4X4IA

Radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 44.6 mgy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage to nucleoprotein complexes in macromolecular crystallography.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Gene regulation
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4x4iA00
2IVBA 3JXDL 4NDWA 1R69A 1PERL 4I8TA 3SCGA 1PNRA 2BNMA 4YG1A 4Z5HA 1B0NA 3ZHIA 1ZZBA 3L1PA 4IA8A 2PUFA 4X4FA 4YARA 4JCXA 2GRLA 1VPWA 3U3WA 2AW6A 1Y9QA 1ZPQA 2O38A 2PUBA 1ZAYA 4IWRA 3D1NI 1ZUGA 1JH9A 4PU3C 1YSEA 3GN5A 1DW9A 3QQ6A 3QWGA 2KZ8A 3QYXA 1QP7A 4J1WA 3ZKCA 3S8QA 2KEKA 4I6TA 2MQKA 1NEQA 3F6WA 2CROA 4Z59A 1JFTA 3GBFA 5A7LA 1LCDA 2LYJA 3G5GA 4Z5DA 2XIUA 4PU4C 2PUDA 3KZ3A 1ZZ9A 2L8NA 1WH6A 3F51A 4YBAA 1BDHA 2KEIA 1L1MA 2IUOA 3FMYA 2PUAA 4YG4A 2LYRA 3OP9A 4Z5CA 2XSDC 2A6CA 2LCVA 4J1XA 4I6UA 3R1FA 4X4IA 1PRVA 3BDNA 3QF3A 4X4BA 1R63A 3CECA 4MCXA 1QP0A 1HF0A 4X4HA 1ZZ7A 1AU7A 2LYLA 2AWIA 3ZHMA 4X4CA 3FYMA 1QQBA 3BD1A 2FJRA 4Y42A 2R63A 3RZZA 3HZIB 1PRAA 2O49A 2PPXA 3JXBC 1ADRA 2OR1L 1UXCA 2HSGA 2IU7A 1JWLA 2LYKA 1LQCA 4X4EA 2GRMA 3SCHA 1JFSA 2D5VA 4YG7B 2KEJA 1S7EA 4PU7A 2PE5A 1WETA 2BJCA 1QQAA 2JVLA 1LMB3 4X4GA 2PUGA 2XCJA 2IV1A 2WUSR 3KJXA 2AUWA 2GZUA 4FBIA 2L49A 1X2LA 1WIZA 2EF8A 1CJGA 1POUA 3IVPA 4O8BA 4IVZA 1ZS4A 2IVQA 3OQOA 1ZZ8A 3KXAA 1OCTC 5K98B 2PUCA 2XJ3A 3LFPA 3O9XA 2R1JL 1GT0C 1IC8A 3OMTA 2B5AA 2AXZA 3CLCA 3G7DA 1ZZCA 4GQMA 2EBYA 3LISA 1O4XA 2O4AA 4GHJA 1RIOA 4OB4A 2PUEA 3PXPA 1CQTA 2LYQA 1RZRD 4PU8A 1NERA 3MLFA 4I6RA 3OQMA 3JXCL 1E3OC 4JQDA 2AXUA 1Y7YA 2JCGA 2LYPA 3UFDA 1UXDA 3H5TA 1SQ8A 1ZZ6A 2PIJA 4MCTA 2IVGA 2EWTA 3EUSA 2HINA 3TRBA 2BNNA 2AXVA 3CROL 2LYSA 1DWKA 3F52A 4F8DA 1WH8A 3VK0A 1QPZA 2XI8A 2KPJA 1RZRA 1OSLA 2H8RA 2ICPA 3DNVB 1ZVVA 2WIUB 1QP4A 4X4DA 3B7HA 3FYAA 4Z58A 3BS3A 1EFAA 1LCCA 1RPEL 3GN5B 1LLIA 4FN3A 2BNOA 1XWRA 2CSFA 1UTXA 2ICTA 1X57A 2OFYA 2MEZA 4JCYA 3OQNA 1PRUA 1RZSA 1BDIA 3SCFA
chains in the Genus database with same CATH superfamily
