4X4IA

Radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 44.6 mgy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage to nucleoprotein complexes in macromolecular crystallography.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Gene regulation
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4x4iA00
1EFAA 1CQTA 3FMYA 1UXCA 2CROA 2KPJA 2PIJA 1LCCA 2H8RA 2AUWA 2MEZA 1XWRA 2AXVA 2LYKA 1QP0A 3OQOA 3SCGA 2XIUA 1UTXA 2FJRA 2HSGA 4I6RA 2PUCA 2O49A 2PPXA 2O4AA 3ZKCA 1R69A 2KZ8A 3KZ3A 4I6TA 1JWLA 1X2LA 1X57A 2IVGA 4J1WA 2HINA 3QWGA 4NDWA 4YG7B 1ZZ8A 4X4DA 4YARA 1Y9QA 1BDHA 3UFDA 2CSFA 2KEKA 4Y42A 4YBAA 3BDNA 3GBFA 2A6CA 1ZVVA 2MQKA 2GRLA 2LYQA 1OCTC 1RZSA 2GRMA 1Y7YA 1POUA 4FBIA 1JFTA 2EWTA 2B5AA 3QYXA 1WIZA 1RIOA 2AXZA 1B0NA 1PRVA 1RZRD 2PUBA 3CLCA 4YG4A 1O4XA 2L8NA 1PRUA 2LYJA 3G7DA 1R63A 4J1XA 2IUOA 3VK0A 2AWIA 3RZZA 4X4HA 3KXAA 3BS3A 1HF0A 3IVPA 3OQMA 2KEJA 4JQDA 4MCTA 5A7LA 2WIUB 4JCYA 1NEQA 4PU8A 1ZS4A 1LLIA 2LYRA 4X4EA 1ZZ7A 1PNRA 1E3OC 1QP7A 1DW9A 4PU4C 4O8BA 4F8DA 2XSDC 3OQNA 2PUAA 3QQ6A 2PE5A 3ZHMA 2BNMA 3L1PA 2PUEA 3S8QA 3H5TA 1S7EA 1ZZ6A 2KEIA 1QP4A 4X4IA 4GQMA 1WH6A 1RZRA 4Z5DA 5K98B 2IV1A 4Z5CA 1QQAA 3EUSA 2LYPA 4Z5HA 4OB4A 3JXDL 2GZUA 4X4GA 2OFYA 4I6UA 1JH9A 2AXUA 1IC8A 3SCFA 2AW6A 1PERL 2JVLA 4Z58A 1OSLA 3OMTA 2EF8A 3F52A 3R1FA 2IVQA 2LCVA 3B7HA 4IA8A 3JXCL 1DWKA 2BNNA 3PXPA 2R1JL 1AU7A 3OP9A 4Z59A 1ADRA 1QQBA 1PRAA 4X4CA 3O9XA 3HZIB 3F6WA 2XI8A 3LFPA 2EBYA 4MCXA 2LYLA 3JXBC 1CJGA 4I8TA 1GT0C 4JCXA 2XCJA 3GN5B 4X4BA 1ZZ9A 1LCDA 1YSEA 1ZPQA 1NERA 2R63A 1JFSA 1BDIA 1QPZA 2OR1L 2PUGA 2D5VA 2WUSR 1SQ8A 2IVBA 3ZHIA 1L1MA 2LYSA 1ZUGA 3FYAA 2O38A 1ZZBA 2L49A 3LISA 2BJCA 2PUDA 3MLFA 3U3WA 4IWRA 2ICPA 2IU7A 1WH8A 2ICTA 3F51A 3QF3A 3KJXA 4YG1A 1ZAYA 2PUFA 4PU7A 2BNOA 3BD1A 3TRBA 1LMB3 3CROL 1RPEL 3G5GA 4X4FA 3DNVB 1WETA 4FN3A 3CECA 3GN5A 1UXDA 3D1NI 4IVZA 2XJ3A 4GHJA 3SCHA 2JCGA 1LQCA 1VPWA 1ZZCA 3FYMA 4PU3C
chains in the Genus database with same CATH superfamily
