3PXPA

Crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
292
structure length
292
Chain Sequence
GMERAAFGKLVQALRREHRDEKGRVWTQEVLAERTQLPKRTIERIENGSLAHLDADILLRLADALELTIGERREFFFAATGIIEQKSATYKRSPEESLQYLIDMIRNMNVPAFVTDQYVNIIAANMITIRFFNIPMELIETAPLLPHGYNLMRVVFGTEYDFRRVVGTMWDEVARHNMQLFRAISLRVRADGYFVELLDNLMQYREFKRFWERAHLETEDTSAENFWYQYTHPVYGLLSYVSSRSQIPTSMGLLSMHTYIPLSPATTDLFAKLSTVANQDVIRLAPWPRSNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Helix-turn-helix domain protein
publication title Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes.
pubmed doi rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription regulator
total genus 85
structure length 292
sequence length 292
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
A PF17765 MLTR_LBD MmyB-like transcription regulator ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3pxpA01
3.30.450.180 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pxpA02
4J1XA 3OMTA 2PE5A 4X4FA 2IVGA 3PXPA 5K98B 3OQMA 1JWLA 1RZSA 3L1PA 2CROA 3D1NI 1E3OC 1NEQA 3OQNA 1VPWA 1DWKA 2GRLA 2HSGA 4MCTA 2OR1L 1QP7A 2BJCA 1XWRA 3ZKCA 4X4DA 1RZRA 2PUFA 3CROL 4IA8A 3F51A 1ZZCA 3KJXA 2KPJA 4PU4C 1LCCA 1ZVVA 1B0NA 2AXZA 1UXDA 3ZHIA 1ZZ6A 2LCVA 3FMYA 1OCTC 1WH6A 1QP4A 2IVQA 3SCGA 2LYKA 2AUWA 2GZUA 2OFYA 2IU7A 2XCJA 3H5TA 1LCDA 1UXCA 3UFDA 2FJRA 4PU8A 3S8QA 3CLCA 2LYPA 4X4GA 2ICTA 3R1FA 3GN5B 1CQTA 1ZPQA 1PERL 4OB4A 2HINA 3HZIB 2BNOA 3RZZA 1ZZ7A 4NDWA 4FBIA 1Y9QA 4PU7A 2KEJA 1LQCA 1ADRA 1L1MA 1Y7YA 3G5GA 4Z58A 2KEIA 1BDHA 2H8RA 2PIJA 1PRUA 1JFSA 1GT0C 1IC8A 2R1JL 3SCHA 3CECA 2AXVA 4Z5CA 2MEZA 1LLIA 3TRBA 3GN5A 4IVZA 1X2LA 1ZZ9A 1ZZ8A 4I6TA 4I8TA 1ZZBA 1PRVA 2O4AA 2D5VA 3MLFA 2EBYA 2XSDC 3OP9A 4MCXA 2PUCA 4FN3A 2PPXA 2B5AA 1DW9A 2BNMA 4I6RA 4I6UA 4J1WA 1JH9A 4YG1A 2PUAA 2PUEA 2KZ8A 1CJGA 1RPEL 3QQ6A 4X4BA 2ICPA 3GBFA 2JCGA 3LFPA 3FYMA 1ZUGA 4PU3C 3KXAA 2O38A 2A6CA 1NERA 3EUSA 4F8DA 3BDNA 2AW6A 4GHJA 3DNVB 1R63A 2O49A 1RZRD 1OSLA 1QQBA 1UTXA 3FYAA 2KEKA 1HF0A 3KZ3A 3QF3A 1QPZA 2XIUA 4Z5DA 4Z59A 1S7EA 3SCFA 1RIOA 1WETA 2LYRA 2L8NA 3QWGA 3IVPA 1PRAA 4YBAA 2BNNA 2R63A 3LISA 3JXDL 1AU7A 4IWRA 3QYXA 1WIZA 4YG4A 1JFTA 2XJ3A 1QP0A 2JVLA 2LYQA 1EFAA 4Y42A 3VK0A 2PUGA 4X4CA 3BS3A 3OQOA 3JXCL 4YG7B 2AWIA 3U3WA 4JCXA 2LYLA 3BD1A 4X4EA 1R69A 1YSEA 2IV1A 4X4IA 3O9XA 3JXBC 3G7DA 2CSFA 3B7HA 2IUOA 1QQAA 1WH8A 4YARA 1PNRA 1ZAYA 2EWTA 2LYJA 1X57A 2LYSA 2WUSR 4GQMA 1ZS4A 4JCYA 2WIUB 4Z5HA 4JQDA 2EF8A 4O8BA 1BDIA 2MQKA 1POUA 5A7LA 3F6WA 1SQ8A 1LMB3 2PUBA 2PUDA 4X4HA 2XI8A 3F52A 2IVBA 1O4XA 3ZHMA 2GRMA 2L49A 2AXUA
chains in the Genus database with same CATH superfamily
4E6WA 4KUOA 2OV5A 2PE5A 2E8IA 3BFFA 1MC0A 4MN6A 1G6OA 3TRCA 4FH4A 1E3OC 4HY8A 1QP7A 3ZG9B 4EV4A 2VV7A 3OWQA 2OAP1 2AVXA 1GHPA 1K54C 1VB6A 2UV0E 4O7DA 1PYYA 5L07A 3QOXA 4FUWA 3W4PA 4OQHA 2EXAA 3BLSA 3AGDA 1P0ZA 2XR0A 3RH8B 3Q7VB 4EUVA 4ID4A 2KEIA 2H8RA 1K55A 3BJNA 3ICYA 2YBDA 1BTLA 4EKGA 1BLHA 4ER7A 1LLIA 1SDEA 3O5YA 1X2LA 2OWHA 4ER0A 3IBRA 4IVKA 1E3UA 3K2NA 3G32A 3Q7VA 5A91A 1FQGA 3T4TA 4IEDA 2PRFA 2H28A 3M2KA 3GZDA 3UY6A 2DRWA 3MFDA 1ZUGA 3IF6C 4F3LB 3NJAA 1NERA 5FDHA 2QJ7A 3CPTB 2V1BA 2FFHA 4G3KA 4CPKA 1RGZA 4S2OA 4XXRA 1QPZA 2WKPA 1S7EA 3S22A 1XA7A 4FCFA 3IVPA 2QZ6A 1LL5A 4KZ4A 2QJ5A 4F3LA 3DW0A 2GZAA 3CPTA 1H8YA 3S7PA 1OTAA 5FAPA 3UB5P 4HESA 4C3QA 3IXGA 1YLYA 3K3CA 1STZA 2PDRA 1R69A 1SKFA 3B7HA 1V9ZA 4EKIA 5EM0A 4ZJ3A 3HLCA 1T1AA 1ZS4A 5EE8A 4M3KA 4Z5HA 5EM1A 2JKFA 3A0SA 3NDEA 2W3EA 2PBDP 3ZG5A 4PAUA 4HP9A 4YG1A 2VEAA 4ZDXA 3C4OA 1ALQA 3PXPA 3KYQA 2M7UA 5DJUA 3VOLA 3OQNA 2EX6A 4IHQA 4BLMA 4MCTA 4HRAA 1TVFA 5L09A 5L2FA 5EVIB 1XWRA 2WKRA 2AXZA 3H82B 3E0YA 5FQQA 4DJ2A 2OFYA 1XXMA 3A9XA 3CLCA 3ITAA 1CQTA 1PERL 4NETA 5EVIA 3UPPA 3LFVA 2DMWA 1JWVA 4QPRA 4Z58A 3H82A 3CZDA 2PIJA 2ZJ9A 3WS1A 1I2SA 3UPNA 3HL9A 2AXVA 4ZBEA 4Y0OA 4E3MA 4Q0HA 5C5KA 1PRVA 5DTQA 2Y2KA 3LR3A 2JE5A 4I6RA 5G4ZA 1HZOA 2PU2A 1H3QA 3QQ6A 4LCMA 1KVMA 4KQQA 2O38A 4F8DA 1VETB 3MQQA 2L1MA 3KZ3A 3ULFA 2WKIA 2J9PA 4EW7A 2ZM2A 1ZKJA 3M6HA 2HDUA 3HLFA 1VETA 3WWXA 1X0OA 3C30A 4GHIA 3VK0A 4OPYA 5AQAA 1PW8A 3QP6A 4ME4A 2OAQ1 2J3WA 4OQIA 1YLPA 3GUUA 1I2WA 1ERMA 3IH9A 4LFUA 4JQDA 5HX9A 1TS6A 1POUA 2PUBA 4S2LA 4GW9A 3QNCA 2Z6DA 1G5UA 1W63Q 5FQJA 1BLCA 4GNUA 2WKHA 4LRZE 2WKEA 1OJGA 3L1PA 4N9LA 3D1NI 5CXWA 3IWQA 3TFLA 4Y15A 1IYPA 4UQIS 1YMXA 4GDBA 5E2EA 3T4KA 2G2WA 3TOIA 1ZZ6A 2XK1A 5EOOA 5J3WA 4ETZA 5GHYA 2PXLA 4U0XA 2GJ3A 4AFIA 3PBOA 3JPUA 2INWA 1Y7YA 5AVEA 2ZQ9A 3CHWP 1GSXA 3A3JA 2PYPA 4JGRA 4OQGA 2MEZA 5CTNA 1SCWA 1IFQA 4KG2A 2HPBA 4Y13A 4MCXA 1RGYA 2KDKA 4WF0A 3MMHA 3BFGA 4KENB 1CJGA 3GBFA 2GX5A 2DCFA 3H7WB 4EETB 2D02A 3FKWA 5G18A 2PHYA 2O49A 4Z1WA 2VGKA 5FEFA 5J7EA 1BLPA 3LIFA 2VEOA 4Z5DA 1LL8A 4L0LA 4DE9A 1K56D 5M19A 4NXFA 2VX8A 3H7WA 2BASA 3NBLA 3NHQA 3H9WA 3A3DA 5IS1A 5TBMB 4JKTA 3IH8A 3W4OA 5HD3A 2Y4AA 3Q82A 1NLYA 4ESPA 4YG7B 1YT4A 1C3BA 2EXBA 3NDGA 4ARZB 2RCXA 5TBMA 1CEFA 4KZ5A 3VP4A 2EF8A 4O8BA 1KE3A 2O4AA 2Y2OA 3GVBA 4Y7PA 2ZC6B 4ARZA 3VWSA 2XGNA 3QP2A 4XUZA 3ZYTA 2I72A 4HQAA 2IA2A 1ODVA 4Y17A 3OPPA 3K3DA 5FATA 1XKZA 2H5SA 5HDDA 3ZG0A 3UDIA 2PXDA 2HP6A 1XA1A 2OOLA 4E3KA 3FMYA 1QP4A 1WH6A 2AUWA 1JTDA 1WE4A 4PU8A 1YAXA 3GN5B 3E2LA 3HVFA 3MKEA 1BUEA 3P09A 4N1HA 3LO7A 3BM6A 5FI7A 3WS5A 1DP8A 2Y2GA 2HZ5A 2PT7A 1CI8A 1S4SA 5AJGA 3GN5A 1SKOB 3CUEC 3PYPA 1HTZA 4X56A 3TW8A 2B5RA 5M1AA 1JH9A 3UDFA 4I6UA 1KE4A 2HP9A 5MC7A 2B18A 1H0MA 1W7FA 3IXDA 1S67L 3W4QA 1L2SA 5BOHA 2AW6A 1I5QA 3CITA 4P0MA 3BFEA 3E4PA 1DY6A 1OSLA 2EWVA 3DM5A 4LRXC 5GLDA 3SCFA 4RX2A 4FH2A 2L8NA 3ZVWA 2QWSA 3PAEA 3SS3A 1ONHA 3P7NA 3C5AA 4Q2JA 4ZAMA 1G6AA 2HJEA 5EVEA 2D01A 2W27A 1NXYA 3O9XA 4EK9A 2J3TC 2X02A 4U3TA 3KSHA 2XA7S 4EBPA 4IBXA 4DE2A 3F6WA 1SQ8A 2LNMA 4BQMA 3IHAA 2HGVA 2L49A 4L9FA 3CI6A 1XGJA 4YOFA 1K6SA 1ES4A 2V8FA 1F2KA 4GCZA 1K4FA 1CJFA 2XSSA 3BQAA 5DF9A 2WZZA 1DRMA 4PU4C 1LCCA 1ZHHB 2YKHA 4OPZA 2UWXA 1ES3A 1K56A 3SCGA 5F68A 2GZUA 2O9CA 3UE3A 3ZCZA 4R70A 3MKFA 1MFQC 1Y28A 3VSKA 2HDRA 1PZPA 4WLAA 5CX7A 3RZZA 1K54A 1BDHA 4JBFA 3VE4A 3VP3A 2M4HA 2VGLM 5U47A 1Z09A 5HWVA 4IVZA 1IKIA 4I8TA 5FQKA 2HCSA 3NOTC 4GD6A 1RP5A 3TJZC 3LIAA 2KZ8A 4HH3A 3VOYA 