZ7 A;  3H7W B;  3FPV A;  3EQU A;  2EBY A;  4ARZ B;  3IVP A;  3R4K A;  1GSX A;  1MZU A;  2JKT M;  3S7N A;  2LYP A;  3LIC A;  5J7E A;  3HJK A;  4Q0H A;  4HH3 A;  4LPZ A;  3ZHI A;  2CSF A;  1BYW A;  4Q0I A;  3JXB C;  1OTI A;  3BW6 A;  4Z58 A;  1UGU A;  1QPZ A;  4JCX A;  1B0N A;  3BS3 A;  3OQM A;  2L4R A;  1G28 A;  1TD5 A;  2W1R A;  2W3G A;  3CLO A;  4G3K A;  4L9G A;  3FYA A;  2O38 A;  1ZHH B;  5HZH A;  1PRA A;  3OOV A;  1DWK A;  4GQM A;  1Y28 A;  2LB9 A;  1LSV A;  4GHI A;  3B47 A;  3HZI B;  3C8C A;  4FN3 A;  3RZZ A;  1NLY A;  4HHD A;  3VV4 A;  1JWL A;  1ADR A;  3KZ3 A;  4E04 A;  3LUQ A;  1X0O A;  1CJG A;  2PIJ A;  2PUA A;  2PR5 A;  4IWR A;  2PYR A;  2XRN A;  3A0V A;  4HP9 A;  2Z6D A;  1S4R A;  3LR4 A;  1ZZC A;  2PDR A;  3MQQ A;  4B9O A;  3JVU A;  4NXF A;  4EET B;  1JFS A;  4MN7 A;  2L1M A;  3KSF A;  4R38 A;  4F3L A;  3UB8 A;  2VJW A;  4I8T A;  4HP4 A;  4HQA A;  4PAU A;  2V1B A;  4I39 A;  1TS6 A;  1X57 A;  3HJI A;  3QYX A;  3KJX A;  1ZPQ A;  4GLQ A;  2FJR A;  2CMN A;  2W27 A;  1PER L;  4G3W A;  4X4H A;  2J80 A;  4OB4 A;  2LCV A;  3T4K A;  2MJ6 A;  3EEA A;  2O99 A;  1QP7 A;  1F5M A;  4Z5C A;  1TS0 A;  1OPX A;  2KDK A;  3OBF A;  4IJG A;  4WUJ A;  4EER A;  2B18 A;  1XJ6 A;  3E0Y A;  4BMW A;  1LSX A;  2QJ7 A;  2VZW A;  3B33 A;  1ZZ6 A;  1DRM A;  2INW A;  1P9R A;  5HDC A;  2GJ3 A;  3IBR A;  3LID A;  2P04 A;  1EW0 A;  1POU A;  2KLI A;  5KSH A;  2W1T B;  5FL3 A;  1T1C A;  3MQO A;  3T50 A;  3LR5 A;  3OMT A;  4Q0J A;  2VV8 A;  1QP4 A;  2QKP A;  1OTA A;  1T1B A;  1NER A;  2GX5 A;  5A7L A;  4O8B A;  4GCZ A;  4BBT A;  2KZ8 A;  1T18 A;  1UWP X;  3QQ6 A;  2V9A A;  4J1W A;  4UQI S;  3LR3 A;  4X4D A;  1DP9 A;  3JXC L;  1QQA A;  2W3F A;  4YG7 B;  1R63 A;  4JGO A;  4XT2 B;  1H8M A;  3IBJ A;  2MEZ A;  2ICP A;  2AUW A;  2W1T A;  3NOP C;  2M7U A;  1S66 L;  2KPJ A;  4Y42 A;  3F6W A;  4I6U A;  3OCL A;  1E3O C;  2BNM A;  1RPE L;  3SCF A;  3S8Q A;  2MQK A;  2OAQ 1;  4PKY G;  2JN7 A;  2R1J L;  3CIT A;  5DF9 A;  1JNU A;  3O5Y A;  1IFQ A;  2VV6 A;  1WET A;  2XI8 