3PXPA

Crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
292
structure length
292
Chain Sequence
GMERAAFGKLVQALRREHRDEKGRVWTQEVLAERTQLPKRTIERIENGSLAHLDADILLRLADALELTIGERREFFFAATGIIEQKSATYKRSPEESLQYLIDMIRNMNVPAFVTDQYVNIIAANMITIRFFNIPMELIETAPLLPHGYNLMRVVFGTEYDFRRVVGTMWDEVARHNMQLFRAISLRVRADGYFVELLDNLMQYREFKRFWERAHLETEDTSAENFWYQYTHPVYGLLSYVSSRSQIPTSMGLLSMHTYIPLSPATTDLFAKLSTVANQDVIRLAPWPRSNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes.
pubmed doi rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription regulator
molecule keywords Helix-turn-helix domain protein
total genus 85
structure length 292
sequence length 292
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
A PF17765 MLTR_LBD MmyB-like transcription regulator ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3pxpA01
3.30.450.180 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pxpA02
3BS3A 1CJGA 4O8BA 3R1FA 3JXBC 1VPWA 2BNOA 2GRMA 1NERA 2PE5A 1BDIA 1OCTC 3H5TA 2GRLA 4PU3C 2PUDA 4FBIA 3GN5B 4GHJA 1R63A 1RPEL 1E3OC 1ZZ9A 2EBYA 1UXDA 3SCHA 2R63A 2AXUA 4X4CA 1WETA 2OFYA 1ZAYA 3B7HA 5A7LA 3OQNA 1JWLA 2AXVA 3VK0A 3RZZA 2IU7A 3OQMA 4PU4C 4FN3A 2XCJA 3MLFA 2LYJA 2KZ8A 1QP7A 2O49A 1LMB3 1S7EA 1PNRA 2OR1L 1BDHA 2BNMA 4X4DA 3LISA 2JVLA 4YG7B 4PU7A 1LCDA 2CROA 2IVQA 3CECA 1HF0A 3PXPA 4OB4A 3HZIB 3GBFA 2AW6A 1ZPQA 2XSDC 2D5VA 4X4FA 4I6RA 3EUSA 3D1NI 3QQ6A 1WH8A 2PUBA 3UFDA 2IVBA 2JCGA 2L8NA 1JFTA 3TRBA 2LYRA 4Z58A 2LYPA 4MCXA 3G7DA 3O9XA 3OP9A 4PU8A 1B0NA 1POUA 4JCXA 3G5GA 1ZZ7A 2LCVA 3KZ3A 1ADRA 2WUSR 2PUEA 2KPJA 1LCCA 1X57A 3F51A 1ZUGA 1CQTA 4Z59A 3ZHMA 2PPXA 3CLCA 4YBAA 4J1XA 3OMTA 1PRAA 2PUAA 1NEQA 2GZUA 1LLIA 3ZKCA 4NDWA 4Y42A 2EWTA 4X4BA 2IVGA 1IC8A 2MEZA 3FYMA 2PUGA 1SQ8A 2ICPA 1DWKA 4J1WA 2LYQA 2EF8A 1L1MA 5K98B 1XWRA 1ZZ6A 2R1JL 1ZZ8A 1EFAA 3CROL 1Y7YA 3F52A 3SCGA 4X4EA 3JXCL 4Z5CA 2O4AA 2AXZA 2MQKA 2WIUB 3KJXA 1Y9QA 1WIZA 1RZRD 3OQOA 1ZZCA 2CSFA 4YARA 4I8TA 2A6CA 1RZRA 2AWIA 1ZS4A 1OSLA 1O4XA 1GT0C 2LYSA 4JCYA 2PIJA 2XIUA 1QP4A 3QF3A 2FJRA 4Z5DA 2KEKA 4X4GA 1AU7A 4I6TA 3FYAA 4X4IA 3FMYA 1WH6A 1UTXA 4Z5HA 4IA8A 1PRUA 2KEIA 2IUOA 2H8RA 1QQBA 2B5AA 3ZHIA 4I6UA 4IWRA 3KXAA 2O38A 2PUCA 1RZSA 3LFPA 3F6WA 1R69A 1YSEA 1DW9A 4GQMA 2IV1A 3DNVB 4YG4A 3S8QA 1QPZA 1QP0A 1JH9A 4F8DA 2XJ3A 2PUFA 2HSGA 1X2LA 2ICTA 4YG1A 4X4HA 2AUWA 3BD1A 3GN5A 3IVPA 2HINA 2XI8A 1PERL 2L49A 1RIOA 3SCFA 3QYXA 2LYLA 4JQDA 1JFSA 1QQAA 3BDNA 1ZZBA 3L1PA 3QWGA 2KEJA 3U3WA 2LYKA 1ZVVA 1LQCA 2BJCA 1PRVA 3JXDL 1UXCA 4IVZA 4MCTA 2BNNA
chains in the Genus database with same CATH superfamily
3OPHA 4FD8A 4LFUA 1EWZA 4E3MA 2V9AA 3KO6A 4G3VA 1CF0A 5A8BA 3DTKA 1R63A 5G4ZA 3UE6A 4P85A 2XF3A 1K4FA 3UB8A 2QZ6A 3LY3A 1T1CA 3D9YA 3HLWA 3LY4A 4F3LB 1PNRA 4FUWA 2GJ3A 1K54A 5DRTA 5KMWA 4OOMA 2XFTA 4WEKA 3BFCA 3OBFA 3EGDC 4BWIA 4FSFA 3EUSA 2PR6A 3E2KA 3NOUC 2PUBA 5HDCA 1PRQA 2LYPA 2XA7M 4HESA 4KG5A 2JKFA 2Y2OA 4GZBA 4N1HA 4PM8A 4Q0IA 3K3DA 4G3WA 3KZ3A 1AWIA 3F51A 4UA7A 3B3XA 4U0TA 4BMWA 3NROA 2XD5A 3M9LA 4KG2A 1YPRA 2PU4A 2GX5A 1S66L 4R3BA 5EVID 3UPPA 4X53A 1EFAA 1OMEA 3ISGA 4ZAMA 4CPKA 3D4FA 1FSWA 3KX0X 3NBLA 3E98A 3KJXA 2ZM8A 1Q2QA 4I8TA 1E25A 4OQIA 5FEGA 1GT0C 4X6TA 2LLWA 3FYAA 4UQIS 2I72A 1NRJA 4GD8A 1HZOA 1L0EA 3GMWA 4LV3A 5AVFA 3F6WA 4GQMA 4PM7A 1QP0A 2PBDP 3MZDA 3IVPA 4JQDA 2LYLA 3OPRA 2VX8A 5AQ9A 4JKTA 3CPTB 5LBRA 5HARA 1SDEA 3RJUA 1N9NA 4DF6A 2GRMA 2PBYA 4XXRA 4KZ3A 1VETB 4GB7A 5HPFA 3HLGA 2KX6A 2Y4AA 3A3DA 3A3IA 1DJCA 4ZJ2A 2H0TA 3C8CA 3G32A 2Y2HA 4E3LA 5JYOA 3ZQ5A 2V3CC 4DE8A 3EQVA 3O87A 2ZD8A 4BD0A 3QQ6A 2BG1A 3MXQA 2Y2MA 3I7JA 1K25A 3SOIA 1ESIA 2WZZA 3TJZC 3T4KA 3MQ0A 3G5GA 1ZZ7A 3ICYA 2KPJA 2VGLM 1LL9A 1W63Q 2IA2A 4WELA 1FCOA 1CJFA 3EOIA 3A9XA 2HDQA 4Y42A 5L2FA 2MEZA 3CITA 2ICPA 5E2EA 3QFIA 3RTYA 4HRAA 1Q2PA 3N8LA 1K4EA 1V9ZA 2CC1A 1ZZCA 3E0YA 2CSFA 4F94A 1ODVA 3GZDA 4I3AA 2P08A 3F1OB 3H9WA 2VGJA 3Q81A 4X4IA 3FMYA 4IA8A 3L9KA 1D7EA 3MSHA 5FATA 3ZG9B 2FFYA 3NIAA 5HSQA 1SKOB 4WMCD 5JUWA 2Y2LA 4B4XA 4HP4A 3GV9A 4KG6A 4C6YA 1JNUA 3LR0A 1PYYA 1VHMA 3BQ8A 5G4YA 3BS3A 4P6ZS 5CGXA 5HWTA 3R1FA 1D06A 4DKIA 4ZRRA 2PXTA 2O9AA 4PKYG 3A9ZA 3ZVWA 1KOUA 3IF5A 4OVDA 5HD5A 3IBJA 4ZJ3A 1XKZA 2GZAA 3MR0A 1WETA 5EVEA 4HH2A 2NUPC 1K57A 5F5YA 1LL8A 1L0GA 3ZCZA 1E3UA 5FQIA 3K2NA 4EW7A 2VV7A 3PYPA 4HJ3A 4EV4A 5TBMA 2W3HA 1KVMA 3A3JA 4FTXA 1ZPQA 4P6ZM 4R38A 2M1CA 3Q7VB 2L8NA 4Y15A 3IT9A 1JFTA 1FILA 2D02A 3G7DA 5U47A 5FA7A 1O7EA 1YSPA 5DF8A 5CGWA 3A3EA 3V67A 4HP9A 2WUSR 4R3JA 3S1YA 3T1QB 3HUOA 3HLBA 2EX9A 4OKPA 3FG8A 5EE8A 1KE3A 2M7UA 4X4BA 3NZLA 4S2LA 3G0TA 3K3CA 2EF8A 1L1MA 4OPRA 4Q0JA 5K98B 2J3WA 3VE4A 2Z6CA 3UY6A 4X4EA 2JKRM 2A2LA 4ZBEA 3EQUA 1Y9QA 4LRYC 2OSUA 5EPHA 1ONHA 2JKTI 1YLZA 1Z6FA 4CLCB 3E4OA 3MQQA 2HDRA 4LCLA 2HP6A 3W8KA 3V3RA 5DTSA 2DRWA 1TS8A 3KXAA 1ESUA 3CMZA 1HD8A 2UWXA 2WGVA 2WKIA 1T19A 3OPPA 1ES2A 1K54C 2PXUA 2W1RA 1ZVVA 5HAPA 2M4HA 2XSSA 4WN5A 2XR0A 5DF7A 2JQEA 5FL3A 1BDIA 5EOEA 2OWJA 2P9VA 4Q0HA 4N9KA 4EK9A 4U3TA 3SH9A 4CJNA 3IXHA 1QZXA 5FAOA 3GTCA 4ER6A 1DJBA 3SW1A 3WS0A 4P0MA 3PBSA 1NY0A 2OWHA 2OLUA 4NXBA 4E3KA 3UB6A 1FQGA 4YG7B 1RGZA 2EX2A 1PIOA 3GSGA 2XDMA 2GDNA 4EETB 4DXBA 2VEAA 4KZ4A 4PM5A 1YMXA 3TRBA 2Q0OA 2Y2KA 5EVIB 1S6RA 1MXOA 2O99A 3QNCA 1LCCA 1L0DA 2GNXA 3LIEA 3G4PA 3UE0A 1NXYA 1MZUA 4LLOB 2XK1A 3VSLA 4ZTKA 3VMAA 1OT6A 4P6BA 2IVGA 2EFUA 1H0MA 3IHBA 2EA9A 4JGQA 4YWZA 1W7FA 4EBNA 3PBTA 4Y17A 3LUQA 4ARZB 3BFEA 3ME5A 2E8IA 3A0SA 4WL9A 3AGDA 4UHUA 2AWIA 4KQQA 1O4XA 1OTIA 2W0NA 3Q7VA 4DE3A 3ZPXA 3IWOA 1UTXA 4KZ5A 3S7NA 1EI5A 5L10A 3P01A 1PZOA 3BFGA 4UAAA 4ETXA 3T4OA 4Y5FA 2JKTM 2WGWB 5CERA 3ITBA 1K6SA 2P74A 5HDSA 4EEPA 2HCSA 2ZC7A 1NW3A 2WZXA 2Z6DA 2ZQ9A 3ZYTA 1FR6A 2PUGA 3WS4A 2BNNA 1PWDA 1LT0A 3T4QA 5CTNA 1CI8A 2H0YA 4DE0A 3EEAA 4NXEA 4Y3IA 3SCHA 2ZJ9A 5GAHi 3NULA 3BFDA 3DM5A 2Y2NA 1S4RA 4N9LA 3TOIA 3VK0A 3HJKA 3KYQA 1J9MA 2JN7A 4X4DA 5I5LA 1LCDA 5DFYA 3D3OA 3F1PB 3LI8A 3ZG5A 1G6OA 4KUOA 4ARZA 3UDIA 5FQJA 2ZOIA 5IS1A 3RXXA 1KGFA 3UMEA 3QP5A 3LYXA 3OCLA 1CEFA 1K6RA 4JF5A 4J1XA 3DWKA 5FAQA 4HBTA 5DJUA 2QPNA 2HGVA 4BQMA 1SQ8A 1JVJA 1H8YA 5HZHA 4MLLA 1OTAA 2Z2LB 4KUKA 3A3FA 1RP5A 4S2KA 3TFLA 4I39A 2MQKA 