3PXPA

Crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
292
structure length
292
Chain Sequence
b'GMERAAFGKLVQALRREHRDEKGRVWTQEVLAERTQLPKRTIERIENGSLAHLDADILLRLADALELTIGERREFFFAATGIIEQKSATYKRSPEESLQYLIDMIRNMNVPAFVTDQYVNIIAANMITIRFFNIPMELIETAPLLPHGYNLMRVVFGTEYDFRRVVGTMWDEVARHNMQLFRAISLRVRADGYFVELLDNLMQYREFKRFWERAHLETEDTSAENFWYQYTHPVYGLLSYVSSRSQIPTSMGLLSMHTYIPLSPATTDLFAKLSTVANQDVIRLAPWPRSNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Helix-turn-helix domain protein
publication title Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes.
pubmed doi rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription regulator
total genus 85
structure length 292
sequence length 292
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
A PF17765 MLTR_LBD MmyB-like transcription regulator ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3pxpA01
3.30.450.180 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pxpA02
3SCFA 2KEIA 2MQKA 1QP7A 2ICPA 1JFSA 3CECA 3JXBC 2KZ8A 2WUSR 1LLIA 2PUCA 2LYLA 3OMTA 4X4EA 1WH6A 4FN3A 1E3OC 1CQTA 2GRMA 2EWTA 3OQNA 1XWRA 2L49A 1RIOA 3G7DA 4J1XA 1BDHA 1X57A 4YARA 3F51A 4O8BA 4FBIA 3KZ3A 3QWGA 4OB4A 3FYMA 2FJRA 2PUAA 2PUBA 1PERL 3FYAA 4J1WA 1ZAYA 2AXUA 2EBYA 2O38A 2IUOA 1JFTA 1HF0A 1EFAA 4X4GA 1O4XA 4PU7A 2KEJA 4MCXA 3CLCA 2EF8A 1YSEA 1POUA 1RZRA 1UXDA 1ZUGA 1PNRA 1ZZ6A 3ZHIA 1CJGA 2LYSA 1UTXA 1ZPQA 1LCCA 1BDIA 3BS3A 3G5GA 1WETA 3MLFA 2BNNA 4Z58A 5K98B 3JXDL 3DNVB 4Y42A 4JCYA 4F8DA 2CSFA 2IVGA 2LYPA 2CROA 4NDWA 1ZVVA 1WH8A 3F52A 1AU7A 1RZSA 3SCGA 1LMB3 3JXCL 2H8RA 1RZRD 4X4BA 3VK0A 1OCTC 3GBFA 3GN5B 2KPJA 4X4IA 4I6RA 1NEQA 2BJCA 2PPXA 3RZZA 1R63A 2AWIA 3QQ6A 2ICTA 3GN5A 2XSDC 2BNMA 3ZHMA 2B5AA 1GT0C 3EUSA 3LFPA 1B0NA 1ZZ9A 3UFDA 2R63A 2PUEA 1LQCA 2AXVA 4Z5HA 2O4AA 3S8QA 3D1NI 4Z5CA 4X4DA 4I8TA 1WIZA 3R1FA 1PRAA 4YG7B 1ADRA 2A6CA 4GHJA 1JWLA 2LCVA 1OSLA 2AUWA 4IA8A 1JH9A 1QP0A 2BNOA 1DWKA 4IVZA 2PE5A 2OFYA 2LYKA 2PUFA 1DW9A 2AW6A 2GRLA 2HINA 2AXZA 2LYQA 3B7HA 4YG4A 4YBAA 1PRVA 3KXAA 1ZZBA 2PUGA 4JCXA 2LYJA 3BDNA 1RPEL 4I6TA 1QPZA 2WIUB 3ZKCA 1ZS4A 2IV1A 2IU7A 3FMYA 2PIJA 1ZZ7A 3O9XA 2O49A 1VPWA 2LYRA 3F6WA 1NERA 4MCTA 4YG1A 3HZIB 3BD1A 3QF3A 4PU4C 1QQAA 3IVPA 4JQDA 2XIUA 1QP4A 1R69A 2IVQA 1X2LA 1L1MA 3SCHA 4Z5DA 1Y7YA 1ZZ8A 1Y9QA 4X4FA 2HSGA 2OR1L 1PRUA 2MEZA 3U3WA 3LISA 1LCDA 2PUDA 3OQMA 3KJXA 1SQ8A 4IWRA 1QQBA 1IC8A 2XJ3A 2JCGA 4Z59A 2JVLA 4I6UA 4X4CA 3TRBA 1S7EA 1UXCA 4PU3C 3CROL 2GZUA 3QYXA 2XCJA 3H5TA 4X4HA 4PU8A 2KEKA 3OQOA 2D5VA 3L1PA 1ZZCA 3PXPA 3OP9A 4GQMA 2L8NA 5A7LA 2IVBA 2R1JL 2XI8A
chains in the Genus database with same CATH superfamily
2Y8HA 3OPHA 1MKIA 2ICPA 4KZ6A 1JTDA 4DE0A 1U60A 2JE5A 4UA6A 4ZJ3A 5M1AA 2PYPA 3DW0A 4CLCB 5DTKA 1BDHA 1NLYA 2ZQCA 3NBLA 2XXPA 1VETA 1EROA 1S1ZA 2PHYA 3E0YA 2XQZA 4J1WA 1ZAYA 3PAGA 2IUOA 1EFAA 4PU7A 5J4EA 3CI6A 5I5LA 1S0WA 1VM1A 2A24A 5HD3A 3W2ZA 4HP4A 2OAQ1 1ZPQA 3WS5A 1BDIA 3PBRA 4Q2JA 5K98B 4Z58A 3V50A 2WYXA 1IKGA 3E4OA 4R4SA 2ZLYA 3TJZC 3IXGA 2D02A 3CLOA 4PM6A 2OOLA 2VGKA 3DBAA 3WWXA 3UDIA 1W7FA 2ZC7A 4Q0HA 3ZDJA 1IOUA 4F3LA 5J8XA 3PHYA 2WAEA 1GHMA 1GSWA 4EUVA 2L1PA 2FZ0A 3S7QA 2O4AA 1PRAA 4GHIA 1JWLA 4EXOA 4S2LA 2BNOA 1DWKA 4G3KA 5FI6A 5EE8A 2JKTI 2GRLA 3C7VA 2XFSA 1PRQA 4GDBA 4E3NA 1NRJA 5JUWA 2DNSA 1X2LA 4PM5A 2JKFA 1J9MA 1F9IA 1ERMA 1DP6A 2MEZA 1NZUA 1XJ4A 4IWRA 1YLZA 3A3JA 4ARZA 1ODVA 4DXBA 2W3FA 2GZUA 1LL8A 4WN5A 3H82A 1VEUB 5GAHi 4Y17A 2Z6CA 1ZZCA 3NOTC 3V3RA 3OP9A 2X02A 2M1CA 3PBSA 4HJ6A 2XI8A 2PXKA 1S67L 1VHMA 5FA7A 3B33A 5GL9A 2GRMA 1ZTUA 3E2LA 2LLWA 4DKIA 1S1YA 5EPHA 3UB8A 4CLCA 4QU3A 3FYAA 3ZG5A 3LCEA 4QY5A 4MCWA 4CLCE 2O9BA 4UA7A 1DJCA 4PMAA 3ZHHA 2W3HA 5HDDA 4NDWA 2PRFA 2QZ6A 2XD1A 1RZSA 3N7WA 4I3IA 3IT9A 2Y2GA 4PM7A 4ER3A 4WL9A 3GN5B 4KZ7A 1L0EA 1FOFA 2PPXA 1TDLA 1MY8A 1RCJA 5EOOA 1F98A 1B0NA 5A91A 3MMHA 2AXVA 3KSHA 4BJPA 4EEUA 4X4DA 2GDNA 4X69A 2PU4A 2AUWA 4R0QA 4ER7A 3ZQ5A 5F69A 3VV4A 2Q9MA 3UPPA 4JXGA 2OAP1 4JCXA 3PYPA 4D2OA 3GRJA 4UA9A 1ES4A 3BFEA 4WEKA 4MCTA 2P74A 1JVJA 4XT2B 2XIUA 3HUOA 4OBMA 4EBNA 1R69A 2PYRA 3MZDA 5FI7A 4GNUA 3NZLA 2J8YA 3ITAA 2JCHA 5IT5A 3KJXA 1SQ8A 3BRMA 3KO6A 1XGIA 4QJGA 3NHQA 4B88A 3C4PA 2WKIA 3EQUA 1FSYA 2D5VA 3LR4A 3LYXA 1VEUA 4ZBEA 5FASA 4JF6A 3P7NA 3UB5P 3PXPA 3MSHA 4NETA 2PR5A 4ZAMA 2V2FF 3T4KA 2VGLS 3A3DA 3TOIA 4G3WA 3F51A 2V1BA 3VP1A 3QWGA 4OB4A 4WF0A 2H28A 2PDRA 1I5QA 5AVFA 1JFTA 4I38A 1YSEA 1PWGA 5J7EA 2Y2MA 2HFZA 2XLNA 4C75A 4LV3A 3DNVB 2GZAA 4EBPA 1LSXA 1OJGA 3IX4A 4EKIA 1XA7A 3LR5A 5A93A 2JKTM 1N4OA 3A0SA 3HLWA 2LB5A 4EZIA 4NKPA 4JGQA 5HPFA 1FQGA 1G68A 4OQ0A 5TFQA 1STZA 3GN5A 2XSDC 4ZJ1A 2HJ9C 4X1MA 2DMWA 2QYBA 3K3DA 1IYPA 4P0MA 4E3MA 2Q9NA 3QP5A 5F83A 4UQIS 3IXBA 2ZL1B 4IVZA 2XDMA 2A2LA 1T19A 3HLFA 4E3IA 2AW6A 3KXAA 1K56D 3GMWA 1JWPA 1N9BA 3GZDA 1BYWA 4LRXC 4FOFA 2JHEA 3OC2A 1V9ZA 1Q2PA 3SCHA 4OPZA 2VX8A 4XT2A 3IWOA 1K4EA 1HQ1A 2G2UA 3M6BA 3N8RA 2JCGA 2V1ZA 4QHCA 3W4OA 4WZ5A 3LEQA 4L9EA 4X4HA 3HUMA 4JGOA 1OT6A 1S66L 3C2WA 5DKLA 5KMWA 2FFFB 3VP3A 3SS4A 3BFFA 3B42A 3C38A 3IBRA 4JXVA 3CITA 3RFBA 5DTQA 2Y55A 1E3OC 4XXRA 3T1XA 5J3WA 4FD8A 1J3WA 2J7UA 5EECA 1HVBA 5EV0A 3VSLA 4Y3IA 4X25A 1BLCA 4S2NA 2W3GA 1HD8A 3ZFZA 3IHAA 4KQRA 1FR1A 5AQ7A 4B9OA 3G5GA 3JXDL 1M40A 2XR0A 5CHMA 2H0TA 4DE8A 1H0MA 4C6YA 3SCGA 2Y2QA 2H8RA 4X4BA 3HLBA 2LB9A 1P9WA 4MLLA 4JKTA 3M2KA 4RA7A 1K0KA 4BLMA 2AWIA 2B5AA 1N9OA 1OMEA 3MQOA 3QP2A 2WKQA 2O99A 5A92A 4HHDA 5GHZA 3IWIA 5DJUA 1RP5A 3R09A 1F5MA 4OPYA 3NECA 3QNCA 2ZL1A 1KDSA 2E8IA 5HSQA 4OQIA 1BLPA 3IF6C 2PUFA 2O0YA 2LLVA 1W63Q 1XPBA 3B7HA 2LYQA 4YG4A 5G4YA 2RCXA 5AVEA 2EX6A 3O88A 4R23A 2LYJA 1RPEL 2XA7S 3ZKCA 3NY4A 2O49A 3QP4A 2XXQA 3F6WA 1W8YA 3A0RA 4GJ4A 1KGEA 3HZIB 1LLBA 4U0XA 1JTGA 5FEGA 2EWWA 1Y9QA 2WADA 2OWHA 4BQMA 3P01A 1P0ZA 1SHVA 3UY6A 2HV1A 5KSCA 3H7WB 3VE3A 3NXHA 1N9NA 1BULA 4Q0JA 4PAUA 2MJ6A 3QYXA 1MC0A 5K5BA 4HBTA 4UAAA 1WYCA 2KEKA 1YM1A 4OP8A 4EK9A 2WAFA 1YLPA 1BLHA 4D60A 2VGLM 2B5RA 2W3DA 2V20A 2WGIA 3L9KA 3BWLA 1YPRA 2ODRD 1RIOA 1H8ZA 1NWZA 2B95A 1IEMA 2JBFA 1ERQA 4BD0A 5CEDA 4PHTA 1JWZA 4WLAA 1HF0A 4UEYA 2XXAA 3BQ8A 2P04A 3D4FA 1ONHA 1UXDA 2K7SA 4I3AA 2EX8A 4N1XA 2BNNA 1NY0A 