3FMYA 4HRAA 1LCCA 2AUWA 2MEZA 1XWRA 2AXVA 2FJRA 4I6RA 2PPXA 2HFZA 1R69A 1JWLA 2VEOA 1X57A 4J1WA 4YG7B 4YARA 4EKGA 1BDHA 2CSFA 4YBAA 3GBFA 2A6CA 2GRLA 5DTRA 1RIOA 1RZRD 3OWQA 4YG4A 2LYJA 1R63A 1QZXA 2IUOA 5JUWA 2J7WA 5GAHi 4JQDA 4MCTA 5A7LA 1ZS4A 2PXEA 1E3OC 1DULA 2PXTA 2XSDC 3OQNA 3QQ6A 2PUEA 5DTMA 4GQMA 1WH6A 4Z5CA 1QQAA 3JXDL 3QOXA 1IC8A 2AW6A 1PERL 1OSLA 3SR4A 2PXDA 3B7HA 4IA8A 1DWKA 1AU7A 1QQBA 4X4CA 3ZPXA 2XI8A 2LYLA 4I8TA 2XCJA 3GN5B 1ZZ9A 1QB2A 1JFSA 3VWSA 3R09A 1L1MA 1ZUGA 3GZDA 2LNMA 3U3WA 4IWRA 2IU7A 3F51A 1WH8A 3QF3A 4DE9A 3TRBA 3G5GA 3UWPA 3GUUA 1VPWA 1ZVVA 1DW9A 3NDBB 1EFAA 2CROA 2H8RA 2LYKA 3SCGA 2O4AA 3KZ3A 4I6TA 2FFHA 4DE8A 2HINA 3QWGA 4NDWA 4X4DA 2KEKA 3NZLA 2LYQA 1OCTC 1RZSA 2GRMA 1Y7YA 1POUA 2J7UA 1WIZA 3QOWA 1B0NA 4ER0A 1PRUA 3G7DA 3RZZA 4X4HA 2XXQA 3BS3A 1HF0A 4EKIA 4PU8A 3SX0A 1QP7A 4O8BA 3A9YA 2PE5A 3S8QA 2ODRD 3H5TA 5DSXA 2KEIA 1QP4A 1RZRA 4Z5DA 2V3CC 2LYPA 4Z5HA 4OB4A 4X4GA 2AXUA 3ME5A 3NROA 4Z58A 2IVQA 2LCVA 2BNNA 3PXPA 3OP9A 1U2ZA 1PRAA 3O9XA 3QFIA 3LFPA 2YBDA 3TEPA 1YSEA 1ZPQA 1QPZA 3LQXA 3M9LA 3ZHIA 3FYAA 2BJCA 2PUDA 4ER6A 2ICTA 3KJXA 5GAGi 3TELA 1LMB3 3CROL 1RPEL 4X4FA 1WETA 4ER5A 3GN5A 1UXDA 4GHJA 2JCGA 1CQTA 2PXBA 2PIJA 2KPJA 3DM5A 3A9XA 2XIUA 1UTXA 2O49A 2HCSA 2PUCA 3ZKCA 2KZ8A 2XXPA 2IVGA 3MEJA 3UFDA 4Y42A 2MQKA 3GZCA 3GZDC 4FBIA 1JFTA 4EK9A 2B5AA 3QYXA 3CLCA 1O4XA 2L8NA 4J1XA 3VK0A 2AWIA 3A9ZA 3IVPA 2WIUB 4JCYA 1NEQA 1MFQC 1LLIA 2LYRA 4X4EA 2L1PA 4F8DA 2PUAA 1ZZ6A 2PXQA 2IV1A 5DTQA 2GZUA 2OFYA 3SCFA 2JVLA 3OMTA 3F52A 4EQZA 3JXCL 3PE5A 2PXKA 1ADRA 3HZIB 3F6WA 4MCXA 1CJGA 1GT0C 4X4BA 1LCDA 2R63A 2OR1L 2D5VA 2IVBA 1HQ1A 2LYSA 2O38A 3MLFA 4YG1A 1ZAYA 2PUFA 1NW3A 3BD1A 2HCNA 4FN3A 2PXFA 3CECA 2XJ3A 3SCHA 1ZZCA 3FYMA 4PU3C 1UXCA 1QP0A 3OQOA 2HSGA 2XXAA 1X2LA 2M4HA 2PXPA 4Q2JA 5DRYA 2PXLA 1ZZ8A 2PXVA 1Y9QA 3TFLA 3BDNA 2MXDA 2EWTA 2AXZA 4ER3A 1PRVA 2PUBA 3OKZA 5DT2A 4OBMA 2JQEA 3KXAA 3OQMA 2KEJA 5DRTA 1ZZ7A 1PNRA 4PU4C 3ZHMA 2BNMA 3L1PA 1S7EA 4X4IA 5K98B 3G0TA 3EUSA 2PXUA 3NXHA 1JH9A 4I6UA 2EF8A 3R1FA 2R1JL 4Z59A 2EBYA 3JXBC 4JCXA 1NERA 1BDIA 2PUGA 2WUSR 2LLWA 1SQ8A 4WVLA 1ZZBA 2L49A 3LISA 2ICPA 4PU7A 2BNOA 3KL4A 4EZIA 3DNVB 2LLVA 3D1NI 4IVZA 1LQCA 4ER7A
