3PXPA

Crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
292
structure length
292
Chain Sequence
GMERAAFGKLVQALRREHRDEKGRVWTQEVLAERTQLPKRTIERIENGSLAHLDADILLRLADALELTIGERREFFFAATGIIEQKSATYKRSPEESLQYLIDMIRNMNVPAFVTDQYVNIIAANMITIRFFNIPMELIETAPLLPHGYNLMRVVFGTEYDFRRVVGTMWDEVARHNMQLFRAISLRVRADGYFVELLDNLMQYREFKRFWERAHLETEDTSAENFWYQYTHPVYGLLSYVSSRSQIPTSMGLLSMHTYIPLSPATTDLFAKLSTVANQDVIRLAPWPRSNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Helix-turn-helix domain protein
publication title Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes.
pubmed doi rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription regulator
total genus 85
structure length 292
sequence length 292
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
A PF17765 MLTR_LBD MmyB-like transcription regulator ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3pxpA01
3.30.450.180 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pxpA02
3H5TA 5A7LA 2PUGA 5K98B 3ZKCA 1ZVVA 3BD1A 3F52A 2EWTA 3R1FA 1WETA 2LYJA 4X4IA 3KJXA 1QQBA 2KEJA 4JCYA 2BNNA 3OQOA 1ZZ6A 2LYQA 2JCGA 1X2LA 4O8BA 2MEZA 2PUEA 1RZRD 3TRBA 3OMTA 4Y42A 4YG7B 2LYPA 4X4GA 3QQ6A 4X4BA 2GRLA 1XWRA 2WIUB 1LCCA 3CLCA 3DNVB 1JFTA 2PPXA 2L49A 2XJ3A 1RPEL 1S7EA 2EF8A 2LYLA 1UTXA 1AU7A 3GN5B 2O38A 4MCXA 2FJRA 1ZZ8A 3BDNA 1ZPQA 1WH8A 1ZZ9A 2GZUA 4Z59A 1OSLA 3EUSA 4YG4A 4YBAA 3UFDA 2IVGA 1ZZCA 3OQMA 1ADRA 3VK0A 1NERA 2AUWA 2KPJA 3JXBC 2OFYA 1E3OC 1ZZBA 2CSFA 4X4HA 1LMB3 1UXDA 1JWLA 3SCGA 4I6TA 1IC8A 1OCTC 1BDIA 2O49A 4PU3C 3OP9A 2R63A 1YSEA 2OR1L 4IWRA 2AXUA 3SCFA 1O4XA 4Z5CA 1PRUA 1X57A 3QWGA 1JFSA 2O4AA 4FBIA 2LYSA 3F6WA 1R63A 1EFAA 2PUBA 1Y9QA 3JXCL 2BJCA 1RZRA 1LLIA 3G5GA 4IA8A 4J1WA 3OQNA 4X4EA 3SCHA 1HF0A 1ZUGA 2IU7A 2KZ8A 2KEIA 1R69A 2XI8A 3FYMA 3GN5A 1VPWA 1CJGA 3CECA 3D1NI 1B0NA 4JQDA 2GRMA 2IV1A 4I6UA 3IVPA 1QQAA 3GBFA 1PERL 4OB4A 4X4CA 1ZZ7A 3BS3A 2LCVA 1RZSA 2A6CA 1Y7YA 2PE5A 1QP7A 1ZS4A 4I6RA 1PRAA 3FYAA 1PRVA 2JVLA 1WH6A 2PUAA 2IVBA 3QYXA 4MCTA 3LISA 3FMYA 3B7HA 4FN3A 3L1PA 2PUCA 2BNOA 3CROL 4F8DA 1RIOA 4GHJA 1CQTA 1POUA 1ZAYA 2WUSR 4YG1A 4NDWA 2XIUA 3KZ3A 1LQCA 3QF3A 4PU8A 1BDHA 1LCDA 3O9XA 1QP0A 3KXAA 2AWIA 4X4FA 3HZIB 2IVQA 1QPZA 4Z58A 2PUFA 2MQKA 2R1JL 2H8RA 2PUDA 2XSDC 1L1MA 4Z5HA 3G7DA 3ZHMA 2LYRA 2AXZA 4GQMA 2HINA 3S8QA 4PU7A 1SQ8A 2B5AA 2ICPA 1DWKA 2ICTA 1WIZA 2XCJA 1DW9A 3RZZA 2LYKA 3MLFA 2CROA 1JH9A 2IUOA 3ZHIA 3F51A 2HSGA 2PIJA 4JCXA 4YARA 2AW6A 4I8TA 1UXCA 2D5VA 2L8NA 1PNRA 3JXDL 2KEKA 3LFPA 4J1XA 3PXPA 4IVZA 4X4DA 1GT0C 1NEQA 2BNMA 4Z5DA 2EBYA 1QP4A 2AXVA 3U3WA 4PU4C
chains in the Genus database with same CATH superfamily
1A0KA 5E43A 4ZTKA 3S7NA 2GDNA 5K98B 2WKIA 3G2ZA 1LI0A 3NOTC 5A92A 4YWZA 3T4JA 1K6RA 3G31A 4YOFA 3OZHA 1NZUA 2QJ7A 4P0MA 2VLGA 3NOPC 4Z1WA 5CHJA 1MFQC 4I3JA 3BDNA 3EUSA 3LI8A 4RQ9A 2CSFA 4U0XA 4OQIA 3SS5A 5K5BA 2EX6A 3OOVA 3SCFA 1DJAA 4Z5CA 3OPPA 3ULFA 1JFSA 2ZD8A 3ITBA 1EFAA 2BJCA 1N9OA 5EM0A 2J3TC 1HVBA 3OLOA 4WZ4A 4GB7A 4L9EA 5FAPA 4JQDA 2Y2GA 2K7SA 3UPNA 3LIBA 3GBFA 1NLYA 2ZL1A 1Y7YA 2H28A 4UA6A 2PR6A 4DXCA 4CLCE 1LSVA 3VP1A 4B4XA 5FQMA 3FMYA 1YLJA 2XLNA 4PM5A 4R4SA 3EOIA 3H7WA 2PD8A 3HUNA 3BWLA 4MDZA 4Q2JA 1W8YA 1L0GA 3S8QA 1DWKA 1SKFA 2YKFA 3MFDA 3F51A 3ZG7B 3RXWA 2J9PA 1G68A 4E3NA 2V9AA 1D06A 1DJBA 5IU1A 4DE0A 1W79A 1WYBA 3DTEA 3CUEA 3LIEA 1Y28A 3BQAA 3V3SA 4JXSA 2J80A 4IVKA 1LLBA 5G18A 5L07A 1K57C 4WBGA 5DFYA 3KYEA 5F1GA 3QQ6A 2PXKA 1MWRA 3G34A 5HD3A 2L49A 3UWPA 3QFIA 3BW6A 4IJGA 3AGDA 5FAQA 2IVGA 1ADRA 3OQMA 2AUWA 5HWTA 2EXAA 1I5QA 5FEGA 2ZL1B 3HLFA 3VP0A 1OCTC 3WRZA 2JE5A 2ZC3B 4OLDA 4HRAA 1GHPA 3E2LA 1WYCA 5EV0A 1CJFA 2J7UA 2NUTC 2WGWA 4ZBEA 3H7WB 2Y2JA 2XFTA 5CEDA 4UAAA 5DVAA 2V1ZA 4OB4A 3MS6A 5AQ9A 5EVLA 4EQ1A 5I5LA 1ZKJA 1GCEA 3V5MA 3E2KA 3HLBA 4WEKA 2WKRA 1IYOA 2H0YA 3HLGA 2M7VA 1TDGA 1ZAYA 4KZ7A 4IUHA 4WLAA 4S2PA 4BJPA 1K55C 1IOUA 2Y2QA 3Q7VA 2H8RA 3UPOA 3G7DA 3IWIA 2I72A 5F1FA 1WIZA 1DW9A 2IUOA 4JGRA 2PDRA 2Q9NA 5J4EA 4I3AA 4N92A 5HX9A 1EWZA 1N4OA 1XGJA 2M1CA 1BLHA 2WKHA 2O99A 3LFPA 3K2NA 3U3WA 2GJ3A 2X02A 4FH4A 5A7LA 3C7VA 3OKZA 3F52A 1F2KA 2DNSA 2Z6CA 4C75A 1OT6A 4M4XA 1K56D 3OQOA 3BLSA 2VV6A 1MY8A 4JPMA 2ZOHA 4EZIA 3M2JA 3UE0A 4OKPA 5EVIA 1FSWA 4RVAA 5FSRA 2WGWB 1QB2A 5DTRA 1Z6FA 2XQZA 2R9XA 1AU7A 1ONHA 2QPNA 4I38A 4LRZE 1YLYA 1TEMA 4KZ9A 2KPJA 1K0KA 2PRFA 5FI2A 2HDRA 1YLZA 1IC8A 2ZC4B 1UGUA 5HZHA 2OR1L 3QOWA 4IWRA 1K4FA 2AXUA 1LHYA 1R63A 5FQKA 3KSFA 1W7FA 5AQ7A 3TJZC 2MXDA 4ZJ3A 5AQAA 5TJJA 3Q7VB 3M2KA 3ZPXA 3WS1A 4HOIA 3VV4A 3IXBA 4QU3A 4HHDA 1RP5A 2A6CA 3SR4A 3DW0A 2PE5A 4LV0A 3NDEA 4I6RA 2WZXA 4WN5A 5FQQA 4Q0IA 4X25A 3ZG9B 4FH2A 3UE3A 4MCTA 1NRFA 2HP5A 3DM5A 3D3OA 5U47A 5JYPA 2VGJA 1X0OA 1QMFA 3UO9A 4R1GA 1Y54A 4Z58A 3NULA 5FQJA 3F1PA 2VV7A 4XXRA 1H0MA 4HP4A 3QP2A 1ZG4A 3FG8A 4Y0UA 2M7UA 5EVIB 5DT2A 2D5VA 2PBYA 1PNRA 2HF6A 2OLVA 3SX0A 1LI9A 2K2NA 2AXVA 2XA7M 3EGXC 2EFUA 4KZ8A 1WETA 3KJXA 3IF6C 4GS9A 2B95A 1H8ZA 3N7WA 2JCGA 4IBXA 5IHVA 4EQZA 4UA7A 2Y2IA 4JXWA 3FWLA 1L0FA 2ZMVA 2FZ0A 2PXBA 1ERQA 4GD8A 1RPEL 4E6WA 1K6SA 2XR0A 1K4EA 3UDXA 2O38A 3NI9A 1FQGA 3DAVA 1ZZ9A 1O07A 5HD5A 4BL2A 1J3WA 3UB7A 3JXBC 2OFYA 1E3OC 1CI8A 3SCGA 2GX5A 3TFLA 2X01A 1FR6A 2V1BA 1F98A 2JBFA 5TGFA 4J1WA 3I7JA 4ZJ2A 1GSVA 3T4OA 4D60A 4BBUA 4GCZA 1OMEA 1CJGA 3NJAA 4MBKA 2GZAA 5GL9A 5DKLA 5EVIC 3F1PB 1YT4A 4OOYA 1NW3A 2HP6A 3MXSA 2ZLYA 4GOGA 2Y2PA 2G2WA 3HUOA 4BQMA 2Z2LB 1MPLA 3QP6A 5HWVA 5HDDA 1WA9A 4U0TA 3SH8A 2XA7S 1IKIA 3G2YA 5HFOA 2ZMFA 1LQCA 4K91A 3HLDA 1YLPA 1MKMA 4X4FA 4HI4A 4GS9B 2Y2KA 2V0WA 3OCLA 2XSDC 4KG2A 4Z5HA 2BLSA 2LYRA 3IXHA 2B5AA 4WMCA 4X1MA 1H8YA 3BRMA 1S0WA 2J3WA 4E3KA 3BFEA 2OSUA 5TBMA 4C3QA 4IVZA 4J1XA 2ZQDA 2Y2OA 1KDWA 3TG9A 3ZNYA 4EQIA 5KSCA 3H5TA 3FPWA 4WYYA 2UV0E 2E8IA 4AFIA 4H6JA 4HEFA 5GHXA 5I94A 2BNNA 3F1NA 4L9FA 2PUEA 1VQQA 2LYPA 4X4GA 4WF0A 4X6TA 3VFFA 1O7EA 3A0VA 1YAXA 2O0YA 1IKGA 4LV2A 4EETB 2OOLA 2PU2A 1P9WA 4RA7A 4PAUA 4DXBA 2VA0A 2XH9A 4EBLA 3O5YA 3UE6A 3GZDA 4YBAA 1VHMA 5DTSA 4I6TA 2ZBBA 3OP9A 1EW0A 4EERA 1XGIA 5DF7A 3DTMA 1W5DA 2PUBA 5CXWA 4EV4A 4I5SA 4EBPA 1ZUGA 4X55A 2I9VA 1R69A 3KX0X 3GN5A 2ZC7A 2HCNA 4IVIA 4ER7A 5LBRA 3A9ZA 4GJ4A 4DJ2A 2Y2HA 