4F8DA

Crystal structure of an r46a mutant of the restriction-modification controller protein c.esp1396i (monoclinic form)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
78
structure length
78
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSANLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription
molecule keywords Regulatory protein
total genus 34
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4f8dA00
3F51A 3DNVB 4NDWA 1PNRA 1QP7A 1UXCA 3IVPA 4IA8A 3G7DA 1QP4A 2IVGA 4X4HA 4J1XA 4YG4A 3OP9A 1BDIA 1B0NA 2BNNA 3FMYA 3UFDA 3U3WA 2PUFA 3SCFA 4X4EA 2KEKA 2GRLA 1PRVA 3SCGA 2D5VA 1SQ8A 1E3OC 1LCDA 2LYPA 2LYJA 1QPZA 2AWIA 2R63A 2A6CA 3TRBA 4X4GA 1ZUGA 4PU7A 1ZZ6A 4MCTA 4MCXA 1RPEL 4JCXA 3OMTA 2PPXA 2PE5A 3CECA 4FBIA 3ZHIA 3JXBC 2AUWA 1QQAA 2L8NA 2XJ3A 2PUBA 1ZPQA 1OSLA 2ICTA 4YARA 4X4CA 3R1FA 1RIOA 1QP0A 1NERA 3JXDL 3D1NI 1YSEA 1CQTA 3ZKCA 2IVQA 2XI8A 2EWTA 3G5GA 1CJGA 1POUA 3EUSA 1PRAA 4IWRA 1BDHA 3S8QA 2IU7A 4PU4C 1ZAYA 3CROL 2L49A 2KPJA 4I6RA 1X2LA 4YG1A 2LYLA 2PUAA 1O4XA 1Y9QA 4JQDA 4JCYA 3KZ3A 2MQKA 1VPWA 2MEZA 1Y7YA 1GT0C 3FYMA 3CLCA 3BDNA 3BS3A 4IVZA 2O38A 4OB4A 2LYSA 4Z5DA 3HZIB 3ZHMA 2CSFA 1UTXA 4Z58A 2AXVA 1AU7A 1RZSA 4Z5CA 4X4DA 4I6TA 2LYKA 4I8TA 2HSGA 1LLIA 4X4BA 2AXUA 1UXDA 1ADRA 1X57A 2HINA 3QF3A 5A7LA 3GN5A 2JVLA 2FJRA 1QQBA 2CROA 4J1WA 2AW6A 2OFYA 3O9XA 2XCJA 2AXZA 3B7HA 3OQNA 1ZZ8A 2B5AA 3JXCL 2IVBA 3LISA 2EBYA 3F52A 3GBFA 2XSDC 3H5TA 1WH6A 4Z5HA 1RZRD 1LCCA 1ZVVA 2PUEA 3MLFA 4YG7B 2KEJA 4YBAA 2PUDA 3RZZA 2LYRA 1RZRA 1NEQA 2XIUA 1OCTC 2BNMA 2PIJA 3QQ6A 5K98B 2KZ8A 1EFAA 2R1JL 1JFTA 2LCVA 4GQMA 4O8BA 4I6UA 2O49A 2ICPA 1JWLA 3KJXA 1XWRA 3SCHA 2BNOA 1ZZ9A 1JFSA 1IC8A 4Y42A 1LMB3 3QWGA 4X4FA 3OQMA 1PRUA 1R69A 2EF8A 4PU3C 3BD1A 1R63A 2GZUA 1DWKA 2BJCA 2IUOA 1JH9A 1HF0A 2WIUB 2IV1A 2H8RA 1DW9A 2JCGA 3LFPA 1LQCA 4X4IA 4GHJA 2KEIA 1WIZA 1ZZ7A 3L1PA 2PUCA 1ZZBA 3FYAA 3OQOA 2PUGA 4Z59A 3F6WA 2LYQA 1ZS4A 1ZZCA 2OR1L 3QYXA 1S7EA 1WETA 1PERL 4FN3A 3GN5B 2WUSR 1L1MA 3VK0A 4F8DA 3PXPA 3KXAA 2GRMA 4PU8A 2O4AA 1WH8A