chains in the Genus database with same CATH topology
1EFAA 1CQTA 3FMYA 1UXCA 2CROA 2KPJA 2PIJA 1LCCA 2H8RA 2AUWA 2MEZA 1XWRA 2AXVA 2LYKA 1QP0A 3OQOA 3SCGA 2XIUA 1UTXA 2FJRA 2HSGA 4I6RA 2PUCA 2O49A 2PPXA 2O4AA 3ZKCA 1R69A 2KZ8A 3KZ3A 4I6TA 1JWLA 1X2LA 1X57A 2IVGA 4J1WA 2HINA 3QWGA 4NDWA 4YG7B 1ZZ8A 4X4DA 4YARA 1Y9QA 1BDHA 3UFDA 2CSFA 2KEKA 4Y42A 4YBAA 3BDNA 3GBFA 2A6CA 1ZVVA 2MQKA 2GRLA 2LYQA 1OCTC 1RZSA 2GRMA 1Y7YA 1POUA 4FBIA 1JFTA 2EWTA 2B5AA 3QYXA 1WIZA 1RIOA 2AXZA 1B0NA 1PRVA 1RZRD 2PUBA 3CLCA 4YG4A 1O4XA 2L8NA 1PRUA 2LYJA 3G7DA 1R63A 4J1XA 2IUOA 3VK0A 2AWIA 3RZZA 4X4HA 3KXAA 3BS3A 1HF0A 3IVPA 3OQMA 2KEJA 4JQDA 4MCTA 5A7LA 2WIUB 4JCYA 1NEQA 4PU8A 1ZS4A 1LLIA 2LYRA 4X4EA 1ZZ7A 1PNRA 1E3OC 1QP7A 1DW9A 4PU4C 4O8BA 4F8DA 2XSDC 3OQNA 2PUAA 3QQ6A 2PE5A 3ZHMA 2BNMA 3L1PA 2PUEA 3S8QA 3H5TA 1S7EA 1ZZ6A 2KEIA 1QP4A 4X4IA 4GQMA 1WH6A 1RZRA 4Z5DA 5K98B 2IV1A 4Z5CA 1QQAA 3EUSA 2LYPA 4Z5HA 4OB4A 3JXDL 2GZUA 4X4GA 2OFYA 4I6UA 1JH9A 2AXUA 1IC8A 3SCFA 2AW6A 1PERL 2JVLA 4Z58A 1OSLA 3OMTA 2EF8A 3F52A 3R1FA 2IVQA 2LCVA 3B7HA 4IA8A 3JXCL 1DWKA 2BNNA 3PXPA 2R1JL 1AU7A 3OP9A 4Z59A 1ADRA 1QQBA 1PRAA 4X4CA 3O9XA 3HZIB 3F6WA 2XI8A 3LFPA 2EBYA 4MCXA 2LYLA 3JXBC 1CJGA 4I8TA 1GT0C 4JCXA 2XCJA 3GN5B 4X4BA 1ZZ9A 1LCDA 1YSEA 1ZPQA 1NERA 2R63A 1JFSA 1BDIA 1QPZA 2OR1L 2PUGA 2D5VA 2WUSR 1SQ8A 2IVBA 3ZHIA 1L1MA 2LYSA 1ZUGA 3FYAA 2O38A 1ZZBA 2L49A 3LISA 2BJCA 2PUDA 3MLFA 3U3WA 4IWRA 2ICPA 2IU7A 1WH8A 2ICTA 3F51A 3QF3A 3KJXA 4YG1A 1ZAYA 2PUFA 4PU7A 2BNOA 3BD1A 3TRBA 1LMB3 3CROL 1RPEL 3G5GA 4X4FA 3DNVB 1WETA 4FN3A 3CECA 3GN5A 1UXDA 3D1NI 4IVZA 2XJ3A 4GHJA 3SCHA 2JCGA 1LQCA 1VPWA 1ZZCA 3FYMA 4PU3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFA A;  1CQT A;  3FMY A;  1UXC A;  2CRO A;  2KPJ A;  2PIJ A;  1LCC A;  2H8R A;  2AUW A;  2MEZ A;  1XWR A;  2AXV A;  2LYK A;  1QP0 A;  3OQO A;  3SCG A;  2XIU A;  1UTX