2LCVA

Structure of the cytidine repressor dna-binding domain; an alternate calculation
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
47
structure length
47
Chain Sequence
AATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional repressor CytR
publication title Multiple Conformations of the Cytidine Repressor DNA-Binding Domain Coalesce to One upon Recognition of a Specific DNA Surface.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 9
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lcvA00
1WH6A 1IC8A 1VPWA 1WIZA 2KPJA 4YG7B 1RZRD 3F52A 3QQ6A 2IVBA 3QWGA 4JCYA 2EBYA 1EFAA 1PNRA 2O49A 1ZZ9A 3PXPA 1LCDA 3OQMA 3CLCA 2PUAA 3LISA 4I8TA 4IVZA 4PU3C 2PUBA 2IV1A 3FYMA 3QF3A 4J1WA 1PRVA 2WIUB 2MQKA 1BDHA 1QQAA 1RZSA 2JVLA 2LYPA 4X4GA 4X4IA 2EWTA 1NERA 4PU4C 2O4AA 4GHJA 4PU7A 1B0NA 3GN5A 1UXCA 2BNOA 2LYRA 3KJXA 4Y42A 3TRBA 3JXDL 3ZKCA 2GRLA 3EUSA 2AW6A 3LFPA 4Z5DA 1JFSA 4IA8A 1OCTC 2KEKA 1ZAYA 1Y9QA 3ZHIA 1R63A 3CROL 2IVGA 1HF0A 4I6TA 3BDNA 1X2LA 2AXZA 3F6WA 3H5TA 1GT0C 4F8DA 4I6UA 1ZUGA 4OB4A 1QP4A 2AWIA 3OMTA 2B5AA 3KZ3A 3G7DA 2XSDC 2FJRA 2L49A 2O38A 2XI8A 4X4FA 3OP9A 1L1MA 1JH9A 4Z5HA 3MLFA 4FN3A 2PUFA 1BDIA 3JXCL 4Z58A 4X4HA 3G5GA 2LYJA 3KXAA 3VK0A 3JXBC 2PE5A 1JFTA 5A7LA 4O8BA 3SCHA 3O9XA 2AXUA 2BNNA 4Z5CA 1LMB3 3D1NI 2JCGA 4YBAA 2AUWA 3RZZA 3BS3A 3SCGA 3FMYA 4JQDA 4X4DA 1RIOA 1AU7A 1ADRA 2R63A 1R69A 3DNVB 1PERL 1CQTA 2PUEA 3SCFA 2KEJA 2LCVA 3OQOA 2CROA 2PUDA 1WH8A 3GN5B 1O4XA 2PUGA 2GRMA 1ZZ6A 1ZZBA 2LYKA 4X4BA 1PRUA 2XCJA 3BD1A 2OR1L 1PRAA 1WETA 2A6CA 2CSFA 2BJCA 3HZIB 2PPXA 3ZHMA 1LQCA 4GQMA 2H8RA 2ICTA 4NDWA 4MCTA 2IUOA 4MCXA 2LYSA 1UXDA 2IU7A 1X57A 2KEIA 1ZZ8A 2LYQA 4PU8A 1ZS4A 4JCXA 2MEZA 1CJGA 1LLIA 4J1XA 4FBIA 1POUA 1RZRA 2EF8A 2KZ8A 2D5VA 3UFDA 1XWRA 1ZVVA 1NEQA 2OFYA 3IVPA 4X4EA 2R1JL 3CECA 3B7HA 4YG4A 2HSGA 2IVQA 2BNMA 1S7EA 5K98B 4YG1A 3GBFA 1DW9A 1YSEA 2ICPA 2PIJA 4I6RA 4X4CA 3U3WA 1RPEL 1QPZA 3F51A 1OSLA 4YARA 1Y7YA 1DWKA 3L1PA 3OQNA 2GZUA 1QQBA 4IWRA 3QYXA 2LYLA 1QP7A 2AXVA 1ZZ7A 1LCCA 1QP0A 2WUSR 2L8NA 3S8QA 1JWLA 1SQ8A 2XIUA 2HINA 3R1FA 1ZZCA 4Z59A 2XJ3A 2PUCA 1E3OC 1ZPQA 3FYAA 1UTXA