3V3SA 3PE5A 1V9YA 3FWLA 3SR4A 1YLJA 2W3DA 1XFNA 4OOYA 3SX0A 1RZRD 1LL9A 2HCNA 4JXWA 2KLIA 5HAIA 4GB7A 1KVLA 5CTMA 1TD5A 2LLWA 2I9VA 4BD1A 3N8SA 4MCWA 4B9OA 2QHKA 5HPIA 4JF6A 2HP5A 2Y2NA 4YG4A 4FSFA 3BFCA 1S6RA 2LYQA 5I5LA 2AWIA 4X4IA 3MZEA 3U4LP 4I3JA 1OPXA 2VA0A 5A92A 2WUSR 3G2ZA 1H8ZA 2FH5A 1GA9A 4WEJA 3G2YA 3L7HA 5CHUA 3UE1A 2O9BA 5K98B 3OQMA 3FKVA 5K5BA 3D9YA 4YNRA 2WADA 3UB9A 2ZM0A 4NKPA 2LLVA 3P01A 2PYRA 4WELA 2GRLA 2HSGA 1NWZA 3AGFA 3KSFA 3UNWA 3S7NA 3ZVTA 2W1TB 3C7UA 2PUFA 2JCHA 3A3EA 1NW3A 3KSGA 4ETXA 4EEPA 3HLDA 2PXEA 4UEYA 1NY0A 5FEGA 3PBRA 2FJRA 1TDLA 4JPMA 2W1TA 4YINA 1ADRA 3MXSA 2R1JL 5DKLA 3ZG7B 3OZHA 4OH0A 2W3GA 5EOEA 2OLVA 3NROA 3MBZA 4II7A 4S2NC 4OP5A 4J1WA 1FCNA 4G3VA 2WUQA 4R38A 2JKTI 5DVAA 4L9EA 5IT5A 3FYAA 1IELA 3LIBA 1T1CA 3NC8A 2ZQ8A 4E3OA 5JUWA 4Z59A 1G68A 2ZM8A 1ZG6A 3MSHA 1XJ3A 3EWKA 3MXRA 2XJ3A 2XD5A 4N9KA 2LB9A 1EI5A 1WA9A 2HF6A 2HFZA 1XFQA 4EEUA 1ZAYA 1LLBA 1KGEA 3NCKA 3LY3A 4JCYA 2XXAA 3VSLA 3MQ0A 2IVBA 4X53A 4K0WA 5E43A 2IVGA 1XGIA 5DTRA 1JWLA 4DXCA 1DWKA 5KMWA 1RZRA 1XPBA 2QPNA 1ZZCA 2KPJA 2DNSA 5HD5A 5F6AA 4OLGA 4EU0A 1LCDA 4JF4A 3SS5A 3SS4A 2LYPA 3WS4A 4EERA 1FSYA 1ZPQA 1T1BA 4MDZA 1Y9QA 2KEJA 1Q2PA 3EQUA 1Y4OA 1PRUA 3GRJA 1NYMA 4WVLA 3SH7A 1MWTA 5KIZA 2P08A 2ZC3B 3NI9A 2VKSA 2PUEA 1ZC2A 3UB8A 5FL3A 3IXHA 3LFPA 2WGWB 2A49A 3KXAA 4GS9B 4NXGA 2V1AA 2IWCA 4IUHA 4KZ9A 1J3WA 1FSWA 2HDSA 3T1RA 2WGWA 1PRAA 5IU1A 1O7EA 3KYZA 4GS9A 1FR6A 4UA7A 1JFTA 3HUNA 1P9WA 5EV0A 4BBTA 3JXCL 4WMCD 3ITBA 3VFHA 4BBUA 4RX3A 3OCLA 2L1PA 4ER6A 5DTKA 1PNRA 1PI5A 4D60A 4GHIB 3BY8A 4R4SA 2Z2MB 4KG6A 2M1CA 1K55C 1F5MA 5DTSA 3NDBB 3CJMA 3GECA 2A3UA 2ZMVA 2GDNA 3IQAA 3ZNTA 3E2KA 3UE0A 4KZ8A 3VP2A 1PW1A 4LV0A 2XQZA 2CROA 1NEQA 4QJGA 1VPWA 2A24B 3G31A 2LB5A 3GZCA 2GNXA 5CGXA 3WS2A 4DKIA 2ZC7A 5HL6A 1ONGA 2IU7A 3S8QA 3BRMA 4DXBA 2A24A 2W0NA 2VLGA 3E98A 1S4RA 2BG1A 3HZIB 1BLSA 1J9MA 2ZMAA 4HHDA 4O8GA 4RA7A 1P9RA 3M2JA 4I39A 3GR2A 3T4LA 1ESUA 3WRZA 1IC8A 1XX2A 3C38A 4E6XA 3BY9A 3WS0A 4OOLA 2D5VA 2BTFP 2PPXA 2EX9A 4BL3A 3MJQA 5DTMA 3T50A 2ICPA 2WZXA 1JWZA 2PXTA 4D2OA 3CUEA 1LSVA 2A6CA 3OOVA 3DNVB 3UWPA 1OT6A 1CQAA 5GHZA 3W8KA 3BW6A 3QWGA 1YSQA 4MBKA 2BNNA 5HAQA 1AU7A 5EECA 2PD7A 3A3FA 3VOZA 3BEBA 3EEAA 3VFFA 4K91A 3R7WB 5HSQA 2FFYA 3LY4A 5CGWA 3TELA 4EZIA 4HJ4A 4KZBA 3SW1A 2MQKA 3R7WA 2XXPA 4GN2A 4CLCE 4OONA 2XI8A 4Z9QA 2VGJA 3OMTA 3PBSA 2EX8A 5HWTA 2V0UA 4U0TA 5GAHi 3FV7A 4O0PA 3HLGA 2VZWA 4P6ZS 2O0YA 5J4EA 5A93A 3E4QA 3UMDA 3ZKCA 4X4DA 4JGQA 4R6LA 1L0DA 3KJXA 5DF7A 1IYOA 4MNRA 4OVDA 3QFIA 1QMEA 4DE3A 3I7JA 2FZ0A 1UXCA 3FZCA 4H8RA 4PM8A 3V67A 3EEHA 4PKYG 4WZ4A 5A90A 3R1FA 3HCYA 3NULA 1GSVA 4LLOB 4CLCC 4PM6A 3Q1FA 4MEZA 2XDMA 1IYQA 4DDSA 3IWIA 1CI9A 1GT0C 4WMCA 4Z5CA 1JTGA 4DDYA 1GSWA 2XEPA 4I6TA 1P97A 4HOIA 4KQOA 1ZG4A 3F1NB 2PUCA 2P7JA 4FN3A 4QU3A 1SDNA 1FR1A 3N7WA 3F1NA 3F1OB 3VP1A 4LPZA 3SZTA 2Z2LB 5FA7A 1ES2A 2VK3A 4KQRA 2PXQA 4OBMA 2WYXA 3BECA 3HBRA 5DRTA 4MLLA 3F1OA 2V9AA 2Y2IA 4BMWA 2JVLA 3ZNYA 3LICA 2V2FF 3U3WA 4JCXA 2Y2JA 4S2IA 2K7SA 2VV6A 3G30A 4GD8A 1QQAA 5GHXA 5F69A 3T1SA 4PPRA 4WBGA 3PBTA 2V20A 5HWWA 3T12B 2GRMA 2AXUA 3A3IA 1LT0A 1RCJA 1MBLA 1NZUA 4B4XA 2Y91A 5KSCA 4S2PA 4X25A 2X71A 4R3BA 2ZL1B 1PNEA 1WYCA 4LENA 1BT5A 2OR1L 2C5WB 3NECA 3N8RA 5HPFA 5AQBA 3V3RA 2ZD8A 1F9IA 2EX2A 4E3JA 3ZHIA 2JKTM 5AQ9A 4JF5A 5CEBA 3LYXA 2ZL1A 5CECA 2LYKA 4DF6A 2EFXA 2ZMFA 2V1ZA 4L9GA 3NY4A 3S7QA 3G35A 1YQSA 4MMNA 1K57C 2WAFA 1N9NA 3DWZA 1M6KA 3LEQA 1VEUB 3GMWA 4QY6A 1N9LA 3PBNA 4ER5A 3LEZA 4S2KA 3TSGA 3G0TA 5DF8A 4PHTA 1YLZA 4KG5A 4H6JB 3MLFA 2JQEA 1QZXA 5FASA 2B5AA 1VEUA 4LV1A 2XH9A 5DSXA 5E2FA 1L0FA 4Y0TA 4X1LA 3EGXC 4PU3C 3EGDC 3EUSA 2PAVP 4GHJA 4H6JA 1YKDA 1GA0A 1DP9A 4YFMA 1QQBA 4S2NA 3LI8A 5DFXA 3QF3A 1HQ1A 4UQIM 5EVLA 4MBHA 1BULA 1Z6FA 2JBFA 3FYZA 2PXVA 3G4PA 5GL9A 2R63A 3JXDL 3LI9A 1BSGA 1EW0A 5CGSA 4JXGA 2XROA 2BLSA 4BD0A 4NG2A 1EFAA 4R4RA 3LIDA 1L3LA 3IF6B 1W8QA 3BLMA 2PR6A 3FG8A 2PXUA 2MJ6A 3JXBC 3Q07A 3G7DA 2ZOHA 3PAGA 4OPQA 2EWTA 1QMFA 3Q7ZA 2JHEA 4WL9A 1LI0A 1PIOA 2J9OA 3ZDJA 3OLOA 3IF6A 4J1XA 1YMSA 3MXQA 1H5XA 3G6OA 4X4FA 3IX4A 2J80A 3SOIA 1TS0A 1K6RA 2ZQAA 2P04A 5A8BA 2MXDA 1K4EA 2BJCA 1IYSA 2WK0A 3NIAA 5FI2A 5EUAA 1HLUP 3F51A 3OC2A 1KDWA 1ZVVA 4PM9A 1K0KA 4R0QA 2ZQ7A 3QP5A 5GLBA 3UFDA 3O88A 2WKQA 5L10A 2ACGA 4JXVA 3CWFA 2V3CC 1ACFA 4LRYC 1AWIA 1KE0A 2O9AA 4KZ6A 2V8CA 2CMNA 1U60A 2JKRI 1ZZ9A 3FPWA 1KGGA 1S66L 4BL2A 4WZ5C 2XSDC 3E4OA 3ZHHA 2Y55A 4A5RA 3D72A 1DJCA 1H8MA 4MN5A 5F83A 2PXPA 4R1GA 3UB7A 2Q0OA 1NJ4A 1T19A 1FOFA 1CEGA 5JYOA 1UTXA 2Y59A 3RJUA 1SZVA 1WETA 4K0XA 4HNBA 4OQ0A 1NYYA 4K08A 4IBRA 4KZ7A 4G3WA 2R78A 1PWCA 2XRNA 3IX8A 4WN5A 1MY8A 2PUGA 1D06A 2G2UA 3BD1A 4X4EA 1K38A 1DULA 3ME5A 1IKGA 3D3OA 4CLCD 4DMZA 1XP4A 3B42A 1EROA 2PUDA 3IT9A 1TS7A 3EOIA 3P98A 4O01A 1L0EA 3JVVA 3IX3A 4BBVA 4ZJ2A 2P74A 1OTDA 3O3VA 4X1MA 2OLUA 1CF0A 3V5MA 2YKFA 4DE8A 3CROL 1L0GA 4IA8A 1TDGA 1TS8A 4B93A 5TR7A 2RL3A 4Q8IA 3A9YA 3MEJA 3ZFZA 2J7WA 1DJBA 3QP4A 4I3AA 3NZLA 1MZUA 1LQCA 3G5GA 5TJJA 1IOUA 3B47A 2XD1A 2R9WA 2ZQDA 2XA7M 3JVUA 3KSIA 3UN7A 3R09A 5DTTA 4N92A 3LCEA 2WGIA 3OPRA 4LV2A 4UHUA 4OLDA 4X4BA 5HL1A 3C7VA 2NUTC 2M7VA 4E3LA 4E3NA 4OPRA 3UB6A 3BFDA 4DE0A 5KZHA 3N6IA 3T4QA 3S1YA 3DAVA 1A0KA 3CMZA 3EQVA 5FSRA 1W8YA 4HBUA 3LGOA 2K31A 2H0YA 3QYXA 2J3TD 3OCNA 3T1XA 1OTIA 4X4CA 1EWZA 5EPHA 4PMAA 5AVFA 2VV8A 2XFSA 4LV3A 2JN7A 1VQQA 5F82A 5HDSA 2IUOA 4P85A 3RFBA 4NK3A 2LYJA 1X57A 2LYSA 1BYWA 1XJ4A 2HV1A 2L0WA 1TEMA 3VV4A 3UPOA 2W3HA 3DTMA 3SH9A 1LMB3 4JXSA 1NLZA 3N8LA 3S4XA 1F98A 1LSWA 3LR4A 4QWOA 2HJ9C 3V50A 3N4IA 4I3IA 4PM5A 4GZBA 3A0RA 5J8XA 1PRQA 3V39A 2W3FA 1YLTA 3VMAA 4IJGA 4Y2FA 1OCTC 4LCLA 2OSUA 3NOUC 3H5TA 4QHCA 2H10A 4F94A 4HJ6A 5EFWA 4FOFA 2ICTA 4R3JA 3FPVA 4OB4A 5F1FA 3PTEA 3LQXA 2K2NA 4CLCB 4FBIA 2ZC4B 1L1MA 3G34A 1UWPX 3FC7A 1OMEA 4E3IA 4HH2A 2PR5A 3GZDC 4GDNA 4ZRRA 5DFYA 3PBQA 2EWWA 3B33A 1ZZBA 3QNBA 1OT9A 5E2HA 4CLCA 1MWUA 3KO6A 4DN0A 4Q0IA 4EQIA 3ZPXA 1DW9A 2BNMA 3LR0A 4EQZA 2ODRD 1TF1A 3RXXA 3QOWA 4RVAA 2FFFB 2KX6A 1HD8A 3ZQ5A 1Y54A 4PM7A 2XF3A 3S7OA 1RIOA 5HZHA 3GSGA 4YBAA 1W79A 4EWFA 4ZTKA 2ZOIA 4EXOA 2ZBBA 4IWRA 3KL4A 5F5YA 1WIZA 2IWDA 