2LCVA

Structure of the cytidine repressor dna-binding domain; an alternate calculation
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
47
structure length
47
Chain Sequence
AATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple Conformations of the Cytidine Repressor DNA-Binding Domain Coalesce to One upon Recognition of a Specific DNA Surface.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional repressor CytR
total genus 9
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lcvA00
1PERL 1ZPQA 2PUEA 3OQNA 1WETA 2R63A 4YARA 1UTXA 3F6WA 4I6TA 3L1PA 1QQAA 4JCYA 3QWGA 1JH9A 1Y9QA 3GN5A 1ZZ7A 2EWTA 2MEZA 3ZHIA 3ZKCA 1QP0A 1QQBA 3F52A 1EFAA 4GHJA 4Z5DA 1ADRA 2KEJA 3IVPA 3OQMA 3FYAA 4X4CA 3JXDL 2WIUB 3F51A 4Z58A 3JXBC 1GT0C 1CQTA 3QYXA 2BJCA 4X4GA 2GRMA 2D5VA 2LYLA 3SCHA 4FBIA 2XJ3A 1VPWA 4YG1A 2O38A 1X57A 4MCTA 2HSGA 1PNRA 4Z59A 2ICPA 3O9XA 4J1WA 4Y42A 4MCXA 1ZZBA 1ZUGA 2PIJA 1JWLA 5K98B 2KPJA 2L8NA 2AXVA 4I8TA 1B0NA 3EUSA 1YSEA 3G7DA 2R1JL 1IC8A 4X4EA 1R63A 2L49A 3FYMA 4X4DA 1QP4A 1ZVVA 2BNNA 3CLCA 1R69A 2IV1A 2OFYA 1ZAYA 2HINA 3RZZA 4I6UA 4IA8A 2XCJA 3BD1A 4YG7B 3GN5B 3U3WA 3OQOA 1LQCA 3KXAA 3KJXA 1XWRA 1SQ8A 1UXDA 2JCGA 1OCTC 1RZSA 1PRAA 2IVQA 2OR1L 4J1XA 2O4AA 1AU7A 2BNOA 1LCCA 4X4IA 1BDIA 5A7LA 3ZHMA 3H5TA 1DW9A 1JFSA 2PE5A 2EBYA 1Y7YA 4OB4A 1RZRD 3QF3A 1UXCA 1RZRA 3DNVB 4PU4C 3S8QA 2LYJA 2GRLA 3KZ3A 1ZZCA 1L1MA 4PU8A 4IWRA 2BNMA 1LMB3 1E3OC 2PUBA 2WUSR 4PU7A 3BDNA 3UFDA 2O49A 3SCGA 2KEIA 1BDHA 2IU7A 2JVLA 2PPXA 4PU3C 2AXZA 2LYRA 2XI8A 2B5AA 3GBFA 2AXUA 2A6CA 1ZS4A 3SCFA 1RPEL 1QPZA 2PUCA 3QQ6A 1RIOA 2PUDA 3R1FA 4YBAA 2EF8A 2PUAA 2PUFA 4X4HA 1CJGA 4JCXA 2AW6A 4Z5HA 2PUGA 3B7HA 2CROA 1LCDA 2IVBA 3MLFA 2XSDC 4YG4A 2KEKA 4X4BA 4IVZA 2ICTA 1WIZA 1O4XA 4I6RA 1ZZ9A 1HF0A 4JQDA 1POUA 2LYKA 1PRVA 3HZIB 3OP9A 3FMYA 4GQMA 3JXCL 3LISA 2H8RA 2LYPA 1WH6A 1LLIA 1NEQA 2AUWA 2LCVA 2LYSA 1NERA 3LFPA 1ZZ6A 4O8BA 1JFTA 1X2LA 1QP7A 2XIUA 1DWKA 1PRUA 2FJRA 3VK0A 1S7EA 2IVGA 3D1NI 4Z5CA 3CECA 2IUOA 2CSFA 4FN3A 4X4FA 4NDWA 1ZZ8A 2KZ8A 3PXPA 2GZUA 4F8DA 2AWIA 1WH8A 3BS3A 3G5GA 3TRBA 3OMTA 2MQKA 3CROL 2LYQA 1OSLA
