4X4IA

Radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 44.6 mgy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Regulatory protein
publication title Radiation damage to nucleoprotein complexes in macromolecular crystallography.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4x4iA00
2JCGA 2EBYA 3SCHA 1L1MA 2B5AA 1CQTA 2XCJA 1R69A 4PU7A 2CROA 4Y42A 3SCFA 1QP0A 4YG1A 3GN5B 2O49A 1WH8A 2XIUA 4I6RA 2PUEA 2XJ3A 4X4FA 2EF8A 2R63A 1PRUA 3GBFA 4FN3A 4OB4A 1ZZCA 4X4IA 3U3WA 2O38A 3ZHMA 1POUA 4I6TA 3FMYA 2L8NA 2XI8A 1ZZ6A 3QWGA 3KZ3A 4YG7B 2PUBA 4JCXA 2O4AA 1S7EA 1X2LA 1VPWA 3IVPA 1ZZ9A 2IVGA 5K98B 1QP7A 2HSGA 2JVLA 3L1PA 4X4EA 2GRMA 2R1JL 3BDNA 1IC8A 1JH9A 2BNNA 3H5TA 1WIZA 2LYRA 3KJXA 3SCGA 1OCTC 3BD1A 5A7LA 4PU3C 3ZKCA 3GN5A 4NDWA 1JFSA 2PUDA 2ICPA 2KZ8A 2XSDC 3JXCL 1JWLA 3OQMA 1GT0C 1CJGA 2L49A 3OP9A 1QP4A 1ZPQA 2FJRA 2GZUA 3VK0A 2WIUB 3DNVB 3UFDA 1ZS4A 3B7HA 3OQNA 4Z58A 2HINA 3EUSA 1PERL 2LYPA 2LYKA 4YARA 1ZZ8A 3CECA 2PIJA 3PXPA 1BDHA 2OR1L 4IVZA 1DW9A 3JXBC 2KEKA 2LCVA 2LYSA 2AXUA 2PPXA 3CLCA 2MQKA 4YBAA 4J1XA 2KEIA 2PUAA 3OMTA 3R1FA 3BS3A 3TRBA 3RZZA 4Z5CA 3HZIB 1PRVA 1JFTA 1HF0A 1QPZA 1WETA 2IVQA 2LYQA 3MLFA 2IV1A 4JQDA 4MCXA 4X4GA 3S8QA 1RIOA 1XWRA 1ZZ7A 2AUWA 4GQMA 2PUCA 1AU7A 4I6UA 3F51A 3LFPA 2OFYA 4X4BA 4X4DA 3QYXA 2ICTA 4GHJA 3O9XA 2PUFA 1LCDA 1EFAA 1QQBA 3JXDL 3ZHIA 1ZVVA 1LQCA 4IA8A 4O8BA 1BDIA 1UXCA 1Y7YA 1UTXA 4JCYA 4Z5HA 2PUGA 1SQ8A 2IUOA 4PU8A 1UXDA 1PNRA 4X4CA 1O4XA 2AXVA 2EWTA 2A6CA 1Y9QA 1LCCA 4I8TA 3KXAA 1B0NA 4YG4A 2IU7A 4X4HA 2WUSR 1ZAYA 2CSFA 2KPJA 2LYJA 3F6WA 3FYMA 1RZRA 4PU4C 4Z5DA 2D5VA 2IVBA 1RZRD 1OSLA 1PRAA 3OQOA 2MEZA 3CROL 4MCTA 1RPEL 1DWKA 1X57A 1QQAA 1ZUGA 3FYAA 3F52A 2BJCA 1RZSA 2LYLA 1WH6A 2PE5A 2H8RA 4Z59A 1E3OC 3QQ6A 4IWRA 3QF3A 4F8DA 4J1WA 1LMB3 3LISA 1R63A 2BNOA 3D1NI 3G5GA 1LLIA 2KEJA 1ADRA 4FBIA 2AW6A 2BNMA 2AXZA 2AWIA 1NEQA 2GRLA 3G7DA 1ZZBA 1YSEA 1NERA
chains in the Genus database with same CATH superfamily