1AXBA 1QP0A 2PXFA 1SHVA 2QMIA 5CHJA 4S2JA 1YM1A 2OWJA 1OTBA 3MS6A 2V0WA 3C4PA 3WRTA 3CAXA 1GHIA 1N9BA 2VGLS 2CSFA 4KZAA 1KDSA 4R23A 4YARA 4UAAA 3SH8A 4RYEA 4GJ4A 2WIUB 1PFLA 2KOIA 2Y2HA 3IXBA 2HDQA 4IVIA 4B4ZA 2X01A 2EFUA 5L8MA 4HJ3A 1XJ6A 1JNUA 2IWBA 4EQ1A 1WYBA 5I94A 1JWPA 4JGPA 1DJAA 5EVIC 5CHMA 4HEFA 4NXBA 2NUPC 1GHMA 2P9VB 1QB2A 4ER3A 1OTEA 2XCJA 2EA9A 5FDSA 3HLBA 4X4GA 4S2MA 1E25A 3PR6A 3TEPA 1MKMA 4FD8A 2BNOA 1ZZ7A 4NDWA 4CQHA 2P9VA 1M40A 3C2WA 4EESA 3ZGAB 3VP0A 3QP1A 4I38A 4XUXA 3NOPC 1ZZ8A 2VJWA 3B3XA 2EBYA 1YPRA 3GDIA 1K57A 4PKYA 4GOGA 1N4OA 4QY5A 3MF0A 2XLNA 4N1XA 5AQ7A 5FQMA 1Q2QA 2JCGA 3FYMA 3R4KA 3MQOA 2O99A 5HAPA 1ES5A 1IEMA 4KQDA 3F1PB 4BENA 2KEKA 1HF0A 1BZAA 4RQ9A 2XIUA 4IUKA 3NXHA 2J8YA 1HVBA 5HDCA 2LYRA 4XT2B 5DKKA 1T18A 3IBJA 5FI6A 2H0TA 1N9OA 2W1RA 3F1PA 1MKIA 1OJ5A 4Y42A 3BS3A 1CK3A 2E8JA 2PU4A 4WEKA 4XT2A 3HJIA 4ZJ1A 3T4OA 3PHYA 1ZTUA 4X6TA 1KGFA 3LR5A 3MR0A 5IHVA 3ISGA 2PXBA 1GCEA 2JKGA 3DBAA 2Y8HA 3CLOA 4X4HA 3F52A 5D3OA 2J7VA 2Y2LA 2PXKA 1LHYA 3GV9A 4GKUA 1RZSA 1G28A 2JKRM 4HI4A 3UO9A 3O87A 4Y5FA 2G7UA 4UA6A 4C6YA 1DP6A 4E04A 3L9KA 2QYBA 2L4RA 3T4JA 4JLFA 1JVJA 4HP4A 3U2AA 3A9ZA 1B0NA 3DTIA 3HUOA 2IVQA 4YWZA 4I5SA 1UGUA 3IF5A 2Q9NA 1MXOA 4CJNA 2HINA 2XXQA 1SKOA 1E4DA 3A0VA 5HARA 2Q9MA 3OBFA 4GLQA 4NXEA 1W5DA 4HIAA 3IHBA 4EBLA 1JFSA 3RXWA 3CECA 4FTXA 3C8CA 4OKPA 1FILA 3TRBA 1S0WA 3KX0X 4LGWA 4EUZA 1D7EA 2A2LA 3OP9A 5DRYA 2WGVA 4OP8A 2B95A 5KSHA 5GAGi 2PUAA 4MN7A 5GLAA 3BWLA 3VE3A 1S1YA 5TGFA 5JYPA 4DJ3A 4WZ5A 3O86A 3DTKA 3HJKA 1R63A 3JYIA 2R9XA 2XFTA 4P6BA 3DWKA 3GQZA 4JGOA 4MBFA 2B02A 5FQ9A 1K25A 3LISA 4X68A 3T4SA 5G4YA 1FCOA 1U2ZA 3M9LA 4OOMA 3OQOA 1FCMA 2QKPA 5TFQA 2LYLA 4NEED 3LUQA 2Y79A 1YSEA 1PI4A 1E3UD 5FAOA 1ERQA 1VHMA 1BDIA 5CEDA 4B88A 5A7LA 4KZ3A 4BWIA 1MWRA 2PD8A 3OKZA 5F1GA 3TE8A 1NZOA 3IWOA 2PBYA 3BQ8A 4P87A 4QD4A 1XJ2A 3RTYA 2J7UA 5LBRA 2ZC5B 2ZQCA 1UWNX 4M4XA 1S1ZA 3TG9A 3BYDA 2Y2QA 1UXDA 2WAEA 2LCVA 4QB8A 3HLEA 4Y0UA 2Z6CA 5M18A 3M6BA 1NRJA 3DTEA 3MZFA 2Y2PA 5CERA 4PU7A 4EBNA 1LI9A 5DJTA 3AGEA 3HREA 3SCHA 3OPLA 4R3AA 4DRTA 3Q81A 2C6WB 4WYYA 3CG5A 1LSXA 4KUKA 3HLWA 3MFXA 5FAQA 3UE6A 3W2ZA 4Q0JA 5HFOA 3MZDA 1RPEL 1FIKA 3KYEA 1KOUA 1PZOA 2Y2MA 4BJPA 4Y3IA 3UDXA 4UA9A 3LIEA 1D1JA 1O07A 3BDNA 4P6ZM 5DT2A 3IS2B 3ZG8B 1MWSA 1NRFA 5FQIA 3UMEA 4WUJA 5CRFA 1VM1A 3OPHA 3D4FA 3GTCA 1YLWA 4C75A 3QP8A 5EVID 4DE1A 5GLCA 2ZLYA 2CC1A 3IS2A 1YSPA 3HUMA 1PWDA 2JC7A 1ESIA 3QHYA 4WM9A 5HW3A 2IV1A 1W63M 4HBTA 4X69A 1WH8A 4GQMA 5E2GA 3T1QB 1PWGA 1O4XA 3ZHMA 1MPLA 4X55A
chains in the Genus database with same CATH topology
3OMTA 3CI6A 3PBSA 4YOFA 4KUOA 1F98A 2PE5A 5HWTA 1LSWA 2V0UA 3LR4A 1MC0A 4MN6A 1G6OA 4O0PA 3TRCA 1E3OC 2VZWA 4HY8A 4GCZA 4P6ZS 2O0YA 2HJ9C 1QP7A 5J4EA 3E4QA 3UMDA 2XSSA 3BQAA 2VV7A 3ZKCA 5DF9A 4X4DA 4I3IA 2OAP1 3A0RA 4JGQA 4R6LA 3KJXA 1DRMA 4PU4C 1LCCA 1VB6A 1ZHHB 2W3FA 2YKHA 4IJGA 4Y2FA 1OCTC 3SCGA 3NOUC 5F68A 2GZUA 3H5TA 2O9CA 3UE3A 2FZ0A 1UXCA 4R70A 4HJ6A 3V67A 1Y28A 3EEHA 4FOFA 4PKYG 5EFWA 2ICTA 3R1FA 3HCYA 3FPVA 4OB4A 4WLAA 1P0ZA 1GSVA 5CX7A 4LLOB 3RZZA 3RH8B 2K2NA 4CLCC 4CLCB 4FBIA 4EUVA 1L1MA 2KEIA 1UWPX 1BDHA 2H8RA 3FC7A 3VE4A 4HH2A 2PR5A 3BJNA 3ICYA 1GT0C 2VGLM 4ZRRA 4Z5CA 5DFYA 1LLIA 3O5YA 5HWVA 4IVZA 1X2LA 1GSWA 2EWWA 3PBQA 4I8TA 4I6TA 2OWHA 3B33A 1ZZBA 3IBRA 1OT9A 1P97A 3K2NA 3NOTC 4HOIA 4KQOA 3F1NB 2PUCA 2P7JA 4CLCA 3KO6A 4DN0A 4FN3A 4Q0IA 3TJZC 1DW9A 2BNMA 3T4TA 3LR0A 3LIAA 2H28A 2KZ8A 1TF1A 4HH3A 1V9YA 1ZUGA 2KX6A 2W3DA 1XFNA 4F3LB 3NJAA 1NERA 2QJ7A 2V1BA 4G3KA 3ZQ5A 3F1NA 1RZRD 3F1OB 2KLIA 4LPZA 1QPZA 2WKPA 3S7OA 1S7EA 1RIOA 5HZHA 1TD5A 3IVPA 4YBAA 2I9VA 2QJ5A 4F3LA 2ZOIA 4MCWA 2GZAA 4B9OA 4EXOA 2QHKA 5HPIA 2ZBBA 4IWRA 3S7PA 5F5YA 1OTAA 1WIZA 4YG4A 3F1OA 2V9AA 4FSFA 4BMWA 1QP0A 2JVLA 2LYQA 2OWJA 1OTBA 5I5LA 3LICA 2V0WA 3U3WA 2AWIA 4JCXA 2K7SA 1STZA 3K3CA 2PDRA 1R69A 2VV6A 3CAXA 4X4IA 1QQAA 2CSFA 3B7HA 1V9ZA 2VGLS 5F69A 4YARA 4I3JA 1OPXA 2VA0A 2WUSR 1T1AA 1ZS4A 4GJ4A 3PBTA 2WIUB 4Z5HA 3A0SA 2W3EA 2FH5A 4WEJA 5HWWA 4PAUA 2KOIA 2GRMA 4HP9A 4YG1A 2AXUA 1LT0A 2O9BA 2VEAA 3PXPA 5K98B 3OQMA 5K5BA 3KYQA 4YNRA 2M7UA 5DJUA 3UB9A 4NKPA 5L8MA 4HJ3A 3VOLA 3P01A 1XJ6A 2PYRA 3OQNA 4WELA 2GRLA 4IHQA 2HSGA 1JNUA 4MCTA 2OR1L 1NWZA 3KSFA 4EQ1A 3S7NA 4JGPA 2W1TB 4NXBA 1XWRA 2PUFA 2NUPC 5HPFA 2WKRA 1F9IA 2AXZA 3ZHIA 3E0YA 2JKTM 3H82B 3KSGA 4ETXA 3LYXA 4DJ2A 4EEPA 1OTEA 2LYKA 2OFYA 2XCJA 4UEYA 3PBRA 2FJRA 2EA9A 3CLCA 2ZMFA 4X4GA 1CQTA 1PERL 3PR6A 4L9GA 1MKMA 2W1TA 3S7QA 3LFVA 2BNOA 1ZZ7A 4NDWA 4MMNA 4CQHA 2DMWA 4QPRA 1ADRA 3ULFA 4Z58A 1N9NA 3H82A 2PIJA 3C2WA 4EESA 1N9LA 2R1JL 4I38A 5DKLA 3NOPC 2AXVA 3PBNA 2W3GA 4Q0HA 1ZZ8A 5C5KA 4PHTA 1PRVA 2VJWA 4H6JB 3MLFA 2EBYA 4II7A 3LR3A 3GDIA 4PKYA 2B5AA 4I6RA 5G4ZA 4J1WA 1H3QA 3QQ6A 3MF0A 4G3VA 2JCGA 3FYMA 3R4KA 3MQOA 3EGXC 4PU3C 2O99A 4R38A 3EGDC 2O38A 3EUSA 2JKTI 4F8DA 4GHJA 4H6JA 4L9EA 1YKDA 1DP9A 4KQDA 3MQQA 2L1MA 1QQBA 3F1PB 5IT5A 3FYAA 2KEKA 1HF0A 1T1CA 3KZ3A 3LIBA 3LI8A 5DFXA 3QF3A 4RQ9A 2XIUA 4UQIM 4Z59A 4IUKA 4EW7A 5HDCA 2LYRA 4XT2B 5DKKA 1T18A 2R63A 3JXDL 3LI9A 3IBJA 1XJ3A 1EW0A 3EWKA 1N9OA 2W1RA 3F1PA 2XROA 2XJ3A 1X0OA 1OJ5A 1EFAA 3C30A 4Y42A 3VK0A 2LB9A 3LIDA 4GHIA 3BS3A 4ME4A 2OAQ1 4WEKA 4XT2A 1WA9A 3HJIA 2J3WA 3T4OA 2PR6A 3FG8A 3PHYA 1ZTUA 2MJ6A 3JXBC 3G7DA 3LR5A 3MR0A 2HF6A 1XFQA 2ZOHA 4EEUA 1ZAYA 2EWTA 4JCYA 4JQDA 1TS6A 2JHEA 4WL9A 3DBAA 1POUA 2Y8HA 3MQ0A 3CLOA 2PUBA 4X4HA 4GW9A 3F52A 2IVBA 3OLOA 4J1XA 2Z6DA 1W63Q 3MXQA 3G6OA 4X4FA 2IVGA 2J80A 1JWLA 4LRZE 1RZSA 1G28A 2JKRM 4HI4A 1TS0A 1OJGA 4Y5FA 2G7UA 3L1PA 3D1NI 2P04A 5A8BA 1DP6A 1DWKA 4E04A 2QYBA 2L4RA 3T4JA 2BJCA 1RZRA 4UQIS 3F51A 3OC2A 1ZZCA 4HP4A 2KPJA 1ZVVA 3T4KA 3U2AA 1B0NA 5HD5A 1ZZ6A 5F6AA 2IVQA 4EU0A 5J3WA 4ETZA 1LCDA 3UFDA 4I5SA 4YWZA 1UGUA 2WKQA 4EERA 2LYPA 2GJ3A 1ZPQA 2HINA 1T1BA 4AFIA 3PBOA 4MDZA 3A0VA 3CWFA 3OBFA 4GLQA 1Y9QA 2KEJA 4NXEA 2INWA 1Y7YA 5AVEA 4HIAA 4LRYC 3EQUA 1PRUA 1JFSA 1GSXA 3CECA 2PYPA 4JGRA 2MEZA 2O9AA 3C8CA 5KIZA 2CMNA 3TRBA 1IFQA 2JKRI 3KX0X 1ZZ9A 3FPWA 1S66L 1D7EA 2A2LA 2P08A 2XSDC 3OP9A 4MCXA 3E4OA 2VKSA 5KSHA 2PUAA 2PUEA 2KDKA 3D72A 3MMHA 4MN7A 4WF0A 3UB8A 1CJGA 1H8MA 4MN5A 