A;  3KO6 A;  2D5V A;  2ZMF A;  3H82 B;  3EWK A;  4L0L A;  3FMY A;  1MC0 A;  4X4F A;  1ZAY A;  1ZS4 A;  4BBU A;  3V67 A;  4ZRR A;  3KXA A;  2Y8H A;  3ICY A;  3OCN A;  2XRO A;  4O8G A;  4WLA A;  2VA0 A;  1NEQ A;  2IVQ A;  2R78 A;  2PHY A;  2V1A A;  4QPR A;  5F6A A;  4X4I A;  2XA7 S;  3HCY A;  2NUP C;  2M7V A;  4G3V A;  2LYJ A;  1SQ8 A;  5HSQ A;  4EEU A;  2EF8 A;  2V0W A;  3MLF A;  3A0R A;  3F1P B;  4HH2 A;  4NEE D;  1HF0 A;  3D1N I;  2YKF A;  3EOI A;  1STZ A;  2EA9 A;  2J3T C;  2GZU A;  3CWF A;  3R1F A;  3BY8 A;  3MMH A;  1P9W A;  4CQH A;  1S1Z A;  5DJT A;  3U3W A;  2PPX A;  3LR0 A;  4IUH A;  4B93 A;  4H6J B;  3OP9 A;  1XWR A;  2GNX A;  4I3J A;  3U2A A;  2J3W A;  1DW9 A;  4FOF A;  2VX8 A;  3BY9 A;  3T4J A;  4WEJ A;  1MKM A;  4OOL A;  4WEK A;  1YSQ A;  3LIB A;  4YNR A;  3FC7 A;  4ARZ A;  1OJG A;  2KEK A;  2J3T D;  3G7D A;  3PXP A;  2JCG A;  3H82 A;  3OQO A;  2Y79 A;  3OLO A;  4HJ3 A;  1DP6 A;  4I6T A;  3LYX A;  1WA9 A;  4FBI A;  3EGX C;  5DFY A;  4IVZ A;  1PNR A;  4X4E A;  4PU3 C;  3TW8 A;  3VE3 A;  1P0Z A;  2A6C A;  2QYB A;  3NOT C;  3T4O A;  5J4E A;  5HDD A;  1L1M A;  2P7J A;  3BDN A;  1V9Y A;  3PBQ A;  3VE4 A;  5TBM B;  3O9X A;  3CUE A;  5DKK A;  3UE3 A;  2WKP A;  4Y2F A;  3SCG A;  1ZZB A;  2LYQ A;  3PYP A;  1YSE A;  4LRX C;  4O01 A;  3C38 A;  5HWT A;  2JKR I;  1GSW A;  5A8B A;  2JVL A;  1NLZ A;  5TJJ A;  2IU7 A;  2JKR M;  2HSG A;  2IVB A;  1S7E A;  4IHQ A;  1XJ2 A;  4Z59 A;  2KOI A;  5HWW A;  5IS1 A;  4HJ6 A;  3TJZ C;  2LYK A;  3A0S A;  4JQD A;  4CLC C;  4JGQ A;  1N9L A;  2B5A A;  2JHE A;  2D02 A;  4R6L A;  2ZBB A;  1WH8 A;  3C30 A;  5F69 A;  5IU1 A;  2PR6 A;  4CLC D;  1PRV A;  3BD1 A;  2XA7 M;  5MC7 A;  2PUE A;  4K08 A;  4GHI B;  3GDI A;  3UMD A;  4LRZ E;  1R69 A;  3GBF A;  4Z5D A;  2K7S A;  5J3W A;  3CUE C;  1IC8 A;  1P97 A;  1OTB A;  4P6Z S;  2BJC A;  3S7O A;  2WKR A;  1LCC A;  1F98 A;  1N9N A;  4GJ4 A;  3MR0 A;  4KQD A;  3F1O A;  4JGR A;  1V9Z A;  1T19 A;  2XCJ A;  4NXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...