chains in the Genus database with same CATH superfamily
1WETA 2R63A 3NROA 4JCYA 2J7WA 2MEZA 3OWQA 1QQBA 3F52A 1EFAA 4GHJA 2KEJA 5DT2A 3FYAA 2WIUB 3F51A 4Z58A 4X4GA 3SCHA 2XJ3A 2HFZA 1X57A 3ME5A 2HSGA 4Z59A 2ICPA 2JQEA 5DTMA 2V3CC 3QOXA 1JWLA 2AXVA 3EUSA 3G7DA 3QOWA 2R1JL 3CLCA 2OFYA 3QFIA 3DM5A 4IA8A 3BD1A 3U3WA 3GN5B 1UXDA 2M4HA 2PXBA 1RZSA 4J1XA 1AU7A 2BNOA 4X4IA 3M9LA 1JFSA 3A9YA 1UXCA 1RZRA 2GRLA 4PU8A 4IWRA 3SCGA 2IU7A 2PPXA 2XXPA 1ZS4A 2LLVA 3QQ6A 2PUAA 3SR4A 4X4HA 4JCXA 2XXQA 3KL4A 2PUGA 2LNMA 1WIZA 4I6RA 1ZZ9A 1HF0A 2LYKA 3TELA 2LLWA 3NZLA 4GQMA 5DTQA 4ER0A 1WH6A 2PXVA 1X2LA 2XIUA 1S7EA 3D1NI 4Q2JA 2CSFA 2PXLA 4FN3A 4NDWA 3PXPA 3G5GA 3TRBA 1VPWA 2PUEA 3SX0A 3OQNA 3QWGA 1Y9QA 4EQZA 1QP0A 1ADRA 5DRYA 3OQMA 2PXDA 3QYXA 5DSXA 3GZDC 4FBIA 2YBDA 4YG1A 3O9XA 1ZZBA 2PIJA 1YSEA 1QB2A 1IC8A 4X4EA 4EKGA 4X4DA 1QP4A 2BNNA 1U2ZA 1R69A 2XCJA 4YG7B 3OQOA 2L1PA 3KXAA 3KJXA 1XWRA 1PRAA 2IVQA 1BDIA 5A7LA 3H5TA 4OB4A 1RZRD 3DNVB 1L1MA 2PXQA 2PUBA 2WUSR 3BDNA 2B5AA 3GBFA 1RPEL 4DE8A 2EF8A 3VWSA 4WVLA 1LCDA 2XSDC 4YG4A 4JQDA 1PRVA 3LISA 2LYPA 2LYSA 1QP7A 3MEJA 3CECA 2IUOA 1ZZ8A 2GZUA 2PXUA 3OMTA 2LYQA 1OSLA 1ZPQA 3F6WA 3L1PA 5DTRA 1JH9A 3GN5A 1ZZ7A 4DE9A 4X4CA 3JXDL 2ODRD 1GT0C 1HQ1A 1CQTA 2BJCA 2GRMA 1PNRA 3LQXA 2HCSA 4Y42A 5K98B 2L8NA 1B0NA 2L49A 1ZVVA 2IV1A 3RZZA 4I6UA 4OBMA 1LQCA 2PXPA 1SQ8A 4EKIA 5GAGi 1OCTC 2J7UA 2OR1L 2PXEA 1Y7YA 3QF3A 4ER3A 2PXFA 4PU4C 3S8QA 2HCNA 2LYJA 3KZ3A 1LMB3 1E3OC 4PU7A 3UWPA 2KEIA 1BDHA 4PU3C 2AXZA 2AXUA 2PUCA 3SCFA 1QPZA 3R1FA 4YBAA 2PUFA 1NW3A 4EZIA 2IVBA 4HRAA 2KEKA 1O4XA 1POUA 3OP9A 3FMYA 1LLIA 2AUWA 2LCVA 3R09A 1NERA 1ZZ6A 4O8BA 5GAHi 1JFTA 2VEOA 1DWKA 1PRUA 2FJRA 3TFLA 2IVGA 3VK0A 4F8DA 2KZ8A 2AWIA 3GZCA 2MQKA 1PERL 4YARA 1UTXA 4I6TA 1QQAA 2EWTA 3NXHA 3ZHIA 3ZKCA 4Z5DA 3IVPA 3JXBC 2D5VA 2LYLA 2O38A 4MCTA 4J1WA 2XXAA 4MCXA 1ZUGA 2KPJA 4I8TA 1R63A 3GUUA 3FYMA 1ZAYA 2HINA 2JCGA 2O4AA 1LCCA 3ZHMA 3OKZA 1DW9A 2PE5A 2EBYA 5JUWA 2FFHA 1ZZCA 2BNMA 3GZDA 3UFDA 2PXTA 2O49A 2JVLA 1QZXA 2LYRA 1DULA 2XI8A 5DRTA 2A6CA 3ZPXA 4ER6A 3TEPA 1RIOA 2PUDA 1CJGA 3A9XA 2AW6A 4Z5HA 3B7HA 2CROA 3MLFA 3PE5A 2MXDA 4X4BA 4IVZA 2ICTA 3NDBB 3HZIB 3JXCL 2H8RA 1NEQA 2PXKA 3A9ZA 3LFPA 3G0TA 4Z5CA 4X4FA 4EK9A 1MFQC 4ER5A 4ER7A 1WH8A 3BS3A 3CROL