1IYPA 2LLVA 3SZTA 4I5SA 1TS7A 2ZQDA 2X01A 3IH9A 2AVXA 2XD1A 3DTIA 5CECA 4GD6A 4KENB 4K0WA 4OPQA 1NLYA 1FIKA 1JWZA 1GHPA 4JGOA 4GDBA 4OQHA 5FASA 4BD1A 4MDZA 5A90A 2J9PA 3NDEA 2KLIA 5AQ7A 3QHYA 5CRFA 1FSYA 2JKGA 2OLVA 2PD8A 4X56A 3PBNA 2Q9MA 2HINA 1M40A 4EWFA 3UO9A 3QYXA 1W5DA 1F2KA 3LI9A 5J7EA 4S2NC 1W79A 1PRVA 2WK0A 3OKZA 5IHVA 4JF6A 1PI4A 4E3OA 4DDYA 3KSGA 4R4SA 5EVIA 1YQSA 4B88A 4H8RA 3OQNA 5GAGi 3QP1A 2L0WA 2QJ5A 2FZ0A 3U2AA 3ZNYA 3W2ZA 1FCMA 3RZZA 4DJ3A 1YM1A 5F1GA 3MLFA 4G3KA 2ZMAA 5DT2A 4NKPA 3V39A 1XA7A 2Y8HA 2VGLS 4PM6A 4MNRA 1GA9A 4Y2FA 1OTEA 2WKRA 1KE4A 4FCFA 4MCXA 3ZHHA 4EQZA 2L1PA 3SS3A 4ME4A 4I38A 4MN5A 4E6XA 4LENA 3ZHMA 3CLCA 2XRNA 5C5KA 2ZQAA 1LLIA 2PU2A 4XUZA 3C4PA 4R23A 4EESA 4Q8IA 3WS2A 1KVLA 1ZZ8A 4UA6A 3LFVA 4K08A 5GL9A 3H82A 2JCHA 3V5MA 4GHIA 4WYYA 4QU3A 5HAIA 2EX8A 1BLPA 3AGEA 5KSCA 3QF3A 2B02A 4GW9A 4LGWA 4X4GA 1WH6A 3N6IA 3BWLA 4C75A 1JWVA 3G35A 4B9OA 3MXSA 1FR1A 3HREA 1N9BA 2XJ3A 3MKEA 3LR5A 1NWZA 3PAEA 2B18A 4KZAA 4S2NA 5DTKA 3QP4A 3L1PA 3ZG8B 2PDRA 1MWRA 4MCTA 1J3WA 2BNOA 5KIZA 1QB2A 4X1MA 1XX2A 1E3UD 3KSHA 4R3AA 1E3OC 1Y28A 1UXDA 2W1TB 4X4CA 2JBFA 1G68A 2VZWA 1U2ZA 4O8GA 3A0RA 2ZBBA 5GLDA 5AVEA 1MWTA 1TD5A 1H8MA 1SKFA 4PAUA 2PT7A 2EFXA 5EECA 1S1ZA 5M1AA 4X4FA 1OTDA 2RL3A 2J7WA 3UFDA 2P7JA 4BBUA 3S4XA 1O07A 2VA0A 1TVFA 2VK3A 1LLBA 5L8MA 3OP9A 4MBHA 1B0NA 4JCXA 4S2JA 3W4PA 3L7HA 2PUEA 4GHIB 4CQHA 3DWZA 4EXOA 3UNWA 5E2HA 2V0WA 3OMTA 4HEFA 4IJGA 3IF6A 3QOWA 5HL1A 2ZC4B 5FAPA 4C3QA 1Y7YA 1PI5A 1MWSA 4UEYA 4EKIA 2K31A 3LGOA 4PMAA 1RZRD 4WEJA 3RXWA 2ZMVA 1RZRA 1OSLA 2O9CA 2J7VA 1GHMA 1G6AA 3B47A 3UDXA 4JCYA 2XIUA 4B4ZA 4I6TA 3NXHA 4L9FA 3VFFA 1WYBA 3IXGA 4WF0A 3IX4A 4NXFA 4IBXA 2XEPA 2V2FF 3JVVA 5HD3A 3LFPA 1YSEA 1Y4OA 3VP0A 1S4SA 1X0OA 1X2LA 2WKQA 3FC7A 2PXDA 3DW0A 3IWQA 2HDSA 1LHYA 1ZZBA 1BULA 4BJPA 4KZ7A 2BJCA 3UMDA 2Y79A 1XJ4A 4R70A 2V1ZA 1ZZ9A 4F3LA 1E4DA 2RCXA 1F98A 4LRXC 2M7VA 2XXAA 1N9OA 3GQZA 3IWIA 2WKPA 1W63M 1SKOA 1NYYA 2VGKA 2A24B 3BRMA 1ES4A 3LR4A 2CROA 3BYDA 1DP9A 4HHDA 4I6RA 4MBFA 4GS9B 4HY8A 4FH4A 4E6WA 1KDSA 3N8SA 3C30A 1MPLA 3BECA 4MCWA 4PU8A 3G6OA 3N4IA 2C6WB 2H10A 5DTRA 1K0KA 4X1LA 5DVAA 4WBGA 4X55A 1WA9A 2W3EA 4NDWA 5L07A 2X02A 1S0WA 2V20A 5KSHA 3E4QA 1ZZ6A 1BUEA 5J3WA 5FQKA 1XXMA 3MMHA 4EEUA 5F82A 2HV1A 1BT5A 4ZJ1A 4DE9A 1BTLA 3CZDA 1VQQA 3OLOA 2JC7A 3FYZA 1IOUA 5GHZA 2J7UA 1P0ZA 2ZLYA 1T1AA 3LEQA 2HP9A 4IHQA 2O38A 3N8RA 1RZSA 3QP6A 4YG4A 1LI0A 4KZ6A 3FWLA 5I94A 5HWVA 3V3SA 3HL9A 3BDNA 4DE2A 1MY8A 2OR1L 4Y7PA 1VB6A 3C2WA 2D01A 5AJGA 4KQOA 4JXSA 3N7WA 1TEMA 5FQ9A 1GSXA 3GN5B 5MC7A 2Y2GA 4JBFA 4OQ0A 3BEBA 3IBRA 2AXUA 2CMNA 2PXLA 2OFYA 1LSXA 1ZHHB 3BW6A 3ZG7B 2P9VB 4JXWA 3SS5A 1AXBA 4PU4C 1FOFA 2V1AA 5AQAA 1I5QA 1S7EA 3LIAA 3NC8A 2INWA 3PXPA 1HTZA 2OAP1 4Y13A 2QYBA 1N4OA 3O88A 3C7VA 2XXPA 4Y0OA 2HJ9C 1BSGA 2XA7S 1DY6A 4E3NA 4EZIA 2QMIA 1ADRA 3LO7A 3F1NB 1SZVA 3DTEA 4E04A 4CLCD 2IWBA 1DP6A 1VM1A 3PBOA 5F69A 2ZQ8A 2LB9A 3NOPC 3S22A 1IC8A 3H7WB 3QNBA 2K2NA 4J1WA 2LYQA 4RX3A 3PR6A 1YSQA 1CK3A 2WAEA 5EUAA 1WIZA 4GLQA 5HDDA 2ZL1A 2PR5A 4GJ4A 2ZC5B 4EQ1A 4JGPA 4GDNA 1KE0A 1S1YA 4UQIM 3NDGA 4IEDA 5TJJA 3VOYA 2BLSA 3E2LA 2YKHA 3C5AA 5HW3A 4GKUA 1KGGA 2XLNA 3T12B 3PE5A 2EXBA 4BL3A 2FFFB 3F1NA 3FKWA 1IYQA 2ZM2A 4A5RA 3ZVTA 2G2UA 3NECA 2QWSA 3U3WA 2OOLA 5EVLA 5F83A 4CLCE 3WRZA 3D72A 1GSWA 3P7NA 2V8CA 4QY6A 1VPWA 3Q7ZA 4HJ6A 3GUUA 3NY4A 4OP8A 4YNRA 3HBRA 5GHXA 3B7HA 2JHEA 4IUKA 1XFNA 4IBRA 2AXVA 1OJGA 4WVLA 3V50A 4OP5A 1KGEA 2YBDA 1QP7A 2LYJA 4KQRA 2PYRA 3F1OA 3TRCA 1TS6A 3CECA 3MS6A 3HLFA 3WS5A 2PXFA 3O86A 4PHTA 1NRFA 3B42A 2HJEA 2W3FA 3H7WA 4MBKA 5DF9A 1WH8A 1KDWA 2JCGA 4ER3A 1VEUA 1H5XA 5IU1A 4FH2A 3CLOA 4PKYA 3R09A 1X57A 5DTQA 2WGIA 2J80A 4YBAA 3OOVA 1NEQA 2PXVA 2WGWA 2ZQCA 4MMNA 5DTTA 3C4OA 4OQGA 1K57C 1V9YA 4NETA 2R1JL 1XWRA 3VP3A 4Z5CA 2O4AA 1PNEA 2EX6A 2O9BA 2J9OA 3SR4A 5FI7A 2Q9NA 3MKFA 4WM9A 4B93A 1FCNA 1GCEA 2LYSA 1P9RA 2PIJA 3CPTA 3CWFA 5HWWA 3HLEA 1TDGA 3Q1FA 3QOXA 3B33A 1XJ6A 1S67L 1IKIA 3BLSA 4RA7A 3UDFA 3HUNA 4R1GA 5GHYA 3NDBB 1QPZA 1STZA 3OCNA 2HSGA 3SX0A 2VV6A 5AQBA 1YKDA 4WZ4A 2LYKA 2HP5A 3M6HA 1ALQA 1OCTC 5E2GA 1ACFA 1LSWA 3R7WA 1SHVA 4MN6A 3Q07A 4HIAA 1PW1A 3MEJA 3VWSA 1OT9A 1VEUB 3BLMA 2BTFP 4Z9QA 2PXQA 3ZDJA 2QKPA 3PBQA 3OC2A 1OTBA 5CTMA 1YLWA 3LCEA 1GSVA 4NG2A 1BDHA 3VV4A 3JYIA 3LISA 3ZFZA 5A92A 3GBFA 3FPVA 4L9EA 4MN7A 3IF6C 4QJGA 2Y2QA 3T1SA 2J3TD 2K7SA 3PAGA 2PXPA 3CJMA 3MBZA 1YMSA 3GECA 3HCYA 1MKMA 4N1XA 5GLAA 1UWPX 1C3BA 1M6KA 5FI6A 3QP2A 1POUA 2LCVA 2EWVA 5DSXA 2H5SA 3MXRA 4PPRA 3BM6A 3LIFA 3W4QA 1HVBA 4X25A 3TE8A 3IX3A 3G31A 3TW8A 2L4RA 4LV1A 1UWNX 1DWKA 1XP4A 3G2ZA 4NEED 1MC0A 3UE3A 2Y2IA 2PD7A 2J8YA 2A6CA 4GNUA 1ZS4A 1HQ1A 4HQAA 4LRZE 4DJ2A 4IVIA 4Z5DA 4GN2A 4XT2B 1AU7A 3VP1A 3TG9A 3TELA 4QWOA 2NUTC 3BFFA 1T18A 2B5AA 1OPXA 4WLAA 3S8QA 1JTDA 1DW9A 4Q2JA 3IS2B 2LNMA 1JH9A 5GLCA 4JLFA 4GS9A 5GLBA 1RIOA 4R0QA 3VFHA 3S7QA 3QWGA 3LR3A 3R4KA 1ES3A 3CG5A 5HFOA 1OJ5A 1XJ3A 1G28A 3ZG0A 1F9IA 4ZDXA 2C5WB 5JYPA 3VSKA 1JWLA 1G5UA 3FKVA 3GR2A 2IU7A 2HZ5A 4NXGA 3BY8A 3U4LP 4UA9A 1W8QA 1MBLA 4P87A 4QB8A 5DRYA 4ID4A 2IVQA 4X68A 4E3JA 3IF6B 5J4EA 2ACGA 1YLPA 1CEGA 2JE5A 2QHKA 3MF0A 4EU0A 3T1XA 2LB5A 1K55A 1XJ2A 4OOLA 1ZUGA 4Z59A 2PYPA 4OOYA 2PUAA 5CXWA 3PBRA 2EWTA 2HF6A 1GHIA 1U60A 1T1BA 2PXKA 5CGSA 3S7PA 3T4TA 5EM1A 1IYOA 1RGYA 1NZOA 3GZCA 1YAXA 5FEFA 4HOIA 4OBMA 2XQZA 2IUOA 1XGIA 4K91A 5L09A 2R9WA 3KSIA 4I6UA 4IWRA 5DFXA 3RH8B 3WRTA 1PZPA 4WZ5C 2G7UA 3OZHA 3BD1A 5EM0A 2ZC6B 4GCZA 4HBUA 1EW0A 1K56D 4DN0A 2EXAA 3P09A 2V0UA 2KEJA 3HVFA 1GA0A 4R4RA 4IVZA 3TEPA 4O8BA 4I3JA 4H6JB 1H3QA 2Z2MB 4OH0A 2WADA 3ZGAB 2R63A 1L3LA 3DTMA 4CLCA 5A7LA 3CUEA 1CQAA 3LIDA 3G2YA 2ZM0A 2WAFA 3EGXC 3OQMA 4PM9A 4DE1A 4EBLA 2FH5A 1Z09A 5A93A 3JVUA 2Y2JA 1HF0A 3KSFA 2HCNA 4D2OA 4K0XA 4Z58A 1MKIA 3HLCA 2DMWA 1ERQA 2W27A 5J8XA 1BLHA 2IWCA 2PPXA 4EQIA 2VLGA 1ZG4A 2PAVP 3UPOA 5FQMA 4OPYA 1L0FA 3PHYA 5D3OA 2BASA 3S7OA 3UE1A 1JTGA 2WUQA 1YLYA 5HPIA 3SCGA 3FZCA 4HH3A 4ER0A 3OQOA 3G30A 4KQDA 3CHWP 1BZAA 5EOOA 4Y0TA 2Y2PA 3GRJA 3M6BA 1ZC2A 4ETZA 2WKEA 2KEIA 2ZC3B 4S2IA 3T4SA 1SCWA 2ZL1B 1F5MA 1NYMA 5TR7A 4DXCA 2ZMFA 3VE3A 1IYSA 1JWPA 