chains in the Genus database with same CATH superfamily
4EQZA 1QP7A 2HCNA 3G7DA 2IVGA 4J1XA 4YG4A 1BDIA 3QOWA 3UFDA 2PXEA 2PXFA 1PRVA 2R63A 3TRBA 4PU7A 2HFZA 4FBIA 1ZPQA 1QP0A 3A9YA 3R1FA 1DULA 1NERA 3D1NI 1YSEA 1CQTA 3ZKCA 5DT2A 3LQXA 1CJGA 1POUA 3S8QA 2IU7A 3NROA 4PU4C 4I6RA 1X2LA 2LNMA 4YG1A 3KZ3A 1VPWA 3ZHMA 2PXBA 2M4HA 2LLVA 1AU7A 1RZSA 4X4DA 1LLIA 3M9LA 1X57A 2HINA 5A7LA 3GZCA 1QQBA 2CROA 2HCSA 2OFYA 3O9XA 4EK9A 3B7HA 2FFHA 2IVBA 3F52A 3SX0A 4YG7B 2PUDA 3RZZA 1RZRA 1NEQA 2PIJA 5DRTA 5K98B 2YBDA 5DTQA 3KJXA 2BNOA 4X4FA 1HF0A 1DW9A 3DM5A 1LQCA 4GHJA 1WIZA 3L1PA 2PUCA 3FYAA 3OQOA 2PUGA 1WETA 4FN3A 3PXPA 2PXUA 3MEJA 3TELA 1HQ1A 1UXCA 3IVPA 1B0NA 2BNNA 2PUFA 3SCFA 2KEKA 1QPZA 2LYJA 4MCTA 4JCXA 3ZHIA 2PXLA 2XJ3A 4YARA 3TFLA 3TEPA 2XXAA 4Q2JA 2IVQA 2XI8A 3G5GA 4WVLA 5DTMA 1BDHA 1ZAYA 2MQKA 3CLCA 4EKGA 2O38A 2LYSA 3HZIB 2CSFA 1UTXA 4Z5CA 4ER7A 2AXUA 1ADRA 3GN5A 2AW6A 2PXTA 4DE8A 3OWQA 2KEJA 3PE5A 2XIUA 1OCTC 2BNMA 3QQ6A 4GQMA 2PXPA 1MFQC 1JWLA 5DRYA 1IC8A 5DTRA 1PRUA 2EF8A 1R63A 5GAHi 2WIUB 2IV1A 2H8RA 3LFPA 4ER5A 4X4IA 3GZDC 1ZZBA 2JQEA 3F6WA 1ZZCA 3QYXA 3GN5B 2WUSR 3VK0A 4F8DA 2GRMA 4PU8A 2O4AA 3F51A 1PNRA 1QP4A 4EZIA 3OP9A 3FMYA 2GRLA 3SCGA 2D5VA 1U2ZA 1LCDA 2LYPA 3GUUA 4X4GA 2A6CA 3A9ZA 1ZUGA 3QFIA 1ZZ6A 3A9XA 4MCXA 3OMTA 3JXBC 3SR4A 3JXDL 2L1PA 2EWTA 4IWRA 3QOXA 3VWSA 2ODRD 1O4XA 2MEZA 1Y7YA 3FYMA 5DSXA 3G0TA 3ZPXA 2AXVA 4I6TA 3NXHA 5GAGi 3QF3A 2PXVA 2JVLA 2FJRA 2AXZA 3OQNA 1ZZ8A 3LISA 2EBYA 3GBFA 1WH6A 4Z5HA 2PUEA 1QZXA 4YBAA 1EFAA 1JFTA 4O8BA 2ICPA 1JFSA 3SCHA 2XXPA 1LMB3 2PXKA 3QWGA 3OKZA 3ME5A 3OQMA 1R69A 2PXQA 4PU3C 2GZUA 2BJCA 2IUOA 2JCGA 2KEIA 3GZDA 1ZS4A 2V3CC 1PERL 1L1MA 2VEOA 3KXAA 3EUSA 3DNVB 4NDWA 4IA8A 3NZLA 4X4HA 2J7WA 3U3WA 4X4EA 4EKIA 1SQ8A 1E3OC 2AWIA 2PXDA 2J7UA 1RPEL 2PPXA 2PE5A 3CECA 2AUWA 1QQAA 2L8NA 2PUBA 1OSLA 2ICTA 4X4CA 1RIOA 1NW3A 1PRAA 3CROL 2L49A 2KPJA 2LYLA 2PUAA 4JQDA 1Y9QA 4JCYA 1GT0C 3UWPA 3BDNA 3BS3A 4IVZA 4OB4A 4Z5DA 4ER3A 4Z58A 4I8TA 2LYKA 2HSGA 4X4BA 1UXDA 4J1WA 2XCJA 4ER6A 4HRAA 2B5AA 3JXCL 2XSDC 4OBMA 3H5TA 1LCCA 1RZRD 1ZVVA 4ER0A 3MLFA 2LYRA 3NDBB 2KZ8A 2R1JL 2LCVA 2MXDA 1QB2A 4I6UA 2O49A 3KL4A 1XWRA 1ZZ9A 4Y42A 2XXQA 3BD1A 1DWKA 1JH9A 1ZZ7A 4DE9A 4Z59A 2LYQA 2OR1L 1S7EA 5JUWA 2LLWA 3R09A 1WH8A