chains in the Genus database with same CATH superfamily
3F52A 3QQ6A 3QWGA 2XXPA 2EBYA 1ZZ9A 2PUAA 2PUBA 1QQAA 3GZDA 4PU7A 1UXCA 3KJXA 3VWSA 3EUSA 2PXPA 2KEKA 1ZAYA 2J7UA 2PXDA 4I6TA 3GUUA 1ZUGA 2B5AA 2XSDC 2L49A 4X4FA 1L1MA 1HQ1A 3DM5A 4ER3A 4Z58A 3R09A 3O9XA 3RZZA 2HFZA 3FMYA 2PUEA 2KEJA 2LCVA 2CROA 2PUDA 4X4BA 4EKGA 2XCJA 2OR1L 3ZPXA 3TELA 3ZHMA 2XXAA 4EKIA 2LYSA 3SX0A 1LLIA 1RZRA 2H8RA 2KZ8A 3UFDA 5GAGi 3CECA 3B7HA 4YG4A 2BNMA 4EK9A 1ADRA 2PIJA 1QPZA 1OSLA 4YARA 2M4HA 2GZUA 4IWRA 2LYLA 2AXVA 2L8NA 4ER6A 1JWLA 5DRYA 3MEJA 4Z59A 1E3OC 1PRUA 3FYAA 1UTXA 3GZDC 1WIZA 2KPJA 1RZRD 2IVBA 4JCYA 3LISA 4IVZA 3FYMA 3QF3A 3ME5A 1PRVA 3SR4A 4X4GA 4PU4C 2O4AA 4GHJA 3TRBA 2GRLA 4HRAA 2PXVA 4OBMA 1QB2A 3ZHIA 2LLWA 3BDNA 1X2LA 3NROA 4EQZA 4OB4A 3QOXA 1JH9A 3OP9A 3KXAA 3VK0A 1JFTA 5A7LA 1LMB3 2LNMA 3SCGA 2LLVA 1PERL 1CQTA 5DTMA 2PUGA 1ZZ6A 1ZZBA 4WVLA 2PXQA 2PXTA 1WETA 1X57A 1ZZ8A 2LYQA 1ZS4A 4JCXA 1MFQC 4FBIA 1POUA 2D5VA 1XWRA 2OFYA 3KL4A 2HSGA 1S7EA 1Y7YA 1QQBA 3QYXA 1QP7A 1LCCA 2HINA 1WH6A 1VPWA 4YG7B 1EFAA 1LCDA 3OQMA 2IV1A 4J1WA 2LYPA 2EWTA 1NERA 4EZIA 3TFLA 3QFIA 3ZKCA 2LYRA 4Y42A 3OWQA 4ER5A 2AW6A 1JFSA 4DE8A 3CROL 1GT0C 3GZCA 4F8DA 2JQEA 4I6UA 2PXFA 2AWIA 1U2ZA 3KZ3A 2PXEA 2O38A 2XI8A 2PXUA 3G0TA 4Z5HA 4FN3A 1BDIA 3JXCL 4X4HA 3G5GA 2LYJA 3JXBC 4O8BA 2AXUA 2AUWA 5JUWA 4JQDA 1RIOA 3QOWA 3DNVB 3NZLA 3OQOA 2HCNA 1WH8A 3GN5B 4ER0A 3UWPA 1O4XA 2LYKA 1PRAA 2A6CA 3HZIB 2PPXA 2VEOA 4GQMA 3LQXA 2ICTA 4NDWA 4MCTA 4MCXA 4Q2JA 2KEIA 1NW3A 2MEZA 4J1XA 2PXBA 2R1JL 4YG1A 5K98B 3GBFA 1YSEA 2ICPA 4I6RA 4X4CA 1RPEL 3F51A 1QZXA 3A9XA 2PXLA 3L1PA 3OQNA 1ZZ7A 1QP0A 3S8QA 2ODRD 2XIUA 3R1FA 1ZZCA 2XJ3A 1ZPQA 2V3CC 1IC8A 2XXQA 1PNRA 2O49A 3PXPA 3CLCA 2PXKA 4I8TA 4PU3C 1BDHA 2WIUB 2MQKA 1RZSA 2JVLA 5DRTA 4X4IA 2J7WA 1B0NA 3GN5A 2BNOA 4DE9A 3JXDL 4Z5DA 3LFPA 5GAHi 4IA8A 1OCTC 1Y9QA 2FFHA 1R63A 2IVGA 1HF0A 5DTRA 2AXZA 3F6WA 3H5TA 5DT2A 4ER7A 1QP4A 3OMTA 2HCSA 3G7DA 2FJRA 3MLFA 2PUFA 2PE5A 3SCHA 3NXHA 2BNNA 4Z5CA 3D1NI 2JCGA 4YBAA 5DSXA 3BS3A 5DTQA 4X4DA 1AU7A 2R63A 1R69A 3SCFA 2GRMA 3BD1A 2CSFA 2BJCA 3A9YA 3TEPA 1LQCA 1DULA 2IUOA 1UXDA 3OKZA 2MXDA 2L1PA 2IU7A 2YBDA 4PU8A 3A9ZA 1CJGA 2EF8A 1ZVVA 1NEQA 3IVPA 4X4EA 2IVQA 3PE5A 1DW9A 3U3WA 3NDBB 1DWKA 2WUSR 3M9LA 1SQ8A 2PUCA