2B95A 2XROA 4HJ4A 2L49A 1ZKJA 3LIBA 1ZG6A 3UPNA 5BOHA 2X71A 1XGJA 1UXCA 3O9XA 1LI9A 3JXBC 4JXGA 3AGFA 4RX2A 3H5TA 2GRLA 1ERMA 1D1JA 4FBIA 4GHJA 3UWPA 2EBYA 1IELA 2R78A 2OV5A 1K55C 4BL2A 5CEDA 2HPBA 4E3IA 2KZ8A 3IHAA 4KZBA 3UN7A 5DTMA 3T4JA 5CEBA 4D60A 2QJ7A 4OB4A 4N92A 3VOLA 2AW6A 1XA1A 2XSDC 4XUXA 1YT4A 3KYEA 3D1NI 2PXBA 4HNBA 4OLDA 2W3DA 1I2WA 2LYRA 5DKKA 1PWGA 2WYXA 3BY9A 2XXQA 3VP2A 4OLGA 1RCJA 2OAQ1 1DRMA 1N9LA 4EERA 3ITAA 4JXVA 4NK3A 1PRAA 2GZUA 1BYWA 3IQAA 3NJAA 4QPRA 3MZEA 1DJAA 2EWWA 1XPBA 5FDHA 2PXEA 4BBVA 3T1RA 4RVAA 2R9XA 3ZNTA 1PW8A 3JXCL 2Y59A 5IT5A 2W1TA 1SDNA 2MJ6A 3NOTC 1NLZA 3BQAA 4DMZA 3DAVA 2B5RA 4KZ8A 4M3KA 4QHCA 5F68A 2VEOA 5HX9A 4RQ9A 1IEMA 4EUVA 2G2WA 5TGFA 3M2KA 2H8RA 2UV0E 3NHQA 3T50A 3H82B 3GVBA 5TBMB 2ZQ7A 2IV1A 4F8DA 4X4HA 2ICTA 4RYEA 5TFQA 1QMFA 3JPUA 2IWDA 3R7WB 4FOFA 3SCFA 2KOIA 3O5YA 1QQAA 4OPZA 4L9GA 2P04A 2H28A 4BENA 5CX7A 3C38A 5CHMA 3JXDL 2KDKA 1HLUP 4S2OA 5FQQA 1XFQA 2V8FA 4S2PA 4IUHA 3PTEA 2XH9A 3HJIA 4EBPA 3MJQA 3WS1A 3NCKA 1ZAYA 3NI9A 4YFMA 2WKHA 2ODRD 3T4LA 3UB9A 3GDIA 4FN3A 2XCJA 1TDLA 1LMB3 2V1BA 2E8JA 4GOGA 2BNMA 2A49A 2DNSA 4I3IA 2PRFA 4PU7A 4LCMA 5HAQA 3HZIB 2XFSA 4H6JA 3C7UA 4OONA 4WUJA 4QD4A 3QP8A 3IXBA 1YLTA 4DRTA 3IS2A 1MWUA 3IX8A 1LSVA 1QMEA 1TF1A 2O0YA 5M18A 4Y0UA 5DJTA 1A0KA 2XGNA 3LEZA 5K5BA 1BLSA 4JPMA 4EUZA 3OPLA 3ZKCA 4MEZA 1UGUA 2FFHA 5G18A 3FYMA 5FI2A 5F6AA 3CROL 4JGRA 5HL6A 4ER5A 3UB5P 2WIUB 1PFLA 3LICA 2L1MA 1L2SA 2A3UA 4O01A 3CUEC 4R6LA 2FJRA 4ER7A 3IXDA 3A9YA 4Z5HA 3ULFA 1IFQA 3MZFA 1QQBA 5FDSA 2PUCA 3DNVB 1CI9A 1R69A 4WMCA 2PUFA 5E2FA 4YG1A 4L0LA 2AUWA 1P9WA 2I9VA 3E4PA 3HLDA 1PERL 4JF4A 1JFSA 2MXDA 4M4XA 4II7A 5M19A 1K56A 1LQCA 1P97A 1NJ4A 1LL5A 1CJGA 3HUMA 5E43A 1NERA 2PE5A 3MFXA 3CAXA 1DULA 4PU3C 2PUDA 2DCFA 3DBAA 1H8ZA 1RPEL 2Y55A 5FSRA 4QY5A 2HDUA 2VKSA 5EFWA 2JKRI 3O3VA 2VV8A 4IVKA 3P98A 3F1PA 1PWCA 2O49A 1DP8A 4LV2A 1TS0A 1BLCA 4BLMA 2JVLA 4U0XA 1YLJA 4YOFA 2D5VA 2J3TC 3TSGA 5EVIC 4LPZA 3SS4A 4O0PA 2VJWA 3CI6A 4WZ5A 1EROA 2IVBA 1NZUA 3VP4A 3KL4A 4Z1WA 4X69A 4KZ9A 4EKGA 3A0VA 3FPWA 1CQTA 3RFBA 2W3GA 3FV7A 1ZTUA 1ONGA 4S2MA 5KZHA 2PHYA 3M2JA 1IKGA 4O7DA 3WWXA 1I2SA 2YKFA 3MFDA 1WE4A 3SH8A 5CHJA 3EWKA 5DKLA 5EV0A 3UB7A 3F52A 2Y91A 1ES5A 2AXZA 3OWQA 3IH8A 1VETA 4AFIA 4YARA 3LQXA 4BBTA 4LV0A 2A24A 4YINA 1K38A 1Y54A 1QP4A 1MFQC 4ESPA 2KEKA 5CHUA 3VOZA 3KYZA 1PRUA 3G34A 3Q82A 3ZHIA 3SH7A 2HFZA 3MQOA 4XT2A 3W4OA 3BJNA 4HI4A 3GZDC 3GN5A 4CLCC 2XI8A 5A91A 4DDSA 2ZOHA 3EEHA 5F1FA 1WYCA 1W8YA
chains in the Genus database with same CATH topology
1VB6A 4O8BA 3C2WA 2V9AA 2D01A 3KO6A 5AJGA 4I3JA 4KQOA 1LT0A 4G3VA 4H6JB 1H3QA 3T4QA 5A8BA 1GSXA 3GN5B 1R63A 5G4ZA 5MC7A 3EEAA 4NXEA 4Y3IA 3SCHA 3IBRA 2R63A 2AXUA 2CMNA 2BNNA 3UE6A 3UB8A 2OFYA 1LSXA 1ZHHB 3BW6A 5A7LA 4CLCA 3CUEA 1S4RA 3LIDA 3VK0A 3HJKA 3EGXC 3OQMA 4PU4C 1T1CA 3KYQA 2V1AA 2FH5A 3JVUA 4F3LB 1PNRA 1S7EA 2JN7A 4X4DA 5I5LA 2GJ3A 3LIAA 1LCDA 4OOMA 5DFYA 3D3OA 3F1PB 4WEKA 1HF0A 2INWA 3PXPA 3KSFA 3LI8A 3OBFA 3EGDC 2OAP1 4BWIA 4FSFA 3EUSA 2PR6A 2QYBA 3NOUC 2PUBA 1G6OA 5HDCA 2HJ9C 4KUOA 4Z58A 2LYPA 2XA7M 4ARZA 2XA7S 2DMWA 2ZOIA 2W27A 5IS1A 4Q0IA 3K3DA 4G3WA 1ADRA 3KZ3A 3UMEA 3LYXA 3F51A 3F1NB 3OCLA 2PPXA 4E04A 4CLCD 4J1XA 1DP6A 2VLGA 4BMWA 3PBOA 5F69A 3PHYA 5DJUA 2LB9A 2BASA 3NOPC 2GX5A 1IC8A 1S66L 2HGVA 3H7WB 1SQ8A 3S7OA 2K2NA 4J1WA 2LYQA 5HZHA 1OTAA 1EFAA 4KUKA 5HPIA 3PR6A 1YSQA 3SCGA 3KX0X 4HH3A 4I39A 3E98A 2MQKA 3KJXA 5HDDA 1WIZA 4GLQA 3OQOA 2PR5A 4GJ4A 4I5SA 1TS7A 4I8TA 4EQ1A 4KQDA 4JGPA 1GT0C 1S1YA 1NLYA 4ETZA 4UQIM 3FYAA 4UQIS 2KEIA 4JGOA 3T4SA 1NRJA 5TJJA 4MDZA 1F5MA 2KLIA 2ZMFA 3VE3A 2YKHA 5AVFA 3F6WA 4GQMA 1QP0A 2PD8A 3PBNA 2XROA 3IVPA 2HINA 3F1NA 4HJ4A 2L49A 4JQDA 3QYXA 2LYLA 3LIBA 2QWSA 3LI9A 3U3WA 5J7EA 2OOLA 2VX8A 4CLCE 1PRVA 3D72A 1UXCA 5LBRA 3O9XA 1GSWA 3P7NA 3JXBC 1N9NA 1VPWA 2GRMA 4HJ6A 3H5TA 2GRLA 3KSGA 4FBIA 4GHJA 5HPFA 2EBYA 2KX6A 4YNRA 2R78A 3B7HA 2JHEA 3OQNA 4IUKA 1XFNA 2L0WA 2QJ5A 2AXVA 1OJGA 2FZ0A 3U2AA 3W2ZA 3C8CA 3RZZA 4DJ3A 3MLFA 1QP7A 2LYJA 2KZ8A 4G3KA 3ZQ5A 2PYRA 4NKPA 3F1OA 3T4JA 2Y8HA 3TRCA 1TS6A 3CECA 2QJ7A 4OB4A 2VGLS 3EQVA 4PHTA 2AW6A 3B42A 2XSDC 2HJEA 2W3FA 3H7WA 3VOLA 3D1NI 3QQ6A 5DF9A 1WH8A 3MXQA 2JCGA 4HNBA 1OTEA 4Y2FA 2WKRA 2W3DA 2LYRA 5DKKA 4MCXA 5IU1A 3TJZC 3BY9A 3T4KA 3MQ0A 3G5GA 1ZZ7A 3CLOA 3ICYA 2OAQ1 4ME4A 2KPJA 4PKYA 1X57A 1DRMA 1N9LA 4I38A 4MN5A 4EERA 3ZHMA 3CLCA 2VGLM 2J80A 4YBAA 1W63Q 2XRNA 2IA2A 3OOVA 5C5KA 4WELA 1PRAA 1NEQA 2GZUA 1LLIA 3EOIA 1BYWA 4Y42A 3NJAA 4QPRA 4EESA 4MMNA 2MEZA 3CITA 2EWWA 2ICPA 4BBVA 1V9YA 2R1JL 1XWRA 1ZZ8A 3RTYA 3JXCL 5IT5A 3LFVA 4Z5CA 2O4AA 2W1TA 2O9BA 4K08A 2MJ6A 3H82A 1V9ZA 3NOTC 1ZZCA 3E0YA 2CSFA 4GHIA 1ODVA 1NLZA 3BQAA 4DMZA 4B93A 4I3AA 2P08A 3F1OB 5F68A 2LYSA 1P9RA 2PIJA 3CWFA 5HWWA 3QF3A 2B02A 3H9WA 4GW9A 4RQ9A 4X4GA 3B33A 4EUVA 4X4IA 1XJ6A 1S67L 3FMYA 1WH6A 4IA8A 3BWLA 1D7EA 2H8RA 4B9OA 3NHQA 3T50A 3H82B 5TBMB 5HSQA 2IV1A 1QPZA 1STZA 3OCNA 4F8DA 2XJ3A 2HSGA 2ICTA 4X4HA 3LR5A 1NWZA 2VV6A 2B18A 3R7WB 4FOFA 3SCFA 2KOIA 4HP4A 3O5YA 1YKDA 1JNUA 1QQAA 3L1PA 3LR0A 4L9GA 1VHMA 2H28A 2LYKA 2P04A 3BQ8A 3C38A 5CX7A 5G4YA 3JXDL 2KDKA 2PDRA 4MCTA 3BS3A 4P6ZS 5HWTA 3R1FA 1D06A 4ZRRA 1XFQA 2O9AA 2BNOA 5KIZA 1OCTC 4PKYG 1LSWA 1KOUA 3R7WA 3KSHA 4R3AA 4IUHA 4MN6A 5HD5A 1E3OC 1Y28A 3IBJA 3HJIA 4HIAA 1UXDA 2W1TB 2GZAA 4X4CA 1OT9A 3MR0A 3MJQA 1WETA 1ZAYA 2QKPA 3PBQA 3OC2A 4HH2A 2NUPC 1OTBA 2VZWA 4O8GA 3A0RA 2ZBBA 5F5YA 1LL8A 3T4LA 3UB9A 3GDIA 5AVEA 1TD5A 4FN3A 2XCJA 1H8MA 4PAUA 1GSVA 3K2NA 1LMB3 2V1BA 4EW7A 1BDHA 2VV7A 2BNMA 3PYPA 4HJ3A 2PT7A 4I3IA 3VV4A 3LISA 4PU7A 5TBMA 2W3HA 1S1ZA 3HZIB 3GBFA 4P6ZM 1ZPQA 3FPVA 4L9EA 4MN7A 4X4FA 1OTDA 4H6JA 4R38A 2M1CA 2J3TD 2K7SA 4WUJA 3UFDA 3HCYA 3GECA 2L8NA 1MKMA 2P7JA 1JFTA 4BBUA 3IS2A 1UWPX 1LSVA 2D02A 3G7DA 1TF1A 2VA0A 1YSPA 2O0YA 3OP9A 5L8MA 1B0NA 1POUA 4JCXA 4HP9A 3V67A 2LCVA 2EWVA 2WUSR 2PUEA 4GHIB 4CQHA 5DJTA 4EXOA 5K5BA 2V0WA 3OMTA 3FG8A 3LIFA 3ZKCA 3TE8A 4IJGA 2M7UA 3TW8A 4X4BA 1UGUA 2L4RA 3FYMA 1UWNX 3K3CA 1DWKA 2EF8A 1L1MA 4Q0JA 5F6AA 5K98B 2J3WA 3VE4A 2Z6CA 4NEED 3CROL 1Y7YA 1MC0A 4X4EA 4JGRA 5HL6A 3UE3A 2JKRM 2A2LA 3EQUA 4UEYA 