chains in the Genus database with same CATH topology
3F51A 3DNVB 4NDWA 1PNRA 1QP7A 1UXCA 3IVPA 4IA8A 3G7DA 1QP4A 2IVGA 4X4HA 4J1XA 4YG4A 3OP9A 1BDIA 1B0NA 2BNNA 3FMYA 3UFDA 3U3WA 2PUFA 3SCFA 4X4EA 2KEKA 2GRLA 1PRVA 3SCGA 2D5VA 1SQ8A 1E3OC 1LCDA 2LYPA 2LYJA 1QPZA 2AWIA 2R63A 2A6CA 3TRBA 4X4GA 1ZUGA 4PU7A 1ZZ6A 4MCTA 4MCXA 1RPEL 4JCXA 3OMTA 2PPXA 2PE5A 3CECA 4FBIA 3ZHIA 3JXBC 2AUWA 1QQAA 2L8NA 2XJ3A 2PUBA 1ZPQA 1OSLA 2ICTA 4YARA 4X4CA 3R1FA 1RIOA 1QP0A 1NERA 3JXDL 3D1NI 1YSEA 1CQTA 3ZKCA 2IVQA 2XI8A 2EWTA 3G5GA 1CJGA 1POUA 3EUSA 1PRAA 4IWRA 1BDHA 3S8QA 2IU7A 4PU4C 1ZAYA 3CROL 2L49A 2KPJA 4I6RA 1X2LA 4YG1A 2LYLA 2PUAA 1O4XA 1Y9QA 4JQDA 4JCYA 3KZ3A 2MQKA 1VPWA 2MEZA 1Y7YA 1GT0C 3FYMA 3CLCA 3BDNA 3BS3A 4IVZA 2O38A 4OB4A 2LYSA 4Z5DA 3HZIB 3ZHMA 2CSFA 1UTXA 4Z58A 2AXVA 1AU7A 1RZSA 4Z5CA 4X4DA 4I6TA 2LYKA 4I8TA 2HSGA 1LLIA 4X4BA 2AXUA 1UXDA 1ADRA 1X57A 2HINA 3QF3A 5A7LA 3GN5A 2JVLA 2FJRA 1QQBA 2CROA 4J1WA 2AW6A 2OFYA 3O9XA 2XCJA 2AXZA 3B7HA 3OQNA 1ZZ8A 2B5AA 3JXCL 2IVBA 3LISA 2EBYA 3F52A 3GBFA 2XSDC 3H5TA 1WH6A 4Z5HA 1RZRD 1LCCA 1ZVVA 2PUEA 3MLFA 4YG7B 2KEJA 4YBAA 2PUDA 3RZZA 2LYRA 1RZRA 1NEQA 2XIUA 1OCTC 2BNMA 2PIJA 3QQ6A 5K98B 2KZ8A 1EFAA 2R1JL 1JFTA 2LCVA 4GQMA 4O8BA 4I6UA 2O49A 2ICPA 1JWLA 3KJXA 1XWRA 3SCHA 2BNOA 1ZZ9A 1JFSA 1IC8A 4Y42A 1LMB3 3QWGA 4X4FA 3OQMA 1PRUA 1R69A 2EF8A 4PU3C 3BD1A 1R63A 2GZUA 1DWKA 2BJCA 2IUOA 1JH9A 1HF0A 2WIUB 2IV1A 2H8RA 1DW9A 2JCGA 3LFPA 1LQCA 4X4IA 4GHJA 2KEIA 1WIZA 1ZZ7A 3L1PA 2PUCA 1ZZBA 3FYAA 3OQOA 2PUGA 4Z59A 3F6WA 2LYQA 1ZS4A 1ZZCA 2OR1L 3QYXA 1S7EA 1WETA 1PERL 4FN3A 3GN5B 2WUSR 1L1MA 3VK0A 4F8DA 3PXPA 3KXAA 2GRMA 4PU8A 2O4AA 1WH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F51 A;  3DNV B;  4NDW A;  1PNR A;  1QP7 A;  1UXC A;  3IVP A;  4IA8 A;  3G7D A;  1QP4 A;  2IVG A;  4X4H