chains in the Genus database with same CATH topology
1WH6A 1IC8A 1VPWA 1WIZA 2KPJA 4YG7B 1RZRD 3F52A 3QQ6A 2IVBA 3QWGA 4JCYA 2EBYA 1EFAA 1PNRA 2O49A 1ZZ9A 3PXPA 1LCDA 3OQMA 3CLCA 2PUAA 3LISA 4I8TA 4IVZA 4PU3C 2PUBA 2IV1A 3FYMA 3QF3A 4J1WA 1PRVA 2WIUB 2MQKA 1BDHA 1QQAA 1RZSA 2JVLA 2LYPA 4X4GA 4X4IA 2EWTA 1NERA 4PU4C 2O4AA 4GHJA 4PU7A 1B0NA 3GN5A 1UXCA 2BNOA 2LYRA 3KJXA 4Y42A 3TRBA 3JXDL 3ZKCA 2GRLA 3EUSA 2AW6A 3LFPA 4Z5DA 1JFSA 4IA8A 1OCTC 2KEKA 1ZAYA 1Y9QA 3ZHIA 1R63A 3CROL 2IVGA 1HF0A 4I6TA 3BDNA 1X2LA 2AXZA 3F6WA 3H5TA 1GT0C 4F8DA 4I6UA 1ZUGA 4OB4A 1QP4A 2AWIA 3OMTA 2B5AA 3KZ3A 3G7DA 2XSDC 2FJRA 2L49A 2O38A 2XI8A 4X4FA 3OP9A 1L1MA 1JH9A 4Z5HA 3MLFA 4FN3A 2PUFA 1BDIA 3JXCL 4Z58A 4X4HA 3G5GA 2LYJA 3KXAA 3VK0A 3JXBC 2PE5A 1JFTA 5A7LA 4O8BA 3SCHA 3O9XA 2AXUA 2BNNA 4Z5CA 1LMB3 3D1NI 2JCGA 4YBAA 2AUWA 3RZZA 3BS3A 3SCGA 3FMYA 4JQDA 4X4DA 1RIOA 1AU7A 1ADRA 2R63A 1R69A 3DNVB 1PERL 1CQTA 2PUEA 3SCFA 2KEJA 2LCVA 3OQOA 2CROA 2PUDA 1WH8A 3GN5B 1O4XA 2PUGA 2GRMA 1ZZ6A 1ZZBA 2LYKA 4X4BA 1PRUA 2XCJA 3BD1A 2OR1L 1PRAA 1WETA 2A6CA 2CSFA 2BJCA 3HZIB 2PPXA 3ZHMA 1LQCA 4GQMA 2H8RA 2ICTA 4NDWA 4MCTA 2IUOA 4MCXA 2LYSA 1UXDA 2IU7A 1X57A 2KEIA 1ZZ8A 2LYQA 4PU8A 1ZS4A 4JCXA 2MEZA 1CJGA 1LLIA 4J1XA 4FBIA 1POUA 1RZRA 2EF8A 2KZ8A 2D5VA 3UFDA 1XWRA 1ZVVA 1NEQA 2OFYA 3IVPA 4X4EA 2R1JL 3CECA 3B7HA 4YG4A 2HSGA 2IVQA 2BNMA 1S7EA 5K98B 4YG1A 3GBFA 1DW9A 1YSEA 2ICPA 2PIJA 4I6RA 4X4CA 3U3WA 1RPEL 1QPZA 3F51A 1OSLA 4YARA 1Y7YA 1DWKA 3L1PA 3OQNA 2GZUA 1QQBA 4IWRA 3QYXA 2LYLA 1QP7A 2AXVA 1ZZ7A 1LCCA 1QP0A 2WUSR 2L8NA 3S8QA 1JWLA 1SQ8A 2XIUA 2HINA 3R1FA 1ZZCA 4Z59A 2XJ3A 2PUCA 1E3OC 1ZPQA 3FYAA 1UTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH6 A;  1IC8 A;  1VPW A;  1WIZ A;  2KPJ A;  4YG7 B;  