2WIUB 2K31A 1Y9QA 1RZRD 4WEJA 2PD7A 2ZMVA 2A6CA 3LICA 1RZRA 4LRYC 1ZS4A 2L1MA 1OSLA 2O9CA 2JKTI 4HQAA 3B47A 4CLCB 4O01A 4LRZE 4DJ2A 3CUEC 4JCYA 3E4OA 3MQQA 2XIUA 4R6LA 4Z5DA 2FJRA 4XT2B 1AU7A 4I6TA 4L9FA 4Z5HA 4WF0A 3ULFA 1TS8A 4NXFA 2NUTC 1IFQA 1QQBA 1T18A 2B5AA 1OPXA 4WLAA 3KXAA 3JVVA 5HD3A 2PUCA 3DNVB 3LFPA 3S8QA 1R69A 1YSEA 1DW9A 3IS2B 1T19A 1S4SA 1X0OA 1JH9A 2PUFA 1X2LA 4YG1A 2WKQA 3FC7A 2AUWA 1P9WA 4GS9A 4L0LA 2I9VA 3E4PA 1PERL 1RIOA 1JFSA 3S7QA 4M4XA 1ZZBA 4II7A 3QWGA 2W1RA 4BJPA 3LR3A 1ZVVA 1LQCA 2BJCA 3R4KA 1P97A 2XSSA 4WN5A 1CJGA 1OJ5A 1XJ3A 3UMDA 5FL3A 1G28A 1NERA 2PE5A 1BDIA 1F9IA 3MFXA 2Y79A 3CAXA 1XJ4A 4PU3C 2PUDA 2OWJA 4R70A 3DBAA 1RPEL 4Q0HA 1ZZ9A 4F3LA 1F98A 2VKSA 5EFWA 2JKRI 4LRXC 1JWLA 2M7VA 2VV8A 3SW1A 2IU7A 3PBSA 4NXGA 1N9OA 2OWHA 3F1PA 4NXBA 3BY8A 3UB6A 2O49A 1DP8A 2WKPA 1TS0A 1W63M 2A24B 2JVLA 4YG7B 3LR4A 2CROA 2IVQA 4YOFA 1DP9A 4HHDA 2D5VA 2J3TC 4EETB 4LPZA 4I6RA 4O0PA 2VJWA 3CI6A 2VEAA 4GS9B 4HY8A 5J4EA 2IVBA 3TRBA 3C30A 2QHKA 3MF0A 4MCWA 4EU0A 4PU8A 2LB5A 3G6OA 4Z1WA 2O99A 1XJ2A 1LCCA 4OOLA 3A0VA 3FPWA 1ZUGA 1CQTA 2GNXA 3LIEA 4Z59A 2W3GA 3RFBA 2PYPA 1ZTUA 2PUAA 1MZUA 4LLOB 1WA9A 2W3EA 2PHYA 4NDWA 1OT6A 3PBRA 2EWTA 2IVGA 2HF6A 2EA9A 2YKFA 4JGQA 5KSHA 3E4QA 4YWZA 1T1BA 3EWKA 1ZZ6A 5DKLA 3UB7A 3PBTA 3LUQA 3F52A 4ARZB 5J3WA 2AXZA 3MMHA 4EEUA 3A0SA 3S7PA 3T4TA 4WL9A 4AFIA 4YARA 2AWIA 2HV1A 1YAXA 1O4XA 1OTIA 4BBTA 2A24A 3OLOA 2W0NA 1IOUA 1QP4A 4HOIA 2KEKA 3KYZA 1UTXA 1P0ZA 1PRUA 2IUOA 3S7NA 1T1AA 3P01A 4ETXA 3ZHIA 3KSIA 4I6UA 4IWRA 4IHQA 4Y5FA 5DFXA 3T4OA 2O38A 3RH8B 3MQOA 2JKTM 1RZSA 4XT2A 3BJNA 4YG4A 4HI4A 5HDSA 4EEPA 2G7UA 3BD1A 3GN5A 4CLCC 2XI8A 2Z6DA 4GCZA 5HWVA 1EW0A 4DN0A 3ZYTA 3BDNA 2V0UA 2ZOHA 2KEJA 3EEHA 2PUGA 4IVZA 2OR1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS3 A;  1CJG A;  4O8B A;  3R1F A;  3JXB C;  1VPW A;  2BNO A;  2GRM A;  1NER A;  2PE5 A;  1BDI A;  1OCT C;  3H5T A;  2GRL A;  4PU3 C;  2PUD A;  4FBI A;  3GN5 B;  4GHJ A;  1R63 A;  1RPE L;  1E3O C;  1ZZ9 A;  2EBY A;  1UXD A;  3SCH A;  2R63 A;  2AXU A;  4X4C A;  1WET A;  2OFY A;  1ZAY A;  3B7H A;  5A7L A;  3OQN A;  1JWL A;  2AXV A;  3VK0 A;  3RZZ A;  2IU7 A;  3OQM A;  4PU4 C;  4FN3 A;  2XCJ A;  3MLF A;  2LYJ A;  2KZ8 A;  1QP7 A;  2O49 A;  1LMB 3;  1S7E A;  1PNR A;  2OR1 L;  1BDH A;  2BNM A;  4X4D A;  3LIS A;  2JVL A;  4YG7 B;  4PU7 A;  1LCD A;  2CRO A;  2IVQ A;  3CEC A;  1HF0 A;  3PXP A;  4OB4 A;  3HZI B;  3GBF A;  2AW6 A;  1ZPQ A;  2XSD C;  2D5V A;  4X4F A;  4I6R A;  3EUS A;  3D1N I;  3QQ6 A;  1WH8 A;  2PUB A;  3UFD A;  2IVB A;  2JCG A;  2L8N A;  1JFT A;  3TRB A;  2LYR A;  4Z58 A;  2LYP A;  4MCX A;  3G7D A;  3O9X A;  3OP9 A;  4PU8 A;  1B0N A;  1POU A;  4JCX A;  3G5G A;  1ZZ7 A;  2LCV A;  3KZ3 A;  1ADR A;  2WUS R;  2PUE A;  2KPJ A;  1LCC A;  1X57 A;  3F51 A;  1ZUG A;  1CQT A;  4Z59 A;  3ZHM A;  2PPX A;  3CLC A;  4YBA A;  4J1X A;  3OMT A;  1PRA A;  2PUA A;  1NEQ A;  2GZU A;  1LLI A;  3ZKC A;  4NDW A;  4Y42 A;  2EWT A;  4X4B A;  2IVG A;  1IC8 A;  2MEZ A;  3FYM A;  2PUG A;  1SQ8 A;  2ICP A;  1DWK A;  4J1W A;  2LYQ A;  2EF8 A;  1L1M A;  5K98 B;  1XWR A;  1ZZ6 A;  2R1J L;  1ZZ8 A;  1EFA A;  3CRO L;  1Y7Y A;  3F52 A;  3SCG A;  4X4E A;  3JXC L;  4Z5C A;  2O4A A;  2AXZ A;  2MQK A;  2WIU B;  3KJX A;  1Y9Q A;  1WIZ A;  1RZR D;  3OQO A;  1ZZC A;  2CSF A;  4YAR A;  4I8T A;  2A6C A;  1RZR A;  2AWI A;  1ZS4 A;  1OSL A;  1O4X A;  1GT0 C;  2LYS A;  4JCY A;  2PIJ A;  2XIU A;  1QP4 A;  3QF3 A;  2FJR A;  4Z5D A;  2KEK A;  4X4G A;  1AU7 A;  4I6T A;  3FYA A;  4X4I A;  3FMY A;  1WH6 A;  1UTX A;  4Z5H A;  4IA8 A;  1PRU A;  2KEI A;  2IUO A;  2H8R A;  1QQB A;  2B5A A;  3ZHI A;  4I6U A;  4IWR A;  3KXA A;  2O38 A;  2PUC A;  1RZS A;  3LFP A;  3F6W A;  1R69 A;  1YSE A;  1DW9 A;  4GQM A;  2IV1 A;  3DNV B;  4YG4 A;  3S8Q A;  1QPZ A;  1QP0 A;  1JH9 A;  4F8D A;  2XJ3 A;  2PUF A;  2HSG A;  1X2L A;  2ICT A;  4YG1 A;  4X4H A;  2AUW A;  3BD1 A;  3GN5 A;  3IVP A;  2HIN A;  2XI8 A;  1PER L;  2L49 A;  1RIO A;  3SCF A;  3QYX A;  2LYL A;  4JQD A;  1JFS A;  1QQA A;  3BDN A;  1ZZB A;  3L1P A;  3QWG A;  2KEJ A;  3U3W A;  2LYK A;  1ZVV A;  1LQC A;  2BJC A;  1PRV A;  3JXD L;  1UXC A;  4IVZ A;  4MCT A;  2BNN A; 
#chains in the Genus database with same CATH topology
 3OPH A;  4FD8 A;  4LFU A;  1EWZ A;  4E3M A;  2V9A A;  3KO6 A;  4G3V A;  1CF0 A;  5A8B A;  3DTK A;  1R63 A;  5G4Z A;  3UE6 A;  4P85 A;  2XF3 A;  1K4F A;  3UB8 A;  2QZ6 A;  3LY3 A;  1T1C A;  3D9Y A;  3HLW A;  3LY4 A;  4F3L B;  1PNR A;  4FUW A;  2GJ3 A;  1K54 A;  5DRT A;  5KMW A;  4OOM A;  2XFT A;  4WEK A;  3BFC A;  3OBF A;  3EGD C;  4BWI A;  4FSF A;  3EUS A;  2PR6 A;  3E2K A;  3NOU C;  2PUB A;  5HDC A;  1PRQ A;  2LYP A;  2XA7 M;  4HES A;  4KG5 A;  2JKF A;  2Y2O A;  4GZB A;  4N1H A;  4PM8 A;  4Q0I A;  3K3D A;  4G3W A;  3KZ3 A;  1AWI A;  3F51 A;  4UA7 A;  3B3X A;  4U0T A;  4BMW A;  3NRO A;  2XD5 A;  3M9L A;  4KG2 A;  1YPR A;  2PU4 A;  2GX5 A;  1S66 L;  4R3B A;  5EVI D;  3UPP A;  4X53 A;  1EFA A;  1OME A;  3ISG A;  4ZAM A;  4CPK A;  3D4F A;  1FSW A;  3KX0 X;  3NBL A;  3E98 A;  3KJX A;  2ZM8 A;  1Q2Q A;  4I8T A;  1E25 A;  4OQI A;  5FEG A;  1GT0 C;  4X6T A;  2LLW A;  3FYA A;  4UQI S;  2I72 A;  1NRJ A;  4GD8 A;  1HZO A;  1L0E A;  3GMW A;  4LV3 A;  5AVF A;  3F6W A;  4GQM A;  4PM7 A;  1QP0 A;  2PBD P;  3MZD A;  3IVP A;  4JQD A;  2LYL A;  3OPR A;  2VX8 A;  5AQ9 A;  4JKT A;  3CPT B;  5LBR A;  5HAR A;  1SDE A;  3RJU A;  1N9N A;  4DF6 A;  2GRM A;  2PBY A;  4XXR A;  4KZ3 A;  1VET B;  4GB7 A;  5HPF A;  3HLG A;  2KX6 A;  2Y4A A;  3A3D A;  3A3I A;  1DJC A;  4ZJ2 A;  2H0T A;  3C8C A;  3G32 A;  2Y2H A;  4E3L A;  5JYO A;  3ZQ5 A;  2V3C C;  4DE8 A;  3EQV A;  3O87 A;  2ZD8 A;  4BD0 A;  3QQ6 A;  2BG1 A;  3MXQ A;  2Y2M A;  3I7J A;  1K25 A;  3SOI A;  1ESI A;  2WZZ A;  3TJZ C;  3T4K A;  3MQ0 A;  3G5G A;  1ZZ7 A;  3ICY A;  2KPJ A;  2VGL M;  1LL9 A;  1W63 Q;  2IA2 A;  4WEL A;  1FCO A;  1CJF A;  3EOI A;  3A9X A;  2HDQ A;  4Y42 A;  5L2F A;  2MEZ A;  3CIT A;  2ICP A;  5E2E A;  3QFI A;  3RTY A;  4HRA A;  1Q2P A;  3N8L A;  1K4E A;  1V9Z A;  2CC1 A;  1ZZC A;  3E0Y A;  