5DT2A 2CROA 4YG1A 2XJ3A 4X4FA 4FN3A 2O38A 1POUA 4I6TA 2XI8A 4JCXA 3KZ3A 3IVPA 3L1PA 2GRMA 3BDNA 4ER6A 5DSXA 5A7LA 2HFZA 4NDWA 2PUDA 4WVLA 2LNMA 5JUWA 3UWPA 4DE9A 1QP4A 3UFDA 2WIUB 2PXPA 2HINA 4OBMA 2LYPA 4EZIA 2PIJA 1BDHA 2OR1L 3VWSA 2AXUA 3CLCA 3M9LA 4J1XA 1HF0A 1QPZA 3HZIB 1WETA 2LYQA 4JQDA 4X4GA 1XWRA 1ZZ7A 2AUWA 1AU7A 3F51A 2OFYA 4X4BA 4X4DA 2XXAA 2ICTA 2PXBA 1LCDA 4ER7A 4EQZA 4Z5HA 3GZCA 2PUGA 1PNRA 2LLVA 2A6CA 1Y9QA 3KL4A 4I8TA 2PXUA 2LYJA 4DE8A 4PU4C 1QQAA 3QQ6A 3LISA 3G5GA 2AW6A 2BNMA 2AWIA 1ZZBA 2XCJA 1R69A 4Y42A 5DTRA 2O49A 4I6RA 2PXVA 1PRUA 1ZZ6A 2JQEA 3QWGA 4YG7B 2PUBA 1DULA 2M4HA 1X2LA 3QOWA 4ER3A 3SX0A 4X4EA 1JH9A 2BNNA 3H5TA 1OCTC 4PU3C 2HCSA 2KZ8A 5DTQA 1ZS4A 4Z58A 4YARA 5DRTA 1ZZ8A 3CECA 3PE5A 1DW9A 2LLWA 4YBAA 3BS3A 3MLFA 4I6UA 5GAGi 2FFHA 3LQXA 4GHJA 3O9XA 3G0TA 1QQBA 2PXLA 3ZHIA 1ZVVA 1LQCA 4IA8A 1Y7YA 4JCYA 2IUOA 2HCNA 2AXVA 3GZDC 4X4HA 2IU7A 2KPJA 3FYMA 4Z5DA 2IVBA 1RZRD 3NDBB 1PRAA 3OQOA 2MEZA 3CROL 2PXDA 1ZUGA 3FYAA 1WH6A 1E3OC 4IWRA 4ER5A 1ADRA 4FBIA 2V3CC 3SR4A 3QOXA 3B7HA 5GAHi 1L1MA 2B5AA 1CQTA 4PU7A 3OKZA 2PXTA 1WH8A 2J7WA 2XIUA 3DM5A 4OB4A 4X4IA 2J7UA 3FMYA 2L8NA 2VEOA 4ER0A 1ZZ9A 2IVGA 5K98B 1QP7A 2HSGA 2JVLA 2R1JL 4Q2JA 1WIZA 2LYRA 3KJXA 3BD1A 3ZKCA 3GN5A 1JFSA 3JXCL 1JWLA 3OQMA 1GT0C 1CJGA 2L49A 1ZPQA 2FJRA 2GZUA 3VK0A 4EK9A 2PXEA 3EUSA 2YBDA 3PXPA 3GZDA 4IVZA 3JXBC 2LCVA 2LYSA 2PPXA 2KEIA 3OMTA 3TRBA 3RZZA 4Z5CA 2IV1A 3S8QA 1RIOA 3TEPA 2PUFA 3JXDL 1BDIA 4O8BA 1UTXA 3A9XA 5DRYA 4PU8A 1QZXA 2EWTA 1LCCA 3KXAA 1B0NA 1ZAYA 2CSFA 2PXKA 4MCTA 1RPEL 1DWKA 1X57A 2H8RA 2PXFA 4Z59A 3QF3A 4J1WA 1LMB3 3QFIA 2PXQA 3D1NI 1LLIA 3GUUA 2GRLA 1NERA 2JCGA 2EBYA 3SCHA 3NXHA 3SCFA 1QP0A 3GN5B 4HRAA 2PUEA 1NW3A 2EF8A 2R63A 3GBFA 1ZZCA 3U3WA 3NROA 3ZHMA 2O4AA 1S7EA 1VPWA 4EKGA 2MXDA 1IC8A 3SCGA 2XXPA 2ICPA 2XSDC 3OP9A 3DNVB 2L1PA 3OQNA 3A9ZA 1QB2A 1PERL 2LYKA 4EKIA 2KEKA 5DTMA 1U2ZA 2MQKA 2PUAA 3R1FA 3ZPXA 1JFTA 1PRVA 1HQ1A 2IVQA 4MCXA 2XXQA 4GQMA 2PUCA 3LFPA 3OWQA 3MEJA 3QYXA 3TFLA 1EFAA 1UXCA 3R09A 1SQ8A 3ME5A 1UXDA 4X4CA 1MFQC 4YG4A 2WUSR 3TELA 3F6WA 1RZRA 2D5VA 2ODRD 1OSLA 3NZLA 2BJCA 3F52A 1RZSA 2LYLA 2PE5A 4F8DA 3A9YA 1R63A 2BNOA 2KEJA 2AXZA 1NEQA 3G7DA 1YSEA 1O4XA