3BS3A 2W3GA 3VMAA 1T1BA 2ZQ7A 2V8FA 4JF6A 5HDCA 3MSHA 1E3UD 5TBMB 3V67A 3VP3A 4Y0TA 1Q2QA 3D4FA 3EEAA 1BUEA 3QF3A 3T1XA 4R0QA 3U2AA 1XJ2A 3RXXA 4OOLA 1QPZA 1BTLA 4WELA 1JWZA 4H6JB 2B02A 2O9AA 2P04A 1L1MA 3F1NB 3CWFA 3ZHMA 2Y79A 2HPBA 5MC7A 1D1JA 1MKIA 2J7VA 3L7HA 2A3UA 2VK3A 4WZ5C 2PIJA 3GECA 1Q2PA 4X69A 1XJ4A 2EX2A 1UXCA 1P97A 4NKPA 4X53A 1E25A 1U60A 2EBYA 3OPHA 4FOFA 4B88A 1YLTA 1LSXA 2BASA 4B93A 1SDNA 1KE4A 3UNWA 1GHIA 2KEJA 2LNMA 1CEFA 4OQGA 2MEZA 4YG7B 2VGKA 3AGFA 3ISGA 4LV3A 2GRLA 1XWRA 2WIUB 2PHYA 1KDSA 3GN5B 4E6XA 3T4TA 4NXGA 3SZTA 1CF0A 1UWPX 2XD1A 2PYPA 4X4HA 2H5SA 1BDIA 3GRJA 4P6BA 5GHYA 3NDBB 3EQUA 4PKYG 4KZBA 5DKKA 4ZAMA 1HF0A 2HP9A 3LCEA 2KZ8A 3F1OA 2XI8A 3A0RA 3C2WA 5CERA 4YNRA 2JKTI 3KSGA 1F9IA 3S7QA 1PI4A 4Y0OA 3LFVA 3FYAA 2AVXA 3TEPA 4HH2A 3GZDC 1YMSA 3ICYA 3VP4A 3U4LP 1FR1A 2EWWA 2W27A 3UMEA 3IF5A 3HJKA 2V3CC 3A9YA 1BT5A 4LRXC 1GHMA 4EW7A 1L2SA 2KLIA 3IH8A 3RZZA 1JH9A 3IH9A 3PE5A 4WM9A 2ODRD 1GA0A 1SZVA 2HJEA 1AXBA 3L9KA 3OPLA 2KOIA 2Z2MB 5AQBA 4LCLA 3GDIA 1ZVVA 2EWTA 4MCWA 3LQXA 2P9VA 5CX7A 5EOOA 4O8BA 1RZRD 4Y42A 3KL4A 4LCMA 5EPHA 1N9NA 2HGVA 4HP9A 3IS2A 4LPZA 4UEYA 5GLCA 3F1OB 2HFZA 3D9YA 2OAP1 2L4RA 3BFGA 1OSLA 3UB8A 4PM7A 3WRTA 3CITA 3VSLA 1ERMA 2W3FA 3MQ0A 4JXGA 5J7EA 4R6LA 4OPQA 1S67L 1J9MA 3DBAA 4MEZA 2VGLM 3NECA 2OLUA 5F82A 3LIAA 1FILA 4NG2A 2Y4AA 1CK3A 4JF4A 1VPWA 2B18A 3UB5P 3P98A 2Y2MA 4I6UA 1PERL 2C5WB 5F69A 1RZSA 5DF9A 3ZGAB 5G4YA 4Q0JA 5HW3A 4O01A 4A5RA 4HJ6A 2ZQCA 2BNOA 4GHJA 5CTMA 4F94A 1YKDA 3BLMA 3BJNA 1TF1A 4OP8A 3IHBA 1LCDA 3LR4A 3BFFA 5E2HA 3MJQA 2P9VB 2PUDA 4HBUA 5IT5A 1PIOA 2PXDA 1PZPA 4WMCD 2XEPA 4S2OA 2XROA 3CI6A 5F68A 4HQAA 3FKVA 3QP4A 3MZFA 4OPZA 4QD4A 3IS2B 2V20A 1BYWA 4KUOA 1OT9A 1PW1A 2WKEA 3JXDL 1E3UA 4JBFA 3MBZA 3H9WA 3ITAA 5HPIA 4NXFA 3HREA 1Z09A 1N9LA 4EXOA 1QQBA 1HLUP 1RGZA 2QKPA 3IQAA 2IA2A 2VGLS 2Y2LA 4EBNA 1LL8A 1IELA 2XXAA 2EF8A 4GNUA 2XSSA 4IEDA 3W4PA 4ESPA 1VB6A 5GLAA 3G6OA 4FUWA 5DTKA 2ZOIA 1ZZCA 4WEJA 1RGYA 1IFQA 4LGWA 1JWLA 4PU3C 4CQHA 2VEOA 3KSIA 3GV9A 4Q8IA 1PRQA 4UHUA 3JYIA 4LV1A 2OWJA 1SKOA 2Y2NA 5CGXA 4IA8A 3S7PA 2CC1A 4X4EA 3SCHA 3VE3A 3G32A 2YBDA 4G3KA 1G6OA 1UWNX 1MWSA 4B4ZA 1STZA 1KE3A 1EI5A 3V50A 5FQ9A 3C4PA 3LIFA 5CECA 4KENB 4FTXA 3MMHA 1ZZ7A 2J9OA 2HJ9C 1QP7A 5J8XA 1S6RA 3GUUA 3PR6A 5FI7A 2X71A 3GR2A 2HDUA 4RX3A 1W8QA 5CHUA 2OV5A 3T4LA 3FV7A 3CUEC 1NYYA 2EA9A 4F8DA 3MQOA 2RCXA 2PBDP 4EESA 1KVLA 3G35A 3FZCA 2ZJ9A 3LYXA 3LEQA 2RL3A 3MR0A 3KXAA 3Q7ZA 5L09A 2MQKA 1XPBA 2WUQA 4DRTA 4GQMA 4EUZA 2ICPA 1ESUA 3QHYA 5TFQA 1TVFA 1NYMA 3LEZA 2G7UA 5EUAA 4Y17A 1JTDA 4KQDA 1GT0C 4NXBA 4Z5DA 1NY0A 1S1YA 1V9ZA 3B42A 2JKRI 4UQIM 3OWQA 3LUQA 1K25A 3BD1A 1IYPA 2Y91A 2LYJA 4DE8A 3T1SA 1PWDA 2Q0OA 2V2FF 1NWZA 2JKTM 3LICA 1SKOB 4E3JA 2FFFB 2PPXA 3IHAA 3ZVWA 4MNRA 3S1YA 1V9YA 1WH8A 2ZM8A 5FATA 1ES5A 3NIAA 3UFDA 4KG6A 2EWVA 5EM1A 1CQAA 1XA1A 2ZC5B 3UMDA 4DDSA 2VEAA 1X57A 4E3LA 2INWA 1BULA 3MZEA 4S2NA 3CZDA 1RZRA 4JGQA 4QJGA 1NXYA 3B33A 2KEIA 4S2LA 1W63M 2QMIA 5CRFA 1MZUA 2VX8A 4BD0A 3LI9A 3BYDA 3TSGA 1QQAA 3UE1A 1KGFA 2QYBA 4NEED 5FDSA 5EFWA 3R4KA 1JTGA 3Q1FA 3L1PA 4YINA 1RIOA 3DTKA 4UQIS 4S2MA 1MWTA 4KQQA 1NRJA 4ER6A 4DF6A 1LSWA 1M6KA 2QWSA 4PHTA 3C7UA 3ZYTA 1XP4A 1LT0A 3VSKA 1OTEA 4OQ0A 3HCYA 1IYQA 2AXZA 1DP8A 3PBRA 4EKIA 1SQ8A 1LL9A 2R9WA 3MLFA 3PBTA 5HAPA 1OJGA 1VM1A 5DTMA 1OTDA 3MXRA 2EX9A 5F5YA 3CPTB 3N6IA 3T1QB 3WS0A 1TS7A 3W4OA 2PUGA 4HY8A 4LLOB 3MKFA 5DF8A 3R1FA 4ETZA 3PBOA 3M6HA 1X2LA 2M4HA 2VKSA 2YKHA 3MF0A 2HZ5A 4M3KA 3LR5A 2OAQ1 1IEMA 1QMEA 1S7EA 1H5XA 3BFDA 4HBTA 4LRYC 4N1HA 1ZZ8A 1ZHHB 3VK0A 2JQEA 2Y59A 3GSGA 3NHQA 4P85A 1FOFA 1TS0A 2R63A 4D2OA 2JHEA 3QWGA 4XT2A 2LYSA 4R70A 3ZVTA 5AVFA 2BG1A 1CI9A 3LIDA 4DE1A 1GA9A 1FCNA 3A3FA 4QY5A 1QZXA 3HLEA 4E04A 4BL3A 2IV1A 1ZC2A 5CGWA 1S4RA 3NOUC 3A3IA 4KZAA 3MKEA 3QP1A 4Y15A 4E3OA 3S22A 5CTNA 3A9XA 4B9OA 2PUAA 4R38A 3SOIA 3VOZA 2BTFP 3QYXA 3LISA 3UDIA 2HDQA 1U2ZA 2PUCA 4OPRA 5FQIA 2PXLA 4ZRRA 1ALQA 1AWIA 1XA7A 4R3JA 2IWCA 3M9LA 4OPYA 3BQ8A 3A0SA 4S2NC 2O9BA 2AWIA 3HZIB 4P6ZM 2IVQA 3E4OA 3PHYA 4Y2FA 1FCMA 3B3XA 5FI6A 2XCJA 2CROA 1MXOA 3A3DA 2HSGA 1DRMA 4CLCD 3LR3A 4GN2A 4DJ3A 3TOIA 3M6BA 3B47A 3CHWP 4F3LA 4R23A 4EWFA 4QB8A 3PBQA 1XJ6A 2JCHA 1ZZ6A 2LYQA 4XT2B 1PNEA 3BY9A 5BOHA 5DSXA 1KGEA 3C4OA 2ZMAA 4MLLA 2LYLA 3LGOA 2O9CA 4OONA 4MBHA 3W8KA 5A8BA 3W2ZA 1BZAA 4K08A 5DTTA 2XRNA 2VV8A 4WUJA 3UB9A 1T1AA 5F83A 4BD1A 5HWWA 3Q81A 5C5KA 4KQOA 2JKGA 4OVDA 3RH8B 5FA7A 1XJ3A 3E4QA 5KMWA 4OBMA 2J7WA 5FASA 2JKFA 2LLVA 3ZG8B 1OTBA 3FYMA 4DDYA 1D7EA 3TRCA 4P6ZS 3CECA 4IHQA 1B0NA 1CEGA 3N8SA 1ESIA 4JGOA 4NXEA 2NUPC 2GNXA 2JVLA 1WH6A 4OP5A 5KZHA 2XGNA 3K3DA 2Q9MA 2WGVA 1XKZA 2C6WB 3BY8A 1YLWA 3R7WA 5KSHA 1H3QA 2A24A 2IWBA 4F3LB 3QNCA 4QY6A 4X56A 3N8RA 4ARZA 2EFXA 2WAFA 1Y4OA 5JYOA 1FCOA 1XFQA 2XXQA 3IWQA 2ICTA 3RTYA 2V0UA 2LYKA 4I3IA 2LB9A 3LY4A 4YARA 3HBRA 1PZOA 5TR7A 5E2FA 3T1RA 4X4DA 3NDGA 1JWVA 4ETXA 3TW8A 2H0TA 2B5RA 4EK9A 1PWGA 2EX8A 1MWUA 1ODVA 2ZQ9A 3PYPA 2ZQAA 1T19A 1K55A 4KQRA 3O86A 4X4BA 4Z9QA 5GAGi 5M1AA 1JFTA 1G5UA 3EWKA 1YQSA 2XJ3A 3JVVA 3V39A 2LLWA 2WZZA 1FSYA 2GZUA 2PXTA 4YG4A 1L3LA 4HIAA 1NERA 1ZZBA 5L8MA 2PXFA 3BEBA 4PM9A 3E4PA 1O4XA 3VFHA 4FBIA 3C30A 4E3IA 1M40A 3G30A 3R7WB 4KZ4A 4MN5A 2J8YA 2A24B 3ZDJA 2V8CA 4FSFA 1N9BA 3O3VA 4ARZB 4GLQA 3Q82A 1EROA 4CJNA 1BLSA 4OOMA 3PAEA 2LCVA 3JPUA 3GQZA 5HPFA 1TS8A 4L0LA 3T4SA 3E0YA 3T12B 1JVJA 5HDSA 4PKYA 4PM6A 5L10A 3B7HA 2PAVP 4GKUA 4FN3A 3CROL 4YG1A 1XFNA 4KZ5A 3KZ3A 3IBRA 4R3AA 1MC0A 2OWHA 1QP0A 1DY6A 4QWOA 1DP6A 4Y3IA 4BBVA 2WK0A 2HINA 3MFXA 4PU7A 4L9GA 5DRYA 2PXQA 4WVLA 2PXVA 3SS3A 4MMNA 1OPXA 2ZQ8A 3P01A 2W3DA 4GW9A 5CGSA 2PU4A 5DJTA 3O88A 2XK1A 3LY3A 3NBLA 3W4QA 3ME5A 3PTEA 4K0XA 1KOUA 4QPRA 3OBFA 3WS4A 3A3JA 4FD8A 3NY4A 4EU0A 4HH3A 1ES3A 3RJUA 1KVMA 4JXVA 1NLZA 1SDEA 1PFLA 3DNVB 4GDBA 5EECA 1T18A 4CLCA 4NK3A 4LENA 1FIKA 4JF5A 1IYSA 2HCSA 3VWSA 3MQQA 4DE3A 1HD8A 4O8GA 4E3MA 2FFYA 3C8CA 5DTQA 4O0PA 3QNBA 2HDSA 2XXPA 4MN6A 1LLIA 1OTIA 2KDKA 2PXUA 3IF6A 2WKPA 1GSXA 4MN7A 2P08A 1L0EA 2GRMA 2L1MA 3CAXA 1S1ZA 3TELA 1K38A 5A91A 3OC2A 3GMWA 1ZS4A 2DMWA 1PRVA 2WADA 2IVBA 2EXBA 2PT7A 4S2IA 3JVUA 2MJ6A 