A;  2FJR A;  2HSG A;  4I6R A;  2PUC A;  2O49 A;  2PPX A;  2O4A A;  3ZKC A;  1R69 A;  2KZ8 A;  3KZ3 A;  4I6T A;  1JWL A;  1X2L A;  1X57 A;  2IVG A;  4J1W A;  2HIN A;  3QWG A;  4NDW A;  4YG7 B;  1ZZ8 A;  4X4D A;  4YAR A;  1Y9Q A;  1BDH A;  3UFD A;  2CSF A;  2KEK A;  4Y42 A;  4YBA A;  3BDN A;  3GBF A;  2A6C A;  1ZVV A;  2MQK A;  2GRL A;  2LYQ A;  1OCT C;  1RZS A;  2GRM A;  1Y7Y A;  1POU A;  4FBI A;  1JFT A;  2EWT A;  2B5A A;  3QYX A;  1WIZ A;  1RIO A;  2AXZ A;  1B0N A;  1PRV A;  1RZR D;  2PUB A;  3CLC A;  4YG4 A;  1O4X A;  2L8N A;  1PRU A;  2LYJ A;  3G7D A;  1R63 A;  4J1X A;  2IUO A;  3VK0 A;  2AWI A;  3RZZ A;  4X4H A;  3KXA A;  3BS3 A;  1HF0 A;  3IVP A;  3OQM A;  2KEJ A;  4JQD A;  4MCT A;  5A7L A;  2WIU B;  4JCY A;  1NEQ A;  4PU8 A;  1ZS4 A;  1LLI A;  2LYR A;  4X4E A;  1ZZ7 A;  1PNR A;  1E3O C;  1QP7 A;  1DW9 A;  4PU4 C;  4O8B A;  4F8D A;  2XSD C;  3OQN A;  2PUA A;  3QQ6 A;  2PE5 A;  3ZHM A;  2BNM A;  3L1P A;  2PUE A;  3S8Q A;  3H5T A;  1S7E A;  1ZZ6 A;  2KEI A;  1QP4 A;  4X4I A;  4GQM A;  1WH6 A;  1RZR A;  4Z5D A;  5K98 B;  2IV1 A;  4Z5C A;  1QQA A;  3EUS A;  2LYP A;  4Z5H A;  4OB4 A;  3JXD L;  2GZU A;  4X4G A;  2OFY A;  4I6U A;  1JH9 A;  2AXU A;  1IC8 A;  3SCF A;  2AW6 A;  1PER L;  2JVL A;  4Z58 A;  1OSL A;  3OMT A;  2EF8 A;  3F52 A;  3R1F A;  2IVQ A;  2LCV A;  3B7H A;  4IA8 A;  3JXC L;  1DWK A;  2BNN A;  3PXP A;  2R1J L;  1AU7 A;  3OP9 A;  4Z59 A;  1ADR A;  1QQB A;  1PRA A;  4X4C A;  3O9X A;  3HZI B;  3F6W A;  2XI8 A;  3LFP A;  2EBY A;  4MCX A;  2LYL A;  3JXB C;  1CJG A;  4I8T A;  1GT0 C;  4JCX A;  2XCJ A;  3GN5 B;  4X4B A;  1ZZ9 A;  1LCD A;  1YSE A;  1ZPQ A;  1NER A;  2R63 A;  1JFS A;  1BDI A;  1QPZ A;  2OR1 L;  2PUG A;  2D5V A;  2WUS R;  1SQ8 A;  2IVB A;  3ZHI A;  1L1M A;  2LYS A;  1ZUG A;  3FYA A;  2O38 A;  1ZZB A;  2L49 A;  3LIS A;  2BJC A;  2PUD A;  3MLF A;  3U3W A;  4IWR A;  2ICP A;  2IU7 A;  1WH8 A;  2ICT A;  3F51 A;  3QF3 A;  3KJX A;  4YG1 A;  1ZAY A;  2PUF A;  4PU7 A;  2BNO A;  3BD1 A;  3TRB A;  1LMB 3;  3CRO L;  1RPE L;  3G5G A;  4X4F A;  3DNV B;  1WET A;  4FN3 A;  3CEC A;  3GN5 A;  1UXD A;  3D1N I;  4IVZ A;  2XJ3 A;  4GHJ A;  3SCH A;  2JCG A;  1LQC A;  1VPW A;  1ZZC A;  3FYM A;  4PU3 C; 