chains in the Genus database with same CATH topology
1PERL 1ZPQA 2PUEA 3OQNA 1WETA 2R63A 4YARA 1UTXA 3F6WA 4I6TA 3L1PA 1QQAA 4JCYA 3QWGA 1JH9A 1Y9QA 3GN5A 1ZZ7A 2EWTA 2MEZA 3ZHIA 3ZKCA 1QP0A 1QQBA 3F52A 1EFAA 4GHJA 4Z5DA 1ADRA 2KEJA 3IVPA 3OQMA 3FYAA 4X4CA 3JXDL 2WIUB 3F51A 4Z58A 3JXBC 1GT0C 1CQTA 3QYXA 2BJCA 4X4GA 2GRMA 2D5VA 2LYLA 3SCHA 4FBIA 2XJ3A 1VPWA 4YG1A 2O38A 1X57A 4MCTA 2HSGA 1PNRA 4Z59A 2ICPA 3O9XA 4J1WA 4Y42A 4MCXA 1ZZBA 1ZUGA 2PIJA 1JWLA 5K98B 2KPJA 2L8NA 2AXVA 4I8TA 1B0NA 3EUSA 1YSEA 3G7DA 2R1JL 1IC8A 4X4EA 1R63A 2L49A 3FYMA 4X4DA 1QP4A 1ZVVA 2BNNA 3CLCA 1R69A 2IV1A 2OFYA 1ZAYA 2HINA 3RZZA 4I6UA 4IA8A 2XCJA 3BD1A 4YG7B 3GN5B 3U3WA 3OQOA 1LQCA 3KXAA 3KJXA 1XWRA 1SQ8A 1UXDA 2JCGA 1OCTC 1RZSA 1PRAA 2IVQA 2OR1L 4J1XA 2O4AA 1AU7A 2BNOA 1LCCA 4X4IA 1BDIA 5A7LA 3ZHMA 3H5TA 1DW9A 1JFSA 2PE5A 2EBYA 1Y7YA 4OB4A 1RZRD 3QF3A 1UXCA 1RZRA 3DNVB 4PU4C 3S8QA 2LYJA 2GRLA 3KZ3A 1ZZCA 1L1MA 4PU8A 4IWRA 2BNMA 1LMB3 1E3OC 2PUBA 2WUSR 4PU7A 3BDNA 3UFDA 2O49A 3SCGA 2KEIA 1BDHA 2IU7A 2JVLA 2PPXA 4PU3C 2AXZA 2LYRA 2XI8A 2B5AA 3GBFA 2AXUA 2A6CA 1ZS4A 3SCFA 1RPEL 1QPZA 2PUCA 3QQ6A 1RIOA 2PUDA 3R1FA 4YBAA 2EF8A 2PUAA 2PUFA 4X4HA 1CJGA 4JCXA 2AW6A 4Z5HA 2PUGA 3B7HA 2CROA 1LCDA 2IVBA 3MLFA 2XSDC 4YG4A 2KEKA 4X4BA 4IVZA 2ICTA 1WIZA 1O4XA 4I6RA 1ZZ9A 1HF0A 4JQDA 1POUA 2LYKA 1PRVA 3HZIB 3OP9A 3FMYA 4GQMA 3JXCL 3LISA 2H8RA 2LYPA 1WH6A 1LLIA 1NEQA 2AUWA 2LCVA 2LYSA 1NERA 3LFPA 1ZZ6A 4O8BA 1JFTA 1X2LA 1QP7A 2XIUA 1DWKA 1PRUA 2FJRA 3VK0A 1S7EA 2IVGA 3D1NI 4Z5CA 3CECA 2IUOA 2CSFA 4FN3A 4X4FA 4NDWA 1ZZ8A 2KZ8A 3PXPA 2GZUA 4F8DA 2AWIA 1WH8A 3BS3A 3G5GA 3TRBA 3OMTA 2MQKA 3CROL 2LYQA 1OSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PER L;  1ZPQ A;  2PUE A;  3OQN A;  1WET A;  2R63 A;  4YAR