1CQTA

Crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
134
Chain Sequence
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*CP*AP*AP*AP*TP*AP*AP*GP*G)-3')
total genus 36
structure length 134
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1cqtA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1cqtA01
2NVXJ 2IVBA 3QPLA 1VPWA 3MKLA 1B8IA 1BW5A 1ZZ9A 3OQNA 3ZHMA 3L1PA 3D1NI 1VF9A 3ZQLA 1ZS4A 3SJMA 3BD1A 2X48A 4X4GA 5GPAA 3GTKJ 5EG0B 3F51A 3I4NJ 3ZQHA 2XPUA 3GTGJ 2E19A 3HOUJ 4M3FA 1BJZA 2FX0A 3S14J 4A3DJ 2AXVA 3LFPA 3E7LA 3K7AJ 2PPXA 4C2MJ 9ANTA 2GRMA 1ZAYA 3PM1A 5E3LA 5HODA 5IYDJ 4IHWA 1R9TJ 2AWIA 1MBFA 5IYCJ 3OSGA 2BNNA 2YU9J 3BR0A 5K7FA 4A3BJ 3GN5B 5E3MA 1WETA 2LK2A 3LSGA 3Q3SA 1WIZA 4Y52J 3MVPA 1U8BA 1RIOA 1LCCA 1JKOC 1YRNA 4PU3C 1Z77A 4FISA 3DNVB 2E2IJ 4BY7J 1FTZA 3CLCA 3BT9A 3ZHIA 2MEZA 1JWLA 4X4EA 3CROL 1IC8A 3BQYA 2E2JJ 3F52A 2PUBA 1Y7YA 2R5YA 2PE5A 2YS9A 1A5JA 1WI3A 5IYBJ 2EBIA 5JLXA 2LKXA 2PMZN 2DA2A 3OQMA 4YG7B 1PUFB 3Q0WA 4YBAA 3HEFA 4XICA 5F0HA 1CQTA 2PUFA 3OIOA 3JREA 2DMQA 1L1MA 3S2DJ 3S1RJ 2AW6A 3GTPJ 3UFDA 2FQ4A 3BTJA 2EZHA 3C2BA 2R5ZA 1UXDA 2GM4A 1DU0A 2DTZA 2AXUA 1JH9A 2LY9A 3KXAA 5M5WJ 1LFUP 4X1EA 2H1KA 1P7IA 2E2HJ 4F8DA 2JA6J 2BNOA 2O9LA 2LLKA 4A3JJ 3S1MJ 2ICTA 2KT0A 5F08A 5DS9A 3Q0VA 5J1YA 1Y1WJ 3QYXA 1E3OC 2OFYA 1H8AC 1QP4A 1YRNB 4JP0A 3VK0A 2XB0X 5M5XJ 3WHBA 1R69A 4M3EA 1ZK8A 5K98B 3LSJA 2L8NA 4Y42A 1G2HA 2LR8A 5EF6A 1ETVA 1ZZBA 4L5EA 4RDUA 3ZQGA 4UUSA 2VUMJ 4UUTA 2CUFA 2FJ1A 4PU8A 2MG4A 3HOZJ 3RKQA 1H89C 3S1QJ 2R63A 3TEDA 1ETXA 2HYJA 5FKLA 1PRUA 3G1LA 1MH4A 3SCHA 3LSRA 2JMWA 2DN0A 2ID6A 3GN5A 4X4CA 2CJJA 2DMTA 4IA8A 2XPWA 1W0TA 1K61A 3H3VK 1RPEL 3JRHA 1MNMC 4I6TA 1RZSA 3TRBA 2LCVA 2E1OA 2HOAA 2MGQA 3BR1A 4D7MA 2XJ3A 1QRYA 3HB9A 2LYJA 3OMTA 1DU6A 5FLMJ 5F0CA 4J1WA 3BR6A 3IH3A 2AUWA 2O4AA 4A3FJ 5F0FA 1SANA 3CCYA 4AYBN 1B72B 3BTIA 1MBJA 5FLVA 4JCYA 3MN2A 4IEJA 2CRGA 2ELKA 1UHSA 1IV6A 2CU7A 1NERA 2FJRA 1ZKGA 3JRIA 2NS7A 2IUOA 1IDYA 3OP9A 1IRZA 1OFCX 1FTTA 1X58A 3BS3A 2R1JL 1JJ8C 4A3IJ 1ZZ7A 2M2EA 2XCJA 1IUFA 4BXXJ 2AXZA 1RZRD 1HF0A 4B3AA 5EGOB 2Y0SN 4QTRA 1PERL 2I10A 3EUSA 2R0QC 2HOTA 3TW7A 3K2AA 1RESA 1ETWA 3IH2A 4FTHA 3SCFA 1ADRA 2L7MP 2XI8A 3FISA 3HOWJ 3OSFA 2EQRA 4MFDA 1U9OA 2JVLA 1XG1A 4W1UA 3GTOJ 1EF4A 3GBFA 2L9RA 3ZKCA 2EWTA 2OPTA 2AHQA 5IP9J 5EDNA 2KEKA 1QQAA 2PUGA 1LE8B 2YUSA 1I50J 1SQ8A 3G1MA 3PO2J 1JFSA 3R1FA 2GLOA 5K7ZA 4DYRA 4YG1A 4I6UA 1O4XA 1HCRA 5E3NA 2KZ8A 3LOCA 3FIWA 3O8GA 2HDDA 1F36A 2EZLA 4XIDA 3I4MJ 1Y1VJ 1BDHA 1UTXA 4G12A 1QPIA 1JKQC 4J1XA 4FBIA 1LLIA 2H8RA 3GTQJ 5EZHA 4M3GA 4C3JJ 2JA8J 2WAQN 2R93J 1LCDA 2ME0A 4A3CJ 3GBGA 1WH8A 4GHJA 1RPWA 2DA6A 1VFCA 1UXCA 1MBEA 1GT0C 1S7EA 1MBGA 2LTPA 2XSDC 2JWTA 1JUPA 5M3MJ 3JRFA 3S17J 3ZQCA 3JRCA 1JKRC 2CQQA 3BR3A 1X2MA 2B5AA 1ETQA 3CMYA 1ORKA 4QSHA 3S2HJ 2HOSA 1MBHA 2MW8A 2EF8A 2BNMA 1GUUA 2HSGA 4Z58A 4MIMA 2G0EA 3G1OA 1NTCA 3LISA 3JR9A 2O7OA 3G5GA 3QPSA 4NDWA 2JK3A 2GRLA 2K9SA 5BNGA 3HOVJ 1RETA 1TWCJ 4NDLA 5J1UA 2NVYJ 2Y31A 2VKEA 1F43A 2ME6A 2DMUA 3TP3A 4MFEA 1HDDC 2GBYA 3JRGA 1IJWC 2LYLA 1I3QJ 3F6WA 1MSFC 5J1RA 4D5CA 4CYCB 3BTLA 3QF3A 4B4CA 2LYPA 2ICPA 4X4BA 3A02A 2DA1A 4IHXA 1HLVA 1GDTA 1D5YA 4DYQA 3BTCA 2PUAA 4IWRA 3B6AA 3M4OJ 1ZGWA 4GFBA 1ZVVA 1QP7A 4A3EJ 4MCXA 2VI6A 2X6OA 4X4IA 1JUMA 4FCYA 2M9HA 5F04A 1WCMJ 2HXOA 4A3MJ 1ZUGA 1IDZA 2X9DA 5FKKA 2R5ZB 3IH4A 2LVSA 5EEAA 4A3GJ 3JRBA 2Y2ZA 2WIUB 1JTYA 1TWFJ 4V2GA 4MCTA 4X4HA 2KEJA 3O8HA 2COBA 1TWHJ 2DA3A 1UMQA 4I6ZA 3UKGA 1T33A 3JRDA 4A69C 2DA7A 3NARA 2Y9YA 2LYRA 4ABZA 1AKHB 4PU4C 1X57A 1R63A 4AC0A 1ZZ8A 4O8BA 3GTMJ 2N8GA 1JJ6C 2XPVA 3FYAA 1EFAA 1GVDA 3NAUA 4RBOA 1QVTA 2IVGA 1U78A 2MSYA 5J3LA 1OJLA 2VKVA 1JGGA 4BY1J 3HBLA 4AUXA 2WV1A 1A6IA 3WHCA 1B72A 1OCPA 2K40A 5DTDA 3S16J 3HZIB 4I76A 3QQAA 2HXIA 2LP0A 1JT0A 2PIJA 3OOUA 3HOXJ 1ZR2A 3ZQFA 2R7ZJ 2XIUA 4CYCA 1FJLA 5F1JA 5EG0A 2CROA 2P81A 2DMNA 3U3WA 4D7NA 1QP0A 3VPRA 3DCFA 3JXDL 3HGYA 3PO3J 3H0GJ 3HOYJ 1ZPQA 2IAIA 4OB4A 4J19A 2JA7J 1B8IB 1PRAA 5EGOA 4DZJA 5FJ8J 3A03A 1WGXA 2XB5A 1Y9QA 4JX4A 3FK7A 2NOGA 3SFIA 4JX5A 3FKIJ 1VI0A 4QIWN 3RZZA 3LNQA 3GTJJ 1UG2A 1VNDA 1BW6A 2KDZA 2R5YB 1SFOJ 2AO9A 4Z5HA 4IHVA 2PUCA 3HGGA 4EEFG 1FIPA 3HKZN 2Y30A 2IBDA 2LFBA 4XRMA 2O49A 1WH6A 2KEIA 4HNVA 4I8TA 1ETKA 1PNRA 1BA5A 1AKHA 2IV1A 2EZIA 3HM5A 2HI3A 3F0CA 2K9NA 2B63J 4MLOA 3Q0UA 1OCTC 2DA4A 3RZDJ 4A93J 4Z5DA 2HQ5A 5IOYA 2GZUA 5C44J 3M3YJ 1MBKA 2RAEA 4A3LJ 1MH3A 2WUSR 2IU7A 1JFTA 1T56A 2M8GX 4Y7NJ 5FKNA 2TCTA 4JX6A 1ENHA 2JCGA 2ID3A 1POGA 4FE4A 3ZQIA 1NEQA 1I6HJ 4JYKA 5IP6A 1JKPC 1NK3P 3KJXA 4I6RA 3FYMA 3RQIA 1CJGA 2QCOA 3SDGA 3BDNA 1ZR4A 1K83J 3PXPA 2IVQA 2ECBA 3TP0A 2NS8A 4M3BA 2O38A 5K7HA 1AHDP 2XGCA 5JLWA 3G7DA 2JJ7A 4V2FA 3IVPA 5IP7J 4UUSB 1ZQ3P 1LMB3 4M6VA 2XGEA 1DW9A 1LQCA 2L7FP 4IVZA 3W6VA 3JXBC 1RZRA 2FD5A 4D5FA 1W0UA 2KPJA 2M0CA 3BQZA 3DEWA 4BBSJ 1XWRA 3A01B 1X2NA 4M3DA 2Y9ZA 1ITYA 1ETYA 3CDLA 3MLFA 2XGDA 2LYKA 2L7ZA 1ZZCA 3CECA 4Z5CA 3IV5A 1LFBA 2PUDA 1HDPA 3QQ6A 1AU7A 2NVTJ 4X4FA 4JCXA 1WH5A 3S1NJ 2DMPA 4BBRJ 4LOCA 4X6AJ 5FKOA 1XS9A 3ZOBA 2LD5A 3QWGA 3FK6A 4DZPA 2WB1N 3S8QA 2BJCA 4W97A 1RR7A 1ZTRA 4XRSA 2A6CA 1BDIA 3BG5A 2OR1L 1QPZA 2CSFA 5IPAA 5EYRA 2QF7A 2R92J 5C4XJ 1P7JA 1XC5A 5GP9A 1Z0XA 1APLC 2HINA 5F27A 1B0NA 1JTXA 1WH7A 3S15J 4PU7A 4S0HB 2K9QA 3A01A 1RKWA 2CQXA 1GV5A 5M3FJ 2L49A 3B7HA 4X4DA 3BR5A 2ZB9A 3O9XA 1BL0A 4B1RA 2DA5A 1DWKA 1RKTA 5E3OA 3B6CA 4BKXA 1Q1VA 2L0KA 5GPCA 1ETOA 1MSEC 3H5TA 3OQOA 1U9NA 3LSPA 1NK2P 1FEXA 2PUEA 2JA5J 2W48A 2VPRA 1WPKA 2LYSA 3FMYA 3JXCL 2IEKA 1HOMA 2DJNA 5C3EJ 2XRLA 3JRAA 1QVUA 2LYQA 2M34A 1FIAA 3HDDA 4JQDA 4DW6A 4MO7A 2ECCA 5EZGA 5A7LA 2EBYA 4GQMA 4A3KJ 4YG4A 1OSLA 1PUFA 1TWGJ 4DYCA 1X2LA 1TC3C 1LE8A 5IOZA 4C3IJ 4IHYA 2D5VA 4Z59A 3RZOJ 2CUEA 1GV2A 2OF7A 2NVQJ 2EZKA 4FE7A 4YARA 1TWAJ 4XK4A 3GTLJ 5M5YJ 1IGNA 1H88C 3BG9A 1JUSA 3BR2A 2MQKA 3TW6A 1QQBA 1POUA 4C3HJ 1ZZ6A 2EH3A 2JN6A 1IG7A 2O8KA 3KZ3A 3CQZJ 1JT6A 4FN3A 3SCGA 1YSEA 5C4JJ 4XRSG 5FKMA 3BG3A 2TRTA 1PRVA
chains in the Genus database with same CATH superfamily
1B1BA 2NVXJ 3QPLA 2IVBA 3MKLA 5HLGA 1B8IA 2QSHX 2WB1A 3D1NI 2R7VA 1U2ZA 4P1WA 3FMRA 3TMOA 1ZS4A 4X4GA 4XORA 3O6BB 1K78B 2QWWA 1FYMA 1TTYA 2ZMEC 4XNFA 1C0WA 3I4NJ 2XAJA 3GO5A 2XPUA 2XC7A 3GTGJ 3A9XA 2MH2A 2E19A 1P4WA 3LQXA 4A3DJ 3LFPA 1BJZA 5CPRB 4E7HA 2AXVA 2OTJI 3E7LA 2PPXA 2FBHA 4HYEA 5HODA 1P9QC 4CYDA 1MBFA 3OSGA 4N9HA 1YOVB 2YU9J 3ASNH 3Q9VA 4XSZF 3GN5B 5E3MA 1WETA 3LSGA 1WIZA 4Y52J 1RIOA 4RGXA 1LCCA 5GAEJ 3I5UA 1JKOC 2ZC2A 1Z05A 2XF7A 3Q9SA 2VJ4A 4XONA 4BY7J 3DNVB 4L9TA 3BT9A 3CROL 4NUBA 1YW8A 2HGCA 3CF2A 3F52A 3OYCA 5J47A 2EIMH 2YS9A 1EKEA 1A5JA 2IXSA 3JSPA 2BBYA 2PXQA 2EBIA 1ZG3A 3SFZA 2HYFA 5D8LB 4O3MA 4HW0A 2EFQA 1E3HA 4YBAA 1CQTA 6PAXA 5F0HA 1X1AA 3S8PA 1T2KA 2FEZA 2DMQA 3T5XA 1VQ4I 5HS7A 1MW7A 2FQ4A 4KN4X 2R5ZA 4UVCA 4GCVA 3KL4A 2GM4A 4ZYEA 4XLNF 2Z9OA 1ZGJA 3PE5A 3J80Z 1EV7A 2DTZA 3W3CA 2JRMA 2KRHA 4A3JJ 3GLLA 2ICTA 1Z7UA 5DS9A 3WU2C 1VQ7I 1RC9A 2OFYA 1H8AC 4AIDA 1HKQA 3E6BA 3VK0A 4PFOA 2ETHA 2HVQA 1ZK8A 3BCAA 4KN7X 1TT0A 1ETVA 5J6XA 4C30A 3ZQGA 1WJBA 2ZXJA 3CMAI 4UUTA 3RJPA 2FJ1A 4PU8A 2UUZA 4MTEA 3SDBA 4OWRB 4HNTA 4CUGA 5FKLA 1H0MA 2I8DA 2K7LA 1PRUA 2BY2A 1XMAA 2CJJA 3H3VK 1WI9A 3A0BC 