3GBFA 5FL3A 3BWLA 2GX5A 3UB7A 3LFPA 3VE3A 1S1YA 3H7WB 4EETB 3KXAA 2D02A 2L49A 4DJ3A 1T19A 4GS9B 3HJKA 1R63A 2PHYA 2O49A 4NXGA 4Z1WA 1UTXA 5J7EA 2V1AA 3LIFA 4Z5DA 4JGOA 1LL8A 4IUHA 4L0LA 2B02A 1WETA 4HNBA 4NXFA 1PRAA 2VX8A 3H7WA 2BASA 5IU1A 3NHQA 3LISA 3H9WA 4K08A 3KYZA 3T4SA 4GS9A 4G3WA 5G4YA 2R78A 2XRNA 5IS1A 5TBMB 1JFTA 4WN5A 2PUGA 1D06A 4OOMA 1P9WA 5HD3A 1NLYA 3OQOA 4BBTA 3JXCL 4YG7B 2QKPA 2LYLA 4NEED 3BD1A 4X4EA 4BBUA 3LUQA 2Y79A 3OCLA 1YSEA 4ARZB 1PNRA 4GHIB 3BY8A 3D3OA 5TBMA 4CLCD 4DMZA 1VHMA 2M1CA 2EF8A 4O8BA 1BDIA 3B42A 5A7LA 4BWIA 2PUDA 2O4AA 1F5MA 2PD8A 1TS7A 3TE8A 3GECA 3EOIA 2ZMVA 4O01A 3JVVA 4ARZA 3BQ8A 4BBVA 1OTDA 1XJ2A 3RTYA 3ZYTA 4HQAA 2CROA 2IA2A 1NEQA 5LBRA 1VPWA 1ODVA 2A24B 1UWNX 2LB5A 2YKFA 4M4XA 2GNXA 3K3DA 5HDDA 3CROL 1S1ZA 4IA8A 1TS8A 4B93A 2OOLA 1UXDA 2LCVA 3FMYA 1QP4A 1WH6A 5HL6A 2AUWA 2IU7A 3S8QA 4PU8A 2A24A 2Z6CA 2W0NA 1YAXA 2VLGA 3GN5B 3E98A 1NRJA 1S4RA 3HZIB 4I3AA 4HHDA 4O8GA 1MZUA 1P9RA 4I39A 4PU7A 3T4LA 1LQCA 3G5GA 5TJJA 1IOUA 1DP8A 5DJTA 3B47A 1IC8A 3SCHA 4R3AA 2PT7A 3C38A 1S4SA 3BY9A 5AJGA 3GN5A 3CUEC 1LSXA 2XA7M 3JVUA 3KSIA 3PYPA 4KUKA 3MFXA 4OOLA 2D5VA 3TW8A 3UE6A 2PPXA 1JH9A 4I6UA 3W2ZA 4Q0JA 5MC7A 1RPEL 3MJQA 1KOUA 3T50A 4X4BA 2ICPA 2B18A 4BJPA 4Y3IA 2NUTC 2M7VA 1S67L 3LIEA 3CUEA 1LSVA 2A6CA 3UB6A 3BDNA 3OOVA 2AW6A 3CITA 3DNVB 4P6ZM 3E4PA 1OSLA 2EWVA 3IS2B 3T4QA 1OT6A 4LRXC 3SCFA 3BW6A 3EQVA 2L8NA 3QWGA 1YSQA 3UMEA 4WUJA 2BNNA 1AU7A 2K31A 2PD7A 2QWSA 3QYXA 3IS2A 2J3TD 1YSPA 3EEAA 3OCNA 3P7NA 1OTIA 3R7WB 4X4CA 5HSQA 5AVFA 2VV8A 2HJEA 2JN7A 2D01A 2W27A 2IV1A 5HDSA 3O9XA 1W63M 2IUOA 1WH8A 2J3TC 4HJ4A 3RFBA 2LYJA 1X57A 2LYSA 4GQMA 1BYWA 1XJ4A 2HV1A 2L0WA 3KSHA 2XA7S 3VV4A 2W3HA 3SW1A 2MQKA 3R7WA 3F6WA 4CLCE 1SQ8A 1LMB3 3ZHMA 2XI8A 1O4XA 2HGVA 1NLZA 4L9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1X A;  3OMT A;  2PE5 A;  4X4F A;  2IVG A;  3PXP A;  5K98 B;  3OQM A;  1JWL A;  1RZS A;  3L1P A;  2CRO A;  3D1N I;  1E3O C;  1NEQ A;  3OQN A;  1VPW A;  1DWK A;  2GRL A;  2HSG A;  4MCT A;  2OR1 L;  1QP7 A;  2BJC A;  1XWR A;  3ZKC A;  4X4D A;  1RZR A;  2PUF A;  3CRO L;  4IA8 A;  3F51 A;  1ZZC A;  3KJX A;  2KPJ A;  4PU4 C;  1LCC A;  1ZVV A;  1B0N A;  2AXZ A;  1UXD A;  3ZHI A;  1ZZ6 A;  2LCV A;  3FMY A;  1OCT C;  1WH6 A;  1QP4 A;  2IVQ A;  3SCG A;  2LYK A;  2AUW A;  2GZU A;  2OFY A;  2IU7 A;  2XCJ A;  3H5T A;  1LCD A;  1UXC A;  3UFD A;  2FJR A;  4PU8 A;  3S8Q A;  3CLC A;  2LYP A;  4X4G A;  2ICT A;  3R1F A;  3GN5 B;  1CQT A;  1ZPQ A;  1PER L;  4OB4 A;  2HIN A;  3HZI B;  2BNO A;  3RZZ A;  1ZZ7 A;  4NDW A;  4FBI A;  1Y9Q A;  4PU7 A;  2KEJ A;  1LQC A;  1ADR A;  1L1M A;  1Y7Y A;  3G5G A;  4Z58 A;  2KEI A;  1BDH A;  2H8R A;  2PIJ A;  1PRU A;  1JFS A;  1GT0 C;  1IC8 A;  2R1J L;  3SCH A;  3CEC A;  2AXV A;  4Z5C A;  2MEZ A;  1LLI A;  3TRB A;  3GN5 A;  4IVZ A;  1X2L A;  1ZZ9 A;  1ZZ8 A;  4I6T A;  4I8T A;  1ZZB A;  1PRV A;  2O4A A;  2D5V A;  3MLF A;  2EBY A;  2XSD C;  3OP9 A;  4MCX A;  2PUC A;  4FN3 A;  2PPX A;  2B5A A;  1DW9 A;  2BNM A;  4I6R A;  4I6U A;  4J1W A;  1JH9 A;  4YG1 A;  2PUA A;  2PUE A;  2KZ8 A;  1CJG A;  1RPE L;  3QQ6 A;  4X4B A;  2ICP A;  3GBF A;  2JCG A;  3LFP A;  3FYM A;  1ZUG A;  4PU3 C;  3KXA A;  2O38 A;  2A6C A;  1NER A;  3EUS A;  4F8D A;  3BDN A;  2AW6 A;  4GHJ A;  3DNV B;  1R63 A;  2O49 A;  1RZR D;  1OSL A;  1QQB A;  1UTX A;  3FYA A;  2KEK A;  1HF0 A;  3KZ3 A;  3QF3 A;  1QPZ A;  2XIU A;  4Z5D A;  4Z59 A;  1S7E A;  3SCF A;  1RIO A;  1WET A;  2LYR A;  2L8N A;  3QWG A;  3IVP A;  1PRA A;  4YBA A;  2BNN A;  2R63 A;  3LIS A;  3JXD L;  1AU7 A;  4IWR A;  3QYX A;  1WIZ A;  4YG4 A;  1JFT A;  2XJ3 A;  1QP0 A;  2JVL A;  2LYQ A;  1EFA A;  4Y42 A;  3VK0 A;  2PUG A;  4X4C A;  3BS3 A;  3OQO A;  3JXC L;  4YG7 B;  2AWI A;  3U3W A;  4JCX A;  2LYL A;  3BD1 A;  4X4E A;  1R69 A;  1YSE A;  2IV1 A;  4X4I A;  3O9X A;  3JXB C;  3G7D A;  2CSF A;  3B7H A;  2IUO A;  1QQA A;  1WH8 A;  4YAR A;  1PNR A;  1ZAY A;  2EWT A;  2LYJ A;  1X57 A;  2LYS A;  2WUS R;  4GQM A;  1ZS4 A;  4JCY A;  2WIU B;  4Z5H A;  4JQD A;  2EF8 A;  4O8B A;  1BDI A;  2MQK A;  1POU A;  5A7L A;  3F6W A;  1SQ8 A;  1LMB 3;  2PUB A;  2PUD A;  4X4H A;  2XI8 A;  3F52 A;  2IVB A;  1O4X A;  3ZHM A;  2GRM A;  2L49 A;  2AXU A; 
#chains in the Genus database with same CATH topology
 4E6W A;  4KUO A;  2OV5 A;  2PE5 A;  2E8I A;  3BFF A;  1MC0 A;  4MN6 A;  1G6O A;  3TRC A;  4FH4 A;  1E3O C;  4HY8 A;  1QP7 A;  3ZG9 B;  4EV4 A;  2VV7 A;  3OWQ A;  2OAP 1;  2AVX A;  1GHP A;  1K54 C;  1VB6 A;  2UV0 E;  4O7D A;  1PYY A;  5L07 A;  3QOX A;  4FUW A;  3W4P A;  4OQH A;  2EXA A;  3BLS A;  3AGD A;  1P0Z A;  2XR0 A;  3RH8 B;  3Q7V B;  4EUV A;  4ID4 A;  2KEI A;  2H8R A;  1K55 A;  3BJN A;  3ICY A;  2YBD A;  1BTL A;  4EKG A;  1BLH A;  4ER7 A;  1LLI A;  1SDE A;  3O5Y A;  1X2L A;  2OWH A;  4ER0 A;  3IBR A;  4IVK A;  1E3U A;  3K2N A;  3G32 A;  3Q7V A;  5A91 A;  1FQG A;  3T4T A;  4IED A;  2PRF A;  2H28 A;  3M2K A;  3GZD A;  3UY6 A;  2DRW A;  3MFD A;  1ZUG A;  3IF6 C;  4F3L B;  3NJA A;  1NER A;  5FDH A;  2QJ7 A;  3CPT B;  2V1B A;  2FFH A;  4G3K A;  4CPK A;  1RGZ A;  4S2O A;  4XXR A;  1QPZ A;  2WKP A;  1S7E A;  3S22 A;  1XA7 A;  4FCF A;  3IVP A;  2QZ6 A;  1LL5 A;  4KZ4 A;  2QJ5 A;  4F3L A;  3DW0 A;  2GZA A;  3CPT A;  1H8Y A;  3S7P A;  1OTA A;  5FAP A;  3UB5 P;  4HES A;  4C3Q A;  3IXG A;  1YLY A;  3K3C A;  1STZ A;  2PDR A;  1R69 A;  1SKF A;  3B7H A;  1V9Z A;  4EKI A;  5EM0 A;  4ZJ3 A;  3HLC A;  1T1A A;  1ZS4 A;  5EE8 A;  4M3K A;  4Z5H A;  5EM1 A;  2JKF A;  3A0S A;  3NDE A;  2W3E A;  2PBD P;  3ZG5 A;  4PAU A;  4HP9 A;  4YG1 A;  2VEA A;  4ZDX A;  3C4O A;  1ALQ A;  3PXP A;  3KYQ A;  2M7U A;  5DJU A;  3VOL A;  3OQN A;  2EX6 A;  4IHQ A;  4BLM A;  4MCT A;  4HRA A;  1TVF A;  5L09 A;  5L2F A;  5EVI B;  1XWR A;  2WKR A;  2AXZ A;  3H82 B;  3E0Y A;  5FQQ A;  4DJ2 A;  2OFY A;  1XXM A;  3A9X A;  3CLC A;  3ITA A;  1CQT A;  1PER L;  4NET A;  5EVI A;  3UPP A;  3LFV A;  2DMW A;  1JWV A;  4QPR A;  4Z58 A;  3H82 A;  3CZD A;  2PIJ A;  2ZJ9 A;  3WS1 A;  1I2S A;  3UPN A;  3HL9 A;  2AXV A;  4ZBE A;  4Y0O A;  4E3M A;  4Q0H A;  5C5K A;  