1POUA 4BWIA 4CPKA 1YSPA 2J3TD 5HL6A 3P7NA 1L0DA 1P9RA 4RYEA 1ONGA 2PUFA 2UWXA 4G3VA 4YFMA 3NXHA 3VP2A 2VZWA 3H82A 5EVEA 4DMZA 3KO6A 3S7OA 5M19A 3IT9A 4ID4A 2XDMA 2KEKA 3T4QA 1WE4A 4FCFA 4CLCB 3MZDA 1QP4A 2R1JL 4K0WA 4BBTA 3OPRA 3Q07A 2XF3A 1NZOA 4WL9A 3UN7A 4KZ6A 5HSQA 5GAHi 1OTAA 1W63Q 1MBLA 1RCJA 2QHKA 1E4DA 3OMTA 3UB6A 5JUWA 1LCCA 3IF6B 5AJGA 3CJMA 3VOLA 1UTXA 3FKWA 2FJRA 3ZG5A 4II7A 4Q0HA 3QP5A 5DFXA 5DRTA 1G6AA 3N8LA 2L1PA 4GHIA 3SW1A 1LMB3 3K3CA 2E8JA 2O49A 4C6YA 4ME4A 1YMXA 1H8MA 2O4AA 5IS1A 5HAIA 4PPRA 3T4KA 3ZHHA 3IWOA 5GLBA 4QHCA 3CPTA 3BECA 3HUMA 2PD7A 3D1NI 3HL9A 1TD5A 2CMNA 4HESA 4UA9A 3N4IA 2W1RA 3BM6A 3A3EA 1LL5A 5D3OA 4HJ3A 1NJ4A 2Z6DA 3HLCA 4GDNA 3H82B 4I39A 1SHVA 1ES2A 3HVFA 4CLCC 4KUKA 3TE8A 3ZNTA 3V3RA 2ACGA 2Y8HA 3DWZA 5HAQA 1K54A 3T50A 5E2GA 5CHMA 3E98A 3MEJA 3HLWA 3ZQ5A 3D72A 3LR0A 4Y5FA 4XUZA 4PU8A 3P09A 3ZFZA 3R09A 5F6AA 4N9KA 4S2JA 5FL3A 4KZ3A 5HL1A 3UY6A 4EKGA 3SS4A 2W3EA 3ZHIA 3PBNA 4ZJ1A 1KE0A 4JCXA 4I8TA 1P0ZA 2K31A 3O87A 2HV1A 1ES4A 3PXPA 4BENA 4DN0A 4ZDXA 4PU4C 4JLFA 4NETA 5EE8A 5FEFA 3PAGA 3PBSA 1PI5A 1XXMA 4GHIB 3CG5A 3VE4A 2LB5A 3NZLA 5FAOA 4JCYA 4X1LA 2DRWA 3KYZA 2XD5A 3TRBA 4GD6A 5E2EA 1PWCA 3CLCA 3WWXA 3IBJA 1VEUA 5A90A 3AGEA 2PR5A 5L2FA 2PXPA 1ZG6A 2WKQA 4MBFA 1DJCA 2A2LA 1GSWA 4WZ5A 2ZC6B 2W3HA 3IX4A 2L0WA 4DE2A 1YM1A 1VETA 3NCKA 3QP8A 3KSHA 2D01A 3F6WA 3SH9A 4S2KA 4ER3A 4HNBA 3KYQA 3G5GA 4BLMA 2VJWA 3OQNA 1ACFA 4RX2A 4N9LA 5CEBA 4DKIA 1I2WA 5A93A 2G2UA 2P7JA 3G0TA 3DTIA 3IX3A 4EEUA 2ZM0A 1HZOA 4X4CA 4ER0A 1C3BA 3RFBA 1PRAA 4R4RA 4KG5A 3GVBA 3BFCA 1JWPA 2Y55A 3CLOA 4PMAA 1S4SA 5J3WA 1CQTA 3IXGA 2WUSR 4OQHA 2W1TA 4NDWA 2XIUA 4N1XA 4R3BA 3FPVA 2R78A 1BDHA 4GZBA 3UPPA 3O9XA 4EUVA 2JN7A 2WYXA 3GTCA 3GZCA 5GHZA 5EOEA 1VEUB 3EGDC 2AW6A 3EEHA 4XUXA 2L8NA 4PM8A 3QOXA 3FYZA 1ZTUA 3OCNA 5GLDA 1PYYA 3ZKCA 1HTZA 1K54C 2WGIA 4IUKA 4X4IA 1VETB 3LO7A 2A49A 2WAEA 3IXDA 3NROA 2PYRA 3C5AA 1K56A 1YSQA 4LFUA 2XFSA 4JKTA 2IWDA 4BMWA 4MCXA 1ZPQA 4Z59A 1T1CA 4HJ4A 4ER5A 3IX8A 4OLGA 4Y7PA 1UXDA 3FC7A 1SCWA 2FH5A 4O7DA 1KGGA 1YSEA 5FDHA 2PXEA 2DCFA 3WS2A 3WS5A 1PRUA 5DJUA 3SH7A 1I2SA 1Y9QA 2JC7A 3JXCL 3ZCZA 2W1TB 3S4XA 2IU7A 5KIZA 1BSGA 4JGPA 2FFHA 1JNUA 2QJ5A 3UDFA 3G4PA 1BLCA 2P74A 2ZM2A 3IVPA 5G4ZA 3CMZA 2D02A 1YPRA 2QZ6A 1PW8A 1OJ5A 2V1AA 3C38A 3MXQA 1BLPA 2H10A 1DULA 3NC8A 1TS6A 3DWKA 4G3WA 4EEPA 4P87A 3VOYA 4X68A 1K57A 4U3TA 1G28A 1HQ1A 1TDLA 4Y13A 4OH0A 5M18A 1F5MA 1S66L 5EVID 2JKRM 4DE9A 4IBRA 3EQVA 3HJIA 5AVEA 1XX2A 4H8RA 3ZG0A 1NEQA 2KX6A 2BNMA 5HARA 1DP9A 2W0NA
chains in the Genus database with same CATH topology
3H5TA 3FPWA 3LUQA 3S7NA 5K98B 3BD1A 4AFIA 2LYJA 3NOTC 4H6JA 4QPRA 1KOUA 2BNNA 3F1NA 3OBFA 4YWZA 4L9FA 2PUEA 3T4JA 4EU0A 4HH3A 4YOFA 2QJ7A 2LYPA 4X4GA 1NWZA 2JKTM 3LICA 4WF0A 3A0VA 1NLZA 1YAXA 3DNVB 2O0YA 2VLGA 3NOPC 2PPXA 4EETB 4Z1WA 2OOLA 1T18A 1P9WA 4CLCA 4PAUA 1V9YA 2VA0A 4I3JA 3BDNA 3O5YA 3UE6A 1WH8A 3EUSA 4YBAA 3UFDA 3LI8A 2EWVA 1VHMA 4RQ9A 3MQQA 2CSFA 4I6TA 4O8GA 2ZBBA 5K5BA 3OP9A 3UMDA 1EW0A 2VEAA 3C8CA 3SCFA 3OOVA 4Z5CA 4EERA 1X57A 3ULFA 1JFSA 2INWA 4O0PA 1EFAA 4MN6A 2PUBA 2BJCA 1RZRA 1LLIA 1OTIA 1N9OA 2KDKA 2J3TC 4I5SA 4JGQA 3OLOA 1ZUGA 3B33A 2KEIA 2I9VA 1R69A 1W63M 3KX0X 1MZUA 2VX8A 3GN5A 4L9EA 2WKPA 1GSXA 3LI9A 4MN7A 4JQDA 2P08A 2L1MA 2GRMA 3CAXA 2K7SA 1QQAA 3LIBA 3GBFA 1S1ZA 2QYBA 5LBRA 4NEED 4GJ4A 4DJ2A 3BS3A 1NLYA 3OC2A 2W3GA 5EFWA 1T1BA 1Y7YA 2H28A 1ZS4A 3R4KA 2PR6A 4CLCE 2DMWA 1LSVA 1PRVA 2IVBA 5HDCA 5TBMB 3V67A 2PT7A 3JVUA 3FMYA 2MJ6A 3L1PA 1RIOA 4UQIS 1POUA 4BWIA 3EEAA 3EOIA 4UQIM 3H7WA 3QF3A 1YSPA 2PD8A 3U2AA 1XJ2A 1NRJA 3BWLA 1LSWA 2J3TD 5HL6A 2QWSA 4PHTA 3P7NA 1P9RA 4MDZA 4OOLA 3ZYTA 1QPZA 4WELA 2PUFA 1LT0A 4H6JB 4G3VA 1OTEA 2B02A 2O9AA 2P04A 1L1MA 3F1NB 2VZWA 3CWFA 3ZHMA 3HCYA 2AXZA 1DP8A 3H82A 3PBRA 3S8QA 2Y79A 1SQ8A 1DWKA 2YKFA 4DMZA 3KO6A 3MLFA 5MC7A 3F51A 3S7OA 3PBTA 2PIJA 3GECA 1OJGA 1XJ4A 1UXCA 1OTDA 2KEKA 5F5YA 3T4QA 4CLCB 1P97A 4NKPA 2V9AA 2EBYA 4FOFA 1QP4A 2R1JL 1D06A 1LSXA 1TS7A 2BASA 4B93A 4BBTA 5IU1A 2PUGA 4HY8A 4LLOB 4WL9A 3R1FA 3LIEA 3CUEA 1Y28A 5HSQA 4ETZA 2KEJA 3BQAA 1OTAA 1W63Q 2J80A 3PBOA 1X2LA 2QHKA 2MEZA 2VKSA 2YKHA 3MF0A 5DFYA 3OMTA 4YG7B 3UB6A 3QQ6A 2GRLA 1XWRA 2WIUB 1LCCA 3LR5A 2OAQ1 5HD3A 5AJGA 2L49A 1S7EA 3VOLA 1UTXA 2PHYA 3BW6A 3GN5B 4IJGA 3T4TA 4LRYC 2FJRA 4NXGA 4II7A 1ZZ8A 4Q0HA 1ZHHB 1UWPX 2IVGA 1ADRA 3OQMA 5DFXA 3VK0A 2AUWA 5HWTA 2PYPA 4GHIA 3SW1A 4X4HA 1LMB3 3K3CA 2O49A 1OCTC 1BDIA 3NHQA 1TS0A 4ME4A 2R63A 2JHEA 3QWGA 1H8MA 2O4AA 4XT2A 2LYSA 4R70A 5IS1A 5AVFA 3EQUA 3T4KA 4PKYG 3LIDA 5DKKA 2NUTC 1HF0A 2KZ8A 3F1OA 3H7WB 2XI8A 3A0RA 2PD7A 4E04A 3D1NI 3C2WA 1TD5A 2CMNA 2IV1A 4YNRA 2JKTI 2W1RA 3KSGA 1F9IA 3S7QA 1S4RA 3NOUC 4HJ3A 2Z6DA 4OB4A 4I39A 3H82B 4EQ1A 5I5LA 4CLCC 4KUKA 3TE8A 3LFVA 3FYAA 4HH2A 4B9OA 2PUAA 3ICYA 4R38A 4WEKA 2Y8HA 3QYXA 3T50A 3LISA 2WKRA 2PUCA 3E98A 2M7VA 3ZQ5A 4ZRRA 1ZAYA 3D72A 3LR0A 4Y5FA 2EWWA 4IUHA 4WLAA 4PU8A 4BJPA 3BQ8A 2W27A 3A0SA 3UMEA 2O9BA 5F6AA 1IOUA 2AWIA 3HZIB 3HJKA 4P6ZM 2IVQA 2H8RA 4LRXC 3E4OA 5FL3A 3G7DA 4EW7A 3PHYA 4Y2FA 2KLIA 1WIZA 2XCJA 1DW9A 3RZZA 1JH9A 2CROA 2IUOA 2W3EA 3ZHIA 2PDRA 3PBNA 2HSGA 1DRMA 4JGRA 5J4EA 4JCXA 4I3AA 4CLCD 4I8TA 1P0ZA 2K31A 2HJEA 2HV1A 2M1CA 3LR3A 4DJ3A 2O99A 3LFPA 3K2NA 3PXPA 2KOIA 4DN0A 3B47A 3U3WA 4PU4C 2GJ3A 4F3LA 3GDIA 5A7LA 1ZVVA 3F52A 3PBSA 4GHIB 2EWTA 2Z6CA 4MCWA 3VE4A 2LB5A 1OT6A 5CX7A 4JCYA 1XJ6A 3PBQA 3OQOA 1ZZ6A 2LYQA 2VV6A 4M4XA 3KYZA 4O8BA 4XT2B 1RZRD 3TRBA 4Y42A 2ZOHA 3BY9A 1N9NA 3CLCA 2HGVA 4HP9A 3IBJA 3IS2A 4LPZA 4UEYA 2PR5A 3F1OB 2LYLA 2WKQA 1AU7A 2O9CA 4I38A 2OAP1 2L4RA 2A2LA 1OSLA 3UB8A 4LRZE 1GSWA 5A8BA 3W2ZA 4K08A 3CITA 2KPJA 2XRNA 2W3HA 2W3FA 2L0WA 3MQ0A 5J7EA 4R6LA 1IC8A 2VV8A 4WUJA 3UB9A 1S67L 1UGUA 5HZHA 2OR1L 4IWRA 2AXUA 1T1AA 3KSHA 2D01A 3F6WA 5HWWA 3DBAA 1R63A 2VGLM 5C5KA 4KQOA 4HNBA 3KSFA 3G5GA 3KYQA 2VJWA 3LIAA 3OQNA 3RH8B 1XJ3A 3E4QA 3TJZC 5TJJA 1OTBA 3FYMA 2P7JA 1VPWA 2B18A 1D7EA 3TRCA 4P6ZS 3CECA 4IHQA 1B0NA 4I6UA 4EEUA 1PERL 4HOIA 3VV4A 4JGOA 4NXEA 4X4CA 5F69A 1RZSA 4HHDA 2NUPC 2A6CA 5DF9A 2PE5A 4I6RA 3RFBA 2GNXA 1PRAA 4WN5A 2JVLA 4Q0JA 1WH6A 4Q0IA 5G4YA 3UE3A 3K3DA 3CLOA 