#chains in the Genus database with same CATH topology
 3FMY A;  4HRA A;  1LCC A;  2AUW A;  2MEZ A;  1XWR A;  2AXV A;  2FJR A;  4I6R A;  2PPX A;  2HFZ A;  1R69 A;  1JWL A;  2VEO A;  1X57 A;  4J1W A;  4YG7 B;  4YAR A;  4EKG A;  1BDH A;  2CSF A;  4YBA A;  3GBF A;  2A6C A;  2GRL A;  5DTR A;  1RIO A;  1RZR D;  3OWQ A;  4YG4 A;  2LYJ A;  1R63 A;  1QZX A;  2IUO A;  5JUW A;  2J7W A;  5GAH i;  4JQD A;  4MCT A;  5A7L A;  1ZS4 A;  2PXE A;  1E3O C;  1DUL A;  2PXT A;  2XSD C;  3OQN A;  3QQ6 A;  2PUE A;  5DTM A;  4GQM A;  1WH6 A;  4Z5C A;  1QQA A;  3JXD L;  3QOX A;  1IC8 A;  2AW6 A;  1PER L;  1OSL A;  3SR4 A;  2PXD A;  3B7H A;  4IA8 A;  1DWK A;  1AU7 A;  1QQB A;  4X4C A;  3ZPX A;  2XI8 A;  2LYL A;  4I8T A;  2XCJ A;  3GN5 B;  1ZZ9 A;  1QB2 A;  1JFS A;  3VWS A;  3R09 A;  1L1M A;  1ZUG A;  3GZD A;  2LNM A;  3U3W A;  4IWR A;  2IU7 A;  3F51 A;  1WH8 A;  3QF3 A;  4DE9 A;  3TRB A;  3G5G A;  3UWP A;  3GUU A;  1VPW A;  1ZVV A;  1DW9 A;  3NDB B;  1EFA A;  2CRO A;  2H8R A;  2LYK A;  3SCG A;  2O4A A;  3KZ3 A;  4I6T A;  2FFH A;  4DE8 A;  2HIN A;  3QWG A;  4NDW A;  4X4D A;  2KEK A;  3NZL A;  2LYQ A;  1OCT C;  1RZS A;  2GRM A;  1Y7Y A;  1POU A;  2J7U A;  1WIZ A;  3QOW A;  1B0N A;  4ER0 A;  1PRU A;  3G7D A;  3RZZ A;  4X4H A;  2XXQ A;  3BS3 A;  1HF0 A;  4EKI A;  4PU8 A;  3SX0 A;  1QP7 A;  4O8B A;  3A9Y A;  2PE5 A;  3S8Q A;  2ODR D;  3H5T A;  5DSX A;  2KEI A;  1QP4 A;  1RZR A;  4Z5D A;  2V3C C;  2LYP A;  4Z5H A;  4OB4 A;  4X4G A;  2AXU A;  3ME5 A;  3NRO A;  4Z58 A;  2IVQ A;  2LCV A;  2BNN A;  3PXP A;  3OP9 A;  1U2Z A;  1PRA A;  3O9X A;  3QFI A;  3LFP A;  2YBD A;  3TEP A;  1YSE A;  1ZPQ A;  1QPZ A;  3LQX A;  3M9L A;  3ZHI A;  3FYA A;  2BJC A;  2PUD A;  4ER6 A;  2ICT A;  3KJX A;  5GAG i;  3TEL A;  1LMB 3;  3CRO L;  1RPE L;  4X4F A;  1WET A;  4ER5 A;  3GN5 