1PRV A;  5DTQ A;  2Y2K A;  3LR3 A;  2JE5 A;  4I6R A;  5G4Z A;  1HZO A;  2PU2 A;  1H3Q A;  3QQ6 A;  4LCM A;  1KVM A;  4KQQ A;  2O38 A;  4F8D A;  1VET B;  3MQQ A;  2L1M A;  3KZ3 A;  3ULF A;  2WKI A;  2J9P A;  4EW7 A;  2ZM2 A;  1ZKJ A;  3M6H A;  2HDU A;  3HLF A;  1VET A;  3WWX A;  1X0O A;  3C30 A;  4GHI A;  3VK0 A;  4OPY A;  5AQA A;  1PW8 A;  3QP6 A;  4ME4 A;  2OAQ 1;  2J3W A;  4OQI A;  1YLP A;  3GUU A;  1I2W A;  1ERM A;  3IH9 A;  4LFU A;  4JQD A;  5HX9 A;  1TS6 A;  1POU A;  2PUB A;  4S2L A;  4GW9 A;  3QNC A;  2Z6D A;  1G5U A;  1W63 Q;  5FQJ A;  1BLC A;  4GNU A;  2WKH A;  4LRZ E;  2WKE A;  1OJG A;  3L1P A;  4N9L A;  3D1N I;  5CXW A;  3IWQ A;  3TFL A;  4Y15 A;  1IYP A;  4UQI S;  1YMX A;  4GDB A;  5E2E A;  3T4K A;  2G2W A;  3TOI A;  1ZZ6 A;  2XK1 A;  5EOO A;  5J3W A;  4ETZ A;  5GHY A;  2PXL A;  4U0X A;  2GJ3 A;  4AFI A;  3PBO A;  3JPU A;  2INW A;  1Y7Y A;  5AVE A;  2ZQ9 A;  3CHW P;  1GSX A;  3A3J A;  2PYP A;  4JGR A;  4OQG A;  2MEZ A;  5CTN A;  1SCW A;  1IFQ A;  4KG2 A;  2HPB A;  4Y13 A;  4MCX A;  1RGY A;  2KDK A;  4WF0 A;  3MMH A;  3BFG A;  4KEN B;  1CJG A;  3GBF A;  2GX5 A;  2DCF A;  3H7W B;  4EET B;  2D02 A;  3FKW A;  5G18 A;  2PHY A;  2O49 A;  4Z1W A;  2VGK A;  5FEF A;  5J7E A;  1BLP A;  3LIF A;  2VEO A;  4Z5D A;  1LL8 A;  4L0L A;  4DE9 A;  1K56 D;  5M19 A;  4NXF A;  2VX8 A;  3H7W A;  2BAS A;  3NBL A;  3NHQ A;  3H9W A;  3A3D A;  5IS1 A;  5TBM B;  4JKT A;  3IH8 A;  3W4O A;  5HD3 A;  2Y4A A;  3Q82 A;  1NLY A;  4ESP A;  4YG7 B;  1YT4 A;  1C3B A;  2EXB A;  3NDG A;  4ARZ B;  2RCX A;  5TBM A;  1CEF A;  4KZ5 A;  3VP4 A;  2EF8 A;  4O8B A;  1KE3 A;  2O4A A;  2Y2O A;  3GVB A;  4Y7P A;  2ZC6 B;  4ARZ A;  3VWS A;  2XGN A;  3QP2 A;  4XUZ A;  3ZYT A;  2I72 A;  4HQA A;  2IA2 A;  1ODV A;  4Y17 A;  3OPP A;  3K3D A;  5FAT A;  1XKZ A;  2H5S A;  5HDD A;  3ZG0 A;  3UDI A;  2PXD A;  2HP6 A;  1XA1 A;  2OOL A;  4E3K A;  3FMY A;  1QP4 A;  1WH6 A;  2AUW A;  1JTD A;  1WE4 A;  4PU8 A;  1YAX A;  3GN5 B;  3E2L A;  3HVF A;  3MKE A;  1BUE A;  3P09 A;  4N1H A;  3LO7 A;  3BM6 A;  5FI7 A;  3WS5 A;  1DP8 A;  2Y2G A;  2HZ5 A;  2PT7 A;  1CI8 A;  1S4S A;  5AJG A;  3GN5 A;  1SKO B;  3CUE C;  3PYP A;  1HTZ A;  4X56 A;  3TW8 A;  2B5R A;  5M1A A;  1JH9 A;  3UDF A;  4I6U A;  1KE4 A;  2HP9 A;  5MC7 A;  2B18 A;  1H0M A;  1W7F A;  3IXD A;  1S67 L;  3W4Q A;  1L2S A;  5BOH A;  2AW6 A;  1I5Q A;  3CIT A;  4P0M A;  3BFE A;  3E4P A;  1DY6 A;  1OSL A;  2EWV A;  3DM5 A;  4LRX C;  5GLD A;  3SCF A;  4RX2 A;  4FH2 A;  2L8N A;  3ZVW A;  2QWS A;  3PAE A;  3SS3 A;  1ONH A;  3P7N A;  3C5A A;  4Q2J A;  4ZAM A;  1G6A A;  2HJE A;  5EVE A;  2D01 A;  2W27 A;  1NXY A;  3O9X A;  4EK9 A;  2J3T C;  2X02 A;  4U3T A;  3KSH A;  2XA7 S;  4EBP A;  4IBX A;  4DE2 A;  3F6W A;  1SQ8 A;  2LNM A;  4BQM A;  3IHA A;  2HGV A;  2L49 A;  4L9F A;  3CI6 A;  1XGJ A;  4YOF A;  1K6S A;  1ES4 A;  2V8F A;  1F2K A;  4GCZ A;  1K4F A;  1CJF A;  2XSS A;  3BQA A;  5DF9 A;  2WZZ A;  1DRM A;  4PU4 C;  1LCC A;  1ZHH B;  2YKH A;  4OPZ A;  2UWX A;  1ES3 A;  1K56 A;  3SCG A;  5F68 A;  2GZU A;  2O9C A;  3UE3 A;  3ZCZ A;  4R70 A;  3MKF A;  1MFQ C;  1Y28 A;  3VSK A;  2HDR A;  1PZP A;  4WLA A;  5CX7 A;  3RZZ A;  1K54 A;  1BDH A;  4JBF A;  3VE4 A;  3VP3 A;  2M4H A;  2VGL M;  5U47 A;  1Z09 A;  5HWV A;  4IVZ A;  1IKI A;  4I8T A;  5FQK A;  2HCS A;  3NOT C;  4GD6 A;  1RP5 A;  3TJZ C;  3LIA A;  2KZ8 A;  4HH3 A;  3VOY A;  3V3S A;  3PE5 A;  1V9Y A;  3FWL A;  3SR4 A;  1YLJ A;  2W3D A;  1XFN A;  4OOY A;  3SX0 A;  1RZR D;  1LL9 A;  2HCN A;  4JXW A;  2KLI A;  5HAI A;  4GB7 A;  1KVL A;  5CTM A;  1TD5 A;  2LLW A;  2I9V A;  4BD1 A;  3N8S A;  4MCW A;  4B9O A;  2QHK A;  5HPI A;  4JF6 A;  2HP5 A;  2Y2N A;  4YG4 A;  4FSF A;  3BFC A;  1S6R A;  2LYQ A;  5I5L A;  2AWI A;  4X4I A;  3MZE A;  3U4L P;  4I3J A;  1OPX A;  2VA0 A;  5A92 A;  2WUS R;  3G2Z A;  1H8Z A;  2FH5 A;  1GA9 A;  4WEJ A;  3G2Y A;  3L7H A;  5CHU A;  3UE1 A;  2O9B A;  5K98 B;  3OQM A;  3FKV A;  5K5B A;  3D9Y A;  4YNR A;  2WAD A;  3UB9 A;  2ZM0 A;  4NKP A;  2LLV A;  3P01 A;  2PYR A;  4WEL A;  2GRL A;  2HSG A;  1NWZ A;  3AGF A;  3KSF A;  3UNW A;  3S7N A;  3ZVT A;  2W1T B;  3C7U A;  2PUF A;  2JCH A;  3A3E A;  1NW3 A;  3KSG A;  4ETX A;  4EEP A;  3HLD A;  2PXE A;  4UEY A;  1NY0 A;  5FEG A;  3PBR A;  2FJR A;  1TDL A;  4JPM A;  2W1T A;  4YIN A;  1ADR A;  3MXS A;  2R1J L;  5DKL A;  3ZG7 B;  3OZH A;  4OH0 A;  2W3G A;  5EOE A;  2OLV A;  3NRO A;  3MBZ A;  4II7 A;  4S2N C;  4OP5 A;  4J1W A;  1FCN A;  4G3V A;  2WUQ A;  4R38 A;  2JKT I;  5DVA A;  4L9E A;  5IT5 A;  3FYA A;  1IEL A;  3LIB A;  1T1C A;  3NC8 A;  2ZQ8 A;  4E3O A;  5JUW A;  4Z59 A;  1G68 A;  2ZM8 A;  1ZG6 A;  3MSH A;  1XJ3 A;  3EWK A;  3MXR A;  2XJ3 A;  2XD5 A;  4N9K A;  2LB9 A;  1EI5 A;  1WA9 A;  2HF6 A;  2HFZ A;  1XFQ A;  4EEU A;  1ZAY A;  1LLB A;  1KGE A;  3NCK A;  3LY3 A;  4JCY A;  2XXA A;  3VSL A;  3MQ0 A;  2IVB A;  4X53 A;  4K0W A;  5E43 A;  2IVG A;  1XGI A;  5DTR A;  1JWL A;  4DXC A;  1DWK A;  5KMW A;  1RZR A;  1XPB A;  2QPN A;  1ZZC A;  2KPJ A;  2DNS A;  5HD5 A;  5F6A A;  4OLG A;  4EU0 A;  1LCD A;  4JF4 A;  3SS5 A;  3SS4 A;  2LYP A;  3WS4 A;  4EER A;  1FSY A;  1ZPQ A;  1T1B A;  4MDZ A;  1Y9Q A;  2KEJ A;  1Q2P A;  3EQU A;  1Y4O A;  1PRU A;  3GRJ A;  1NYM A;  4WVL A;  3SH7 A;  1MWT A;  5KIZ A;  2P08 A;  2ZC3 B;  3NI9 A;  2VKS A;  2PUE A;  1ZC2 A;  3UB8 A;  5FL3 A;  3IXH A;  3LFP A;  2WGW B;  2A49 A;  3KXA A;  4GS9 B;  4NXG A;  2V1A A;  2IWC A;  4IUH A;  4KZ9 A;  1J3W A;  1FSW A;  2HDS A;  3T1R A;  2WGW A;  1PRA A;  5IU1 A;  1O7E A;  3KYZ A;  4GS9 A;  1FR6 A;  4UA7 A;  1JFT A;  3HUN A;  1P9W A;  5EV0 A;  4BBT A;  3JXC L;  4WMC D;  3ITB A;  3VFH A;  4BBU A;  4RX3 A;  3OCL A;  2L1P A;  4ER6 A;  5DTK A;  1PNR A;  1PI5 A;  4D60 A;  4GHI B;  3BY8 A;  4R4S A;  2Z2M B;  4KG6 A;  2M1C A;  1K55 C;  1F5M A;  5DTS A;  3NDB B;  3CJM A;  3GEC A;  2A3U A;  2ZMV A;  2GDN A;  3IQA A;  3ZNT A;  3E2K A;  3UE0 A;  4KZ8 A;  3VP2 A;  1PW1 A;  4LV0 A;  2XQZ A;  2CRO A;  1NEQ A;  4QJG A;  1VPW A;  2A24 B;  3G31 A;  2LB5 A;  3GZC A;  2GNX A;  5CGX A;  3WS2 A;  4DKI A;  2ZC7 A;  5HL6 A;  