4O01A 4MCTA 1S4SA 3BY8A 4HJ6A 5J3WA 3D3OA 3R7WA 2BNOA 5KSHA 4GHJA 1CQTA 1H3QA 2WUSR 2A24A 1YKDA 2W1TA 4NDWA 2XIUA 4F3LB 3BJNA 1TF1A 1X0OA 3FPVA 1LCDA 1BDHA 2R78A 3LR4A 3O9XA 4ARZA 4EUVA 3MJQA 4Z58A 3F1PA 2PUDA 1XFQA 2JN7A 2VV7A 5IT5A 2XROA 4HP4A 2ICTA 3CI6A 2V0UA 5F68A 3FG8A 4HQAA 3RTYA 2LYKA 4I3IA 2M7UA 2LB9A 3EGDC 4YARA 2AW6A 1BYWA 3EEHA 3IS2B 1OT9A 4KUOA 2D5VA 2L8NA 1PNRA 3JXDL 2HF6A 4X4DA 1ZTUA 2K2NA 3H9WA 2AXVA 2XA7M 3EGXC 3OCNA 3TW8A 4ETXA 5HPIA 4NXFA 3ZKCA 1N9LA 4IUKA 1WETA 4X4IA 3KJXA 4EXOA 1QQBA 2QKPA 4GS9A 2IA2A 1ODVA 2JCGA 3PYPA 2VGLS 2PYRA 1T19A 1LL8A 4X4BA 1YSQA 2ZMVA 2FZ0A 1JFTA 3EWKA 2XJ3A 1RPEL 3JVVA 2EF8A 2XSSA 2O38A 4BMWA 4MCXA 1ZPQA 1ZZ9A 2GZUA 1VB6A 3G6OA 4Z59A 5HD5A 1T1CA 4HJ4A 4YG4A 2ZOIA 1ZZCA 4HIAA 4WEJA 1NERA 3UB7A 3JXBC 2OFYA 1E3OC 1ZZBA 1IFQA 5L8MA 1UXDA 3FC7A 1JWLA 3SCGA 2FH5A 4PU3C 2GX5A 3E4PA 4CQHA 1YSEA 3KSIA 1O4XA 1PRUA 5DJUA 4FBIA 2V1BA 1F98A 3C30A 1Y9QA 3R7WB 2OWJA 3JXCL 4IA8A 3S7PA 4J1WA 4MN5A 4X4EA 3SCHA 2A24B 2IU7A 2W1TB 1GSVA 3T4OA 3VE3A 5KIZA 4JGPA 4FSFA 1JNUA 4BBUA 4GCZA 2QJ5A 4G3KA 1CJGA 3NJAA 4ARZB 2GZAA 1G6OA 1UWNX 4GLQA 5DKLA 3IVPA 3F1PB 1STZA 5G4ZA 3LIFA 3MMHA 4OOMA 1ZZ7A 2LCVA 2HJ9C 5HPFA 1QP7A 1TS8A 3PR6A 2D02A 4L0LA 1OJ5A 2V1AA 3T4SA 3E0YA 3C38A 3MXQA 4PKYA 5HDSA 3T4LA 5HWVA 5HDDA 1WA9A 3B7HA 3CUEC 4FN3A 3CROL 2EA9A 4F8DA 2XA7S 1TS6A 3MQOA 4YG1A 1XFNA 4EESA 3KZ3A 4G3WA 3IBRA 4R3AA 4EEPA 3LYXA 2ZMFA 1LQCA 1MC0A 2OWHA 3MR0A 1MKMA 1QP0A 3KXAA 4X4FA 4HI4A 1G28A 5DJTA 1DP6A 4GS9B 2MQKA 4Y3IA 2V0WA 3OCLA 2XSDC 4Z5HA 4BBVA 2LYRA 4GQMA 2HINA 3MFXA 1F5MA 4PU7A 4L9GA 2B5AA 2ICPA 1S66L 2JKRM 4MMNA 2G7UA 2J3WA 1OPXA 3EQVA 3HJIA 3P01A 5TBMA 4KQDA 2W3DA 4GW9A 5AVEA 4IVZA 4J1XA 1GT0C 4NXBA 1NEQA 2KX6A 2BNMA 4Z5DA 1S1YA 1V9ZA 3B42A 1DP9A 2W0NA 2JKRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H5T A;  5A7L A;  2PUG A;  5K98 B;  3ZKC A;  1ZVV A;  3BD1 A;  3F52 A;  2EWT A;  3R1F A;  1WET A;  2LYJ A;  4X4I A;  3KJX A;  1QQB A;  2KEJ A;  4JCY A;  2BNN A;  3OQO A;  1ZZ6 A;  2LYQ A;  2JCG A;  1X2L A;  4O8B A;  2MEZ A;  2PUE A;  1RZR D;  3TRB A;  3OMT A;  4Y42 A;  4YG7 B;  2LYP A;  4X4G A;  3QQ6 A;  4X4B A;  2GRL A;  1XWR A;  2WIU B;  1LCC A;  3CLC A;  3DNV B;  1JFT A;  2PPX A;  2L49 A;  2XJ3 A;  1RPE L;  1S7E A;  2EF8 A;  2LYL A;  1UTX A;  1AU7 A;  3GN5 B;  2O38 A;  4MCX A;  2FJR A;  1ZZ8 A;  3BDN A;  1ZPQ A;  1WH8 A;  1ZZ9 A;  2GZU A;  4Z59 A;  1OSL A;  3EUS A;  4YG4 A;  4YBA A;  3UFD A;  2IVG A;  1ZZC A;  3OQM A;  1ADR A;  3VK0 A;  1NER A;  2AUW A;  2KPJ A;  3JXB C;  2OFY A;  1E3O C;  1ZZB A;  2CSF A;  4X4H A;  1LMB 3;  1UXD A;  1JWL A;  3SCG A;  4I6T A;  1IC8 A;  1OCT C;  1BDI A;  2O49 A;  4PU3 C;  3OP9 A;  2R63 A;  1YSE A;  2OR1 L;  4IWR A;  2AXU A;  3SCF A;  1O4X A;  4Z5C A;  1PRU A;  1X57 A;  3QWG A;  1JFS A;  2O4A A;  4FBI A;  2LYS A;  3F6W A;  1R63 A;  1EFA A;  2PUB A;  1Y9Q A;  3JXC L;  2BJC A;  1RZR A;  1LLI A;  3G5G A;  4IA8 A;  4J1W A;  3OQN A;  4X4E A;  3SCH A;  1HF0 A;  1ZUG A;  2IU7 A;  2KZ8 A;  2KEI A;  1R69 A;  2XI8 A;  3FYM A;  3GN5 A;  1VPW A;  1CJG A;  3CEC A;  3D1N I;  1B0N A;  4JQD A;  2GRM A;  2IV1 A;  4I6U A;  3IVP A;  1QQA A;  3GBF A;  1PER L;  4OB4 A;  4X4C A;  1ZZ7 A;  3BS3 A;  2LCV A;  1RZS A;  2A6C A;  1Y7Y A;  2PE5 A;  1QP7 A;  1ZS4 A;  4I6R A;  1PRA A;  3FYA A;  1PRV A;  2JVL A;  1WH6 A;  2PUA A;  2IVB A;  3QYX A;  4MCT A;  3LIS A;  3FMY A;  3B7H A;  4FN3 A;  3L1P A;  2PUC A;  2BNO A;  3CRO L;  4F8D A;  1RIO A;  4GHJ A;  1CQT A;  1POU A;  1ZAY A;  2WUS R;  4YG1 A;  4NDW A;  2XIU A;  3KZ3 A;  1LQC A;  3QF3 A;  4PU8 A;  1BDH A;  1LCD A;  3O9X A;  1QP0 A;  3KXA A;  2AWI A;  4X4F A;  3HZI B;  2IVQ A;  1QPZ A;  4Z58 A;  2PUF A;  2MQK A;  2R1J L;  2H8R A;  2PUD A;  2XSD C;  1L1M A;  4Z5H A;  3G7D A;  3ZHM A;  2LYR A;  2AXZ A;  4GQM A;  2HIN A;  3S8Q A;  4PU7 A;  1SQ8 A;  2B5A A;  2ICP A;  1DWK A;  2ICT A;  1WIZ A;  2XCJ A;  1DW9 A;  3RZZ A;  2LYK A;  3MLF A;  2CRO A;  1JH9 A;  2IUO A;  3ZHI A;  3F51 A;  2HSG A;  2PIJ A;  4JCX A;  4YAR A;  2AW6 A;  4I8T A;  1UXC A;  2D5V A;  2L8N A;  1PNR A;  3JXD L;  2KEK A;  3LFP A;  4J1X A;  3PXP A;  4IVZ A;  4X4D A;  1GT0 C;  1NEQ A;  2BNM A;  4Z5D A;  2EBY A;  1QP4 A;  2AXV A;  3U3W A;  4PU4 C; 
#chains in the Genus database with same CATH topology
 1A0K A;  5E43 A;  4ZTK A;  3S7N A;  2GDN A;  5K98 B;  2WKI A;  3G2Z A;  1LI0 A;  3NOT C;  5A92 A;  4YWZ A;  3T4J A;  1K6R A;  3G31 A;  4YOF A;  3OZH A;  1NZU A;  2QJ7 A;  4P0M A;  2VLG A;  3NOP C;  4Z1W A;  5CHJ A;  1MFQ C;  4I3J A;  3BDN A;  3EUS A;  3LI8 A;  4RQ9 A;  2CSF A;  4U0X A;  4OQI A;  3SS5 A;  5K5B A;  2EX6 A;  3OOV A;  3SCF A;  1DJA A;  4Z5C A;  3OPP A;  3ULF A;  1JFS A;  2ZD8 A;  3ITB A;  1EFA A;  2BJC A;  1N9O A;  5EM0 A;  2J3T C;  1HVB A;  3OLO A;  4WZ4 A;  4GB7 A;  4L9E A;  5FAP A;  4JQD A;  2Y2G A;  2K7S A;  3UPN A;  3LIB A;  3GBF A;  1NLY A;  2ZL1 A;  1Y7Y A;  2H28 A;  4UA6 A;  2PR6 A;  4DXC A;  4CLC E;  1LSV A;  3VP1 A;  4B4X A;  5FQM A;  3FMY A;  1YLJ A;  2XLN A;  4PM5 A;  4R4S A;  3EOI A;  3H7W A;  2PD8 A;  3HUN A;  3BWL A;  4MDZ A;  4Q2J A;  1W8Y A;  1L0G A;  3S8Q A;  1DWK A;  1SKF A;  2YKF A;  3MFD A;  3F51 A;  3ZG7 B;  3RXW A;  2J9P A;  1G68 A;  4E3N A;  2V9A A;  1D06 A;  1DJB A;  5IU1 A;  4DE0 A;  1W79 A;  1WYB A;  3DTE A;  3CUE A;  3LIE A;  1Y28 A;  3BQA A;  3V3S A;  4JXS A;  2J80 A;  4IVK A;  1LLB A;  5G18 A;  5L07 A;  1K57 C;  4WBG A;  5DFY A;  3KYE A;  5F1G A;  3QQ6 A;  2PXK A;  1MWR A;  3G34 A;  5HD3 A;  2L49 A;  3UWP A;  3QFI A;  3BW6 A;  4IJG A;  3AGD A;  5FAQ A;  2IVG A;  1ADR A;  3OQM A;  2AUW A;  5HWT A;  2EXA A;  1I5Q A;  5FEG A;  2ZL1 B;  3HLF A;  3VP0 A;  1OCT C;  3WRZ A;  2JE5 A;  2ZC3 B;  4OLD A;  4HRA A;  1GHP A;  3E2L A;  1WYC A;  5EV0 A;  1CJF A;  2J7U A;  2NUT C;  2WGW A;  4ZBE A;  3H7W B;  2Y2J A;  2XFT A;  5CED A;  4UAA A;  5DVA A;  2V1Z A;  4OB4 A;  3MS6 A;  5AQ9 A;  5EVL A;  4EQ1 A;  5I5L A;  1ZKJ A;  1GCE A;  3V5M A;  3E2K A;  3HLB A;  4WEK A;  2WKR A;  1IYO A;  2H0Y A;  3HLG A;  2M7V A;  1TDG A;  1ZAY A;  4KZ7 A;  4IUH A;  4WLA A;  4S2P A;  4BJP A;  1K55 C;  