2CSF A;  4F94 A;  1ODV A;  3GZD A;  4I3A A;  2P08 A;  3F1O B;  3H9W A;  2VGJ A;  3Q81 A;  4X4I A;  3FMY A;  4IA8 A;  3L9K A;  1D7E A;  3MSH A;  5FAT A;  3ZG9 B;  2FFY A;  3NIA A;  5HSQ A;  1SKO B;  4WMC D;  5JUW A;  2Y2L A;  4B4X A;  4HP4 A;  3GV9 A;  4KG6 A;  4C6Y A;  1JNU A;  3LR0 A;  1PYY A;  1VHM A;  3BQ8 A;  5G4Y A;  3BS3 A;  4P6Z S;  5CGX A;  5HWT A;  3R1F A;  1D06 A;  4DKI A;  4ZRR A;  2PXT A;  2O9A A;  4PKY G;  3A9Z A;  3ZVW A;  1KOU A;  3IF5 A;  4OVD A;  5HD5 A;  3IBJ A;  4ZJ3 A;  1XKZ A;  2GZA A;  3MR0 A;  1WET A;  5EVE A;  4HH2 A;  2NUP C;  1K57 A;  5F5Y A;  1LL8 A;  1L0G A;  3ZCZ A;  1E3U A;  5FQI A;  3K2N A;  4EW7 A;  2VV7 A;  3PYP A;  4HJ3 A;  4EV4 A;  5TBM A;  2W3H A;  1KVM A;  3A3J A;  4FTX A;  1ZPQ A;  4P6Z M;  4R38 A;  2M1C A;  3Q7V B;  2L8N A;  4Y15 A;  3IT9 A;  1JFT A;  1FIL A;  2D02 A;  3G7D A;  5U47 A;  5FA7 A;  1O7E A;  1YSP A;  5DF8 A;  5CGW A;  3A3E A;  3V67 A;  4HP9 A;  2WUS R;  4R3J A;  3S1Y A;  3T1Q B;  3HUO A;  3HLB A;  2EX9 A;  4OKP A;  3FG8 A;  5EE8 A;  1KE3 A;  2M7U A;  4X4B A;  3NZL A;  4S2L A;  3G0T A;  3K3C A;  2EF8 A;  1L1M A;  4OPR A;  4Q0J A;  5K98 B;  2J3W A;  3VE4 A;  2Z6C A;  3UY6 A;  4X4E A;  2JKR M;  2A2L A;  4ZBE A;  3EQU A;  1Y9Q A;  4LRY C;  2OSU A;  5EPH A;  1ONH A;  2JKT I;  1YLZ A;  1Z6F A;  4CLC B;  3E4O A;  3MQQ A;  2HDR A;  4LCL A;  2HP6 A;  3W8K A;  3V3R A;  5DTS A;  2DRW A;  1TS8 A;  3KXA A;  1ESU A;  3CMZ A;  1HD8 A;  2UWX A;  2WGV A;  2WKI A;  1T19 A;  3OPP A;  1ES2 A;  1K54 C;  2PXU A;  2W1R A;  1ZVV A;  5HAP A;  2M4H A;  2XSS A;  4WN5 A;  2XR0 A;  5DF7 A;  2JQE A;  5FL3 A;  1BDI A;  5EOE A;  2OWJ A;  2P9V A;  4Q0H A;  4N9K A;  4EK9 A;  4U3T A;  3SH9 A;  4CJN A;  3IXH A;  1QZX A;  5FAO A;  3GTC A;  4ER6 A;  1DJB A;  3SW1 A;  3WS0 A;  4P0M A;  3PBS A;  1NY0 A;  2OWH A;  2OLU A;  4NXB A;  4E3K A;  3UB6 A;  1FQG A;  4YG7 B;  1RGZ A;  2EX2 A;  1PIO A;  3GSG A;  2XDM A;  2GDN A;  4EET B;  4DXB A;  2VEA A;  4KZ4 A;  4PM5 A;  1YMX A;  3TRB A;  2Q0O A;  2Y2K A;  5EVI B;  1S6R A;  1MXO A;  2O99 A;  3QNC A;  1LCC A;  1L0D A;  2GNX A;  3LIE A;  3G4P A;  3UE0 A;  1NXY A;  1MZU A;  4LLO B;  2XK1 A;  3VSL A;  4ZTK A;  3VMA A;  1OT6 A;  4P6B A;  2IVG A;  2EFU A;  1H0M A;  3IHB A;  2EA9 A;  4JGQ A;  4YWZ A;  1W7F A;  4EBN A;  3PBT A;  4Y17 A;  3LUQ A;  4ARZ B;  3BFE A;  3ME5 A;  2E8I A;  3A0S A;  4WL9 A;  3AGD A;  4UHU A;  2AWI A;  4KQQ A;  1O4X A;  1OTI A;  2W0N A;  3Q7V A;  4DE3 A;  3ZPX A;  3IWO A;  1UTX A;  4KZ5 A;  3S7N A;  1EI5 A;  5L10 A;  3P01 A;  1PZO A;  3BFG A;  4UAA A;  4ETX A;  3T4O A;  4Y5F A;  2JKT M;  2WGW B;  5CER A;  3ITB A;  1K6S A;  2P74 A;  5HDS A;  4EEP A;  2HCS A;  2ZC7 A;  1NW3 A;  2WZX A;  2Z6D A;  2ZQ9 A;  3ZYT A;  1FR6 A;  2PUG A;  3WS4 A;  2BNN A;  1PWD A;  1LT0 A;  3T4Q A;  5CTN A;  1CI8 A;  2H0Y A;  4DE0 A;  3EEA A;  4NXE A;  4Y3I A;  3SCH A;  2ZJ9 A;  5GAH i;  3NUL A;  3BFD A;  3DM5 A;  2Y2N A;  1S4R A;  4N9L A;  3TOI A;  3VK0 A;  3HJK A;  3KYQ A;  1J9M A;  2JN7 A;  4X4D A;  5I5L A;  1LCD A;  5DFY A;  3D3O A;  3F1P B;  3LI8 A;  3ZG5 A;  1G6O A;  4KUO A;  4ARZ A;  3UDI A;  5FQJ A;  2ZOI A;  5IS1 A;  3RXX A;  1KGF A;  3UME A;  3QP5 A;  3LYX A;  3OCL A;  1CEF A;  1K6R A;  4JF5 A;  4J1X A;  3DWK A;  5FAQ A;  4HBT A;  5DJU A;  2QPN A;  2HGV A;  4BQM A;  1SQ8 A;  1JVJ A;  1H8Y A;  5HZH A;  4MLL A;  1OTA A;  2Z2L B;  4KUK A;  3A3F A;  1RP5 A;  4S2K A;  3TFL A;  4I39 A;  2MQK A;  1IYP A;  2LLV A;  3SZT A;  4I5S A;  1TS7 A;  2ZQD A;  2X01 A;  3IH9 A;  2AVX A;  2XD1 A;  3DTI A;  5CEC A;  4GD6 A;  4KEN B;  4K0W A;  4OPQ A;  1NLY A;  1FIK A;  1JWZ A;  1GHP A;  4JGO A;  4GDB A;  4OQH A;  5FAS A;  4BD1 A;  4MDZ A;  5A90 A;  2J9P A;  3NDE A;  2KLI A;  5AQ7 A;  3QHY A;  5CRF A;  1FSY A;  2JKG A;  2OLV A;  2PD8 A;  4X56 A;  3PBN A;  2Q9M A;  2HIN A;  1M40 A;  4EWF A;  3UO9 A;  3QYX A;  1W5D A;  1F2K A;  3LI9 A;  5J7E A;  4S2N C;  1W79 A;  1PRV A;  2WK0 A;  3OKZ A;  5IHV A;  4JF6 A;  1PI4 A;  4E3O A;  4DDY A;  3KSG A;  4R4S A;  5EVI A;  1YQS A;  4B88 A;  4H8R A;  3OQN A;  5GAG i;  3QP1 A;  2L0W A;  2QJ5 A;  2FZ0 A;  3U2A A;  3ZNY A;  3W2Z A;  1FCM A;  3RZZ A;  4DJ3 A;  1YM1 A;  5F1G A;  3MLF A;  4G3K A;  2ZMA A;  5DT2 A;  4NKP A;  3V39 A;  1XA7 A;  2Y8H A;  2VGL S;  4PM6 A;  4MNR A;  1GA9 A;  4Y2F A;  1OTE A;  2WKR A;  1KE4 A;  4FCF A;  4MCX A;  3ZHH A;  4EQZ A;  2L1P A;  3SS3 A;  4ME4 A;  4I38 A;  4MN5 A;  4E6X A;  4LEN A;  3ZHM A;  3CLC A;  2XRN A;  5C5K A;  2ZQA A;  1LLI A;  2PU2 A;  4XUZ A;  3C4P A;  4R23 A;  4EES A;  4Q8I A;  3WS2 A;  1KVL A;  1ZZ8 A;  4UA6 A;  3LFV A;  4K08 A;  5GL9 A;  3H82 A;  2JCH A;  3V5M A;  4GHI A;  4WYY A;  4QU3 A;  5HAI A;  2EX8 A;  1BLP A;  3AGE A;  5KSC A;  3QF3 A;  2B02 A;  4GW9 A;  4LGW A;  4X4G A;  1WH6 A;  3N6I A;  3BWL A;  4C75 A;  1JWV A;  3G35 A;  4B9O A;  3MXS A;  1FR1 A;  3HRE A;  1N9B A;  2XJ3 A;  3MKE A;  3LR5 A;  1NWZ A;  3PAE A;  2B18 A;  4KZA A;  4S2N A;  5DTK A;  3QP4 A;  3L1P A;  3ZG8 B;  2PDR A;  1MWR A;  4MCT A;  1J3W A;  2BNO A;  5KIZ A;  1QB2 A;  4X1M A;  1XX2 A;  1E3U D;  3KSH A;  4R3A A;  1E3O C;  1Y28 A;  1UXD A;  2W1T B;  4X4C A;  2JBF A;  1G68 A;  2VZW A;  1U2Z A;  4O8G A;  3A0R A;  2ZBB A;  5GLD A;  5AVE A;  1MWT A;  1TD5 A;  1H8M A;  1SKF A;  4PAU A;  2PT7 A;  2EFX A;  5EEC A;  1S1Z A;  5M1A A;  4X4F A;  1OTD A;  2RL3 A;  2J7W A;  3UFD A;  2P7J A;  4BBU A;  3S4X A;  1O07 A;  2VA0 A;  1TVF A;  2VK3 A;  1LLB A;  5L8M A;  3OP9 A;  4MBH A;  1B0N A;  4JCX A;  4S2J A;  3W4P A;  3L7H A;  2PUE A;  4GHI B;  4CQH A;  3DWZ A;  4EXO A;  3UNW A;  5E2H A;  2V0W A;  3OMT A;  4HEF A;  4IJG A;  3IF6 A;  3QOW A;  5HL1 A;  2ZC4 B;  5FAP A;  4C3Q A;  1Y7Y A;  1PI5 A;  1MWS A;  4UEY A;  4EKI A;  2K31 A;  3LGO A;  4PMA A;  1RZR D;  4WEJ A;  3RXW A;  2ZMV A;  1RZR A;  1OSL A;  2O9C A;  2J7V A;  1GHM A;  1G6A A;  3B47 A;  3UDX A;  4JCY A;  2XIU A;  4B4Z A;  4I6T A;  3NXH A;  4L9F A;  3VFF A;  1WYB A;  3IXG A;  4WF0 A;  3IX4 A;  4NXF A;  4IBX A;  2XEP A;  2V2F F;  3JVV A;  5HD3 A;  3LFP A;  1YSE A;  1Y4O A;  3VP0 A;  1S4S A;  1X0O A;  1X2L A;  2WKQ A;  