chains in the Genus database with same CATH topology
2JCGA 2EBYA 3SCHA 1L1MA 2B5AA 1CQTA 2XCJA 1R69A 4PU7A 2CROA 4Y42A 3SCFA 1QP0A 4YG1A 3GN5B 2O49A 1WH8A 2XIUA 4I6RA 2PUEA 2XJ3A 4X4FA 2EF8A 2R63A 1PRUA 3GBFA 4FN3A 4OB4A 1ZZCA 4X4IA 3U3WA 2O38A 3ZHMA 1POUA 4I6TA 3FMYA 2L8NA 2XI8A 1ZZ6A 3QWGA 3KZ3A 4YG7B 2PUBA 4JCXA 2O4AA 1S7EA 1X2LA 1VPWA 3IVPA 1ZZ9A 2IVGA 5K98B 1QP7A 2HSGA 2JVLA 3L1PA 4X4EA 2GRMA 2R1JL 3BDNA 1IC8A 1JH9A 2BNNA 3H5TA 1WIZA 2LYRA 3KJXA 3SCGA 1OCTC 3BD1A 5A7LA 4PU3C 3ZKCA 3GN5A 4NDWA 1JFSA 2PUDA 2ICPA 2KZ8A 2XSDC 3JXCL 1JWLA 3OQMA 1GT0C 1CJGA 2L49A 3OP9A 1QP4A 1ZPQA 2FJRA 2GZUA 3VK0A 2WIUB 3DNVB 3UFDA 1ZS4A 3B7HA 3OQNA 4Z58A 2HINA 3EUSA 1PERL 2LYPA 2LYKA 4YARA 1ZZ8A 3CECA 2PIJA 3PXPA 1BDHA 2OR1L 4IVZA 1DW9A 3JXBC 2KEKA 2LCVA 2LYSA 2AXUA 2PPXA 3CLCA 2MQKA 4YBAA 4J1XA 2KEIA 2PUAA 3OMTA 3R1FA 3BS3A 3TRBA 3RZZA 4Z5CA 3HZIB 1PRVA 1JFTA 1HF0A 1QPZA 1WETA 2IVQA 2LYQA 3MLFA 2IV1A 4JQDA 4MCXA 4X4GA 3S8QA 1RIOA 1XWRA 1ZZ7A 2AUWA 4GQMA 2PUCA 1AU7A 4I6UA 3F51A 3LFPA 2OFYA 4X4BA 4X4DA 3QYXA 2ICTA 4GHJA 3O9XA 2PUFA 1LCDA 1EFAA 1QQBA 3JXDL 3ZHIA 1ZVVA 1LQCA 4IA8A 4O8BA 1BDIA 1UXCA 1Y7YA 1UTXA 4JCYA 4Z5HA 2PUGA 1SQ8A 2IUOA 4PU8A 1UXDA 1PNRA 4X4CA 1O4XA 2AXVA 2EWTA 2A6CA 1Y9QA 1LCCA 4I8TA 3KXAA 1B0NA 4YG4A 2IU7A 4X4HA 2WUSR 1ZAYA 2CSFA 2KPJA 2LYJA 3F6WA 3FYMA 1RZRA 4PU4C 4Z5DA 2D5VA 2IVBA 1RZRD 1OSLA 1PRAA 3OQOA 2MEZA 3CROL 4MCTA 1RPEL 1DWKA 1X57A 1QQAA 1ZUGA 3FYAA 3F52A 2BJCA 1RZSA 2LYLA 1WH6A 2PE5A 2H8RA 4Z59A 1E3OC 3QQ6A 4IWRA 3QF3A 4F8DA 4J1WA 1LMB3 3LISA 1R63A 2BNOA 3D1NI 3G5GA 1LLIA 2KEJA 1ADRA 4FBIA 2AW6A 2BNMA 2AXZA 2AWIA 1NEQA 2GRLA 3G7DA 1ZZBA 1YSEA 1NERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JCG A;  2EBY A;  3SCH A;  1L1M A;  2B5A A;  1CQT A;  2XCJ A;  1R69 A;  4PU7 A;  2CRO A;  4Y42 A;  3SCF A;  1QP0 A;  4YG1 A;  3GN5 B;  2O49 A;  1WH8 A;  2XIU A;  4I6R A;  2PUE