A;  1UXD A;  4GHJ A;  2JCG A;  1CQT A;  2PXB A;  2PIJ A;  2KPJ A;  3DM5 A;  3A9X A;  2XIU A;  1UTX A;  2O49 A;  2HCS A;  2PUC A;  3ZKC A;  2KZ8 A;  2XXP A;  2IVG A;  3MEJ A;  3UFD A;  4Y42 A;  2MQK A;  3GZC A;  3GZD C;  4FBI A;  1JFT A;  4EK9 A;  2B5A A;  3QYX A;  3CLC A;  1O4X A;  2L8N A;  4J1X A;  3VK0 A;  2AWI A;  3A9Z A;  3IVP A;  2WIU B;  4JCY A;  1NEQ A;  1MFQ C;  1LLI A;  2LYR A;  4X4E A;  2L1P A;  4F8D A;  2PUA A;  1ZZ6 A;  2PXQ A;  2IV1 A;  5DTQ A;  2GZU A;  2OFY A;  3SCF A;  2JVL A;  3OMT A;  3F52 A;  4EQZ A;  3JXC L;  3PE5 A;  2PXK A;  1ADR A;  3HZI B;  3F6W A;  4MCX A;  1CJG A;  1GT0 C;  4X4B A;  1LCD A;  2R63 A;  2OR1 L;  2D5V A;  2IVB A;  1HQ1 A;  2LYS A;  2O38 A;  3MLF A;  4YG1 A;  1ZAY A;  2PUF A;  1NW3 A;  3BD1 A;  2HCN A;  4FN3 A;  2PXF A;  3CEC A;  2XJ3 A;  3SCH A;  1ZZC A;  3FYM A;  4PU3 C;  1UXC A;  1QP0 A;  3OQO A;  2HSG A;  2XXA A;  1X2L A;  2M4H A;  2PXP A;  4Q2J A;  5DRY A;  2PXL A;  1ZZ8 A;  2PXV A;  1Y9Q A;  3TFL A;  3BDN A;  2MXD A;  2EWT A;  2AXZ A;  4ER3 A;  1PRV A;  2PUB A;  3OKZ A;  5DT2 A;  4OBM A;  2JQE A;  3KXA A;  3OQM A;  2KEJ A;  5DRT A;  1ZZ7 A;  1PNR A;  4PU4 C;  3ZHM A;  2BNM A;  3L1P A;  1S7E A;  4X4I A;  5K98 B;  3G0T A;  3EUS A;  2PXU A;  3NXH A;  1JH9 A;  4I6U A;  2EF8 A;  3R1F A;  2R1J L;  4Z59 A;  2EBY A;  3JXB C;  4JCX A;  1NER A;  1BDI A;  2PUG A;  2WUS R;  2LLW A;  1SQ8 A;  4WVL A;  1ZZB A;  2L49 A;  3LIS A;  2ICP A;  4PU7 A;  2BNO A;  3KL4 A;  4EZI A;  3DNV B;  2LLV A;  3D1N I;  4IVZ A;  1LQC A;  4ER7 A; 
#chains in the Genus database with same CATH homology
 1EFA A;  1CQT A;  3FMY A;  1UXC A;  2CRO A;  2KPJ A;  2PIJ A;  1LCC A;  2H8R A;  2AUW A;  2MEZ A;  1XWR A;  2AXV A;  2LYK A;  1QP0 A;  3OQO A;  3SCG A;  2XIU A;  1UTX A;  2FJR A;  2HSG A;  4I6R A;  2PUC A;  2O49 A;  2PPX A;  2O4A A;  3ZKC A;  1R69 A;  2KZ8 A;  3KZ3 A;  4I6T A;  1JWL A;  1X2L A;  1X57 A;  2IVG A;  4J1W A;  2HIN A;  3QWG A;  4NDW A;  4YG7 B;  1ZZ8 A;  4X4D A;  4YAR A;  1Y9Q A;  1BDH A;  3UFD