3FC7 A;  2PXD A;  3DW0 A;  3IWQ A;  2HDS A;  1LHY A;  1ZZB A;  1BUL A;  4BJP A;  4KZ7 A;  2BJC A;  3UMD A;  2Y79 A;  1XJ4 A;  4R70 A;  2V1Z A;  1ZZ9 A;  4F3L A;  1E4D A;  2RCX A;  1F98 A;  4LRX C;  2M7V A;  2XXA A;  1N9O A;  3GQZ A;  3IWI A;  2WKP A;  1W63 M;  1SKO A;  1NYY A;  2VGK A;  2A24 B;  3BRM A;  1ES4 A;  3LR4 A;  2CRO A;  3BYD A;  1DP9 A;  4HHD A;  4I6R A;  4MBF A;  4GS9 B;  4HY8 A;  4FH4 A;  4E6W A;  1KDS A;  3N8S A;  3C30 A;  1MPL A;  3BEC A;  4MCW A;  4PU8 A;  3G6O A;  3N4I A;  2C6W B;  2H10 A;  5DTR A;  1K0K A;  4X1L A;  5DVA A;  4WBG A;  4X55 A;  1WA9 A;  2W3E A;  4NDW A;  5L07 A;  2X02 A;  1S0W A;  2V20 A;  5KSH A;  3E4Q A;  1ZZ6 A;  1BUE A;  5J3W A;  5FQK A;  1XXM A;  3MMH A;  4EEU A;  5F82 A;  2HV1 A;  1BT5 A;  4ZJ1 A;  4DE9 A;  1BTL A;  3CZD A;  1VQQ A;  3OLO A;  2JC7 A;  3FYZ A;  1IOU A;  5GHZ A;  2J7U A;  1P0Z A;  2ZLY A;  1T1A A;  3LEQ A;  2HP9 A;  4IHQ A;  2O38 A;  3N8R A;  1RZS A;  3QP6 A;  4YG4 A;  1LI0 A;  4KZ6 A;  3FWL A;  5I94 A;  5HWV A;  3V3S A;  3HL9 A;  3BDN A;  4DE2 A;  1MY8 A;  2OR1 L;  4Y7P A;  1VB6 A;  3C2W A;  2D01 A;  5AJG A;  4KQO A;  4JXS A;  3N7W A;  1TEM A;  5FQ9 A;  1GSX A;  3GN5 B;  5MC7 A;  2Y2G A;  4JBF A;  4OQ0 A;  3BEB A;  3IBR A;  2AXU A;  2CMN A;  2PXL A;  2OFY A;  1LSX A;  1ZHH B;  3BW6 A;  3ZG7 B;  2P9V B;  4JXW A;  3SS5 A;  1AXB A;  4PU4 C;  1FOF A;  2V1A A;  5AQA A;  1I5Q A;  1S7E A;  3LIA A;  3NC8 A;  2INW A;  3PXP A;  1HTZ A;  2OAP 1;  4Y13 A;  2QYB A;  1N4O A;  3O88 A;  3C7V A;  2XXP A;  4Y0O A;  2HJ9 C;  1BSG A;  2XA7 S;  1DY6 A;  4E3N A;  4EZI A;  2QMI A;  1ADR A;  3LO7 A;  3F1N B;  1SZV A;  3DTE A;  4E04 A;  4CLC D;  2IWB A;  1DP6 A;  1VM1 A;  3PBO A;  5F69 A;  2ZQ8 A;  2LB9 A;  3NOP C;  3S22 A;  1IC8 A;  3H7W B;  3QNB A;  2K2N A;  4J1W A;  2LYQ A;  4RX3 A;  3PR6 A;  1YSQ A;  1CK3 A;  2WAE A;  5EUA A;  1WIZ A;  4GLQ A;  5HDD A;  2ZL1 A;  2PR5 A;  4GJ4 A;  2ZC5 B;  4EQ1 A;  4JGP A;  4GDN A;  1KE0 A;  1S1Y A;  4UQI M;  3NDG A;  4IED A;  5TJJ A;  3VOY A;  2BLS A;  3E2L A;  2YKH A;  3C5A A;  5HW3 A;  4GKU A;  1KGG A;  2XLN A;  3T12 B;  3PE5 A;  2EXB A;  4BL3 A;  2FFF B;  3F1N A;  3FKW A;  1IYQ A;  2ZM2 A;  4A5R A;  3ZVT A;  2G2U A;  3NEC A;  2QWS A;  3U3W A;  2OOL A;  5EVL A;  5F83 A;  4CLC E;  3WRZ A;  3D72 A;  1GSW A;  3P7N A;  2V8C A;  4QY6 A;  1VPW A;  3Q7Z A;  4HJ6 A;  3GUU A;  3NY4 A;  4OP8 A;  4YNR A;  3HBR A;  5GHX A;  3B7H A;  2JHE A;  4IUK A;  1XFN A;  4IBR A;  2AXV A;  1OJG A;  4WVL A;  3V50 A;  4OP5 A;  1KGE A;  2YBD A;  1QP7 A;  2LYJ A;  4KQR A;  2PYR A;  3F1O A;  3TRC A;  1TS6 A;  3CEC A;  3MS6 A;  3HLF A;  3WS5 A;  2PXF A;  3O86 A;  4PHT A;  1NRF A;  3B42 A;  2HJE A;  2W3F A;  3H7W A;  4MBK A;  5DF9 A;  1WH8 A;  1KDW A;  2JCG A;  4ER3 A;  1VEU A;  1H5X A;  5IU1 A;  4FH2 A;  3CLO A;  4PKY A;  3R09 A;  1X57 A;  5DTQ A;  2WGI A;  2J80 A;  4YBA A;  3OOV A;  1NEQ A;  2PXV A;  2WGW A;  2ZQC A;  4MMN A;  5DTT A;  3C4O A;  4OQG A;  1K57 C;  1V9Y A;  4NET A;  2R1J L;  1XWR A;  3VP3 A;  4Z5C A;  2O4A A;  1PNE A;  2EX6 A;  2O9B A;  2J9O A;  3SR4 A;  5FI7 A;  2Q9N A;  3MKF A;  4WM9 A;  4B93 A;  1FCN A;  1GCE A;  2LYS A;  1P9R A;  2PIJ A;  3CPT A;  3CWF A;  5HWW A;  3HLE A;  1TDG A;  3Q1F A;  3QOX A;  3B33 A;  1XJ6 A;  1S67 L;  1IKI A;  3BLS A;  4RA7 A;  3UDF A;  3HUN A;  4R1G A;  5GHY A;  3NDB B;  1QPZ A;  1STZ A;  3OCN A;  2HSG A;  3SX0 A;  2VV6 A;  5AQB A;  1YKD A;  4WZ4 A;  2LYK A;  2HP5 A;  3M6H A;  1ALQ A;  1OCT C;  5E2G A;  1ACF A;  1LSW A;  3R7W A;  1SHV A;  4MN6 A;  3Q07 A;  4HIA A;  1PW1 A;  3MEJ A;  3VWS A;  1OT9 A;  1VEU B;  3BLM A;  2BTF P;  4Z9Q A;  2PXQ A;  3ZDJ A;  2QKP A;  3PBQ A;  3OC2 A;  1OTB A;  5CTM A;  1YLW A;  3LCE A;  1GSV A;  4NG2 A;  1BDH A;  3VV4 A;  3JYI A;  3LIS A;  3ZFZ A;  5A92 A;  3GBF A;  3FPV A;  4L9E A;  4MN7 A;  3IF6 C;  4QJG A;  2Y2Q A;  3T1S A;  2J3T D;  2K7S A;  3PAG A;  2PXP A;  3CJM A;  3MBZ A;  1YMS A;  3GEC A;  3HCY A;  1MKM A;  4N1X A;  5GLA A;  1UWP X;  1C3B A;  1M6K A;  5FI6 A;  3QP2 A;  1POU A;  2LCV A;  2EWV A;  5DSX A;  2H5S A;  3MXR A;  4PPR A;  3BM6 A;  3LIF A;  3W4Q A;  1HVB A;  4X25 A;  3TE8 A;  3IX3 A;  3G31 A;  3TW8 A;  2L4R A;  4LV1 A;  1UWN X;  1DWK A;  1XP4 A;  3G2Z A;  4NEE D;  1MC0 A;  3UE3 A;  2Y2I A;  2PD7 A;  2J8Y A;  2A6C A;  4GNU A;  1ZS4 A;  1HQ1 A;  4HQA A;  4LRZ E;  4DJ2 A;  4IVI A;  4Z5D A;  4GN2 A;  4XT2 B;  1AU7 A;  3VP1 A;  3TG9 A;  3TEL A;  4QWO A;  2NUT C;  3BFF A;  1T18 A;  2B5A A;  1OPX A;  4WLA A;  3S8Q A;  1JTD A;  1DW9 A;  4Q2J A;  3IS2 B;  2LNM A;  1JH9 A;  5GLC A;  4JLF A;  4GS9 A;  5GLB A;  1RIO A;  4R0Q A;  3VFH A;  3S7Q A;  3QWG A;  3LR3 A;  3R4K A;  1ES3 A;  3CG5 A;  5HFO A;  1OJ5 A;  1XJ3 A;  1G28 A;  3ZG0 A;  1F9I A;  4ZDX A;  2C5W B;  5JYP A;  3VSK A;  1JWL A;  1G5U A;  3FKV A;  3GR2 A;  2IU7 A;  2HZ5 A;  4NXG A;  3BY8 A;  3U4L P;  4UA9 A;  1W8Q A;  1MBL A;  4P87 A;  4QB8 A;  5DRY A;  4ID4 A;  2IVQ A;  4X68 A;  4E3J A;  3IF6 B;  5J4E A;  2ACG A;  1YLP A;  1CEG A;  2JE5 A;  2QHK A;  3MF0 A;  4EU0 A;  3T1X A;  2LB5 A;  1K55 A;  1XJ2 A;  4OOL A;  1ZUG A;  4Z59 A;  2PYP A;  4OOY A;  2PUA A;  5CXW A;  3PBR A;  2EWT A;  2HF6 A;  1GHI A;  1U60 A;  1T1B A;  2PXK A;  5CGS A;  3S7P A;  3T4T A;  5EM1 A;  1IYO A;  1RGY A;  1NZO A;  3GZC A;  1YAX A;  5FEF A;  4HOI A;  4OBM A;  2XQZ A;  2IUO A;  1XGI A;  4K91 A;  5L09 A;  2R9W A;  3KSI A;  4I6U A;  4IWR A;  5DFX A;  3RH8 B;  3WRT A;  1PZP A;  4WZ5 C;  2G7U A;  3OZH A;  3BD1 A;  5EM0 A;  2ZC6 B;  4GCZ A;  4HBU A;  1EW0 A;  1K56 D;  4DN0 A;  2EXA A;  3P09 A;  2V0U A;  2KEJ A;  3HVF A;  1GA0 A;  4R4R A;  4IVZ A;  3TEP A;  4O8B A;  4I3J A;  4H6J B;  1H3Q A;  2Z2M B;  4OH0 A;  2WAD A;  3ZGA B;  2R63 A;  1L3L A;  3DTM A;  4CLC A;  5A7L A;  3CUE A;  1CQA A;  3LID A;  3G2Y A;  2ZM0 A;  2WAF A;  3EGX C;  3OQM A;  4PM9 A;  4DE1 A;  4EBL A;  2FH5 A;  1Z09 A;  5A93 A;  3JVU A;  2Y2J A;  1HF0 A;  3KSF A;  2HCN A;  4D2O A;  4K0X A;  4Z58 A;  1MKI A;  3HLC A;  2DMW A;  1ERQ A;  2W27 A;  5J8X A;  1BLH A;  2IWC A;  2PPX A;  4EQI A;  2VLG A;  1ZG4 A;  2PAV P;  3UPO A;  5FQM A;  4OPY