3JXDL 3SCGA 3ME5A 4YG1A 3ZHIA 3L1PA 2GRLA 2M4HA 1Y9QA 1ZPQA 2O38A 1ZAYA 4PU3C 3QWGA 2KZ8A 1DULA 1NEQA 2FFHA 2CROA 3NZLA 1LCDA 4PU4C 2PUDA 1ZZ9A 3F51A 1BDHA 2KEIA 2IUOA 4Z5CA 2LCVA 4I6UA 3R1FA 4X4IA 3QOXA 4X4BA 2LYLA 3BD1A 1PRAA 2PPXA 2HSGA 2IU7A 1JWLA 2LYKA 4X4EA 2LLWA 2KEJA 4PU7A 2WUSR 3KJXA 2L49A 3NROA 5DRYA 1ZS4A 2PXPA 4EKGA 3KXAA 3LFPA 2R1JL 2LLVA 3OMTA 2B5AA 3MEJA 2XXPA 3G7DA 5DRTA 4GHJA 3PXPA 1CQTA 4PU8A 1NERA 2J7WA 1E3OC 4ER3A 1UXDA 2IVGA 2EWTA 4OBMA 4F8DA 1WH8A 2XI8A 1OSLA 3B7HA 3TEPA 1LLIA 2BNOA 1XWRA 1UTXA 4JCYA 1PRUA 3M9LA 3TELA 4I8TA 1PNRA 4WVLA 2BNMA 3TFLA 1B0NA 3A9YA 4IA8A 4X4FA 3R09A 3UWPA 4YARA 2LNMA 1VPWA 1JH9A 3A9ZA 4EK9A 5JUWA 3DM5A 3GN5A 4J1WA 3ZKCA 5A7LA 2PXDA 2LYJA 2XIUA 2PXUA 3GZDC 1WH6A 1L1MA 2LYRA 3OP9A 2A6CA 3BDNA 3QF3A 1AU7A 4EZIA 4X4CA 3GZCA 3RZZA 2PXTA 4HRAA 4DE8A 2PXBA 3SCHA 4YG7B 1S7EA 1WETA 2BJCA 2MXDA 1LMB3 4X4GA 2PUGA 2XCJA 2XXQA 2XJ3A 1GT0C 3GUUA 3G0TA 2O4AA 1RIOA 3JXCL 4I6RA 3MLFA 1Y7YA 3H5TA 1SQ8A 3EUSA 3TRBA 2AXVA 2LYSA 1QPZA 2H8RA 2ICPA 5DTMA 1QP4A 2V3CC 3FYAA 4Z58A 1MFQC 3GZDA 3GN5B 4FN3A 2YBDA 3SCFA 3PE5A 1R69A 4Z5HA 1ZZBA 4JCXA 3U3WA 2AW6A 3SR4A 4ER0A 2PUBA 4IWRA 2XXAA 1ZUGA 1YSEA 2HFZA 1DW9A 3QQ6A 4I6TA 2MQKA 3F6WA 4Z59A 3VWSA 3G5GA 4Z5DA 4YBAA 4YG4A 2XSDC 4J1XA 2J7UA 3A9XA 1PRVA 4MCXA 1QP0A 2HCNA 4X4HA 1ZZ7A 4EQZA 3ZHMA 3FYMA 2R63A 3HZIB 2OR1L 4ER6A 2D5VA 4DE9A 1QQAA 1X2LA 1WIZA 2EF8A 5GAGi 1POUA 4IVZA 2IVQA 1OCTC 1ZZ8A 2PUCA 5K98B 3O9XA 2AXZA 4GQMA 1ZZCA 1QB2A 2EBYA 3LISA 1O4XA 3NXHA 1RZRD 3OQMA 3ZPXA 2ODRD 2LYPA 1NW3A 2L1PA 3CROL 2PXKA 2WIUB 3OKZA 3QFIA 1LCCA 1RPEL 2CSFA 2MEZA 5DTQA 2PXVA 1BDIA 5DSXA 4ER7A 2PXFA 2IVBA 4NDWA 1PERL 2PUFA 5GAHi 5DTRA 2PXLA 3D1NI 3QYXA 1QP7A 3S8QA 2KEKA 1JFTA 3GBFA 2JQEA 3KZ3A 2L8NA 3FMYA 2PUAA 2PXEA 1R63A 3CECA 2PXQA 1HF0A 2AWIA 1QQBA 2O49A 2FJRA 4Y42A 3JXBC 1ADRA 1UXCA 4Q2JA 1LQCA 2GRMA 1JFSA 3QOWA 2PE5A 2JVLA 2VEOA 2IV1A 4FBIA 1HQ1A 2AUWA 2GZUA 1CJGA 3IVPA 4O8BA 3OQOA 4EKIA 3KL4A 4ER5A 1IC8A 3CLCA 4OB4A 2PUEA 2LYQA 4JQDA 2AXUA 2JCGA 3SX0A 3UFDA 2PIJA 1ZZ6A 4MCTA 2HINA 2BNNA 1DWKA 3F52A 3VK0A 3NDBB 2KPJA 1U2ZA 1RZRA 3OWQA 2HCSA 3DNVB 1ZVVA 4X4DA 1QZXA 3BS3A 5DT2A 1EFAA 2ICTA 1X57A 2OFYA 3OQNA 1RZSA 3LQXA
