2M4HA

Solution structure of the core domain (10-76) of the feline calicivirus vpg protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
GTYRGRGVALTDDEYDEWREHNASRKLDLSVEDFLMLRHRAALGADDNDAVKFRSWWNSRTKMANDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Compact Helical Core Domains of Feline Calicivirus and Murine Norovirus VPg Proteins.
pubmed doi rcsb
source organism Feline calicivirus
molecule tags Viral protein
molecule keywords Feline Calicivirus VPg protein
total genus 20
structure length 67
sequence length 67
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.110 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2m4hA00
2MXDA 2M4HA
chains in the Genus database with same CATH superfamily
1JFTA 2BNMA 3CLCA 2PXTA 3KXAA 2EF8A 4FBIA 3MLFA 1ZZ6A 3OQMA 1WIZA 1ZZCA 4X4IA 2PXUA 2CROA 2CSFA 2HSGA 1AU7A 2PXLA 2IU7A 2J7WA 3QOXA 2R63A 3NROA 4Z5CA 3R1FA 4YG7B 1ZZ9A 1LLIA 2XXPA 4DE9A 4X4DA 3OMTA 3BDNA 3A9XA 3LFPA 3M9LA 4F8DA 1POUA 3TFLA 1UXDA 3IVPA 2XSDC 1S7EA 2BNNA 3FYAA 3CROL 1DW9A 3PE5A 2JQEA 2KPJA 2OR1L 4EK9A 1OCTC 2PPXA 3ZPXA 4X4HA 3L1PA 1SQ8A 4EKIA 3QFIA 1QQAA 4IA8A 2L8NA 3CECA 1RZRD 2IVGA 1RIOA 1DULA 3GZDC 1CJGA 3SCGA 2KEIA 3OWQA 2LYLA 3DM5A 2J7UA 1JH9A 4J1XA 2PXVA 2R1JL 2PXQA 2XJ3A 4ER3A 3QWGA 4I6UA 3KJXA 2AXUA 4EZIA 3B7HA 1QP7A 1ZZ7A 2MEZA 4EKGA 3KZ3A 1PNRA 3RZZA 1BDIA 2HINA 1ZZBA 3TRBA 3KL4A 5A7LA 1DWKA 2D5VA 3OQNA 3UWPA 2PUDA 1UXCA 2PUCA 4X4CA 1HQ1A 2KEKA 1YSEA 4ER0A 3BS3A 3A9ZA 4DE8A 2WIUB 1OSLA 2PXPA 3H5TA 4X4FA 5GAHi 1R63A 1RZSA 3ZHMA 3TELA 3ZKCA 3SR4A 1IC8A 5JUWA 1L1MA 4YBAA 1PRAA 2XCJA 2O49A 4ER7A 2L1PA 1ZUGA 3QOWA 3A9YA 1NERA 2GRMA 2GZUA 4GHJA 1JWLA 3NDBB 4O8BA 4WVLA 3GBFA 1CQTA 2PIJA 3O9XA 1WH6A 2AUWA 2IV1A 2PUBA 1RPEL 1O4XA 4Z58A 4Z5DA 1NW3A 1LCCA 3UFDA 5K98B 2FFHA 3QF3A 2MQKA 3F51A 2EWTA 3FYMA 4Y42A 1LQCA 2IUOA 3JXBC 3JXCL 5DSXA 2PXFA 2H8RA 2HFZA 2AXZA 2KZ8A 2XXAA 1PERL 3U3WA 3LISA 1X2LA 2B5AA 1R69A 2ICPA 1QP4A 1Y7YA 4Z5HA 3DNVB 4JCYA 4IWRA 4PU3C 2OFYA 3GZDA 3F52A 3JXDL 3G5GA 3R09A 3NXHA 2LYPA 4YG4A 2BNOA 3VWSA 4J1WA 5DRTA 2O38A 4MCTA 1ZVVA 3FMYA 1MFQC 4YG1A 1QP0A 4JCXA 2PE5A 4NDWA 3D1NI 1QPZA 2PUEA 4PU4C 1QB2A 1BDHA 2LLWA 2KEJA 1ZZ8A 3OP9A 2LYKA 2AXVA 2LYQA 4OBMA 1WH8A 2M4HA 5DRYA 3EUSA 1RZRA 2L49A 2LLVA 1E3OC 2XI8A 2IVQA 3G0TA 1PRVA 1WETA 3BD1A 1U2ZA 2AWIA 2ODRD 3OQOA 2LYSA 2VEOA 2EBYA 3S8QA 2PXKA 5DT2A 2PXDA 4MCXA 3G7DA 2FJRA 2PXEA 4X4GA 4I6TA 1QZXA 4X4BA 3ZHIA 2MXDA 2V3CC 5DTMA 3PXPA 4ER5A 1ZPQA 1VPWA 2LCVA 2JVLA 3NZLA 2ICTA 3TEPA 2IVBA 1B0NA 1LMB3 3F6WA 4GQMA 2WUSR 4HRAA 4JQDA 