A;  1L0F A;  3PHY A;  5D3O A;  2BAS A;  3S7O A;  3UE1 A;  1JTG A;  2WUQ A;  1YLY A;  5HPI A;  3SCG A;  3FZC A;  4HH3 A;  4ER0 A;  3OQO A;  3G30 A;  4KQD A;  3CHW P;  1BZA A;  5EOO A;  4Y0T A;  2Y2P A;  3GRJ A;  3M6B A;  1ZC2 A;  4ETZ A;  2WKE A;  2KEI A;  2ZC3 B;  4S2I A;  3T4S A;  1SCW A;  2ZL1 B;  1F5M A;  1NYM A;  5TR7 A;  4DXC A;  2ZMF A;  3VE3 A;  1IYS A;  1JWP A;  2B95 A;  2XRO A;  4HJ4 A;  2L49 A;  1ZKJ A;  3LIB A;  1ZG6 A;  3UPN A;  5BOH A;  2X71 A;  1XGJ A;  1UXC A;  3O9X A;  1LI9 A;  3JXB C;  4JXG A;  3AGF A;  4RX2 A;  3H5T A;  2GRL A;  1ERM A;  1D1J A;  4FBI A;  4GHJ A;  3UWP A;  2EBY A;  1IEL A;  2R78 A;  2OV5 A;  1K55 C;  4BL2 A;  5CED A;  2HPB A;  4E3I A;  2KZ8 A;  3IHA A;  4KZB A;  3UN7 A;  5DTM A;  3T4J A;  5CEB A;  4D60 A;  2QJ7 A;  4OB4 A;  4N92 A;  3VOL A;  2AW6 A;  1XA1 A;  2XSD C;  4XUX A;  1YT4 A;  3KYE A;  3D1N I;  2PXB A;  4HNB A;  4OLD A;  2W3D A;  1I2W A;  2LYR A;  5DKK A;  1PWG A;  2WYX A;  3BY9 A;  2XXQ A;  3VP2 A;  4OLG A;  1RCJ A;  2OAQ 1;  1DRM A;  1N9L A;  4EER A;  3ITA A;  4JXV A;  4NK3 A;  1PRA A;  2GZU A;  1BYW A;  3IQA A;  3NJA A;  4QPR A;  3MZE A;  1DJA A;  2EWW A;  1XPB A;  5FDH A;  2PXE A;  4BBV A;  3T1R A;  4RVA A;  2R9X A;  3ZNT A;  1PW8 A;  3JXC L;  2Y59 A;  5IT5 A;  2W1T A;  1SDN A;  2MJ6 A;  3NOT C;  1NLZ A;  3BQA A;  4DMZ A;  3DAV A;  2B5R A;  4KZ8 A;  4M3K A;  4QHC A;  5F68 A;  2VEO A;  5HX9 A;  4RQ9 A;  1IEM A;  4EUV A;  2G2W A;  5TGF A;  3M2K A;  2H8R A;  2UV0 E;  3NHQ A;  3T50 A;  3H82 B;  3GVB A;  5TBM B;  2ZQ7 A;  2IV1 A;  4F8D A;  4X4H A;  2ICT A;  4RYE A;  5TFQ A;  1QMF A;  3JPU A;  2IWD A;  3R7W B;  4FOF A;  3SCF A;  2KOI A;  3O5Y A;  1QQA A;  4OPZ A;  4L9G A;  2P04 A;  2H28 A;  4BEN A;  5CX7 A;  3C38 A;  5CHM A;  3JXD L;  2KDK A;  1HLU P;  4S2O A;  5FQQ A;  1XFQ A;  2V8F A;  4S2P A;  4IUH A;  3PTE A;  2XH9 A;  3HJI A;  4EBP A;  3MJQ A;  3WS1 A;  3NCK A;  1ZAY A;  3NI9 A;  4YFM A;  2WKH A;  2ODR D;  3T4L A;  3UB9 A;  3GDI A;  4FN3 A;  2XCJ A;  1TDL A;  1LMB 3;  2V1B A;  2E8J A;  4GOG A;  2BNM A;  2A49 A;  2DNS A;  4I3I A;  2PRF A;  4PU7 A;  4LCM A;  5HAQ A;  3HZI B;  2XFS A;  4H6J A;  3C7U A;  4OON A;  4WUJ A;  4QD4 A;  3QP8 A;  3IXB A;  1YLT A;  4DRT A;  3IS2 A;  1MWU A;  3IX8 A;  1LSV A;  1QME A;  1TF1 A;  2O0Y A;  5M18 A;  4Y0U A;  5DJT A;  1A0K A;  2XGN A;  3LEZ A;  5K5B A;  1BLS A;  4JPM A;  4EUZ A;  3OPL A;  3ZKC A;  4MEZ A;  1UGU A;  2FFH A;  5G18 A;  3FYM A;  5FI2 A;  5F6A A;  3CRO L;  4JGR A;  5HL6 A;  4ER5 A;  3UB5 P;  2WIU B;  1PFL A;  3LIC A;  2L1M A;  1L2S A;  2A3U A;  4O01 A;  3CUE C;  4R6L A;  2FJR A;  4ER7 A;  3IXD A;  3A9Y A;  4Z5H A;  3ULF A;  1IFQ A;  3MZF A;  1QQB A;  5FDS A;  2PUC A;  3DNV B;  1CI9 A;  1R69 A;  4WMC A;  2PUF A;  5E2F A;  4YG1 A;  4L0L A;  2AUW A;  1P9W A;  2I9V A;  3E4P A;  3HLD A;  1PER L;  4JF4 A;  1JFS A;  2MXD A;  4M4X A;  4II7 A;  5M19 A;  1K56 A;  1LQC A;  1P97 A;  1NJ4 A;  1LL5 A;  1CJG A;  3HUM A;  5E43 A;  1NER A;  2PE5 A;  3MFX A;  3CAX A;  1DUL A;  4PU3 C;  2PUD A;  2DCF A;  3DBA A;  1H8Z A;  1RPE L;  2Y55 A;  5FSR A;  4QY5 A;  2HDU A;  2VKS A;  5EFW A;  2JKR I;  3O3V A;  2VV8 A;  4IVK A;  3P98 A;  3F1P A;  1PWC A;  2O49 A;  1DP8 A;  4LV2 A;  1TS0 A;  1BLC A;  4BLM A;  2JVL A;  4U0X A;  1YLJ A;  4YOF A;  2D5V A;  2J3T C;  3TSG A;  5EVI C;  4LPZ A;  3SS4 A;  4O0P A;  2VJW A;  3CI6 A;  4WZ5 A;  1ERO A;  2IVB A;  1NZU A;  3VP4 A;  3KL4 A;  4Z1W A;  4X69 A;  4KZ9 A;  4EKG A;  3A0V A;  3FPW A;  1CQT A;  3RFB A;  2W3G A;  3FV7 A;  1ZTU A;  1ONG A;  4S2M A;  5KZH A;  2PHY A;  3M2J A;  1IKG A;  4O7D A;  3WWX A;  1I2S A;  2YKF A;  3MFD A;  1WE4 A;  3SH8 A;  5CHJ A;  3EWK A;  5DKL A;  5EV0 A;  3UB7 A;  3F52 A;  2Y91 A;  1ES5 A;  2AXZ A;  3OWQ A;  3IH8 A;  1VET A;  4AFI A;  4YAR A;  3LQX A;  4BBT A;  4LV0 A;  2A24 A;  4YIN A;  1K38 A;  1Y54 A;  1QP4 A;  1MFQ C;  4ESP A;  2KEK A;  5CHU A;  3VOZ A;  3KYZ A;  1PRU A;  3G34 A;  3Q82 A;  3ZHI A;  3SH7 A;  2HFZ A;  3MQO A;  4XT2 A;  3W4O A;  3BJN A;  4HI4 A;  3GZD C;  3GN5 A;  4CLC C;  2XI8 A;  5A91 A;  4DDS A;  2ZOH A;  3EEH A;  5F1F A;  1WYC A;  1W8Y A; 
#chains in the Genus database with same CATH homology
 1VB6 A;  4O8B A;  3C2W A;  2V9A A;  2D01 A;  3KO6 A;  5AJG A;  4I3J A;  4KQO A;  1LT0 A;  4G3V A;  4H6J B;  1H3Q A;  3T4Q A;  5A8B A;  1GSX A;  3GN5 B;  1R63 A;  5G4Z A;  5MC7 A;  3EEA A;  4NXE A;  4Y3I A;  3SCH A;  3IBR A;  2R63 A;  2AXU A;  2CMN A;  2BNN A;  3UE6 A;  3UB8 A;  2OFY A;  1LSX A;  1ZHH B;  3BW6 A;  5A7L A;  4CLC A;  3CUE A;  1S4R A;  3LID A;  3VK0 A;  3HJK A;  3EGX C;  3OQM A;  4PU4 C;  1T1C A;  3KYQ A;  2V1A A;  2FH5 A;  3JVU A;  4F3L B;  1PNR A;  1S7E A;  2JN7 A;  4X4D A;  5I5L A;  2GJ3 A;  3LIA A;  1LCD A;  4OOM A;  5DFY A;  3D3O A;  3F1P B;  4WEK A;  1HF0 A;  2INW A;  3PXP A;  3KSF A;  3LI8 A;  3OBF A;  3EGD C;  2OAP 1;  4BWI A;  4FSF A;  3EUS A;  2PR6 A;  2QYB A;  3NOU C;  2PUB A;  1G6O A;  5HDC A;  2HJ9 C;  4KUO A;  4Z58 A;  2LYP A;  2XA7 M;  4ARZ A;  2XA7 S;  2DMW A;  2ZOI A;  2W27 A;  5IS1 A;  4Q0I A;  3K3D A;  4G3W A;  1ADR A;  3KZ3 A;  3UME A;  3LYX A;  3F51 A;  3F1N B;  3OCL A;  2PPX A;  4E04 A;  4CLC D;  4J1X A;  1DP6 A;  2VLG A;  4BMW A;  3PBO A;  5F69 A;  3PHY A;  5DJU A;  2LB9 A;  2BAS A;  3NOP C;  2GX5 A;  1IC8 A;  1S66 L;  2HGV A;  3H7W B;  1SQ8 A;  3S7O A;  2K2N A;  4J1W A;  2LYQ A;  5HZH A;  1OTA A;  1EFA A;  4KUK A;  5HPI A;  3PR6 A;  1YSQ A;  3SCG A;  3KX0 X;  4HH3 A;  4I39 A;  3E98 A;  2MQK A;  3KJX A;  5HDD A;  1WIZ A;  4GLQ A;  3OQO A;  2PR5 A;  4GJ4 A;  4I5S A;  1TS7 A;  4I8T A;  4EQ1 A;  4KQD A;  4JGP A;  1GT0 C;  1S1Y A;  1NLY A;  4ETZ A;  4UQI M;  3FYA A;  4UQI S;  2KEI A;  4JGO A;  3T4S A;  1NRJ A;  5TJJ A;  4MDZ A;  1F5M A;  2KLI A;  2ZMF A;  3VE3 A;  2YKH A;  5AVF A;  3F6W A;  4GQM A;  1QP0 A;  2PD8 A;  3PBN A;  2XRO A;  3IVP A;  2HIN A;  3F1N A;  4HJ4 A;  2L49 A;  4JQD A;  3QYX A;  2LYL A;  3LIB A;  2QWS A;  3LI9 A;  3U3W A;  5J7E A;  2OOL A;  2VX8 A;  4CLC E;  1PRV A;  3D72 A;  1UXC A;  5LBR A;  3O9X A;  1GSW A;  3P7N A;  3JXB C;  1N9N A;  1VPW A;  2GRM