chains in the Genus database with same CATH topology
2IVBA 3JXDL 4NDWA 1R69A 1PERL 4I8TA 3SCGA 1PNRA 2BNMA 4YG1A 4Z5HA 1B0NA 3ZHIA 1ZZBA 3L1PA 4IA8A 2PUFA 4X4FA 4YARA 4JCXA 2GRLA 1VPWA 3U3WA 2AW6A 1Y9QA 1ZPQA 2O38A 2PUBA 1ZAYA 4IWRA 3D1NI 1ZUGA 1JH9A 4PU3C 1YSEA 3GN5A 1DW9A 3QQ6A 3QWGA 2KZ8A 3QYXA 1QP7A 4J1WA 3ZKCA 3S8QA 2KEKA 4I6TA 2MQKA 1NEQA 3F6WA 2CROA 4Z59A 1JFTA 3GBFA 5A7LA 1LCDA 2LYJA 3G5GA 4Z5DA 2XIUA 4PU4C 2PUDA 3KZ3A 1ZZ9A 2L8NA 1WH6A 3F51A 4YBAA 1BDHA 2KEIA 1L1MA 2IUOA 3FMYA 2PUAA 4YG4A 2LYRA 3OP9A 4Z5CA 2XSDC 2A6CA 2LCVA 4J1XA 4I6UA 3R1FA 4X4IA 1PRVA 3BDNA 3QF3A 4X4BA 1R63A 3CECA 4MCXA 1QP0A 1HF0A 4X4HA 1ZZ7A 1AU7A 2LYLA 2AWIA 3ZHMA 4X4CA 3FYMA 1QQBA 3BD1A 2FJRA 4Y42A 2R63A 3RZZA 3HZIB 1PRAA 2O49A 2PPXA 3JXBC 1ADRA 2OR1L 1UXCA 2HSGA 2IU7A 1JWLA 2LYKA 1LQCA 4X4EA 2GRMA 3SCHA 1JFSA 2D5VA 4YG7B 2KEJA 1S7EA 4PU7A 2PE5A 1WETA 2BJCA 1QQAA 2JVLA 1LMB3 4X4GA 2PUGA 2XCJA 2IV1A 2WUSR 3KJXA 2AUWA 2GZUA 4FBIA 2L49A 1X2LA 1WIZA 2EF8A 1CJGA 1POUA 3IVPA 4O8BA 4IVZA 1ZS4A 2IVQA 3OQOA 1ZZ8A 3KXAA 1OCTC 5K98B 2PUCA 2XJ3A 3LFPA 3O9XA 2R1JL 1GT0C 1IC8A 3OMTA 2B5AA 2AXZA 3CLCA 3G7DA 1ZZCA 4GQMA 2EBYA 3LISA 1O4XA 2O4AA 4GHJA 1RIOA 4OB4A 2PUEA 3PXPA 1CQTA 2LYQA 1RZRD 4PU8A 1NERA 3MLFA 4I6RA 3OQMA 3JXCL 1E3OC 4JQDA 2AXUA 1Y7YA 2JCGA 2LYPA 3UFDA 1UXDA 3H5TA 1SQ8A 1ZZ6A 2PIJA 4MCTA 2IVGA 2EWTA 3EUSA 2HINA 3TRBA 2BNNA 2AXVA 3CROL 2LYSA 1DWKA 3F52A 4F8DA 1WH8A 3VK0A 1QPZA 2XI8A 2KPJA 1RZRA 1OSLA 2H8RA 2ICPA 3DNVB 1ZVVA 2WIUB 1QP4A 4X4DA 3B7HA 3FYAA 4Z58A 3BS3A 1EFAA 1LCCA 1RPEL 3GN5B 1LLIA 4FN3A 2BNOA 1XWRA 2CSFA 1UTXA 2ICTA 1X57A 2OFYA 2MEZA 4JCYA 3OQNA 1PRUA 1RZSA 1BDIA 3SCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVB A;  3JXD L;  4NDW A;  1R69 A;  1PER L;  4I8T A;  3SCG A;  1PNR A;  2BNM A;  4YG1 A;  4Z5H A;  1B0N A;  3ZHI A;  1ZZB A;  3L1P A;  4IA8 A;  2PUF A;  4X4F A;  4YAR