1IOU A;  2Y2Q A;  3Q7V A;  2H8R A;  3UPO A;  3G7D A;  3IWI A;  2I72 A;  5F1F A;  1WIZ A;  1DW9 A;  2IUO A;  4JGR A;  2PDR A;  2Q9N A;  5J4E A;  4I3A A;  4N92 A;  5HX9 A;  1EWZ A;  1N4O A;  1XGJ A;  2M1C A;  1BLH A;  2WKH A;  2O99 A;  3LFP A;  3K2N A;  3U3W A;  2GJ3 A;  2X02 A;  4FH4 A;  5A7L A;  3C7V A;  3OKZ A;  3F52 A;  1F2K A;  2DNS A;  2Z6C A;  4C75 A;  1OT6 A;  4M4X A;  1K56 D;  3OQO A;  3BLS A;  2VV6 A;  1MY8 A;  4JPM A;  2ZOH A;  4EZI A;  3M2J A;  3UE0 A;  4OKP A;  5EVI A;  1FSW A;  4RVA A;  5FSR A;  2WGW B;  1QB2 A;  5DTR A;  1Z6F A;  2XQZ A;  2R9X A;  1AU7 A;  1ONH A;  2QPN A;  4I38 A;  4LRZ E;  1YLY A;  1TEM A;  4KZ9 A;  2KPJ A;  1K0K A;  2PRF A;  5FI2 A;  2HDR A;  1YLZ A;  1IC8 A;  2ZC4 B;  1UGU A;  5HZH A;  2OR1 L;  3QOW A;  4IWR A;  1K4F A;  2AXU A;  1LHY A;  1R63 A;  5FQK A;  3KSF A;  1W7F A;  5AQ7 A;  3TJZ C;  2MXD A;  4ZJ3 A;  5AQA A;  5TJJ A;  3Q7V B;  3M2K A;  3ZPX A;  3WS1 A;  4HOI A;  3VV4 A;  3IXB A;  4QU3 A;  4HHD A;  1RP5 A;  2A6C A;  3SR4 A;  3DW0 A;  2PE5 A;  4LV0 A;  3NDE A;  4I6R A;  2WZX A;  4WN5 A;  5FQQ A;  4Q0I A;  4X25 A;  3ZG9 B;  4FH2 A;  3UE3 A;  4MCT A;  1NRF A;  2HP5 A;  3DM5 A;  3D3O A;  5U47 A;  5JYP A;  2VGJ A;  1X0O A;  1QMF A;  3UO9 A;  4R1G A;  1Y54 A;  4Z58 A;  3NUL A;  5FQJ A;  3F1P A;  2VV7 A;  4XXR A;  1H0M A;  4HP4 A;  3QP2 A;  1ZG4 A;  3FG8 A;  4Y0U A;  2M7U A;  5EVI B;  5DT2 A;  2D5V A;  2PBY A;  1PNR A;  2HF6 A;  2OLV A;  3SX0 A;  1LI9 A;  2K2N A;  2AXV A;  2XA7 M;  3EGX C;  2EFU A;  4KZ8 A;  1WET A;  3KJX A;  3IF6 C;  4GS9 A;  2B95 A;  1H8Z A;  3N7W A;  2JCG A;  4IBX A;  5IHV A;  4EQZ A;  4UA7 A;  2Y2I A;  4JXW A;  3FWL A;  1L0F A;  2ZMV A;  2FZ0 A;  2PXB A;  1ERQ A;  4GD8 A;  1RPE L;  4E6W A;  1K6S A;  2XR0 A;  1K4E A;  3UDX A;  2O38 A;  3NI9 A;  1FQG A;  3DAV A;  1ZZ9 A;  1O07 A;  5HD5 A;  4BL2 A;  1J3W A;  3UB7 A;  3JXB C;  2OFY A;  1E3O C;  1CI8 A;  3SCG A;  2GX5 A;  3TFL A;  2X01 A;  1FR6 A;  2V1B A;  1F98 A;  2JBF A;  5TGF A;  4J1W A;  3I7J A;  4ZJ2 A;  1GSV A;  3T4O A;  4D60 A;  4BBU A;  4GCZ A;  1OME A;  1CJG A;  3NJA A;  4MBK A;  2GZA A;  5GL9 A;  5DKL A;  5EVI C;  3F1P B;  1YT4 A;  4OOY A;  1NW3 A;  2HP6 A;  3MXS A;  2ZLY A;  4GOG A;  2Y2P A;  2G2W A;  3HUO A;  4BQM A;  2Z2L B;  1MPL A;  3QP6 A;  5HWV A;  5HDD A;  1WA9 A;  4U0T A;  3SH8 A;  2XA7 S;  1IKI A;  3G2Y A;  5HFO A;  2ZMF A;  1LQC A;  4K91 A;  3HLD A;  1YLP A;  1MKM A;  4X4F A;  4HI4 A;  4GS9 B;  2Y2K A;  2V0W A;  3OCL A;  2XSD C;  4KG2 A;  4Z5H A;  2BLS A;  2LYR A;  3IXH A;  2B5A A;  4WMC A;  4X1M A;  1H8Y A;  3BRM A;  1S0W A;  2J3W A;  4E3K A;  3BFE A;  2OSU A;  5TBM A;  4C3Q A;  4IVZ A;  4J1X A;  2ZQD A;  2Y2O A;  1KDW A;  3TG9 A;  3ZNY A;  4EQI A;  5KSC A;  3H5T A;  3FPW A;  4WYY A;  2UV0 E;  2E8I A;  4AFI A;  4H6J A;  4HEF A;  5GHX A;  5I94 A;  2BNN A;  3F1N A;  4L9F A;  2PUE A;  1VQQ A;  2LYP A;  4X4G A;  4WF0 A;  4X6T A;  3VFF A;  1O7E A;  3A0V A;  1YAX A;  2O0Y A;  1IKG A;  4LV2 A;  4EET B;  2OOL A;  2PU2 A;  1P9W A;  4RA7 A;  4PAU A;  4DXB A;  2VA0 A;  2XH9 A;  4EBL A;  3O5Y A;  3UE6 A;  3GZD A;  4YBA A;  1VHM A;  5DTS A;  4I6T A;  2ZBB A;  3OP9 A;  1EW0 A;  4EER A;  1XGI A;  5DF7 A;  3DTM A;  1W5D A;  2PUB A;  5CXW A;  4EV4 A;  4I5S A;  4EBP A;  1ZUG A;  4X55 A;  2I9V A;  1R69 A;  3KX0 X;  3GN5 A;  2ZC7 A;  2HCN A;  4IVI A;  4ER7 A;  5LBR A;  3A9Z A;  4GJ4 A;  4DJ2 A;  2Y2H A;  3BS3 A;  2W3G A;  3VMA A;  1T1B A;  2ZQ7 A;  2V8F A;  4JF6 A;  5HDC A;  3MSH A;  1E3U D;  5TBM B;  3V67 A;  3VP3 A;  4Y0T A;  1Q2Q A;  3D4F A;  3EEA A;  1BUE A;  3QF3 A;  3T1X A;  4R0Q A;  3U2A A;  1XJ2 A;  3RXX A;  4OOL A;  1QPZ A;  1BTL A;  4WEL A;  1JWZ A;  4H6J B;  2B02 A;  2O9A A;  2P04 A;  1L1M A;  3F1N B;  3CWF A;  3ZHM A;  2Y79 A;  2HPB A;  5MC7 A;  1D1J A;  1MKI A;  2J7V A;  3L7H A;  2A3U A;  2VK3 A;  4WZ5 C;  2PIJ A;  3GEC A;  1Q2P A;  4X69 A;  1XJ4 A;  2EX2 A;  1UXC A;  1P97 A;  4NKP A;  4X53 A;  1E25 A;  1U60 A;  2EBY A;  3OPH A;  4FOF A;  4B88 A;  1YLT A;  1LSX A;  2BAS A;  4B93 A;  1SDN A;  1KE4 A;  3UNW A;  1GHI A;  2KEJ A;  2LNM A;  1CEF A;  4OQG A;  2MEZ A;  4YG7 B;  2VGK A;  3AGF A;  3ISG A;  4LV3 A;  2GRL A;  1XWR A;  2WIU B;  2PHY A;  1KDS A;  3GN5 B;  4E6X A;  3T4T A;  4NXG A;  3SZT A;  1CF0 A;  1UWP X;  2XD1 A;  2PYP A;  4X4H A;  2H5S A;  1BDI A;  3GRJ A;  4P6B A;  5GHY A;  3NDB B;  3EQU A;  4PKY G;  4KZB A;  5DKK A;  4ZAM A;  1HF0 A;  2HP9 A;  3LCE A;  2KZ8 A;  3F1O A;  2XI8 A;  3A0R A;  3C2W A;  5CER A;  4YNR A;  2JKT I;  3KSG A;  1F9I A;  3S7Q A;  1PI4 A;  4Y0O A;  3LFV A;  3FYA A;  2AVX A;  3TEP A;  4HH2 A;  3GZD C;  1YMS A;  3ICY A;  3VP4 A;  3U4L P;  1FR1 A;  2EWW A;  2W27 A;  3UME A;  3IF5 A;  3HJK A;  2V3C C;  3A9Y A;  1BT5 A;  4LRX C;  1GHM A;  4EW7 A;  1L2S A;  2KLI A;  3IH8 A;  3RZZ A;  1JH9 A;  3IH9 A;  3PE5 A;  4WM9 A;  2ODR D;  1GA0 A;  1SZV A;  2HJE A;  1AXB A;  3L9K A;  3OPL A;  2KOI A;  2Z2M B;  5AQB A;  4LCL A;  3GDI A;  1ZVV A;  2EWT A;  4MCW A;  3LQX A;  2P9V A;  5CX7 A;  5EOO A;  4O8B A;  1RZR D;  4Y42 A;  3KL4 A;  4LCM A;  5EPH A;  1N9N A;  2HGV A;  4HP9 A;  3IS2 A;  4LPZ A;  4UEY A;  5GLC A;  3F1O B;  2HFZ A;  3D9Y A;  2OAP 1;  2L4R A;  3BFG A;  1OSL A;  3UB8 A;  4PM7 A;  3WRT A;  3CIT A;  3VSL A;  1ERM A;  2W3F A;  3MQ0 A;  4JXG A;  5J7E A;  4R6L A;  4OPQ A;  1S67 L;  1J9M A;  3DBA A;  4MEZ A;  2VGL M;  3NEC A;  2OLU A;  5F82 A;  3LIA A;  1FIL A;  4NG2 A;  2Y4A A;  1CK3 A;  4JF4 A;  1VPW A;  2B18 A;  3UB5 P;  3P98 A;  2Y2M A;  4I6U A;  1PER L;  2C5W B;  5F69 A;  1RZS A;  5DF9 A;  3ZGA B;  5G4Y A;  4Q0J A;  5HW3 A;  4O01 A;  4A5R A;  4HJ6 A;  2ZQC A;  2BNO A;  4GHJ A;  5CTM A;  4F94 A;  1YKD A;  3BLM A;  3BJN A;  1TF1 A;  4OP8 A;  3IHB A;  1LCD A;  3LR4 A;  3BFF A;  5E2H A;  3MJQ A;  2P9V B;  2PUD A;  4HBU A;  5IT5 A;  1PIO A;  2PXD A;  1PZP A;  4WMC D;  2XEP A;  4S2O A;  2XRO A;  3CI6 A;  5F68 A;  4HQA A;  3FKV A;  3QP4 A;  3MZF A;  4OPZ A;  4QD4 A;  3IS2 B;  2V20 A;  1BYW A;  4KUO A;  1OT9 A;  1PW1 A;  2WKE A;  3JXD L;  1E3U A;  4JBF A;  3MBZ A;  3H9W A;  3ITA A;  5HPI A;  4NXF A;  3HRE A;  1Z09 A;  