A;  4J1X A;  4YG4 A;  3OP9 A;  1BDI A;  1B0N A;  2BNN A;  3FMY A;  3UFD A;  3U3W A;  2PUF A;  3SCF A;  4X4E A;  2KEK A;  2GRL A;  1PRV A;  3SCG A;  2D5V A;  1SQ8 A;  1E3O C;  1LCD A;  2LYP A;  2LYJ A;  1QPZ A;  2AWI A;  2R63 A;  2A6C A;  3TRB A;  4X4G A;  1ZUG A;  4PU7 A;  1ZZ6 A;  4MCT A;  4MCX A;  1RPE L;  4JCX A;  3OMT A;  2PPX A;  2PE5 A;  3CEC A;  4FBI A;  3ZHI A;  3JXB C;  2AUW A;  1QQA A;  2L8N A;  2XJ3 A;  2PUB A;  1ZPQ A;  1OSL A;  2ICT A;  4YAR A;  4X4C A;  3R1F A;  1RIO A;  1QP0 A;  1NER A;  3JXD L;  3D1N I;  1YSE A;  1CQT A;  3ZKC A;  2IVQ A;  2XI8 A;  2EWT A;  3G5G A;  1CJG A;  1POU A;  3EUS A;  1PRA A;  4IWR A;  1BDH A;  3S8Q A;  2IU7 A;  4PU4 C;  1ZAY A;  3CRO L;  2L49 A;  2KPJ A;  4I6R A;  1X2L A;  4YG1 A;  2LYL A;  2PUA A;  1O4X A;  1Y9Q A;  4JQD A;  4JCY A;  3KZ3 A;  2MQK A;  1VPW A;  2MEZ A;  1Y7Y A;  1GT0 C;  3FYM A;  3CLC A;  3BDN A;  3BS3 A;  4IVZ A;  2O38 A;  4OB4 A;  2LYS A;  4Z5D A;  3HZI B;  3ZHM A;  2CSF A;  1UTX A;  4Z58 A;  2AXV A;  1AU7 A;  1RZS A;  4Z5C A;  4X4D A;  4I6T A;  2LYK A;  4I8T A;  2HSG A;  1LLI A;  4X4B A;  2AXU A;  1UXD A;  1ADR A;  1X57 A;  2HIN A;  3QF3 A;  5A7L A;  3GN5 A;  2JVL A;  2FJR A;  1QQB A;  2CRO A;  4J1W A;  2AW6 A;  2OFY A;  3O9X A;  2XCJ A;  2AXZ A;  3B7H A;  3OQN A;  1ZZ8 A;  2B5A A;  3JXC L;  2IVB A;  3LIS A;  2EBY A;  3F52 A;  3GBF A;  2XSD C;  3H5T A;  1WH6 A;  4Z5H A;  1RZR D;  1LCC A;  1ZVV A;  2PUE A;  3MLF A;  4YG7 B;  2KEJ A;  4YBA A;  2PUD A;  3RZZ A;  2LYR A;  1RZR A;  1NEQ A;  2XIU A;  1OCT C;  2BNM A;  2PIJ A;  3QQ6 A;  5K98 B;  2KZ8 A;  1EFA A;  2R1J L;  1JFT A;  2LCV A;  4GQM A;  4O8B A;  4I6U A;  2O49 A;  2ICP A;  1JWL A;  3KJX A;  1XWR A;  3SCH A;  2BNO A;  1ZZ9 A;  1JFS A;  1IC8 A;  4Y42 A;  1LMB 3;  3QWG A;  4X4F A;  3OQM A;  1PRU A;  1R69 A;  2EF8 A;  4PU3 C;  3BD1 A;  1R63 A;  2GZU A;  1DWK A;  2BJC A;  2IUO A;  1JH9 A;  1HF0 A;  2WIU B;  2IV1 A;  2H8R A;  1DW9 A;  2JCG A;  3LFP A;  1LQC A;  4X4I A;  4GHJ A;  2KEI A;  1WIZ A;  1ZZ7 A;  3L1P A;  2PUC A;  1ZZB A;  3FYA A;  3OQO A;  2PUG A;  4Z59 A;  3F6W A;  2LYQ A;  1ZS4 A;  1ZZC A;  2OR1 L;  3QYX A;  1S7E A;  1WET A;  1PER L;  4FN3 A;  3GN5 B;  2WUS R;  1L1M A;  3VK0 A;  4F8D A;  3PXP A;  3KXA A;  2GRM A;  4PU8 A;  2O4A A;  1WH8 A; 