3JRHA 4I6TA 1RZSA 3HHHA 1RI7A 1W5SA 4ER7A 1VQOI 2MGQA 4D7MA 3BR1A 1TNSA 2LYJA 3KP4A 2VQGA 4F55A 1DU6A 4L18B 1I5ZA 3BR6A 2KQRA 5ILUA 1LEBA 2AUWA 3VB2A 4A3FJ 4KDPA 1NW3A 1SANA 2BEOA 1AWCA 1H9TA 2XV4S 2MA3A 4F93B 1S29A 1USTA 3EETA 1WVRA 1EH8A 3QFIA 1BIBA 1R4MB 1UHSA 3VSLA 2CU7A 3F6OA 2NS7A 3C1DA 1IDYA 3OP9A 1X1CA 2AXLA 2VXDA 1FTTA 3ZPLA 2W00A 2R1JL 2D1VA 1JJ8C 2EFPA 2M2EA 2RNGA 1UFMA 4BXXJ 3GZ5A 3KLNA 4QTRA 1PERL 3DTIA 4GXOA 3BJOA 3EUSA 1RESA 3GFJA 5D5UB 3KETA 2KKOA 3I55I 4WXDA 4FTHA 1EH7A 2L7MP 2O8XA 2RV8A 3BOQA 4OU0A 3FISA 3QODA 3HOWJ 1R00A 3R61A 4MFDA 1J0RA 2ICWG 2OAZA 3WTZA 4EQZA 2VQHA 2OPTA 5IP9J 3F6VA 2ESNA 5EDNA 1OISA 1LDJA 1X1BA 1YIOA 4LMYA 4U7BA 1LE8B 3IAS2 3BCBA 2PBIA 3VOEA 1I50J 1SQ8A 5HLTA 3G1MA 1YHQI 3AL0B 5J8CA 2GLOA 5K7ZA 3RIRA 1K4TA 4I6UA 1IO2A 5E3NA 3O8GA 1G59A 1J7KA 2E1MB 3J7YJ 2J5PA 3H5AA 1UTXA 1MGTA 4BH9A 4QPOA 2WAQA 3EUKL 4GGGA 4HSRA 5DTQA 1LCDA 1BI2A 2R3SA 4AIJA 4GHJA 1UXCA 1MBEA 1D1AA 1U5TB 2DT7B 2QYOA 1MBGA 2LTPA 3SX0A 1QA6A 4V19K 1LPQA 3E6DA 3QWLA 4RGSA 1PP7U 4IXAA 2F5CA 1JKRC 3AFHA 4II2A 2Z33A 2M30A 3E5QA 4Y13A 4QSHA 2HOSA 3D5RC 3IRRA 1GUUA 4Z58A 4CHUA 2V1NA 2G0EA 4CA0A 1QHHD 2L3DA 3BPVA 1NTCA 3LISA 2IT0A 1OCCH 2F5VA 1VQNI 1W4MA 3PFIA 1IN7A 2JK3A 5JR3A 1LFPA 5H20A 4XOPA 2PEXA 4AD9A 1TWCJ 1OMIA 1SVOA 1L3LA 3FXUA 3I71A 1FZPB 3RI4A 1F43A 2ME6A 5GTHC 2PXBA 4Q48A 1W5CC 4P96A 1D0ZA 4AU7A 1UB9A 5HLHA 1LUJB 4G7OF 3P7NA 3TELA 1RRJA 1IJWC 1F9NA 4ASNA 1D0YA 4UVAA 3DXJF 4XSXF 5CQEA 1CF7A 2XXPA 2K86A 3ZMTA 3BTLA 4B4CA 1EJ9A 4X4BA 4MEXF 3A02A 2DA1A 2MYSA 1HLVA 1LEAA 2ISYA 3BTCA 2PUAA 3B6AA 3VSKA 1SD5A 1ZGWA 1ZVVA 2GAUA 2K4BA 4BGDA 5FFXA 4E7KA 2K27A 1M1EB 2F4MB 2NYXA 3GUDA 4KT6A 2VI6A 2ZFWA 4ZDOA 4X4IA 2C6YA 5LBQA 2M9HA 4CCLA 2R4GA 3J80K 4DE9A 2DK5A 2HDCA 5FRNA 3ZCOA 2R5ZB 5TISC 3HRTA 5L3DA 3IH4A 2LVSA 3K1MA 3N97A 2KLOA 1K6YA 1R1VA 1TWFJ 1Y8QB 2KEJA 4L9VA 3O8HA 1KQ0A 2XKPA 4KIGA 2DA3A 2WBMA 1VQMI 1PDNC 2HYGD 3NARA 4KISA 3CCUI 4ABZA 1IRXA 2H94A 4PU4C 3MFKA 1R63A 4O8BA 3DF8A 4F7ZA 3GTMJ 2N8GA 2ZSHB 1PYVA 3BY6A 3J81K 2HCNA 1GVDA 2CO5A 1U78A 4ER0A 3A0HC 2VKVA 4HF2A 2Y69H 1WZ2A 1WJEA 2JUCA 1ZG1A 4HOBA 4BY1J 3N4MA 5B1BH 4KT5C 4EJTA 3OIPA 4AUXA 2XAQA 5IY5H 1IZ1A 2K40A 3ZMSA 4KITB 4I76A 4GDFA 3OOUA 3HOXJ 4G7HF 2R7ZJ 1YW9A 5JHUA 1OCRH 1MD0A 5F1JA 2P7CB 2CROA 1FOYA 1T39A 2DMNA 1R1TA 3ASOH 1QP0A 3SEZA 4AYBA 3PO3J 3OYKA 4A6EA 1FSEA 3E1SA 3KP2A 4IJAA 2X1EA 3WTTC 2W82A 4DZJA 1U5TC 1FMWA 1SVMA 2BHZA 1QQIA 1WGXA 2P8TA 2XB5A 2FE3A 3DKWA 4JK1X 2Z99A 1AA7A 4HSTA 3FKIJ 2RQQA 4DBRA 3FBIB 5CVVA 5B5EC 3W2WA 3RZZA 3LNQA 1UAAA 3MAJA 1BW6A 2MC4A 2PJPA 1SAXA 2VN2A 1TBXA 4OOIA 2PUCA 4EEFG 1FT9A 4BQNA 4XRMA 1YQAA 1WH6A 3BC8A 3MEXA 3NWSA 2YSRA 5E18F 1AKHA 4PSXA 3HM5A 1IXRC 2X51A 3TOAA 2DA4A 4A93J 4XLAA 3KYCB 4P5OA 3OS0A 4EQQA 1ZGAA 2RAEA 2M45A 1MH3A 2CW0F 1YW7A 2DYRH 2TCTA 2D2WA 3DP7A 2BY1A 1HBXG 2JCGA 3T1BA 2ID3A 4L5IA 4FE4A 3ZQIA 3ZXSA 4JYKA 2A05A 2YPRA 4O5VA 4LB5A 4WX9A 3HUGB 1GXPA 3RQIA 3AG3H 3ZMDA 3L09A 2PX9A 4N4NB 3BDNA 1KU9A 4CCOA 1ZR4A 2ZJ2A 1NHAA 4ETSA 1U5TA 2XGCA 2QA4I 4BDYA 3G7DA 3IVPA 4UUSB 1BI3A 1OYIA 2EV5A 2KRCA 4ON0A 2XGEA 4ZDPA 2EIJH 2ZNYA 3CP8A 3PL8A 4OIPF 1J59A 3H5NA 1Z21A 2RC4A 3HOSA 2YBDA 1ULYA 2KFDA 5DTRA 4D5FA 2KPJA 3LAJA 3A01B 1X2NA 2HZDA 4MTDA 1JE8A 2HNHA 3H3ZA 2L7ZA 1ZZCA 3IV5A 2VL8A 3GX4X 3QQ6A 3T8TA 2DYSH 4EVIA 3NDBB 2G7UA 4U0VA 3MEJA 2VQLA 2L54A 2A6TA 1QHGA 5FKOA 1CF7B 2EILH 4ER3A 2LD5A 4DZPA 3F9KA 2RREA 1DP7P 3R6SA 5LGTA 1ZTRA 3C3WA 5AIPA 1HQCA 2STTA 3DV8A 5LEKA 2L01A 4TV7A 2XASA 2HQAA 3EPZA 2W1OA 3GZNB 5IPAA 1UHWA 3U1DA 4AIKA 2QF7A 3LFUA 3PNYA 4P9FA 3CJRB 3MZYA 1PP8F 2R92J 4EKGA 1APLC 1XC5A 1Z0XA 3HOTA 2ZMEA 4IF4A 1B0NA 3H9GA 4DE8A 5LHIA 4S0HB 3A01A 1RKWA 3LSHA 2L49A 4X4DA 3O9XA 3ABTA 1DWKA 1RKTA 2KL4A 3WODF 1Z3XA 3B6CA 4CZCA 1R36A 2KRFA 2EPFA 2JPCA 4HQMA 1ETOA 3LA2A 4IL6C 1J75A 1ZYRF 3RCOA 3FF5A 4KJZA 3G73A 3GYHX 2VPRA 3I64A 1I1GA 2DOEA 4FASD 1XTAA 3BJ6A 5C3EJ 3JRAA 4C2TA 5KK1A 3UNGC 2H27A 3HSEA 1OLTA 2M34A 4F3QA 3HDDA 2M0MA 1JHHA 1T8IA 2JPBA 3R4KA 1OSLA 1E2XA 2HDWA 1TC3C 2HKOA 3L2RA 5IOZA 3VFZA 4C3IJ 2QM3A 4Y15A 3RPUD 3J7ZI 3M9LA 2NVQJ 4XK4A 2R7RA 3GTLJ 3COAC 1H88C 2H09A 3BG9A 1YLFA 4DOZA 2EH3A 2JN6A 1X1PA 2GOMA 2FRHA 4GYIA 2XDVA 2QQ9A 3W6JB 4XRSG 4HDUA 3BG3A 3L9FA 3BWGA 4PUSA 1VPWA 4MNUA 3ZHMA 3OQNA 2CGPA 1LVAA 5ICFA 3L1PA 4HDVA 5CVJA 3DM5A 3J7AO 3OWQA 2NS0A 3HTUA 2LDUA 2VXZA 3DLAA 1BBYA 2W24A 4LFUA 2M4GA 3JAMK 4P9UA 3HOUJ 4GO1A 5LEJA 3WTXC 2ZXWH 3GW2A 3PM1A 3ZRGA 5IYDJ 3HC7A 1DGWY 4IHWA 2HPIA 5A2QZ 2BNNA 5IYCJ 4XN3A 3BR0A 5K7FA 4A3BJ 2LK2A 5TJJA 3Q3SA 1BOBA 3OYMA 4ZYHA 4PU3C 1IN6A 4IOCF 3K2ZA 4LITA 3F22A 1JWLA 2XGXA 3BLYA 2E2JJ 1TQPA 3RPUA 1FWZA 2PUBA 2F2EA 2R5YA 4I99C 1S5LC 2MABA 2IS2A 5IYBJ 1X3UA 4JOMA 2LKXA 2PXFA 2DA2A 4YG7B 1PUFB 3Q0WA 1FPQA 2PJRB 2JQ7A 2FOKA 3U2RA 1DUXC 4CCJA 1WJAA 2AW6A 3ABUA 2EWNA 3C2BA 2WWYA 2VBZA 2H6CA 3M8JA 2XAGA 2R7OA 5D4SA 1YO5C 2LY9A 4AM3A 3KXAA 3VDXA 1LFUP 2PXEA 1P7IA 1BI1A 4F8DA 4IPAA 2IVMA 1KGSA 2O9LA 2LLKA 4D0PA 2KT0A 1DPUA 5J1YA 1Y1WJ 1YJ9I 2E36A 3TOBA 3R09A 4JP0A 2MFZA 2XB0X 2BXZA 5M5XJ 1R69A 2FNAA 2HS5A 5KNLA 1G2HA 2KJCA 1O3QA 1ZZBA 4UUSA 1XSDA 1CGPA 1X1DA 2CUFA 3UR3C 3CO6C 4BYYA 5DSXA 3QU6A 3E5XA 3RKQA 2QQAA 1XPXA 3BG6A 3S1QJ 2R63A 1YX3A 2PXDA 3LSRA 2DN0A 2ID6A 4X4CA 3F8NA 2FMLA 3MKYB 1W0TA 1K61A 1RPEL 2R7QA 3TRBA 4UUVA 3I53A 2LCVA 2WA0A 1YTYA 3K4KA 2LREA 2IGKA 2YR2A 3OMTA 4AWXB 2WAFA 5FLMJ 2FF4A 3FX3A 4J1WA 4S04A 2X6YA 3W2VA 2O4AA 1Y0UA 1KA8A 5JUWA 5F0FA 3PSIA 1LQ1A 3NXHA 3CCYA 4AYBN 1T0FA 1B72B 3ZPXA 5CVUA 3K70C 2FA5A 1XDUA 3TO7A 5DEQA 4JCYA 4XQFA 4IEJA 2DCEA 3K9TA 4E7SA 3IUOA 1IV6A 3DBRB 3JRIA 2IUOA 5DD4A 4XL9A 2FNPA 1IRZA 2XKOA 2F5EA 2KIFA 2LH9A 3F72A 1UJ8A 1IRGA 1OCOH 1MNEA 3S32A 1ZZ7A 3P9IA 1G3SA 1RZRD 2AXZA 2DO7A 1L0OC 4B3AA 5HVQC 5EGOB 2EA4A 4EK9A 3QOWA 2I10A 2J5OA 2VB6A 4N9IA 2R0QC 2HOTA 1HA8A 3K2AA 1BN5A 4LG0A 3TGNA 3A4CA 4EV0A 3OYGA 2ZKZA 5J4VA 1T08B 3MQ0A 1U9OA 4EZIA 3CCRI 3GTOJ 1EF4A 3GBFA 2VOOA 2ZJPF 2L9RA 4KUMA 2EWTA 3S3MA 1WKMA 1G3TA 3RQ4A 4IHSA 3DFGA 1VQKI 2PUGA 2WY8Q 2KHMA 2YUSA 5FB2A 2YX7A 5FROA 3HRSA 3KEYA 3VODA 4ENKA 1JFSA 1NG7A 3QOXA 2K9LA 2MC3A 2OZUA 3OOPA 4DYRA 4YG1A 5D4RA 1HCRA 2IJLA 2HDDA 1F36A 5CYVA 3I4MJ 3ESWB 1BDHA 4G12A 3EUAA 3LMMA 3BPXA 3M1CA 4XLFA 4U87A 4M3GA 5EZHA 1Z6RA 2JA8J 2WAQN 2ME0A 4C2UA 4LG0B 1R6RA 1RPWA 3LSKA 1R5HA 4HG2A 2XAHA 4LK1F 1S7EA 1SD7A 4KMUX 4L9NA 2XSDC 1JUPA 2BVMA 4RLQA 3S17J 2PMZA 2CQQA 2RKHA 3GVAA 2EIKH 3FM5A 3LA3A 2VJIA 3ABLH 3HL2A 2EF8A 2BNMA 5JFRA 3OR2C 3G1OA 1SFKA 5D5WB 1T6SA 2CV1A 2KIQA 2O7OA 3ZQQA 5EEGA 1LVKA 1T98A 3ML6A 1Z3YA 3CCJI 2GRLA 2K9SA 5BNGA 4NDLA 5J1UA 3TFLA 2Y31A 2DFHA 2E1CA 3TP3A 2M4KA 5DM6F 1SD6A 1TQIA 4OINF 1MJAA 3F6WA 4HX8A 2OZ6A 3BZCA 4D5CA 1EH6A 2LYPA 1H9GA 5CVIA 3G71I 4IHXA 2P5KA 2LY2A 1D5YA 5EJCA 1MFQC 4DYQA 3U9GA 1UZCA 1SEUA 3I58A 5GAHi 2K02A 4GFBA 2YU3A 4HLYA 4CH7A 4EATA 4A3EJ 3N05A 1SC7A 2LLWA 1T95A 3GZCA 1Q1HA 1A6QA 2L02A 1LDKB 1P6RA 1BM9A 2HXOA 2LRDA 4HBLA 4PJJA 4KFCA 3PFYA 3FDYA 1XCVA 1YE9A 5EEAA 3U21A 4X4HA 2R7FA 5ILVA 2OA4A 3WG9A 2F6CA 3E6CC 1FYLA 1T33A 3JRDA 2DA7A 3F8BA 1VQ9I 3KYLA 4JQFA 4M6YA 1A36A 1J09A 4NC8A 1EFAA 3NAUA 4RBOA 4HAMA 2V7FA 2IVGA 2V9VA 4A5NA 2MSYA 2XXQA 4E7ZA 4ZTFA 2LY1A 1D0XA 3GFLA 1QB2A 