1N9L A;  4EXO A;  1QQB A;  1HLU P;  1RGZ A;  2QKP A;  3IQA A;  2IA2 A;  2VGL S;  2Y2L A;  4EBN A;  1LL8 A;  1IEL A;  2XXA A;  2EF8 A;  4GNU A;  2XSS A;  4IED A;  3W4P A;  4ESP A;  1VB6 A;  5GLA A;  3G6O A;  4FUW A;  5DTK A;  2ZOI A;  1ZZC A;  4WEJ A;  1RGY A;  1IFQ A;  4LGW A;  1JWL A;  4PU3 C;  4CQH A;  2VEO A;  3KSI A;  3GV9 A;  4Q8I A;  1PRQ A;  4UHU A;  3JYI A;  4LV1 A;  2OWJ A;  1SKO A;  2Y2N A;  5CGX A;  4IA8 A;  3S7P A;  2CC1 A;  4X4E A;  3SCH A;  3VE3 A;  3G32 A;  2YBD A;  4G3K A;  1G6O A;  1UWN X;  1MWS A;  4B4Z A;  1STZ A;  1KE3 A;  1EI5 A;  3V50 A;  5FQ9 A;  3C4P A;  3LIF A;  5CEC A;  4KEN B;  4FTX A;  3MMH A;  1ZZ7 A;  2J9O A;  2HJ9 C;  1QP7 A;  5J8X A;  1S6R A;  3GUU A;  3PR6 A;  5FI7 A;  2X71 A;  3GR2 A;  2HDU A;  4RX3 A;  1W8Q A;  5CHU A;  2OV5 A;  3T4L A;  3FV7 A;  3CUE C;  1NYY A;  2EA9 A;  4F8D A;  3MQO A;  2RCX A;  2PBD P;  4EES A;  1KVL A;  3G35 A;  3FZC A;  2ZJ9 A;  3LYX A;  3LEQ A;  2RL3 A;  3MR0 A;  3KXA A;  3Q7Z A;  5L09 A;  2MQK A;  1XPB A;  2WUQ A;  4DRT A;  4GQM A;  4EUZ A;  2ICP A;  1ESU A;  3QHY A;  5TFQ A;  1TVF A;  1NYM A;  3LEZ A;  2G7U A;  5EUA A;  4Y17 A;  1JTD A;  4KQD A;  1GT0 C;  4NXB A;  4Z5D A;  1NY0 A;  1S1Y A;  1V9Z A;  3B42 A;  2JKR I;  4UQI M;  3OWQ A;  3LUQ A;  1K25 A;  3BD1 A;  1IYP A;  2Y91 A;  2LYJ A;  4DE8 A;  3T1S A;  1PWD A;  2Q0O A;  2V2F F;  1NWZ A;  2JKT M;  3LIC A;  1SKO B;  4E3J A;  2FFF B;  2PPX A;  3IHA A;  3ZVW A;  4MNR A;  3S1Y A;  1V9Y A;  1WH8 A;  2ZM8 A;  5FAT A;  1ES5 A;  3NIA A;  3UFD A;  4KG6 A;  2EWV A;  5EM1 A;  1CQA A;  1XA1 A;  2ZC5 B;  3UMD A;  4DDS A;  2VEA A;  1X57 A;  4E3L A;  2INW A;  1BUL A;  3MZE A;  4S2N A;  3CZD A;  1RZR A;  4JGQ A;  4QJG A;  1NXY A;  3B33 A;  2KEI A;  4S2L A;  1W63 M;  2QMI A;  5CRF A;  1MZU A;  2VX8 A;  4BD0 A;  3LI9 A;  3BYD A;  3TSG A;  1QQA A;  3UE1 A;  1KGF A;  2QYB A;  4NEE D;  5FDS A;  5EFW A;  3R4K A;  1JTG A;  3Q1F A;  3L1P A;  4YIN A;  1RIO A;  3DTK A;  4UQI S;  4S2M A;  1MWT A;  4KQQ A;  1NRJ A;  4ER6 A;  4DF6 A;  1LSW A;  1M6K A;  2QWS A;  4PHT A;  3C7U A;  3ZYT A;  1XP4 A;  1LT0 A;  3VSK A;  1OTE A;  4OQ0 A;  3HCY A;  1IYQ A;  2AXZ A;  1DP8 A;  3PBR A;  4EKI A;  1SQ8 A;  1LL9 A;  2R9W A;  3MLF A;  3PBT A;  5HAP A;  1OJG A;  1VM1 A;  5DTM A;  1OTD A;  3MXR A;  2EX9 A;  5F5Y A;  3CPT B;  3N6I A;  3T1Q B;  3WS0 A;  1TS7 A;  3W4O A;  2PUG A;  4HY8 A;  4LLO B;  3MKF A;  5DF8 A;  3R1F A;  4ETZ A;  3PBO A;  3M6H A;  1X2L A;  2M4H A;  2VKS A;  2YKH A;  3MF0 A;  2HZ5 A;  4M3K A;  3LR5 A;  2OAQ 1;  1IEM A;  1QME A;  1S7E A;  1H5X A;  3BFD A;  4HBT A;  4LRY C;  4N1H A;  1ZZ8 A;  1ZHH B;  3VK0 A;  2JQE A;  2Y59 A;  3GSG A;  3NHQ A;  4P85 A;  1FOF A;  1TS0 A;  2R63 A;  4D2O A;  2JHE A;  3QWG A;  4XT2 A;  2LYS A;  4R70 A;  3ZVT A;  5AVF A;  2BG1 A;  1CI9 A;  3LID A;  4DE1 A;  1GA9 A;  1FCN A;  3A3F A;  4QY5 A;  1QZX A;  3HLE A;  4E04 A;  4BL3 A;  2IV1 A;  1ZC2 A;  5CGW A;  1S4R A;  3NOU C;  3A3I A;  4KZA A;  3MKE A;  3QP1 A;  4Y15 A;  4E3O A;  3S22 A;  5CTN A;  3A9X A;  4B9O A;  2PUA A;  4R38 A;  3SOI A;  3VOZ A;  2BTF P;  3QYX A;  3LIS A;  3UDI A;  2HDQ A;  1U2Z A;  2PUC A;  4OPR A;  5FQI A;  2PXL A;  4ZRR A;  1ALQ A;  1AWI A;  1XA7 A;  4R3J A;  2IWC A;  3M9L A;  4OPY A;  3BQ8 A;  3A0S A;  4S2N C;  2O9B A;  2AWI A;  3HZI B;  4P6Z M;  2IVQ A;  3E4O A;  3PHY A;  4Y2F A;  1FCM A;  3B3X A;  5FI6 A;  2XCJ A;  2CRO A;  1MXO A;  3A3D A;  2HSG A;  1DRM A;  4CLC D;  3LR3 A;  4GN2 A;  4DJ3 A;  3TOI A;  3M6B A;  3B47 A;  3CHW P;  4F3L A;  4R23 A;  4EWF A;  4QB8 A;  3PBQ A;  1XJ6 A;  2JCH A;  1ZZ6 A;  2LYQ A;  4XT2 B;  1PNE A;  3BY9 A;  5BOH A;  5DSX A;  1KGE A;  3C4O A;  2ZMA A;  4MLL A;  2LYL A;  3LGO A;  2O9C A;  4OON A;  4MBH A;  3W8K A;  5A8B A;  3W2Z A;  1BZA A;  4K08 A;  5DTT A;  2XRN A;  2VV8 A;  4WUJ A;  3UB9 A;  1T1A A;  5F83 A;  4BD1 A;  5HWW A;  3Q81 A;  5C5K A;  4KQO A;  2JKG A;  4OVD A;  3RH8 B;  5FA7 A;  1XJ3 A;  3E4Q A;  5KMW A;  4OBM A;  2J7W A;  5FAS A;  2JKF A;  2LLV A;  3ZG8 B;  1OTB A;  3FYM A;  4DDY A;  1D7E A;  3TRC A;  4P6Z S;  3CEC A;  4IHQ A;  1B0N A;  1CEG A;  3N8S A;  1ESI A;  4JGO A;  4NXE A;  2NUP C;  2GNX A;  2JVL A;  1WH6 A;  4OP5 A;  5KZH A;  2XGN A;  3K3D A;  2Q9M A;  2WGV A;  1XKZ A;  2C6W B;  3BY8 A;  1YLW A;  3R7W A;  5KSH A;  1H3Q A;  2A24 A;  2IWB A;  4F3L B;  3QNC A;  4QY6 A;  4X56 A;  3N8R A;  4ARZ A;  2EFX A;  2WAF A;  1Y4O A;  5JYO A;  1FCO A;  1XFQ A;  2XXQ A;  3IWQ A;  2ICT A;  3RTY A;  2V0U A;  2LYK A;  4I3I A;  2LB9 A;  3LY4 A;  4YAR A;  3HBR A;  1PZO A;  5TR7 A;  5E2F A;  3T1R A;  4X4D A;  3NDG A;  1JWV A;  4ETX A;  3TW8 A;  2H0T A;  2B5R A;  4EK9 A;  1PWG A;  2EX8 A;  1MWU A;  1ODV A;  2ZQ9 A;  3PYP A;  2ZQA A;  1T19 A;  1K55 A;  4KQR A;  3O86 A;  4X4B A;  4Z9Q A;  5GAG i;  5M1A A;  1JFT A;  1G5U A;  3EWK A;  1YQS A;  2XJ3 A;  3JVV A;  3V39 A;  2LLW A;  2WZZ A;  1FSY A;  2GZU A;  2PXT A;  4YG4 A;  1L3L A;  4HIA A;  1NER A;  1ZZB A;  5L8M A;  2PXF A;  3BEB A;  4PM9 A;  3E4P A;  1O4X A;  3VFH A;  4FBI A;  3C30 A;  4E3I A;  1M40 A;  3G30 A;  3R7W B;  4KZ4 A;  4MN5 A;  2J8Y A;  2A24 B;  3ZDJ A;  2V8C A;  4FSF A;  1N9B A;  3O3V A;  4ARZ B;  4GLQ A;  3Q82 A;  1ERO A;  4CJN A;  1BLS A;  4OOM A;  3PAE A;  2LCV A;  3JPU A;  3GQZ A;  5HPF A;  1TS8 A;  4L0L A;  3T4S A;  3E0Y A;  3T12 B;  1JVJ A;  5HDS A;  4PKY A;  4PM6 A;  5L10 A;  3B7H A;  2PAV P;  4GKU A;  4FN3 A;  3CRO L;  4YG1 A;  1XFN A;  4KZ5 A;  3KZ3 A;  3IBR A;  4R3A A;  1MC0 A;  2OWH A;  1QP0 A;  1DY6 A;  4QWO A;  1DP6 A;  4Y3I A;  4BBV A;  2WK0 A;  2HIN A;  3MFX A;  4PU7 A;  4L9G A;  5DRY A;  2PXQ A;  4WVL A;  2PXV A;  3SS3 A;  4MMN A;  1OPX A;  2ZQ8 A;  3P01 A;  2W3D A;  4GW9 A;  5CGS A;  2PU4 A;  5DJT A;  3O88 A;  2XK1 A;  3LY3 A;  3NBL A;  3W4Q A;  3ME5 A;  3PTE A;  4K0X A;  1KOU A;  4QPR A;  3OBF A;  3WS4 A;  3A3J A;  4FD8 A;  3NY4 A;  4EU0 A;  4HH3 A;  1ES3 A;  3RJU A;  1KVM A;  4JXV A;  1NLZ A;  1SDE A;  1PFL A;  3DNV B;  4GDB A;  5EEC A;  1T18 A;  4CLC A;  4NK3 A;  4LEN A;  1FIK A;  4JF5 A;  1IYS A;  2HCS A;  3VWS A;  3MQQ A;  4DE3 A;  1HD8 A;  4O8G A;  4E3M A;  