3GN5B 2AW6A 2LYJA 2BJCA 3SCHA 4X4EA 2PXBA 3LQXA 2PUFA 1UTXA 4OB4A 1X57A 1QQBA 3GZCA 2LYRA 4ER6A 2LNMA 2GRLA 3HZIB 2A6CA 1LCDA 2YBDA 1XWRA 1GT0C 1HF0A 2O4AA 4Q2JA 2XIUA 3OKZA 2XXQA 1NEQA 1ADRA 3GUUA 4PU8A 2HCNA 4Z59A 5GAGi 1JFSA 4IVZA 3MEJA 2PUGA 2PUAA 4I6RA 4PU7A 3SCFA 4I8TA 3QYXA 3SX0A 2JCGA 3ME5A 4EQZA 2HCSA 3GN5A 1Y9QA 1ZS4A 1ZAYA 3QQ6A 5DTQA 5DTRA 1PRUA 1EFAA 4FN3A 3VK0A 4YARA
chains in the Genus database with same CATH topology
2MXDA 4EKGA 4OBMA 4ER0A 3MEJA 3OWQA 1U2ZA 3TELA 2M4HA 5DTMA 4ER7A 4ER5A 2ODRD 2L1PA 3PE5A 4HRAA 2XXPA 2J7UA 2YBDA 1NW3A 4DE9A 4EK9A 2VEOA 4Q2JA 3A9ZA 5DRYA 3SX0A 4DE8A 3ZPXA 3QOWA 3A9YA 3ME5A 4EQZA 3OKZA 2HCSA 4EKIA 3NZLA 2XXQA 2LLVA 5DT2A 4ER3A 3GUUA 3QFIA 3GZDA 3UWPA 3TEPA 2HCNA 2J7WA 3A9XA 3GZCA 3QOXA 3NXHA 3R09A 4WVLA 5DSXA 3M9LA 3G0TA 5DTQA 3GZDC 5DTRA 2LLWA 3SR4A 4EZIA 3NROA 2HFZA 3TFLA 4ER6A 2LNMA 5JUWA 3VWSA 5DRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MXD A;  2M4H A; 
#chains in the Genus database with same CATH topology
 1JFT A;  2BNM A;  3CLC A;  2PXT A;  3KXA A;  2EF8 A;  4FBI A;  3MLF A;  1ZZ6 A;  3OQM A;  1WIZ A;  1ZZC A;  4X4I A;  2PXU A;  2CRO A;  2CSF A;  2HSG A;  1AU7 A;  2PXL A;  2IU7 A;  2J7W A;  3QOX A;  2R63 A;  3NRO A;  4Z5C A;  3R1F A;  4YG7 B;  1ZZ9 A;  1LLI A;  2XXP A;  4DE9 A;  4X4D A;  3OMT A;  3BDN A;  3A9X A;  3LFP A;  3M9L A;  4F8D A;  1POU A;  3TFL A;  1UXD A;  3IVP A;  2XSD C;  1S7E A;  2BNN A;  3FYA A;  3CRO L;  1DW9 A;  3PE5 A;  2JQE A;  2KPJ A;  2OR1 L;  4EK9 A;  1OCT C;  2PPX A;  3ZPX A;  4X4H A;  3L1P A;  1SQ8 A;  4EKI A;  3QFI A;  1QQA A;  4IA8 A;  2L8N A;  3CEC A;  1RZR D;  2IVG A;  1RIO A;  1DUL A;  3GZD C;  1CJG A;  3SCG A;  2KEI A;  3OWQ A;  2LYL A;  3DM5 A;  2J7U A;  1JH9 A;  4J1X A;  2PXV A;  2R1J L;  2PXQ A;  2XJ3 A;  4ER3 A;  3QWG A;  4I6U A;  3KJX A;  2AXU A;  4EZI A;  3B7H A;  1QP7 A;  1ZZ7 A;  2MEZ A;  4EKG A;  3KZ3 A;  1PNR A;  3RZZ A;  1BDI A;  2HIN A;  1ZZB A;  3TRB A;  3KL4 A;  5A7L A;  1DWK A;  2D5V A;  3OQN A;  3UWP A;  2PUD A;  1UXC A;  2PUC A;  4X4C A;  1HQ1 A;  2KEK A;  1YSE A;  4ER0 A;  3BS3 A;  3A9Z A;  4DE8 A;  2WIU B;  1OSL A;  2PXP A;  3H5T A;  4X4F A;  5GAH i;  1R63 A;  1RZS A;  3ZHM A;  3TEL A;  3ZKC A;  3SR4 A;  1IC8 A;  5JUW A;  1L1M A;  4YBA A;  1PRA A;  2XCJ A;  2O49 A;  4ER7 A;  2L1P A;  1ZUG A;  3QOW A;  3A9Y A;  1NER A;  2GRM A;  2GZU A;  4GHJ A;  1JWL A;  3NDB B;  4O8B A;  4WVL A;  3GBF A;  1CQT A;  2PIJ A;  3O9X A;  1WH6 A;  2AUW A;  2IV1 A;  2PUB A;  1RPE L;  1O4X A;  4Z58 A;  4Z5D A;  1NW3 A;  