A;  2XJ3 A;  4X4F A;  2EF8 A;  2R63 A;  1PRU A;  3GBF A;  4FN3 A;  4OB4 A;  1ZZC A;  4X4I A;  3U3W A;  2O38 A;  3ZHM A;  1POU A;  4I6T A;  3FMY A;  2L8N A;  2XI8 A;  1ZZ6 A;  3QWG A;  3KZ3 A;  4YG7 B;  2PUB A;  4JCX A;  2O4A A;  1S7E A;  1X2L A;  1VPW A;  3IVP A;  1ZZ9 A;  2IVG A;  5K98 B;  1QP7 A;  2HSG A;  2JVL A;  3L1P A;  4X4E A;  2GRM A;  2R1J L;  3BDN A;  1IC8 A;  1JH9 A;  2BNN A;  3H5T A;  1WIZ A;  2LYR A;  3KJX A;  3SCG A;  1OCT C;  3BD1 A;  5A7L A;  4PU3 C;  3ZKC A;  3GN5 A;  4NDW A;  1JFS A;  2PUD A;  2ICP A;  2KZ8 A;  2XSD C;  3JXC L;  1JWL A;  3OQM A;  1GT0 C;  1CJG A;  2L49 A;  3OP9 A;  1QP4 A;  1ZPQ A;  2FJR A;  2GZU A;  3VK0 A;  2WIU B;  3DNV B;  3UFD A;  1ZS4 A;  3B7H A;  3OQN A;  4Z58 A;  2HIN A;  3EUS A;  1PER L;  2LYP A;  2LYK A;  4YAR A;  1ZZ8 A;  3CEC A;  2PIJ A;  3PXP A;  1BDH A;  2OR1 L;  4IVZ A;  1DW9 A;  3JXB C;  2KEK A;  2LCV A;  2LYS A;  2AXU A;  2PPX A;  3CLC A;  2MQK A;  4YBA A;  4J1X A;  2KEI A;  2PUA A;  3OMT A;  3R1F A;  3BS3 A;  3TRB A;  3RZZ A;  4Z5C A;  3HZI B;  1PRV A;  1JFT A;  1HF0 A;  1QPZ A;  1WET A;  2IVQ A;  2LYQ A;  3MLF A;  2IV1 A;  4JQD A;  4MCX A;  4X4G A;  3S8Q A;  1RIO A;  1XWR A;  1ZZ7 A;  2AUW A;  4GQM A;  2PUC A;  1AU7 A;  4I6U A;  3F51 A;  3LFP A;  2OFY A;  4X4B A;  4X4D A;  3QYX A;  2ICT A;  4GHJ A;  3O9X A;  2PUF A;  1LCD A;  1EFA A;  1QQB A;  3JXD L;  3ZHI A;  1ZVV A;  1LQC A;  4IA8 A;  4O8B A;  1BDI A;  1UXC A;  1Y7Y A;  1UTX A;  4JCY A;  4Z5H A;  2PUG A;  1SQ8 A;  2IUO A;  4PU8 A;  1UXD A;  1PNR A;  4X4C A;  1O4X A;  2AXV A;  2EWT A;  2A6C A;  1Y9Q A;  1LCC A;  4I8T A;  3KXA A;  1B0N A;  4YG4 A;  2IU7 A;  4X4H A;  2WUS R;  1ZAY A;  2CSF A;  2KPJ A;  2LYJ A;  3F6W A;  3FYM A;  1RZR A;  4PU4 C;  4Z5D A;  2D5V A;  2IVB A;  1RZR D;  1OSL A;  1PRA A;  3OQO A;  2MEZ A;  3CRO L;  4MCT A;  1RPE L;  1DWK A;  1X57 A;  1QQA A;  1ZUG A;  3FYA A;  3F52 A;  2BJC A;  1RZS A;  2LYL A;  1WH6 A;  2PE5 A;  2H8R A;  4Z59 A;  1E3O C;  3QQ6 A;  4IWR A;  3QF3 A;  4F8D A;  4J1W A;  1LMB 3;  3LIS A;  1R63 A;  2BNO A;  3D1N I;  3G5G A;  1LLI A;  2KEJ A;  1ADR A;  4FBI A;  2AW6 A;  2BNM A;  2AXZ A;  2AWI A;  1NEQ A;  2GRL A;  3G7D A;  1ZZB A;  1YSE A;  1NER A; 
