3PXPA

Crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
292
structure length
292
Chain Sequence
GMERAAFGKLVQALRREHRDEKGRVWTQEVLAERTQLPKRTIERIENGSLAHLDADILLRLADALELTIGERREFFFAATGIIEQKSATYKRSPEESLQYLIDMIRNMNVPAFVTDQYVNIIAANMITIRFFNIPMELIETAPLLPHGYNLMRVVFGTEYDFRRVVGTMWDEVARHNMQLFRAISLRVRADGYFVELLDNLMQYREFKRFWERAHLETEDTSAENFWYQYTHPVYGLLSYVSSRSQIPTSMGLLSMHTYIPLSPATTDLFAKLSTVANQDVIRLAPWPRSNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Helix-turn-helix domain protein
publication title Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes.
pubmed doi rcsb
source organism Chloroflexus aurantiacus
total genus 85
structure length 292
sequence length 292
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
A PF17765 MLTR_LBD MmyB-like transcription regulator ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3pxpA01
3.30.450.180 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pxpA02
4YBAA 4J1XA 1LCDA 2AUWA 3LFPA 2O4AA 3FYMA 3S8QA 4X4IA 3F6WA 4X4FA 3CECA 2PUGA 4JCXA 4I6TA 1CQTA 2MQKA 1NERA 1YSEA 4FN3A 3SCFA 4PU4C 1JWLA 1O4XA 3KZ3A 1Y7YA 2D5VA 1PRUA 1JFSA 2PUEA 1OSLA 2IVGA 1HF0A 3GBFA 1CJGA 2OR1L 1PRVA 3BD1A 4YARA 3JXBC 1LQCA 3JXCL 2BJCA 2KEIA 2ICPA 1RPEL 1ZZ7A 2AXUA 1ZZBA 2GZUA 2HINA 4Y42A 2KPJA 2PUDA 1QPZA 2KZ8A 3GN5A 4FBIA 1JH9A 3QF3A 4Z58A 1VPWA 4Z5HA 4X4HA 4JQDA 3G7DA 2AWIA 2JVLA 2EBYA 4X4BA 1GT0C 4X4GA 2R63A 3ZHMA 3OMTA 3L1PA 3KXAA 3QQ6A 1ZAYA 2LYPA 4X4DA 1X2LA 2XI8A 2MEZA 4PU7A 1LLIA 2XJ3A 1R69A 3O9XA 3IVPA 4MCTA 2IV1A 2PIJA 2KEKA 4F8DA 1UXDA 2WIUB 2OFYA 3QWGA 2A6CA 4IVZA 4Z59A 1OCTC 2XIUA 2HSGA 1WETA 1ZUGA 4I6RA 1ADRA 2JCGA 1ZS4A 2AW6A 1QP7A 1S7EA 3CLCA 4OB4A 1LCCA 2PPXA 1IC8A 2GRLA 3SCGA 4I6UA 4O8BA 2LCVA 1POUA 2O49A 1BDIA 3U3WA 1EFAA 2XSDC 1ZZ6A 3OP9A 2LYRA 1DWKA 1B0NA 1ZPQA 3ZHIA 2KEJA 1UXCA 2CSFA 3LISA 4IA8A 3BDNA 4IWRA 4Z5DA 1QQBA 2EWTA 2IVQA 3G5GA 1JFTA 3H5TA 4X4CA 1ZZ8A 2B5AA 2XCJA 4NDWA 1QP4A 3OQOA 4X4EA 2BNNA 4GHJA 3ZKCA 3CROL 1L1MA 3RZZA 3B7HA 1ZZ9A 3FYAA 2O38A 2PUBA 5K98B 2L49A 3QYXA 2BNOA 1NEQA 5A7LA 3OQNA 1QQAA 2LYKA 2LYJA 3TRBA 1LMB3 2IVBA 3HZIB 1UTXA 3D1NI 1WH6A 1BDHA 2IUOA 2AXZA 3PXPA 1X57A 4I8TA 1R63A 2L8NA 1RZRA 3SCHA 2LYQA 3UFDA 2PUAA 3F52A 3F51A 3MLFA 3R1FA 1RIOA 1RZRD 3VK0A 3JXDL 3DNVB 2H8RA 2AXVA 2BNMA 1PERL 2R1JL 2EF8A 2GRMA 1Y9QA 1AU7A 4YG7B 4Z5CA 1XWRA 3KJXA 4MCXA 1ZVVA 1RZSA 2FJRA 2PUCA 2PUFA 4GQMA 1SQ8A 1WH8A 2CROA 3BS3A 4PU8A 1PRAA 1E3OC 1DW9A 4J1WA 1WIZA 1QP0A 3OQMA 3GN5B 4YG1A 2PE5A 3FMYA 2LYSA 4PU3C 4JCYA 2IU7A 4YG4A 3EUSA 2ICTA 1PNRA 1ZZCA 2LYLA 2WUSR
chains in the Genus database with same CATH superfamily
4WM9A 3UPNA 3VP1A 3FYMA 1K38A 1O7EA 4I6TA 3BRMA 1GCEA 3SCFA 2QMIA 2ZQ8A 4Q0IA 3MQOA 2WKQA 2IVGA 3BW6A 1MBLA 1OT9A 5HL6A 2OR1L 4HH3A 2IWDA 2ICPA 1YLWA 4ZDXA 2AXUA 5EECA 4DKIA 1ZKJA 3BLSA 4X25A 4R6LA 2HFZA 5GHZA 3GN5A 4LV0A 5G4ZA 4N9LA 2P74A 3RJUA 2G7UA 1RCJA 5LBRA 3LFVA 3UE3A 3IBRA 4HJ6A 4R3BA 3L1PA 4QY6A 3F1OA 3KXAA 3HVFA 2A2LA 4II7A 2M7VA 4I3IA 3N6IA 1U2ZA 2B5RA 3E0YA 3NROA 3LI9A 2GZAA 2KEKA 1OCTC 1HD8A 2AW6A 3QNBA 2PD8A 3U3WA 2ZM2A 4MBKA 4IA8A 4OH0A 1ZZ8A 3A9YA 1XFQA 2X01A 3GECA 2HJEA 2LNMA 2Y59A 1MKIA 2L0WA 2PHYA 2VEAA 1T1CA 1NEQA 1X0OA 3E98A 3OQNA 3SR4A 2V2FF 3PBSA 1KE3A 1KGFA 1PWGA 3K3CA 4ER0A 4JXWA 3FKWA 5L07A 3UMDA 3FWLA 4NXEA 3KYEA 3TJZC 1IYPA 4YG7B 1RZSA 2QWSA 3H9WA 3O3VA 4PU8A 2ZLYA 1E4DA 3KSIA 2Q9NA 1BT5A 1JTDA 4HJ4A 3OQMA 1LL9A 2PT7A 1TS0A 3PBTA 1E3UA 1QP0A 3IS2A 4C6YA 4UA6A 1QB2A 3RTYA 1CJFA 4OQGA 1U60A 3A3FA 1G28A 1O4XA 2PUEA 2L1MA 1JFSA 3T1SA 5EOOA 2V0UA 3VOLA 3M6HA 1XJ4A 3NHQA 4EQ1A 4ARZA 2DCFA 1M40A 5CTNA 3ZDJA 3BFCA 4LCMA 4D60A 4FH4A 2J9OA 3TE8A 2ZJ9A 2AWIA 1VEUA 2PYPA 5A92A 4DE2A 4X69A 3IWQA 3MKEA 1NJ4A 4CLCE 4F3LA 5TBMB 4MCWA 4PAUA 2JBFA 5FASA 4OP8A 2K7SA 3ZVWA 2XF3A 3LYXA 1LCCA 5L2FA 3DWKA 2VX8A 1UWPX 2XA7M 3ZHIA 4FSFA 2WK0A 4NG2A 4WEJA 1KDSA 2BASA 4B4XA 4BL2A 3E4QA 1DP9A 1EI5A 4JGQA 1YAXA 1DP6A 1LI9A 4B88A 3A9XA 3PR6A 2EX2A 1ES2A 3WS5A 1LMB3 3TELA 3G35A 1N9LA 4IBXA 1IEMA 2OAP1 4Z1WA 3NC8A 1ZHHB 2XD1A 3PYPA 5JYPA 2FZ0A 2GRMA 5F1FA 1XWRA 1GHMA 2Z6DA 4QY5A 4JGPA 1KGGA 1XPBA 4OPZA 5FQMA 2X02A 3BS3A 4KZBA 1OJ5A 4R38A 2FFFB 3T4JA 2WKHA 3IQAA 4OBMA 3JVUA 1PWDA 4EESA 2R9WA 1FR1A 4GS9B 1CK3A 1BLHA 4MN6A 4E04A 4PU4C 4KZ5A 5HX9A 3KSHA 2PYRA 5DRTA 1N4OA 3G34A 1S67L 4UA9A 2KEIA 3NIAA 4LRZE 2XR0A 4I38A 2EXAA 2PUDA 2ZC7A 3WRZA 1WA9A 4S2NA 1ONHA 3CWFA 3F1OB 2XDMA 3VFHA 5GL9A 5FQIA 1IELA 1D7EA 4FUWA 3GZCA 2Q0OA 5AQ7A 4XXRA 1TDLA 5GLCA 3NZLA 1PI5A 4LENA 2BLSA 2QHKA 1WETA 4YOFA 4NEED 3CITA 3LIDA 4ZAMA 1HQ1A 4B9OA 2GRLA 1IYOA 2GDNA 3VP2A 1OTDA 4HNBA 3LISA 2OLUA 2W3GA 4WZ4A 2WKIA 1W8QA 4R4SA 2XCJA 3P98A 2KX6A 4GHJA 3NDGA 4RYEA 4ZJ1A 3R09A 5FI6A 1SHVA 5CEDA 1AXBA 2JKRI 2W27A 3V5MA 1BDHA 2XGNA 3SH7A 3VOZA 1YM1A 5HDCA 4B93A 4P6BA 2UWXA 4KQOA 3SOIA 1RZRD 5D3OA 2BNMA 1PERL 3HBRA 4ZBEA 1F5MA 3GUUA 1P0ZA 3LR4A 5KIZA 4S2KA 4Y2FA 4PU3C 2PD7A 3IS2B 2D02A 2WUSR 4N1HA 2EX8A 3C38A 4PKYG 3S4XA 5BOHA 3LFPA 4ZJ3A 4JF4A 3W2ZA 2V1ZA 1W8YA 1MZUA 4RX3A 1HF0A 1RGYA 4I3AA 1XJ3A 1ZC2A 5IS1A 2VV8A 1NRFA 4I3JA 3JXBC 1HVBA 1I5QA 3G2YA 1YLPA 4ARZB 4WLAA 1QMEA 2J3TD 1J3WA 2E8IA 3UDXA 4Q2JA 1VEUB 2A49A 5DF7A 3A3JA 3L7HA 3VP4A 3TFLA 3IXGA 2LYPA 2PXPA 2PR5A 2Y2OA 4EUVA 4L9EA 4MCTA 2IV1A 2PIJA 1OTBA 2CC1A 2HV1A 3N8SA 2VGLS 4I6RA 1V9YA 1ESIA 5DTRA 4BMWA 2V0WA 5FQKA 2ZD8A 3IXBA 4UHUA 1ZPQA 1YKDA 2CSFA 4M3KA 3VE4A 2LLVA 1JFTA 3G5GA 2Y2LA 4X53A 5KSHA 1H5XA 5TFQA 3MJQA 1DY6A 3LI8A 1XFNA 3FYAA 2O38A 2W1TA 2Y91A 1DP8A 2XLNA 2M1CA 1QQAA 3TEPA 1OT6A 4LGWA 5AQAA 5FEFA 3PXPA 2J3TC 4I8TA 1LSXA 2B95A 5FSRA 3VSKA 3S7QA 3UN7A 2PDRA 3BFEA 4BLMA 3R7WA 1GA0A 5U47A 2XH9A 2A24B 1S6RA 4ETZA 4MLLA 3HUNA 5EVEA 5HFOA 3FMYA 3SH8A 4YG4A 4J1XA 2ZQDA 4EQZA 5HWTA 3BM6A 1XJ6A 3D9YA 2B18A 4G3VA 2XXPA 3MXQA 3E4OA 4S2NC 4DE0A 3C30A 4K91A 3ZHHA 1HLUP 2ZC6B 3GBFA 5AVFA 4P87A 1XGIA 4OPYA 4BBTA 1UGUA 1GHIA 1WYBA 2KLIA 4O01A 3NECA 4MNRA 4FH2A 4WZ5A 4ETXA 3MKFA 2ACGA 2D01A 2PXEA 3T12B 1KVMA 3BFFA 4BBVA 3ICYA 2NUTC 4X4GA 4WMCA 1MWTA 4S2LA 3GDIA 5DKLA 3QQ6A 1TF1A 5J4EA 4DF6A 3QOWA 4PMAA 2XJ3A 3FC7A 3VP3A 4S2PA 2O9AA 4F8DA 1CI8A 4D2OA 2FH5A 3QNCA 5FDSA 1S4SA 4M4XA 