4PM8A 4CLCD 1ACFA 1Z6FA 5HDCA 4LLOB 4NEED 4Y0UA 1AXBA 3FYZA 4LV1A 3UB9A 3BLMA 4S2MA 2JN7A 1KVMA 3WS1A 2JKGA 3ZHMA 1TS6A 3JYIA 3UE6A 4S2JA 1OTIA 4OP5A 4P6BA 5EVIB 2A3UA 3QFIA 2JQEA 2PE5A 2ZOHA 1ONGA 3Q7VB 1OTBA 3FWLA 1YLYA 3S4XA 4RQ9A 4I39A 1YKDA 2YKFA 4ZTKA 2VV7A 5F5YA 2OR1L 3ZPXA 1ZHHB 2WKRA 3CMZA 2VA0A 5L07A 1RGZA 3LY3A 4N9LA 1G28A 4X4CA 3KYZA 1HZOA 3H7WA 4X55A 4DE1A 3LFVA 4R3JA 5HL6A 2ZQ9A 3GQZA 3M9LA 2HGVA 3BY8A 2L49A 2HCSA 4MEZA 3NULA 2ZC5B 2B18A 2XSSA 4ZJ2A 1FR6A 1Y28A 2K2NA 2WZXA 3DWZA 1ZUGA 4KZ3A 4DJ2A 3GZCA 1TD5A 3S7OA 4EWFA 3MXRA 4MBHA 3MQ0A 3LI8A 3HCYA 2J3TC 2Y2LA 1GT0C 2HCNA 3LFPA 3KSIA 4GLQA 1XA1A 4I8TA 4ZDXA 2LCVA 5HPIA 1EW0A 2J3WA 3TSGA 2XA7M 3T1SA 5EVIA 3D3OA 3FKVA 1MZUA 4BWIA 3Q7VA 3GSGA 4EETB 5FAPA 2Y2HA 2AVXA 3IF5A 4KG2A 1X0OA 2IVQA 1E4DA 3MJQA 2CMNA 2IWCA 2XRNA 3C8CA 1MWRA 4P85A 4JF4A 1K54A 3OZHA 2ZM8A 4NG2A 2ZMVA 2HP5A 2QJ7A 3V67A 5HX9A 3OOVA 1PI5A 3SS3A 1QZXA 4BENA 5TR7A 2L8NA 1KE0A 3Q1FA 1TEMA 3F1OB 1ES5A 4EERA 1CQTA 4IBXA 4E3OA 1UGUA 4IBRA 4FBIA 3NCKA 4LCMA 3IQAA 3FYMA 5DF7A 4WVLA 3MFXA 3SZTA 4Y5FA 3P98A 1XP4A 4E3LA 2GNXA 1SCWA 4BBUA 1RZRA 4QWOA 1DP8A 1UTXA 3OPPA 4JCYA 1TVFA 2CC1A 5F82A 3LIBA 4F8DA 4LRYC 3LEZA 1T1CA 1K55C 4S2PA 1YMXA 3QHYA 3ZGAB 3DTIA 3W4PA 3A3EA 1PZOA 4U3TA 2ZQDA 1P97A 3TW8A 5FQ9A 2BJCA 5DT2A 3QQ6A 3CUEC 2BNMA 1UWPX 3KX0X 2ZC4B 3C30A 3S22A 4OQHA 3CHWP 1W8QA 4R38A 4Z5HA 1OTEA 4Z5CA 4HQAA 2PXVA 2ZQAA 3IH8A 3U2AA 2A6CA 2ZQ7A 3ZNYA 1MBLA 2VLGA 3T4SA 2V9AA 2Y2PA 2PUGA 4DMZA 4I6TA 2XK1A 4M3KA 4R3AA 4KQOA 3HJIA 3A9YA 4O0PA 2OSUA 2H0YA 4Q0IA 4Z5DA 4DE2A 3MS6A 4GD6A 2X71A 4X56A 5CGWA 4FSFA 3VFFA 3PAEA 2XJ3A 4DE3A 3TE8A 3UB7A 1PIOA 1NW3A 4F94A 3L1PA 4H8RA 5M19A 1KE3A 4WZ4A 3F1OA 1WH6A 4MNRA 2BTFP 1PWDA 2PAVP 4WZ5C 1K38A 4WYYA 1YMSA 1FILA 5GLCA 3KZ3A 3BJNA 4CPKA 3OCNA 1LT0A 3PTEA 1OTDA 4E04A 2XD5A 3CAXA 1ZZ6A 3ZHIA 2PXUA 2PXFA 4OKPA 4Y0OA 4X6TA 2GJ3A 3HL9A 5M18A 3I7JA 3HJKA 3V5MA 5A90A 1NYMA 4MN7A 3PR6A 2WKHA 3M6HA 1OCTC 1PYYA 4GD8A 4S2NC 1BZAA 1K6RA 5FQJA 3B3XA 1HTZA 4I6RA 3BM6A 1DULA 2IA2A 1R63A 4IUKA 3BFDA 2W1RA 3SH7A 3TEPA 1ES2A 3JVUA 2PUEA 5DRTA 4KUOA 2HF6A 3DTMA 5C5KA 1MPLA 1P9RA 4M4XA 4IA8A 1QP0A 2Y59A 4ETZA 2PXPA 2VGJA 5U47A 5LBRA 3GR2A 1DW9A 4Z9QA 2AXZA 2W3EA 4DXCA 4OPRA 2XGNA 1K4FA 4E6WA 3M2JA 2QMIA 3LICA 1ALQA 3ME5A 1VPWA 1OPXA 2Y2OA 2J80A 3NJAA 1FCOA 1QP4A 2DCFA 3CJMA 1ZZ8A 1EI5A 1TDGA 4WEJA 4WMCA 3LIDA 3CZDA 5DFXA 3LR3A 3F1PB 3Q82A 3PBQA 2R9XA 3WS0A 4S2KA 1KVLA 2EX2A 4HJ3A 2IVBA 1BLSA 3A9ZA 4S2OA 1PNEA 2WGWB 5L10A 5FDSA 3NC8A 5FQQA 3G2ZA 1Y4OA 1XWRA 4EKGA 1YLWA 3UB6A 4HY8A 4HRAA 4FH2A 2XEPA 1YAXA 3O87A 3VOLA 4O8BA 4Y2FA 2PUAA 5HFOA 5E2EA 2ZBBA 4N1HA 5AJGA 2ZM2A 3R4KA 4GW9A 2ZD8A 3VE4A 5CTMA 3RJUA 4KZ4A 3T4TA 3JXCL 2PD8A 2B02A 5DFYA 2V8CA 2EXBA 1L2SA 2L1MA 2WKEA 2HJEA 5EOEA 3EWKA 3S1YA 5HWTA 1K6SA 4EESA 1H5XA 3HVFA 4ZRRA 1LQCA 3ZCZA 3T1QB 4DN0A 2KLIA 1ADRA 5AQAA 4EV4A 1JH9A 1OSLA 2Z2LB 4IHQA 4HJ4A 3UNWA 3RTYA 5EVLA 4HH2A 4R4RA 4R3BA 2V8FA 4LV0A 1PRVA 1ZZBA 1GA9A 3ZYTA 3OBFA 5IU1A 1ZZ7A 3T12B 3ZG0A 4NK3A 4GDNA 2W1TB 2M7VA 5EVID 3HLGA 1I2SA 3F1NB 2PUDA 3CPTB 2L4RA 2Q0OA 1IYQA 2X01A 1UXCA 3CROL 5FATA 4OOYA 1BT5A 4OONA 5IS1A 4WM9A 3F1PA 4HEFA 2QKPA 3DAVA 4LENA 3ULFA 1GCEA 3S7NA 5GAGi 5HZHA 3SCFA 1JFSA 2Y2NA 1LSWA 1PI4A 3G31A 3KL4A 2LYLA 4II7A 4JPMA 2WGWA 2EWTA 3NROA 3UE3A 2HP9A 3ZG8B 3G7DA 3TRCA 4PM9A 2W0NA 5EVEA 4YARA 1TS8A 2O9AA 2PUBA 2VKSA 3UE0A 1S4SA 1K57A 2EX9A 4K0WA 4B93A 3VFHA 4WBGA 5FEFA 3MXSA 2ZQ8A 1CJGA 2PU2A 3C7UA 4JLFA 1MWTA 3QP6A 3HLDA 3G2YA 5AQBA 1CI8A 2CSFA 3JVVA 2QHKA 4QPRA 1L0FA 3F52A 4KG6A 1RZRD 2VZWA 3MZEA 3NDGA 5HL1A 5BOHA 2C6WB 3OWQA 4GS9B 3DTKA 1W79A 1ZZ9A 4RYEA 4JF5A 4HH3A 1YSQA 4H6JB 5FDHA 1MFQC 1E3UA 4GHJA 2BG1A 1GSVA 3WS2A 3BW6A 3LY4A 2OFYA 1GSXA 4UHUA 3SOIA 3G30A 1QMFA 4EUZA 4IEDA 2M4HA 3UN7A 4PKYG 2PIJA 1NRFA 3ZG9B 3GVBA 1VB6A 3BD1A 3QF3A 1QMEA 2PR6A 2ZM0A 5F1GA 1I2WA 1SDEA 4P87A 2QWSA 3SS5A 2OLVA 2W1TA 4OOLA 1LCDA 2VV8A 3CWFA 4OLDA 3F1NA 4HIAA 3EQVA 1S7EA 3CPTA 4RVAA 4B4ZA 3A3IA 4IVIA 1GHIA 2KDKA 1H8YA 2VEAA 3WRTA 2R1JL 1NJ4A 2NUPC 3G4PA 5CX7A 2MQKA 5EM0A 3JXBC 2KZ8A 1CK3A 2PT7A 2Y91A 2XH9A 2PUCA 3OKZA 2QPNA 3BY9A 2V0WA 2KOIA 4LGWA 4R70A 3IWQA 2Y2IA 1AWIA 1NLZA 1TS0A 1NYYA 1D06A 1DJBA 4L9GA 1LI9A 3LGOA 2KEJA 3CLCA 1H8MA 2R78A 1FIKA 3T4JA 2PXEA 4GZBA 2PBDP 1RGYA 2DRWA 1S6RA 5DJTA 1ESIA 2IWDA 3GUUA 1Y54A 4HOIA 1HLUP 2EXAA 4DDYA 3HLCA 1W5DA 4X53A 3UDXA 2WUQA 1KDWA 4KG5A 5A8BA 5G4ZA 2ZMAA 4U0TA 1M6KA 4LV2A 4BD1A 1T1AA 3EUSA 3E98A 4QY6A 4GS9A 1GA0A 4C3QA 3R1FA 4G3VA 1GHPA 4HESA 4CLCC 4H6JA 5KIZA 3IBJA 4ER5A 3LUQA 2PBYA 3FG8A 5DTTA 3AGFA 2D01A 3V3SA 2PXQA 1BTLA 4NXFA 2J9PA 2IWBA 1CF0A 5HAPA 4YG1A 1MKMA 3MXQA 2E8JA 3HBRA 1Y7YA 4KZ8A 5GHXA 3QP1A 3IXDA 1CQAA 5EM1A 4E3JA 3OQMA 3W8KA 4CQHA 5AQ9A 3GECA 3HREA 3OQOA 4RX2A 4IJGA 1FCNA 3LIAA 4WMCD 4BBTA 5E2GA 2V0UA 5F1FA 3N8LA 5CTNA 2VEOA 3L7HA 4YINA 4OOMA 4KENB 1VQQA 2P7JA 4FN3A 3OQNA 4R6LA 4J1XA 4MMNA 3R7WB 1ESUA 1X57A 4MN5A 2HP6A 4FTXA 5CERA 3WS4A 1QB2A 2AXUA 1ZKJA 4L0LA 1O4XA 2EF8A 3NOPC 4JGRA 1PNRA 2BASA 1XKZA 1LCCA 5E43A 1WETA 3MLFA 5GLBA 3BYDA 1XXMA 3GTCA 3EGDC 4Z1WA 3G35A 3Q81A 3RXWA 2VK3A 2K31A 3W4QA 3VOYA 1T18A 3VK0A 1KE4A 5GLDA 1D7EA 1YLTA 1KGFA 1XGJA 3LI9A 1YSPA 2M7UA 2Y2JA 1G6OA 2FH5A 4ESPA 3PBTA 3OPRA 3MBZA 4DF6A 3CG5A 4EEPA 3U4LP 3G6OA 4LCLA 2C5WB 3UE1A 3P09A 4IUHA 2LNMA 3QOWA 3PBNA 2VJWA 1TS7A 1QPZA 1WA9A 4MBFA 2IU7A 2ZC6B 4Q8IA 3IHBA 3LQXA 2I9VA 1QQAA 3T50A 4A5RA 3FZCA 1L1MA 2HSGA 3O3VA 1PRUA 1UWNX 3UPNA 3U3WA 1CJFA 3FPVA 5JYPA 4R1GA 4LRZE 4I5SA 5DF9A 4Z59A 2P9VB 4KUKA 3NDEA 5TBMB 2XCJA 3MKEA 3RXXA 1PFLA 4N9KA 4Y15A 5FQMA 4O7DA 4NXGA 2H10A 4GQMA 1O07A 5A7LA 4WUJA 3G34A 4Y7PA 5FQKA 1QP7A 5CECA 1D1JA 1LLIA 5HAQA 4HI4A 3PE5A 1SKOB 3VP4A 2V3CC 3FV7A 3GZDC 3R7WA 3KYQA 1LI0A 4EW7A 3DM5A 3LIFA 1FCMA 4BL2A 3BQAA 3MZFA 4X4GA 4P6ZS 1F2KA 5DKKA 3HLEA 3AGDA 3UWPA 2INWA 3BS3A 1CI9A 2UV0E 4NXEA 3BFCA 4N92A 2CROA 3E2KA 1WH8A 1U2ZA 3A9XA 2L0WA 3UDFA 3MFDA 3N4IA 2QJ5A 2EFUA 3OPLA 3GBFA 3SR4A 4YNRA 4YOFA 2KPJA 4JBFA 2KX6A 1NEQA 5EUAA 2EFXA 1KGGA 3UMDA 3C4OA 4FCFA 5D3OA 1BUEA 3UFDA 1L0GA 2MXDA 2JKRI 5HD5A 5MC7A 1WIZA 5E2FA 2OV5A 4BL3A 2LYKA 3A0VA 4E3KA 