#chains in the Genus database with same CATH topology
 5DT2 A;  2CRO A;  4YG1 A;  2XJ3 A;  4X4F A;  4FN3 A;  2O38 A;  1POU A;  4I6T A;  2XI8 A;  4JCX A;  3KZ3 A;  3IVP A;  3L1P A;  2GRM A;  3BDN A;  4ER6 A;  5DSX A;  5A7L A;  2HFZ A;  4NDW A;  2PUD A;  4WVL A;  2LNM A;  5JUW A;  3UWP A;  4DE9 A;  1QP4 A;  3UFD A;  2WIU B;  2PXP A;  2HIN A;  4OBM A;  2LYP A;  4EZI A;  2PIJ A;  1BDH A;  2OR1 L;  3VWS A;  2AXU A;  3CLC A;  3M9L A;  4J1X A;  1HF0 A;  1QPZ A;  3HZI B;  1WET A;  2LYQ A;  4JQD A;  4X4G A;  1XWR A;  1ZZ7 A;  2AUW A;  1AU7 A;  3F51 A;  2OFY A;  4X4B A;  4X4D A;  2XXA A;  2ICT A;  2PXB A;  1LCD A;  4ER7 A;  4EQZ A;  4Z5H A;  3GZC A;  2PUG A;  1PNR A;  2LLV A;  2A6C A;  1Y9Q A;  3KL4 A;  4I8T A;  2PXU A;  2LYJ A;  4DE8 A;  4PU4 C;  1QQA A;  3QQ6 A;  3LIS A;  3G5G A;  2AW6 A;  2BNM A;  2AWI A;  1ZZB A;  2XCJ A;  1R69 A;  4Y42 A;  5DTR A;  2O49 A;  4I6R A;  2PXV A;  1PRU A;  1ZZ6 A;  2JQE A;  3QWG A;  4YG7 B;  2PUB A;  1DUL A;  2M4H A;  1X2L A;  3QOW A;  4ER3 A;  3SX0 A;  4X4E A;  1JH9 A;  2BNN A;  3H5T A;  1OCT C;  4PU3 C;  2HCS A;  2KZ8 A;  5DTQ A;  1ZS4 A;  4Z58 A;  4YAR A;  5DRT A;  1ZZ8 A;  3CEC A;  3PE5 A;  1DW9 A;  2LLW A;  4YBA A;  3BS3 A;  3MLF A;  4I6U A;  5GAG i;  2FFH A;  3LQX A;  4GHJ A;  3O9X A;  3G0T A;  1QQB A;  2PXL A;  3ZHI A;  1ZVV A;  1LQC A;  4IA8 A;  1Y7Y A;  4JCY A;  2IUO A;  2HCN A;  2AXV A;  3GZD C;  4X4H A;  2IU7 A;  2KPJ A;  3FYM A;  4Z5D A;  2IVB A;  1RZR D;  3NDB B;  1PRA A;  3OQO A;  2MEZ A;  3CRO L;  2PXD A;  1ZUG A;  3FYA A;  1WH6 A;  1E3O C;  4IWR A;  4ER5 A;  1ADR A;  4FBI A;  2V3C C;  3SR4 A;  3QOX A;  3B7H A;  5GAH i;  1L1M A;  2B5A A;  1CQT A;  4PU7 A;  3OKZ A;  2PXT A;  1WH8 A;  2J7W A;  2XIU A;  3DM5 A;  4OB4 A;  4X4I A;  2J7U A;  3FMY A;  2L8N A;  2VEO A;  4ER0 A;  1ZZ9 A;  2IVG A;  