4BU2A 4RB3C 4G7ZF 3WG7H 1Z7LA 1Z91A 3HBLA 4UB6C 4B43A 2WV1A 3CLOA 5DTDA 3KZIC 5JI6A 3S16J 3UWPA 1UELB 1WFXA 2DOAA 2IGOA 2NXNB 4YIIA 2NNYA 3OY9A 3BJAA 3QPHA 1ZR2A 4CYCA 2HWVA 3GUUA 1F1ZA 1MJ9A 3CP2A 4PZJA 5J8FA 3FXLA 3K1NA 2A69F 3S2WA 4D7NA 3U3WA 2FSWA 2GIVA 4BUPA 3V8KA 2E7WA 2JA2A 3OYJA 2MBFA 4OB4A 2A6EF 4J19A 1B8IB 1PRAA 5EGOA 5FJ8J 2JTVA 1IXSB 1AOYA 2L4MA 4BXUA 2WY7Q 1B59A 2CMPA 3M9AA 3P9CA 1FYKA 3ECOA 4RAZA 3FK7A 5DYMA 1W7PB 2XVCA 1KYWA 4B48A 5IT9K 1MZBA 1ZELA 3C7JA 2E7XA 1VNDA 4CGZA 3L2QA 4XLCA 4E6KG 4IHVA 1I27A 1OQYA 3RDIA 4HQEA 3HGGA 4UXNA 2IBDA 2IS1A 1BOAA 4PGHA 2HKXA 2B63J 2DBBA 2RGVA 3KLOA 5ICCA 2Q0OA 4HF0A 4NB5A 5IOYA 2ESHA 1E0EA 2GZUA 4FT8A 4JBAA 2QEXI 4A3LJ 4ER6A 2WUSR 3IC7A 2QBYA 1JFTA 1T56A 4ZJZA 4Y7NJ 2EV6A 1N25A 4M9XA 4BJ6C 1NEQA 2A5YB 5F1RA 1I6HJ 1OYWA 2VLAA 3K4LA 1NK3P 3KJXA 4I6RA 3E97A 4XKWA 2CQKA 1CJGA 2QCOA 2KMUA 2ZXHA 3G4SI 2IVQA 1XX5A 2ECBA 4HRAA 2O38A 4OBMA 5GAGJ 2OJED 4AVZA 3I59A 4V2FA 2L1PA 5DT2A 2X6WA 3HG9A 1ZQ3P 4IZZA 3EYYA 4M6VA 1MIJA 3CCLI 1YS7A 4UV8A 1R49A 1IRFA 1DW9A 1LQCA 2VC0A 3K10A 4U88A 3KP7A 4CZZA 2FD5A 1MKMA 3MCZA 3QU3A 2VE9A 5DTMA 4YRVA 3BQZA 3CZ6A 1Y8RB 2PQ8A 2V1UA 1PJRA 2WAEA 5LHGA 2UZKA 2Y9ZA 3A9YA 4B44A 3AKZA 3MLFA 2LYKA 1ON2A 5ILSA 3CCQI 4XBFA 2BW3B 5B3SH 3CECA 2CYYA 4H4KC 1HDPA 3FMQA 1AU7A 3FXOA 1R7JA 2DLLA 2L2OA 3WE2A 5LRSA 1WH5A 2P6SA 2F5FA 3S1NJ 2DI3A 1U8RA 1X3WB 4LOCA 4BBRJ 4BNCA 3TO9A 2F48A 2KPMA 2HEOA 3CTAA 1F4KA 1MNDA 2FFHA 1F5TA 3FK6A 1GLNA 2WB1N 3ELKA 2QSFX 4W97A 2XF5A 1RR7A 3DEEA 1BDIA 2GA2A 4L9JA 1KZHA 2VT3A 3DTKA 2P0WA 3DPLC 4HX7A 4K2EA 2Q2EA 4RGRA 3O2PE 1B9MA 3ZMUA 1P7JA 1Y0NA 4A0YA 3S3NA 2HINA 5F27A 4NBQA 3QP6A 4BHBA 1SD4A 2K9QA 2CQXA 3WE3A 5L3FA 1HSJA 3I4PA 1FOKA 2FBKA 2BW3A 1UCRA 2E5ZA 2BYVE 4ENMA 2R7SA 1Q1VA 1O7LA 1G8XA 2DQRA 4BXFA 2DDAA 4LLNA 3OQOA 1ODDA 4EM2A 1NK2P 2MH9A 4LK0F 1FEXA 2JA5J 2CS3A 2JT1A 4RM3A 1WPKA 3FMYA 3JXCL 4HPQA 2V26A 1V5FA 3HRUA 3PNTA 2J7UA 4BQAA 1HKTA 3CCEI 2VEOA 3FWEA 3C18A 1WRJA 1QVUA 1MDMA 2Z5UA 4KIBA 4YIRX 4U7DA 5JVGF 4MO7A 3GFIA 3T8RA 4RA2A 5A7LA 2CV0A 4GQMA 2J7WA 3WGHA 1K79A 1PUFA 1KU3A 2Q2EB 2UXXA 1BIAA 2Z1DA 1LE8A 3RZOJ 2OCEA 2Y75A 5CQGA 1V3FA 1G3WA 1IGNA 1JGSA 1JUSA 5DRYA 1P92A 2V1XA 3CQZJ 1JT6A 4FN3A 1I6XA 4LIVA 4IKFA 2DT6A 2NVUB 2XRNA 4HV5A 4ZC3A 2IP2A 2OUMA 4YG2F 3A9ZA 3LWFA 1BW5A 5DCMA 4KYWA 4E7IA 3MD2A 2GXAA 3KEQA 1VF9A 1X19A 3F8MA 3K4JA 3V4GA 2X48A 4CCNA 3CUOA 5GPAA 2MXDA 5EG0B 3F51A 3GXOA 3GFMA 3ZQHA 4OIQF 1VQ6I 2CUJA 5HOOA 4M3FA 2FX0A 3S14J 2FXAA 3K7AJ 1DPRA 4FQGA 4C2MJ 1ZAYA 1TNTA 5E3LA 3RYRA 2CG4A 1R9TJ 4ANJA 3OYIA 4ENJA 4AIHA 3HPHA 4WXHA 2FQ3A 3MVPA 1V55H 4HNUA 1YRNA 5F64A 3WGIA 5E17F 2BVLA 3NWTA 3CLCA 2G7HA 3EDPA 1G6NA 2PE5A 1ZHFA 1T0FC 4ESJA 3TEPA 2PMZN 3MMYB 3PIPF 3OQMA 3IRQA 4LLLA 5TGTA 3DBLB 4IVNA 2I5UA 4XICA 4D1QA 1O3TA 1UG0A 3JREA 1L1MA 2PUFA 5ICEA 1OCZH 5B66C 4E70A 4HX4A 3S1RJ 3HPGA 3GTPJ 1K78A 1D8KA 3BTJA 4Z6YA 3TO6A 3RYPA 4R79A 1W36D 2QBYB 3PIOF 2LNMA 1DU0A 2DPDA 5H6RA 2AXUA 2NAZA 1QZYA 5TRDA 2H1KA 5FFZA 2NOJB 3Q5FA 2HVSA 3HSRA 2BNOA 4EM0B 2STWA 2VQCA 5D6FA 3QYXA 1E3OC 1YRNB 1DP3A 4EJUA 2GXBA 5HLIA 3WHBA 5HS8A 3ONQA 5LRRA 5K98B 3TDUC 1VQ5I 3LSJA 2L8NA 3DPTA 2LR8A 3HRMA 4XKVA 5EF6A 4L5EA 4KNYA 2PMUA 3DLLF 5BMZA 2VC1A 1S72I 3WTYC 3DKXA 4LGWA 4O6JA 1H89C 3TEDA 1ETXA 2HYJA 3SCHA 2MLKA 4RMNA 1FNNA 4ZTJA 1MNMC 1WJCA 2IRFG 1FSHA 2E1OA 1RR8C 2XJ3A 5GTIC 1QRYA 5F0CA 3X2QH 4EM1A 4F92B 4IX7A 1MMSA 2HTJA 3OYDA 5H2FC 3BTIA 1LDDA 3H5RA 2RDPA 4BAYA 3ZN0A 5FLVA 4EJOA 2FU4A 1SMTA 2CRGA 1YYVA 2DQLA 3OIQA 3ISPA 2ELKA 2DPUA 3H9JA 1VQLI 3DWLE 1NERA 2FJRA 3KZZA 1ZKGA 1OYYA 2O5RA 2RN7A 4E7LA 1HW2A 1QZXA 4LD5A 3LSIA 2IA2A 1OFCX 5D5XB 2D45A 1X58A 1IXCA 4BQQA 4A3IJ 4NHJA 2OCCH 2XCJA 1IUFA 2BXYA 2DFFA 2EA2A 2Y0SN 3JSOA 3V7CA 4F91B 3TW7A 1W36C 3SR4A 3IH2A 5K5QA 2DDBA 2PLYA 1RUNA 1MDMB 2EQRA 5FO5A 2JVLA 2L5QA 4W1UA 1BR4A 2BV6A 1NG6A 4BHPA 2Y48A 2AHQA 2ZJRF 1FP1D 3H35A 2AQEA 2JSPA 4HEA2 5BQTA 2H6BA 2EB7A 5DDGA 1YIJI 4DGWB 2M7AA 2LG4A 3WTUC 3V42A 3R1FA 2M3AA 2OV7A 2KZ8A 4WF2A 3CF5F 2DJIA 4UHTA 4XIDA 2A68F 3OYAA 1Y1VJ 1QPIA 1JKQC 4N0BA 4J1XA 3M7GA 4AVPA 1VTNC 4FBIA 2H8RA 2X4HA 1XGMA 3FBNB 3GTQJ 3JW4A 2K5CA 2R93J 3CCMI 3GBGA 1O57A 3PNVA 3CMEI 1VFCA 2E60A 4R1HA 2B9SA 3OWTA 4EMSA 2KIMA 2LMDA 5K1YA 4HV6A 2JWTA 4FX4A 2EFWA 3ZQCA 1XN7A 2QKMB 5D6EA 3JRCA 2PN6A 4MGRA 3ERED 3CMYA 3S2HJ 1W1WE 2H1LA 1MBHA 2R7UA 3GZ6A 1FBQA 2HSGA 4I01A 4G8XA 5GAHJ 3D5LA 1DGRM 5DD8A 1FMVA 3D0SA 2ZO4A 3JR9A 2PFBA 3RKXA 3QPSA 1RIOH 4NDWA 2OQRA 3HOVJ 2DAOA 2M87A 3E5UA 1A31A 2VKEA 4U0WA 4WWCA 4L0ZB 3BZ6A 1QNTA 2DMUA 4UNOA 1HDDC 4OAZA 2KJBA 2PXUA 1UHMA 5J1RA 3PJRA 4CYCB 3QF3A 3G0TA 4WCGA 4ZYDA 1GDTA 3AAFA 2DOFA 4OMZA 3M4OJ 1U2WA 3IP4B 2L7KA 4IHTA 1XD7A 1QP7A 2HCSA 1IN8A 2X6OA 2ZXIA 2OTLI 2LF7A 1FBUA 1JUMA 2ZFUA 4FCYA 4UY8I 1XB4A 4A3MJ 1WCMJ 5GAGi 5L3CA 1ZUGA 1IDZA 3BZKA 3ROUA 2R7DA 5FKKA 4IQ4A 3TBIA 3JAMZ 3JRBA 2WIUB 2CQNA 1QBJA 1D5VA 2JZYA 2V3CC 2QUFA 4E4HA 1UMQA 4I6ZA 5IT9Z 4A69C 3E0JB 3K4BA 2XIGA 3ZMZA 2W25A 2Y9YA 1K6OA 1X57A 1ZZ8A 4AC0A 4Q4ZF 3FYAA 1PUEE 2QSGX 3V8JA 1B4AA 2FUG2 4B09A 2O0YA 3CUQB 2Y0MA 5J3LA 3B73A 5ICGA 1OJLA 5DRTA 2IA0A 3P5JA 1X4OA 3MZ8A 3OL4A 3ME5A 4WK8F 3E3VA 2VKDA 3W2AA 2XUBA 3HIFA 2CFXA 1FP2A 5L3EA 4M73A 2LP0A 1V4RA 3E6MA 3KZYA 4ZZDA 3F23A 4OIOF 2PIJA 2PXVA 2KZVA 2CH0A 1R1UA 3KEOA 3SZPA 1FJLA 1ZRCA 1BR1A 2QQ8A 4OMYA 3R60A 1I39A 3FXRA 1FOWA 2P4WA 2HOEA 3DCFA 3JXDL 4P55A 3I0TA 3SZTA 1ZPQA 4I2OA 1V54H 2IAIA 3K6GA 2GWRA 1KONA 3A03A 3SXYA 2DTRA 4M71A 4I0AA 1Z1DA 3SQNA 2L4AA 4JX4A 2NOGA 3SFIA 1HSTA 3NROA 4JX5A 1GHCA 1VI0A 4ESFA 2LNBA 4G9YA 4MHGA 1UG2A 2R5YB 2KDZA 4NC7A 1SFOJ 2K3PA 4XLPF 1FOXA 2VASA 3HKZN 1YI2I 5KHDA 2MD0A 3HTSB 2O49A 2F5DA 2KEIA 4HNVA 1XCBA 1ETKA 4I8TA 4Z2YA 5HS9A 2WC2A 1PNRA 1FBSA 1J5YA 3F0CA 2K9NA 1XGOA 4MLOA 4Z5DA 1YITI 3DQVC 1IV8A 3CJTB 2HQ5A 4DJAA 4OAYA 5JHFA 1MBKA 1G3YA 1ERDA 5A2QK 2IU7A 3PQJA 1E3PA 5BOXA 5FKNA 3M07A 3A1YA 4JX6A 3WU0A 1ENHA 3K70D 1I1SA 3PUBA 4YFXF 1SFEA 3FXMA 3HZJA 3KYDB 3ECHA 5IP6A 1P4AA 1R23A 3TQNA 1YX5A 1JKPC 3I56I 2PJRA 2TDXA 3SDGA 3ZR8X 3NZLA 3LSTA 1K83J 3L7WA 3G6EI 3FXKA 5E1XA 2NS8A 4Y17A 5JLWA 2JJ7A 2QLZA 3AL0C 2HFZA 4LLGF 4RS8A 2O61A 3GLXA 4Y4RA 1W7PD 5DUKA 1LMB3 2NNNA 3DU5A 1TL8A 1HW1A 3RSNA 3VYSB 2L7FP 4IVZA 3PQKA 5ERIA 2HPMA 3T0YA 5K5RA 4ZYAA 1FY7A 1RZRA 2W84A 2AXTC 5L3GA 1W0UA 2M0CA 3OYFA 3DEWA 2K9MA 4BBSJ 3LL7A 4BE2A 4M3DA 1ITYA 1ETYA 3HHGA 3CDLA 3DPUA 2XGDA 5LGUA 1K4SA 1QU3A 2IS4A 2PG4A 1LFBA 3ABKH 2PUDA 2M7BA 4IRIA 2CQ7A 3HUGA 2NVTJ 1GXQA 3RPQA 2DMPA 4NQWB 1IUYA 3RKWA 4X6AJ 3QRFF 4IOAF 4UB8C 5DCFA 5FLXK 1BR2A 2FBIA 4RAFA 2OU2A 3H1CA 3ZOBA 5FD6A 3QPTA 5FRMA 4I7HA 3QWGA 2K3FA 3S8QA 2BJCA 2HQNA 1O3SA 2AQFA 2A6CA 4PJLA 2EV0A 3BG5A 3LA7A 2OR1L 4BACA 3ZN1A 2GIZA 1D1CA 1DQUA 5EYRA 3VWSA 2V4JC 3QOEA 2IA1A 2ADUA 3GMEA 5E1ZB 3CJQB 1QGPA 2ODRD 2DFIA 3HSFA 4PJMA 3CESA 3TDZC 1TT5B 5LLQA 1GV5A 1S8NA 4XN0A 4CCMA 3B7HA 3BR5A 2ZB9A 3GCMA 4B1RA 2CWEA 4XKCA 1ZREA 5BS6A 4PGGA 5GPCA 1IN5A 1MSEC 5DM7F 4PK4A 1LJ9A 2A61A 4DBQA 1N75A 3EUHA 2OC6A 2W48A 4M9SA 4XOTA 1STZA 4XR6A 5GADJ 1T38A 2LYSA 1ON1A 2PXTA 4YFNF 3K69A 1HOMA 2DJNA 3OYBA 1U3EM 1IN4A 2LYQA 2LKSA 4DQ2A 2W7NA 1FIAA 2R7XA 5E8IA 2ECCA 5EZGA 2LBFB 2VE8A 4E7JA 2EBYA 4YG4A 4A3KJ 2Z2SB 