2HINA 2J9OA 2G2WA 2H5SA 1ZG6A 3LO7A 4DDSA 1ZS4A 3O9XA 3LR0A 1E3UD 1NERA 3G0TA 4MBKA 3Q7ZA 2XF3A 3AGEA 4GCZA 1C3BA 1CEFA 2ZC3B 1XFQA 1SKFA 5DTSA 1IC8A 3K3CA 4JGPA 1XJ2A 4I6UA 1K55A 5GLAA 3NIAA 3VMAA 3SW1A 2J7VA 3H5TA 1XX2A 3EOIA 2P9VA 3KYEA 3T4OA 1ZC2A 2I72A 2Z2MB 5TBMA 5KZHA 2HZ5A 3IX3A 1LHYA 4WELA 2WKPA 3CUEA 2EA9A 3IX8A 3IXHA 3HUNA 3VP2A 1W63M 1MXOA 2BLSA 2FFYA 1NZOA 5CGSA 3SH8A 1SKOA 5L2FA 2O38A 1JWVA 5L8MA 4EU0A 3QNBA 5TGFA 4OLGA 3SX0A 4KQDA 1Z09A 4K91A 4LFUA 1O7EA 2IVGA 2VV6A 3TELA 3ZVWA 4IVKA 1K57C 3FPWA 4HP9A 1DY6A 4GN2A 4S2IA 1G5UA 3ZNTA 1IFQA 2HDSA 3IS2B 3BFGA 1KOUA 3EGXC 2V1AA 5HAIA 5CRFA 2PXTA 1XJ3A 1IYSA 4KZ5A 5HDSA 4BMWA 2UWXA 1WYBA 1YT4A 3DWKA 3A3FA 1SZVA 2HDUA 2JC7A 3LIEA 4JXSA 1DP9A 4DRTA 4KZ9A 1XJ6A 4KQQA 1PZPA 4O8GA 2IV1A 3FMYA 4NXBA 4KZBA 3V39A 1IYOA 1PW1A 5HW3A 4JQDA 3MEJA 3UMEA 2PXDA 2EWVA 1EWZA 2ZOIA 3JPUA 2HDQA 2ACGA 5HWVA 2XROA 4PPRA 3K2NA 1H3QA 3E4PA 2JVLA 4YWZA 5KSHA 5FAQA 1OJ5A 5IHVA 2R9WA 4PU8A 2ZMFA 4ETXA 1PWCA 5FL3A 1PW8A 3B47A 3QP8A 4HBUA 2WUSR 4EQZA 1Q2QA 3OMTA 5HWWA 4E6XA 3ZG7B 1T1BA 4P6ZM 3ISGA 3FC7A 1NXYA 3S7PA 2FJRA 5I94A 1PERL 2HPBA 2HDRA 3TFLA 2PXBA 5DF8A 4MCXA 3D9YA 1MWSA 4HNBA 2JKRM 4PKYA 5DTMA 5FSRA 3FKWA 4CJNA 4Y13A 5F6AA 3VWSA 5DTRA 4ER0A 1LSVA 3BECA 2GX5A 3IF6B 4MDZA 3DTEA 2W27A 4ME4A 5CEBA 3IS2A 3BLSA 1MWUA 4X68A 3S8QA 3D1NI 3RH8B 4EQ1A 4KZAA 2YKHA 2OLUA 4YG7B 4O01A 3O86A 4XUZA 2P08A 5FAOA 1LL9A 4GB7A 3T4LA 2YBDA 1K25A 3O5YA 5L09A 3BDNA 1YLJA 5F68A 3MKFA 1OTAA 2Y2KA 4B4XA 3MF0A 2LYRA 4DJ3A 3EEHA 1G6AA 5FI2A 1IELA 2J7WA 4PU4C 1OT9A 3QOXA 3N8SA 5G18A 3KSFA 4X4FA 4GOGA 3T4QA 3LISA 3MR0A 1DJAA 3OLOA 1ZG4A 5TJJA 1QQBA 4LPZA 4ER6A 5CXWA 3TRBA 2WGVA 4PU3C 2WZZA 5HARA 3N6IA 5CHUA 1DRMA 5CGXA 4OPQA 3BEBA 4ID4A 3GDIA 1IKIA 3IH9A 2KEIA 1LL5A 3CECA 4JXWA 5DSXA 4AFIA 4X4EA 5EVIC 3SH9A 1CEGA 1VETB 3VOZA 3H9WA 2NUTC 2XFTA 3G32A 1E25A 5GHYA 4UQIM 2EBYA 3ITBA 4K08A 2Y79A 2A24B 2J3TD 3NI9A 4X1LA 1POUA 1L0DA 5FQIA 3EEAA 2LYSA 4BBVA 4Y42A 2PXLA 1K54C 1S4RA 4QB8A 2LYPA 1ZVVA 3E4QA 1AU7A 3MQQA 1LMB3 2FFHA 2WK0A 4DE9A 3ICYA 2PD7A 4F3LB 3ZVTA 4X4IA 1V9YA 4I3JA 1ES3A 3IF6A 4EBLA 3RZZA 5E2HA 2ICTA 1L3LA 3T1RA 4GKUA 2R63A 1A0KA 1K56A 4GHIB 2OWJA 4Y0TA 2Y4AA 4K0XA 1BSGA 4QD4A 4L9FA 3VP0A 3C5AA 3D72A 2G7UA 3UO9A 5DRYA 5DVAA 3KSGA 1JNUA 3NDBB 4MN6A 5JYOA 4YBAA 3TG9A 4YFMA 2WIUB 1YQSA 2Z6DA 4FH4A 1TF1A 2O9CA 5CHJA 3IVPA 3PBOA 3NOUC 2ZJ9A 3Q07A 3GV9A 4OVDA 2A49A 4EQIA 4FUWA 4ARZB 3VSKA 4RX3A 3H82B 1N9LA 4OH0A 2RL3A 3UPOA 5EFWA 4XUXA 1WE4A 3WRZA 1FSWA 4OQGA 1XFNA 1SDNA 3OCLA
chains in the Genus database with same CATH topology
2Y8HA 1QP7A 2ICPA 1LLIA 2W3DA 3BWLA 2PYPA 1XWRA 1RIOA 4HI4A 4CLCB 1NWZA 3UB6A 1BDHA 1NLYA 4HY8A 1YAXA 3VOLA 4O8BA 4Y2FA 2PUAA 2PHYA 1S1ZA 3KYQA 3R7WA 4EW7A 3E0YA 4J1WA 1ZAYA 4PHTA 3LIFA 4WLAA 2IUOA 1HF0A 1EFAA 3BQAA 2ZBBA 4X4GA 4P6ZS 4PU7A 3BQ8A 4UEYA 2P04A 5J4EA 3CI6A 1UXDA 2K7SA 5AJGA 5DKKA 5I5LA 2A24A 5HD3A 4I3AA 3W2ZA 4HP4A 2OAQ1 1ZPQA 2INWA 1BDIA 3BS3A 3PBRA 3R4KA 4GW9A 2BNNA 4Z58A 5K98B 4CLCD 3VE4A 4NXEA 3E4OA 2CROA 5HDCA 4LLOB 3TJZC 1WH8A 2D02A 3CLOA 2OOLA 4NEED 3T4TA 2L0WA 3JXCL 2PD8A 3DBAA 2B02A 5DFYA 2QJ5A 3UB9A 4Q0HA 3GBFA 2L1MA 2JN7A 4YNRA 4YOFA 2KPJA 1IOUA 2KX6A 4F3LA 1NEQA 2HJEA 3EWKA 3PHYA 1GSWA 4EUVA 3ZHMA 1TS6A 5HWTA 2FZ0A 3UMDA 4EESA 3UFDA 4ZRRA 3S7QA 2JKRI 1LQCA 2O4AA 5HD5A 3UE6A 5MC7A 4DN0A 2KLIA 1WIZA 1OTIA 1PRAA 1ADRA 4GHIA 1JWLA 1JH9A 1OSLA 4IHQA 4EXOA 2BNOA 1DWKA 4HJ4A 4G3KA 2PE5A 3RTYA 2ZOHA 2LYKA 3A0VA 4HH2A 2JKTI 2GRLA 2HINA 1OTBA 1PRVA 1ZZBA 3ZYTA 4RQ9A 1NRJA 3OBFA 1ZS4A 4I39A 5IU1A 3O9XA 1ZZ7A 3LR0A 1YKDA 1NERA 2YKFA 2VV7A 5F5YA 2W1TB 1X2LA 4GCZA 2M7VA 1F9IA 2OR1L 1DP6A 2MEZA 1XFQA 1XJ4A 3F1NB 1ZHHB 2PUDA 2WKRA 4IWRA 2VA0A 2L4RA 1IC8A 3K3CA 4JGPA 4ARZA 1ODVA 1XJ2A 4I6UA 4X4CA 1G28A 2W3FA 3KYZA 1UXCA 3CROL 2GZUA 1LL8A 4WN5A 3H82A 3H7WA 3SW1A 3H5TA 3EOIA 5IS1A 2Z6CA 3F1PA 3ULFA 2QKPA 3T4OA 1ZZCA 3NOTC 5TBMA 3OP9A 3S7NA 5HZHA 2M1CA 3LFVA 3PBSA 4HJ6A 2XI8A 3SCFA 1S67L 4WELA 2WKPA 1JFSA 1LSWA 5HL6A 1VHMA 3CUEA 2EA9A 2HGVA 2LYLA 4II7A 3B33A 3BY8A 2GRMA 2EWTA 2L49A 1W63M 1ZTUA 3UE3A 3G7DA 3TRCA 2W0NA 4YARA 1S1YA 3UB8A 1TS8A 2B18A 4CLCA 2O9AA 2XSSA 2PUBA 2VKSA 3FYAA 2O38A 1S4SA 1Y28A 5L8MA 4EU0A 4B93A 2K2NA 1ZUGA 4MCWA 1CJGA 4CLCE 2O9BA 4DJ2A 4KQDA 2CSFA 3JVVA 2IVGA 2QHKA 2W3HA 5HDDA 1TD5A 4NDWA 4QPRA 2VV6A 3F52A 4I3IA 1RZSA 3S7OA 3FPWA 4HP9A 1RZRD 2VZWA 4WL9A 1IFQA 3MQ0A 3GN5B 3IS2B 2PPXA 1KOUA 3EGXC 4GS9B 2V1AA 3LI8A 3HCYA 1XJ3A 2J3TC 5HDSA 4BMWA 1GT0C 3LFPA 1B0NA 1ZZ9A 3KSIA 4GLQA 3MMHA 4HH3A 2AXVA 1YSQA 3KSHA 4BJPA 4EEUA 4H6JB 4X4DA 4I8TA 4GHJA 2LCVA 5HPIA 2AUWA 1EW0A 3LIEA 1DP9A 1GSVA 2J3WA 3BW6A 2XA7M 2OFYA 3ZQ5A 1GSXA 3D3OA 1MZUA 5F69A 3VV4A 1XJ6A 2OAP1 4BWIA 4JCXA 3PYPA 4EETB 4PKYG 4O8GA 2IV1A 3FMYA 2PIJA 4NXBA 4WEKA 4MCTA 1VB6A 3BD1A 3QF3A 4JQDA 2PR6A 4XT2B 2XIUA 3UMEA 1X0OA 1R69A 2IVQA 2EWVA 2PYRA 2ZOIA 3MJQA 2QWSA 2CMNA 2W1TA 2XRNA 4OOLA 3C8CA 5HWVA 2XROA 1LCDA 2VV8A 3KJXA 1SQ8A 5IT5A 3CWFA 3K2NA 1H3QA 3E4PA 3KO6A 3F1NA 2JVLA 4HIAA 4YWZA 5KSHA 3EQVA 1S7EA 2ZMVA 1OJ5A 3NHQA 2QJ7A 3V67A 3OOVA 3EQUA 4PU8A 2ZMFA 2D5VA 2KDKA 3LR4A 4ETXA 3LYXA 3P7NA 2VEAA 3PXPA 5FL3A 2L8NA 2R1JL 2NUPC 5CX7A 2MQKA 3B47A 3F1OB 3JXBC 2PR5A 2KZ8A 4EERA 2PT7A 2WUSR 2PUCA 3OMTA 5HWWA 1CQTA 3T4KA 2VGLS 2V0WA 2KOIA 3BY9A 4R70A 1UGUA 1T1BA 1NLZA 4P6ZM 4G3WA 3F51A 4FBIA 1TS0A 2V1BA 3FC7A 3QWGA 4OB4A 3S7PA 3FYMA 2FJRA 4WF0A 3MFXA 2H28A 2PDRA 1D06A 1PERL 4L9GA 5AVFA 1JFTA 4Y5FA 4I38A 2GNXA 2KEJA 4MCXA 3CLCA 1YSEA 4BBUA 1H8MA 1RZRA 2R78A 4HNBA 5J7EA 2JKRM 3T4JA 4PKYA 1DP8A 1UTXA 4JCYA 3DNVB 2GZAA 3LIBA 4F8DA 5DJTA 5F6AA 1LSXA 4LRYC 1OJGA 1T1CA 3LR5A 4HOIA 2JKTM 3A0SA 1LSVA 2LB5A 4NKPA 5A8BA 2GX5A 5G4ZA 4JGQA 4MDZA 5HPFA 2W27A 1P97A 4ME4A 3TW8A 2BJCA 1STZA 3QQ6A 3GN5A 2XSDC 3CUEC 2BNMA 1UWPX 2HJ9C 2DMWA 2QYBA 1T1AA 3EUSA 3C30A 3E98A 3IS2A 3K3DA 3KX0X 4GS9A 4R38A 4Z5HA 4UQIS 1OTEA 3S8QA 3D1NI 4Z5CA 4HQAA 3RH8B 4EQ1A 3R1FA 2YKHA 4YG7B 4G3VA 4O01A 2A6CA 3U2AA 4CLCC 2VLGA 2P08A 4H6JA 4IVZA 3T4SA 5KIZA 3IBJA 2A2LA 3LUQA 3FG8A 1T19A 2V9AA 2AW6A 3T4LA 3O5YA 3KXAA 2PUGA 3BDNA 4DMZA 4I6TA 2D01A 5F68A 1OTAA 4NXFA 1BYWA 2LYRA 