A;  4JCX A;  2GRL A;  1VPW A;  3U3W A;  2AW6 A;  1Y9Q A;  1ZPQ A;  2O38 A;  2PUB A;  1ZAY A;  4IWR A;  3D1N I;  1ZUG A;  1JH9 A;  4PU3 C;  1YSE A;  3GN5 A;  1DW9 A;  3QQ6 A;  3QWG A;  2KZ8 A;  3QYX A;  1QP7 A;  4J1W A;  3ZKC A;  3S8Q A;  2KEK A;  4I6T A;  2MQK A;  1NEQ A;  3F6W A;  2CRO A;  4Z59 A;  1JFT A;  3GBF A;  5A7L A;  1LCD A;  2LYJ A;  3G5G A;  4Z5D A;  2XIU A;  4PU4 C;  2PUD A;  3KZ3 A;  1ZZ9 A;  2L8N A;  1WH6 A;  3F51 A;  4YBA A;  1BDH A;  2KEI A;  1L1M A;  2IUO A;  3FMY A;  2PUA A;  4YG4 A;  2LYR A;  3OP9 A;  4Z5C A;  2XSD C;  2A6C A;  2LCV A;  4J1X A;  4I6U A;  3R1F A;  4X4I A;  1PRV A;  3BDN A;  3QF3 A;  4X4B A;  1R63 A;  3CEC A;  4MCX A;  1QP0 A;  1HF0 A;  4X4H A;  1ZZ7 A;  1AU7 A;  2LYL A;  2AWI A;  3ZHM A;  4X4C A;  3FYM A;  1QQB A;  3BD1 A;  2FJR A;  4Y42 A;  2R63 A;  3RZZ A;  3HZI B;  1PRA A;  2O49 A;  2PPX A;  3JXB C;  1ADR A;  2OR1 L;  1UXC A;  2HSG A;  2IU7 A;  1JWL A;  2LYK A;  1LQC A;  4X4E A;  2GRM A;  3SCH A;  1JFS A;  2D5V A;  4YG7 B;  2KEJ A;  1S7E A;  4PU7 A;  2PE5 A;  1WET A;  2BJC A;  1QQA A;  2JVL A;  1LMB 3;  4X4G A;  2PUG A;  2XCJ A;  2IV1 A;  2WUS R;  3KJX A;  2AUW A;  2GZU A;  4FBI A;  2L49 A;  1X2L A;  1WIZ A;  2EF8 A;  1CJG A;  1POU A;  3IVP A;  4O8B A;  4IVZ A;  1ZS4 A;  2IVQ A;  3OQO A;  1ZZ8 A;  3KXA A;  1OCT C;  5K98 B;  2PUC A;  2XJ3 A;  3LFP A;  3O9X A;  2R1J L;  1GT0 C;  1IC8 A;  3OMT A;  2B5A A;  2AXZ A;  3CLC A;  3G7D A;  1ZZC A;  4GQM A;  2EBY A;  3LIS A;  1O4X A;  2O4A A;  4GHJ A;  1RIO A;  4OB4 A;  2PUE A;  3PXP A;  1CQT A;  2LYQ A;  1RZR D;  4PU8 A;  1NER A;  3MLF A;  4I6R A;  3OQM A;  3JXC L;  1E3O C;  4JQD A;  2AXU A;  1Y7Y A;  2JCG A;  2LYP A;  3UFD A;  1UXD A;  3H5T A;  1SQ8 A;  1ZZ6 A;  2PIJ A;  4MCT A;  2IVG A;  2EWT A;  3EUS A;  2HIN A;  3TRB A;  2BNN A;  2AXV A;  3CRO L;  2LYS A;  1DWK A;  3F52 A;  4F8D A;  1WH8 A;  3VK0 A;  1QPZ A;  2XI8 A;  2KPJ A;  1RZR A;  1OSL A;  2H8R A;  2ICP A;  3DNV B;  1ZVV A;  2WIU B;  1QP4 A;  4X4D A;  3B7H A;  3FYA A;  4Z58 A;  3BS3 A;  1EFA A;  1LCC A;  1RPE L;  3GN5 B;  1LLI A;  4FN3 A;  2BNO A;  1XWR A;  2CSF A;  1UTX A;  2ICT A;  1X57 A;  2OFY A;  2MEZ A;  4JCY A;  3OQN A;  1PRU A;  1RZS A;  1BDI A;  3SCF A; 
#chains in the Genus database with same CATH topology
 3JXD L;  3SCG A;  3ME5 A;  4YG1 A;  3ZHI A;  3L1P A;  2GRL A;  2M4H A;  1Y9Q A;  1ZPQ A;  2O38 A;  1ZAY A;  4PU3 C;  3QWG A;  2KZ8 A;  1DUL A;  1NEQ A;  2FFH A;  2CRO A;  3NZL A;  1LCD A;  4PU4 C;  2PUD A;  1ZZ9 A;  3F51 A;  1BDH A;  2KEI A;  2IUO A;  4Z5C A;  2LCV A;  4I6U A;  3R1F A;  4X4I A;  3QOX A;  4X4B A;  2LYL A;  3BD1 A;  1PRA A;  2PPX A;  2HSG A;  2IU7 A;  1JWL A;  2LYK A;  4X4E A;  2LLW A;  2KEJ A;  4PU7 A;  2WUS R;  3KJX A;  2L49 A;  3NRO A;  5DRY A;  1ZS4 A;  2PXP A;  4EKG A;  3KXA A;  3LFP A;  2R1J L;  2LLV A;  3OMT A;  2B5A A;  3MEJ A;  2XXP A;  3G7D A;  5DRT A;  4GHJ A;  3PXP A;  1CQT A;  4PU8 A;  1NER A;  2J7W A;  1E3O C;  4ER3 A;  1UXD A;  2IVG A;  2EWT A;  4OBM A;  4F8D A;  1WH8 A;  2XI8 A;  1OSL A;  3B7H A;  3TEP A;  1LLI A;  2BNO A;  1XWR A;  1UTX A;  4JCY A;  1PRU A;  3M9L A;  3TEL A;  4I8T A;  1PNR A;  4WVL A;  2BNM A;  3TFL A;  1B0N A;  3A9Y A;  4IA8 A;  4X4F A;  3R09 A;  3UWP A;  4YAR A;  2LNM A;  1VPW A;  1JH9 A;  3A9Z A;  4EK9 A;  5JUW A;  3DM5 A;  3GN5 A;  4J1W A;  3ZKC A;  5A7L A;  2PXD A;  2LYJ A;  2XIU A;  2PXU A;  3GZD C;  1WH6 A;  1L1M A;  2LYR A;  3OP9 A;  2A6C A;  3BDN A;  3QF3 A;  1AU7 A;  4EZI A;  4X4C A;  3GZC A;  3RZZ A;  2PXT A;  4HRA A;  4DE8 A;  2PXB A;  3SCH A;  4YG7 B;  1S7E A;  1WET A;  2BJC A;  2MXD A;  1LMB 3;  4X4G A;  2PUG A;  2XCJ A;  2XXQ A;  2XJ3 A;  1GT0 C;  3GUU A;  3G0T A;  2O4A A;  1RIO A;  3JXC L;  4I6R A;  3MLF A;  1Y7Y A;  3H5T A;  1SQ8 A;  3EUS A;  3TRB A;  2AXV A;  2LYS A;  1QPZ A;  2H8R A;  2ICP A;  5DTM A;  1QP4 A;  2V3C C;  3FYA A;  4Z58 A;  1MFQ C;  3GZD A;  3GN5 B;  4FN3 A;  2YBD A;  3SCF A;  3PE5 A;  1R69 A;  4Z5H A;  1ZZB A;  4JCX A;  3U3W A;  2AW6 A;  3SR4 A;  4ER0 A;  2PUB A;  4IWR A;  2XXA A;  1ZUG