A;  1UTX A;  3F6W A;  4I6T A;  3L1P A;  1QQA A;  4JCY A;  3QWG A;  1JH9 A;  1Y9Q A;  3GN5 A;  1ZZ7 A;  2EWT A;  2MEZ A;  3ZHI A;  3ZKC A;  1QP0 A;  1QQB A;  3F52 A;  1EFA A;  4GHJ A;  4Z5D A;  1ADR A;  2KEJ A;  3IVP A;  3OQM A;  3FYA A;  4X4C A;  3JXD L;  2WIU B;  3F51 A;  4Z58 A;  3JXB C;  1GT0 C;  1CQT A;  3QYX A;  2BJC A;  4X4G A;  2GRM A;  2D5V A;  2LYL A;  3SCH A;  4FBI A;  2XJ3 A;  1VPW A;  4YG1 A;  2O38 A;  1X57 A;  4MCT A;  2HSG A;  1PNR A;  4Z59 A;  2ICP A;  3O9X A;  4J1W A;  4Y42 A;  4MCX A;  1ZZB A;  1ZUG A;  2PIJ A;  1JWL A;  5K98 B;  2KPJ A;  2L8N A;  2AXV A;  4I8T A;  1B0N A;  3EUS A;  1YSE A;  3G7D A;  2R1J L;  1IC8 A;  4X4E A;  1R63 A;  2L49 A;  3FYM A;  4X4D A;  1QP4 A;  1ZVV A;  2BNN A;  3CLC A;  1R69 A;  2IV1 A;  2OFY A;  1ZAY A;  2HIN A;  3RZZ A;  4I6U A;  4IA8 A;  2XCJ A;  3BD1 A;  4YG7 B;  3GN5 B;  3U3W A;  3OQO A;  1LQC A;  3KXA A;  3KJX A;  1XWR A;  1SQ8 A;  1UXD A;  2JCG A;  1OCT C;  1RZS A;  1PRA A;  2IVQ A;  2OR1 L;  4J1X A;  2O4A A;  1AU7 A;  2BNO A;  1LCC A;  4X4I A;  1BDI A;  5A7L A;  3ZHM A;  3H5T A;  1DW9 A;  1JFS A;  2PE5 A;  2EBY A;  1Y7Y A;  4OB4 A;  1RZR D;  3QF3 A;  1UXC A;  1RZR A;  3DNV B;  4PU4 C;  3S8Q A;  2LYJ A;  2GRL A;  3KZ3 A;  1ZZC A;  1L1M A;  4PU8 A;  4IWR A;  2BNM A;  1LMB 3;  1E3O C;  2PUB A;  2WUS R;  4PU7 A;  3BDN A;  3UFD A;  2O49 A;  3SCG A;  2KEI A;  1BDH A;  2IU7 A;  2JVL A;  2PPX A;  4PU3 C;  2AXZ A;  2LYR A;  2XI8 A;  2B5A A;  3GBF A;  2AXU A;  2A6C A;  1ZS4 A;  3SCF A;  1RPE L;  1QPZ A;  2PUC A;  3QQ6 A;  1RIO A;  2PUD A;  3R1F A;  4YBA A;  2EF8 A;  2PUA A;  2PUF A;  4X4H A;  1CJG A;  4JCX A;  2AW6 A;  4Z5H A;  2PUG A;  3B7H A;  2CRO A;  1LCD A;  2IVB A;  3MLF A;  2XSD C;  4YG4 A;  2KEK A;  4X4B A;  4IVZ A;  2ICT A;  1WIZ A;  1O4X A;  4I6R A;  1ZZ9 A;  1HF0 A;  4JQD A;  1POU A;  2LYK A;  1PRV A;  3HZI B;  3OP9 A;  3FMY A;  4GQM A;  3JXC L;  3LIS A;  2H8R A;  2LYP A;  1WH6 A;  1LLI A;  1NEQ A;  2AUW A;  2LCV A;  2LYS A;  1NER A;  3LFP A;  1ZZ6 A;  4O8B A;  1JFT A;  1X2L A;  1QP7 A;  2XIU A;  1DWK A;  1PRU A;  2FJR A;  3VK0 A;  1S7E A;  2IVG A;  3D1N I;  4Z5C A;  3CEC A;  2IUO A;  2CSF A;  4FN3 A;  4X4F A;  4NDW A;  1ZZ8 A;  2KZ8 A;  3PXP A;  2GZU A;  4F8D A;  2AWI A;  1WH8 A;  3BS3 A;  3G5G A;  3TRB A;  3OMT A;  2MQK A;  3CRO L;  2LYQ A;  1OSL A; 