3MF0A 4R3AA 4DJ3A 3EEHA 4YG1A 4LRXC 4KQOA 3HJIA 4PU4C 1OT9A 4O0PA 1MKMA 3MXQA 4FOFA 2JHEA 3OC2A 1V9ZA 4Q0IA 3SCHA 4Z5DA 1Y7YA 3KSFA 2VX8A 4XT2A 4X4FA 3T4QA 3LISA 3MR0A 3OLOA 5TJJA 3OQMA 4FSFA 1QQBA 4LPZA 2XJ3A 2JCGA 3TE8A 4CQHA 3TRBA 4PU3C 1DRMA 3GECA 4L9EA 4X4HA 3UB7A 3OQOA 4JGOA 1OT6A 1S66L 3C2WA 5DKLA 3L1PA 4IJGA 3GDIA 3LIAA 4BBTA 3OCLA 2V0UA 2KEIA 3B42A 3C38A 3CECA 3IBRA 3CITA 4AFIA 3RFBA 4OOMA 4X4EA 2P7JA 3F1OA 1WH6A 4FN3A 1E3OC 5J3WA 3OQNA 4R6LA 4J1XA 4MMNA 3R7WB 1X57A 3H9WA 4MN5A 2NUTC 3KZ3A 3BJNA 3OCNA 4Y3IA 1LT0A 2AXUA 2EBYA 4UQIM 4K08A 2Y79A 2A24B 1OTDA 2J3TD 4L0LA 1O4XA 4E04A 2EF8A 3NOPC 1POUA 4JGRA 1PNRA 2BASA 3CAXA 3EEAA 1ZZ6A 3ZHIA 2W3GA 2LYSA 4BBVA 1LCCA 4B9OA 3G5GA 1WETA 3MLFA 3JXDL 4Y42A 1S4RA 2GJ3A 2LYPA 3EGDC 3HJKA 1ZVVA 4Z1WA 3E4QA 1AU7A 3SCGA 1LMB3 3MQQA 2H8RA 2K31A 3ICYA 2PD7A 4MN7A 4X4BA 3PR6A 2LB9A 4F3LB 1P9WA 1T18A 3VK0A 1OCTC 1D7EA 4X4IA 1V9YA 4I3JA 4I6RA 3LI9A 1YSPA 2M7UA 2IA2A 3RZZA 1R63A 2AWIA 1G6OA 2ICTA 2FH5A 2B5AA 4IUKA 2W1RA 3PBTA 1N9OA 3JVUA 3MQOA 2R63A 2PUEA 2WKQA 4GHIB 2O99A 2OWJA 4HHDA 4KUOA 2HF6A 4EEPA 4L9FA 5C5KA 5DJUA 1P9RA 1F5MA 3D72A 3G6OA 2G7UA 4M4XA 4IA8A 1QP0A 4ETZA 3KSGA 1JNUA 5HSQA 5LBRA 2PUFA 1W63Q 1DW9A 2O0YA 4IUHA 3B7HA 2AXZA 2LYQA 4YG4A 2W3EA 4YBAA 4MN6A 5AVEA 5G4YA 3PBNA 2VJWA 2LYJA 1RPEL 1TS7A 1QPZA 1WA9A 2WIUB 2XA7S 3ZKCA 2Z6DA 2IU7A 3LICA 2O49A 1VPWA 3F6WA 1TF1A 2O9CA 3A0RA 4GJ4A 1OPXA 2I9VA 3HZIB 1QQAA 3IVPA 2J80A 3NJAA 3PBOA 3T50A 1QP4A 3NOUC 1L1MA 2EWWA 1ZZ8A 1Y9QA 2HSGA 1PRUA 1UWNX 3U3WA 2OWHA 4WEJA 3P01A 4ARZB 1P0ZA 3FPVA 2HV1A 3LIDA 4LRZE 3H82B 4I5SA 5DF9A 4Z59A 1N9LA 3H7WB 5DFXA 3VE3A 1N9NA 4Q0JA 3LR3A 5EFWA 3F1PB 4KUKA 4PAUA 2MJ6A 3PBQA 3QYXA 1MC0A 5TBMB 5K5BA 2XCJA 2KEKA 1XFNA 4NXGA 4GQMA 4HJ3A 5A7LA 2IVBA 4WUJA 2VGLM 1F98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SCF A;  2KEI A;  2MQK A;  1QP7 A;  2ICP A;  1JFS A;  3CEC A;  3JXB C;  2KZ8 A;  2WUS R;  1LLI A;  2PUC A;  2LYL A;  3OMT A;  4X4E A;  1WH6 A;  4FN3 A;  1E3O C;  1CQT A;  2GRM A;  2EWT A;  3OQN A;  1XWR A;  2L49 A;  1RIO A;  3G7D A;  4J1X A;  1BDH A;  1X57 A;  4YAR A;  3F51 A;  4O8B A;  4FBI A;  3KZ3 A;  3QWG A;  4OB4 A;  3FYM A;  2FJR A;  2PUA A;  2PUB A;  1PER L;  3FYA A;  4J1W A;  1ZAY A;  2AXU A;  2EBY A;  2O38 A;  2IUO A;  1JFT A;  1HF0 A;  1EFA A;  4X4G A;  1O4X A;  4PU7 A;  2KEJ A;  4MCX A;  3CLC A;  2EF8 A;  1YSE A;  1POU A;  1RZR A;  1UXD A;  1ZUG A;  1PNR A;  1ZZ6 A;  3ZHI A;  1CJG A;  2LYS A;  1UTX A;  1ZPQ A;  1LCC A;  1BDI A;  3BS3 A;  3G5G A;  1WET A;  3MLF A;  2BNN A;  4Z58 A;  5K98 B;  3JXD L;  3DNV B;  4Y42 A;  4JCY A;  4F8D A;  2CSF A;  2IVG A;  2LYP A;  2CRO A;  4NDW A;  1ZVV A;  1WH8 A;  3F52 A;  1AU7 A;  1RZS A;  3SCG A;  1LMB 3;  3JXC L;  2H8R A;  1RZR D;  4X4B A;  3VK0 A;  1OCT C;  3GBF A;  3GN5 B;  2KPJ A;  4X4I A;  4I6R A;  1NEQ A;  2BJC A;  2PPX A;  3RZZ A;  1R63 A;  2AWI A;  3QQ6 A;  2ICT A;  3GN5 A;  2XSD C;  2BNM A;  3ZHM A;  2B5A A;  1GT0 C;  3EUS A;  3LFP A;  1B0N A;  1ZZ9 A;  3UFD A;  2R63 A;  2PUE A;  1LQC A;  2AXV A;  4Z5H A;  2O4A A;  3S8Q A;  3D1N I;  4Z5C A;  4X4D A;  4I8T A;  1WIZ A;  3R1F A;  1PRA A;  4YG7 B;  1ADR A;  2A6C A;  4GHJ A;  1JWL A;  2LCV A;  1OSL A;  2AUW A;  4IA8 A;  1JH9 A;  1QP0 A;  2BNO A;  1DWK A;  4IVZ A;  2PE5 A;  2OFY A;  2LYK A;  2PUF A;  1DW9 A;  2AW6 A;  2GRL A;  2HIN A;  2AXZ A;  2LYQ A;  3B7H A;  4YG4 A;  4YBA A;  1PRV A;  3KXA A;  1ZZB A;  2PUG A;  4JCX A;  2LYJ A;  3BDN A;  1RPE L;  4I6T A;  1QPZ A;  2WIU B;  3ZKC A;  1ZS4 A;  2IV1 A;  2IU7 A;  3FMY A;  2PIJ A;  1ZZ7 A;  3O9X A;  2O49 A;  1VPW A;  2LYR A;  3F6W A;  1NER A;  4MCT A;  4YG1 A;  3HZI B;  3BD1 A;  3QF3 A;  4PU4 C;  1QQA A;  3IVP A;  4JQD A;  2XIU A;  1QP4 A;  1R69 A;  2IVQ A;  1X2L A;  1L1M A;  3SCH A;  4Z5D A;  1Y7Y A;  1ZZ8 A;  1Y9Q A;  4X4F A;  2HSG A;  2OR1 L;  1PRU A;  2MEZ A;  3U3W A;  3LIS A;  1LCD A;  2PUD A;  3OQM A;  3KJX A;  1SQ8 A;  4IWR A;  1QQB A;  1IC8 A;  2XJ3 A;  2JCG A;  4Z59 A;  2JVL A;  4I6U A;  4X4C A;  3TRB A;  1S7E A;  1UXC A;  4PU3 C;  3CRO L;  2GZU A;  3QYX A;  2XCJ A;  3H5T A;  4X4H A;  4PU8 A;  2KEK A;  3OQO A;  2D5V A;  3L1P A;  1ZZC A;  3PXP A;  3OP9 A;  4GQM A;  2L8N A;  5A7L A;  2IVB A;  2R1J L;  2XI8 A; 
#chains in the Genus database with same CATH topology
 2Y8H A;  3OPH A;  1MKI A;  2ICP A;  4KZ6 A;  1JTD A;  4DE0 A;  1U60 A;  2JE5 A;  4UA6 A;  4ZJ3 A;  5M1A A;  2PYP A;  3DW0 A;  4CLC B;  5DTK A;  1BDH A;  1NLY A;  2ZQC A;  3NBL A;  2XXP A;  1VET A;  1ERO A;  1S1Z A;  2PHY A;  3E0Y A;  2XQZ A;  4J1W A;  1ZAY A;  3PAG A;  2IUO A;  1EFA A;  4PU7 A;  5J4E A;  3CI6 A;  5I5L A;  1S0W A;  1VM1 A;  2A24 A;  5HD3 A;  3W2Z A;  4HP4 A;  2OAQ 1;  1ZPQ A;  3WS5 A;  1BDI A;  3PBR A;  4Q2J A;  5K98 B;  4Z58 A;  3V50 A;  2WYX A;  1IKG A;  3E4O A;  4R4S A;  2ZLY A;  3TJZ C;  3IXG A;  2D02 A;  3CLO A;  4PM6 A;  2OOL A;  2VGK A;  3DBA A;  3WWX A;  3UDI A;  1W7F A;  2ZC7 A;  4Q0H A;  3ZDJ A;  1IOU A;  4F3L A;  5J8X A;  3PHY A;  2WAE A;  1GHM A;  1GSW A;  4EUV A;  2L1P A;  2FZ0 A;  3S7Q A;  2O4A A;  1PRA A;  4GHI A;  1JWL A;  4EXO A;  4S2L A;  2BNO A;  1DWK A;  4G3K A;  5FI6 A;  5EE8 A;  2JKT I;  2GRL A;  3C7V A;  2XFS A;  1PRQ A;  4GDB A;  4E3N A;  1NRJ A;  5JUW A;  2DNS A;  1X2L A;  4PM5 A;  2JKF A;  1J9M A;  1F9I A;  1ERM A;  1DP6 A;  2MEZ A;  1NZU A;  1XJ4 A;  4IWR A;  1YLZ A;  3A3J A;  4ARZ A;  1ODV A;  4DXB A;  2W3F A;  2GZU A;  1LL8 A;  4WN5 A;  3H82 A;  1VEU B;  5GAH i;  4Y17 A;  2Z6C A;  1ZZC A;  3NOT C;  3V3R A;  3OP9 A;  2X02 A;  2M1C A;  3PBS A;  4HJ6 A;  2XI8 A;  2PXK A;  1S67 L;  1VHM A;  5FA7 A;  3B33 A;  5GL9 A;  2GRM A;  1ZTU A;  3E2L A;  2LLW A;  4DKI A;  1S1Y A;  5EPH A;  3UB8 A;  4CLC A;  4QU3 A;  3FYA A;  3ZG5 A;  3LCE A;  4QY5 A;  4MCW A;  4CLC E;  2O9B A;  4UA7 A;  1DJC A;  4PMA A;  3ZHH A;  2W3H A;  5HDD A;  4NDW A;  2PRF A;  2QZ6 A;  2XD1 A;  1RZS A;  3N7W A;  4I3I A;  3IT9 A;  2Y2G A;  4PM7 A;  4ER3 A;  4WL9 A;  3GN5 B;  4KZ7 A;  1L0E A;  1FOF A;  2PPX A;  1TDL A;  1MY8 A;  1RCJ A;  5EOO A;  1F98 A;  1B0N A;  5A91 A;  3MMH A;  2AXV A;  3KSH A;  4BJP A;  