1EFAA 2HP5A 1WYCA 1ODVA 2VV6A 4Y0OA 4Z5DA 4K0WA 4ER5A 2VGKA 4LCLA 3N7WA 5E2FA 1S1YA 3KX0X 2V1AA 4H8RA 4OOLA 5CHJA 3B7HA 1ZZ9A 1IOUA 4YNRA 5GAGi 3HLEA 5EUAA 3GZDA 2WAFA 2KDKA 3A3IA 2IUOA 3CPTB 3ITAA 4NXBA 3OLOA 4CPKA 2J7WA 3UNWA 3PBOA 4A5RA 5EM0A 4JKTA 3ZCZA 2ZM0A 2J8YA 2VK3A 4JPMA 4DE8A 2JE5A 2Y2KA 1ZG6A 1TS6A 3LIBA 4RA7A 1UWNX 4YBAA 4EV4A 3ZG7B 4C3QA 1XP4A 4KZ3A 3LGOA 4KZ9A 4X4IA 2ZMVA 3FG8A 3HL9A 3N4IA 2J3WA 2Y2IA 3KZ3A 1KOUA 4HP4A 4O8GA 3AGEA 3BD1A 3FKVA 3JXCL 3GQZA 2CMNA 5I5LA 4RQ9A 2GZUA 3MQ0A 3QF3A 1M6KA 2M4HA 2J9PA 4GS9A 1GSWA 3Q82A 3WS0A 2H10A 3C4OA 3UY6A 4OVDA 2I9VA 2H0TA 4G3WA 5HWVA 3O86A 5G18A 3ZYTA 4IHQA 5FDHA 3U4LP 4OPRA 2WIUB 3QWGA 2V3CC 3IH9A 4GD6A 1ADRA 3EGDC 1PW1A 5CRFA 3Q07A 3EOIA 2JN7A 2XQZA 4BD0A 4E6XA 1LLBA 1YLTA 3GTCA 4MBHA 3HREA 5GHYA 2Y2JA 1L0GA 3W4PA 4WMCD 4NDWA 4X4EA 5CECA 1BULA 5HAPA 2W1TB 1NXYA 1BLSA 1L3LA 2HJ9C 3H7WA 4KZ8A 3TRBA 1WH6A 3VSLA 1MFQC 2W3EA 2PXVA 3LR0A 4RVAA 3A0VA 3A3EA 2ZOIA 3F51A 3OPPA 1YT4A 2AXVA 3R7WB 1SCWA 5DF8A 4DXBA 2J7VA 2CROA 3T4QA 4FD8A 3LICA 2EFXA 4S2MA 2RCXA 3JYIA 2WGIA 2WKEA 2K31A 2P7JA 1FILA 3EEAA 5EM1A 4E3IA 4WZ5C 2OAQ1 5IT5A 5EOEA 2C6WB 2HDQA 5A8BA 4GJ4A 1AWIA 1NRJA 2H28A 2HINA 3IBJA 3DW0A 3OKZA 2HZ5A 5HPFA 3NULA 3G7DA 3O88A 4P0MA 1GSXA 4X4BA 3NOPC 4PM9A 5DF9A 1K57A 3ZG5A 4EW7A 2HGVA 1X2LA 3PBNA 3CZDA 4KZ4A 2XK1A 1LSWA 4F94A 1SZVA 1KVLA 1C3BA 3GRJA 4EBNA 3Q1FA 1ZUGA 4UQIM 4U0XA 3DTKA 3QFIA 3H82A 1H8YA 1PYYA 1DJCA 3TSGA 3HLDA 1S66L 2KEJA 3GZDC 3I7JA 5GLDA 3C8CA 1RP5A 5EVLA 2ZQ9A 4NETA 2WZZA 3KSFA 5FQQA 1VM1A 3LR3A 1F2KA 1EWZA 3M9LA 3MFXA 4I39A 4X68A 2FFYA 4EKIA 2Y2MA 1UTXA 1PZPA 4DMZA 4L9GA 1RZRA 3OPRA 3OZHA 4MMNA 2PUAA 3R1FA 4U3TA 2H8RA 3NOUC 2BG1A 4DE3A 3ZQ5A 1ESUA 1MWSA 1T1AA 3NOTC 3V3SA 3MSHA 1WIZA 2JKGA 4YG1A 4HOIA 1OTIA 4MN7A 4ER6A 2O99A 2VA0A 1YPRA 5K98B 3GVBA 3QP1A 5A7LA 4KG6A 4IJGA 3WS4A 4EBPA 3CLOA 2Y2PA 4BD1A 1MXOA 3S8QA 4Y3IA 4KG5A 1CQTA 2M7UA 1NERA 4XT2B 3FYZA 3K2NA 2QYBA 5I94A 2HP9A 5KMWA 1ALQA 3HUMA 5FAQA 4JXSA 2XA7S 3WRTA 2QJ7A 5G4YA 4R4RA 1NZUA 2XD5A 2A24A 2Z2MB 2LLWA 2KZ8A 2VLGA 5DTKA 4JQDA 3B3XA 5CX7A 2JVLA 4MN5A 1H8MA 2ZM8A 1H3QA 2XI8A 3UMEA 3ZVTA 3FZCA 4GDNA 4U0TA 4JF5A 5F69A 4RX2A 5J8XA 3K3DA 4EBLA 1YQSA 2XIUA 4HJ3A 3DTEA 4P6ZM 3NXHA 5HDSA 4XUZA 4Y13A 2LCVA 3IT9A 1ERQA 4QHCA 4JF6A 3IH8A 2QKPA 2ZQ7A 2OSUA 1YSQA 3VP0A 4PM6A 4Y15A 1LSVA 5FA7A 1KDWA 3H7WB 4KQRA 2Z2LB 1LI0A 3EQUA 2LYKA 4LV2A 4KUKA 1VB6A 1SKFA 2IWCA 4HP9A 3MLFA 1XGJA 3L9KA 3KO6A 2WAEA 3S7OA 3VWSA 2PUCA 1BYWA 3HLWA 5HSQA 1K0KA 1E3OC 2PU2A 1DW9A 4J1WA 3M2JA 1CEGA 3NI9A 1Y4OA 3AGDA 1OMEA 4WBGA 1K4FA 1P97A 1W7FA 2O4AA 4HEFA 4LV3A 3CPTA 3MZDA 4X4FA 5DTSA 1YSPA 2XXQA 3F1NB 4K08A 3Q81A 2R9XA 3ZG8B 5DFYA 4Q8IA 3CI6A 4GD8A 1PRVA 4YARA 1K57C 2GJ3A 1LQCA 3NCKA 1ZZ7A 2JC7A 2HDUA 4I5SA 3NJAA 3UWPA 3DM5A 1T1BA 3SS4A 3UB8A 1GA9A 1JH9A 1JNUA 5DT2A 2EA9A 3P09A 4PM5A 4S2JA 1EROA 1K4EA 4XUXA 5HAIA 3RXWA 3OPLA 1JWVA 2V20A 4N1XA 3O9XA 4NKPA 2OFYA 3KL4A 2Y2GA 4QD4A 3FV7A 4N92A 5M1AA 2J80A 1MWRA 2KOIA 1QP7A 3H82B 1IC8A 4PHTA 3SCGA 3SH9A 3FPVA 2AVXA 1TEMA 2VGLM 4IEDA 2LYRA 3LO7A 1N9OA 3G2ZA 3G6OA 4IWRA 3BWLA 2DNSA 3T4TA 4X4CA 5E2HA 5GAHi 3OPHA 5C5KA 3OQOA 3VE3A 3V67A 1TDGA 5DSXA 4N9KA 1QZXA 2JKRM 4KZ6A 3LEQA 1PW8A 1FQGA 1NY0A 3BEBA 4EK9A 2AXZA 3UE6A 3PAGA 1ES5A 2BTFP 4JGOA 3CHWP 2VKSA 3DNVB 3HJKA 3OOVA 4OQ0A 4OPQA 4NXGA 3DTIA 4X55A 4GQMA 1H0MA 5FEGA 2DMWA 4O0PA 1PRAA 1YLZA 4EQIA 3D4FA 3N8RA 3CUEA 3Q7ZA 4IVIA 1LHYA 1L2SA 1TVFA 5F1GA 4OLGA 4QU3A 1WE4A 4JCXA 1A0KA 1NYMA 2JQEA 2ZQCA 4BWIA 4FN3A 4ER7A 1P9RA 5EVIA 1OSLA 1MY8A 4BBUA 1CJGA 2HCNA 1Z6FA 3BY8A 1F9IA 4OQIA 1ZZBA 1BTLA 4Z58A 1PZOA 4E3NA 1Z09A 3WWXA 3NDEA 2XEPA 1FCMA 3O5YA 5CERA 2OLVA 4KQDA 1T19A 2IA2A 2OOLA 2XSSA 1I2SA 4LV1A 2B02A 2RL3A 1ES3A 1GHPA 4ZJ2A 3U2AA 2HSGA 2G2WA 1NYYA 3UB6A 5GLAA 3CLCA 2PPXA 5M18A 1RGZA 4DN0A 2VGJA 1UXCA 3PBRA 3H5TA 4QPRA 3UB7A 1XKZA 1J9MA 2ZMAA 3NY4A 3Q7VB 2BNNA 3F1PB 2Y4AA 5DTMA 3ZKCA 1L1MA 1FSWA 2JKFA 2XXAA 4S2IA 1QMFA 3GV9A 5HD3A 1ES4A 1O07A 2EXBA 4GLQA 4X6TA 3W8KA 2IVBA 4R23A 2V8FA 4GZBA 2YKFA 3D72A 1S0WA 5FI7A 3LQXA 2QJ5A 3DWZA 3FPWA 1E25A 4OKPA 3F52A 3G31A 1K56D 1FCNA 5A91A 3MZEA 3C5AA 4K0XA 3P01A 4JBFA 5CTMA 3ZGAB 2WADA 3HCYA 3AGFA 3BECA 3IHAA 1FSYA 5GLBA 2LYSA 3BFGA 3LR5A 2EFUA 3QHYA 4WUJA 2PXQA 4GHIB 4NK3A 3S22A 3ZPXA 3ME5A 1BSGA 2MQKA 2HCSA 2GNXA 2ZQAA 5HARA 4DJ3A 4X1MA 1XX2A 1IYSA 2H5SA 1L0FA 4HIAA 5F6AA 1SDEA 3A0SA 5L09A 5JYOA 4PPRA 3C7UA 5F82A 2INWA 1D06A 3QP8A 5E2GA 3ZHMA 3OMTA 1FCOA 1W63M 3LY3A 4HH2A 2XFTA 4X4DA 2K2NA 4PU7A 2O9CA 4XT2A 5EVID 3G4PA 4QJGA 5FAPA 4Z59A 3VFFA 4OONA 3DAVA 2PXKA 5CGWA 4MBFA 2ZMFA 4HBTA 4R3AA 4EEUA 3OC2A 1VETA 4Y5FA 2EWTA 2B5AA 1PRQA 1QP4A 2WGVA 4PKYA 5EE8A 1KE4A 4GB7A 1YMXA 5GHXA 3D1NI 1SDNA 2XRNA 1X57A 4FCFA 2ZC3B 4C75A 2LYQA 3VK0A 3CUEC 1AU7A 4DRTA 1ZVVA 2PAVP 5DJUA 1ONGA 1SQ8A 2Y79A 3SX0A 3HLFA 4EU0A 5EV0A 3LUQA 5E43A 2Y2HA 5DVAA 5EVIC 5HPIA 2IU7A 3C2WA 3KYQA 2PXTA 5EVIB 2D5VA 1PRUA 4Y17A 2W3DA 3T1RA 2P08A 1G6OA 1K54A 4EUZA 3WS2A 2C5WB 4EKGA 2BJCA 2WYXA 4E3OA 1RPEL 2Z6CA 2W0NA 4O7DA 2ODRD 4QB8A 1BZAA 3JVVA 4Y42A 2WKPA 3NDBB 3SZTA 1K6RA 1N9NA 3F1NA 1LLIA 2FFHA 1R69A 4DDSA 1P9WA 3G30A 2JCGA 3MF0A 2O0YA 3V39A 3JPUA 1ZG4A 4HHDA 4NXFA 5DRYA 3PHYA 4GN2A 2LB5A 4HESA 2PU4A 3EEHA 1D1JA 2W3HA 5M19A 2ZBBA 4CLCA 5DTTA 3C4PA 3TOIA 3CROL 3RZZA 5DFXA 3QYXA 4JLFA 3OCLA 2W3FA 3KYZA 4WN5A 1LL8A 4Y0UA 1MKMA 3UFDA 1SKOA 4PM8A 2EF8A 3KJXA 1N9BA 1G5UA 1Q2PA 1NW3A 4YINA 2JKTI 4L9FA 1Q2QA 2MXDA 3BFDA 2ICTA 1PNRA 4WVLA 1IYQA 3BJNA 3NBLA 3SS3A 2PXFA 2YBDA 3PAEA 2ZC5B 3D3OA 4UQIS 3S7NA 3MBZA 1Y7YA 3ULFA 1MPLA 4YFMA 3ZG9B 3LIEA 5TJJA 2KPJA 2VV7A 4LRYC 1QPZA 1XXMA 1F98A 3EGXC 4UAAA 4BJPA 1GT0C 2PR6A 2XROA 4EEPA 2R63A 2PXUA 3UB9A 4EERA 5DKKA 1ZAYA 5FQ9A 2WZXA 4OQHA 5CGSA 4WF0A 4GW9A 4KG2A 3IXDA 5CGXA 4EWFA 3CAXA 5CEBA 4IVZA 3SS5A 4DDYA 2PXLA 3EWKA 3MQQA 3M6BA 1POUA 1VETB 2WGWB 2HDSA 2P9VA 5F68A 5K5BA 3BDNA 1PNEA 1LT0A 2XFSA 3UPPA 1JTGA 1VHMA 1DJBA 2MJ6A 3HUOA 3T4SA 1W63Q 2JKTM 3MMHA 4E3KA 3M2KA 5KZHA 4OP5A 5J3WA 2G2UA 3BYDA 3PTEA 3UDFA 4GCZA 4HI4A 3OBFA 2J7UA 1HTZA 4KUOA 3E4PA 1JWZA 4GOGA 4LRXC 1RIOA 4IVKA 4Z9QA 5FQJA 3JXDL 2PBYA 4ME4A 