#chains in the Genus database with same CATH topology
 1WET A;  2R63 A;  3NRO A;  4JCY A;  2J7W A;  2MEZ A;  3OWQ A;  1QQB A;  3F52 A;  1EFA A;  4GHJ A;  2KEJ A;  5DT2 A;  3FYA A;  2WIU B;  3F51 A;  4Z58 A;  4X4G A;  3SCH A;  2XJ3 A;  2HFZ A;  1X57 A;  3ME5 A;  2HSG A;  4Z59 A;  2ICP A;  2JQE A;  5DTM A;  2V3C C;  3QOX A;  1JWL A;  2AXV A;  3EUS A;  3G7D A;  3QOW A;  2R1J L;  3CLC A;  2OFY A;  3QFI A;  3DM5 A;  4IA8 A;  3BD1 A;  3U3W A;  3GN5 B;  1UXD A;  2M4H A;  2PXB A;  1RZS A;  4J1X A;  1AU7 A;  2BNO A;  4X4I A;  3M9L A;  1JFS A;  3A9Y A;  1UXC A;  1RZR A;  2GRL A;  4PU8 A;  4IWR A;  3SCG A;  2IU7 A;  2PPX A;  2XXP A;  1ZS4 A;  2LLV A;  3QQ6 A;  2PUA A;  3SR4 A;  4X4H A;  4JCX A;  2XXQ A;  3KL4 A;  2PUG A;  2LNM A;  1WIZ A;  4I6R A;  1ZZ9 A;  1HF0 A;  2LYK A;  3TEL A;  2LLW A;  3NZL A;  4GQM A;  5DTQ A;  4ER0 A;  1WH6 A;  2PXV A;  1X2L A;  2XIU A;  1S7E A;  3D1N I;  4Q2J A;  2CSF A;  2PXL A;  4FN3 A;  4NDW A;  3PXP A;  3G5G A;  3TRB A;  1VPW A;  2PUE A;  3SX0 A;  3OQN A;  3QWG A;  1Y9Q A;  4EQZ A;  1QP0 A;  1ADR A;  5DRY A;  3OQM A;  2PXD A;  3QYX A;  5DSX A;  3GZD C;  4FBI A;  2YBD A;  4YG1 A;  3O9X A;  1ZZB A;  2PIJ A;  1YSE A;  1QB2 A;  1IC8 A;  4X4E A;  4EKG A;  4X4D A;  1QP4 A;  2BNN A;  1U2Z A;  1R69 A;  2XCJ A;  4YG7 B;  3OQO A;  2L1P A;  3KXA A;  3KJX A;  1XWR A;  1PRA A;  2IVQ A;  1BDI A;  5A7L A;  3H5T A;  4OB4 A;  1RZR D;  3DNV B;  1L1M A;  2PXQ A;  2PUB A;  2WUS R;  3BDN A;  2B5A A;  3GBF A;  1RPE L;  4DE8 A;  2EF8 A;  3VWS A;  4WVL A;  1LCD A;  2XSD C;  4YG4 A;  4JQD A;  1PRV A;  3LIS A;  2LYP A;  2LYS A;  1QP7 A;  3MEJ A;  3CEC A;  2IUO A;  1ZZ8 A;  2GZU A;  2PXU A;  3OMT A;  2LYQ A;  1OSL A;  1ZPQ A;  3F6W A;  3L1P A;  5DTR A;  1JH9 A;  3GN5 A;  1ZZ7 