2FFY A;  3C8C A;  5DTQ A;  4O0P A;  3QNB A;  2HDS A;  2XXP A;  4MN6 A;  1LLI A;  1OTI A;  2KDK A;  2PXU A;  3IF6 A;  2WKP A;  1GSX A;  4MN7 A;  2P08 A;  1L0E A;  2GRM A;  2L1M A;  3CAX A;  1S1Z A;  3TEL A;  1K38 A;  5A91 A;  3OC2 A;  3GMW A;  1ZS4 A;  2DMW A;  1PRV A;  2WAD A;  2IVB A;  2EXB A;  2PT7 A;  4S2I A;  3JVU A;  2MJ6 A;  1POU A;  4BWI A;  4CPK A;  1YSP A;  2J3T D;  5HL6 A;  3P7N A;  1L0D A;  1P9R A;  4RYE A;  1ONG A;  2PUF A;  2UWX A;  4G3V A;  4YFM A;  3NXH A;  3VP2 A;  2VZW A;  3H82 A;  5EVE A;  4DMZ A;  3KO6 A;  3S7O A;  5M19 A;  3IT9 A;  4ID4 A;  2XDM A;  2KEK A;  3T4Q A;  1WE4 A;  4FCF A;  4CLC B;  3MZD A;  1QP4 A;  2R1J L;  4K0W A;  4BBT A;  3OPR A;  3Q07 A;  2XF3 A;  1NZO A;  4WL9 A;  3UN7 A;  4KZ6 A;  5HSQ A;  5GAH i;  1OTA A;  1W63 Q;  1MBL A;  1RCJ A;  2QHK A;  1E4D A;  3OMT A;  3UB6 A;  5JUW A;  1LCC A;  3IF6 B;  5AJG A;  3CJM A;  3VOL A;  1UTX A;  3FKW A;  2FJR A;  3ZG5 A;  4II7 A;  4Q0H A;  3QP5 A;  5DFX A;  5DRT A;  1G6A A;  3N8L A;  2L1P A;  4GHI A;  3SW1 A;  1LMB 3;  3K3C A;  2E8J A;  2O49 A;  4C6Y A;  4ME4 A;  1YMX A;  1H8M A;  2O4A A;  5IS1 A;  5HAI A;  4PPR A;  3T4K A;  3ZHH A;  3IWO A;  5GLB A;  4QHC A;  3CPT A;  3BEC A;  3HUM A;  2PD7 A;  3D1N I;  3HL9 A;  1TD5 A;  2CMN A;  4HES A;  4UA9 A;  3N4I A;  2W1R A;  3BM6 A;  3A3E A;  1LL5 A;  5D3O A;  4HJ3 A;  1NJ4 A;  2Z6D A;  3HLC A;  4GDN A;  3H82 B;  4I39 A;  1SHV A;  1ES2 A;  3HVF A;  4CLC C;  4KUK A;  3TE8 A;  3ZNT A;  3V3R A;  2ACG A;  2Y8H A;  3DWZ A;  5HAQ A;  1K54 A;  3T50 A;  5E2G A;  5CHM A;  3E98 A;  3MEJ A;  3HLW A;  3ZQ5 A;  3D72 A;  3LR0 A;  4Y5F A;  4XUZ A;  4PU8 A;  3P09 A;  3ZFZ A;  3R09 A;  5F6A A;  4N9K A;  4S2J A;  5FL3 A;  4KZ3 A;  5HL1 A;  3UY6 A;  4EKG A;  3SS4 A;  2W3E A;  3ZHI A;  3PBN A;  4ZJ1 A;  1KE0 A;  4JCX A;  4I8T A;  1P0Z A;  2K31 A;  3O87 A;  2HV1 A;  1ES4 A;  3PXP A;  4BEN A;  4DN0 A;  4ZDX A;  4PU4 C;  4JLF A;  4NET A;  5EE8 A;  5FEF A;  3PAG A;  3PBS A;  1PI5 A;  1XXM A;  4GHI B;  3CG5 A;  3VE4 A;  2LB5 A;  3NZL A;  5FAO A;  4JCY A;  4X1L A;  2DRW A;  3KYZ A;  2XD5 A;  3TRB A;  4GD6 A;  5E2E A;  1PWC A;  3CLC A;  3WWX A;  3IBJ A;  1VEU A;  5A90 A;  3AGE A;  2PR5 A;  5L2F A;  2PXP A;  1ZG6 A;  2WKQ A;  4MBF A;  1DJC A;  2A2L A;  1GSW A;  4WZ5 A;  2ZC6 B;  2W3H A;  3IX4 A;  2L0W A;  4DE2 A;  1YM1 A;  1VET A;  3NCK A;  3QP8 A;  3KSH A;  2D01 A;  3F6W A;  3SH9 A;  4S2K A;  4ER3 A;  4HNB A;  3KYQ A;  3G5G A;  4BLM A;  2VJW A;  3OQN A;  1ACF A;  4RX2 A;  4N9L A;  5CEB A;  4DKI A;  1I2W A;  5A93 A;  2G2U A;  2P7J A;  3G0T A;  3DTI A;  3IX3 A;  4EEU A;  2ZM0 A;  1HZO A;  4X4C A;  4ER0 A;  1C3B A;  3RFB A;  1PRA A;  4R4R A;  4KG5 A;  3GVB A;  3BFC A;  1JWP A;  2Y55 A;  3CLO A;  4PMA A;  1S4S A;  5J3W A;  1CQT A;  3IXG A;  2WUS R;  4OQH A;  2W1T A;  4NDW A;  2XIU A;  4N1X A;  4R3B A;  3FPV A;  2R78 A;  1BDH A;  4GZB A;  3UPP A;  3O9X A;  4EUV A;  2JN7 A;  2WYX A;  3GTC A;  3GZC A;  5GHZ A;  5EOE A;  1VEU B;  3EGD C;  2AW6 A;  3EEH A;  4XUX A;  2L8N A;  4PM8 A;  3QOX A;  3FYZ A;  1ZTU A;  3OCN A;  5GLD A;  1PYY A;  3ZKC A;  1HTZ A;  1K54 C;  2WGI A;  4IUK A;  4X4I A;  1VET B;  3LO7 A;  2A49 A;  2WAE A;  3IXD A;  3NRO A;  2PYR A;  3C5A A;  1K56 A;  1YSQ A;  4LFU A;  2XFS A;  4JKT A;  2IWD A;  4BMW A;  4MCX A;  1ZPQ A;  4Z59 A;  1T1C A;  4HJ4 A;  4ER5 A;  3IX8 A;  4OLG A;  4Y7P A;  1UXD A;  3FC7 A;  1SCW A;  2FH5 A;  4O7D A;  1KGG A;  1YSE A;  5FDH A;  2PXE A;  2DCF A;  3WS2 A;  3WS5 A;  1PRU A;  5DJU A;  3SH7 A;  1I2S A;  1Y9Q A;  2JC7 A;  3JXC L;  3ZCZ A;  2W1T B;  3S4X A;  2IU7 A;  5KIZ A;  1BSG A;  4JGP A;  2FFH A;  1JNU A;  2QJ5 A;  3UDF A;  3G4P A;  1BLC A;  2P74 A;  2ZM2 A;  3IVP A;  5G4Z A;  3CMZ A;  2D02 A;  1YPR A;  2QZ6 A;  1PW8 A;  1OJ5 A;  2V1A A;  3C38 A;  3MXQ A;  1BLP A;  2H10 A;  1DUL A;  3NC8 A;  1TS6 A;  3DWK A;  4G3W A;  4EEP A;  4P87 A;  3VOY A;  4X68 A;  1K57 A;  4U3T A;  1G28 A;  1HQ1 A;  1TDL A;  4Y13 A;  4OH0 A;  5M18 A;  1F5M A;  1S66 L;  5EVI D;  2JKR M;  4DE9 A;  4IBR A;  3EQV A;  3HJI A;  5AVE A;  1XX2 A;  4H8R A;  3ZG0 A;  1NEQ A;  2KX6 A;  2BNM A;  5HAR A;  1DP9 A;  2W0N A; 
#chains in the Genus database with same CATH homology
 3H5T A;  3FPW A;  3LUQ A;  3S7N A;  5K98 B;  3BD1 A;  4AFI A;  2LYJ A;  3NOT C;  4H6J A;  4QPR A;  1KOU A;  2BNN A;  3F1N A;  3OBF A;  4YWZ A;  4L9F A;  2PUE A;  3T4J A;  4EU0 A;  4HH3 A;  4YOF A;  2QJ7 A;  2LYP A;  4X4G A;  1NWZ A;  2JKT M;  3LIC A;  4WF0 A;  3A0V A;  1NLZ A;  1YAX A;  3DNV B;  2O0Y A;  2VLG A;  3NOP C;  2PPX A;  4EET B;  4Z1W A;  2OOL A;  1T18 A;  1P9W A;  4CLC A;  4PAU A;  1V9Y A;  2VA0 A;  4I3J A;  3BDN A;  3O5Y A;  3UE6 A;  1WH8 A;  3EUS A;  4YBA A;  3UFD A;  3LI8 A;  2EWV A;  1VHM A;  4RQ9 A;  3MQQ A;  2CSF A;  4I6T A;  4O8G A;  2ZBB A;  5K5B A;  3OP9 A;  3UMD A;  1EW0 A;  2VEA A;  3C8C A;  3SCF A;  3OOV A;  4Z5C A;  4EER A;  1X57 A;  3ULF A;  1JFS A;  2INW A;  4O0P A;  1EFA A;  4MN6 A;  2PUB A;  2BJC A;  1RZR A;  1LLI A;  1OTI A;  1N9O A;  2KDK A;  2J3T C;  4I5S A;  4JGQ A;  3OLO A;  1ZUG A;  3B33 A;  2KEI A;  2I9V A;  1R69 A;  1W63 M;  3KX0 X;  1MZU A;  2VX8 A;  3GN5 A;  4L9E A;  2WKP A;  1GSX A;  3LI9 A;  4MN7 A;  4JQD A;  2P08 A;  2L1M A;  2GRM A;  3CAX A;  2K7S A;  1QQA A;  3LIB A;  3GBF A;  1S1Z A;  2QYB A;  5LBR A;  4NEE D;  4GJ4 A;  4DJ2 A;  3BS3 A;  1NLY A;  3OC2 A;  2W3G A;  5EFW A;  1T1B A;  1Y7Y A;  2H28 A;  1ZS4 A;  3R4K A;  2PR6 A;  4CLC E;  2DMW A;  1LSV A;  1PRV A;  2IVB A;  5HDC A;  5TBM B;  3V67 A;  2PT7 A;  3JVU A;  3FMY A;  2MJ6 A;  3L1P A;  1RIO A;  4UQI S;  1POU A;  4BWI A;  3EEA A;  3EOI A;  4UQI M;  3H7W A;  3QF3 A;  1YSP A;  2PD8 A;  3U2A A;  1XJ2 A;  1NRJ A;  3BWL A;  1LSW A;  2J3T D;  5HL6 A;  2QWS A;  4PHT A;  3P7N A;  1P9R A;  4MDZ A;  4OOL A;  3ZYT A;  1QPZ A;  4WEL A;  2PUF A;  1LT0 A;  4H6J B;  4G3V A;  1OTE A;  2B02 A;  2O9A A;  2P04 A;  1L1M A;  3F1N B;  2VZW A;  3CWF A;  3ZHM A;  3HCY A;  2AXZ A;  1DP8 A;  3H82 A;  3PBR A;  3S8Q A;  2Y79 A;  1SQ8 A;  1DWK A;  2YKF A;  4DMZ A;  3KO6 A;  3MLF A;  5MC7 A;  3F51 A;  3S7O A;  3PBT A;  2PIJ A;  3GEC A;  1OJG A;  1XJ4 A;  1UXC A;  1OTD A;  2KEK A;  5F5Y A;  3T4Q A;  4CLC B;  1P97 A;  4NKP A;  2V9A A;  2EBY A;  4FOF A;  1QP4 A;  2R1J L;  1D06 A;  1LSX A;  1TS7 A;  2BAS A;  4B93 A;  4BBT A;  5IU1 A;  2PUG A;  4HY8 A;  4LLO B;  4WL9 A;  3R1F A;  3LIE A;  3CUE A;  1Y28 A;  5HSQ A;  4ETZ A;  2KEJ A;  3BQA A;  1OTA A;  1W63 Q;  2J80 A;  3PBO A;  1X2L A;  2QHK A;  2MEZ A;  2VKS A;  2YKH A;  3MF0 A;  5DFY A;  3OMT A;  4YG7 B;  3UB6 A;  3QQ6 A;  2GRL A;  1XWR A;  2WIU B;  1LCC A;  3LR5 A;  2OAQ 1;  5HD3 A;  5AJG A;  2L49 A;  1S7E A;  3VOL A;  1UTX A;  2PHY A;  3BW6 A;  3GN5 B;  4IJG A;  3T4T A;  4LRY C;  2FJR A;  4NXG A;  4II7 A;  1ZZ8 A;  4Q0H A;  1ZHH B;  1UWP X;  2IVG A;  1ADR A;  3OQM A;  5DFX A;  3VK0 A;  2AUW A;  5HWT A;  2PYP A;  4GHI A;  3SW1 A;  4X4H A;  1LMB 3;  3K3C A;  2O49 A;  1OCT C;  1BDI A;  3NHQ A;  1TS0 A;  4ME4 A;  2R63 A;  2JHE A;  3QWG A;  1H8M A;  2O4A A;  4XT2 A;  2LYS A;  4R70 A;  5IS1 A;  5AVF A;  3EQU A;  3T4K A;  4PKY G;  3LID A;  5DKK A;  2NUT C;  1HF0 A;  2KZ8 A;  3F1O A;  3H7W B;  2XI8 A;  3A0R A;  2PD7 A;  4E04 A;  3D1N I;  3C2W A;  1TD5 A;  2CMN A;  2IV1 A;  4YNR A;  2JKT I;  2W1R A;  3KSG A;  1F9I A;  3S7Q A;  1S4R A;  3NOU C;  4HJ3 A;  2Z6D A;  4OB4 A;  4I39 A;  3H82 B;  4EQ1 A;  5I5L A;  4CLC C;  4KUK A;  3TE8 A;  3LFV A;  3FYA A;  4HH2 A;  4B9O A;  2PUA A;  3ICY A;  4R38 A;  4WEK A;  2Y8H A;  3QYX A;  3T50 A;  3LIS A;  2WKR A;  2PUC A;  3E98 A;  2M7V A;  3ZQ5 A;  4ZRR A;  1ZAY A;  3D72 A;  3LR0 A;  4Y5F A;  2EWW A;  4IUH A;  4WLA A;  4PU8 A;  4BJP A;  3BQ8 A;  2W27 A;  3A0S A;  3UME A;  2O9B A;  5F6A A;  1IOU A;  2AWI A;  3HZI B;  3HJK A;  4P6Z M;  2IVQ A;  2H8R A;  4LRX C;  3E4O A;  5FL3 A;  3G7D A;  4EW7 A;  3PHY A;  4Y2F A;  2KLI A;  1WIZ A;  2XCJ A;  1DW9 A;  3RZZ A;  1JH9 A;  2CRO A;  2IUO A;  2W3E A;  3ZHI A;  2PDR A;  3PBN A;  2HSG A;  1DRM A;  4JGR A;  5J4E A;  4JCX A;  4I3A A;  4CLC D;  4I8T A;  1P0Z A;  2K31 A;  2HJE A;  2HV1 A;  2M1C A;  3LR3 A;  4DJ3 A;  2O99 A;  3LFP A;  3K2N A;  3PXP A;  2KOI A;  4DN0 A;  3B47 A;  3U3W A;  4PU4 C;  2GJ3 A;  4F3L A;  3GDI A;  5A7L A;  1ZVV A;  3F52 A;  3PBS A;  4GHI B;  2EWT A;  2Z6C A;  4MCW A;  3VE4 A;  2LB5 A;  1OT6 A;  5CX7 A;  4JCY A;  1XJ6 A;  3PBQ A;  3OQO A;  1ZZ6 A;  2LYQ A;  2VV6 A;  4M4X A;  3KYZ A;  4O8B A;  4XT2 B;  1RZR D;  3TRB A;  4Y42 A;  2ZOH A;  3BY9 A;  1N9N A;  3CLC A;  2HGV A;  4HP9 A;  3IBJ A;  3IS2 A;  4LPZ A;  4UEY A;  2PR5 A;  3F1O B;  2LYL A;  2WKQ A;  1AU7 A;  2O9C A;  4I38 A;  2OAP 1;  2L4R A;  2A2L A;  1OSL A;  3UB8 A;  4LRZ E;  1GSW A;  5A8B A;  3W2Z A;  4K08 A;  3CIT A;  2KPJ A;  2XRN A;  2W3H A;  2W3F A;  2L0W A;  3MQ0 A;  5J7E A;  4R6L A;  1IC8 A;  2VV8 A;  4WUJ A;  3UB9 A;  1S67 L;  1UGU A;  5HZH A;  2OR1 L;  4IWR A;  2AXU A;  1T1A A;  3KSH A;  2D01 A;  3F6W A;  5HWW A;  3DBA A;  1R63 A;  2VGL M;  5C5K A;  4KQO A;  4HNB A;  3KSF A;  3G5G A;  3KYQ A;  2VJW A;  3LIA A;  3OQN A;  3RH8 B;  1XJ3 A;  3E4Q A;  3TJZ C;  5TJJ A;  1OTB A;  3FYM A;  2P7J A;  1VPW A;  2B18 A;  1D7E A;  3TRC A;  4P6Z S;  3CEC A;  4IHQ A;  1B0N A;  4I6U A;  4EEU A;  1PER L;  4HOI A;  3VV4 A;  4JGO A;  4NXE A;  4X4C A;  5F69 A;  1RZS A;  4HHD A;  2NUP C;  2A6C A;  5DF9 A;  2PE5 A;  4I6R A;  3RFB A;  2GNX A;  1PRA A;  4WN5 A;  2JVL A;  4Q0J A;  1WH6 A;  4Q0I A;  5G4Y A;  3UE3 A;  3K3D A;  3CLO A;  4O01 A;  4MCT A;  1S4S A;  3BY8 A;  4HJ6 A;  5J3W A;  3D3O A;  3R7W A;  2BNO A;  5KSH A;  4GHJ A;  1CQT A;  1H3Q A;  2WUS R;  2A24 A;  1YKD A;  2W1T A;  4NDW A;  2XIU A;  4F3L B;  3BJN A;  1TF1 A;  1X0O A;  3FPV A;  1LCD A;  1BDH A;  2R78 A;  3LR4 A;  3O9X A;  4ARZ A;  4EUV A;  3MJQ A;  4Z58 A;  3F1P A;  2PUD A;  1XFQ A;  2JN7 A;  2VV7 A;  5IT5 A;  2XRO A;  4HP4 A;  2ICT A;  3CI6 A;  2V0U A;  5F68 A;  3FG8 A;  4HQA A;  3RTY A;  2LYK A;  4I3I A;  2M7U A;  2LB9 A;  3EGD C;  4YAR A;  2AW6 A;  1BYW A;  3EEH A;  3IS2 B;  1OT9 A;  4KUO A;  2D5V A;  2L8N A;  1PNR A;  3JXD L;  2HF6 A;  4X4D A;  1ZTU A;  2K2N A;  3H9W A;  2AXV A;  2XA7 M;  3EGX C;  3OCN A;  3TW8 A;  4ETX A;  5HPI A;  4NXF A;  3ZKC A;  1N9L A;  4IUK A;  1WET A;  4X4I A;  3KJX A;  4EXO A;  1QQB A;  2QKP A;  4GS9 A;  2IA2 A;  1ODV A;  2JCG A;  3PYP A;  2VGL S;  2PYR A;  1T19 A;  1LL8 A;  4X4B A;  1YSQ A;  2ZMV A;  2FZ0 A;  1JFT A;  3EWK A;  2XJ3 A;  1RPE L;  3JVV A;  2EF8 A;  2XSS A;  2O38 A;  4BMW A;  4MCX A;  1ZPQ A;  1ZZ9 A;  2GZU A;  1VB6 A;  3G6O A;  4Z59 A;  5HD5 A;  1T1C A;  4HJ4 A;  4YG4 A;  2ZOI A;  1ZZC A;  4HIA A;  4WEJ A;  1NER A;  3UB7 A;  3JXB C;  2OFY A;  1E3O C;  1ZZB A;  1IFQ A;  5L8M A;  1UXD A;  3FC7 A;  1JWL A;  3SCG A;  2FH5 A;  4PU3 C;  2GX5 A;  3E4P A;  4CQH A;  1YSE A;  3KSI A;  1O4X A;  1PRU A;  5DJU A;  4FBI A;  2V1B A;  1F98 A;  3C30 A;  1Y9Q A;  3R7W B;  2OWJ A;  3JXC L;  4IA8 A;  3S7P A;  4J1W A;  4MN5 A;  4X4E A;  3SCH A;  2A24 B;  2IU7 A;  2W1T B;  1GSV A;  3T4O A;  3VE3 A;  5KIZ A;  4JGP A;  4FSF A;  1JNU A;  4BBU A;  4GCZ A;  2QJ5 A;  4G3K A;  1CJG A;  3NJA A;  4ARZ B;  2GZA A;  1G6O A;  1UWN X;  4GLQ A;  5DKL A;  3IVP A;  3F1P B;  1STZ A;  5G4Z A;  3LIF A;  3MMH A;  4OOM A;  1ZZ7 A;  2LCV A;  2HJ9 C;  5HPF A;  1QP7 A;  1TS8 A;  3PR6 A;  2D02 A;  4L0L A;  1OJ5 A;  2V1A A;  3T4S A;  3E0Y A;  3C38 A;  3MXQ A;  4PKY A;  5HDS A;  3T4L A;  5HWV A;  5HDD A;  1WA9 A;  3B7H A;  3CUE C;  4FN3 A;  3CRO L;  2EA9 A;  4F8D A;  2XA7 S;  1TS6 A;  3MQO A;  4YG1 A;  1XFN A;  4EES A;  3KZ3 A;  4G3W A;  3IBR A;  4R3A A;  4EEP A;  3LYX A;  2ZMF A;  1LQC A;  1MC0 A;  2OWH A;  3MR0 A;  1MKM A;  1QP0 A;  3KXA A;  4X4F A;  4HI4 A;  1G28 A;  5DJT A;  1DP6 A;  4GS9 B;  2MQK A;  4Y3I A;  2V0W A;  3OCL A;  2XSD C;  4Z5H A;  4BBV A;  2LYR A;  4GQM A;  2HIN A;  3MFX A;  1F5M A;  4PU7 A;  4L9G A;  2B5A A;  2ICP A;  1S66 L;  2JKR M;  4MMN A;  2G7U A;  2J3W A;  1OPX A;  3EQV A;  3HJI A;  3P01 A;  5TBM A;  4KQD A;  2W3D A;  4GW9 A;  5AVE A;  4IVZ A;  4J1X A;  1GT0 C;  4NXB A;  1NEQ A;  2KX6 A;  2BNM A;  4Z5D A;  1S1Y A;  1V9Z A;  3B42 A;  1DP9 A;  2W0N A;  2JKR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...