3IF6A 4JXVA 2PUFA 4Z5CA 4MCXA 4R0QA 5A93A 4CLCD 5HD5A 3Q7VA 4IUKA 4R1GA 1I2WA 3F1PA 3GSGA 5HDDA 5IHVA 3GN5B 2PBDP 1TD5A 3A9ZA 4EETB 3ZNYA 2HP6A 1K54C 1E3UD 3VV4A 2Y8HA 3ZG0A 5A90A 3TW8A 1Y28A 4H6JA 2PUGA 2DRWA 3IX8A 4P6ZS 1Y54A 3RH8B 1MWUA 2JCHA 5F83A 4P85A 4R3JA 2VEOA 4UEYA 3C7VA 1NZOA 3T4KA 3HLGA 3MFDA 3BQ8A 1OTEA 1XA7A 4DE9A 2Q9MA 1VPWA 4X4HA 1ERMA 4OLDA 4BENA 3IWIA 3E2LA 4LPZA 4GHIA 1HZOA 1KE0A 1IKGA 3W4QA 1W79A 2MEZA 3IVPA 3LEZA 3PBQA 3QP5A 1NWZA 2YKHA 3HLCA 1S1ZA 5TGFA 3PE5A 2V8CA 3EQVA 4CLCC 3LIFA 2ZL1A 4Y0TA 5IU1A 1TS7A 3VOYA 2OWHA 3IF5A 4EZIA 1K6SA 2P04A 3BQAA 3MEJA 1S4RA 1STZA 5EFWA 3T4LA 4CLCB 1PFLA 4IBRA 5HL1A 3T1XA 1EW0A 3UB5P 2ZOHA 4WYYA 3T1QB 3HLBA 2O9BA 2VZWA 3QOXA 4GKUA 5E2EA 4HY8A 5HZHA 1IFQA 1K55A 1SKOB 4CQHA 1K56A 3DBAA 2HDRA 3ISGA 5TR7A 1CI9A 5L10A 2R1JL 5L8MA 4KZ7A 4JXGA 2FJRA 1WH8A 4HQAA 1YLJA 4JGRA 1DJAA 4FOFA 2I72A 2OWJA 3SW1A 2W1RA 2PE5A 3A0RA 4S2OA 3UDIA 4HBUA 3UE1A 4PM7A 1L0DA 4DJ2A 3G0TA 5HW3A 5J7EA 4E3JA 4EXOA 3CECA 3BLMA 1L0EA 3P7NA 1YSEA 1JWLA 5FAOA 5CHMA 5FL3A 4F3LB 2VJWA 3RFBA 4OOYA 1BLCA 1YLYA 2EWWA 3RXXA 1XA1A 1G68A 3QP2A 2LB9A 3T50A 4DE1A 1ACFA 4ZRRA 1T18A 4LFUA 1YMSA 2Y2NA 4Q0JA 4GNUA 1KGEA 4E3MA 3IXHA 3CJMA 4WEKA 3ZFZA 1UXDA 1JVJA 2A6CA 5KSCA 1ZS4A 2L4RA 3MXSA 3G32A 1JWPA 5EPHA 3TRCA 2P9VB 4I6UA 3N8LA 3GR2A 5AVEA 2R78A 4BL3A 3IWOA 2XSDC 2V1BA 1DWKA 3MZFA 1B0NA 1CEFA 4WL9A 4KQQA 3B42A 1QQBA 1NLYA 2IVQA 3QP4A 4Q0HA 4ZTKA 1PIOA 2PRFA 2EX6A 3HJIA 3O87A 1NLZA 3QP6A 2UV0E 5AJGA 3IF6C 2JHEA 4E6WA 3TG9A 2LYJA 1FIKA 5F5YA 1OJGA 3IX3A 2NUPC 4X1LA 1R63A 3SCHA 3IF6B 4AFIA 2IWBA 4YWZA 3V3RA 5AQBA 4UA7A 1DULA 4IUHA 4HRAA 1OTAA 1CQAA 1W5DA 4JCYA 2WKRA 2PXBA 3E2KA 3ITBA 1ZZCA 2LYLA 1V9ZA 2X71A 4H6JB 4LLOB 1LCDA 2AUWA 3DTMA 5FATA 3UO9A 3F6WA 1OPXA 3MR0A 1PWCA 4E3LA 1LL5A 3MS6A 2EX9A 4ID4A 3VMAA 3V50A 4B4ZA 2OV5A 2HF6A 4WELA 4KZAA 2PXDA 2L1PA 4R70A 4G3KA 4ESPA 4QWOA 5DJTA 4FBIA 2E8JA 4Z5HA 2Y55A 2EBYA 2H0YA 3A3DA 3LCEA 3WS1A 3OCNA 2GX5A 5CHUA 4MDZA 2ZC4B 2A3UA 2QPNA 2Y2QA 4CJNA 2ZL1B 3B33A 4OOMA 5AQ9A 5TBMA 3UPOA 4ER3A 3BY9A 1BUEA 1S7EA 4OB4A 4GDBA 3S7PA 3W4OA 4O8BA 5CXWA 3LY4A 2O49A 4L0LA 1BDIA 1ZZ6A 3OP9A 3OWQA 3T4OA 5MC7A 2EWVA 1PI4A 3R4KA 3LIAA 1FOFA 2V9AA 1K55C 5HAQA 2QZ6A 5JUWA 2PUBA 1DRMA 4X56A 2L49A 2WUQA 2BNOA 5FI2A 3B47A 1CF0A 5DTQA 3MXRA 4Y7PA 3HZIB 3ZNTA 3UE0A 2HPBA 3GMWA 2L8NA 3CMZA 1GSVA 4MEZA 1TS8A 2WGWA 3CG5A 4DXCA 3S1YA 4FTXA 1VQQA 1Y9QA 3IX4A 1BLPA 1XJ2A 5HWWA 1FR6A 1MC0A 1G6AA 3IHBA 4BQMA 3KSGA 4KENB 1K25A 1IKIA 3EUSA 1ZTUA 1H8ZA
chains in the Genus database with same CATH topology
1P97A 3BJNA 4J1XA 2O4AA 5HWTA 3FYMA 4X4FA 4I6TA 1XJ6A 1YSPA 3D3OA 3SCFA 3F1NB 4K08A 4UQIS 3S7NA 4Q0IA 3MQOA 1Y7YA 2B18A 3ULFA 2WKQA 3MXQA 4G3VA 3E4OA 5DFYA 3C30A 2IVGA 3BW6A 1OT9A 3CI6A 3GBFA 5AVFA 5HL6A 2OR1L 4HH3A 1PRVA 4YARA 4BBTA 1UGUA 2GJ3A 1LQCA 2KLIA 2ICPA 4O01A 1ZZ7A 2AXUA 3LIEA 4I5SA 5TJJA 3NJAA 4ETXA 2KPJA 1T1BA 2VV7A 4R6LA 4LRYC 3UB8A 1QPZA 3GN5A 2D01A 1JH9A 1JNUA 5G4ZA 1F98A 3EGXC 4BJPA 2EA9A 3UE3A 2G7UA 5LBRA 4BBVA 3LFVA 1GT0C 3ICYA 3IBRA 2NUTC 2PR6A 4EEPA 4X4GA 2R63A 4HJ6A 2XROA 3L1PA 3UB9A 4EERA 3GDIA 3F1OA 5DKLA 3KXAA 3QQ6A 1ZAYA 5DKKA 1TF1A 2A2LA 4II7A 5J4EA 2M7VA 4I3IA 4WF0A 2XJ3A 3FC7A 3E0YA 3LI9A 4GW9A 3O9XA 4NKPA 2GZAA 2O9AA 2KEKA 4F8DA 3CAXA 2OFYA 4IVZA 1OCTC 2FH5A 2J80A 2KOIA 1QP7A 2AW6A 3H82B 1S4SA 1IC8A 4PHTA 3SCGA 3EWKA 2PD8A 3MQQA 1POUA 4M4XA 3FPVA 3U3WA 1EFAA 5F68A 2VGLM 2LYRA 1ODVA 1N9OA 4IA8A 2VV6A 5K5BA 3BDNA 3G6OA 4IWRA 4Z5DA 3BWLA 1LT0A 3T4TA 4X4CA 1VHMA 1ZZ8A 2MJ6A 5C5KA 3T4SA 3OQOA 1W63Q 1S1YA 1XFQA 2JKTM 2V1AA 3KX0X 3MMHA 3V67A 3VE3A 3GECA 2HJEA 4OOLA 3B7HA 1ZZ9A 1IOUA 2L0WA 5J3WA 4YNRA 2JKRM 2PHYA 2VEAA 1T1CA 4GCZA 4HI4A 1NEQA 1X0OA 2KDKA 3OQNA 3E98A 3OBFA 3PBSA 3UE6A 2IUOA 2AXZA 4KUOA 3E4PA 3K3CA 4NXBA 3OLOA 4JGOA 4LRXC 3UMDA 1RIOA 2VKSA 3PBOA 3JXDL 3DNVB 4NXEA 4ME4A 3HJKA 3OOVA 3TJZC 4YG7B 4Z5CA 2PUFA 4MCXA 4NXGA 1RZSA 4GQMA 4CLCD 2QWSA 5HD5A 4IUKA 3H9WA 2DMWA 4PU8A 4O0PA 1PRAA 3KSIA 3F1PA 4HJ4A 5HDDA 3OQMA 3GN5B 2PT7A 1TD5A 1TS0A 3PBTA 1TS6A 4EETB 3LIBA 1QP0A 1UWNX 3CUEA 3IS2A 3VV4A 2Y8HA 4YBAA 3TW8A 1Y28A 4H6JA 3RTYA 4X4IA 2PUGA 4JCXA 2ZMVA 3FG8A 4BWIA 4FN3A 1G28A 2J3WA 1O4XA 1P9RA 3KZ3A 2PUEA 1KOUA 2L1MA 1JFSA 4P6ZS 1OSLA 4HP4A 3RH8B 4BBUA 1CJGA 4O8GA 3BD1A 2V0UA 3VOLA 4UEYA 3JXCL 3T4KA 2CMNA 5I5LA 1XJ4A 3NHQA 4EQ1A 3BY8A 1F9IA 3BQ8A 1OTEA 4ARZA 4RQ9A 1ZZBA 2GZUA 3MQ0A 3QF3A 4Z58A 1VPWA 4X4HA 3TE8A 2AWIA 4GS9A 2PYPA 1GSWA 4LPZA 4GHIA 3O5YA 2I9VA 4G3WA 4KQDA 2MEZA 5HWVA 1T19A 2IA2A 2OOLA 2XSSA 3ZYTA 4IHQA 4CLCE 3IVPA 2B02A 4F3LA 5TBMB 2WIUB 3QWGA 3PBQA 1NWZA 2YKHA 1S1ZA 3EQVA 4MCWA 3U2AA 4CLCC 2HSGA 3LIFA 4PAUA 1ADRA 3EGDC 2K7SA 3UB6A 3CLCA 1LCCA 3LYXA 2PPXA 5IU1A 1TS7A 3EOIA 2JN7A 2OWHA 4DN0A 2P04A 2VX8A 1UWPX 3BQAA 2XA7M 3ZHIA 1S4RA 1STZA 1UXCA 4FSFA 4WEJA 5EFWA 3T4LA 4CLCB 2BASA 3PBRA 1EW0A 3E4QA 3H5TA 1DP9A 2ZOHA 4JGQA 1YAXA 4QPRA 3UB7A 4NDWA 1DP6A 4X4EA 2BNNA 2O9BA 3F1PB 3ZKCA 2VZWA 1L1MA 2W1TB 3PR6A 5HD3A 4HY8A 2HJ9C 4GLQA 3H7WA 5HZHA 3TRBA 1LMB3 1IFQA 2IVBA 1N9LA 1WH6A 2YKFA 2W3EA 3D72A 3LR0A 2QJ5A 3A0VA 4CQHA 2OAP1 3FPWA 4Z1WA 2ZOIA 3DBAA 3F52A 3F51A 1ZHHB 2AXVA 3R7WB 3PYPA 2R1JL 5L8MA 2FZ0A 2GRMA 1XWRA 2Z6DA 2FJRA 4JGPA 1WH8A 2CROA 3T4QA 3P01A 3BS3A 4HQAA 1OJ5A 3LICA 3HCYA 4JGRA 4FOFA 4R38A 2OWJA 3T4JA 3SW1A 2W1RA 2PE5A 3A0RA 2LYSA 3LR5A 3JVUA 4EESA 2K31A 2P7JA 4GS9B 4DJ2A 4WUJA 5J7EA 4GHIB 3EEAA 4EXOA 3CECA 2MQKA 3P7NA 1YSEA 1JWLA 4MN6A 4PU4C 4E04A 2OAQ1 5IT5A 3KSHA 2PYRA 5FL3A 4F3LB 2GNXA 4DJ3A 2VJWA 4HIAA 5F6AA 1S67L 3RFBA 5A8BA 4GJ4A 2KEIA 1NRJA 2H28A 3A0SA 4LRZE 2EWWA 2HINA 4I38A 3IBJA 2PUDA 1WA9A 5HPFA 3CWFA 3G7DA 2INWA 1D06A 2LB9A 1GSXA 4X4BA 3F1OB 3NOPC 5DF9A 3T50A 3ZHMA 3OMTA 1W63M 4ZRRA 4EW7A 1T18A 2HGVA 4HH2A 4X4DA 1X2LA 2K2NA 3PBNA 1D7EA 4Q0JA 4PU7A 2O9CA 1LSWA 4XT2A 4WEKA 1UXDA 2A6CA 4Z59A 2QHKA 1WETA 4YOFA 1ZUGA 4NEED 3CITA 4UQIM 3LIDA 1ZS4A 2L4RA 4B9OA 2GRLA 3TRCA 2ZMFA 4I6UA 5AVEA 3H82A 2R78A 4R3AA 4EEUA 2XSDC 2V1BA 3OC2A 1OTDA 1DWKA 4HNBA 1B0NA 1S66L 2KEJA 3LISA 4WL9A 2W3GA 3B42A 1QQBA 4Y5FA 2EWTA 2IVQA 1NLYA 4Q0HA 3C8CA 2B5AA 2XCJA 1QP4A 2KX6A 4PKYA 3HJIA 4GHJA 