#chains in the Genus database with same CATH topology
 4EQZ A;  1QP7 A;  2HCN A;  3G7D A;  2IVG A;  4J1X A;  4YG4 A;  1BDI A;  3QOW A;  3UFD A;  2PXE A;  2PXF A;  1PRV A;  2R63 A;  3TRB A;  4PU7 A;  2HFZ A;  4FBI A;  1ZPQ A;  1QP0 A;  3A9Y A;  3R1F A;  1DUL A;  1NER A;  3D1N I;  1YSE A;  1CQT A;  3ZKC A;  5DT2 A;  3LQX A;  1CJG A;  1POU A;  3S8Q A;  2IU7 A;  3NRO A;  4PU4 C;  4I6R A;  1X2L A;  2LNM A;  4YG1 A;  3KZ3 A;  1VPW A;  3ZHM A;  2PXB A;  2M4H A;  2LLV A;  1AU7 A;  1RZS A;  4X4D A;  1LLI A;  3M9L A;  1X57 A;  2HIN A;  5A7L A;  3GZC A;  1QQB A;  2CRO A;  2HCS A;  2OFY A;  3O9X A;  4EK9 A;  3B7H A;  2FFH A;  2IVB A;  3F52 A;  3SX0 A;  4YG7 B;  2PUD A;  3RZZ A;  1RZR A;  1NEQ A;  2PIJ A;  5DRT A;  5K98 B;  2YBD A;  5DTQ A;  3KJX A;  2BNO A;  4X4F A;  1HF0 A;  1DW9 A;  3DM5 A;  1LQC A;  4GHJ A;  1WIZ A;  3L1P A;  2PUC A;  3FYA A;  3OQO A;  2PUG A;  1WET A;  4FN3 A;  3PXP A;  2PXU A;  3MEJ A;  3TEL A;  1HQ1 A;  1UXC A;  3IVP A;  1B0N A;  2BNN A;  2PUF A;  3SCF A;  2KEK A;  1QPZ A;  2LYJ A;  4MCT A;  4JCX A;  3ZHI A;  2PXL A;  2XJ3 A;  4YAR A;  3TFL A;  3TEP A;  2XXA A;  4Q2J A;  2IVQ A;  2XI8 A;  3G5G A;  4WVL A;  5DTM A;  1BDH A;  1ZAY A;  2MQK A;  3CLC A;  4EKG A;  2O38 A;  2LYS A;  3HZI B;  2CSF A;  1UTX A;  4Z5C A;  4ER7 A;  2AXU A;  1ADR A;  3GN5 A;  2AW6 A;  2PXT A;  4DE8 A;  3OWQ A;  2KEJ A;  3PE5 A;  2XIU A;  1OCT C;  2BNM A;  3QQ6 A;  4GQM A;  2PXP A;  1MFQ C;  1JWL A;  5DRY A;  1IC8 A;  5DTR A;  1PRU A;  2EF8 A;  1R63 A;  5GAH i;  2WIU B;  2IV1 A;  2H8R A;  3LFP A;  4ER5 A;  4X4I A;  3GZD C;  1ZZB A;  2JQE A;  3F6W A;  1ZZC A;  3QYX A;  3GN5 B;  2WUS R;  3VK0 A;  4F8D A;  2GRM A;  4PU8 A;  2O4A A;  3F51 A;  1PNR A;  1QP4 A;  4EZI A;  3OP9 A;  3FMY A;  2GRL A;  3SCG A;  2D5V A;  