1ONG A;  2IU7 A;  3S8Q A;  3BRM A;  4DXB A;  2A24 A;  2W0N A;  2VLG A;  3E98 A;  1S4R A;  2BG1 A;  3HZI B;  1BLS A;  1J9M A;  2ZMA A;  4HHD A;  4O8G A;  4RA7 A;  1P9R A;  3M2J A;  4I39 A;  3GR2 A;  3T4L A;  1ESU A;  3WRZ A;  1IC8 A;  1XX2 A;  3C38 A;  4E6X A;  3BY9 A;  3WS0 A;  4OOL A;  2D5V A;  2BTF P;  2PPX A;  2EX9 A;  4BL3 A;  3MJQ A;  5DTM A;  3T50 A;  2ICP A;  2WZX A;  1JWZ A;  2PXT A;  4D2O A;  3CUE A;  1LSV A;  2A6C A;  3OOV A;  3DNV B;  3UWP A;  1OT6 A;  1CQA A;  5GHZ A;  3W8K A;  3BW6 A;  3QWG A;  1YSQ A;  4MBK A;  2BNN A;  5HAQ A;  1AU7 A;  5EEC A;  2PD7 A;  3A3F A;  3VOZ A;  3BEB A;  3EEA A;  3VFF A;  4K91 A;  3R7W B;  5HSQ A;  2FFY A;  3LY4 A;  5CGW A;  3TEL A;  4EZI A;  4HJ4 A;  4KZB A;  3SW1 A;  2MQK A;  3R7W A;  2XXP A;  4GN2 A;  4CLC E;  4OON A;  2XI8 A;  4Z9Q A;  2VGJ A;  3OMT A;  3PBS A;  2EX8 A;  5HWT A;  2V0U A;  4U0T A;  5GAH i;  3FV7 A;  4O0P A;  3HLG A;  2VZW A;  4P6Z S;  2O0Y A;  5J4E A;  5A93 A;  3E4Q A;  3UMD A;  3ZKC A;  4X4D A;  4JGQ A;  4R6L A;  1L0D A;  3KJX A;  5DF7 A;  1IYO A;  4MNR A;  4OVD A;  3QFI A;  1QME A;  4DE3 A;  3I7J A;  2FZ0 A;  1UXC A;  3FZC A;  4H8R A;  4PM8 A;  3V67 A;  3EEH A;  4PKY G;  4WZ4 A;  5A90 A;  3R1F A;  3HCY A;  3NUL A;  1GSV A;  4LLO B;  4CLC C;  4PM6 A;  3Q1F A;  4MEZ A;  2XDM A;  1IYQ A;  4DDS A;  3IWI A;  1CI9 A;  1GT0 C;  4WMC A;  4Z5C A;  1JTG A;  4DDY A;  1GSW A;  2XEP A;  4I6T A;  1P97 A;  4HOI A;  4KQO A;  1ZG4 A;  3F1N B;  2PUC A;  2P7J A;  4FN3 A;  4QU3 A;  1SDN A;  1FR1 A;  3N7W A;  3F1N A;  3F1O B;  3VP1 A;  4LPZ A;  3SZT A;  2Z2L B;  5FA7 A;  1ES2 A;  2VK3 A;  4KQR A;  2PXQ A;  4OBM A;  2WYX A;  3BEC A;  3HBR A;  5DRT A;  4MLL A;  3F1O A;  2V9A A;  2Y2I A;  4BMW A;  2JVL A;  3ZNY A;  3LIC A;  2V2F F;  3U3W A;  4JCX A;  2Y2J A;  4S2I A;  2K7S A;  2VV6 A;  3G30 A;  4GD8 A;  1QQA A;  5GHX A;  5F69 A;  3T1S A;  4PPR A;  4WBG A;  3PBT A;  2V20 A;  5HWW A;  3T12 B;  2GRM A;  2AXU A;  3A3I A;  1LT0 A;  1RCJ A;  1MBL A;  1NZU A;  4B4X A;  2Y91 A;  5KSC A;  4S2P A;  4X25 A;  2X71 A;  4R3B A;  2ZL1 B;  1PNE A;  1WYC A;  4LEN A;  1BT5 A;  2OR1 L;  2C5W B;  3NEC A;  3N8R A;  5HPF A;  5AQB A;  3V3R A;  2ZD8 A;  1F9I A;  2EX2 A;  4E3J A;  3ZHI A;  2JKT M;  5AQ9 A;  4JF5 A;  5CEB A;  3LYX A;  2ZL1 A;  5CEC A;  2LYK A;  4DF6 A;  2EFX A;  2ZMF A;  2V1Z A;  4L9G A;  3NY4 A;  3S7Q A;  3G35 A;  1YQS A;  4MMN A;  1K57 C;  2WAF A;  1N9N A;  3DWZ A;  1M6K A;  3LEQ A;  1VEU B;  3GMW A;  4QY6 A;  1N9L A;  3PBN A;  4ER5 A;  3LEZ A;  4S2K A;  3TSG A;  3G0T A;  5DF8 A;  4PHT A;  1YLZ A;  4KG5 A;  4H6J B;  3MLF A;  2JQE A;  1QZX A;  5FAS A;  2B5A A;  1VEU A;  4LV1 A;  2XH9 A;  5DSX A;  5E2F A;  1L0F A;  4Y0T A;  4X1L A;  3EGX C;  4PU3 C;  3EGD C;  3EUS A;  2PAV P;  4GHJ A;  4H6J A;  1YKD A;  1GA0 A;  1DP9 A;  4YFM A;  1QQB A;  4S2N A;  3LI8 A;  5DFX A;  3QF3 A;  1HQ1 A;  4UQI M;  5EVL A;  4MBH A;  1BUL A;  1Z6F A;  2JBF A;  3FYZ A;  2PXV A;  3G4P A;  5GL9 A;  2R63 A;  3JXD L;  3LI9 A;  1BSG A;  1EW0 A;  5CGS A;  4JXG A;  2XRO A;  2BLS A;  4BD0 A;  4NG2 A;  1EFA A;  4R4R A;  3LID A;  1L3L A;  3IF6 B;  1W8Q A;  3BLM A;  2PR6 A;  3FG8 A;  2PXU A;  2MJ6 A;  3JXB C;  3Q07 A;  3G7D A;  2ZOH A;  3PAG A;  4OPQ A;  2EWT A;  1QMF A;  3Q7Z A;  2JHE A;  4WL9 A;  1LI0 A;  1PIO A;  2J9O A;  3ZDJ A;  3OLO A;  3IF6 A;  4J1X A;  1YMS A;  3MXQ A;  1H5X A;  3G6O A;  4X4F A;  3IX4 A;  2J80 A;  3SOI A;  1TS0 A;  1K6R A;  2ZQA A;  2P04 A;  5A8B A;  2MXD A;  1K4E A;  2BJC A;  1IYS A;  2WK0 A;  3NIA A;  5FI2 A;  5EUA A;  1HLU P;  3F51 A;  3OC2 A;  1KDW A;  1ZVV A;  4PM9 A;  1K0K A;  4R0Q A;  2ZQ7 A;  3QP5 A;  5GLB A;  3UFD A;  3O88 A;  2WKQ A;  5L10 A;  2ACG A;  4JXV A;  3CWF A;  2V3C C;  1ACF A;  4LRY C;  1AWI A;  1KE0 A;  2O9A A;  4KZ6 A;  2V8C A;  2CMN A;  1U60 A;  2JKR I;  1ZZ9 A;  3FPW A;  1KGG A;  1S66 L;  4BL2 A;  4WZ5 C;  2XSD C;  3E4O A;  3ZHH A;  2Y55 A;  4A5R A;  3D72 A;  1DJC A;  1H8M A;  4MN5 A;  5F83 A;  2PXP A;  4R1G A;  3UB7 A;  2Q0O A;  1NJ4 A;  1T19 A;  1FOF A;  1CEG A;  5JYO A;  1UTX A;  2Y59 A;  3RJU A;  1SZV A;  1WET A;  4K0X A;  4HNB A;  4OQ0 A;  1NYY A;  4K08 A;  4IBR A;  4KZ7 A;  4G3W A;  2R78 A;  1PWC A;  2XRN A;  3IX8 A;  4WN5 A;  1MY8 A;  2PUG A;  1D06 A;  2G2U A;  3BD1 A;  4X4E A;  1K38 A;  1DUL A;  3ME5 A;  1IKG A;  3D3O A;  4CLC D;  4DMZ A;  1XP4 A;  3B42 A;  1ERO A;  2PUD A;  3IT9 A;  1TS7 A;  3EOI A;  3P98 A;  4O01 A;  1L0E A;  3JVV A;  3IX3 A;  4BBV A;  4ZJ2 A;  2P74 A;  1OTD A;  3O3V A;  4X1M A;  2OLU A;  1CF0 A;  3V5M A;  2YKF A;  4DE8 A;  3CRO L;  1L0G A;  4IA8 A;  1TDG A;  1TS8 A;  4B93 A;  5TR7 A;  2RL3 A;  4Q8I A;  3A9Y A;  3MEJ A;  3ZFZ A;  2J7W A;  1DJB A;  3QP4 A;  4I3A A;  3NZL A;  1MZU A;  1LQC A;  3G5G A;  5TJJ A;  1IOU A;  3B47 A;  2XD1 A;  2R9W A;  2ZQD A;  2XA7 M;  3JVU A;  3KSI A;  3UN7 A;  3R09 A;  5DTT A;  4N92 A;  3LCE A;  2WGI A;  3OPR A;  4LV2 A;  4UHU A;  4OLD A;  4X4B A;  5HL1 A;  3C7V A;  2NUT C;  2M7V A;  4E3L A;  4E3N A;  4OPR A;  3UB6 A;  3BFD A;  4DE0 A;  5KZH A;  3N6I A;  3T4Q A;  3S1Y A;  3DAV A;  1A0K A;  3CMZ A;  3EQV A;  5FSR A;  1W8Y A;  4HBU A;  3LGO A;  2K31 A;  2H0Y A;  3QYX A;  2J3T D;  3OCN A;  3T1X A;  1OTI A;  4X4C A;  1EWZ A;  5EPH A;  4PMA A;  5AVF A;  2VV8 A;  2XFS A;  4LV3 A;  2JN7 A;  1VQQ A;  5F82 A;  5HDS A;  2IUO A;  4P85 A;  3RFB A;  4NK3 A;  2LYJ A;  1X57 A;  2LYS A;  1BYW A;  1XJ4 A;  2HV1 A;  2L0W A;  1TEM A;  3VV4 A;  3UPO A;  2W3H A;  3DTM A;  3SH9 A;  1LMB 3;  4JXS A;  1NLZ A;  3N8L A;  3S4X A;  1F98 A;  1LSW A;  3LR4 A;  4QWO A;  2HJ9 C;  3V50 A;  3N4I A;  4I3I A;  4PM5 A;  4GZB A;  3A0R A;  5J8X A;  1PRQ A;  3V39 A;  2W3F A;  1YLT A;  3VMA A;  4IJG A;  4Y2F A;  1OCT C;  4LCL A;  2OSU A;  3NOU C;  3H5T A;  4QHC A;  2H10 A;  4F94 A;  4HJ6 A;  5EFW A;  4FOF A;  2ICT A;  4R3J A;  3FPV A;  4OB4 A;  5F1F A;  3PTE A;  3LQX A;  2K2N A;  4CLC B;  4FBI A;  2ZC4 B;  1L1M A;  3G34 A;  1UWP X;  3FC7 A;  1OME A;  4E3I A;  4HH2 A;  2PR5 A;  3GZD C;  4GDN A;  4ZRR A;  5DFY A;  3PBQ A;  2EWW A;  3B33 A;  1ZZB A;  3QNB A;  1OT9 A;  5E2H A;  4CLC A;  1MWU A;  