3KSFA 1NLZA 3LR3A 5AJGA 2JHEA 3MFXA 4I39A 2JKRI 2W27A 2LYJA 3D1NI 1UTXA 1BDHA 5F5YA 1OJGA 2XRNA 1X57A 2NUPC 5HDCA 1R63A 4B93A 4L9GA 4DMZA 1RZRA 3SCHA 2LYQA 4MMNA 2PUAA 4KQOA 3R1FA 1RZRD 3VK0A 2H8RA 3NOUC 4AFIA 2BNMA 1PERL 3CUEC 1AU7A 1F5MA 4YWZA 3ZQ5A 1ZVVA 1P0ZA 5DJUA 3LR4A 5KIZA 1SQ8A 1T1AA 2Y79A 3NOTC 4EU0A 3LUQA 4IUHA 1WIZA 1OTAA 4Y2FA 4YG1A 4HOIA 5HPIA 1OTIA 4PU3C 4JCYA 2PD7A 2WKRA 2IU7A 2D02A 3IS2B 4MN7A 2O99A 2VA0A 1ZZCA 5K98B 2LYLA 1V9ZA 5A7LA 2WUSR 3C2WA 4IJGA 3KYQA 3CLOA 1LCDA 3C38A 4H6JB 4LLOB 2AUWA 4PKYG 3LFPA 3S8QA 3F6WA 4Y3IA 1OPXA 3MR0A 1CQTA 2M7UA 1NERA 3W2ZA 4XT2B 3K2NA 1MZUA 2D5VA 2QYBA 1PRUA 2W3DA 1HF0A 2P08A 4I3AA 1XJ3A 5IS1A 1G6OA 2VV8A 4I3JA 3JXBC 2XA7S 2BJCA 4ARZB 1RPEL 2HF6A 2QJ7A 4WELA 2Z6CA 2W0NA 5G4YA 4WLAA 2J3TD 3JVVA 2A24A 4R70A 4Y42A 4G3KA 2WKPA 5DJTA 2KZ8A 4FBIA 2VLGA 4Z5HA 4JQDA 5CX7A 2JVLA 4MN5A 2EBYA 1H8MA 1N9NA 2LYPA 3OCNA 2GX5A 1H3QA 2XI8A 3UMEA 2PR5A 4MDZA 3F1NA 1LLIA 4EUVA 4L9EA 1R69A 4MCTA 2IV1A 5F69A 2PIJA 1OTBA 2HV1A 3K3DA 2VGLS 1P9WA 3B33A 4OOMA 2XIUA 5TBMA 4I6RA 3BY9A 4HJ3A 2JCGA 3MF0A 1S7EA 2O0YA 4P6ZM 4OB4A 1V9YA 5HDSA 4HHDA 4NXFA 3S7PA 4O8BA 2LCVA 4BMWA 2V0WA 2O49A 3PHYA 1BDIA 4L0LA 2LB5A 1ZZ6A 3OP9A 3EEHA 3T4OA 1ZPQA 1YKDA 2CSFA 2W3HA 5MC7A 2EWVA 3VE4A 2QKPA 1JFTA 3G5GA 2ZBBA 3R4KA 4CLCA 3LIAA 5KSHA 2V9AA 3MJQA 1YSQA 3LI8A 1LSVA 3CROL 1XFNA 3RZZA 3FYAA 2PUBA 2O38A 1DRMA 2W1TA 2L49A 1DP8A 3H7WB 5DFXA 3QYXA 2BNOA 2M1CA 3B47A 1QQAA 3OCLA 1OT6A 2LYKA 3EQUA 3HZIB 2W3FA 3PXPA 2J3TC 3KYZA 4I8TA 4WN5A 4KUKA 1LL8A 1LSXA 1VB6A 2L8NA 1GSVA 1MKMA 4HP9A 3UFDA 1TS8A 3MLFA 3S7QA 2PDRA 3KO6A 2EF8A 1Y9QA 3S7OA 3KJXA 3R7WA 2PUCA 1XJ2A 1BYWA 5HWWA 1MC0A 5HSQA 2JKTI 1E3OC 2A24B 4L9FA 1DW9A 4J1WA 4ETZA 3KSGA 3FMYA 4YG4A 3EUSA 1ZTUA 2ICTA 1PNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBA A;  4J1X A;  1LCD A;  2AUW A;  3LFP A;  2O4A A;  3FYM A;  3S8Q A;  4X4I A;  3F6W A;  4X4F A;  3CEC A;  2PUG A;  4JCX A;  4I6T A;  1CQT A;  2MQK A;  1NER A;  1YSE A;  4FN3 A;  3SCF A;  4PU4 C;  1JWL A;  1O4X A;  3KZ3 A;  1Y7Y A;  2D5V A;  1PRU A;  1JFS A;  2PUE A;  1OSL A;  2IVG A;  1HF0 A;  3GBF A;  1CJG A;  2OR1 L;  1PRV A;  3BD1 A;  4YAR A;  3JXB C;  1LQC A;  3JXC L;  2BJC A;  2KEI A;  2ICP A;  1RPE L;  1ZZ7 A;  2AXU A;  1ZZB A;  2GZU A;  2HIN A;  4Y42 A;  2KPJ A;  2PUD A;  1QPZ A;  2KZ8 A;  3GN5 A;  4FBI A;  1JH9 A;  3QF3 A;  4Z58 A;  1VPW A;  4Z5H A;  4X4H A;  4JQD A;  3G7D A;  2AWI A;  2JVL A;  2EBY A;  4X4B A;  1GT0 C;  4X4G A;  2R63 A;  3ZHM A;  3OMT A;  3L1P A;  3KXA A;  3QQ6 A;  1ZAY A;  2LYP A;  4X4D A;  1X2L A;  2XI8 A;  2MEZ A;  4PU7 A;  1LLI A;  2XJ3 A;  1R69 A;  3O9X A;  3IVP A;  4MCT A;  2IV1 A;  2PIJ A;  2KEK A;  4F8D A;  1UXD A;  2WIU B;  2OFY A;  3QWG A;  2A6C A;  4IVZ A;  4Z59 A;  1OCT C;  2XIU A;  2HSG A;  1WET A;  1ZUG A;  4I6R A;  1ADR A;  2JCG A;  1ZS4 A;  2AW6 A;  1QP7 A;  1S7E A;  3CLC A;  4OB4 A;  1LCC A;  2PPX A;  1IC8 A;  2GRL A;  3SCG A;  4I6U A;  4O8B A;  2LCV A;  1POU A;  2O49 A;  1BDI A;  3U3W A;  1EFA A;  2XSD C;  1ZZ6 A;  3OP9 A;  2LYR A;  1DWK A;  1B0N A;  1ZPQ A;  3ZHI A;  2KEJ A;  1UXC A;  2CSF A;  3LIS A;  4IA8 A;  3BDN A;  4IWR A;  4Z5D A;  1QQB A;  2EWT A;  2IVQ A;  3G5G A;  1JFT A;  3H5T A;  4X4C A;  1ZZ8 A;  2B5A A;  2XCJ A;  4NDW A;  1QP4 A;  3OQO A;  4X4E A;  2BNN A;  4GHJ A;  3ZKC A;  3CRO L;  1L1M A;  3RZZ A;  3B7H A;  1ZZ9 A;  3FYA A;  2O38 A;  2PUB A;  5K98 B;  2L49 A;  3QYX A;  2BNO A;  1NEQ A;  5A7L A;  3OQN A;  1QQA A;  2LYK A;  2LYJ A;  3TRB A;  1LMB 3;  2IVB A;  3HZI B;  1UTX A;  3D1N I;  1WH6 A;  1BDH A;  2IUO A;  2AXZ A;  3PXP A;  1X57 A;  4I8T A;  1R63 A;  2L8N A;  1RZR A;  3SCH A;  2LYQ A;  3UFD A;  2PUA A;  3F52 A;  3F51 A;  3MLF A;  3R1F A;  1RIO A;  1RZR D;  3VK0 A;  3JXD L;  3DNV B;  2H8R A;  2AXV A;  2BNM A;  1PER L;  2R1J L;  2EF8 A;  2GRM A;  1Y9Q A;  1AU7 A;  4YG7 B;  4Z5C A;  1XWR A;  3KJX A;  4MCX A;  1ZVV A;  1RZS A;  2FJR A;  2PUC A;  2PUF A;  4GQM A;  1SQ8 A;  1WH8 A;  2CRO A;  3BS3 A;  4PU8 A;  1PRA A;  1E3O C;  1DW9 A;  4J1W A;  1WIZ A;  1QP0 A;  3OQM A;  3GN5 B;  4YG1 A;  2PE5 A;  3FMY A;  2LYS A;  4PU3 C;  4JCY A;  2IU7 A;  4YG4 A;  3EUS A;  2ICT A;  1PNR A;  1ZZC A;  2LYL A;  2WUS R; 
#chains in the Genus database with same CATH topology
 4WM9 A;  3UPN A;  3VP1 A;  3FYM A;  1K38 A;  1O7E A;  4I6T A;  3BRM A;  1GCE A;  3SCF A;  2QMI A;  2ZQ8 A;  4Q0I A;  3MQO A;  2WKQ A;  2IVG A;  3BW6 A;  1MBL A;  1OT9 A;  5HL6 A;  2OR1 L;  4HH3 A;  2IWD A;  2ICP A;  1YLW A;  4ZDX A;  2AXU A;  5EEC A;  4DKI A;  1ZKJ A;  3BLS A;  4X25 A;  4R6L A;  2HFZ A;  5GHZ A;  3GN5 A;  4LV0 A;  5G4Z A;  4N9L A;  2P74 A;  3RJU A;  2G7U A;  1RCJ A;  5LBR A;  3LFV A;  3UE3 A;  3IBR A;  4HJ6 A;  4R3B A;  3L1P A;  4QY6 A;  3F1O A;  3KXA A;  3HVF A;  2A2L A;  4II7 A;  2M7V A;  4I3I A;  3N6I A;  1U2Z A;  2B5R A;  3E0Y A;  3NRO A;  3LI9 A;  2GZA A;  2KEK A;  1OCT C;  1HD8 A;  2AW6 A;  3QNB A;  2PD8 A;  3U3W A;  2ZM2 A;  4MBK A;  4IA8 A;  4OH0 A;  1ZZ8 A;  3A9Y A;  1XFQ A;  2X01 A;  3GEC A;  2HJE A;  2LNM A;  2Y59 A;  1MKI A;  2L0W A;  2PHY A;  2VEA A;  1T1C A;  1NEQ A;  1X0O A;  3E98 A;  3OQN A;  3SR4 A;  2V2F F;  3PBS A;  1KE3 A;  1KGF A;  1PWG A;  3K3C A;  4ER0 A;  4JXW A;  3FKW A;  5L07 A;  3UMD A;  3FWL A;  4NXE A;  3KYE A;  3TJZ C;  1IYP A;  4YG7 B;  1RZS A;  2QWS A;  3H9W A;  3O3V A;  4PU8 A;  2ZLY A;  1E4D A;  3KSI A;  2Q9N A;  1BT5 A;  1JTD A;  4HJ4 A;  3OQM A;  1LL9 A;  2PT7 A;  1TS0 A;  3PBT A;  1E3U A;  1QP0 A;  3IS2 A;  4C6Y A;  4UA6 A;  1QB2 A;  3RTY A;  1CJF A;  4OQG A;  1U60 A;  3A3F A;  1G28 A;  1O4X A;  2PUE A;  2L1M A;  1JFS A;  3T1S A;  5EOO A;  2V0U A;  3VOL A;  3M6H A;  1XJ4 A;  3NHQ A;  4EQ1 A;  4ARZ A;  2DCF A;  1M40 A;  5CTN A;  3ZDJ A;  3BFC A;  4LCM A;  4D60 A;  4FH4 A;  2J9O A;  3TE8 A;  2ZJ9 A;  2AWI A;  1VEU A;  2PYP A;  5A92 A;  4DE2 A;  4X69 A;  3IWQ A;  3MKE A;  1NJ4 A;  4CLC E;  4F3L A;  5TBM B;  4MCW A;  4PAU A;  2JBF A;  5FAS A;  4OP8 A;  2K7S A;  3ZVW A;  2XF3 A;  3LYX A;  1LCC A;  5L2F A;  3DWK A;  2VX8 A;  1UWP X;  2XA7 M;  3ZHI A;  4FSF A;  2WK0 A;  4NG2 