4EEU A;  4X4D A;  2GDN A;  4X69 A;  2PU4 A;  2AUW A;  4R0Q A;  4ER7 A;  3ZQ5 A;  5F69 A;  3VV4 A;  2Q9M A;  3UPP A;  4JXG A;  2OAP 1;  4JCX A;  3PYP A;  4D2O A;  3GRJ A;  4UA9 A;  1ES4 A;  3BFE A;  4WEK A;  4MCT A;  2P74 A;  1JVJ A;  4XT2 B;  2XIU A;  3HUO A;  4OBM A;  4EBN A;  1R69 A;  2PYR A;  3MZD A;  5FI7 A;  4GNU A;  3NZL A;  2J8Y A;  3ITA A;  2JCH A;  5IT5 A;  3KJX A;  1SQ8 A;  3BRM A;  3KO6 A;  1XGI A;  4QJG A;  3NHQ A;  4B88 A;  3C4P A;  2WKI A;  3EQU A;  1FSY A;  2D5V A;  3LR4 A;  3LYX A;  1VEU A;  4ZBE A;  5FAS A;  4JF6 A;  3P7N A;  3UB5 P;  3PXP A;  3MSH A;  4NET A;  2PR5 A;  4ZAM A;  2V2F F;  3T4K A;  2VGL S;  3A3D A;  3TOI A;  4G3W A;  3F51 A;  2V1B A;  3VP1 A;  3QWG A;  4OB4 A;  4WF0 A;  2H28 A;  2PDR A;  1I5Q A;  5AVF A;  1JFT A;  4I38 A;  1YSE A;  1PWG A;  5J7E A;  2Y2M A;  2HFZ A;  2XLN A;  4C75 A;  4LV3 A;  3DNV B;  2GZA A;  4EBP A;  1LSX A;  1OJG A;  3IX4 A;  4EKI A;  1XA7 A;  3LR5 A;  5A93 A;  2JKT M;  1N4O A;  3A0S A;  3HLW A;  2LB5 A;  4EZI A;  4NKP A;  4JGQ A;  5HPF A;  1FQG A;  1G68 A;  4OQ0 A;  5TFQ A;  1STZ A;  3GN5 A;  2XSD C;  4ZJ1 A;  2HJ9 C;  4X1M A;  2DMW A;  2QYB A;  3K3D A;  1IYP A;  4P0M A;  4E3M A;  2Q9N A;  3QP5 A;  5F83 A;  4UQI S;  3IXB A;  2ZL1 B;  4IVZ A;  2XDM A;  2A2L A;  1T19 A;  3HLF A;  4E3I A;  2AW6 A;  3KXA A;  1K56 D;  3GMW A;  1JWP A;  1N9B A;  3GZD A;  1BYW A;  4LRX C;  4FOF A;  2JHE A;  3OC2 A;  1V9Z A;  1Q2P A;  3SCH A;  4OPZ A;  2VX8 A;  4XT2 A;  3IWO A;  1K4E A;  1HQ1 A;  2G2U A;  3M6B A;  3N8R A;  2JCG A;  2V1Z A;  4QHC A;  3W4O A;  4WZ5 A;  3LEQ A;  4L9E A;  4X4H A;  3HUM A;  4JGO A;  1OT6 A;  1S66 L;  3C2W A;  5DKL A;  5KMW A;  2FFF B;  3VP3 A;  3SS4 A;  3BFF A;  3B42 A;  3C38 A;  3IBR A;  4JXV A;  3CIT A;  3RFB A;  5DTQ A;  2Y55 A;  1E3O C;  4XXR A;  3T1X A;  5J3W A;  4FD8 A;  1J3W A;  2J7U A;  5EEC A;  1HVB A;  5EV0 A;  3VSL A;  4Y3I A;  4X25 A;  1BLC A;  4S2N A;  2W3G A;  1HD8 A;  3ZFZ A;  3IHA A;  4KQR A;  1FR1 A;  5AQ7 A;  4B9O A;  3G5G A;  3JXD L;  1M40 A;  2XR0 A;  5CHM A;  2H0T A;  4DE8 A;  1H0M A;  4C6Y A;  3SCG A;  2Y2Q A;  2H8R A;  4X4B A;  3HLB A;  2LB9 A;  1P9W A;  4MLL A;  4JKT A;  3M2K A;  4RA7 A;  1K0K A;  4BLM A;  2AWI A;  2B5A A;  1N9O A;  1OME A;  3MQO A;  3QP2 A;  2WKQ A;  2O99 A;  5A92 A;  4HHD A;  5GHZ A;  3IWI A;  5DJU A;  1RP5 A;  3R09 A;  1F5M A;  4OPY A;  3NEC A;  3QNC A;  2ZL1 A;  1KDS A;  2E8I A;  5HSQ A;  4OQI A;  1BLP A;  3IF6 C;  2PUF A;  2O0Y A;  2LLV A;  1W63 Q;  1XPB A;  3B7H A;  2LYQ A;  4YG4 A;  5G4Y A;  2RCX A;  5AVE A;  2EX6 A;  3O88 A;  4R23 A;  2LYJ A;  1RPE L;  2XA7 S;  3ZKC A;  3NY4 A;  2O49 A;  3QP4 A;  2XXQ A;  3F6W A;  1W8Y A;  3A0R A;  4GJ4 A;  1KGE A;  3HZI B;  1LLB A;  4U0X A;  1JTG A;  5FEG A;  2EWW A;  1Y9Q A;  2WAD A;  2OWH A;  4BQM A;  3P01 A;  1P0Z A;  1SHV A;  3UY6 A;  2HV1 A;  5KSC A;  3H7W B;  3VE3 A;  3NXH A;  1N9N A;  1BUL A;  4Q0J A;  4PAU A;  2MJ6 A;  3QYX A;  1MC0 A;  5K5B A;  4HBT A;  4UAA A;  1WYC A;  2KEK A;  1YM1 A;  4OP8 A;  4EK9 A;  2WAF A;  1YLP A;  1BLH A;  4D60 A;  2VGL M;  2B5R A;  2W3D A;  2V20 A;  2WGI A;  3L9K A;  3BWL A;  1YPR A;  2ODR D;  1RIO A;  1H8Z A;  1NWZ A;  2B95 A;  1IEM A;  2JBF A;  1ERQ A;  4BD0 A;  5CED A;  4PHT A;  1JWZ A;  4WLA A;  1HF0 A;  4UEY A;  2XXA A;  3BQ8 A;  2P04 A;  3D4F A;  1ONH A;  1UXD A;  2K7S A;  4I3A A;  2EX8 A;  4N1X A;  2BNN A;  1NY0 A;  4PM8 A;  4CLC D;  1ACF A;  1Z6F A;  5HDC A;  4LLO B;  4NEE D;  4Y0U A;  1AXB A;  3FYZ A;  4LV1 A;  3UB9 A;  3BLM A;  4S2M A;  2JN7 A;  1KVM A;  3WS1 A;  2JKG A;  3ZHM A;  1TS6 A;  3JYI A;  3UE6 A;  4S2J A;  1OTI A;  4OP5 A;  4P6B A;  5EVI B;  2A3U A;  3QFI A;  2JQE A;  2PE5 A;  2ZOH A;  1ONG A;  3Q7V B;  1OTB A;  3FWL A;  1YLY A;  3S4X A;  4RQ9 A;  4I39 A;  1YKD A;  2YKF A;  4ZTK A;  2VV7 A;  5F5Y A;  2OR1 L;  3ZPX A;  1ZHH B;  2WKR A;  3CMZ A;  2VA0 A;  5L07 A;  1RGZ A;  3LY3 A;  4N9L A;  1G28 A;  4X4C A;  3KYZ A;  1HZO A;  3H7W A;  4X55 A;  4DE1 A;  3LFV A;  4R3J A;  5HL6 A;  2ZQ9 A;  3GQZ A;  3M9L A;  2HGV A;  3BY8 A;  2L49 A;  2HCS A;  4MEZ A;  3NUL A;  2ZC5 B;  2B18 A;  2XSS A;  4ZJ2 A;  1FR6 A;  1Y28 A;  2K2N A;  2WZX A;  3DWZ A;  1ZUG A;  4KZ3 A;  4DJ2 A;  3GZC A;  1TD5 A;  3S7O A;  4EWF A;  3MXR A;  4MBH A;  3MQ0 A;  3LI8 A;  3HCY A;  2J3T C;  2Y2L A;  1GT0 C;  2HCN A;  3LFP A;  3KSI A;  4GLQ A;  1XA1 A;  4I8T A;  4ZDX A;  2LCV A;  5HPI A;  1EW0 A;  2J3W A;  3TSG A;  2XA7 M;  3T1S A;  5EVI A;  3D3O A;  3FKV A;  1MZU A;  4BWI A;  3Q7V A;  3GSG A;  4EET B;  5FAP A;  2Y2H A;  2AVX A;  3IF5 A;  4KG2 A;  1X0O A;  2IVQ A;  1E4D A;  3MJQ A;  2CMN A;  2IWC A;  2XRN A;  3C8C A;  1MWR A;  4P85 A;  4JF4 A;  1K54 A;  3OZH A;  2ZM8 A;  4NG2 A;  2ZMV A;  2HP5 A;  2QJ7 A;  3V67 A;  5HX9 A;  3OOV A;  1PI5 A;  3SS3 A;  1QZX A;  4BEN A;  5TR7 A;  2L8N A;  1KE0 A;  3Q1F A;  1TEM A;  3F1O B;  1ES5 A;  4EER A;  1CQT A;  4IBX A;  4E3O A;  1UGU A;  4IBR A;  4FBI A;  3NCK A;  4LCM A;  3IQA A;  3FYM A;  5DF7 A;  4WVL A;  3MFX A;  3SZT A;  4Y5F A;  3P98 A;  1XP4 A;  4E3L A;  2GNX A;  1SCW A;  4BBU A;  1RZR A;  4QWO A;  1DP8 A;  1UTX A;  3OPP A;  4JCY A;  1TVF A;  2CC1 A;  5F82 A;  3LIB A;  4F8D A;  4LRY C;  3LEZ A;  1T1C A;  1K55 C;  4S2P A;  1YMX A;  3QHY A;  3ZGA B;  3DTI A;  3W4P A;  3A3E A;  1PZO A;  4U3T A;  2ZQD A;  1P97 A;  3TW8 A;  5FQ9 A;  2BJC A;  5DT2 A;  3QQ6 A;  3CUE C;  2BNM A;  1UWP X;  3KX0 X;  2ZC4 B;  3C30 A;  3S22 A;  4OQH A;  3CHW P;  1W8Q A;  4R38 A;  4Z5H A;  1OTE A;  4Z5C A;  4HQA A;  2PXV A;  2ZQA A;  3IH8 A;  3U2A A;  2A6C A;  2ZQ7 A;  3ZNY A;  1MBL A;  2VLG A;  3T4S A;  2V9A A;  2Y2P A;  2PUG A;  4DMZ A;  4I6T A;  2XK1 A;  4M3K A;  4R3A A;  4KQO A;  3HJI A;  3A9Y A;  4O0P A;  2OSU A;  2H0Y A;  4Q0I A;  4Z5D A;  4DE2 A;  3MS6 A;  4GD6 A;  2X71 A;  4X56 A;  5CGW A;  4FSF A;  3VFF A;  3PAE A;  2XJ3 A;  4DE3 A;  3TE8 A;  3UB7 A;  1PIO A;  1NW3 A;  4F94 A;  3L1P A;  4H8R A;  5M19 A;  1KE3 A;  4WZ4 A;  3F1O A;  1WH6 A;  4MNR A;  2BTF P;  1PWD A;  2PAV P;  4WZ5 C;  1K38 A;  4WYY A;  1YMS A;  1FIL A;  5GLC A;  3KZ3 A;  3BJN A;  4CPK A;  3OCN A;  1LT0 A;  