3KO6 A;  4DN0 A;  4Q0I A;  4EQI A;  3ZPX A;  1DW9 A;  2BNM A;  3LR0 A;  4EQZ A;  2ODR D;  1TF1 A;  3RXX A;  3QOW A;  4RVA A;  2FFF B;  2KX6 A;  1HD8 A;  3ZQ5 A;  1Y54 A;  4PM7 A;  2XF3 A;  3S7O A;  1RIO A;  5HZH A;  3GSG A;  4YBA A;  1W79 A;  4EWF A;  4ZTK A;  2ZOI A;  4EXO A;  2ZBB A;  4IWR A;  3KL4 A;  5F5Y A;  1WIZ A;  2IWD A;  1AXB A;  1QP0 A;  2PXF A;  1SHV A;  2QMI A;  5CHJ A;  4S2J A;  1YM1 A;  2OWJ A;  1OTB A;  3MS6 A;  2V0W A;  3C4P A;  3WRT A;  3CAX A;  1GHI A;  1N9B A;  2VGL S;  2CSF A;  4KZA A;  1KDS A;  4R23 A;  4YAR A;  4UAA A;  3SH8 A;  4RYE A;  4GJ4 A;  2WIU B;  1PFL A;  2KOI A;  2Y2H A;  3IXB A;  2HDQ A;  4IVI A;  4B4Z A;  2X01 A;  2EFU A;  5L8M A;  4HJ3 A;  1XJ6 A;  1JNU A;  2IWB A;  4EQ1 A;  1WYB A;  5I94 A;  1JWP A;  4JGP A;  1DJA A;  5EVI C;  5CHM A;  4HEF A;  4NXB A;  2NUP C;  1GHM A;  2P9V B;  1QB2 A;  4ER3 A;  1OTE A;  2XCJ A;  2EA9 A;  5FDS A;  3HLB A;  4X4G A;  4S2M A;  1E25 A;  3PR6 A;  3TEP A;  1MKM A;  4FD8 A;  2BNO A;  1ZZ7 A;  4NDW A;  4CQH A;  2P9V A;  1M40 A;  3C2W A;  4EES A;  3ZGA B;  3VP0 A;  3QP1 A;  4I38 A;  4XUX A;  3NOP C;  1ZZ8 A;  2VJW A;  3B3X A;  2EBY A;  1YPR A;  3GDI A;  1K57 A;  4PKY A;  4GOG A;  1N4O A;  4QY5 A;  3MF0 A;  2XLN A;  4N1X A;  5AQ7 A;  5FQM A;  1Q2Q A;  2JCG A;  3FYM A;  3R4K A;  3MQO A;  2O99 A;  5HAP A;  1ES5 A;  1IEM A;  4KQD A;  3F1P B;  4BEN A;  2KEK A;  1HF0 A;  1BZA A;  4RQ9 A;  2XIU A;  4IUK A;  3NXH A;  2J8Y A;  1HVB A;  5HDC A;  2LYR A;  4XT2 B;  5DKK A;  1T18 A;  3IBJ A;  5FI6 A;  2H0T A;  1N9O A;  2W1R A;  3F1P A;  1MKI A;  1OJ5 A;  4Y42 A;  3BS3 A;  1CK3 A;  2E8J A;  2PU4 A;  4WEK A;  4XT2 A;  3HJI A;  4ZJ1 A;  3T4O A;  3PHY A;  1ZTU A;  4X6T A;  1KGF A;  3LR5 A;  3MR0 A;  5IHV A;  3ISG A;  2PXB A;  1GCE A;  2JKG A;  3DBA A;  2Y8H A;  3CLO A;  4X4H A;  3F52 A;  5D3O A;  2J7V A;  2Y2L A;  2PXK A;  1LHY A;  3GV9 A;  4GKU A;  1RZS A;  1G28 A;  2JKR M;  4HI4 A;  3UO9 A;  3O87 A;  4Y5F A;  2G7U A;  4UA6 A;  4C6Y A;  1DP6 A;  4E04 A;  3L9K A;  2QYB A;  2L4R A;  3T4J A;  4JLF A;  1JVJ A;  4HP4 A;  3U2A A;  3A9Z A;  1B0N A;  3DTI A;  3HUO A;  2IVQ A;  4YWZ A;  4I5S A;  1UGU A;  3IF5 A;  2Q9N A;  1MXO A;  4CJN A;  2HIN A;  2XXQ A;  1SKO A;  1E4D A;  3A0V A;  5HAR A;  2Q9M A;  3OBF A;  4GLQ A;  4NXE A;  1W5D A;  4HIA A;  3IHB A;  4EBL A;  1JFS A;  3RXW A;  3CEC A;  4FTX A;  3C8C A;  4OKP A;  1FIL A;  3TRB A;  1S0W A;  3KX0 X;  4LGW A;  4EUZ A;  1D7E A;  2A2L A;  3OP9 A;  5DRY A;  2WGV A;  4OP8 A;  2B95 A;  5KSH A;  5GAG i;  2PUA A;  4MN7 A;  5GLA A;  3BWL A;  3VE3 A;  1S1Y A;  5TGF A;  5JYP A;  4DJ3 A;  4WZ5 A;  3O86 A;  3DTK A;  3HJK A;  1R63 A;  3JYI A;  2R9X A;  2XFT A;  4P6B A;  3DWK A;  3GQZ A;  4JGO A;  4MBF A;  2B02 A;  5FQ9 A;  1K25 A;  3LIS A;  4X68 A;  3T4S A;  5G4Y A;  1FCO A;  1U2Z A;  3M9L A;  4OOM A;  3OQO A;  1FCM A;  2QKP A;  5TFQ A;  2LYL A;  4NEE D;  3LUQ A;  2Y79 A;  1YSE A;  1PI4 A;  1E3U D;  5FAO A;  1ERQ A;  1VHM A;  1BDI A;  5CED A;  4B88 A;  5A7L A;  4KZ3 A;  4BWI A;  1MWR A;  2PD8 A;  3OKZ A;  5F1G A;  3TE8 A;  1NZO A;  3IWO A;  2PBY A;  3BQ8 A;  4P87 A;  4QD4 A;  1XJ2 A;  3RTY A;  2J7U A;  5LBR A;  2ZC5 B;  2ZQC A;  1UWN X;  4M4X A;  1S1Z A;  3TG9 A;  3BYD A;  2Y2Q A;  1UXD A;  2WAE A;  2LCV A;  4QB8 A;  3HLE A;  4Y0U A;  2Z6C A;  5M18 A;  3M6B A;  1NRJ A;  3DTE A;  3MZF A;  2Y2P A;  5CER A;  4PU7 A;  4EBN A;  1LI9 A;  5DJT A;  3AGE A;  3HRE A;  3SCH A;  3OPL A;  4R3A A;  4DRT A;  3Q81 A;  2C6W B;  4WYY A;  3CG5 A;  1LSX A;  4KUK A;  3HLW A;  3MFX A;  5FAQ A;  3UE6 A;  3W2Z A;  4Q0J A;  5HFO A;  3MZD A;  1RPE L;  1FIK A;  3KYE A;  1KOU A;  1PZO A;  2Y2M A;  4BJP A;  4Y3I A;  3UDX A;  4UA9 A;  3LIE A;  1D1J A;  1O07 A;  3BDN A;  4P6Z M;  5DT2 A;  3IS2 B;  3ZG8 B;  1MWS A;  1NRF A;  5FQI A;  3UME A;  4WUJ A;  5CRF A;  1VM1 A;  3OPH A;  3D4F A;  3GTC A;  1YLW A;  4C75 A;  3QP8 A;  5EVI D;  4DE1 A;  5GLC A;  2ZLY A;  2CC1 A;  3IS2 A;  1YSP A;  3HUM A;  1PWD A;  2JC7 A;  1ESI A;  3QHY A;  4WM9 A;  5HW3 A;  2IV1 A;  1W63 M;  4HBT A;  4X69 A;  1WH8 A;  4GQM A;  5E2G A;  3T1Q B;  1PWG A;  1O4X A;  3ZHM A;  1MPL A;  4X55 A; 
#chains in the Genus database with same CATH homology
 3OMT A;  3CI6 A;  3PBS A;  4YOF A;  4KUO A;  1F98 A;  2PE5 A;  5HWT A;  1LSW A;  2V0U A;  3LR4 A;  1MC0 A;  4MN6 A;  1G6O A;  4O0P A;  3TRC A;  1E3O C;  2VZW A;  4HY8 A;  4GCZ A;  4P6Z S;  2O0Y A;  2HJ9 C;  1QP7 A;  5J4E A;  3E4Q A;  3UMD A;  2XSS A;  3BQA A;  2VV7 A;  3ZKC A;  5DF9 A;  4X4D A;  4I3I A;  2OAP 1;  3A0R A;  4JGQ A;  4R6L A;  3KJX A;  1DRM A;  4PU4 C;  1LCC A;  1VB6 A;  1ZHH B;  2W3F A;  2YKH A;  4IJG A;  4Y2F A;  1OCT C;  3SCG A;  3NOU C;  5F68 A;  2GZU A;  3H5T A;  2O9C A;  3UE3 A;  2FZ0 A;  1UXC A;  4R70 A;  4HJ6 A;  3V67 A;  1Y28 A;  3EEH A;  4FOF A;  4PKY G;  5EFW A;  2ICT A;  3R1F A;  3HCY A;  3FPV A;  4OB4 A;  4WLA A;  1P0Z A;  1GSV A;  5CX7 A;  4LLO B;  3RZZ A;  3RH8 B;  2K2N A;  4CLC C;  4CLC B;  4FBI A;  4EUV A;  1L1M A;  2KEI A;  1UWP X;  1BDH A;  2H8R A;  3FC7 A;  3VE4 A;  4HH2 A;  2PR5 A;  3BJN A;  3ICY A;  1GT0 C;  2VGL M;  4ZRR A;  4Z5C A;  5DFY A;  1LLI A;  3O5Y A;  5HWV A;  4IVZ A;  1X2L A;  1GSW A;  2EWW A;  3PBQ A;  4I8T A;  4I6T A;  2OWH A;  3B33 A;  1ZZB A;  3IBR A;  1OT9 A;  1P97 A;  3K2N A;  3NOT C;  4HOI A;  4KQO A;  3F1N B;  2PUC A;  2P7J A;  4CLC A;  3KO6 A;  4DN0 A;  4FN3 A;  4Q0I A;  3TJZ C;  1DW9 A;  2BNM A;  3T4T A;  3LR0 A;  3LIA A;  2H28 A;  2KZ8 A;  1TF1 A;  4HH3 A;  1V9Y A;  1ZUG A;  2KX6 A;  2W3D A;  1XFN A;  4F3L B;  3NJA A;  1NER A;  2QJ7 A;  2V1B A;  4G3K A;  3ZQ5 A;  3F1N A;  1RZR D;  3F1O B;  2KLI A;  4LPZ A;  1QPZ A;  2WKP A;  3S7O A;  1S7E A;  1RIO A;  5HZH A;  1TD5 A;  3IVP A;  4YBA A;  2I9V A;  2QJ5 A;  4F3L A;  2ZOI A;  4MCW A;  2GZA A;  4B9O A;  4EXO A;  2QHK A;  5HPI A;  2ZBB A;  4IWR A;  3S7P A;  5F5Y A;  1OTA A;  1WIZ A;  4YG4 A;  3F1O A;  2V9A A;  4FSF A;  4BMW A;  1QP0 A;  2JVL A;  2LYQ A;  2OWJ A;  1OTB A;  5I5L A;  3LIC A;  2V0W A;  3U3W A;  2AWI A;  4JCX A;  2K7S A;  1STZ A;  3K3C A;  2PDR A;  1R69 A;  2VV6 A;  3CAX A;  4X4I