3BDDA 1JHFA 1ZG5A 1TWGJ 4RLFA 2HTSA 5HNFA 1GVJA 4RB1A 4EGYA 4Z59A 2VIXA 2EINH 3R0AA 4ZZLA 1GV2A 2A3SA 2OF7A 2EZKA 2OD5A 1J9IA 1TWAJ 2DK8A 5M5YJ 3BR2A 1WJ5A 1BJAA 3CUQA 4C3HJ 1IG7A 4M6XA 3EYIA 2W4SA 1YSEA 2HR3A 5C4JJ 3V8LA 4KMFA 1JI8A 1MMGA 3V7SA 2TRTA 2VOPA 1PRVA 4IQJA 1ZZ9A 2MD5A 2Q8KA 2X6XA 3J7AY 4F52A 3F3XA 1HXDA 2IGMA 3C2HA 3ZQLA 5H6QA 3SJMA 1LB2A 3BD1A 2M4HA 2LSOA 3GTKJ 4NNJA 2IW5A 3FKJA 4ZDLA 3REOA 2DODA 9ANTA 2GRMA 2JQEA 1SFXA 1O7FA 2AWIA 5ED4A 1RZ4A 4OIRF 1V5EA 2WTEA 1U8BA 4Q2JA 4A5MA 5LGNA 1Z77A 4FISA 1VQPI 4FETA 2X85A 2E2IJ 4HF1A 2IPQX 5IT3A 1FTZA 3GZDC 2MEZA 3ZHIA 2X0LA 4X4EA 1WWXA 3BQYA 2W57A 1IC8A 3I54A 1Y7YA 2VONA 1WQ2A 1TLHB 1OR7C 1DDNA 1WI3A 5JLXA 3ZMVA 1OPCA 1SAUA 2XAFA 1RUOA 5E20A 3HEFA 1SVLA 2VBWA 3QAHA 3OIOA 2VODA 3S2DJ 2JVHA 3UFDA 2ACJA 2EZHA 2PXKA 4II3A 1UXDA 4G6QA 1JH9A 2MLGA 4BS9A 4EKIA 5M5WJ 3OL3A 4X1EA 5HDKA 5J4YA 4R8HA 2E2HJ 5DUIA 3MWMA 2JA6J 1MMDA 2KP6A 2PMHA 3DTEA 1Z67A 4XLHA 4MQ9F 4QPQA 4EJWA 3HXLA 3IKVA 3S1MJ 5F08A 5DCMB 3Q0VA 2DXIA 2Z3YA 1QP4A 2L9SA 2Q1ZB 1SFUA 4M3EA 3M1EA 3KP5A 3EUHC 4Y42A 4WXCA 4RM2A 1P2FA 4RDUA 1TQMA 4Y3OA 2X1CA 4C9YA 2VUMJ 3QOPA 2MG4A 1B9NA 3HOZJ 2XXAA 4ESBA 1WJFA 5E1WA 3CJNA 3G1LA 1MH4A 5LHHA 4J01A 2JMWA 3CLQA 3MKZA 3GN5A 2PXPA 1QZEA 1S9HA 2DMTA 4NC6A 4IA8A 2XPWA 4MQVA 4M9ZA 1VZ0A 2Y0SA 1Z9CA 3BP8A 3OV8A 1ZAOA 2VBYA 2HOAA 4G6DA 3HB9A 2JRTA 5F6FA 3LSMA 3IH3A 2KISA 2WADA 1ZRFA 5JVTA 3TL4X 5HNHA 3SEQA 3CO7C 2XAUA 1N78A 3G2BA 2FMYA 3JTHA 3NRVA 5K5OA 3IL2A 1LNWA 4BJTA 2ISZA 1TP4A 3CC2I 1MBJA 1RNLA 1LKXA 3MN2A 3WGGA 2GXGA 3S3OA 3JTGA 1R4NB 3PSFA 3LQQA 3BS3A 3OYNA 3KCCA 3RKYA 2VT2A 4PJ0C 3KP3A 3KX2A 1HF0A 2QGUA 2LF8A 3OYLA 4LIUA 4S05A 2FOWA 3O3KA 3GWZA 2QKLB 1TZLA 2ZMEB 1ETWA 4LB6B 1HQ1A 3MKWB 2ELJA 3K1PA 3F21A 3SCFA 1KU7A 1ADRA 4CO8A 2B0LA 3GEZA 2H8WA 2XI8A 2BGCA 3OSFA 3GZDA 3B02A 1XG1A 3WU1B 4HLXA 5LD2C 3VWBA 3ZKCA 2BHYA 4QLCU 2KEKA 4YEJA 1QQAA 2K4JA 2ZCWA 2F4IA 3ERMA 4ZH4F 3PO2J 5DV5A 1REPC 4A0ZA 4BQOA 1O4XA 3RTRA 3LOCA 3FIWA 3I59B 5KCMA 4HRIA 2R7TA 3VYRB 2EZLA 5E8GA 4ER5A 1WHUA 2LBFA 4RB0A 2COMA 2V79A 1Z6TA 2CUZA 3NQOA 4XKBA 4B3XA 3AG1H 1LLIA 2YX4A 5AONA 2D1HA 2DW4A 2O03A 4LG3A 3GF2A 3VYTB 4C3JJ 4CICA 3H0DA 4D9JA 3OYHA 4A3CJ 1WH8A 2LLVA 2DA6A 2F4OB 3H36A 3CC7I 1GT0C 1R71A 2BY0A 2BZTA 2E5NA 3M8EA 2LC2A 4GYGA 2PXLA 5M3MJ 2HQRA 3JRFA 2RNJA 2VJ5A 2V9KA 3CC4I 4XRFA 3BR3A 2BE5F 1X2MA 2GOXB 2B5AA 1ETQA 3SYTA 3EQLF 3JCUC 1ORKA 4A2UA 2DU9A 2M8EA 2MW8A 4MIMA 4FX0A 4BJ5C 2IGNA 2G9WA 2RVCA 3G5GA 1WJDA 3HKZA 1FLIA 3NEUA 4I98B 1Y6IA 1E17A 1RETA 1NH3A 1IW7F 2NVYJ 1S7AA 1ZLKA 4A12A 2E1MC 1KYZA 4MEYF 4MFEA 3AG4H 2GBYA 3JRGA 4H0EA 2KDOA 1I3QJ 4YIFA 1ZLJA 4EJVA 2LYLA 1MSFC 3OS2A 3H9QA 2O6GE 2CSOA 2ICPA 1IAWA 2P5LC 4ZYGA 5FD5A 1FX7A 4IWRA 3SHFA 2E35A 4RGUA 1S7OA 3D5SC 4A6DA 2VKHA 3QYFA 4MCXA 4B47A 4UV9A 3L2WA 5F04A 1YJWI 2HVRA 1B6AA 2X9DA 2LYCA 1ZRDA 1U6GA 1JXSA 5KVRA 1MMNA 4A3GJ 2Y2ZA 1JTYA 2GQQA 4V2GA 4MCTA 2COBA 1TWHJ 2ZSIB 4WVLA 3L2UA 3UKGA 4CDGA 4IRGA 4LJZF 3C2GA 1ACIA 4I09A 2LYRA 1AKHB 3CDHA 4Q47A 2VBXA 2CW8A 3CCSI 1FC3A 1JJ6C 2XPVA 4X0GA 1XGSA 3CD6I 3OS1A 1QVTA 1W7PA 2E1NA 2ZNZA 4M72A 1JGGA 1MMAA 1YG2A 1KQ9A 3F8FA 4Y33A 2QZ8A 2E34A 2XSJC 1A6IA 3WHCA 1B72A 1OCPA 3HZIB 3WTSC 4UVBA 2L9NA 3G3ZA 4GRIA 2EK5A 3F8CA 3K4CA 2HXIA 2KIUA 3QQAA 1JT0A 2E71A 1USSA 3ZQFA 1QO0D 1X3ZB 2XIUA 4I02A 2CW7A 5EG0A 2JSCA 3L2VA 5AIQA 3KP6A 4CSWA 1WSUA 4PDKA 2P81A 2UV1A 3DU6A 3ABMH 1VQ8I 3VPRA 2B7EA 4IRHA 3HGYA 3IHUA 2JVGA 3H0GJ 3HOYJ 2GZWA 4BHCA 4EGZA 1K7AA 1D1BA 2JA7J 1HKSA 4ITVA 2GA1A 1Y9QA 1XSXA 1XMXA 4CXFA 3AG2H 4B8XA 3WTWC 2OBPA 4QIWN 4L0YB 4IO9F 3GTJJ 1J2XA 3K4MA 4PFPA 2AO9A 5HDGA 4Z5HA 3H92A 1D3YA 4J00A 1FIPA 2JUGA 2Y30A 2LFBA 3TKYA 3PUFA 3QP5A 3FMSA 1BA5A 2IV1A 1YFHA 2EZIA 1BC7C 2HI3A 3LAPA 3Q0UA 1OCTC 2M1BA 4FHTA 4YFKF 3RZDJ 2A5WA 4BEHA 2ZJQF 2CV2A 3DBHB 5C44J 2DT5A 1IF1A 3KE2A 2P7VB 3M3YJ 3MZHA 1YS6A 1I3AA 2M8GX 1A35A 5FGMA 5J40A 1ZARA 1QZZA 3K4NA 1POGA 4RB2C 4RAYA 5FLXZ 1XGNA 5BPIA 2X1DA 1OR7A 4CCKA 3CMMA 3FYMA 1Y39A 4HZFA 2HFHA 1DULA 3IKTA 2M5WA 3P9KA 2P6TA 3PXPA 1HW5A 1R58A 2UXNA 1V5GA 2BY3A 4M3BA 3TP0A 5K7HA 1AHDP 5CLSA 5IP7J 1ZN2A 3KPHA 5E79C 3ZQ7A 2A6HF 3VYUB 1SMYF 5B1AH 3KFWX 4BDZA 1S6LA 3H3UA 2HU9A 3FXJA 4DNCA 2V6EA 3W6VA 2O3FA 3JXBC 1HC8A 4BEHB 1A04A 1G4DA 2HZTA 3OR1C 1XWRA 2DFEA 1P4XA 3KIOA 4YELA 4BE1A 1KU2A 4Z5CA 5HDNA 1U0JA 1PVEA 4XLEA 2LOOA 4X4FA 4JCXA 3I9V2 4XMYA 4I0BA 3DEUA 3FHZA 3CUQC 3V7RA 1XS9A 2XF6A 4DIQA 5CKTA 2RQPA 3HYIA 3OMYA 4G6TB 3IAM2 3FHNA 4XRSA 1XMKA 1TW2A 2IS6A 2PI0A 1TW3A 1QPZA 2QVOA 2OQGA 3IWZA 4PSWA 5EEHA 3ULQB 1S3JA 2CSFA 4PCQA 4M74A 3OKZA 1W5TA 3CCVI 5C4XJ 2ZBKA 5GP9A 4A0XA 3DKYA 2EJRA 1JTXA 1WH7A 2QQBA 3S15J 4PU7A 2LKPA 3CDIA 5KAIC 5KAFC 3L2CA 3K0LA 3S93A 5M3FJ 4ENNA 1D8JA 2EFNA 2XHKA 1ONVA 2AS5F 4U0YA 3FM3A 3QYEA 1BC8C 2BOLA 1BL0A 2DA5A 5CJ9A 4KA4A 3HJEA 5E3OA 2V1DA 1R22A 4BKXA 4N4OB 2L0KA 4KICA 4BE0A 3QYBA 4KIFA 3SZGA 3H5TA 3LFKA 4HA8A 1XSVA 4QWQA 5L3BA 1U9NA 3LSPA 2PUEA 1X4PA 3WTVC 1XDSA 3ZP5A 2IEKA 3ZGKA 3VEPA 2XRLA 3A2KA 4Q5SF 1R5GA 3L00A 2NRAC 3OYEA 1BI0A 3LQRA 5D5VB 4JQDA 2P5VA 2QENA 3BROA 4DW6A 2R7WA 2CFOA 1MJBA 5D8KB 2W85A 4XM3A 1YJNI 1EA3A 2L9VA 4DYCA 3R0JA 5CVRA 2A07F 1O3RA 1X2LA 3J81Z 3M8FA 4IHYA 4NQWA 1R5ID 2D5VA 3W6KB 2K85A 1QPMA 2CUEA 3I3LA 4PJNA 2WV0A 4FE7A 3U1KA 4YARA 2KZGA 5BPDA 2VPLA 2VJJA 1KQ8A 2MQKA 4G94A 3FXQA 1OKRA 2ELHA 3TW6A 5LFAA 2UWMA 1POUA 1ZZ6A 3KZ3A 1QQBA 2V6CA 2V9PA 2O8KA 1N77A 3FZVA 3SCGA 1Y56A 3IWFA 3BG7A 2XROA 2Z16A 4L5JA 4RAGA 2EFOA 5FKMA 1ZH5A 4BL0B
chains in the Genus database with same CATH topology
2NVXJ 2IVBA 3QPLA 1VPWA 3MKLA 1B8IA 1BW5A 1ZZ9A 3OQNA 3ZHMA 3L1PA 3D1NI 1VF9A 3ZQLA 1ZS4A 3SJMA 3BD1A 2X48A 4X4GA 5GPAA 3GTKJ 5EG0B 3F51A 3I4NJ 3ZQHA 2XPUA 3GTGJ 2E19A 3HOUJ 4M3FA 1BJZA 2FX0A 3S14J 4A3DJ 2AXVA 3LFPA 3E7LA 3K7AJ 2PPXA 4C2MJ 9ANTA 2GRMA 1ZAYA 3PM1A 5E3LA 5HODA 5IYDJ 4IHWA 1R9TJ 2AWIA 1MBFA 5IYCJ 3OSGA 2BNNA 2YU9J 3BR0A 5K7FA 4A3BJ 3GN5B 5E3MA 1WETA 2LK2A 3LSGA 3Q3SA 1WIZA 4Y52J 3MVPA 1U8BA 1RIOA 1LCCA 1JKOC 1YRNA 4PU3C 1Z77A 4FISA 3DNVB 2E2IJ 4BY7J 1FTZA 3CLCA 3BT9A 3ZHIA 2MEZA 1JWLA 4X4EA 3CROL 1IC8A 3BQYA 2E2JJ 3F52A 2PUBA 1Y7YA 2R5YA 2PE5A 2YS9A 1A5JA 1WI3A 5IYBJ 2EBIA 5JLXA 2LKXA 2PMZN 2DA2A 3OQMA 4YG7B 1PUFB 3Q0WA 4YBAA 3HEFA 4XICA 5F0HA 1CQTA 2PUFA 3OIOA 3JREA 2DMQA 1L1MA 3S2DJ 3S1RJ 2AW6A 3GTPJ 3UFDA 2FQ4A 3BTJA 2EZHA 3C2BA 2R5ZA 1UXDA 2GM4A 1DU0A 2DTZA 2AXUA 1JH9A 2LY9A 3KXAA 5M5WJ 1LFUP 4X1EA 2H1KA 1P7IA 2E2HJ 4F8DA 2JA6J 2BNOA 2O9LA 2LLKA 4A3JJ 3S1MJ 2ICTA 2KT0A 5F08A 5DS9A 3Q0VA 5J1YA 1Y1WJ 3QYXA 1E3OC 2OFYA 1H8AC 1QP4A 1YRNB 4JP0A 3VK0A 2XB0X 5M5XJ 3WHBA 1R69A 4M3EA 1ZK8A 5K98B 3LSJA 2L8NA 4Y42A 1G2HA 2LR8A 5EF6A 1ETVA 1ZZBA 4L5EA 4RDUA 3ZQGA 4UUSA 2VUMJ 4UUTA 2CUFA 2FJ1A 4PU8A 2MG4A 3HOZJ 3RKQA 1H89C 3S1QJ 2R63A 3TEDA 1ETXA 2HYJA 5FKLA 1PRUA 3G1LA 1MH4A 3SCHA 3LSRA 2JMWA 2DN0A 2ID6A 3GN5A 4X4CA 2CJJA 2DMTA 4IA8A 2XPWA 1W0TA 1K61A 3H3VK 1RPEL 3JRHA 1MNMC 4I6TA 1RZSA 3TRBA 2LCVA 2E1OA 2HOAA 2MGQA 3BR1A 4D7MA 2XJ3A 1QRYA 3HB9A 2LYJA 3OMTA 1DU6A 5FLMJ 5F0CA 4J1WA 3BR6A 3IH3A 2AUWA 2O4AA 4A3FJ 5F0FA 1SANA 3CCYA 4AYBN 1B72B 3BTIA 1MBJA 5FLVA 4JCYA 3MN2A 4IEJA 2CRGA 2ELKA 1UHSA 1IV6A 2CU7A 1NERA 2FJRA 1ZKGA 3JRIA 2NS7A 2IUOA 1IDYA 