3PTE A;  1OTD A;  4E04 A;  2XD5 A;  3CAX A;  1ZZ6 A;  3ZHI A;  2PXU A;  2PXF A;  4OKP A;  4Y0O A;  4X6T A;  2GJ3 A;  3HL9 A;  5M18 A;  3I7J A;  3HJK A;  3V5M A;  5A90 A;  1NYM A;  4MN7 A;  3PR6 A;  2WKH A;  3M6H A;  1OCT C;  1PYY A;  4GD8 A;  4S2N C;  1BZA A;  1K6R A;  5FQJ A;  3B3X A;  1HTZ A;  4I6R A;  3BM6 A;  1DUL A;  2IA2 A;  1R63 A;  4IUK A;  3BFD A;  2W1R A;  3SH7 A;  3TEP A;  1ES2 A;  3JVU A;  2PUE A;  5DRT A;  4KUO A;  2HF6 A;  3DTM A;  5C5K A;  1MPL A;  1P9R A;  4M4X A;  4IA8 A;  1QP0 A;  2Y59 A;  4ETZ A;  2PXP A;  2VGJ A;  5U47 A;  5LBR A;  3GR2 A;  1DW9 A;  4Z9Q A;  2AXZ A;  2W3E A;  4DXC A;  4OPR A;  2XGN A;  1K4F A;  4E6W A;  3M2J A;  2QMI A;  3LIC A;  1ALQ A;  3ME5 A;  1VPW A;  1OPX A;  2Y2O A;  2J80 A;  3NJA A;  1FCO A;  1QP4 A;  2DCF A;  3CJM A;  1ZZ8 A;  1EI5 A;  1TDG A;  4WEJ A;  4WMC A;  3LID A;  3CZD A;  5DFX A;  3LR3 A;  3F1P B;  3Q82 A;  3PBQ A;  2R9X A;  3WS0 A;  4S2K A;  1KVL A;  2EX2 A;  4HJ3 A;  2IVB A;  1BLS A;  3A9Z A;  4S2O A;  1PNE A;  2WGW B;  5L10 A;  5FDS A;  3NC8 A;  5FQQ A;  3G2Z A;  1Y4O A;  1XWR A;  4EKG A;  1YLW A;  3UB6 A;  4HY8 A;  4HRA A;  4FH2 A;  2XEP A;  1YAX A;  3O87 A;  3VOL A;  4O8B A;  4Y2F A;  2PUA A;  5HFO A;  5E2E A;  2ZBB A;  4N1H A;  5AJG A;  2ZM2 A;  3R4K A;  4GW9 A;  2ZD8 A;  3VE4 A;  5CTM A;  3RJU A;  4KZ4 A;  3T4T A;  3JXC L;  2PD8 A;  2B02 A;  5DFY A;  2V8C A;  2EXB A;  1L2S A;  2L1M A;  2WKE A;  2HJE A;  5EOE A;  3EWK A;  3S1Y A;  5HWT A;  1K6S A;  4EES A;  1H5X A;  3HVF A;  4ZRR A;  1LQC A;  3ZCZ A;  3T1Q B;  4DN0 A;  2KLI A;  1ADR A;  5AQA A;  4EV4 A;  1JH9 A;  1OSL A;  2Z2L B;  4IHQ A;  4HJ4 A;  3UNW A;  3RTY A;  5EVL A;  4HH2 A;  4R4R A;  4R3B A;  2V8F A;  4LV0 A;  1PRV A;  1ZZB A;  1GA9 A;  3ZYT A;  3OBF A;  5IU1 A;  1ZZ7 A;  3T12 B;  3ZG0 A;  4NK3 A;  4GDN A;  2W1T B;  2M7V A;  5EVI D;  3HLG A;  1I2S A;  3F1N B;  2PUD A;  3CPT B;  2L4R A;  2Q0O A;  1IYQ A;  2X01 A;  1UXC A;  3CRO L;  5FAT A;  4OOY A;  1BT5 A;  4OON A;  5IS1 A;  4WM9 A;  3F1P A;  4HEF A;  2QKP A;  3DAV A;  4LEN A;  3ULF A;  1GCE A;  3S7N A;  5GAG i;  5HZH A;  3SCF A;  1JFS A;  2Y2N A;  1LSW A;  1PI4 A;  3G31 A;  3KL4 A;  2LYL A;  4II7 A;  4JPM A;  2WGW A;  2EWT A;  3NRO A;  3UE3 A;  2HP9 A;  3ZG8 B;  3G7D A;  3TRC A;  4PM9 A;  2W0N A;  5EVE A;  4YAR A;  1TS8 A;  2O9A A;  2PUB A;  2VKS A;  3UE0 A;  1S4S A;  1K57 A;  2EX9 A;  4K0W A;  4B93 A;  3VFH A;  4WBG A;  5FEF A;  3MXS A;  2ZQ8 A;  1CJG A;  2PU2 A;  3C7U A;  4JLF A;  1MWT A;  3QP6 A;  3HLD A;  3G2Y A;  5AQB A;  1CI8 A;  2CSF A;  3JVV A;  2QHK A;  4QPR A;  1L0F A;  3F52 A;  4KG6 A;  1RZR D;  2VZW A;  3MZE A;  3NDG A;  5HL1 A;  5BOH A;  2C6W B;  3OWQ A;  4GS9 B;  3DTK A;  1W79 A;  1ZZ9 A;  4RYE A;  4JF5 A;  4HH3 A;  1YSQ A;  4H6J B;  5FDH A;  1MFQ C;  1E3U A;  4GHJ A;  2BG1 A;  1GSV A;  3WS2 A;  3BW6 A;  3LY4 A;  2OFY A;  1GSX A;  4UHU A;  3SOI A;  3G30 A;  1QMF A;  4EUZ A;  4IED A;  2M4H A;  3UN7 A;  4PKY G;  2PIJ A;  1NRF A;  3ZG9 B;  3GVB A;  1VB6 A;  3BD1 A;  3QF3 A;  1QME A;  2PR6 A;  2ZM0 A;  5F1G A;  1I2W A;  1SDE A;  4P87 A;  2QWS A;  3SS5 A;  2OLV A;  2W1T A;  4OOL A;  1LCD A;  2VV8 A;  3CWF A;  4OLD A;  3F1N A;  4HIA A;  3EQV A;  1S7E A;  3CPT A;  4RVA A;  4B4Z A;  3A3I A;  4IVI A;  1GHI A;  2KDK A;  1H8Y A;  2VEA A;  3WRT A;  2R1J L;  1NJ4 A;  2NUP C;  3G4P A;  5CX7 A;  2MQK A;  5EM0 A;  3JXB C;  2KZ8 A;  1CK3 A;  2PT7 A;  2Y91 A;  2XH9 A;  2PUC A;  3OKZ A;  2QPN A;  3BY9 A;  2V0W A;  2KOI A;  4LGW A;  4R70 A;  3IWQ A;  2Y2I A;  1AWI A;  1NLZ A;  1TS0 A;  1NYY A;  1D06 A;  1DJB A;  4L9G A;  1LI9 A;  3LGO A;  2KEJ A;  3CLC A;  1H8M A;  2R78 A;  1FIK A;  3T4J A;  2PXE A;  4GZB A;  2PBD P;  1RGY A;  2DRW A;  1S6R A;  5DJT A;  1ESI A;  2IWD A;  3GUU A;  1Y54 A;  4HOI A;  1HLU P;  2EXA A;  4DDY A;  3HLC A;  1W5D A;  4X53 A;  3UDX A;  2WUQ A;  1KDW A;  4KG5 A;  5A8B A;  5G4Z A;  2ZMA A;  4U0T A;  1M6K A;  4LV2 A;  4BD1 A;  1T1A A;  3EUS A;  3E98 A;  4QY6 A;  4GS9 A;  1GA0 A;  4C3Q A;  3R1F A;  4G3V A;  1GHP A;  4HES A;  4CLC C;  4H6J A;  5KIZ A;  3IBJ A;  4ER5 A;  3LUQ A;  2PBY A;  3FG8 A;  5DTT A;  3AGF A;  2D01 A;  3V3S A;  2PXQ A;  1BTL A;  4NXF A;  2J9P A;  2IWB A;  1CF0 A;  5HAP A;  4YG1 A;  1MKM A;  3MXQ A;  2E8J A;  3HBR A;  1Y7Y A;  4KZ8 A;  5GHX A;  3QP1 A;  3IXD A;  1CQA A;  5EM1 A;  4E3J A;  3OQM A;  3W8K A;  4CQH A;  5AQ9 A;  3GEC A;  3HRE A;  3OQO A;  4RX2 A;  4IJG A;  1FCN A;  3LIA A;  4WMC D;  4BBT A;  5E2G A;  2V0U A;  5F1F A;  3N8L A;  5CTN A;  2VEO A;  3L7H A;  4YIN A;  4OOM A;  4KEN B;  1VQQ A;  2P7J A;  4FN3 A;  3OQN A;  4R6L A;  4J1X A;  4MMN A;  3R7W B;  1ESU A;  1X57 A;  4MN5 A;  2HP6 A;  4FTX A;  5CER A;  3WS4 A;  1QB2 A;  2AXU A;  1ZKJ A;  4L0L A;  1O4X A;  2EF8 A;  3NOP C;  4JGR A;  1PNR A;  2BAS A;  1XKZ A;  1LCC A;  5E43 A;  1WET A;  3MLF A;  5GLB A;  3BYD A;  1XXM A;  3GTC A;  3EGD C;  4Z1W A;  3G35 A;  3Q81 A;  3RXW A;  2VK3 A;  2K31 A;  3W4Q A;  3VOY A;  1T18 A;  3VK0 A;  1KE4 A;  5GLD A;  1D7E A;  1YLT A;  1KGF A;  1XGJ A;  3LI9 A;  1YSP A;  2M7U A;  2Y2J A;  1G6O A;  2FH5 A;  4ESP A;  3PBT A;  3OPR A;  3MBZ A;  4DF6 A;  3CG5 A;  4EEP A;  3U4L P;  3G6O A;  4LCL A;  2C5W B;  3UE1 A;  3P09 A;  4IUH A;  2LNM A;  3QOW A;  3PBN A;  2VJW A;  1TS7 A;  1QPZ A;  1WA9 A;  4MBF A;  2IU7 A;  2ZC6 B;  4Q8I A;  3IHB A;  3LQX A;  2I9V A;  1QQA A;  3T50 A;  4A5R A;  3FZC A;  1L1M A;  2HSG A;  3O3V A;  1PRU A;  1UWN X;  3UPN A;  3U3W A;  1CJF A;  3FPV A;  5JYP A;  4R1G A;  4LRZ E;  4I5S A;  5DF9 A;  4Z59 A;  2P9V B;  4KUK A;  3NDE A;  5TBM B;  2XCJ A;  3MKE A;  3RXX A;  1PFL A;  4N9K A;  4Y15 A;  5FQM A;  4O7D A;  4NXG A;  2H10 A;  4GQM A;  1O07 A;  5A7L A;  4WUJ A;  3G34 A;  4Y7P A;  5FQK A;  1QP7 A;  5CEC A;  1D1J A;  1LLI A;  5HAQ A;  4HI4 A;  3PE5 A;  1SKO B;  3VP4 A;  2V3C C;  3FV7 A;  3GZD C;  3R7W A;  3KYQ A;  1LI0 A;  4EW7 A;  3DM5 A;  3LIF A;  1FCM A;  4BL2 A;  3BQA A;  3MZF A;  4X4G A;  4P6Z S;  1F2K A;  5DKK A;  3HLE A;  3AGD A;  3UWP A;  2INW A;  3BS3 A;  1CI9 A;  2UV0 E;  4NXE A;  3BFC A;  4N92 A;  2CRO A;  3E2K A;  1WH8 A;  1U2Z A;  