1U2Z A;  1LCD A;  2LYP A;  3GUU A;  4X4G A;  2A6C A;  3A9Z A;  1ZUG A;  3QFI A;  1ZZ6 A;  3A9X A;  4MCX A;  3OMT A;  3JXB C;  3SR4 A;  3JXD L;  2L1P A;  2EWT A;  4IWR A;  3QOX A;  3VWS A;  2ODR D;  1O4X A;  2MEZ A;  1Y7Y A;  3FYM A;  5DSX A;  3G0T A;  3ZPX A;  2AXV A;  4I6T A;  3NXH A;  5GAG i;  3QF3 A;  2PXV A;  2JVL A;  2FJR A;  2AXZ A;  3OQN A;  1ZZ8 A;  3LIS A;  2EBY A;  3GBF A;  1WH6 A;  4Z5H A;  2PUE A;  1QZX A;  4YBA A;  1EFA A;  1JFT A;  4O8B A;  2ICP A;  1JFS A;  3SCH A;  2XXP A;  1LMB 3;  2PXK A;  3QWG A;  3OKZ A;  3ME5 A;  3OQM A;  1R69 A;  2PXQ A;  4PU3 C;  2GZU A;  2BJC A;  2IUO A;  2JCG A;  2KEI A;  3GZD A;  1ZS4 A;  2V3C C;  1PER L;  1L1M A;  2VEO A;  3KXA A;  3EUS A;  3DNV B;  4NDW A;  4IA8 A;  3NZL A;  4X4H A;  2J7W A;  3U3W A;  4X4E A;  4EKI A;  1SQ8 A;  1E3O C;  2AWI A;  2PXD A;  2J7U A;  1RPE L;  2PPX A;  2PE5 A;  3CEC A;  2AUW A;  1QQA A;  2L8N A;  2PUB A;  1OSL A;  2ICT A;  4X4C A;  1RIO A;  1NW3 A;  1PRA A;  3CRO L;  2L49 A;  2KPJ A;  2LYL A;  2PUA A;  4JQD A;  1Y9Q A;  4JCY A;  1GT0 C;  3UWP A;  3BDN A;  3BS3 A;  4IVZ A;  4OB4 A;  4Z5D A;  4ER3 A;  4Z58 A;  4I8T A;  2LYK A;  2HSG A;  4X4B A;  1UXD A;  4J1W A;  2XCJ A;  4ER6 A;  4HRA A;  2B5A A;  3JXC L;  2XSD C;  4OBM A;  3H5T A;  1LCC A;  1RZR D;  1ZVV A;  4ER0 A;  3MLF A;  2LYR A;  3NDB B;  2KZ8 A;  2R1J L;  2LCV A;  2MXD A;  1QB2 A;  4I6U A;  2O49 A;  3KL4 A;  1XWR A;  1ZZ9 A;  4Y42 A;  2XXQ A;  3BD1 A;  1DWK A;  1JH9 A;  1ZZ7 A;  4DE9 A;  4Z59 A;  2LYQ A;  2OR1 L;  1S7E A;  5JUW A;  2LLW A;  3R09 A;  1WH8 A; 
#chains in the Genus database with same CATH homology
 3F51 A;  3DNV B;  4NDW A;  1PNR A;  1QP7 A;  1UXC A;  3IVP A;  4IA8 A;  3G7D A;  1QP4 A;  2IVG A;  4X4H A;  4J1X A;  4YG4 A;  3OP9 A;  1BDI A;  1B0N A;  2BNN A;  3FMY A;  3UFD A;  3U3W A;  2PUF A;  3SCF A;  4X4E A;  2KEK A;  2GRL A;  1PRV A;  3SCG A;  2D5V A;  1SQ8 A;  1E3O C;  1LCD A;  2LYP A;  2LYJ A;  1QPZ A;  2AWI A;  2R63 A;  2A6C A;  3TRB A;  4X4G A;  1ZUG A;  4PU7 A;  1ZZ6 A;  4MCT