3OP9A 1IRZA 1OFCX 1FTTA 1X58A 3BS3A 2R1JL 1JJ8C 4A3IJ 1ZZ7A 2M2EA 2XCJA 1IUFA 4BXXJ 2AXZA 1RZRD 1HF0A 4B3AA 5EGOB 2Y0SN 4QTRA 1PERL 2I10A 3EUSA 2R0QC 2HOTA 3TW7A 3K2AA 1RESA 1ETWA 3IH2A 4FTHA 3SCFA 1ADRA 2L7MP 2XI8A 3FISA 3HOWJ 3OSFA 2EQRA 4MFDA 1U9OA 2JVLA 1XG1A 4W1UA 3GTOJ 1EF4A 3GBFA 2L9RA 3ZKCA 2EWTA 2OPTA 2AHQA 5IP9J 5EDNA 2KEKA 1QQAA 2PUGA 1LE8B 2YUSA 1I50J 1SQ8A 3G1MA 3PO2J 1JFSA 3R1FA 2GLOA 5K7ZA 4DYRA 4YG1A 4I6UA 1O4XA 1HCRA 5E3NA 2KZ8A 3LOCA 3FIWA 3O8GA 2HDDA 1F36A 2EZLA 4XIDA 3I4MJ 1Y1VJ 1BDHA 1UTXA 4G12A 1QPIA 1JKQC 4J1XA 4FBIA 1LLIA 2H8RA 3GTQJ 5EZHA 4M3GA 4C3JJ 2JA8J 2WAQN 2R93J 1LCDA 2ME0A 4A3CJ 3GBGA 1WH8A 4GHJA 1RPWA 2DA6A 1VFCA 1UXCA 1MBEA 1GT0C 1S7EA 1MBGA 2LTPA 2XSDC 2JWTA 1JUPA 5M3MJ 3JRFA 3S17J 3ZQCA 3JRCA 1JKRC 2CQQA 3BR3A 1X2MA 2B5AA 1ETQA 3CMYA 1ORKA 4QSHA 3S2HJ 2HOSA 1MBHA 2MW8A 2EF8A 2BNMA 1GUUA 2HSGA 4Z58A 4MIMA 2G0EA 3G1OA 1NTCA 3LISA 3JR9A 2O7OA 3G5GA 3QPSA 4NDWA 2JK3A 2GRLA 2K9SA 5BNGA 3HOVJ 1RETA 1TWCJ 4NDLA 5J1UA 2NVYJ 2Y31A 2VKEA 1F43A 2ME6A 2DMUA 3TP3A 4MFEA 1HDDC 2GBYA 3JRGA 1IJWC 2LYLA 1I3QJ 3F6WA 1MSFC 5J1RA 4D5CA 4CYCB 3BTLA 3QF3A 4B4CA 2LYPA 2ICPA 4X4BA 3A02A 2DA1A 4IHXA 1HLVA 1GDTA 1D5YA 4DYQA 3BTCA 2PUAA 4IWRA 3B6AA 3M4OJ 1ZGWA 4GFBA 1ZVVA 1QP7A 4A3EJ 4MCXA 2VI6A 2X6OA 4X4IA 1JUMA 4FCYA 2M9HA 5F04A 1WCMJ 2HXOA 4A3MJ 1ZUGA 1IDZA 2X9DA 5FKKA 2R5ZB 3IH4A 2LVSA 5EEAA 4A3GJ 3JRBA 2Y2ZA 2WIUB 1JTYA 1TWFJ 4V2GA 4MCTA 4X4HA 2KEJA 3O8HA 2COBA 1TWHJ 2DA3A 1UMQA 4I6ZA 3UKGA 1T33A 3JRDA 4A69C 2DA7A 3NARA 2Y9YA 2LYRA 4ABZA 1AKHB 4PU4C 1X57A 1R63A 4AC0A 1ZZ8A 4O8BA 3GTMJ 2N8GA 1JJ6C 2XPVA 3FYAA 1EFAA 1GVDA 3NAUA 4RBOA 1QVTA 2IVGA 1U78A 2MSYA 5J3LA 1OJLA 2VKVA 1JGGA 4BY1J 3HBLA 4AUXA 2WV1A 1A6IA 3WHCA 1B72A 1OCPA 2K40A 5DTDA 3S16J 3HZIB 4I76A 3QQAA 2HXIA 2LP0A 1JT0A 2PIJA 3OOUA 3HOXJ 1ZR2A 3ZQFA 2R7ZJ 2XIUA 4CYCA 1FJLA 5F1JA 5EG0A 2CROA 2P81A 2DMNA 3U3WA 4D7NA 1QP0A 3VPRA 3DCFA 3JXDL 3HGYA 3PO3J 3H0GJ 3HOYJ 1ZPQA 2IAIA 4OB4A 4J19A 2JA7J 1B8IB 1PRAA 5EGOA 4DZJA 5FJ8J 3A03A 1WGXA 2XB5A 1Y9QA 4JX4A 3FK7A 2NOGA 3SFIA 4JX5A 3FKIJ 1VI0A 4QIWN 3RZZA 3LNQA 3GTJJ 1UG2A 1VNDA 1BW6A 2KDZA 2R5YB 1SFOJ 2AO9A 4Z5HA 4IHVA 2PUCA 3HGGA 4EEFG 1FIPA 3HKZN 2Y30A 2IBDA 2LFBA 4XRMA 2O49A 1WH6A 2KEIA 4HNVA 4I8TA 1ETKA 1PNRA 1BA5A 1AKHA 2IV1A 2EZIA 3HM5A 2HI3A 3F0CA 2K9NA 2B63J 4MLOA 3Q0UA 1OCTC 2DA4A 3RZDJ 4A93J 4Z5DA 2HQ5A 5IOYA 2GZUA 5C44J 3M3YJ 1MBKA 2RAEA 4A3LJ 1MH3A 2WUSR 2IU7A 1JFTA 1T56A 2M8GX 4Y7NJ 5FKNA 2TCTA 4JX6A 1ENHA 2JCGA 2ID3A 1POGA 4FE4A 3ZQIA 1NEQA 1I6HJ 4JYKA 5IP6A 1JKPC 1NK3P 3KJXA 4I6RA 3FYMA 3RQIA 1CJGA 2QCOA 3SDGA 3BDNA 1ZR4A 1K83J 3PXPA 2IVQA 2ECBA 3TP0A 2NS8A 4M3BA 2O38A 5K7HA 1AHDP 2XGCA 5JLWA 3G7DA 2JJ7A 4V2FA 3IVPA 5IP7J 4UUSB 1ZQ3P 1LMB3 4M6VA 2XGEA 1DW9A 1LQCA 2L7FP 4IVZA 3W6VA 3JXBC 1RZRA 2FD5A 4D5FA 1W0UA 2KPJA 2M0CA 3BQZA 3DEWA 4BBSJ 1XWRA 3A01B 1X2NA 4M3DA 2Y9ZA 1ITYA 1ETYA 3CDLA 3MLFA 2XGDA 2LYKA 2L7ZA 1ZZCA 3CECA 4Z5CA 3IV5A 1LFBA 2PUDA 1HDPA 3QQ6A 1AU7A 2NVTJ 4X4FA 4JCXA 1WH5A 3S1NJ 2DMPA 4BBRJ 4LOCA 4X6AJ 5FKOA 1XS9A 3ZOBA 2LD5A 3QWGA 3FK6A 4DZPA 2WB1N 3S8QA 2BJCA 4W97A 1RR7A 1ZTRA 4XRSA 2A6CA 1BDIA 3BG5A 2OR1L 1QPZA 2CSFA 5IPAA 5EYRA 2QF7A 2R92J 5C4XJ 1P7JA 1XC5A 5GP9A 1Z0XA 1APLC 2HINA 5F27A 1B0NA 1JTXA 1WH7A 3S15J 4PU7A 4S0HB 2K9QA 3A01A 1RKWA 2CQXA 1GV5A 5M3FJ 2L49A 3B7HA 4X4DA 3BR5A 2ZB9A 3O9XA 1BL0A 4B1RA 2DA5A 1DWKA 1RKTA 5E3OA 3B6CA 4BKXA 1Q1VA 2L0KA 5GPCA 1ETOA 1MSEC 3H5TA 3OQOA 1U9NA 3LSPA 1NK2P 1FEXA 2PUEA 2JA5J 2W48A 2VPRA 1WPKA 2LYSA 3FMYA 3JXCL 2IEKA 1HOMA 2DJNA 5C3EJ 2XRLA 3JRAA 1QVUA 2LYQA 2M34A 1FIAA 3HDDA 4JQDA 4DW6A 4MO7A 2ECCA 5EZGA 5A7LA 2EBYA 4GQMA 4A3KJ 4YG4A 1OSLA 1PUFA 1TWGJ 4DYCA 1X2LA 1TC3C 1LE8A 5IOZA 4C3IJ 4IHYA 2D5VA 4Z59A 3RZOJ 2CUEA 1GV2A 2OF7A 2NVQJ 2EZKA 4FE7A 4YARA 1TWAJ 4XK4A 3GTLJ 5M5YJ 1IGNA 1H88C 3BG9A 1JUSA 3BR2A 2MQKA 3TW6A 1QQBA 1POUA 4C3HJ 1ZZ6A 2EH3A 2JN6A 1IG7A 2O8KA 3KZ3A 3CQZJ 1JT6A 4FN3A 3SCGA 1YSEA 5C4JJ 4XRSG 5FKMA 3BG3A 2TRTA 1PRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX J;  2IVB A;  3QPL A;  1VPW A;  3MKL A;  1B8I A;  1BW5 A;  1ZZ9 A;  3OQN A;  3ZHM A;  3L1P A;  3D1N I;  1VF9 A;  3ZQL A;  1ZS4 A;  3SJM A;  3BD1 A;  2X48 A;  4X4G A;  5GPA A;  3GTK J;  5EG0 B;  3F51 A;  3I4N J;  3ZQH A;  2XPU A;  3GTG J;  2E19 A;  3HOU J;  4M3F A;  1BJZ A;  2FX0 A;  3S14 J;  4A3D J;  2AXV A;  3LFP A;  3E7L A;  3K7A J;  2PPX A;  4C2M J;  9ANT A;  2GRM A;  1ZAY A;  3PM1 A;  5E3L A;  5HOD A;  5IYD J;  4IHW A;  1R9T J;  2AWI A;  1MBF A;  5IYC J;  3OSG A;  2BNN A;  2YU9 J;  3BR0 A;  5K7F A;  4A3B J;  3GN5 B;  5E3M A;  1WET A;  2LK2 A;  3LSG A;  3Q3S A;  1WIZ A;  4Y52 J;  3MVP A;  1U8B A;  1RIO A;  1LCC A;  1JKO C;  1YRN A;  4PU3 C;  1Z77 A;  4FIS A;  3DNV B;  2E2I J;  4BY7 J;  1FTZ A;  3CLC A;  3BT9 A;  3ZHI A;  2MEZ A;  1JWL A;  4X4E A;  3CRO L;  1IC8 A;  3BQY A;  2E2J J;  3F52 A;  2PUB A;  1Y7Y A;  2R5Y A;  2PE5 A;  2YS9 A;  1A5J A;  1WI3 A;  5IYB J;  2EBI A;  5JLX A;  2LKX A;  2PMZ N;  2DA2 A;  3OQM A;  4YG7 B;  1PUF B;  3Q0W A;  4YBA A;  3HEF A;  4XIC A;  5F0H A;  1CQT A;  2PUF A;  3OIO A;  3JRE A;  2DMQ A;  1L1M A;  3S2D J;  3S1R J;  2AW6 A;  3GTP J;  3UFD A;  2FQ4 A;  3BTJ A;  2EZH A;  3C2B A;  2R5Z A;  1UXD A;  2GM4 A;  1DU0 A;  2DTZ A;  2AXU A;  1JH9 A;  2LY9 A;  3KXA A;  5M5W J;  1LFU P;  4X1E A;  2H1K A;  1P7I A;  2E2H J;  4F8D A;  2JA6 J;  2BNO A;  2O9L A;  2LLK A;  4A3J J;  3S1M J;  2ICT A;  2KT0 A;  5F08 A;  5DS9 A;  3Q0V A;  5J1Y A;  1Y1W J;  3QYX A;  1E3O C;  2OFY A;  1H8A C;  1QP4 A;  1YRN B;  4JP0 A;  3VK0 A;  2XB0 X;  5M5X J;  3WHB A;  1R69 A;  4M3E A;  1ZK8 A;  5K98 B;  3LSJ A;  2L8N A;  4Y42 A;  1G2H A;  2LR8 A;  5EF6 A;  1ETV A;  1ZZB A;  4L5E A;  4RDU A;  3ZQG A;  4UUS A;  2VUM J;  4UUT A;  2CUF A;  2FJ1 A;  4PU8 A;  2MG4 A;  3HOZ J;  3RKQ A;  1H89 C;  3S1Q J;  2R63 A;  3TED A;  1ETX A;  2HYJ A;  5FKL A;  1PRU A;  3G1L A;  1MH4 A;  3SCH A;  3LSR A;  2JMW A;  2DN0 A;  2ID6 A;  3GN5 A;  4X4C A;  2CJJ A;  2DMT A;  4IA8 A;  2XPW A;  1W0T A;  1K61 A;  3H3V K;  1RPE L;  3JRH A;  1MNM C;  4I6T A;  1RZS A;  3TRB A;  2LCV A;  2E1O A;  2HOA A;  2MGQ A;  3BR1 A;  4D7M A;  2XJ3 A;  1QRY A;  3HB9 A;  2LYJ A;  3OMT A;  1DU6 A;  5FLM J;  5F0C A;  4J1W A;  3BR6 A;  3IH3 A;  2AUW A;  2O4A A;  4A3F J;  5F0F A;  1SAN A;  3CCY A;  4AYB N;  1B72 B;  3BTI A;  1MBJ A;  5FLV A;  4JCY A;  3MN2 A;  4IEJ A;  2CRG A;  2ELK A;  1UHS A;  1IV6 A;  2CU7 A;  1NER A;  2FJR A;  1ZKG A;  3JRI A;  2NS7 A;  2IUO A;  1IDY A;  3OP9 A;  1IRZ A;  1OFC X;  1FTT A;  1X58 A;  3BS3 A;  2R1J L;  1JJ8 C;  4A3I J;  1ZZ7 A;  2M2E A;  2XCJ A;  1IUF A;  4BXX J;  2AXZ A;  1RZR D;  1HF0 A;  4B3A A;  5EGO B;  2Y0S N;  4QTR A;  1PER L;  2I10 A;  3EUS A;  2R0Q C;  2HOT A;  3TW7 A;  3K2A A;  1RES A;  1ETW A;  3IH2 A;  4FTH A;  3SCF A;  1ADR A;  2L7M P;  2XI8 A;  3FIS A;  3HOW J;  3OSF A;  2EQR A;  4MFD A;  1U9O A;  2JVL A;  1XG1 A;  4W1U A;  3GTO J;  1EF4 A;  3GBF A;  2L9R A;  3ZKC A;  2EWT A;  2OPT A;  2AHQ A;  5IP9 J;  5EDN A;  2KEK A;  1QQA A;  2PUG A;  1LE8 B;  2YUS A;  1I50 J;  1SQ8 A;  3G1M A;  3PO2 J;  1JFS A;  3R1F A;  2GLO A;  5K7Z A;  4DYR A;  4YG1 A;  4I6U A;  1O4X A;  1HCR A;  5E3N