1RZR D;  3F52 A;  3QQ6 A;  2IVB A;  3QWG A;  4JCY A;  2EBY A;  1EFA A;  1PNR A;  2O49 A;  1ZZ9 A;  3PXP A;  1LCD A;  3OQM A;  3CLC A;  2PUA A;  3LIS A;  4I8T A;  4IVZ A;  4PU3 C;  2PUB A;  2IV1 A;  3FYM A;  3QF3 A;  4J1W A;  1PRV A;  2WIU B;  2MQK A;  1BDH A;  1QQA A;  1RZS A;  2JVL A;  2LYP A;  4X4G A;  4X4I A;  2EWT A;  1NER A;  4PU4 C;  2O4A A;  4GHJ A;  4PU7 A;  1B0N A;  3GN5 A;  1UXC A;  2BNO A;  2LYR A;  3KJX A;  4Y42 A;  3TRB A;  3JXD L;  3ZKC A;  2GRL A;  3EUS A;  2AW6 A;  3LFP A;  4Z5D A;  1JFS A;  4IA8 A;  1OCT C;  2KEK A;  1ZAY A;  1Y9Q A;  3ZHI A;  1R63 A;  3CRO L;  2IVG A;  1HF0 A;  4I6T A;  3BDN A;  1X2L A;  2AXZ A;  3F6W A;  3H5T A;  1GT0 C;  4F8D A;  4I6U A;  1ZUG A;  4OB4 A;  1QP4 A;  2AWI A;  3OMT A;  2B5A A;  3KZ3 A;  3G7D A;  2XSD C;  2FJR A;  2L49 A;  2O38 A;  2XI8 A;  4X4F A;  3OP9 A;  1L1M A;  1JH9 A;  4Z5H A;  3MLF A;  4FN3 A;  2PUF A;  1BDI A;  3JXC L;  4Z58 A;  4X4H A;  3G5G A;  2LYJ A;  3KXA A;  3VK0 A;  3JXB C;  2PE5 A;  1JFT A;  5A7L A;  4O8B A;  3SCH A;  3O9X A;  2AXU A;  2BNN A;  4Z5C A;  1LMB 3;  3D1N I;  2JCG A;  4YBA A;  2AUW A;  3RZZ A;  3BS3 A;  3SCG A;  3FMY A;  4JQD A;  4X4D A;  1RIO A;  1AU7 A;  1ADR A;  2R63 A;  1R69 A;  3DNV B;  1PER L;  1CQT A;  2PUE A;  3SCF A;  2KEJ A;  2LCV A;  3OQO A;  2CRO A;  2PUD A;  1WH8 A;  3GN5 B;  1O4X A;  2PUG A;  2GRM A;  1ZZ6 A;  1ZZB A;  2LYK A;  4X4B A;  1PRU A;  2XCJ A;  3BD1 A;  2OR1 L;  1PRA A;  1WET A;  2A6C A;  2CSF A;  2BJC A;  3HZI B;  2PPX A;  3ZHM A;  1LQC A;  4GQM A;  2H8R A;  2ICT A;  4NDW A;  4MCT A;  2IUO A;  4MCX A;  2LYS A;  1UXD A;  2IU7 A;  1X57 A;  2KEI A;  1ZZ8 A;  2LYQ A;  4PU8 A;  1ZS4 A;  4JCX A;  2MEZ A;  1CJG A;  1LLI A;  4J1X A;  4FBI A;  1POU A;  1RZR A;  2EF8 A;  2KZ8 A;  2D5V A;  3UFD A;  1XWR A;  1ZVV A;  1NEQ A;  2OFY A;  3IVP A;  4X4E A;  2R1J L;  3CEC A;  3B7H A;  4YG4 A;  2HSG A;  2IVQ A;  2BNM A;  1S7E A;  5K98 B;  4YG1 A;  3GBF A;  1DW9 A;  1YSE A;  2ICP A;  2PIJ A;  4I6R A;  4X4C A;  3U3W A;  1RPE L;  1QPZ A;  3F51 A;  1OSL A;  4YAR A;  1Y7Y A;  1DWK A;  3L1P A;  3OQN A;  2GZU A;  1QQB A;  4IWR A;  3QYX A;  2LYL A;  1QP7 A;  2AXV A;  1ZZ7 A;  1LCC A;  1QP0 A;  2WUS R;  2L8N A;  3S8Q A;  1JWL A;  1SQ8 A;  2XIU A;  2HIN A;  3R1F A;  1ZZC A;  4Z59 A;  2XJ3 A;  2PUC A;  1E3O C;  1ZPQ A;  3FYA A;  1UTX A; 