A;  4WEJ A;  1KDS A;  2BAS A;  4B4X A;  4BL2 A;  3E4Q A;  1DP9 A;  1EI5 A;  4JGQ A;  1YAX A;  1DP6 A;  1LI9 A;  4B88 A;  3A9X A;  3PR6 A;  2EX2 A;  1ES2 A;  3WS5 A;  1LMB 3;  3TEL A;  3G35 A;  1N9L A;  4IBX A;  1IEM A;  2OAP 1;  4Z1W A;  3NC8 A;  1ZHH B;  2XD1 A;  3PYP A;  5JYP A;  2FZ0 A;  2GRM A;  5F1F A;  1XWR A;  1GHM A;  2Z6D A;  4QY5 A;  4JGP A;  1KGG A;  1XPB A;  4OPZ A;  5FQM A;  2X02 A;  3BS3 A;  4KZB A;  1OJ5 A;  4R38 A;  2FFF B;  3T4J A;  2WKH A;  3IQA A;  4OBM A;  3JVU A;  1PWD A;  4EES A;  2R9W A;  1FR1 A;  4GS9 B;  1CK3 A;  1BLH A;  4MN6 A;  4E04 A;  4PU4 C;  4KZ5 A;  5HX9 A;  3KSH A;  2PYR A;  5DRT A;  1N4O A;  3G34 A;  1S67 L;  4UA9 A;  2KEI A;  3NIA A;  4LRZ E;  2XR0 A;  4I38 A;  2EXA A;  2PUD A;  2ZC7 A;  3WRZ A;  1WA9 A;  4S2N A;  1ONH A;  3CWF A;  3F1O B;  2XDM A;  3VFH A;  5GL9 A;  5FQI A;  1IEL A;  1D7E A;  4FUW A;  3GZC A;  2Q0O A;  5AQ7 A;  4XXR A;  1TDL A;  5GLC A;  3NZL A;  1PI5 A;  4LEN A;  2BLS A;  2QHK A;  1WET A;  4YOF A;  4NEE D;  3CIT A;  3LID A;  4ZAM A;  1HQ1 A;  4B9O A;  2GRL A;  1IYO A;  2GDN A;  3VP2 A;  1OTD A;  4HNB A;  3LIS A;  2OLU A;  2W3G A;  4WZ4 A;  2WKI A;  1W8Q A;  4R4S A;  2XCJ A;  3P98 A;  2KX6 A;  4GHJ A;  3NDG A;  4RYE A;  4ZJ1 A;  3R09 A;  5FI6 A;  1SHV A;  5CED A;  1AXB A;  2JKR I;  2W27 A;  3V5M A;  1BDH A;  2XGN A;  3SH7 A;  3VOZ A;  1YM1 A;  5HDC A;  4B93 A;  4P6B A;  2UWX A;  4KQO A;  3SOI A;  1RZR D;  5D3O A;  2BNM A;  1PER L;  3HBR A;  4ZBE A;  1F5M A;  3GUU A;  1P0Z A;  3LR4 A;  5KIZ A;  4S2K A;  4Y2F A;  4PU3 C;  2PD7 A;  3IS2 B;  2D02 A;  2WUS R;  4N1H A;  2EX8 A;  3C38 A;  4PKY G;  3S4X A;  5BOH A;  3LFP A;  4ZJ3 A;  4JF4 A;  3W2Z A;  2V1Z A;  1W8Y A;  1MZU A;  4RX3 A;  1HF0 A;  1RGY A;  4I3A A;  1XJ3 A;  1ZC2 A;  5IS1 A;  2VV8 A;  1NRF A;  4I3J A;  3JXB C;  1HVB A;  1I5Q A;  3G2Y A;  1YLP A;  4ARZ B;  4WLA A;  1QME A;  2J3T D;  1J3W A;  2E8I A;  3UDX A;  4Q2J A;  1VEU B;  2A49 A;  5DF7 A;  3A3J A;  3L7H A;  3VP4 A;  3TFL A;  3IXG A;  2LYP A;  2PXP A;  2PR5 A;  2Y2O A;  4EUV A;  4L9E A;  4MCT A;  2IV1 A;  2PIJ A;  1OTB A;  2CC1 A;  2HV1 A;  3N8S A;  2VGL S;  4I6R A;  1V9Y A;  1ESI A;  5DTR A;  4BMW A;  2V0W A;  5FQK A;  2ZD8 A;  3IXB A;  4UHU A;  1ZPQ A;  1YKD A;  2CSF A;  4M3K A;  3VE4 A;  2LLV A;  1JFT A;  3G5G A;  2Y2L A;  4X53 A;  5KSH A;  1H5X A;  5TFQ A;  3MJQ A;  1DY6 A;  3LI8 A;  1XFN A;  3FYA A;  2O38 A;  2W1T A;  2Y91 A;  1DP8 A;  2XLN A;  2M1C A;  1QQA A;  3TEP A;  1OT6 A;  4LGW A;  5AQA A;  5FEF A;  3PXP A;  2J3T C;  4I8T A;  1LSX A;  2B95 A;  5FSR A;  3VSK A;  3S7Q A;  3UN7 A;  2PDR A;  3BFE A;  4BLM A;  3R7W A;  1GA0 A;  5U47 A;  2XH9 A;  2A24 B;  1S6R A;  4ETZ A;  4MLL A;  3HUN A;  5EVE A;  5HFO A;  3FMY A;  3SH8 A;  4YG4 A;  4J1X A;  2ZQD A;  4EQZ A;  5HWT A;  3BM6 A;  1XJ6 A;  3D9Y A;  2B18 A;  4G3V A;  2XXP A;  3MXQ A;  3E4O A;  4S2N C;  4DE0 A;  3C30 A;  4K91 A;  3ZHH A;  1HLU P;  2ZC6 B;  3GBF A;  5AVF A;  4P87 A;  1XGI A;  4OPY A;  4BBT A;  1UGU A;  1GHI A;  1WYB A;  2KLI A;  4O01 A;  3NEC A;  4MNR A;  4FH2 A;  4WZ5 A;  4ETX A;  3MKF A;  2ACG A;  2D01 A;  2PXE A;  3T12 B;  1KVM A;  3BFF A;  4BBV A;  3ICY A;  2NUT C;  4X4G A;  4WMC A;  1MWT A;  4S2L A;  3GDI A;  5DKL A;  3QQ6 A;  1TF1 A;  5J4E A;  4DF6 A;  3QOW A;  4PMA A;  2XJ3 A;  3FC7 A;  3VP3 A;  4S2P A;  2O9A A;  4F8D A;  1CI8 A;  4D2O A;  2FH5 A;  3QNC A;  5FDS A;  1S4S A;  4M4X A;  1EFA A;  2HP5 A;  1WYC A;  1ODV A;  2VV6 A;  4Y0O A;  4Z5D A;  4K0W A;  4ER5 A;  2VGK A;  4LCL A;  3N7W A;  5E2F A;  1S1Y A;  3KX0 X;  2V1A A;  4H8R A;  4OOL A;  5CHJ A;  3B7H A;  1ZZ9 A;  1IOU A;  4YNR A;  5GAG i;  3HLE A;  5EUA A;  3GZD A;  2WAF A;  2KDK A;  3A3I A;  2IUO A;  3CPT B;  3ITA A;  4NXB A;  3OLO A;  4CPK A;  2J7W A;  3UNW A;  3PBO A;  4A5R A;  5EM0 A;  4JKT A;  3ZCZ A;  2ZM0 A;  2J8Y A;  2VK3 A;  4JPM A;  4DE8 A;  2JE5 A;  2Y2K A;  1ZG6 A;  1TS6 A;  3LIB A;  4RA7 A;  1UWN X;  4YBA A;  4EV4 A;  3ZG7 B;  4C3Q A;  1XP4 A;  4KZ3 A;  3LGO A;  4KZ9 A;  4X4I A;  2ZMV A;  3FG8 A;  3HL9 A;  3N4I A;  2J3W A;  2Y2I A;  3KZ3 A;  1KOU A;  4HP4 A;  4O8G A;  3AGE A;  3BD1 A;  3FKV A;  3JXC L;  3GQZ A;  2CMN A;  5I5L A;  4RQ9 A;  2GZU A;  3MQ0 A;  3QF3 A;  1M6K A;  2M4H A;  2J9P A;  4GS9 A;  1GSW A;  3Q82 A;  3WS0 A;  2H10 A;  3C4O A;  3UY6 A;  4OVD A;  2I9V A;  2H0T A;  4G3W A;  5HWV A;  3O86 A;  5G18 A;  3ZYT A;  4IHQ A;  5FDH A;  3U4L P;  4OPR A;  2WIU B;  3QWG A;  2V3C C;  3IH9 A;  4GD6 A;  1ADR A;  3EGD C;  1PW1 A;  5CRF A;  3Q07 A;  3EOI A;  2JN7 A;  2XQZ A;  4BD0 A;  4E6X A;  1LLB A;  1YLT A;  3GTC A;  4MBH A;  3HRE A;  5GHY A;  2Y2J A;  1L0G A;  3W4P A;  4WMC D;  4NDW A;  4X4E A;  5CEC A;  1BUL A;  5HAP A;  2W1T B;  1NXY A;  1BLS A;  1L3L A;  2HJ9 C;  3H7W A;  4KZ8 A;  3TRB A;  1WH6 A;  3VSL A;  1MFQ C;  2W3E A;  2PXV A;  3LR0 A;  4RVA A;  3A0V A;  3A3E A;  2ZOI A;  3F51 A;  3OPP A;  1YT4 A;  2AXV A;  3R7W B;  1SCW A;  5DF8 A;  4DXB A;  2J7V A;  2CRO A;  3T4Q A;  4FD8 A;  3LIC A;  2EFX A;  4S2M A;  2RCX A;  3JYI A;  2WGI A;  2WKE A;  2K31 A;  2P7J A;  1FIL A;  3EEA A;  5EM1 A;  4E3I A;  4WZ5 C;  2OAQ 1;  5IT5 A;  5EOE A;  2C6W B;  2HDQ A;  5A8B A;  4GJ4 A;  1AWI A;  1NRJ A;  2H28 A;  2HIN A;  3IBJ A;  3DW0 A;  3OKZ A;  2HZ5 A;  5HPF A;  3NUL A;  3G7D A;  3O88 A;  4P0M A;  1GSX A;  4X4B A;  3NOP C;  4PM9 A;  5DF9 A;  1K57 A;  3ZG5 A;  4EW7 A;  2HGV A;  1X2L A;  3PBN A;  3CZD A;  4KZ4 A;  2XK1 A;  1LSW A;  4F94 A;  1SZV A;  1KVL A;  1C3B A;  3GRJ A;  4EBN A;  3Q1F A;  1ZUG A;  4UQI M;  4U0X A;  3DTK A;  3QFI A;  3H82 A;  1H8Y A;  1PYY A;  1DJC A;  3TSG A;  3HLD A;  1S66 L;  2KEJ A;  3GZD C;  3I7J A;  5GLD A;  3C8C A;  1RP5 A;  5EVL A;  2ZQ9 A;  4NET A;  2WZZ A;  3KSF A;  5FQQ A;  1VM1 A;  3LR3 A;  1F2K A;  1EWZ A;  3M9L A;  3MFX A;  4I39 A;  4X68 A;  2FFY A;  4EKI A;  2Y2M A;  1UTX A;  1PZP A;  4DMZ A;  4L9G A;  1RZR A;  3OPR A;  3OZH A;  4MMN A;  2PUA A;  3R1F A;  4U3T A;  2H8R A;  3NOU C;  2BG1 A;  4DE3 A;  3ZQ5 A;  1ESU A;  1MWS A;  1T1A A;  3NOT C;  3V3S A;  3MSH A;  1WIZ A;  2JKG A;  4YG1 A;  4HOI A;  1OTI A;  4MN7 A;  4ER6 A;  2O99 A;  2VA0 A;  1YPR A;  5K98 B;  3GVB A;  3QP1 A;  5A7L A;  4KG6 A;  4IJG A;  3WS4 A;  4EBP A;  3CLO A;  2Y2P A;  4BD1 A;  1MXO A;  3S8Q A;  4Y3I A;  4KG5 A;  1CQT A;  2M7U A;  1NER A;  4XT2 B;  3FYZ A;  3K2N A;  2QYB A;  5I94 A;  2HP9 A;  5KMW A;  1ALQ A;  3HUM A;  5FAQ A;  4JXS A;  2XA7 S;  3WRT A;  2QJ7 A;  5G4Y A;  4R4R A;  1NZU A;  2XD5 A;  2A24 A;  2Z2M B;  2LLW A;  2KZ8 A;  2VLG A;  5DTK A;  4JQD A;  3B3X A;  5CX7 A;  2JVL A;  4MN5 A;  1H8M A;  2ZM8 A;  1H3Q A;  2XI8 A;  3UME A;  3ZVT A;  3FZC A;  4GDN A;  4U0T A;  4JF5 A;  5F69 A;  4RX2 A;  5J8X A;  3K3D A;  4EBL A;  1YQS A;  2XIU A;  4HJ3 A;  3DTE A;  4P6Z M;  3NXH A;  5HDS A;  4XUZ A;  4Y13 A;  2LCV A;  3IT9 A;  1ERQ A;  4QHC A;  4JF6 A;  3IH8 A;  2QKP A;  2ZQ7 A;  2OSU A;  1YSQ A;  3VP0 A;  4PM6 A;  4Y15 A;  1LSV A;  5FA7 A;  1KDW A;  3H7W B;  4KQR A;  2Z2L B;  1LI0 A;  3EQU A;  2LYK A;  4LV2 A;  4KUK A;  1VB6 A;  1SKF A;  2IWC A;  4HP9 A;  3MLF A;  1XGJ A;  3L9K A;  3KO6 A;  2WAE A;  3S7O A;  3VWS A;  2PUC A;  1BYW A;  3HLW A;  5HSQ A;  1K0K A;  1E3O C;  2PU2 A;  1DW9 A;  4J1W A;  3M2J A;  1CEG A;  3NI9 A;  1Y4O A;  3AGD A;  1OME A;  4WBG A;  1K4F A;  1P97 A;  1W7F A;  2O4A A;  4HEF A;  4LV3 A;  3CPT A;  3MZD A;  4X4F A;  5DTS A;  1YSP A;  2XXQ A;  3F1N B;  4K08 A;  3Q81 A;  2R9X A;  3ZG8 B;  5DFY A;  4Q8I A;  3CI6 A;  4GD8 A;  1PRV A;  4YAR A;  1K57 C;  2GJ3 A;  1LQC A;  3NCK A;  1ZZ7 A;  2JC7 A;  2HDU A;  4I5S A;  3NJA A;  3UWP A;  3DM5 A;  1T1B A;  3SS4 A;  3UB8 A;  1GA9 A;  1JH9 A;  1JNU A;  5DT2 A;  2EA9 A;  3P09 A;  4PM5 A;  4S2J A;  1ERO A;  1K4E A;  4XUX A;  5HAI A;  3RXW A;  3OPL A;  1JWV A;  2V20 A;  4N1X A;  3O9X A;  4NKP A;  2OFY A;  3KL4 A;  2Y2G A;  4QD4 A;  3FV7 A;  4N92 A;  5M1A A;  2J80 A;  1MWR A;  2KOI A;  1QP7 A;  3H82 B;  1IC8 A;  4PHT A;  3SCG A;  3SH9 A;  3FPV A;  2AVX A;  1TEM A;  2VGL M;  4IED A;  2LYR A;  3LO7 A;  1N9O A;  3G2Z A;  3G6O A;  4IWR A;  3BWL A;  2DNS A;  3T4T A;  4X4C A;  5E2H A;  5GAH i;  3OPH A;  5C5K A;  3OQO A;  3VE3 A;  3V67 A;  1TDG A;  5DSX A;  4N9K A;  1QZX A;  2JKR M;  4KZ6 A;  3LEQ A;  1PW8 A;  1FQG A;  1NY0 A;  3BEB A;  4EK9 A;  2AXZ A;  3UE6 A;  3PAG A;  1ES5 A;  2BTF P;  4JGO A;  3CHW P;  2VKS A;  3DNV B;  3HJK A;  3OOV A;  4OQ0 A;  4OPQ A;  4NXG A;  3DTI A;  4X55 A;  4GQM A;  1H0M A;  5FEG A;  2DMW A;  4O0P A;  1PRA A;  1YLZ A;  4EQI A;  3D4F A;  3N8R A;  3CUE A;  3Q7Z A;  4IVI A;  1LHY A;  1L2S A;  1TVF A;  5F1G A;  4OLG A;  4QU3 A;  1WE4 A;  4JCX A;  1A0K A;  1NYM A;  2JQE A;  2ZQC A;  4BWI A;  4FN3 A;  4ER7 A;  1P9R A;  5EVI A;  1OSL A;  1MY8 A;  4BBU A;  1CJG A;  2HCN A;  1Z6F A;  3BY8 A;  1F9I A;  4OQI A;  1ZZB A;  1BTL A;  4Z58 A;  1PZO A;  4E3N A;  1Z09 A;  3WWX A;  3NDE A;  2XEP A;  1FCM A;  3O5Y A;  5CER A;  2OLV A;  4KQD A;  1T19 A;  2IA2 A;  2OOL A;  2XSS A;  1I2S A;  4LV1 A;  2B02 A;  2RL3 A;  1ES3 A;  1GHP A;  4ZJ2 A;  3U2A A;  2HSG A;  2G2W A;  1NYY A;  3UB6 A;  5GLA A;  3CLC A;  2PPX A;  5M18 A;  1RGZ A;  4DN0 A;  2VGJ A;  1UXC A;  3PBR A;  3H5T A;  4QPR A;  3UB7 A;  1XKZ A;  1J9M A;  2ZMA A;  3NY4 A;  3Q7V B;  2BNN A;  3F1P B;  2Y4A A;  5DTM A;  3ZKC A;  1L1M A;  1FSW A;  2JKF A;  2XXA A;  4S2I A;  1QMF A;  3GV9 A;  5HD3 A;  1ES4 A;  1O07 A;  2EXB A;  4GLQ A;  4X6T A;  3W8K A;  2IVB A;  4R23 A;  2V8F A;  4GZB A;  2YKF A;  3D72 A;  1S0W A;  5FI7 A;  3LQX A;  2QJ5 A;  3DWZ A;  3FPW A;  1E25 A;  4OKP A;  3F52 A;  3G31 A;  1K56 D;  1FCN A;  5A91 A;  3MZE A;  3C5A A;  4K0X A;  3P01 A;  4JBF A;  5CTM A;  3ZGA B;  2WAD A;  3HCY A;  3AGF A;  3BEC A;  3IHA A;  1FSY A;  5GLB A;  2LYS A;  3BFG A;  3LR5 A;  2EFU A;  3QHY A;  4WUJ A;  2PXQ A;  4GHI B;  4NK3 A;  3S22 A;  3ZPX A;  3ME5 A;  1BSG A;  2MQK A;  2HCS A;  2GNX A;  2ZQA A;  5HAR A;  4DJ3 A;  4X1M A;  1XX2 A;  1IYS A;  2H5S A;  1L0F A;  4HIA A;  5F6A A;  1SDE A;  3A0S A;  5L09 A;  5JYO A;  4PPR A;  3C7U A;  5F82 A;  2INW A;  1D06 A;  3QP8 A;  5E2G A;  3ZHM A;  3OMT A;  1FCO A;  1W63 M;  3LY3 A;  4HH2 A;  2XFT A;  4X4D A;  2K2N A;  4PU7 A;  2O9C A;  4XT2 A;  5EVI D;  3G4P A;  4QJG A;  5FAP A;  4Z59 A;  3VFF A;  4OON A;  3DAV A;  2PXK A;  5CGW A;  4MBF A;  2ZMF A;  4HBT A;  4R3A A;  4EEU A;  3OC2 A;  1VET A;  4Y5F A;  2EWT A;  2B5A A;  1PRQ A;  1QP4 A;  2WGV A;  4PKY A;  5EE8 A;  1KE4 A;  4GB7 A;  1YMX A;  5GHX A;  3D1N I;  1SDN A;  2XRN A;  1X57 A;  4FCF A;  2ZC3 B;  4C75 A;  2LYQ A;  3VK0 A;  3CUE C;  1AU7 A;  4DRT A;  1ZVV A;  2PAV P;  5DJU A;  1ONG A;  1SQ8 A;  2Y79 A;  3SX0 A;  3HLF A;  4EU0 A;  5EV0 A;  3LUQ A;  5E43 A;  2Y2H A;  5DVA A;  5EVI C;  5HPI A;  2IU7 A;  3C2W A;  3KYQ A;  2PXT A;  5EVI B;  2D5V A;  1PRU A;  4Y17 A;  2W3D A;  3T1R A;  2P08 A;  1G6O A;  1K54 A;  4EUZ A;  3WS2 A;  2C5W B;  4EKG A;  2BJC A;  2WYX A;  4E3O A;  1RPE L;  2Z6C A;  2W0N A;  4O7D A;  2ODR D;  4QB8 A;  1BZA A;  3JVV A;  4Y42 A;  2WKP A;  3NDB B;  3SZT A;  1K6R A;  1N9N A;  3F1N A;  1LLI A;  2FFH A;  1R69 A;  4DDS A;  1P9W A;  3G30 A;  2JCG A;  3MF0 A;  2O0Y A;  3V39 A;  3JPU A;  1ZG4 A;  4HHD A;  4NXF A;  5DRY A;  3PHY A;  4GN2 A;  2LB5 A;  4HES A;  2PU4 A;  3EEH A;  1D1J A;  2W3H A;  5M19 A;  2ZBB A;  4CLC A;  5DTT A;  3C4P A;  3TOI A;  3CRO L;  3RZZ A;  5DFX A;  3QYX A;  4JLF A;  3OCL A;  2W3F A;  3KYZ A;  4WN5 A;  1LL8 A;  4Y0U A;  1MKM A;  3UFD A;  1SKO A;  4PM8 A;  2EF8 A;  3KJX A;  1N9B A;  1G5U A;  1Q2P A;  1NW3 A;  4YIN A;  2JKT I;  4L9F A;  1Q2Q A;  2MXD A;  3BFD A;  2ICT A;  1PNR A;  4WVL A;  1IYQ A;  3BJN A;  3NBL A;  3SS3 A;  2PXF A;  2YBD A;  3PAE A;  2ZC5 B;  3D3O A;  4UQI S;  3S7N A;  3MBZ A;  1Y7Y A;  3ULF A;  1MPL A;  4YFM A;  3ZG9 B;  3LIE A;  5TJJ A;  2KPJ A;  2VV7 A;  4LRY C;  1QPZ A;  1XXM A;  1F98 A;  3EGX C;  4UAA A;  4BJP A;  1GT0 C;  2PR6 A;  2XRO A;  4EEP A;  2R63 A;  2PXU A;  3UB9 A;  4EER A;  5DKK A;  1ZAY A;  5FQ9 A;  2WZX A;  4OQH A;  5CGS A;  4WF0 A;  4GW9 A;  4KG2 A;  3IXD A;  5CGX A;  4EWF A;  3CAX A;  5CEB A;  4IVZ A;  3SS5 A;  4DDY A;  2PXL A;  3EWK A;  3MQQ A;  3M6B A;  1POU A;  1VET B;  2WGW B;  2HDS A;  2P9V A;  5F68 A;  5K5B A;  3BDN