3A9X A;  2L0W A;  3UDF A;  3MFD A;  3N4I A;  2QJ5 A;  2EFU A;  3OPL A;  3GBF A;  3SR4 A;  4YNR A;  4YOF A;  2KPJ A;  4JBF A;  2KX6 A;  1NEQ A;  5EUA A;  2EFX A;  1KGG A;  3UMD A;  3C4O A;  4FCF A;  5D3O A;  1BUE A;  3UFD A;  1L0G A;  2MXD A;  2JKR I;  5HD5 A;  5MC7 A;  1WIZ A;  5E2F A;  2OV5 A;  4BL3 A;  2LYK A;  3A0V A;  4E3K A;  2HIN A;  2J9O A;  2G2W A;  2H5S A;  1ZG6 A;  3LO7 A;  4DDS A;  1ZS4 A;  3O9X A;  3LR0 A;  1E3U D;  1NER A;  3G0T A;  4MBK A;  3Q7Z A;  2XF3 A;  3AGE A;  4GCZ A;  1C3B A;  1CEF A;  2ZC3 B;  1XFQ A;  1SKF A;  5DTS A;  1IC8 A;  3K3C A;  4JGP A;  1XJ2 A;  4I6U A;  1K55 A;  5GLA A;  3NIA A;  3VMA A;  3SW1 A;  2J7V A;  3H5T A;  1XX2 A;  3EOI A;  2P9V A;  3KYE A;  3T4O A;  1ZC2 A;  2I72 A;  2Z2M B;  5TBM A;  5KZH A;  2HZ5 A;  3IX3 A;  1LHY A;  4WEL A;  2WKP A;  3CUE A;  2EA9 A;  3IX8 A;  3IXH A;  3HUN A;  3VP2 A;  1W63 M;  1MXO A;  2BLS A;  2FFY A;  1NZO A;  5CGS A;  3SH8 A;  1SKO A;  5L2F A;  2O38 A;  1JWV A;  5L8M A;  4EU0 A;  3QNB A;  5TGF A;  4OLG A;  3SX0 A;  4KQD A;  1Z09 A;  4K91 A;  4LFU A;  1O7E A;  2IVG A;  2VV6 A;  3TEL A;  3ZVW A;  4IVK A;  1K57 C;  3FPW A;  4HP9 A;  1DY6 A;  4GN2 A;  4S2I A;  1G5U A;  3ZNT A;  1IFQ A;  2HDS A;  3IS2 B;  3BFG A;  1KOU A;  3EGX C;  2V1A A;  5HAI A;  5CRF A;  2PXT A;  1XJ3 A;  1IYS A;  4KZ5 A;  5HDS A;  4BMW A;  2UWX A;  1WYB A;  1YT4 A;  3DWK A;  3A3F A;  1SZV A;  2HDU A;  2JC7 A;  3LIE A;  4JXS A;  1DP9 A;  4DRT A;  4KZ9 A;  1XJ6 A;  4KQQ A;  1PZP A;  4O8G A;  2IV1 A;  3FMY A;  4NXB A;  4KZB A;  3V39 A;  1IYO A;  1PW1 A;  5HW3 A;  4JQD A;  3MEJ A;  3UME A;  2PXD A;  2EWV A;  1EWZ A;  2ZOI A;  3JPU A;  2HDQ A;  2ACG A;  5HWV A;  2XRO A;  4PPR A;  3K2N A;  1H3Q A;  3E4P A;  2JVL A;  4YWZ A;  5KSH A;  5FAQ A;  1OJ5 A;  5IHV A;  2R9W A;  4PU8 A;  2ZMF A;  4ETX A;  1PWC A;  5FL3 A;  1PW8 A;  3B47 A;  3QP8 A;  4HBU A;  2WUS R;  4EQZ A;  1Q2Q A;  3OMT A;  5HWW A;  4E6X A;  3ZG7 B;  1T1B A;  4P6Z M;  3ISG A;  3FC7 A;  1NXY A;  3S7P A;  2FJR A;  5I94 A;  1PER L;  2HPB A;  2HDR A;  3TFL A;  2PXB A;  5DF8 A;  4MCX A;  3D9Y A;  1MWS A;  4HNB A;  2JKR M;  4PKY A;  5DTM A;  5FSR A;  3FKW A;  4CJN A;  4Y13 A;  5F6A A;  3VWS A;  5DTR A;  4ER0 A;  1LSV A;  3BEC A;  2GX5 A;  3IF6 B;  4MDZ A;  3DTE A;  2W27 A;  4ME4 A;  5CEB A;  3IS2 A;  3BLS A;  1MWU A;  4X68 A;  3S8Q A;  3D1N I;  3RH8 B;  4EQ1 A;  4KZA A;  2YKH A;  2OLU A;  4YG7 B;  4O01 A;  3O86 A;  4XUZ A;  2P08 A;  5FAO A;  1LL9 A;  4GB7 A;  3T4L A;  2YBD A;  1K25 A;  3O5Y A;  5L09 A;  3BDN A;  1YLJ A;  5F68 A;  3MKF A;  1OTA A;  2Y2K A;  4B4X A;  3MF0 A;  2LYR A;  4DJ3 A;  3EEH A;  1G6A A;  5FI2 A;  1IEL A;  2J7W A;  4PU4 C;  1OT9 A;  3QOX A;  3N8S A;  5G18 A;  3KSF A;  4X4F A;  4GOG A;  3T4Q A;  3LIS A;  3MR0 A;  1DJA A;  3OLO A;  1ZG4 A;  5TJJ A;  1QQB A;  4LPZ A;  4ER6 A;  5CXW A;  3TRB A;  2WGV A;  4PU3 C;  2WZZ A;  5HAR A;  3N6I A;  5CHU A;  1DRM A;  5CGX A;  4OPQ A;  3BEB A;  4ID4 A;  3GDI A;  1IKI A;  3IH9 A;  2KEI A;  1LL5 A;  3CEC A;  4JXW A;  5DSX A;  4AFI A;  4X4E A;  5EVI C;  3SH9 A;  1CEG A;  1VET B;  3VOZ A;  3H9W A;  2NUT C;  2XFT A;  3G32 A;  1E25 A;  5GHY A;  4UQI M;  2EBY A;  3ITB A;  4K08 A;  2Y79 A;  2A24 B;  2J3T D;  3NI9 A;  4X1L A;  1POU A;  1L0D A;  5FQI A;  3EEA A;  2LYS A;  4BBV A;  4Y42 A;  2PXL A;  1K54 C;  1S4R A;  4QB8 A;  2LYP A;  1ZVV A;  3E4Q A;  1AU7 A;  3MQQ A;  1LMB 3;  2FFH A;  2WK0 A;  4DE9 A;  3ICY A;  2PD7 A;  4F3L B;  3ZVT A;  4X4I A;  1V9Y A;  4I3J A;  1ES3 A;  3IF6 A;  4EBL A;  3RZZ A;  5E2H A;  2ICT A;  1L3L A;  3T1R A;  4GKU A;  2R63 A;  1A0K A;  1K56 A;  4GHI B;  2OWJ A;  4Y0T A;  2Y4A A;  4K0X A;  1BSG A;  4QD4 A;  4L9F A;  3VP0 A;  3C5A A;  3D72 A;  2G7U A;  3UO9 A;  5DRY A;  5DVA A;  3KSG A;  1JNU A;  3NDB B;  4MN6 A;  5JYO A;  4YBA A;  3TG9 A;  4YFM A;  2WIU B;  1YQS A;  2Z6D A;  4FH4 A;  1TF1 A;  2O9C A;  5CHJ A;  3IVP A;  3PBO A;  3NOU C;  2ZJ9 A;  3Q07 A;  3GV9 A;  4OVD A;  2A49 A;  4EQI A;  4FUW A;  4ARZ B;  3VSK A;  4RX3 A;  3H82 B;  1N9L A;  4OH0 A;  2RL3 A;  3UPO A;  5EFW A;  4XUX A;  1WE4 A;  3WRZ A;  1FSW A;  4OQG A;  1XFN A;  1SDN A;  3OCL A; 
#chains in the Genus database with same CATH homology
 2Y8H A;  1QP7 A;  2ICP A;  1LLI A;  2W3D A;  3BWL A;  2PYP A;  1XWR A;  1RIO A;  4HI4 A;  4CLC B;  1NWZ A;  3UB6 A;  1BDH A;  1NLY A;  4HY8 A;  1YAX A;  3VOL A;  4O8B A;  4Y2F A;  2PUA A;  2PHY A;  1S1Z A;  3KYQ A;  3R7W A;  4EW7 A;  3E0Y A;  4J1W A;  1ZAY A;  4PHT A;  3LIF A;  4WLA A;  2IUO A;  1HF0 A;  1EFA A;  3BQA A;  2ZBB A;  4X4G A;  4P6Z S;  4PU7 A;  3BQ8 A;  4UEY A;  2P04 A;  5J4E A;  3CI6 A;  1UXD A;  2K7S A;  5AJG A;  5DKK A;  5I5L A;  2A24 A;  5HD3 A;  4I3A A;  3W2Z A;  4HP4 A;  2OAQ 1;  1ZPQ A;  2INW A;  1BDI A;  3BS3 A;  3PBR A;  3R4K A;  4GW9 A;  2BNN A;  4Z58 A;  5K98 B;  4CLC D;  3VE4 A;  4NXE A;  3E4O A;  2CRO A;  5HDC A;  4LLO B;  3TJZ C;  1WH8 A;  2D02 A;  3CLO A;  2OOL A;  4NEE D;  3T4T A;  2L0W A;  3JXC L;  2PD8 A;  3DBA A;  2B02 A;  5DFY A;  2QJ5 A;  3UB9 A;  4Q0H A;  3GBF A;  2L1M A;  2JN7 A;  4YNR A;  4YOF A;  2KPJ A;  1IOU A;  2KX6 A;  4F3L A;  1NEQ A;  2HJE A;  3EWK A;  3PHY A;  1GSW A;  4EUV A;  3ZHM A;  1TS6 A;  5HWT A;  2FZ0 A;  3UMD A;  4EES A;  3UFD A;  4ZRR A;  3S7Q A;  2JKR I;  1LQC A;  2O4A A;  5HD5 A;  3UE6 A;  5MC7 A;  4DN0 A;  2KLI A;  1WIZ A;  1OTI A;  1PRA A;  1ADR A;  4GHI A;  1JWL A;  1JH9 A;  1OSL A;  4IHQ A;  4EXO A;  2BNO A;  1DWK A;  4HJ4 A;  4G3K A;  2PE5 A;  3RTY A;  2ZOH A;  2LYK A;  3A0V A;  4HH2 A;  2JKT I;  2GRL A;  2HIN A;  1OTB A;  1PRV A;  1ZZB A;  3ZYT A;  4RQ9 A;  1NRJ A;  3OBF A;  1ZS4 A;  4I39 A;  5IU1 A;  3O9X A;  1ZZ7 A;  3LR0 A;  1YKD A;  1NER A;  2YKF A;  2VV7 A;  5F5Y A;  2W1T B;  1X2L A;  4GCZ A;  2M7V A;  1F9I A;  2OR1 L;  1DP6 A;  2MEZ A;  1XFQ A;  1XJ4 A;  3F1N B;  1ZHH B;  2PUD A;  2WKR A;  4IWR A;  2VA0 A;  2L4R A;  1IC8 A;  3K3C A;  4JGP A;  4ARZ A;  1ODV A;  1XJ2 A;  4I6U A;  4X4C A;  1G28 A;  2W3F A;  3KYZ A;  1UXC A;  3CRO L;  2GZU A;  1LL8 A;  4WN5 A;  3H82 A;  3H7W A;  3SW1 A;  3H5T A;  3EOI A;  5IS1 A;  2Z6C A;  3F1P