#chains in the Genus database with same CATH topology
 3F52 A;  3QQ6 A;  3QWG A;  2XXP A;  2EBY A;  1ZZ9 A;  2PUA A;  2PUB A;  1QQA A;  3GZD A;  4PU7 A;  1UXC A;  3KJX A;  3VWS A;  3EUS A;  2PXP A;  2KEK A;  1ZAY A;  2J7U A;  2PXD A;  4I6T A;  3GUU A;  1ZUG A;  2B5A A;  2XSD C;  2L49 A;  4X4F A;  1L1M A;  1HQ1 A;  3DM5 A;  4ER3 A;  4Z58 A;  3R09 A;  3O9X A;  3RZZ A;  2HFZ A;  3FMY A;  2PUE A;  2KEJ A;  2LCV A;  2CRO A;  2PUD A;  4X4B A;  4EKG A;  2XCJ A;  2OR1 L;  3ZPX A;  3TEL A;  3ZHM A;  2XXA A;  4EKI A;  2LYS A;  3SX0 A;  1LLI A;  1RZR A;  2H8R A;  2KZ8 A;  3UFD A;  5GAG i;  3CEC A;  3B7H A;  4YG4 A;  2BNM A;  4EK9 A;  1ADR A;  2PIJ A;  1QPZ A;  1OSL A;  4YAR A;  2M4H A;  2GZU A;  4IWR A;  2LYL A;  2AXV A;  2L8N A;  4ER6 A;  1JWL A;  5DRY A;  3MEJ A;  4Z59 A;  1E3O C;  1PRU A;  3FYA A;  1UTX A;  3GZD C;  1WIZ A;  2KPJ A;  1RZR D;  2IVB A;  4JCY A;  3LIS A;  4IVZ A;  3FYM A;  3QF3 A;  3ME5 A;  1PRV A;  3SR4 A;  4X4G A;  4PU4 C;  2O4A A;  4GHJ A;  3TRB A;  2GRL A;  4HRA A;  2PXV A;  4OBM A;  1QB2 A;  3ZHI A;  2LLW A;  3BDN A;  1X2L A;  3NRO A;  4EQZ A;  4OB4 A;  3QOX A;  1JH9 A;  3OP9 A;  3KXA A;  3VK0 A;  1JFT A;  5A7L A;  1LMB 3;  2LNM A;  3SCG A;  2LLV A;  1PER L;  1CQT A;  5DTM A;  2PUG A;  1ZZ6 A;  1ZZB A;  4WVL A;  2PXQ A;  2PXT A;  1WET A;  1X57 A;  1ZZ8 A;  2LYQ A;  1ZS4 A;  4JCX A;  1MFQ C;  4FBI A;  1POU A;  2D5V A;  1XWR A;  2OFY A;  3KL4 A;  2HSG A;  1S7E A;  1Y7Y A;  1QQB A;  3QYX A;  1QP7 A;  1LCC A;  2HIN A;  1WH6 A;  1VPW A;  4YG7 B;  1EFA A;  1LCD A;  3OQM A;  2IV1 A;  4J1W A;  2LYP A;  2EWT A;  1NER A;  4EZI A;  3TFL A;  3QFI A;  3ZKC A;  2LYR A;  4Y42 A;  3OWQ A;  4ER5 A;  2AW6 A;  1JFS A;  4DE8 A;  3CRO L;  1GT0 C;  3GZC A;  4F8D A;  2JQE A;  