5K98 B;  1QP7 A;  2HSG A;  2JVL A;  2R1J L;  4Q2J A;  1WIZ A;  2LYR A;  3KJX A;  3BD1 A;  3ZKC A;  3GN5 A;  1JFS A;  3JXC L;  1JWL A;  3OQM A;  1GT0 C;  1CJG A;  2L49 A;  1ZPQ A;  2FJR A;  2GZU A;  3VK0 A;  4EK9 A;  2PXE A;  3EUS A;  2YBD A;  3PXP A;  3GZD A;  4IVZ A;  3JXB C;  2LCV A;  2LYS A;  2PPX A;  2KEI A;  3OMT A;  3TRB A;  3RZZ A;  4Z5C A;  2IV1 A;  3S8Q A;  1RIO A;  3TEP A;  2PUF A;  3JXD L;  1BDI A;  4O8B A;  1UTX A;  3A9X A;  5DRY A;  4PU8 A;  1QZX A;  2EWT A;  1LCC A;  3KXA A;  1B0N A;  1ZAY A;  2CSF A;  2PXK A;  4MCT A;  1RPE L;  1DWK A;  1X57 A;  2H8R A;  2PXF A;  4Z59 A;  3QF3 A;  4J1W A;  1LMB 3;  3QFI A;  2PXQ A;  3D1N I;  1LLI A;  3GUU A;  2GRL A;  1NER A;  2JCG A;  2EBY A;  3SCH A;  3NXH A;  3SCF A;  1QP0 A;  3GN5 B;  4HRA A;  2PUE A;  1NW3 A;  2EF8 A;  2R63 A;  3GBF A;  1ZZC A;  3U3W A;  3NRO A;  3ZHM A;  2O4A A;  1S7E A;  1VPW A;  4EKG A;  2MXD A;  1IC8 A;  3SCG A;  2XXP A;  2ICP A;  2XSD C;  3OP9 A;  3DNV B;  2L1P A;  3OQN A;  3A9Z A;  1QB2 A;  1PER L;  2LYK A;  4EKI A;  2KEK A;  5DTM A;  1U2Z A;  2MQK A;  2PUA A;  3R1F A;  3ZPX A;  1JFT A;  1PRV A;  1HQ1 A;  2IVQ A;  4MCX A;  2XXQ A;  4GQM A;  2PUC A;  3LFP A;  3OWQ A;  3MEJ A;  3QYX A;  3TFL A;  1EFA A;  1UXC A;  3R09 A;  1SQ8 A;  3ME5 A;  1UXD A;  4X4C A;  1MFQ C;  4YG4 A;  2WUS R;  3TEL A;  3F6W A;  1RZR A;  2D5V A;  2ODR D;  1OSL A;  3NZL A;  2BJC A;  3F52 A;  1RZS A;  2LYL A;  2PE5 A;  4F8D A;  3A9Y A;  1R63 A;  2BNO A;  2KEJ A;  2AXZ A;  1NEQ A;  3G7D A;  1YSE A;  1O4X A; 
#chains in the Genus database with same CATH homology
 2JCG A;  2EBY A;  3SCH A;  1L1M A;  2B5A A;  1CQT A;  2XCJ A;  1R69 A;  4PU7 A;  2CRO A;  4Y42 A;  3SCF A;  1QP0 A;  4YG1 A;  3GN5 B;  2O49 A;  1WH8 A;  2XIU A;  4I6R A;  2PUE A;  2XJ3 A;  4X4F A;  2EF8 A;  2R63 A;  1PRU A;  3GBF A;  4FN3 A;  4OB4 A;  1ZZC A;  4X4I A;  3U3W A;  2O38 A;  3ZHM A;  1POU A;  4I6T A;  3FMY A;  2L8N A;  2XI8 A;  1ZZ6 A;  3QWG A;  3KZ3 A;  4YG7 B;  2PUB A;  4JCX A;  2O4A A;  1S7E A;  