A;  3ULF A;  2QKP A;  3T4O A;  1ZZC A;  3NOT C;  5TBM A;  3OP9 A;  3S7N A;  5HZH A;  2M1C A;  3LFV A;  3PBS A;  4HJ6 A;  2XI8 A;  3SCF A;  1S67 L;  4WEL A;  2WKP A;  1JFS A;  1LSW A;  5HL6 A;  1VHM A;  3CUE A;  2EA9 A;  2HGV A;  2LYL A;  4II7 A;  3B33 A;  3BY8 A;  2GRM A;  2EWT A;  2L49 A;  1W63 M;  1ZTU A;  3UE3 A;  3G7D A;  3TRC A;  2W0N A;  4YAR A;  1S1Y A;  3UB8 A;  1TS8 A;  2B18 A;  4CLC A;  2O9A A;  2XSS A;  2PUB A;  2VKS A;  3FYA A;  2O38 A;  1S4S A;  1Y28 A;  5L8M A;  4EU0 A;  4B93 A;  2K2N A;  1ZUG A;  4MCW A;  1CJG A;  4CLC E;  2O9B A;  4DJ2 A;  4KQD A;  2CSF A;  3JVV A;  2IVG A;  2QHK A;  2W3H A;  5HDD A;  1TD5 A;  4NDW A;  4QPR A;  2VV6 A;  3F52 A;  4I3I A;  1RZS A;  3S7O A;  3FPW A;  4HP9 A;  1RZR D;  2VZW A;  4WL9 A;  1IFQ A;  3MQ0 A;  3GN5 B;  3IS2 B;  2PPX A;  1KOU A;  3EGX C;  4GS9 B;  2V1A A;  3LI8 A;  3HCY A;  1XJ3 A;  2J3T C;  5HDS A;  4BMW A;  1GT0 C;  3LFP A;  1B0N A;  1ZZ9 A;  3KSI A;  4GLQ A;  3MMH A;  4HH3 A;  2AXV A;  1YSQ A;  3KSH A;  4BJP A;  4EEU A;  4H6J B;  4X4D A;  4I8T A;  4GHJ A;  2LCV A;  5HPI A;  2AUW A;  1EW0 A;  3LIE A;  1DP9 A;  1GSV A;  2J3W A;  3BW6 A;  2XA7 M;  2OFY A;  3ZQ5 A;  1GSX A;  3D3O A;  1MZU A;  5F69 A;  3VV4 A;  1XJ6 A;  2OAP 1;  4BWI A;  4JCX A;  3PYP A;  4EET B;  4PKY G;  4O8G A;  2IV1 A;  3FMY A;  2PIJ A;  4NXB A;  4WEK A;  4MCT A;  1VB6 A;  3BD1 A;  3QF3 A;  4JQD A;  2PR6 A;  4XT2 B;  2XIU A;  3UME A;  1X0O A;  1R69 A;  2IVQ A;  2EWV A;  2PYR A;  2ZOI A;  3MJQ A;  2QWS A;  2CMN A;  2W1T A;  2XRN A;  4OOL A;  3C8C A;  5HWV A;  2XRO A;  1LCD A;  2VV8 A;  3KJX A;  1SQ8 A;  5IT5 A;  3CWF A;  3K2N A;  1H3Q A;  3E4P A;  3KO6 A;  3F1N A;  2JVL A;  4HIA A;  4YWZ A;  5KSH A;  3EQV A;  1S7E A;  2ZMV A;  1OJ5 A;  3NHQ A;  2QJ7 A;  3V67 A;  3OOV A;  3EQU A;  4PU8 A;  2ZMF A;  2D5V A;  2KDK A;  3LR4 A;  4ETX A;  3LYX A;  3P7N A;  2VEA A;  3PXP A;  5FL3 A;  2L8N A;  2R1J L;  2NUP C;  5CX7 A;  2MQK A;  3B47 A;  3F1O B;  3JXB C;  2PR5 A;  2KZ8 A;  4EER A;  2PT7 A;  2WUS R;  2PUC A;  3OMT A;  5HWW A;  1CQT A;  3T4K A;  2VGL S;  2V0W A;  2KOI A;  3BY9 A;  4R70 A;  1UGU A;  1T1B A;  1NLZ A;  4P6Z M;  4G3W A;  3F51 A;  4FBI A;  1TS0 A;  2V1B A;  3FC7 A;  3QWG A;  4OB4 A;  3S7P A;  3FYM A;  2FJR A;  4WF0 A;  3MFX A;  2H28 A;  2PDR A;  1D06 A;  1PER L;  4L9G A;  5AVF A;  1JFT A;  4Y5F A;  4I38 A;  2GNX A;  2KEJ A;  4MCX A;  3CLC A;  1YSE A;  4BBU A;  1H8M A;  1RZR A;  2R78 A;  4HNB A;  5J7E A;  2JKR M;  3T4J A;  4PKY A;  1DP8 A;  1UTX A;  4JCY A;  3DNV B;  2GZA A;  3LIB A;  4F8D A;  5DJT A;  5F6A A;  1LSX A;  4LRY C;  1OJG A;  1T1C A;  3LR5 A;  4HOI A;  2JKT M;  3A0S A;  1LSV A;  2LB5 A;  4NKP A;  5A8B A;  2GX5 A;  5G4Z A;  4JGQ A;  4MDZ A;  5HPF A;  2W27 A;  1P97 A;  4ME4 A;  3TW8 A;  2BJC A;  1STZ A;  3QQ6 A;  3GN5 A;  2XSD C;  3CUE C;  2BNM A;  1UWP X;  2HJ9 C;  2DMW A;  2QYB A;  1T1A A;  3EUS A;  3C30 A;  3E98 A;  3IS2 A;  3K3D A;  3KX0 X;  4GS9 A;  4R38 A;  4Z5H A;  4UQI S;  1OTE A;  3S8Q A;  3D1N I;  4Z5C A;  4HQA A;  3RH8 B;  4EQ1 A;  3R1F A;  2YKH A;  4YG7 B;  4G3V A;  4O01 A;  2A6C A;  3U2A A;  4CLC C;  2VLG A;  2P08 A;  4H6J A;  4IVZ A;  3T4S A;  5KIZ A;  3IBJ A;  2A2L A;  3LUQ A;  3FG8 A;  1T19 A;  2V9A A;  2AW6 A;  3T4L A;  3O5Y A;  3KXA A;  2PUG A;  3BDN A;  4DMZ A;  4I6T A;  2D01 A;  5F68 A;  1OTA A;  4NXF A;  1BYW A;  2LYR A;  3MF0 A;  4R3A A;  4DJ3 A;  3EEH A;  4YG1 A;  4LRX C;  4KQO A;  3HJI A;  4PU4 C;  1OT9 A;  4O0P A;  1MKM A;  3MXQ A;  4FOF A;  2JHE A;  3OC2 A;  1V9Z A;  4Q0I A;  3SCH A;  4Z5D A;  1Y7Y A;  3KSF A;  2VX8 A;  4XT2 A;  4X4F A;  3T4Q A;  3LIS A;  3MR0 A;  3OLO A;  5TJJ A;  3OQM A;  4FSF A;  1QQB A;  4LPZ A;  2XJ3 A;  2JCG A;  3TE8 A;  4CQH A;  3TRB A;  4PU3 C;  1DRM A;  3GEC A;  4L9E A;  4X4H A;  3UB7 A;  3OQO A;  4JGO A;  1OT6 A;  1S66 L;  3C2W A;  5DKL A;  3L1P A;  4IJG A;  3GDI A;  3LIA A;  4BBT A;  3OCL A;  2V0U A;  2KEI A;  3B42 A;  3C38 A;  3CEC A;  3IBR A;  3CIT A;  4AFI A;  3RFB A;  4OOM A;  4X4E A;  2P7J A;  3F1O A;  1WH6 A;  4FN3 A;  1E3O C;  5J3W A;  3OQN A;  4R6L A;  4J1X A;  4MMN A;  3R7W B;  1X57 A;  3H9W A;  4MN5 A;  2NUT C;  3KZ3 A;  3BJN A;  3OCN A;  4Y3I A;  1LT0 A;  2AXU A;  2EBY A;  4UQI M;  4K08 A;  2Y79 A;  2A24 B;  1OTD A;  2J3T D;  4L0L A;  1O4X A;  4E04 A;  2EF8 A;  3NOP C;  1POU A;  4JGR A;  1PNR A;  2BAS A;  3CAX A;  3EEA A;  1ZZ6 A;  3ZHI A;  2W3G A;  2LYS A;  4BBV A;  1LCC A;  4B9O A;  3G5G A;  1WET A;  3MLF A;  3JXD L;  4Y42 A;  1S4R A;  2GJ3 A;  2LYP A;  3EGD C;  3HJK A;  1ZVV A;  4Z1W A;  3E4Q A;  1AU7 A;  3SCG A;  1LMB 3;  3MQQ A;  2H8R A;  2K31 A;  3ICY A;  2PD7 A;  4MN7 A;  4X4B A;  3PR6 A;  2LB9 A;  4F3L B;  1P9W A;  1T18 A;  3VK0 A;  1OCT C;  1D7E A;  4X4I A;  1V9Y A;  4I3J A;  4I6R A;  3LI9 A;  1YSP A;  2M7U A;  2IA2 A;  3RZZ A;  1R63 A;  2AWI A;  1G6O A;  2ICT A;  2FH5 A;  2B5A A;  4IUK A;  2W1R A;  3PBT A;  1N9O A;  3JVU A;  3MQO A;  2R63 A;  2PUE A;  2WKQ A;  4GHI B;  2O99 A;  2OWJ A;  4HHD A;  4KUO A;  2HF6 A;  4EEP A;  4L9F A;  5C5K A;  5DJU A;  1P9R A;  1F5M A;  3D72 A;  3G6O A;  2G7U A;  4M4X A;  4IA8 A;  1QP0 A;  4ETZ A;  3KSG A;  1JNU A;  5HSQ A;  5LBR A;  2PUF A;  1W63 Q;  1DW9 A;  2O0Y A;  4IUH A;  3B7H A;  2AXZ A;  2LYQ A;  4YG4 A;  2W3E A;  4YBA A;  4MN6 A;  5AVE A;  5G4Y A;  3PBN A;  2VJW A;  2LYJ A;  1RPE L;  1TS7 A;  1QPZ A;  1WA9 A;  2WIU B;  2XA7 S;  3ZKC A;  2Z6D A;  2IU7 A;  3LIC A;  2O49 A;  1VPW A;  3F6W A;  1TF1 A;  2O9C A;  3A0R A;  4GJ4 A;  1OPX A;  2I9V A;  3HZI B;  1QQA A;  3IVP A;  2J80 A;  3NJA A;  3PBO A;  3T50 A;  1QP4 A;  3NOU C;  1L1M A;  2EWW A;  1ZZ8 A;  1Y9Q A;  2HSG A;  1PRU A;  1UWN X;  3U3W A;  2OWH A;  4WEJ A;  3P01 A;  4ARZ B;  1P0Z A;  3FPV A;  2HV1 A;  3LID A;  4LRZ E;  3H82 B;  4I5S A;  5DF9 A;  4Z59 A;  1N9L A;  3H7W B;  5DFX A;  3VE3 A;  1N9N A;  4Q0J A;  3LR3 A;  5EFW A;  3F1P B;  4KUK A;  4PAU A;  2MJ6 A;  3PBQ A;  3QYX A;  1MC0 A;  5TBM B;  5K5B A;  2XCJ A;  2KEK A;  1XFN A;  4NXG A;  4GQM A;  4HJ3 A;  5A7L A;  2IVB A;  4WUJ A;  2VGL M;  1F98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...