A;  4HJ6 A;  3H5T A;  2GRL A;  3KSG A;  4FBI A;  4GHJ A;  5HPF A;  2EBY A;  2KX6 A;  4YNR A;  2R78 A;  3B7H A;  2JHE A;  3OQN A;  4IUK A;  1XFN A;  2L0W A;  2QJ5 A;  2AXV A;  1OJG A;  2FZ0 A;  3U2A A;  3W2Z A;  3C8C A;  3RZZ A;  4DJ3 A;  3MLF A;  1QP7 A;  2LYJ A;  2KZ8 A;  4G3K A;  3ZQ5 A;  2PYR A;  4NKP A;  3F1O A;  3T4J A;  2Y8H A;  3TRC A;  1TS6 A;  3CEC A;  2QJ7 A;  4OB4 A;  2VGL S;  3EQV A;  4PHT A;  2AW6 A;  3B42 A;  2XSD C;  2HJE A;  2W3F A;  3H7W A;  3VOL A;  3D1N I;  3QQ6 A;  5DF9 A;  1WH8 A;  3MXQ A;  2JCG A;  4HNB A;  1OTE A;  4Y2F A;  2WKR A;  2W3D A;  2LYR A;  5DKK A;  4MCX A;  5IU1 A;  3TJZ C;  3BY9 A;  3T4K A;  3MQ0 A;  3G5G A;  1ZZ7 A;  3CLO A;  3ICY A;  2OAQ 1;  4ME4 A;  2KPJ A;  4PKY A;  1X57 A;  1DRM A;  1N9L A;  4I38 A;  4MN5 A;  4EER A;  3ZHM A;  3CLC A;  2VGL M;  2J80 A;  4YBA A;  1W63 Q;  2XRN A;  2IA2 A;  3OOV A;  5C5K A;  4WEL A;  1PRA A;  1NEQ A;  2GZU A;  1LLI A;  3EOI A;  1BYW A;  4Y42 A;  3NJA A;  4QPR A;  4EES A;  4MMN A;  2MEZ A;  3CIT A;  2EWW A;  2ICP A;  4BBV A;  1V9Y A;  2R1J L;  1XWR A;  1ZZ8 A;  3RTY A;  3JXC L;  5IT5 A;  3LFV A;  4Z5C A;  2O4A A;  2W1T A;  2O9B A;  4K08 A;  2MJ6 A;  3H82 A;  1V9Z A;  3NOT C;  1ZZC A;  3E0Y A;  2CSF A;  4GHI A;  1ODV A;  1NLZ A;  3BQA A;  4DMZ A;  4B93 A;  4I3A A;  2P08 A;  3F1O B;  5F68 A;  2LYS A;  1P9R A;  2PIJ A;  3CWF A;  5HWW A;  3QF3 A;  2B02 A;  3H9W A;  4GW9 A;  4RQ9 A;  4X4G A;  3B33 A;  4EUV A;  4X4I A;  1XJ6 A;  1S67 L;  3FMY A;  1WH6 A;  4IA8 A;  3BWL A;  1D7E A;  2H8R A;  4B9O A;  3NHQ A;  3T50 A;  3H82 B;  5TBM B;  5HSQ A;  2IV1 A;  1QPZ A;  1STZ A;  3OCN A;  4F8D A;  2XJ3 A;  2HSG A;  2ICT A;  4X4H A;  3LR5 A;  1NWZ A;  2VV6 A;  2B18 A;  3R7W B;  4FOF A;  3SCF A;  2KOI A;  4HP4 A;  3O5Y A;  1YKD A;  1JNU A;  1QQA A;  3L1P A;  3LR0 A;  4L9G A;  1VHM A;  2H28 A;  2LYK A;  2P04 A;  3BQ8 A;  3C38 A;  5CX7 A;  5G4Y A;  3JXD L;  2KDK A;  2PDR A;  4MCT A;  3BS3 A;  4P6Z S;  5HWT A;  3R1F A;  1D06 A;  4ZRR A;  1XFQ A;  2O9A A;  2BNO A;  5KIZ A;  1OCT C;  4PKY G;  1LSW A;  1KOU A;  3R7W A;  3KSH A;  4R3A A;  4IUH A;  4MN6 A;  5HD5 A;  1E3O C;  1Y28 A;  3IBJ A;  3HJI A;  4HIA A;  1UXD A;  2W1T B;  2GZA A;  4X4C A;  1OT9 A;  3MR0 A;  3MJQ A;  1WET A;  1ZAY A;  2QKP A;  3PBQ A;  3OC2 A;  4HH2 A;  2NUP C;  1OTB A;  2VZW A;  4O8G A;  3A0R A;  2ZBB A;  5F5Y A;  1LL8 A;  3T4L A;  3UB9 A;  3GDI A;  5AVE A;  1TD5 A;  4FN3 A;  2XCJ A;  1H8M A;  4PAU A;  1GSV A;  3K2N A;  1LMB 3;  2V1B A;  4EW7 A;  1BDH A;  2VV7 A;  2BNM A;  3PYP A;  4HJ3 A;  2PT7 A;  4I3I A;  3VV4 A;  3LIS A;  4PU7 A;  5TBM A;  2W3H A;  1S1Z A;  3HZI B;  3GBF A;  4P6Z M;  1ZPQ A;  3FPV A;  4L9E A;  4MN7 A;  4X4F A;  1OTD A;  4H6J A;  4R38 A;  2M1C A;  2J3T D;  2K7S A;  4WUJ A;  3UFD A;  3HCY A;  3GEC A;  2L8N A;  1MKM A;  2P7J A;  1JFT A;  4BBU A;  3IS2 A;  1UWP X;  1LSV A;  2D02 A;  3G7D A;  1TF1 A;  2VA0 A;  1YSP A;  2O0Y A;  3OP9 A;  5L8M A;  1B0N A;  1POU A;  4JCX A;  4HP9 A;  3V67 A;  2LCV A;  2EWV A;  2WUS R;  2PUE A;  4GHI B;  4CQH A;  5DJT A;  4EXO A;  5K5B A;  2V0W A;  3OMT A;  3FG8 A;  3LIF A;  3ZKC A;  3TE8 A;  4IJG A;  2M7U A;  3TW8 A;  4X4B A;  1UGU A;  2L4R A;  3FYM A;  1UWN X;  3K3C A;  1DWK A;  2EF8 A;  1L1M A;  4Q0J A;  5F6A A;  5K98 B;  2J3W A;  3VE4 A;  2Z6C A;  4NEE D;  3CRO L;  1Y7Y A;  1MC0 A;  4X4E A;  4JGR A;  5HL6 A;  3UE3 A;  2JKR M;  2A2L A;  3EQU A;  4UEY A;  2WIU B;  2K31 A;  1Y9Q A;  1RZR D;  4WEJ A;  2PD7 A;  2ZMV A;  2A6C A;  3LIC A;  1RZR A;  4LRY C;  1ZS4 A;  2L1M A;  1OSL A;  2O9C A;  2JKT I;  4HQA A;  3B47 A;  4CLC B;  4O01 A;  4LRZ E;  4DJ2 A;  3CUE C;  4JCY A;  3E4O A;  3MQQ A;  2XIU A;  4R6L A;  4Z5D A;  2FJR A;  4XT2 B;  1AU7 A;  4I6T A;  4L9F A;  4Z5H A;  4WF0 A;  3ULF A;  1TS8 A;  4NXF A;  2NUT C;  1IFQ A;  1QQB A;  1T18 A;  2B5A A;  1OPX A;  4WLA A;  3KXA A;  3JVV A;  5HD3 A;  2PUC A;  3DNV B;  3LFP A;  3S8Q A;  1R69 A;  1YSE A;  1DW9 A;  3IS2 B;  1T19 A;  1S4S A;  1X0O A;  1JH9 A;  2PUF A;  1X2L A;  4YG1 A;  2WKQ A;  3FC7 A;  2AUW A;  1P9W A;  4GS9 A;  4L0L A;  2I9V A;  3E4P A;  1PER L;  1RIO A;  1JFS A;  3S7Q A;  4M4X A;  1ZZB A;  4II7 A;  3QWG A;  2W1R A;  4BJP A;  3LR3 A;  1ZVV A;  1LQC A;  2BJC A;  3R4K A;  1P97 A;  2XSS A;  4WN5 A;  1CJG A;  1OJ5 A;  1XJ3 A;  3UMD A;  5FL3 A;  1G28 A;  1NER A;  2PE5 A;  1BDI A;  1F9I A;  3MFX A;  2Y79 A;  3CAX A;  1XJ4 A;  4PU3 C;  2PUD A;  2OWJ A;  4R70 A;  3DBA A;  1RPE L;  4Q0H A;  1ZZ9 A;  4F3L A;  1F98 A;  2VKS A;  5EFW A;  2JKR I;  4LRX C;  1JWL A;  2M7V A;  2VV8 A;  3SW1 A;  2IU7 A;  3PBS A;  4NXG A;  1N9O A;  2OWH A;  3F1P A;  4NXB A;  3BY8 A;  3UB6 A;  2O49 A;  1DP8 A;  2WKP A;  1TS0 A;  1W63 M;  2A24 B;  2JVL A;  4YG7 B;  3LR4 A;  2CRO A;  2IVQ A;  4YOF A;  1DP9 A;  4HHD A;  2D5V A;  2J3T C;  4EET B;  4LPZ A;  4I6R A;  4O0P A;  2VJW A;  3CI6 A;  2VEA A;  4GS9 B;  4HY8 A;  5J4E A;  2IVB A;  3TRB A;  3C30 A;  2QHK A;  3MF0 A;  4MCW A;  4EU0 A;  4PU8 A;  2LB5 A;  3G6O A;  4Z1W A;  2O99 A;  1XJ2 A;  1LCC A;  4OOL A;  3A0V A;  3FPW A;  1ZUG A;  1CQT A;  2GNX A;  3LIE A;  4Z59 A;  2W3G A;  3RFB A;  2PYP A;  1ZTU A;  2PUA A;  1MZU A;  4LLO B;  1WA9 A;  2W3E A;  2PHY A;  4NDW A;  1OT6 A;  3PBR A;  2EWT A;  2IVG A;  2HF6 A;  2EA9 A;  2YKF A;  4JGQ A;  5KSH A;  3E4Q A;  4YWZ A;  1T1B A;  3EWK A;  1ZZ6 A;  5DKL A;  3UB7 A;  3PBT A;  3LUQ A;  3F52 A;  4ARZ B;  5J3W A;  2AXZ A;  3MMH A;  4EEU A;  3A0S A;  3S7P A;  3T4T A;  4WL9 A;  4AFI A;  4YAR A;  2AWI A;  2HV1 A;  1YAX A;  1O4X A;  1OTI A;  4BBT A;  2A24 A;  3OLO A;  2W0N A;  1IOU A;  1QP4 A;  4HOI A;  2KEK A;  3KYZ A;  1UTX A;  1P0Z A;  1PRU A;  2IUO A;  3S7N A;  1T1A A;  3P01 A;  4ETX A;  3ZHI A;  3KSI A;  4I6U A;  4IWR A;  4IHQ A;  4Y5F A;  5DFX A;  3T4O A;  2O38 A;  3RH8 B;  3MQO A;  2JKT M;  1RZS A;  4XT2 A;  3BJN A;  4YG4 A;  4HI4 A;  5HDS A;  4EEP A;  2G7U A;  3BD1 A;  3GN5 A;  4CLC C;  2XI8 A;  2Z6D A;  4GCZ A;  5HWV A;  1EW0 A;  4DN0 A;  3ZYT A;  3BDN A;  2V0U A;  2ZOH A;  2KEJ A;  3EEH A;  2PUG A;  4IVZ A;  2OR1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...