A;  1PNE A;  1LT0 A;  2XFS A;  3UPP A;  1JTG A;  1VHM A;  1DJB A;  2MJ6 A;  3HUO A;  3T4S A;  1W63 Q;  2JKT M;  3MMH A;  4E3K A;  3M2K A;  5KZH A;  4OP5 A;  5J3W A;  2G2U A;  3BYD A;  3PTE A;  3UDF A;  4GCZ A;  4HI4 A;  3OBF A;  2J7U A;  1HTZ A;  4KUO A;  3E4P A;  1JWZ A;  4GOG A;  4LRX C;  1RIO A;  4IVK A;  4Z9Q A;  5FQJ A;  3JXD L;  2PBY A;  4ME4 A;  3IF6 A;  4JXV A;  2PUF A;  4Z5C A;  4MCX A;  4R0Q A;  5A93 A;  4CLC D;  5HD5 A;  3Q7V A;  4IUK A;  4R1G A;  1I2W A;  3F1P A;  3GSG A;  5HDD A;  5IHV A;  3GN5 B;  2PBD P;  1TD5 A;  3A9Z A;  4EET B;  3ZNY A;  2HP6 A;  1K54 C;  1E3U D;  3VV4 A;  2Y8H A;  3ZG0 A;  5A90 A;  3TW8 A;  1Y28 A;  4H6J A;  2PUG A;  2DRW A;  3IX8 A;  4P6Z S;  1Y54 A;  3RH8 B;  1MWU A;  2JCH A;  5F83 A;  4P85 A;  4R3J A;  2VEO A;  4UEY A;  3C7V A;  1NZO A;  3T4K A;  3HLG A;  3MFD A;  3BQ8 A;  1OTE A;  1XA7 A;  4DE9 A;  2Q9M A;  1VPW A;  4X4H A;  1ERM A;  4OLD A;  4BEN A;  3IWI A;  3E2L A;  4LPZ A;  4GHI A;  1HZO A;  1KE0 A;  1IKG A;  3W4Q A;  1W79 A;  2MEZ A;  3IVP A;  3LEZ A;  3PBQ A;  3QP5 A;  1NWZ A;  2YKH A;  3HLC A;  1S1Z A;  5TGF A;  3PE5 A;  2V8C A;  3EQV A;  4CLC C;  3LIF A;  2ZL1 A;  4Y0T A;  5IU1 A;  1TS7 A;  3VOY A;  2OWH A;  3IF5 A;  4EZI A;  1K6S A;  2P04 A;  3BQA A;  3MEJ A;  1S4R A;  1STZ A;  5EFW A;  3T4L A;  4CLC B;  1PFL A;  4IBR A;  5HL1 A;  3T1X A;  1EW0 A;  3UB5 P;  2ZOH A;  4WYY A;  3T1Q B;  3HLB A;  2O9B A;  2VZW A;  3QOX A;  4GKU A;  5E2E A;  4HY8 A;  5HZH A;  1IFQ A;  1K55 A;  1SKO B;  4CQH A;  1K56 A;  3DBA A;  2HDR A;  3ISG A;  5TR7 A;  1CI9 A;  5L10 A;  2R1J L;  5L8M A;  4KZ7 A;  4JXG A;  2FJR A;  1WH8 A;  4HQA A;  1YLJ A;  4JGR A;  1DJA A;  4FOF A;  2I72 A;  2OWJ A;  3SW1 A;  2W1R A;  2PE5 A;  3A0R A;  4S2O A;  3UDI A;  4HBU A;  3UE1 A;  4PM7 A;  1L0D A;  4DJ2 A;  3G0T A;  5HW3 A;  5J7E A;  4E3J A;  4EXO A;  3CEC A;  3BLM A;  1L0E A;  3P7N A;  1YSE A;  1JWL A;  5FAO A;  5CHM A;  5FL3 A;  4F3L B;  2VJW A;  3RFB A;  4OOY A;  1BLC A;  1YLY A;  2EWW A;  3RXX A;  1XA1 A;  1G68 A;  3QP2 A;  2LB9 A;  3T50 A;  4DE1 A;  1ACF A;  4ZRR A;  1T18 A;  4LFU A;  1YMS A;  2Y2N A;  4Q0J A;  4GNU A;  1KGE A;  4E3M A;  3IXH A;  3CJM A;  4WEK A;  3ZFZ A;  1UXD A;  1JVJ A;  2A6C A;  5KSC A;  1ZS4 A;  2L4R A;  3MXS A;  3G32 A;  1JWP A;  5EPH A;  3TRC A;  2P9V B;  4I6U A;  3N8L A;  3GR2 A;  5AVE A;  2R78 A;  4BL3 A;  3IWO A;  2XSD C;  2V1B A;  1DWK A;  3MZF A;  1B0N A;  1CEF A;  4WL9 A;  4KQQ A;  3B42 A;  1QQB A;  1NLY A;  2IVQ A;  3QP4 A;  4Q0H A;  4ZTK A;  1PIO A;  2PRF A;  2EX6 A;  3HJI A;  3O87 A;  1NLZ A;  3QP6 A;  2UV0 E;  5AJG A;  3IF6 C;  2JHE A;  4E6W A;  3TG9 A;  2LYJ A;  1FIK A;  5F5Y A;  1OJG A;  3IX3 A;  2NUP C;  4X1L A;  1R63 A;  3SCH A;  3IF6 B;  4AFI A;  2IWB A;  4YWZ A;  3V3R A;  5AQB A;  4UA7 A;  1DUL A;  4IUH A;  4HRA A;  1OTA A;  1CQA A;  1W5D A;  4JCY A;  2WKR A;  2PXB A;  3E2K A;  3ITB A;  1ZZC A;  2LYL A;  1V9Z A;  2X71 A;  4H6J B;  4LLO B;  1LCD A;  2AUW A;  3DTM A;  5FAT A;  3UO9 A;  3F6W A;  1OPX A;  3MR0 A;  1PWC A;  4E3L A;  1LL5 A;  3MS6 A;  2EX9 A;  4ID4 A;  3VMA A;  3V50 A;  4B4Z A;  2OV5 A;  2HF6 A;  4WEL A;  4KZA A;  2PXD A;  2L1P A;  4R70 A;  4G3K A;  4ESP A;  4QWO A;  5DJT A;  4FBI A;  2E8J A;  4Z5H A;  2Y55 A;  2EBY A;  2H0Y A;  3A3D A;  3LCE A;  3WS1 A;  3OCN A;  2GX5 A;  5CHU A;  4MDZ A;  2ZC4 B;  2A3U A;  2QPN A;  2Y2Q A;  4CJN A;  2ZL1 B;  3B33 A;  4OOM A;  5AQ9 A;  5TBM A;  3UPO A;  4ER3 A;  3BY9 A;  1BUE A;  1S7E A;  4OB4 A;  4GDB A;  3S7P A;  3W4O A;  4O8B A;  5CXW A;  3LY4 A;  2O49 A;  4L0L A;  1BDI A;  1ZZ6 A;  3OP9 A;  3OWQ A;  3T4O A;  5MC7 A;  2EWV A;  1PI4 A;  3R4K A;  3LIA A;  1FOF A;  2V9A A;  1K55 C;  5HAQ A;  2QZ6 A;  5JUW A;  2PUB A;  1DRM A;  4X56 A;  2L49 A;  2WUQ A;  2BNO A;  5FI2 A;  3B47 A;  1CF0 A;  5DTQ A;  3MXR A;  4Y7P A;  3HZI B;  3ZNT A;  3UE0 A;  2HPB A;  3GMW A;  2L8N A;  3CMZ A;  1GSV A;  4MEZ A;  1TS8 A;  2WGW A;  3CG5 A;  4DXC A;  3S1Y A;  4FTX A;  1VQQ A;  1Y9Q A;  3IX4 A;  1BLP A;  1XJ2 A;  5HWW A;  1FR6 A;  1MC0 A;  1G6A A;  3IHB A;  4BQM A;  3KSG A;  4KEN B;  1K25 A;  1IKI A;  3EUS A;  1ZTU A;  1H8Z A; 
#chains in the Genus database with same CATH homology
 1P97 A;  3BJN A;  4J1X A;  2O4A A;  5HWT A;  3FYM A;  4X4F A;  4I6T A;  1XJ6 A;  1YSP A;  3D3O A;  3SCF A;  3F1N B;  4K08 A;  4UQI S;  3S7N A;  4Q0I A;  3MQO A;  1Y7Y A;  2B18 A;  3ULF A;  2WKQ A;  3MXQ A;  4G3V A;  3E4O A;  5DFY A;  3C30 A;  2IVG A;  3BW6 A;  1OT9 A;  3CI6 A;  3GBF A;  5AVF A;  5HL6 A;  2OR1 L;  4HH3 A;  1PRV A;  4YAR A;  4BBT A;  1UGU A;  2GJ3 A;  1LQC A;  2KLI A;  2ICP A;  4O01 A;  1ZZ7 A;  2AXU A;  3LIE A;  4I5S A;  5TJJ A;  3NJA A;  4ETX A;  2KPJ A;  1T1B A;  2VV7 A;  4R6L A;  4LRY C;  3UB8 A;  1QPZ A;  3GN5 A;  2D01 A;  1JH9 A;  1JNU A;  5G4Z A;  1F98 A;  3EGX C;  4BJP A;  2EA9 A;  3UE3 A;  2G7U A;  5LBR A;  4BBV A;  3LFV A;  1GT0 C;  3ICY A;  3IBR A;  2NUT C;  2PR6 A;  4EEP A;  4X4G A;  2R63 A;  4HJ6 A;  2XRO A;  3L1P A;  3UB9 A;  4EER A;  3GDI A;  3F1O A;  5DKL A;  3KXA A;  3QQ6 A;  1ZAY A;  5DKK A;  1TF1 A;  2A2L A;  4II7 A;  5J4E A;  2M7V A;  4I3I A;  4WF0 A;  2XJ3 A;  3FC7 A;  3E0Y A;  3LI9 A;  4GW9 A;  3O9X A;  4NKP A;  2GZA A;  2O9A A;  2KEK A;  4F8D A;  3CAX A;  2OFY A;  4IVZ A;  1OCT C;  2FH5 A;  2J80 A;  2KOI A;  1QP7 A;  2AW6 A;  3H82 B;  1S4S A;  1IC8 A;  4PHT A;  3SCG A;  3EWK A;  2PD8 A;  3MQQ A;  1POU A;  4M4X A;  3FPV A;  3U3W A;  1EFA A;  5F68 A;  2VGL M;  2LYR A;  1ODV A;  1N9O A;  4IA8 A;  2VV6 A;  5K5B A;  3BDN A;  3G6O A;  4IWR A;  4Z5D A;  3BWL A;  1LT0 A;  3T4T A;  4X4C A;  1VHM A;  1ZZ8 A;  2MJ6 A;  5C5K A;  3T4S A;  3OQO A;  1W63 Q;  1S1Y A;  1XFQ A;  2JKT M;  2V1A A;  3KX0 X;  3MMH A;  3V67 A;  3VE3 A;  3GEC A;  2HJE A;  4OOL A;  3B7H A;  1ZZ9 A;  1IOU A;  2L0W A;  5J3W A;  4YNR A;  2JKR M;  2PHY A;  2VEA A;  1T1C A;  4GCZ A;  4HI4 A;  1NEQ A;  1X0O A;  2KDK A;  3OQN A;  3E98 A;  3OBF A;  3PBS A;  3UE6 A;  2IUO A;  2AXZ A;  4KUO A;  3E4P A;  3K3C A;  4NXB A;  3OLO A;  4JGO A;  4LRX C;  3UMD A;  1RIO A;  2VKS A;  3PBO A;  3JXD L;  3DNV B;  4NXE A;  