A;  4DE9 A;  4X4C A;  3JXD L;  2ODR D;  1GT0 C;  1HQ1 A;  1CQT A;  2BJC A;  2GRM A;  1PNR A;  3LQX A;  2HCS A;  4Y42 A;  5K98 B;  2L8N A;  1B0N A;  2L49 A;  1ZVV A;  2IV1 A;  3RZZ A;  4I6U A;  4OBM A;  1LQC A;  2PXP A;  1SQ8 A;  4EKI A;  5GAG i;  1OCT C;  2J7U A;  2OR1 L;  2PXE A;  1Y7Y A;  3QF3 A;  4ER3 A;  2PXF A;  4PU4 C;  3S8Q A;  2HCN A;  2LYJ A;  3KZ3 A;  1LMB 3;  1E3O C;  4PU7 A;  3UWP A;  2KEI A;  1BDH A;  4PU3 C;  2AXZ A;  2AXU A;  2PUC A;  3SCF A;  1QPZ A;  3R1F A;  4YBA A;  2PUF A;  1NW3 A;  4EZI A;  2IVB A;  4HRA A;  2KEK A;  1O4X A;  1POU A;  3OP9 A;  3FMY A;  1LLI A;  2AUW A;  2LCV A;  3R09 A;  1NER A;  1ZZ6 A;  4O8B A;  5GAH i;  1JFT A;  2VEO A;  1DWK A;  1PRU A;  2FJR A;  3TFL A;  2IVG A;  3VK0 A;  4F8D A;  2KZ8 A;  2AWI A;  3GZC A;  2MQK A;  1PER L;  4YAR A;  1UTX A;  4I6T A;  1QQA A;  2EWT A;  3NXH A;  3ZHI A;  3ZKC A;  4Z5D A;  3IVP A;  3JXB C;  2D5V A;  2LYL A;  2O38 A;  4MCT A;  4J1W A;  2XXA A;  4MCX A;  1ZUG A;  2KPJ A;  4I8T A;  1R63 A;  3GUU A;  3FYM A;  1ZAY A;  2HIN A;  2JCG A;  2O4A A;  1LCC A;  3ZHM A;  3OKZ A;  1DW9 A;  2PE5 A;  2EBY A;  5JUW A;  2FFH A;  1ZZC A;  2BNM A;  3GZD A;  3UFD A;  2PXT A;  2O49 A;  2JVL A;  1QZX A;  2LYR A;  1DUL A;  2XI8 A;  5DRT A;  2A6C A;  3ZPX A;  4ER6 A;  3TEP A;  1RIO A;  2PUD A;  1CJG A;  3A9X A;  2AW6 A;  4Z5H A;  3B7H A;  2CRO A;  3MLF A;  3PE5 A;  2MXD A;  4X4B A;  4IVZ A;  2ICT A;  3NDB B;  3HZI B;  3JXC L;  2H8R A;  1NEQ A;  2PXK A;  3A9Z A;  3LFP A;  3G0T A;  4Z5C A;  4X4F A;  4EK9 A;  1MFQ C;  4ER5 A;  4ER7 A;  1WH8 A;  3BS3 A;  3CRO L; 
#chains in the Genus database with same CATH homology
 1PER L;  1ZPQ A;  2PUE A;  3OQN A;  1WET A;  2R63 A;  4YAR A;  1UTX A;  3F6W A;  4I6T A;  3L1P A;  1QQA A;  4JCY A;  3QWG A;  1JH9 A;  1Y9Q A;  3GN5 A;  1ZZ7 A;  2EWT A;  2MEZ A;  3ZHI A;  3ZKC A;  1QP0 A;  1QQB A;  3F52 A;  1EFA A;  4GHJ A;  4Z5D A;  1ADR A;  2KEJ A;  3IVP A;  3OQM A;  3FYA A;  4X4C A;  3JXD L;  2WIU B;  3F51 A;  4Z58 A;  3JXB C;  1GT0 C;  1CQT A;  3QYX A;  2BJC