1LCC A;  3UFD A;  5K98 B;  2FFH A;  3QF3 A;  2MQK A;  3F51 A;  2EWT A;  3FYM A;  4Y42 A;  1LQC A;  2IUO A;  3JXB C;  3JXC L;  5DSX A;  2PXF A;  2H8R A;  2HFZ A;  2AXZ A;  2KZ8 A;  2XXA A;  1PER L;  3U3W A;  3LIS A;  1X2L A;  2B5A A;  1R69 A;  2ICP A;  1QP4 A;  1Y7Y A;  4Z5H A;  3DNV B;  4JCY A;  4IWR A;  4PU3 C;  2OFY A;  3GZD A;  3F52 A;  3JXD L;  3G5G A;  3R09 A;  3NXH A;  2LYP A;  4YG4 A;  2BNO A;  3VWS A;  4J1W A;  5DRT A;  2O38 A;  4MCT A;  1ZVV A;  3FMY A;  1MFQ C;  4YG1 A;  1QP0 A;  4JCX A;  2PE5 A;  4NDW A;  3D1N I;  1QPZ A;  2PUE A;  4PU4 C;  1QB2 A;  1BDH A;  2LLW A;  2KEJ A;  1ZZ8 A;  3OP9 A;  2LYK A;  2AXV A;  2LYQ A;  4OBM A;  1WH8 A;  2M4H A;  5DRY A;  3EUS A;  1RZR A;  2L49 A;  2LLV A;  1E3O C;  2XI8 A;  2IVQ A;  3G0T A;  1PRV A;  1WET A;  3BD1 A;  1U2Z A;  2AWI A;  2ODR D;  3OQO A;  2LYS A;  2VEO A;  2EBY A;  3S8Q A;  2PXK A;  5DT2 A;  2PXD A;  4MCX A;  3G7D A;  2FJR A;  2PXE A;  4X4G A;  4I6T A;  1QZX A;  4X4B A;  3ZHI A;  2MXD A;  2V3C C;  5DTM A;  3PXP A;  4ER5 A;  1ZPQ A;  1VPW A;  2LCV A;  2JVL A;  3NZL A;  2ICT A;  3TEP A;  2IVB A;  1B0N A;  1LMB 3;  3F6W A;  4GQM A;  2WUS R;  4HRA A;  4JQD A;  3GN5 B;  2AW6 A;  2LYJ A;  2BJC A;  3SCH A;  4X4E A;  2PXB A;  3LQX A;  2PUF A;  1UTX A;  4OB4 A;  1X57 A;  1QQB A;  3GZC A;  2LYR A;  4ER6 A;  2LNM A;  2GRL A;  3HZI B;  2A6C A;  1LCD A;  2YBD A;  1XWR A;  1GT0 C;  1HF0 A;  2O4A A;  4Q2J A;  2XIU A;  3OKZ A;  2XXQ A;  1NEQ A;  1ADR A;  3GUU A;  4PU8 A;  2HCN A;  4Z59 A;  5GAG i;  1JFS A;  4IVZ A;  3MEJ A;  2PUG A;  2PUA A;  4I6R A;  4PU7 A;  3SCF A;  4I8T A;  3QYX A;  3SX0 A;  2JCG A;  3ME5 A;  4EQZ A;  2HCS A;  3GN5 A;  1Y9Q A;  1ZS4 A;  1ZAY A;  3QQ6 A;  5DTQ A;  5DTR A;  1PRU A;  1EFA A;  4FN3 A;  3VK0 A;  4YAR A; 
#chains in the Genus database with same CATH homology
 2MXD A;  4EKG A;  4OBM A;  4ER0 A;  3MEJ A;  3OWQ A;  1U2Z A;  3TEL A;  2M4H A;  5DTM A;  4ER7 A;  4ER5 A;  2ODR D;  2L1P A;  3PE5 A;  4HRA A;  2XXP A;  2J7U A;  2YBD A;  1NW3 A;  4DE9 A;  4EK9 A;  2VEO A;  4Q2J A;  3A9Z A;  5DRY A;  3SX0 A;  4DE8 A;  3ZPX A;  3QOW A;  3A9Y A;  3ME5 A;  4EQZ A;  3OKZ A;  2HCS A;  4EKI A;  3NZL A;  2XXQ A;  2LLV A;  5DT2 A;  4ER3 A;  3GUU A;  3QFI A;  3GZD A;  3UWP A;  3TEP A;  2HCN A;  2J7W A;  3A9X A;  3GZC A;  3QOX A;  3NXH A;  3R09 A;  4WVL A;  5DSX A;  3M9L A;  3G0T A;  5DTQ A;  3GZD C;  5DTR A;  2LLW A;  3SR4 A;  4EZI A;  3NRO A;  2HFZ A;  3TFL A;  4ER6 A;  2LNM A;  5JUW A;  3VWS A;  5DRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...