A;  4MCX A;  1RPE L;  4JCX A;  3OMT A;  2PPX A;  2PE5 A;  3CEC A;  4FBI A;  3ZHI A;  3JXB C;  2AUW A;  1QQA A;  2L8N A;  2XJ3 A;  2PUB A;  1ZPQ A;  1OSL A;  2ICT A;  4YAR A;  4X4C A;  3R1F A;  1RIO A;  1QP0 A;  1NER A;  3JXD L;  3D1N I;  1YSE A;  1CQT A;  3ZKC A;  2IVQ A;  2XI8 A;  2EWT A;  3G5G A;  1CJG A;  1POU A;  3EUS A;  1PRA A;  4IWR A;  1BDH A;  3S8Q A;  2IU7 A;  4PU4 C;  1ZAY A;  3CRO L;  2L49 A;  2KPJ A;  4I6R A;  1X2L A;  4YG1 A;  2LYL A;  2PUA A;  1O4X A;  1Y9Q A;  4JQD A;  4JCY A;  3KZ3 A;  2MQK A;  1VPW A;  2MEZ A;  1Y7Y A;  1GT0 C;  3FYM A;  3CLC A;  3BDN A;  3BS3 A;  4IVZ A;  2O38 A;  4OB4 A;  2LYS A;  4Z5D A;  3HZI B;  3ZHM A;  2CSF A;  1UTX A;  4Z58 A;  2AXV A;  1AU7 A;  1RZS A;  4Z5C A;  4X4D A;  4I6T A;  2LYK A;  4I8T A;  2HSG A;  1LLI A;  4X4B A;  2AXU A;  1UXD A;  1ADR A;  1X57 A;  2HIN A;  3QF3 A;  5A7L A;  3GN5 A;  2JVL A;  2FJR A;  1QQB A;  2CRO A;  4J1W A;  2AW6 A;  2OFY A;  3O9X A;  2XCJ A;  2AXZ A;  3B7H A;  3OQN A;  1ZZ8 A;  2B5A A;  3JXC L;  2IVB A;  3LIS A;  2EBY A;  3F52 A;  3GBF A;  2XSD C;  3H5T A;  1WH6 A;  4Z5H A;  1RZR D;  1LCC A;  1ZVV A;  2PUE A;  3MLF A;  4YG7 B;  2KEJ A;  4YBA A;  2PUD A;  3RZZ A;  2LYR A;  1RZR A;  1NEQ A;  2XIU A;  1OCT C;  2BNM A;  2PIJ A;  3QQ6 A;  5K98 B;  2KZ8 A;  1EFA A;  2R1J L;  1JFT A;  2LCV A;  4GQM A;  4O8B A;  4I6U A;  2O49 A;  2ICP A;  1JWL A;  3KJX A;  1XWR A;  3SCH A;  2BNO A;  1ZZ9 A;  1JFS A;  1IC8 A;  4Y42 A;  1LMB 3;  3QWG A;  4X4F A;  3OQM A;  1PRU A;  1R69 A;  2EF8 A;  4PU3 C;  3BD1 A;  1R63 A;  2GZU A;  1DWK A;  2BJC A;  2IUO A;  1JH9 A;  1HF0 A;  2WIU B;  2IV1 A;  2H8R A;  1DW9 A;  2JCG A;  3LFP A;  1LQC A;  4X4I A;  4GHJ A;  2KEI A;  1WIZ A;  1ZZ7 A;  3L1P A;  2PUC A;  1ZZB A;  3FYA A;  3OQO A;  2PUG A;  4Z59 A;  3F6W A;  2LYQ A;  1ZS4 A;  1ZZC A;  2OR1 L;  3QYX A;  1S7E A;  1WET A;  1PER L;  4FN3 A;  3GN5 B;  2WUS R;  1L1M A;  3VK0 A;  4F8D A;  3PXP A;  3KXA A;  2GRM A;  4PU8 A;  2O4A A;  1WH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...