A;  1YSE A;  2HFZ A;  1DW9 A;  3QQ6 A;  4I6T A;  2MQK A;  3F6W A;  4Z59 A;  3VWS A;  3G5G A;  4Z5D A;  4YBA A;  4YG4 A;  2XSD C;  4J1X A;  2J7U A;  3A9X A;  1PRV A;  4MCX A;  1QP0 A;  2HCN A;  4X4H A;  1ZZ7 A;  4EQZ A;  3ZHM A;  3FYM A;  2R63 A;  3HZI B;  2OR1 L;  4ER6 A;  2D5V A;  4DE9 A;  1QQA A;  1X2L A;  1WIZ A;  2EF8 A;  5GAG i;  1POU A;  4IVZ A;  2IVQ A;  1OCT C;  1ZZ8 A;  2PUC A;  5K98 B;  3O9X A;  2AXZ A;  4GQM A;  1ZZC A;  1QB2 A;  2EBY A;  3LIS A;  1O4X A;  3NXH A;  1RZR D;  3OQM A;  3ZPX A;  2ODR D;  2LYP A;  1NW3 A;  2L1P A;  3CRO L;  2PXK A;  2WIU B;  3OKZ A;  3QFI A;  1LCC A;  1RPE L;  2CSF A;  2MEZ A;  5DTQ A;  2PXV A;  1BDI A;  5DSX A;  4ER7 A;  2PXF A;  2IVB A;  4NDW A;  1PER L;  2PUF A;  5GAH i;  5DTR A;  2PXL A;  3D1N I;  3QYX A;  1QP7 A;  3S8Q A;  2KEK A;  1JFT A;  3GBF A;  2JQE A;  3KZ3 A;  2L8N A;  3FMY A;  2PUA A;  2PXE A;  1R63 A;  3CEC A;  2PXQ A;  1HF0 A;  2AWI A;  1QQB A;  2O49 A;  2FJR A;  4Y42 A;  3JXB C;  1ADR A;  1UXC A;  4Q2J A;  1LQC A;  2GRM A;  1JFS A;  3QOW A;  2PE5 A;  2JVL A;  2VEO A;  2IV1 A;  4FBI A;  1HQ1 A;  2AUW A;  2GZU A;  1CJG A;  3IVP A;  4O8B A;  3OQO A;  4EKI A;  3KL4 A;  4ER5 A;  1IC8 A;  3CLC A;  4OB4 A;  2PUE A;  2LYQ A;  4JQD A;  2AXU A;  2JCG A;  3SX0 A;  3UFD A;  2PIJ A;  1ZZ6 A;  4MCT A;  2HIN A;  2BNN A;  1DWK A;  3F52 A;  3VK0 A;  3NDB B;  2KPJ A;  1U2Z A;  1RZR A;  3OWQ A;  2HCS A;  3DNV B;  1ZVV A;  4X4D A;  1QZX A;  3BS3 A;  5DT2 A;  1EFA A;  2ICT A;  1X57 A;  2OFY A;  3OQN A;  1RZS A;  3LQX A; 
#chains in the Genus database with same CATH homology
 2IVB A;  3JXD L;  4NDW A;  1R69 A;  1PER L;  4I8T A;  3SCG A;  1PNR A;  2BNM A;  4YG1 A;  4Z5H A;  1B0N A;  3ZHI A;  1ZZB A;  3L1P A;  4IA8 A;  2PUF A;  4X4F A;  4YAR A;  4JCX A;  2GRL A;  1VPW A;  3U3W A;  2AW6 A;  1Y9Q A;  1ZPQ A;  2O38 A;  2PUB A;  1ZAY A;  4IWR A;  3D1N I;  1ZUG A;  1JH9 A;  4PU3 C;  1YSE A;  3GN5 A;  1DW9 A;  3QQ6 A;  3QWG A;  2KZ8 A;  3QYX A;  1QP7 A;  4J1W A;  3ZKC A;  3S8Q A;  2KEK