A;  4X4G A;  2GRM A;  2D5V A;  2LYL A;  3SCH A;  4FBI A;  2XJ3 A;  1VPW A;  4YG1 A;  2O38 A;  1X57 A;  4MCT A;  2HSG A;  1PNR A;  4Z59 A;  2ICP A;  3O9X A;  4J1W A;  4Y42 A;  4MCX A;  1ZZB A;  1ZUG A;  2PIJ A;  1JWL A;  5K98 B;  2KPJ A;  2L8N A;  2AXV A;  4I8T A;  1B0N A;  3EUS A;  1YSE A;  3G7D A;  2R1J L;  1IC8 A;  4X4E A;  1R63 A;  2L49 A;  3FYM A;  4X4D A;  1QP4 A;  1ZVV A;  2BNN A;  3CLC A;  1R69 A;  2IV1 A;  2OFY A;  1ZAY A;  2HIN A;  3RZZ A;  4I6U A;  4IA8 A;  2XCJ A;  3BD1 A;  4YG7 B;  3GN5 B;  3U3W A;  3OQO A;  1LQC A;  3KXA A;  3KJX A;  1XWR A;  1SQ8 A;  1UXD A;  2JCG A;  1OCT C;  1RZS A;  1PRA A;  2IVQ A;  2OR1 L;  4J1X A;  2O4A A;  1AU7 A;  2BNO A;  1LCC A;  4X4I A;  1BDI A;  5A7L A;  3ZHM A;  3H5T A;  1DW9 A;  1JFS A;  2PE5 A;  2EBY A;  1Y7Y A;  4OB4 A;  1RZR D;  3QF3 A;  1UXC A;  1RZR A;  3DNV B;  4PU4 C;  3S8Q A;  2LYJ A;  2GRL A;  3KZ3 A;  1ZZC A;  1L1M A;  4PU8 A;  4IWR A;  2BNM A;  1LMB 3;  1E3O C;  2PUB A;  2WUS R;  4PU7 A;  3BDN A;  3UFD A;  2O49 A;  3SCG A;  2KEI A;  1BDH A;  2IU7 A;  2JVL A;  2PPX A;  4PU3 C;  2AXZ A;  2LYR A;  2XI8 A;  2B5A A;  3GBF A;  2AXU A;  2A6C A;  1ZS4 A;  3SCF A;  1RPE L;  1QPZ A;  2PUC A;  3QQ6 A;  1RIO A;  2PUD A;  3R1F A;  4YBA A;  2EF8 A;  2PUA A;  2PUF A;  4X4H A;  1CJG A;  4JCX A;  2AW6 A;  4Z5H A;  2PUG A;  3B7H A;  2CRO A;  1LCD A;  2IVB A;  3MLF A;  2XSD C;  4YG4 A;  2KEK A;  4X4B A;  4IVZ A;  2ICT A;  1WIZ A;  1O4X A;  4I6R A;  1ZZ9 A;  1HF0 A;  4JQD A;  1POU A;  2LYK A;  1PRV A;  3HZI B;  3OP9 A;  3FMY A;  4GQM A;  3JXC L;  3LIS A;  2H8R A;  2LYP A;  1WH6 A;  1LLI A;  1NEQ A;  2AUW A;  2LCV A;  2LYS A;  1NER A;  3LFP A;  1ZZ6 A;  4O8B A;  1JFT A;  1X2L A;  1QP7 A;  2XIU A;  1DWK A;  1PRU A;  2FJR A;  3VK0 A;  1S7E A;  2IVG A;  3D1N I;  4Z5C A;  3CEC A;  2IUO A;  2CSF A;  4FN3 A;  4X4F A;  4NDW A;  1ZZ8 A;  2KZ8 A;  3PXP A;  2GZU A;  4F8D A;  2AWI A;  1WH8 A;  3BS3 A;  3G5G A;  3TRB A;  3OMT A;  2MQK A;  3CRO L;  2LYQ A;  1OSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...