A;  2KZ8 A;  3LOC A;  3FIW A;  3O8G A;  2HDD A;  1F36 A;  2EZL A;  4XID A;  3I4M J;  1Y1V J;  1BDH A;  1UTX A;  4G12 A;  1QPI A;  1JKQ C;  4J1X A;  4FBI A;  1LLI A;  2H8R A;  3GTQ J;  5EZH A;  4M3G A;  4C3J J;  2JA8 J;  2WAQ N;  2R93 J;  1LCD A;  2ME0 A;  4A3C J;  3GBG A;  1WH8 A;  4GHJ A;  1RPW A;  2DA6 A;  1VFC A;  1UXC A;  1MBE A;  1GT0 C;  1S7E A;  1MBG A;  2LTP A;  2XSD C;  2JWT A;  1JUP A;  5M3M J;  3JRF A;  3S17 J;  3ZQC A;  3JRC A;  1JKR C;  2CQQ A;  3BR3 A;  1X2M A;  2B5A A;  1ETQ A;  3CMY A;  1ORK A;  4QSH A;  3S2H J;  2HOS A;  1MBH A;  2MW8 A;  2EF8 A;  2BNM A;  1GUU A;  2HSG A;  4Z58 A;  4MIM A;  2G0E A;  3G1O A;  1NTC A;  3LIS A;  3JR9 A;  2O7O A;  3G5G A;  3QPS A;  4NDW A;  2JK3 A;  2GRL A;  2K9S A;  5BNG A;  3HOV J;  1RET A;  1TWC J;  4NDL A;  5J1U A;  2NVY J;  2Y31 A;  2VKE A;  1F43 A;  2ME6 A;  2DMU A;  3TP3 A;  4MFE A;  1HDD C;  2GBY A;  3JRG A;  1IJW C;  2LYL A;  1I3Q J;  3F6W A;  1MSF C;  5J1R A;  4D5C A;  4CYC B;  3BTL A;  3QF3 A;  4B4C A;  2LYP A;  2ICP A;  4X4B A;  3A02 A;  2DA1 A;  4IHX A;  1HLV A;  1GDT A;  1D5Y A;  4DYQ A;  3BTC A;  2PUA A;  4IWR A;  3B6A A;  3M4O J;  1ZGW A;  4GFB A;  1ZVV A;  1QP7 A;  4A3E J;  4MCX A;  2VI6 A;  2X6O A;  4X4I A;  1JUM A;  4FCY A;  2M9H A;  5F04 A;  1WCM J;  2HXO A;  4A3M J;  1ZUG A;  1IDZ A;  2X9D A;  5FKK A;  2R5Z B;  3IH4 A;  2LVS A;  5EEA A;  4A3G J;  3JRB A;  2Y2Z A;  2WIU B;  1JTY A;  1TWF J;  4V2G A;  4MCT A;  4X4H A;  2KEJ A;  3O8H A;  2COB A;  1TWH J;  2DA3 A;  1UMQ A;  4I6Z A;  3UKG A;  1T33 A;  3JRD A;  4A69 C;  2DA7 A;  3NAR A;  2Y9Y A;  2LYR A;  4ABZ A;  1AKH B;  4PU4 C;  1X57 A;  1R63 A;  4AC0 A;  1ZZ8 A;  4O8B A;  3GTM J;  2N8G A;  1JJ6 C;  2XPV A;  3FYA A;  1EFA A;  1GVD A;  3NAU A;  4RBO A;  1QVT A;  2IVG A;  1U78 A;  2MSY A;  5J3L A;  1OJL A;  2VKV A;  1JGG A;  4BY1 J;  3HBL A;  4AUX A;  2WV1 A;  1A6I A;  3WHC A;  1B72 A;  1OCP A;  2K40 A;  5DTD A;  3S16 J;  3HZI B;  4I76 A;  3QQA A;  2HXI A;  2LP0 A;  1JT0 A;  2PIJ A;  3OOU A;  3HOX J;  1ZR2 A;  3ZQF A;  2R7Z J;  2XIU A;  4CYC A;  1FJL A;  5F1J A;  5EG0 A;  2CRO A;  2P81 A;  2DMN A;  3U3W A;  4D7N A;  1QP0 A;  3VPR A;  3DCF A;  3JXD L;  3HGY A;  3PO3 J;  3H0G J;  3HOY J;  1ZPQ A;  2IAI A;  4OB4 A;  4J19 A;  2JA7 J;  1B8I B;  1PRA A;  5EGO A;  4DZJ A;  5FJ8 J;  3A03 A;  1WGX A;  2XB5 A;  1Y9Q A;  4JX4 A;  3FK7 A;  2NOG A;  3SFI A;  4JX5 A;  3FKI J;  1VI0 A;  4QIW N;  3RZZ A;  3LNQ A;  3GTJ J;  1UG2 A;  1VND A;  1BW6 A;  2KDZ A;  2R5Y B;  1SFO J;  2AO9 A;  4Z5H A;  4IHV A;  2PUC A;  3HGG A;  4EEF G;  1FIP A;  3HKZ N;  2Y30 A;  2IBD A;  2LFB A;  4XRM A;  2O49 A;  1WH6 A;  2KEI A;  4HNV A;  4I8T A;  1ETK A;  1PNR A;  1BA5 A;  1AKH A;  2IV1 A;  2EZI A;  3HM5 A;  2HI3 A;  3F0C A;  2K9N A;  2B63 J;  4MLO A;  3Q0U A;  1OCT C;  2DA4 A;  3RZD J;  4A93 J;  4Z5D A;  2HQ5 A;  5IOY A;  2GZU A;  5C44 J;  3M3Y J;  1MBK A;  2RAE A;  4A3L J;  1MH3 A;  2WUS R;  2IU7 A;  1JFT A;  1T56 A;  2M8G X;  4Y7N J;  5FKN A;  2TCT A;  4JX6 A;  1ENH A;  2JCG A;  2ID3 A;  1POG A;  4FE4 A;  3ZQI A;  1NEQ A;  1I6H J;  4JYK A;  5IP6 A;  1JKP C;  1NK3 P;  3KJX A;  4I6R A;  3FYM A;  3RQI A;  1CJG A;  2QCO A;  3SDG A;  3BDN A;  1ZR4 A;  1K83 J;  3PXP A;  2IVQ A;  2ECB A;  3TP0 A;  2NS8 A;  4M3B A;  2O38 A;  5K7H A;  1AHD P;  2XGC A;  5JLW A;  3G7D A;  2JJ7 A;  4V2F A;  3IVP A;  5IP7 J;  4UUS B;  1ZQ3 P;  1LMB 3;  4M6V A;  2XGE A;  1DW9 A;  1LQC A;  2L7F P;  4IVZ A;  3W6V A;  3JXB C;  1RZR A;  2FD5 A;  4D5F A;  1W0U A;  2KPJ A;  2M0C A;  3BQZ A;  3DEW A;  4BBS J;  1XWR A;  3A01 B;  1X2N A;  4M3D A;  2Y9Z A;  1ITY A;  1ETY A;  3CDL A;  3MLF A;  2XGD A;  2LYK A;  2L7Z A;  1ZZC A;  3CEC A;  4Z5C A;  3IV5 A;  1LFB A;  2PUD A;  1HDP A;  3QQ6 A;  1AU7 A;  2NVT J;  4X4F A;  4JCX A;  1WH5 A;  3S1N J;  2DMP A;  4BBR J;  4LOC A;  4X6A J;  5FKO A;  1XS9 A;  3ZOB A;  2LD5 A;  3QWG A;  3FK6 A;  4DZP A;  2WB1 N;  3S8Q A;  2BJC A;  4W97 A;  1RR7 A;  1ZTR A;  4XRS A;  2A6C A;  1BDI A;  3BG5 A;  2OR1 L;  1QPZ A;  2CSF A;  5IPA A;  5EYR A;  2QF7 A;  2R92 J;  5C4X J;  1P7J A;  1XC5 A;  5GP9 A;  1Z0X A;  1APL C;  2HIN A;  5F27 A;  1B0N A;  1JTX A;  1WH7 A;  3S15 J;  4PU7 A;  4S0H B;  2K9Q A;  3A01 A;  1RKW A;  2CQX A;  1GV5 A;  5M3F J;  2L49 A;  3B7H A;  4X4D A;  3BR5 A;  2ZB9 A;  3O9X A;  1BL0 A;  4B1R A;  2DA5 A;  1DWK A;  1RKT A;  5E3O A;  3B6C A;  4BKX A;  1Q1V A;  2L0K A;  5GPC A;  1ETO A;  1MSE C;  3H5T A;  3OQO A;  1U9N A;  3LSP A;  1NK2 P;  1FEX A;  2PUE A;  2JA5 J;  2W48 A;  2VPR A;  1WPK A;  2LYS A;  3FMY A;  3JXC L;  2IEK A;  1HOM A;  2DJN A;  5C3E J;  2XRL A;  3JRA A;  1QVU A;  2LYQ A;  2M34 A;  1FIA A;  3HDD A;  4JQD A;  4DW6 A;  4MO7 A;  2ECC A;  5EZG A;  5A7L A;  2EBY A;  4GQM A;  4A3K J;  4YG4 A;  1OSL A;  1PUF A;  1TWG J;  4DYC A;  1X2L A;  1TC3 C;  1LE8 A;  5IOZ A;  4C3I J;  4IHY A;  2D5V A;  4Z59 A;  3RZO J;  2CUE A;  1GV2 A;  2OF7 A;  2NVQ J;  2EZK A;  4FE7 A;  4YAR A;  1TWA J;  4XK4 A;  3GTL J;  5M5Y J;  1IGN A;  1H88 C;  3BG9 A;  1JUS A;  3BR2 A;  2MQK A;  3TW6 A;  1QQB A;  1POU A;  4C3H J;  1ZZ6 A;  2EH3 A;  2JN6 A;  1IG7 A;  2O8K A;  3KZ3 A;  3CQZ J;  1JT6 A;  4FN3 A;  3SCG A;  1YSE A;  5C4J J;  4XRS G;  5FKM A;  3BG3 A;  2TRT A;  1PRV A; 
#chains in the Genus database with same CATH topology
 1B1B A;  2NVX J;  3QPL A;  2IVB A;  3MKL A;  5HLG A;  1B8I A;  2QSH X;  2WB1 A;  3D1N I;  2R7V A;  1U2Z A;  4P1W A;  3FMR A;  3TMO A;  1ZS4 A;  4X4G A;  4XOR A;  3O6B B;  1K78 B;  2QWW A;  1FYM A;  1TTY A;  2ZME C;  4XNF A;  1C0W A;  3I4N J;  2XAJ A;  3GO5 A;  2XPU A;  2XC7 A;  3GTG J;  3A9X A;  2MH2 A;  2E19 A;  1P4W A;  3LQX A;  4A3D J;  3LFP A;  1BJZ A;  5CPR B;  4E7H A;  2AXV A;  2OTJ I;  3E7L A;  2PPX A;  2FBH A;  4HYE A;  5HOD A;  1P9Q C;  4CYD A;  1MBF A;  3OSG A;  4N9H A;  1YOV B;  2YU9 J;  3ASN H;  3Q9V A;  4XSZ F;  3GN5 B;  5E3M A;  1WET A;  3LSG A;  1WIZ A;  4Y52 J;  1RIO A;  4RGX A;  1LCC A;  5GAE J;  3I5U A;  1JKO C;  2ZC2 A;  1Z05 A;  2XF7 A;  3Q9S A;  2VJ4 A;  4XON A;  4BY7 J;  3DNV B;  4L9T A;  3BT9 A;  3CRO L;  4NUB A;  1YW8 A;  2HGC A;  3CF2 A;  3F52 A;  3OYC A;  5J47 A;  2EIM H;  2YS9 A;  1EKE A;  1A5J A;  2IXS A;  3JSP A;  2BBY A;  2PXQ A;  2EBI A;  1ZG3 A;  3SFZ A;  2HYF A;  5D8L B;  4O3M A;  4HW0 A;  2EFQ A;  1E3H A;  4YBA A;  1CQT A;  6PAX A;  5F0H A;  1X1A A;  3S8P A;  1T2K A;  2FEZ A;  2DMQ A;  3T5X A;  1VQ4 I;  5HS7 A;  1MW7 A;  2FQ4 A;  4KN4 X;  2R5Z A;  4UVC A;  4GCV A;  3KL4 A;  2GM4 A;  4ZYE A;  4XLN F;  2Z9O A;  1ZGJ A;  3PE5 A;  3J80 Z;  1EV7 A;  2DTZ A;  3W3C A;  2JRM A;  2KRH A;  4A3J J;  3GLL A;  2ICT A;  1Z7U A;  5DS9 A;  3WU2 C;  1VQ7 I;  1RC9 A;  2OFY A;  1H8A C;  4AID A;  1HKQ A;  3E6B A;  3VK0 A;  4PFO A;  2ETH A;  2HVQ A;  1ZK8 A;  3BCA A;  4KN7 X;  1TT0 A;  1ETV A;  5J6X A;  4C30 A;  3ZQG A;  1WJB A;  2ZXJ A;  3CMA I;  4UUT A;  3RJP A;  2FJ1 A;  4PU8 A;  2UUZ A;  4MTE A;  3SDB A;  4OWR B;  4HNT A;  4CUG A;  5FKL A;  1H0M A;  2I8D A;  2K7L A;  1PRU A;  2BY2 A;  1XMA A;  2CJJ A;  3H3V K;  1WI9 A;  3A0B C;  3JRH A;  4I6T A;  1RZS A;  3HHH A;  1RI7 A;  1W5S A;  4ER7 A;  1VQO I;  2MGQ A;  4D7M A;  3BR1 A;  1TNS A;  2LYJ A;  3KP4 A;  2VQG A;  4F55 A;  1DU6 A;  4L18 B;  1I5Z A;  3BR6 A;  2KQR A;  5ILU A;  1LEB A;  2AUW A;  3VB2 A;  4A3F J;  4KDP A;  1NW3 A;  1SAN A;  2BEO A;  1AWC A;  1H9T A;  2XV4 S;  2MA3 A;  4F93 B;  1S29 A;  1UST A;  3EET A;  1WVR A;  1EH8 A;  3QFI A;  1BIB A;  1R4M B;  1UHS A;  3VSL A;  2CU7 A;  3F6O A;  2NS7 A;  3C1D A;  1IDY A;  3OP9 A;  1X1C A;  2AXL A;  2VXD A;  1FTT A;  3ZPL A;  2W00 A;  2R1J L;  2D1V A;  1JJ8 C;  2EFP A;  2M2E A;  2RNG A;  1UFM A;  4BXX J;  3GZ5 A;  3KLN A;  4QTR A;  1PER L;  3DTI A;  4GXO A;  3BJO A;  3EUS A;  1RES A;  3GFJ A;  5D5U B;  3KET A;  2KKO A;  3I55 I;  4WXD A;  4FTH A;  1EH7 A;  2L7M P;  2O8X A;  2RV8 A;  3BOQ A;  4OU0 A;  3FIS A;  3QOD A;  3HOW J;  1R00 A;  3R61 A;  4MFD A;  1J0R A;  2ICW G;  2OAZ A;  3WTZ A;  4EQZ A;  2VQH A;  2OPT A;  5IP9 J;  3F6V A;  2ESN A;  5EDN A;  1OIS A;  1LDJ A;  1X1B A;  1YIO A;  4LMY A;  4U7B A;  1LE8 B;  3IAS 2;  3BCB A;  2PBI A;  3VOE A;  1I50 J;  1SQ8 A;  5HLT A;  3G1M A;  1YHQ I;  3AL0 B;  5J8C A;  2GLO A;  5K7Z A;  3RIR A;  1K4T A;  4I6U A;  1IO2 A;  5E3N A;  3O8G A;  1G59 A;  1J7K A;  2E1M B;  3J7Y J;  2J5P A;  3H5A A;  1UTX A;  1MGT A;  4BH9 A;  4QPO A;  2WAQ A;  3EUK L;  4GGG A;  4HSR A;  5DTQ A;  1LCD A;  1BI2 A;  2R3S A;  4AIJ A;  4GHJ A;  1UXC A;  1MBE A;  1D1A A;  1U5T B;  2DT7 B;  2QYO A;  1MBG A;  2LTP A;  3SX0 A;  1QA6 A;  4V19 K;  1LPQ A;  3E6D A;  3QWL A;  4RGS A;  1PP7 U;  4IXA A;  2F5C A;  1JKR C;  3AFH A;  4II2 A;  2Z33 A;  2M30 A;  3E5Q A;  4Y13 A;  4QSH A;  2HOS A;  3D5R C;  3IRR A;  1GUU A;  4Z58 A;  4CHU A;  2V1N A;  2G0E A;  4CA0 A;  1QHH D;  2L3D A;  3BPV A;  1NTC A;  3LIS A;  2IT0 A;  1OCC H;  2F5V A;  1VQN I;  1W4M A;  3PFI A;  1IN7 A;  2JK3 A;  5JR3 A;  1LFP A;  5H20 A;  4XOP A;  2PEX A;  4AD9 A;  1TWC J;  1OMI A;  1SVO A;  1L3L A;  3FXU A;  3I71 A;  1FZP B;  3RI4 A;  1F43 A;  2ME6 A;  5GTH C;  2PXB A;  4Q48 A;  1W5C C;  4P96 A;  1D0Z A;  4AU7 A;  1UB9 A;  5HLH A;  1LUJ B;  4G7O F;  3P7N A;  3TEL A;  1RRJ A;  1IJW C;  1F9N A;  4ASN A;  1D0Y A;  4UVA A;  3DXJ F;  4XSX F;  5CQE A;  1CF7 A;  2XXP A;  2K86 A;  3ZMT A;  3BTL A;  4B4C A;  1EJ9 A;  4X4B A;  4MEX F;  3A02 A;  2DA1 A;  2MYS A;  1HLV A;  1LEA A;  2ISY A;  3BTC A;  2PUA A;  3B6A A;  3VSK A;  1SD5 A;  1ZGW A;  1ZVV A;  2GAU A;  2K4B A;  4BGD A;  5FFX A;  4E7K A;  2K27 A;  1M1E B;  2F4M B;  2NYX A;  3GUD A;  4KT6 A;  2VI6 A;  2ZFW A;  4ZDO A;  4X4I A;  2C6Y A;  5LBQ A;  2M9H A;  4CCL A;  2R4G A;  3J80 K;  4DE9 A;  2DK5 A;  2HDC A;  5FRN A;  3ZCO A;  2R5Z B;  5TIS C;  3HRT A;  5L3D A;  3IH4 A;  2LVS A;  3K1M A;  3N97 A;  2KLO A;  1K6Y A;  1R1V A;  1TWF J;  1Y8Q B;  2KEJ A;  4L9V A;  3O8H A;  1KQ0 A;  2XKP A;  4KIG A;  2DA3 A;  2WBM A;  1VQM I;  1PDN C;  2HYG D;  3NAR A;  4KIS A;  3CCU I;  4ABZ A;  1IRX A;  2H94 A;  4PU4 C;  3MFK A;  1R63 A;  4O8B A;  3DF8 A;  4F7Z A;  3GTM J;  2N8G A;  2ZSH B;  1PYV A;  3BY6 A;  3J81 K;  2HCN A;  1GVD A;  2CO5 A;  1U78 A;  4ER0 A;  3A0H C;  2VKV A;  4HF2 A;  2Y69 H;  1WZ2 A;  1WJE A;  2JUC A;  1ZG1 A;  4HOB A;  4BY1 J;  3N4M A;  5B1B H;  4KT5 C;  4EJT A;  3OIP A;  4AUX A;  2XAQ A;  5IY5 H;  1IZ1 A;  2K40 A;  3ZMS A;  4KIT B;  4I76 A;  4GDF A;  3OOU A;  3HOX J;  4G7H F;  2R7Z J;  1YW9 A;  5JHU A;  1OCR H;  1MD0 A;  5F1J A;  2P7C B;  2CRO A;  1FOY A;  1T39 A;  2DMN A;  1R1T A;  3ASO H;  1QP0 A;  3SEZ A;  4AYB A;  3PO3 J;  3OYK A;  4A6E A;  1FSE A;  3E1S A;  3KP2 A;  4IJA A;  2X1E A;  3WTT C;  2W82 A;  4DZJ A;  1U5T C;  1FMW A;  1SVM A;  2BHZ A;  1QQI A;  1WGX A;  2P8T A;  2XB5 A;  2FE3 A;  3DKW A;  4JK1 X;  2Z99 A;  1AA7 A;  4HST A;  3FKI J;  2RQQ A;  4DBR A;  3FBI B;  5CVV A;  5B5E C;  3W2W A;  3RZZ A;  3LNQ A;  1UAA A;  3MAJ A;  1BW6 A;  2MC4 A;  2PJP A;  1SAX A;  2VN2 A;  1TBX A;  4OOI A;  2PUC A;  4EEF G;  1FT9 A;  4BQN A;  4XRM A;  1YQA A;  1WH6 A;  3BC8 A;  3MEX A;  3NWS A;  2YSR A;  5E18 F;  1AKH A;  4PSX A;  3HM5 A;  1IXR C;  2X51 A;  3TOA A;  2DA4 A;  4A93 J;  4XLA A;  3KYC B;  4P5O A;  3OS0 A;  4EQQ A;  1ZGA A;  2RAE A;  2M45 A;  1MH3 A;  2CW0 F;  1YW7 A;  2DYR H;  2TCT A;  2D2W A;  3DP7 A;  2BY1 A;  1HBX G;  2JCG A;  3T1B A;  2ID3 A;  4L5I A;  4FE4 A;  3ZQI A;  3ZXS A;  4JYK A;  2A05 A;  2YPR A;  4O5V A;  4LB5 A;  4WX9 A;  3HUG B;  1GXP A;  3RQI A;  3AG3 H;  3ZMD A;  3L09 A;  2PX9 A;  4N4N B;  3BDN A;  1KU9 A;  4CCO A;  1ZR4 A;  2ZJ2 A;  1NHA A;  4ETS A;  1U5T A;  2XGC A;  2QA4 I;  4BDY A;  3G7D A;  3IVP A;  4UUS B;  1BI3 A;  1OYI A;  2EV5 A;  2KRC A;  4ON0 A;  2XGE A;  4ZDP A;  2EIJ H;  2ZNY A;  3CP8 A;  3PL8 A;  4OIP F;  1J59 A;  3H5N A;  1Z21 A;  2RC4 A;  3HOS A;  2YBD A;  1ULY A;  2KFD A;  5DTR A;  4D5F A;  2KPJ A;  3LAJ A;  3A01 B;  1X2N A;  2HZD A;  4MTD A;  1JE8 A;  2HNH A;  3H3Z A;  2L7Z A;  1ZZC A;  3IV5 A;  2VL8 A;  3GX4 X;  3QQ6 A;  3T8T A;  2DYS H;  4EVI A;  3NDB B;  2G7U A;  4U0V A;  3MEJ A;  2VQL A;  2L54 A;  2A6T A;  1QHG A;  5FKO A;  1CF7 B;  2EIL H;  4ER3 A;  2LD5 A;  4DZP A;  3F9K A;  2RRE A;  1DP7 P;  3R6S A;  5LGT A;  1ZTR A;  3C3W A;  5AIP A;  1HQC A;  2STT A;  3DV8 A;  5LEK A;  2L01 A;  4TV7 A;  2XAS A;  2HQA A;  3EPZ A;  2W1O A;  3GZN B;  5IPA A;  1UHW A;  3U1D A;  4AIK A;  2QF7 A;  3LFU A;  3PNY A;  4P9F A;  3CJR B;  3MZY A;  1PP8 F;  2R92 J;  4EKG A;  1APL C;  1XC5 A;  1Z0X A;  3HOT A;  2ZME A;  4IF4 A;  1B0N A;  3H9G A;  4DE8 A;  5LHI A;  4S0H B;  3A01 A;  1RKW A;  3LSH A;  2L49 A;  4X4D A;  3O9X A;  3ABT A;  1DWK A;  1RKT A;  2KL4 A;  3WOD F;  1Z3X A;  3B6C A;  4CZC A;  1R36 A;  2KRF A;  2EPF A;  2JPC A;  4HQM A;  1ETO A;  3LA2 A;  4IL6 C;  1J75 A;  1ZYR F;  3RCO A;  3FF5 A;  4KJZ A;  3G73 A;  3GYH X;  2VPR A;  3I64 A;  1I1G A;  2DOE A;  4FAS D;  1XTA A;  3BJ6 A;  5C3E J;  3JRA A;  4C2T A;  5KK1 A;  3UNG C;  2H27 A;  3HSE A;  1OLT A;  2M34 A;  4F3Q A;  3HDD A;  2M0M A;  1JHH A;  1T8I A;  2JPB A;  3R4K A;  1OSL A;  1E2X A;  2HDW A;  1TC3 C;  2HKO A;  3L2R A;  5IOZ A;  3VFZ A;  4C3I J;  2QM3 A;  4Y15 A;  3RPU D;  3J7Z I;  3M9L A;  2NVQ J;  4XK4 A;  2R7R A;  3GTL J;  3COA C;  1H88 C;  2H09 A;  3BG9 A;  1YLF A;  4DOZ A;  2EH3 A;  2JN6 A;  1X1P A;  2GOM A;  2FRH A;  4GYI A;  2XDV A;  2QQ9 A;  3W6J B;  4XRS G;  4HDU A;  3BG3 A;  3L9F A;  3BWG A;  4PUS A;  1VPW A;  4MNU A;  3ZHM A;  3OQN A;  2CGP A;  1LVA A;  5ICF A;  3L1P A;  4HDV A;  5CVJ A;  3DM5 A;  3J7A O;  3OWQ A;  2NS0 A;  3HTU A;  2LDU A;  2VXZ A;  3DLA A;  1BBY A;  2W24 A;  4LFU A;  2M4G A;  3JAM K;  4P9U A;  3HOU J;  4GO1 A;  5LEJ A;  3WTX C;  2ZXW H;  3GW2 A;  3PM1 A;  3ZRG A;  5IYD J;  3HC7 A;  1DGW Y;  4IHW A;  2HPI A;  5A2Q Z;  2BNN A;  5IYC J;  4XN3 A;  3BR0 A;  5K7F A;  4A3B J;  2LK2 A;  5TJJ A;  3Q3S A;  1BOB A;  3OYM A;  4ZYH A;  4PU3 C;  1IN6 A;  4IOC F;  3K2Z A;  4LIT A;  3F22 A;  1JWL A;  2XGX A;  3BLY A;  2E2J J;  1TQP A;  3RPU A;  1FWZ A;  2PUB A;  2F2E A;  2R5Y A;  4I99 C;  1S5L C;  2MAB A;  2IS2 A;  5IYB J;  1X3U A;  4JOM A;  2LKX A;  2PXF A;  2DA2 A;  4YG7 B;  1PUF B;  3Q0W A;  1FPQ A;  2PJR B;  2JQ7 A;  2FOK A;  3U2R A;  1DUX C;  4CCJ A;  1WJA A;  2AW6 A;  3ABU A;  2EWN A;  3C2B A;  2WWY A;  2VBZ A;  2H6C A;  3M8J A;  2XAG A;  2R7O A;  5D4S A;  1YO5 