4I6U A;  2PXF A;  2AWI A;  1U2Z A;  3KZ3 A;  2PXE A;  2O38 A;  2XI8 A;  2PXU A;  3G0T A;  4Z5H A;  4FN3 A;  1BDI A;  3JXC L;  4X4H A;  3G5G A;  2LYJ A;  3JXB C;  4O8B A;  2AXU A;  2AUW A;  5JUW A;  4JQD A;  1RIO A;  3QOW A;  3DNV B;  3NZL A;  3OQO A;  2HCN A;  1WH8 A;  3GN5 B;  4ER0 A;  3UWP A;  1O4X A;  2LYK A;  1PRA A;  2A6C A;  3HZI B;  2PPX A;  2VEO A;  4GQM A;  3LQX A;  2ICT A;  4NDW A;  4MCT A;  4MCX A;  4Q2J A;  2KEI A;  1NW3 A;  2MEZ A;  4J1X A;  2PXB A;  2R1J L;  4YG1 A;  5K98 B;  3GBF A;  1YSE A;  2ICP A;  4I6R A;  4X4C A;  1RPE L;  3F51 A;  1QZX A;  3A9X A;  2PXL A;  3L1P A;  3OQN A;  1ZZ7 A;  1QP0 A;  3S8Q A;  2ODR D;  2XIU A;  3R1F A;  1ZZC A;  2XJ3 A;  1ZPQ A;  2V3C C;  1IC8 A;  2XXQ A;  1PNR A;  2O49 A;  3PXP A;  3CLC A;  2PXK A;  4I8T A;  4PU3 C;  1BDH A;  2WIU B;  2MQK A;  1RZS A;  2JVL A;  5DRT A;  4X4I A;  2J7W A;  1B0N A;  3GN5 A;  2BNO A;  4DE9 A;  3JXD L;  4Z5D A;  3LFP A;  5GAH i;  4IA8 A;  1OCT C;  1Y9Q A;  2FFH A;  1R63 A;  2IVG A;  1HF0 A;  5DTR A;  2AXZ A;  3F6W A;  3H5T A;  5DT2 A;  4ER7 A;  1QP4 A;  3OMT A;  2HCS A;  3G7D A;  2FJR A;  3MLF A;  2PUF A;  2PE5 A;  3SCH A;  3NXH A;  2BNN A;  4Z5C A;  3D1N I;  2JCG A;  4YBA A;  5DSX A;  3BS3 A;  5DTQ A;  4X4D A;  1AU7 A;  2R63 A;  1R69 A;  3SCF A;  2GRM A;  3BD1 A;  2CSF A;  2BJC A;  3A9Y A;  3TEP A;  1LQC A;  1DUL A;  2IUO A;  1UXD A;  3OKZ A;  2MXD A;  2L1P A;  2IU7 A;  2YBD A;  4PU8 A;  3A9Z A;  1CJG A;  2EF8 A;  1ZVV A;  1NEQ A;  3IVP A;  4X4E A;  2IVQ A;  3PE5 A;  1DW9 A;  3U3W A;  3NDB B;  1DWK A;  2WUS R;  3M9L A;  1SQ8 A;  2PUC A; 
#chains in the Genus database with same CATH homology
 1WH6 A;  1IC8 A;  1VPW A;  1WIZ A;  2KPJ A;  4YG7 B;  1RZR D;  3F52 A;  3QQ6 A;  2IVB A;  3QWG A;  4JCY A;  2EBY A;  1EFA A;  1PNR A;  2O49 A;  1ZZ9 A;  3PXP A;  1LCD A;  3OQM A;  3CLC A;  2PUA A;  3LIS A;  4I8T A;  4IVZ A;  4PU3 C;  2PUB A;  2IV1 A;  3FYM A;  3QF3 A;  4J1W A;  1PRV A;  2WIU B;  2MQK A;  1BDH A;  1QQA A;  1RZS A;  2JVL A;  2LYP A;  4X4G A;  4X4I A;  2EWT A;  1NER