A;  4I6T A;  2MQK A;  1NEQ A;  3F6W A;  2CRO A;  4Z59 A;  1JFT A;  3GBF A;  5A7L A;  1LCD A;  2LYJ A;  3G5G A;  4Z5D A;  2XIU A;  4PU4 C;  2PUD A;  3KZ3 A;  1ZZ9 A;  2L8N A;  1WH6 A;  3F51 A;  4YBA A;  1BDH A;  2KEI A;  1L1M A;  2IUO A;  3FMY A;  2PUA A;  4YG4 A;  2LYR A;  3OP9 A;  4Z5C A;  2XSD C;  2A6C A;  2LCV A;  4J1X A;  4I6U A;  3R1F A;  4X4I A;  1PRV A;  3BDN A;  3QF3 A;  4X4B A;  1R63 A;  3CEC A;  4MCX A;  1QP0 A;  1HF0 A;  4X4H A;  1ZZ7 A;  1AU7 A;  2LYL A;  2AWI A;  3ZHM A;  4X4C A;  3FYM A;  1QQB A;  3BD1 A;  2FJR A;  4Y42 A;  2R63 A;  3RZZ A;  3HZI B;  1PRA A;  2O49 A;  2PPX A;  3JXB C;  1ADR A;  2OR1 L;  1UXC A;  2HSG A;  2IU7 A;  1JWL A;  2LYK A;  1LQC A;  4X4E A;  2GRM A;  3SCH A;  1JFS A;  2D5V A;  4YG7 B;  2KEJ A;  1S7E A;  4PU7 A;  2PE5 A;  1WET A;  2BJC A;  1QQA A;  2JVL A;  1LMB 3;  4X4G A;  2PUG A;  2XCJ A;  2IV1 A;  2WUS R;  3KJX A;  2AUW A;  2GZU A;  4FBI A;  2L49 A;  1X2L A;  1WIZ A;  2EF8 A;  1CJG A;  1POU A;  3IVP A;  4O8B A;  4IVZ A;  1ZS4 A;  2IVQ A;  3OQO A;  1ZZ8 A;  3KXA A;  1OCT C;  5K98 B;  2PUC A;  2XJ3 A;  3LFP A;  3O9X A;  2R1J L;  1GT0 C;  1IC8 A;  3OMT A;  2B5A A;  2AXZ A;  3CLC A;  3G7D A;  1ZZC A;  4GQM A;  2EBY A;  3LIS A;  1O4X A;  2O4A A;  4GHJ A;  1RIO A;  4OB4 A;  2PUE A;  3PXP A;  1CQT A;  2LYQ A;  1RZR D;  4PU8 A;  1NER A;  3MLF A;  4I6R A;  3OQM A;  3JXC L;  1E3O C;  4JQD A;  2AXU A;  1Y7Y A;  2JCG A;  2LYP A;  3UFD A;  1UXD A;  3H5T A;  1SQ8 A;  1ZZ6 A;  2PIJ A;  4MCT A;  2IVG A;  2EWT A;  3EUS A;  2HIN A;  3TRB A;  2BNN A;  2AXV A;  3CRO L;  2LYS A;  1DWK A;  3F52 A;  4F8D A;  1WH8 A;  3VK0 A;  1QPZ A;  2XI8 A;  2KPJ A;  1RZR A;  1OSL A;  2H8R A;  2ICP A;  3DNV B;  1ZVV A;  2WIU B;  1QP4 A;  4X4D A;  3B7H A;  3FYA A;  4Z58 A;  3BS3 A;  1EFA A;  1LCC A;  1RPE L;  3GN5 B;  1LLI A;  4FN3 A;  2BNO A;  1XWR A;  2CSF A;  1UTX A;  2ICT A;  1X57 A;  2OFY A;  2MEZ A;  4JCY A;  3OQN A;  1PRU A;  1RZS A;  1BDI A;  3SCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...