A;  2CSF A;  2KEK A;  4Y42 A;  4YBA A;  3BDN A;  3GBF A;  2A6C A;  1ZVV A;  2MQK A;  2GRL A;  2LYQ A;  1OCT C;  1RZS A;  2GRM A;  1Y7Y A;  1POU A;  4FBI A;  1JFT A;  2EWT A;  2B5A A;  3QYX A;  1WIZ A;  1RIO A;  2AXZ A;  1B0N A;  1PRV A;  1RZR D;  2PUB A;  3CLC A;  4YG4 A;  1O4X A;  2L8N A;  1PRU A;  2LYJ A;  3G7D A;  1R63 A;  4J1X A;  2IUO A;  3VK0 A;  2AWI A;  3RZZ A;  4X4H A;  3KXA A;  3BS3 A;  1HF0 A;  3IVP A;  3OQM A;  2KEJ A;  4JQD A;  4MCT A;  5A7L A;  2WIU B;  4JCY A;  1NEQ A;  4PU8 A;  1ZS4 A;  1LLI A;  2LYR A;  4X4E A;  1ZZ7 A;  1PNR A;  1E3O C;  1QP7 A;  1DW9 A;  4PU4 C;  4O8B A;  4F8D A;  2XSD C;  3OQN A;  2PUA A;  3QQ6 A;  2PE5 A;  3ZHM A;  2BNM A;  3L1P A;  2PUE A;  3S8Q A;  3H5T A;  1S7E A;  1ZZ6 A;  2KEI A;  1QP4 A;  4X4I A;  4GQM A;  1WH6 A;  1RZR A;  4Z5D A;  5K98 B;  2IV1 A;  4Z5C A;  1QQA A;  3EUS A;  2LYP A;  4Z5H A;  4OB4 A;  3JXD L;  2GZU A;  4X4G A;  2OFY A;  4I6U A;  1JH9 A;  2AXU A;  1IC8 A;  3SCF A;  2AW6 A;  1PER L;  2JVL A;  4Z58 A;  1OSL A;  3OMT A;  2EF8 A;  3F52 A;  3R1F A;  2IVQ A;  2LCV A;  3B7H A;  4IA8 A;  3JXC L;  1DWK A;  2BNN A;  3PXP A;  2R1J L;  1AU7 A;  3OP9 A;  4Z59 A;  1ADR A;  1QQB A;  1PRA A;  4X4C A;  3O9X A;  3HZI B;  3F6W A;  2XI8 A;  3LFP A;  2EBY A;  4MCX A;  2LYL A;  3JXB C;  1CJG A;  4I8T A;  1GT0 C;  4JCX A;  2XCJ A;  3GN5 B;  4X4B A;  1ZZ9 A;  1LCD A;  1YSE A;  1ZPQ A;  1NER A;  2R63 A;  1JFS A;  1BDI A;  1QPZ A;  2OR1 L;  2PUG A;  2D5V A;  2WUS R;  1SQ8 A;  2IVB A;  3ZHI A;  1L1M A;  2LYS A;  1ZUG A;  3FYA A;  2O38 A;  1ZZB A;  2L49 A;  3LIS A;  2BJC A;  2PUD A;  3MLF A;  3U3W A;  4IWR A;  2ICP A;  2IU7 A;  1WH8 A;  2ICT A;  3F51 A;  3QF3 A;  3KJX A;  4YG1 A;  1ZAY A;  2PUF A;  4PU7 A;  2BNO A;  3BD1 A;  3TRB A;  1LMB 3;  3CRO L;  1RPE L;  3G5G A;  4X4F A;  3DNV B;  1WET A;  4FN3 A;  3CEC A;  3GN5 A;  1UXD A;  3D1N I;  4IVZ A;  2XJ3 A;  4GHJ A;  3SCH A;  2JCG A;  1LQC A;  1VPW A;  1ZZC A;  3FYM A;  4PU3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...