A;  4PU4 C;  2O4A A;  4GHJ A;  4PU7 A;  1B0N A;  3GN5 A;  1UXC A;  2BNO A;  2LYR A;  3KJX A;  4Y42 A;  3TRB A;  3JXD L;  3ZKC A;  2GRL A;  3EUS A;  2AW6 A;  3LFP A;  4Z5D A;  1JFS A;  4IA8 A;  1OCT C;  2KEK A;  1ZAY A;  1Y9Q A;  3ZHI A;  1R63 A;  3CRO L;  2IVG A;  1HF0 A;  4I6T A;  3BDN A;  1X2L A;  2AXZ A;  3F6W A;  3H5T A;  1GT0 C;  4F8D A;  4I6U A;  1ZUG A;  4OB4 A;  1QP4 A;  2AWI A;  3OMT A;  2B5A A;  3KZ3 A;  3G7D A;  2XSD C;  2FJR A;  2L49 A;  2O38 A;  2XI8 A;  4X4F A;  3OP9 A;  1L1M A;  1JH9 A;  4Z5H A;  3MLF A;  4FN3 A;  2PUF A;  1BDI A;  3JXC L;  4Z58 A;  4X4H A;  3G5G A;  2LYJ A;  3KXA A;  3VK0 A;  3JXB C;  2PE5 A;  1JFT A;  5A7L A;  4O8B A;  3SCH A;  3O9X A;  2AXU A;  2BNN A;  4Z5C A;  1LMB 3;  3D1N I;  2JCG A;  4YBA A;  2AUW A;  3RZZ A;  3BS3 A;  3SCG A;  3FMY A;  4JQD A;  4X4D A;  1RIO A;  1AU7 A;  1ADR A;  2R63 A;  1R69 A;  3DNV B;  1PER L;  1CQT A;  2PUE A;  3SCF A;  2KEJ A;  2LCV A;  3OQO A;  2CRO A;  2PUD A;  1WH8 A;  3GN5 B;  1O4X A;  2PUG A;  2GRM A;  1ZZ6 A;  1ZZB A;  2LYK A;  4X4B A;  1PRU A;  2XCJ A;  3BD1 A;  2OR1 L;  1PRA A;  1WET A;  2A6C A;  2CSF A;  2BJC A;  3HZI B;  2PPX A;  3ZHM A;  1LQC A;  4GQM A;  2H8R A;  2ICT A;  4NDW A;  4MCT A;  2IUO A;  4MCX A;  2LYS A;  1UXD A;  2IU7 A;  1X57 A;  2KEI A;  1ZZ8 A;  2LYQ A;  4PU8 A;  1ZS4 A;  4JCX A;  2MEZ A;  1CJG A;  1LLI A;  4J1X A;  4FBI A;  1POU A;  1RZR A;  2EF8 A;  2KZ8 A;  2D5V A;  3UFD A;  1XWR A;  1ZVV A;  1NEQ A;  2OFY A;  3IVP A;  4X4E A;  2R1J L;  3CEC A;  3B7H A;  4YG4 A;  2HSG A;  2IVQ A;  2BNM A;  1S7E A;  5K98 B;  4YG1 A;  3GBF A;  1DW9 A;  1YSE A;  2ICP A;  2PIJ A;  4I6R A;  4X4C A;  3U3W A;  1RPE L;  1QPZ A;  3F51 A;  1OSL A;  4YAR A;  1Y7Y A;  1DWK A;  3L1P A;  3OQN A;  2GZU A;  1QQB A;  4IWR A;  3QYX A;  2LYL A;  1QP7 A;  2AXV A;  1ZZ7 A;  1LCC A;  1QP0 A;  2WUS R;  2L8N A;  3S8Q A;  1JWL A;  1SQ8 A;  2XIU A;  2HIN A;  3R1F A;  1ZZC A;  4Z59 A;  2XJ3 A;  2PUC A;  1E3O C;  1ZPQ A;  3FYA A;  1UTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...