1X2L A;  1VPW A;  3IVP A;  1ZZ9 A;  2IVG A;  5K98 B;  1QP7 A;  2HSG A;  2JVL A;  3L1P A;  4X4E A;  2GRM A;  2R1J L;  3BDN A;  1IC8 A;  1JH9 A;  2BNN A;  3H5T A;  1WIZ A;  2LYR A;  3KJX A;  3SCG A;  1OCT C;  3BD1 A;  5A7L A;  4PU3 C;  3ZKC A;  3GN5 A;  4NDW A;  1JFS A;  2PUD A;  2ICP A;  2KZ8 A;  2XSD C;  3JXC L;  1JWL A;  3OQM A;  1GT0 C;  1CJG A;  2L49 A;  3OP9 A;  1QP4 A;  1ZPQ A;  2FJR A;  2GZU A;  3VK0 A;  2WIU B;  3DNV B;  3UFD A;  1ZS4 A;  3B7H A;  3OQN A;  4Z58 A;  2HIN A;  3EUS A;  1PER L;  2LYP A;  2LYK A;  4YAR A;  1ZZ8 A;  3CEC A;  2PIJ A;  3PXP A;  1BDH A;  2OR1 L;  4IVZ A;  1DW9 A;  3JXB C;  2KEK A;  2LCV A;  2LYS A;  2AXU A;  2PPX A;  3CLC A;  2MQK A;  4YBA A;  4J1X A;  2KEI A;  2PUA A;  3OMT A;  3R1F A;  3BS3 A;  3TRB A;  3RZZ A;  4Z5C A;  3HZI B;  1PRV A;  1JFT A;  1HF0 A;  1QPZ A;  1WET A;  2IVQ A;  2LYQ A;  3MLF A;  2IV1 A;  4JQD A;  4MCX A;  4X4G A;  3S8Q A;  1RIO A;  1XWR A;  1ZZ7 A;  2AUW A;  4GQM A;  2PUC A;  1AU7 A;  4I6U A;  3F51 A;  3LFP A;  2OFY A;  4X4B A;  4X4D A;  3QYX A;  2ICT A;  4GHJ A;  3O9X A;  2PUF A;  1LCD A;  1EFA A;  1QQB A;  3JXD L;  3ZHI A;  1ZVV A;  1LQC A;  4IA8 A;  4O8B A;  1BDI A;  1UXC A;  1Y7Y A;  1UTX A;  4JCY A;  4Z5H A;  2PUG A;  1SQ8 A;  2IUO A;  4PU8 A;  1UXD A;  1PNR A;  4X4C A;  1O4X A;  2AXV A;  2EWT A;  2A6C A;  1Y9Q A;  1LCC A;  4I8T A;  3KXA A;  1B0N A;  4YG4 A;  2IU7 A;  4X4H A;  2WUS R;  1ZAY A;  2CSF A;  2KPJ A;  2LYJ A;  3F6W A;  3FYM A;  1RZR A;  4PU4 C;  4Z5D A;  2D5V A;  2IVB A;  1RZR D;  1OSL A;  1PRA A;  3OQO A;  2MEZ A;  3CRO L;  4MCT A;  1RPE L;  1DWK A;  1X57 A;  1QQA A;  1ZUG A;  3FYA A;  3F52 A;  2BJC A;  1RZS A;  2LYL A;  1WH6 A;  2PE5 A;  2H8R A;  4Z59 A;  1E3O C;  3QQ6 A;  4IWR A;  3QF3 A;  4F8D A;  4J1W A;  1LMB 3;  3LIS A;  1R63 A;  2BNO A;  3D1N I;  3G5G A;  1LLI A;  2KEJ A;  1ADR A;  4FBI A;  2AW6 A;  2BNM A;  2AXZ A;  2AWI A;  1NEQ A;  2GRL A;  3G7D A;  1ZZB A;  1YSE A;  1NER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...