A;  1QQA A;  2CSF A;  3B7H A;  1V9Z A;  2VGL S;  5F69 A;  4YAR A;  4I3J A;  1OPX A;  2VA0 A;  2WUS R;  1T1A A;  1ZS4 A;  4GJ4 A;  3PBT A;  2WIU B;  4Z5H A;  3A0S A;  2W3E A;  2FH5 A;  4WEJ A;  5HWW A;  4PAU A;  2KOI A;  2GRM A;  4HP9 A;  4YG1 A;  2AXU A;  1LT0 A;  2O9B A;  2VEA A;  3PXP A;  5K98 B;  3OQM A;  5K5B A;  3KYQ A;  4YNR A;  2M7U A;  5DJU A;  3UB9 A;  4NKP A;  5L8M A;  4HJ3 A;  3VOL A;  3P01 A;  1XJ6 A;  2PYR A;  3OQN A;  4WEL A;  2GRL A;  4IHQ A;  2HSG A;  1JNU A;  4MCT A;  2OR1 L;  1NWZ A;  3KSF A;  4EQ1 A;  3S7N A;  4JGP A;  2W1T B;  4NXB A;  1XWR A;  2PUF A;  2NUP C;  5HPF A;  2WKR A;  1F9I A;  2AXZ A;  3ZHI A;  3E0Y A;  2JKT M;  3H82 B;  3KSG A;  4ETX A;  3LYX A;  4DJ2 A;  4EEP A;  1OTE A;  2LYK A;  2OFY A;  2XCJ A;  4UEY A;  3PBR A;  2FJR A;  2EA9 A;  3CLC A;  2ZMF A;  4X4G A;  1CQT A;  1PER L;  3PR6 A;  4L9G A;  1MKM A;  2W1T A;  3S7Q A;  3LFV A;  2BNO A;  1ZZ7 A;  4NDW A;  4MMN A;  4CQH A;  2DMW A;  4QPR A;  1ADR A;  3ULF A;  4Z58 A;  1N9N A;  3H82 A;  2PIJ A;  3C2W A;  4EES A;  1N9L A;  2R1J L;  4I38 A;  5DKL A;  3NOP C;  2AXV A;  3PBN A;  2W3G A;  4Q0H A;  1ZZ8 A;  5C5K A;  4PHT A;  1PRV A;  2VJW A;  4H6J B;  3MLF A;  2EBY A;  4II7 A;  3LR3 A;  3GDI A;  4PKY A;  2B5A A;  4I6R A;  5G4Z A;  4J1W A;  1H3Q A;  3QQ6 A;  3MF0 A;  4G3V A;  2JCG A;  3FYM A;  3R4K A;  3MQO A;  3EGX C;  4PU3 C;  2O99 A;  4R38 A;  3EGD C;  2O38 A;  3EUS A;  2JKT I;  4F8D A;  4GHJ A;  4H6J A;  4L9E A;  1YKD A;  1DP9 A;  4KQD A;  3MQQ A;  2L1M A;  1QQB A;  3F1P B;  5IT5 A;  3FYA A;  2KEK A;  1HF0 A;  1T1C A;  3KZ3 A;  3LIB A;  3LI8 A;  5DFX A;  3QF3 A;  4RQ9 A;  2XIU A;  4UQI M;  4Z59 A;  4IUK A;  4EW7 A;  5HDC A;  2LYR A;  4XT2 B;  5DKK A;  1T18 A;  2R63 A;  3JXD L;  3LI9 A;  3IBJ A;  1XJ3 A;  1EW0 A;  3EWK A;  1N9O A;  2W1R A;  3F1P A;  2XRO A;  2XJ3 A;  1X0O A;  1OJ5 A;  1EFA A;  3C30 A;  4Y42 A;  3VK0 A;  2LB9 A;  3LID A;  4GHI A;  3BS3 A;  4ME4 A;  2OAQ 1;  4WEK A;  4XT2 A;  1WA9 A;  3HJI A;  2J3W A;  3T4O A;  2PR6 A;  3FG8 A;  3PHY A;  1ZTU A;  2MJ6 A;  3JXB C;  3G7D A;  3LR5 A;  3MR0 A;  2HF6 A;  1XFQ A;  2ZOH A;  4EEU A;  1ZAY A;  2EWT A;  4JCY A;  4JQD A;  1TS6 A;  2JHE A;  4WL9 A;  3DBA A;  1POU A;  2Y8H A;  3MQ0 A;  3CLO A;  2PUB A;  4X4H A;  4GW9 A;  3F52 A;  2IVB A;  3OLO A;  4J1X A;  2Z6D A;  1W63 Q;  3MXQ A;  3G6O A;  4X4F A;  2IVG A;  2J80 A;  1JWL A;  4LRZ E;  1RZS A;  1G28 A;  2JKR M;  4HI4 A;  1TS0 A;  1OJG A;  4Y5F A;  2G7U A;  3L1P A;  3D1N I;  2P04 A;  5A8B A;  1DP6 A;  1DWK A;  4E04 A;  2QYB A;  2L4R A;  3T4J A;  2BJC A;  1RZR A;  4UQI S;  3F51 A;  3OC2 A;  1ZZC A;  4HP4 A;  2KPJ A;  1ZVV A;  3T4K A;  3U2A A;  1B0N A;  5HD5 A;  1ZZ6 A;  5F6A A;  2IVQ A;  4EU0 A;  5J3W A;  4ETZ A;  1LCD A;  3UFD A;  4I5S A;  4YWZ A;  1UGU A;  2WKQ A;  4EER A;  2LYP A;  2GJ3 A;  1ZPQ A;  2HIN A;  1T1B A;  4AFI A;  3PBO A;  4MDZ A;  3A0V A;  3CWF A;  3OBF A;  4GLQ A;  1Y9Q A;  2KEJ A;  4NXE A;  2INW A;  1Y7Y A;  5AVE A;  4HIA A;  4LRY C;  3EQU A;  1PRU A;  1JFS A;  1GSX A;  3CEC A;  2PYP A;  4JGR A;  2MEZ A;  2O9A A;  3C8C A;  5KIZ A;  2CMN A;  3TRB A;  1IFQ A;  2JKR I;  3KX0 X;  1ZZ9 A;  3FPW A;  1S66 L;  1D7E A;  2A2L A;  2P08 A;  2XSD C;  3OP9 A;  4MCX A;  3E4O A;  2VKS A;  5KSH A;  2PUA A;  2PUE A;  2KDK A;  3D72 A;  3MMH A;  4MN7 A;  4WF0 A;  3UB8 A;  1CJG A;  1H8M A;  4MN5 A;  3GBF A;  5FL3 A;  3BWL A;  2GX5 A;  3UB7 A;  3LFP A;  3VE3 A;  1S1Y A;  3H7W B;  4EET B;  3KXA A;  2D02 A;  2L49 A;  4DJ3 A;  1T19 A;  4GS9 B;  3HJK A;  1R63 A;  2PHY A;  2O49 A;  4NXG A;  4Z1W A;  1UTX A;  5J7E A;  2V1A A;  3LIF A;  4Z5D A;  4JGO A;  1LL8 A;  4IUH A;  4L0L A;  2B02 A;  1WET A;  4HNB A;  4NXF A;  1PRA A;  2VX8 A;  3H7W A;  2BAS A;  5IU1 A;  3NHQ A;  3LIS A;  3H9W A;  4K08 A;  3KYZ A;  3T4S A;  4GS9 A;  4G3W A;  5G4Y A;  2R78 A;  2XRN A;  5IS1 A;  5TBM B;  1JFT A;  4WN5 A;  2PUG A;  1D06 A;  4OOM A;  1P9W A;  5HD3 A;  1NLY A;  3OQO A;  4BBT A;  3JXC L;  4YG7 B;  2QKP A;  2LYL A;  4NEE D;  3BD1 A;  4X4E A;  4BBU A;  3LUQ A;  2Y79 A;  3OCL A;  1YSE A;  4ARZ B;  1PNR A;  4GHI B;  3BY8 A;  3D3O A;  5TBM A;  4CLC D;  4DMZ A;  1VHM A;  2M1C A;  2EF8 A;  4O8B A;  1BDI A;  3B42 A;  5A7L A;  4BWI A;  2PUD A;  2O4A A;  1F5M A;  2PD8 A;  1TS7 A;  3TE8 A;  3GEC A;  3EOI A;  2ZMV A;  4O01 A;  3JVV A;  4ARZ A;  3BQ8 A;  4BBV A;  1OTD A;  1XJ2 A;  3RTY A;  3ZYT A;  4HQA A;  2CRO A;  2IA2 A;  1NEQ A;  5LBR A;  1VPW A;  1ODV A;  2A24 B;  1UWN X;  2LB5 A;  2YKF A;  4M4X A;  2GNX A;  3K3D A;  5HDD A;  3CRO L;  1S1Z A;  4IA8 A;  1TS8 A;  4B93 A;  2OOL A;  1UXD A;  2LCV A;  3FMY A;  1QP4 A;  1WH6 A;  5HL6 A;  2AUW A;  2IU7 A;  3S8Q A;  4PU8 A;  2A24 A;  2Z6C A;  2W0N A;  1YAX A;  2VLG A;  3GN5 B;  3E98 A;  1NRJ A;  1S4R A;  3HZI B;  4I3A A;  4HHD A;  4O8G A;  1MZU A;  1P9R A;  4I39 A;  4PU7 A;  3T4L A;  1LQC A;  3G5G A;  5TJJ A;  1IOU A;  1DP8 A;  5DJT A;  3B47 A;  1IC8 A;  3SCH A;  4R3A A;  2PT7 A;  3C38 A;  1S4S A;  3BY9 A;  5AJG A;  3GN5 A;  3CUE C;  1LSX A;  2XA7 M;  3JVU A;  3KSI A;  3PYP A;  4KUK A;  3MFX A;  4OOL A;  2D5V A;  3TW8 A;  3UE6 A;  2PPX A;  1JH9 A;  4I6U A;  3W2Z A;  4Q0J A;  5MC7 A;  1RPE L;  3MJQ A;  1KOU A;  3T50 A;  4X4B A;  2ICP A;  2B18 A;  4BJP A;  4Y3I A;  2NUT C;  2M7V A;  1S67 L;  3LIE A;  3CUE A;  1LSV A;  2A6C A;  3UB6 A;  3BDN A;  3OOV A;  2AW6 A;  3CIT A;  3DNV B;  4P6Z M;  3E4P A;  1OSL A;  2EWV A;  3IS2 B;  3T4Q A;  1OT6 A;  4LRX C;  3SCF A;  3BW6 A;  3EQV A;  2L8N A;  3QWG A;  1YSQ A;  3UME A;  4WUJ A;  2BNN A;  1AU7 A;  2K31 A;  2PD7 A;  2QWS A;  3QYX A;  3IS2 A;  2J3T D;  1YSP A;  3EEA A;  3OCN A;  3P7N A;  1OTI A;  3R7W B;  4X4C A;  5HSQ A;  5AVF A;  2VV8 A;  2HJE A;  2JN7 A;  2D01 A;  2W27 A;  2IV1 A;  5HDS A;  3O9X A;  1W63 M;  2IUO A;  1WH8 A;  2J3T C;  4HJ4 A;  3RFB A;  2LYJ A;  1X57 A;  2LYS A;  4GQM A;  1BYW A;  1XJ4 A;  2HV1 A;  2L0W A;  3KSH A;  2XA7 S;  3VV4 A;  2W3H A;  3SW1 A;  2MQK A;  3R7W A;  3F6W A;  4CLC E;  1SQ8 A;  1LMB 3;  3ZHM A;  2XI8 A;  1O4X A;  2HGV A;  1NLZ A;  4L9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...