4ME4 A;  3HJK A;  3OOV A;  3TJZ C;  4YG7 B;  4Z5C A;  2PUF A;  4MCX A;  4NXG A;  1RZS A;  4GQM A;  4CLC D;  2QWS A;  5HD5 A;  4IUK A;  3H9W A;  2DMW A;  4PU8 A;  4O0P A;  1PRA A;  3KSI A;  3F1P A;  4HJ4 A;  5HDD A;  3OQM A;  3GN5 B;  2PT7 A;  1TD5 A;  1TS0 A;  3PBT A;  1TS6 A;  4EET B;  3LIB A;  1QP0 A;  1UWN X;  3CUE A;  3IS2 A;  3VV4 A;  2Y8H A;  4YBA A;  3TW8 A;  1Y28 A;  4H6J A;  3RTY A;  4X4I A;  2PUG A;  4JCX A;  2ZMV A;  3FG8 A;  4BWI A;  4FN3 A;  1G28 A;  2J3W A;  1O4X A;  1P9R A;  3KZ3 A;  2PUE A;  1KOU A;  2L1M A;  1JFS A;  4P6Z S;  1OSL A;  4HP4 A;  3RH8 B;  4BBU A;  1CJG A;  4O8G A;  3BD1 A;  2V0U A;  3VOL A;  4UEY A;  3JXC L;  3T4K A;  2CMN A;  5I5L A;  1XJ4 A;  3NHQ A;  4EQ1 A;  3BY8 A;  1F9I A;  3BQ8 A;  1OTE A;  4ARZ A;  4RQ9 A;  1ZZB A;  2GZU A;  3MQ0 A;  3QF3 A;  4Z58 A;  1VPW A;  4X4H A;  3TE8 A;  2AWI A;  4GS9 A;  2PYP A;  1GSW A;  4LPZ A;  4GHI A;  3O5Y A;  2I9V A;  4G3W A;  4KQD A;  2MEZ A;  5HWV A;  1T19 A;  2IA2 A;  2OOL A;  2XSS A;  3ZYT A;  4IHQ A;  4CLC E;  3IVP A;  2B02 A;  4F3L A;  5TBM B;  2WIU B;  3QWG A;  3PBQ A;  1NWZ A;  2YKH A;  1S1Z A;  3EQV A;  4MCW A;  3U2A A;  4CLC C;  2HSG A;  3LIF A;  4PAU A;  1ADR A;  3EGD C;  2K7S A;  3UB6 A;  3CLC A;  1LCC A;  3LYX A;  2PPX A;  5IU1 A;  1TS7 A;  3EOI A;  2JN7 A;  2OWH A;  4DN0 A;  2P04 A;  2VX8 A;  1UWP X;  3BQA A;  2XA7 M;  3ZHI A;  1S4R A;  1STZ A;  1UXC A;  4FSF A;  4WEJ A;  5EFW A;  3T4L A;  4CLC B;  2BAS A;  3PBR A;  1EW0 A;  3E4Q A;  3H5T A;  1DP9 A;  2ZOH A;  4JGQ A;  1YAX A;  4QPR A;  3UB7 A;  4NDW A;  1DP6 A;  4X4E A;  2BNN A;  2O9B A;  3F1P B;  3ZKC A;  2VZW A;  1L1M A;  2W1T B;  3PR6 A;  5HD3 A;  4HY8 A;  2HJ9 C;  4GLQ A;  3H7W A;  5HZH A;  3TRB A;  1LMB 3;  1IFQ A;  2IVB A;  1N9L A;  1WH6 A;  2YKF A;  2W3E A;  3D72 A;  3LR0 A;  2QJ5 A;  3A0V A;  4CQH A;  2OAP 1;  3FPW A;  4Z1W A;  2ZOI A;  3DBA A;  3F52 A;  3F51 A;  1ZHH B;  2AXV A;  3R7W B;  3PYP A;  2R1J L;  5L8M A;  2FZ0 A;  2GRM A;  1XWR A;  2Z6D A;  2FJR A;  4JGP A;  1WH8 A;  2CRO A;  3T4Q A;  3P01 A;  3BS3 A;  4HQA A;  1OJ5 A;  3LIC A;  3HCY A;  4JGR A;  4FOF A;  4R38 A;  2OWJ A;  3T4J A;  3SW1 A;  2W1R A;  2PE5 A;  3A0R A;  2LYS A;  3LR5 A;  3JVU A;  4EES A;  2K31 A;  2P7J A;  4GS9 B;  4DJ2 A;  4WUJ A;  5J7E A;  4GHI B;  3EEA A;  4EXO A;  3CEC A;  2MQK A;  3P7N A;  1YSE A;  1JWL A;  4MN6 A;  4PU4 C;  4E04 A;  2OAQ 1;  5IT5 A;  3KSH A;  2PYR A;  5FL3 A;  4F3L B;  2GNX A;  4DJ3 A;  2VJW A;  4HIA A;  5F6A A;  1S67 L;  3RFB A;  5A8B A;  4GJ4 A;  2KEI A;  1NRJ A;  2H28 A;  3A0S A;  4LRZ E;  2EWW A;  2HIN A;  4I38 A;  3IBJ A;  2PUD A;  1WA9 A;  5HPF A;  3CWF A;  3G7D A;  2INW A;  1D06 A;  2LB9 A;  1GSX A;  4X4B A;  3F1O B;  3NOP C;  5DF9 A;  3T50 A;  3ZHM A;  3OMT A;  1W63 M;  4ZRR A;  4EW7 A;  1T18 A;  2HGV A;  4HH2 A;  4X4D A;  1X2L A;  2K2N A;  3PBN A;  1D7E A;  4Q0J A;  4PU7 A;  2O9C A;  1LSW A;  4XT2 A;  4WEK A;  1UXD A;  2A6C A;  4Z59 A;  2QHK A;  1WET A;  4YOF A;  1ZUG A;  4NEE D;  3CIT A;  4UQI M;  3LID A;  1ZS4 A;  2L4R A;  4B9O A;  2GRL A;  3TRC A;  2ZMF A;  4I6U A;  5AVE A;  3H82 A;  2R78 A;  4R3A A;  4EEU A;  2XSD C;  2V1B A;  3OC2 A;  1OTD A;  1DWK A;  4HNB A;  1B0N A;  1S66 L;  2KEJ A;  3LIS A;  4WL9 A;  2W3G A;  3B42 A;  1QQB A;  4Y5F A;  2EWT A;  2IVQ A;  1NLY A;  4Q0H A;  3C8C A;  2B5A A;  2XCJ A;  1QP4 A;  2KX6 A;  4PKY A;  3HJI A;  4GHJ A;  3KSF A;  1NLZ A;  3LR3 A;  5AJG A;  2JHE A;  3MFX A;  4I39 A;  2JKR I;  2W27 A;  2LYJ A;  3D1N I;  1UTX A;  1BDH A;  5F5Y A;  1OJG A;  2XRN A;  1X57 A;  2NUP C;  5HDC A;  1R63 A;  4B93 A;  4L9G A;  4DMZ A;  1RZR A;  3SCH A;  2LYQ A;  4MMN A;  2PUA A;  4KQO A;  3R1F A;  1RZR D;  3VK0 A;  2H8R A;  3NOU C;  4AFI A;  2BNM A;  1PER L;  3CUE C;  1AU7 A;  1F5M A;  4YWZ A;  3ZQ5 A;  1ZVV A;  1P0Z A;  5DJU A;  3LR4 A;  5KIZ A;  1SQ8 A;  1T1A A;  2Y79 A;  3NOT C;  4EU0 A;  3LUQ A;  4IUH A;  1WIZ A;  1OTA A;  4Y2F A;  4YG1 A;  4HOI A;  5HPI A;  1OTI A;  4PU3 C;  4JCY A;  2PD7 A;  2WKR A;  2IU7 A;  2D02 A;  3IS2 B;  4MN7 A;  2O99 A;  2VA0 A;  1ZZC A;  5K98 B;  2LYL A;  1V9Z A;  5A7L A;  2WUS R;  3C2W A;  4IJG A;  3KYQ A;  3CLO A;  1LCD A;  3C38 A;  4H6J B;  4LLO B;  2AUW A;  4PKY G;  3LFP A;  3S8Q A;  3F6W A;  4Y3I A;  1OPX A;  3MR0 A;  1CQT A;  2M7U A;  1NER A;  3W2Z A;  4XT2 B;  3K2N A;  1MZU A;  2D5V A;  2QYB A;  1PRU A;  2W3D A;  1HF0 A;  2P08 A;  4I3A A;  1XJ3 A;  5IS1 A;  1G6O A;  2VV8 A;  4I3J A;  3JXB C;  2XA7 S;  2BJC A;  4ARZ B;  1RPE L;  2HF6 A;  2QJ7 A;  4WEL A;  2Z6C A;  2W0N A;  5G4Y A;  4WLA A;  2J3T D;  3JVV A;  2A24 A;  4R70 A;  4Y42 A;  4G3K A;  2WKP A;  5DJT A;  2KZ8 A;  4FBI A;  2VLG A;  4Z5H A;  4JQD A;  5CX7 A;  2JVL A;  4MN5 A;  2EBY A;  1H8M A;  1N9N A;  2LYP A;  3OCN A;  2GX5 A;  1H3Q A;  2XI8 A;  3UME A;  2PR5 A;  4MDZ A;  3F1N A;  1LLI A;  4EUV A;  4L9E A;  1R69 A;  4MCT A;  2IV1 A;  5F69 A;  2PIJ A;  1OTB A;  2HV1 A;  3K3D A;  2VGL S;  1P9W A;  3B33 A;  4OOM A;  2XIU A;  5TBM A;  4I6R A;  3BY9 A;  4HJ3 A;  2JCG A;  3MF0 A;  1S7E A;  2O0Y A;  4P6Z M;  4OB4 A;  1V9Y A;  5HDS A;  4HHD A;  4NXF A;  3S7P A;  4O8B A;  2LCV A;  4BMW A;  2V0W A;  2O49 A;  3PHY A;  1BDI A;  4L0L A;  2LB5 A;  1ZZ6 A;  3OP9 A;  3EEH A;  3T4O A;  1ZPQ A;  1YKD A;  2CSF A;  2W3H A;  5MC7 A;  2EWV A;  3VE4 A;  2QKP A;  1JFT A;  3G5G A;  2ZBB A;  3R4K A;  4CLC A;  3LIA A;  5KSH A;  2V9A A;  3MJQ A;  1YSQ A;  3LI8 A;  1LSV A;  3CRO L;  1XFN A;  3RZZ A;  3FYA A;  2PUB A;  2O38 A;  1DRM A;  2W1T A;  2L49 A;  1DP8 A;  3H7W B;  5DFX A;  3QYX A;  2BNO A;  2M1C A;  3B47 A;  1QQA A;  3OCL A;  1OT6 A;  2LYK A;  3EQU A;  3HZI B;  2W3F A;  3PXP A;  2J3T C;  3KYZ A;  4I8T A;  4WN5 A;  4KUK A;  1LL8 A;  1LSX A;  1VB6 A;  2L8N A;  1GSV A;  1MKM A;  4HP9 A;  3UFD A;  1TS8 A;  3MLF A;  3S7Q A;  2PDR A;  3KO6 A;  2EF8 A;  1Y9Q A;  3S7O A;  3KJX A;  3R7W A;  2PUC A;  1XJ2 A;  1BYW A;  5HWW A;  1MC0 A;  5HSQ A;  2JKT I;  1E3O C;  2A24 B;  4L9F A;  1DW9 A;  4J1W A;  4ETZ A;  3KSG A;  3FMY A;  4YG4 A;  3EUS A;  1ZTU A;  2ICT A;  1PNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...