C;  2LY9 A;  4AM3 A;  3KXA A;  3VDX A;  1LFU P;  2PXE A;  1P7I A;  1BI1 A;  4F8D A;  4IPA A;  2IVM A;  1KGS A;  2O9L A;  2LLK A;  4D0P A;  2KT0 A;  1DPU A;  5J1Y A;  1Y1W J;  1YJ9 I;  2E36 A;  3TOB A;  3R09 A;  4JP0 A;  2MFZ A;  2XB0 X;  2BXZ A;  5M5X J;  1R69 A;  2FNA A;  2HS5 A;  5KNL A;  1G2H A;  2KJC A;  1O3Q A;  1ZZB A;  4UUS A;  1XSD A;  1CGP A;  1X1D A;  2CUF A;  3UR3 C;  3CO6 C;  4BYY A;  5DSX A;  3QU6 A;  3E5X A;  3RKQ A;  2QQA A;  1XPX A;  3BG6 A;  3S1Q J;  2R63 A;  1YX3 A;  2PXD A;  3LSR A;  2DN0 A;  2ID6 A;  4X4C A;  3F8N A;  2FML A;  3MKY B;  1W0T A;  1K61 A;  1RPE L;  2R7Q A;  3TRB A;  4UUV A;  3I53 A;  2LCV A;  2WA0 A;  1YTY A;  3K4K A;  2LRE A;  2IGK A;  2YR2 A;  3OMT A;  4AWX B;  2WAF A;  5FLM J;  2FF4 A;  3FX3 A;  4J1W A;  4S04 A;  2X6Y A;  3W2V A;  2O4A A;  1Y0U A;  1KA8 A;  5JUW A;  5F0F A;  3PSI A;  1LQ1 A;  3NXH A;  3CCY A;  4AYB N;  1T0F A;  1B72 B;  3ZPX A;  5CVU A;  3K70 C;  2FA5 A;  1XDU A;  3TO7 A;  5DEQ A;  4JCY A;  4XQF A;  4IEJ A;  2DCE A;  3K9T A;  4E7S A;  3IUO A;  1IV6 A;  3DBR B;  3JRI A;  2IUO A;  5DD4 A;  4XL9 A;  2FNP A;  1IRZ A;  2XKO A;  2F5E A;  2KIF A;  2LH9 A;  3F72 A;  1UJ8 A;  1IRG A;  1OCO H;  1MNE A;  3S32 A;  1ZZ7 A;  3P9I A;  1G3S A;  1RZR D;  2AXZ A;  2DO7 A;  1L0O C;  4B3A A;  5HVQ C;  5EGO B;  2EA4 A;  4EK9 A;  3QOW A;  2I10 A;  2J5O A;  2VB6 A;  4N9I A;  2R0Q C;  2HOT A;  1HA8 A;  3K2A A;  1BN5 A;  4LG0 A;  3TGN A;  3A4C A;  4EV0 A;  3OYG A;  2ZKZ A;  5J4V A;  1T08 B;  3MQ0 A;  1U9O A;  4EZI A;  3CCR I;  3GTO J;  1EF4 A;  3GBF A;  2VOO A;  2ZJP F;  2L9R A;  4KUM A;  2EWT A;  3S3M A;  1WKM A;  1G3T A;  3RQ4 A;  4IHS A;  3DFG A;  1VQK I;  2PUG A;  2WY8 Q;  2KHM A;  2YUS A;  5FB2 A;  2YX7 A;  5FRO A;  3HRS A;  3KEY A;  3VOD A;  4ENK A;  1JFS A;  1NG7 A;  3QOX A;  2K9L A;  2MC3 A;  2OZU A;  3OOP A;  4DYR A;  4YG1 A;  5D4R A;  1HCR A;  2IJL A;  2HDD A;  1F36 A;  5CYV A;  3I4M J;  3ESW B;  1BDH A;  4G12 A;  3EUA A;  3LMM A;  3BPX A;  3M1C A;  4XLF A;  4U87 A;  4M3G A;  5EZH A;  1Z6R A;  2JA8 J;  2WAQ N;  2ME0 A;  4C2U A;  4LG0 B;  1R6R A;  1RPW A;  3LSK A;  1R5H A;  4HG2 A;  2XAH A;  4LK1 F;  1S7E A;  1SD7 A;  4KMU X;  4L9N A;  2XSD C;  1JUP A;  2BVM A;  4RLQ A;  3S17 J;  2PMZ A;  2CQQ A;  2RKH A;  3GVA A;  2EIK H;  3FM5 A;  3LA3 A;  2VJI A;  3ABL H;  3HL2 A;  2EF8 A;  2BNM A;  5JFR A;  3OR2 C;  3G1O A;  1SFK A;  5D5W B;  1T6S A;  2CV1 A;  2KIQ A;  2O7O A;  3ZQQ A;  5EEG A;  1LVK A;  1T98 A;  3ML6 A;  1Z3Y A;  3CCJ I;  2GRL A;  2K9S A;  5BNG A;  4NDL A;  5J1U A;  3TFL A;  2Y31 A;  2DFH A;  2E1C A;  3TP3 A;  2M4K A;  5DM6 F;  1SD6 A;  1TQI A;  4OIN F;  1MJA A;  3F6W A;  4HX8 A;  2OZ6 A;  3BZC A;  4D5C A;  1EH6 A;  2LYP A;  1H9G A;  5CVI A;  3G71 I;  4IHX A;  2P5K A;  2LY2 A;  1D5Y A;  5EJC A;  1MFQ C;  4DYQ A;  3U9G A;  1UZC A;  1SEU A;  3I58 A;  5GAH i;  2K02 A;  4GFB A;  2YU3 A;  4HLY A;  4CH7 A;  4EAT A;  4A3E J;  3N05 A;  1SC7 A;  2LLW A;  1T95 A;  3GZC A;  1Q1H A;  1A6Q A;  2L02 A;  1LDK B;  1P6R A;  1BM9 A;  2HXO A;  2LRD A;  4HBL A;  4PJJ A;  4KFC A;  3PFY A;  3FDY A;  1XCV A;  1YE9 A;  5EEA A;  3U21 A;  4X4H A;  2R7F A;  5ILV A;  2OA4 A;  3WG9 A;  2F6C A;  3E6C C;  1FYL A;  1T33 A;  3JRD A;  2DA7 A;  3F8B A;  1VQ9 I;  3KYL A;  4JQF A;  4M6Y A;  1A36 A;  1J09 A;  4NC8 A;  1EFA A;  3NAU A;  4RBO A;  4HAM A;  2V7F A;  2IVG A;  2V9V A;  4A5N A;  2MSY A;  2XXQ A;  4E7Z A;  4ZTF A;  2LY1 A;  1D0X A;  3GFL A;  1QB2 A;  4BU2 A;  4RB3 C;  4G7Z F;  3WG7 H;  1Z7L A;  1Z91 A;  3HBL A;  4UB6 C;  4B43 A;  2WV1 A;  3CLO A;  5DTD A;  3KZI C;  5JI6 A;  3S16 J;  3UWP A;  1UEL B;  1WFX A;  2DOA A;  2IGO A;  2NXN B;  4YII A;  2NNY A;  3OY9 A;  3BJA A;  3QPH A;  1ZR2 A;  4CYC A;  2HWV A;  3GUU A;  1F1Z A;  1MJ9 A;  3CP2 A;  4PZJ A;  5J8F A;  3FXL A;  3K1N A;  2A69 F;  3S2W A;  4D7N A;  3U3W A;  2FSW A;  2GIV A;  4BUP A;  3V8K A;  2E7W A;  2JA2 A;  3OYJ A;  2MBF A;  4OB4 A;  2A6E F;  4J19 A;  1B8I B;  1PRA A;  5EGO A;  5FJ8 J;  2JTV A;  1IXS B;  1AOY A;  2L4M A;  4BXU A;  2WY7 Q;  1B59 A;  2CMP A;  3M9A A;  3P9C A;  1FYK A;  3ECO A;  4RAZ A;  3FK7 A;  5DYM A;  1W7P B;  2XVC A;  1KYW A;  4B48 A;  5IT9 K;  1MZB A;  1ZEL A;  3C7J A;  2E7X A;  1VND A;  4CGZ A;  3L2Q A;  4XLC A;  4E6K G;  4IHV A;  1I27 A;  1OQY A;  3RDI A;  4HQE A;  3HGG A;  4UXN A;  2IBD A;  2IS1 A;  1BOA A;  4PGH A;  2HKX A;  2B63 J;  2DBB A;  2RGV A;  3KLO A;  5ICC A;  2Q0O A;  4HF0 A;  4NB5 A;  5IOY A;  2ESH A;  1E0E A;  2GZU A;  4FT8 A;  4JBA A;  2QEX I;  4A3L J;  4ER6 A;  2WUS R;  3IC7 A;  2QBY A;  1JFT A;  1T56 A;  4ZJZ A;  4Y7N J;  2EV6 A;  1N25 A;  4M9X A;  4BJ6 C;  1NEQ A;  2A5Y B;  5F1R A;  1I6H J;  1OYW A;  2VLA A;  3K4L A;  1NK3 P;  3KJX A;  4I6R A;  3E97 A;  4XKW A;  2CQK A;  1CJG A;  2QCO A;  2KMU A;  2ZXH A;  3G4S I;  2IVQ A;  1XX5 A;  2ECB A;  4HRA A;  2O38 A;  4OBM A;  5GAG J;  2OJE D;  4AVZ A;  3I59 A;  4V2F A;  2L1P A;  5DT2 A;  2X6W A;  3HG9 A;  1ZQ3 P;  4IZZ A;  3EYY A;  4M6V A;  1MIJ A;  3CCL I;  1YS7 A;  4UV8 A;  1R49 A;  1IRF A;  1DW9 A;  1LQC A;  2VC0 A;  3K10 A;  4U88 A;  3KP7 A;  4CZZ A;  2FD5 A;  1MKM A;  3MCZ A;  3QU3 A;  2VE9 A;  5DTM A;  4YRV A;  3BQZ A;  3CZ6 A;  1Y8R B;  2PQ8 A;  2V1U A;  1PJR A;  2WAE A;  5LHG A;  2UZK A;  2Y9Z A;  3A9Y A;  4B44 A;  3AKZ A;  3MLF A;  2LYK A;  1ON2 A;  5ILS A;  3CCQ I;  4XBF A;  2BW3 B;  5B3S H;  3CEC A;  2CYY A;  4H4K C;  1HDP A;  3FMQ A;  1AU7 A;  3FXO A;  1R7J A;  2DLL A;  2L2O A;  3WE2 A;  5LRS A;  1WH5 A;  2P6S A;  2F5F A;  3S1N J;  2DI3 A;  1U8R A;  1X3W B;  4LOC A;  4BBR J;  4BNC A;  3TO9 A;  2F48 A;  2KPM A;  2HEO A;  3CTA A;  1F4K A;  1MND A;  2FFH A;  1F5T A;  3FK6 A;  1GLN A;  2WB1 N;  3ELK A;  2QSF X;  4W97 A;  2XF5 A;  1RR7 A;  3DEE A;  1BDI A;  2GA2 A;  4L9J A;  1KZH A;  2VT3 A;  3DTK A;  2P0W A;  3DPL C;  4HX7 A;  4K2E A;  2Q2E A;  4RGR A;  3O2P E;  1B9M A;  3ZMU A;  1P7J A;  1Y0N A;  4A0Y A;  3S3N A;  2HIN A;  5F27 A;  4NBQ A;  3QP6 A;  4BHB A;  1SD4 A;  2K9Q A;  2CQX A;  3WE3 A;  5L3F A;  1HSJ A;  3I4P A;  1FOK A;  2FBK A;  2BW3 A;  1UCR A;  2E5Z A;  2BYV E;  4ENM A;  2R7S A;  1Q1V A;  1O7L A;  1G8X A;  2DQR A;  4BXF A;  2DDA A;  4LLN A;  3OQO A;  1ODD A;  4EM2 A;  1NK2 P;  2MH9 A;  4LK0 F;  1FEX A;  2JA5 J;  2CS3 A;  2JT1 A;  4RM3 A;  1WPK A;  3FMY A;  3JXC L;  4HPQ A;  2V26 A;  1V5F A;  3HRU A;  3PNT A;  2J7U A;  4BQA A;  1HKT A;  3CCE I;  2VEO A;  3FWE A;  3C18 A;  1WRJ A;  1QVU A;  1MDM A;  2Z5U A;  4KIB A;  4YIR X;  4U7D A;  5JVG F;  4MO7 A;  3GFI A;  3T8R A;  4RA2 A;  5A7L A;  2CV0 A;  4GQM A;  2J7W A;  3WGH A;  1K79 A;  1PUF A;  1KU3 A;  2Q2E B;  2UXX A;  1BIA A;  2Z1D A;  1LE8 A;  3RZO J;  2OCE A;  2Y75 A;  5CQG A;  1V3F A;  1G3W A;  1IGN A;  1JGS A;  1JUS A;  5DRY A;  1P92 A;  2V1X A;  3CQZ J;  1JT6 A;  4FN3 A;  1I6X A;  4LIV A;  4IKF A;  2DT6 A;  2NVU B;  2XRN A;  4HV5 A;  4ZC3 A;  2IP2 A;  2OUM A;  4YG2 F;  3A9Z A;  3LWF A;  1BW5 A;  5DCM A;  4KYW A;  4E7I A;  3MD2 A;  2GXA A;  3KEQ A;  1VF9 A;  1X19 A;  3F8M A;  3K4J A;  3V4G A;  2X48 A;  4CCN A;  3CUO A;  5GPA A;  2MXD A;  5EG0 B;  3F51 A;  3GXO A;  3GFM A;  3ZQH A;  4OIQ F;  1VQ6 I;  2CUJ A;  5HOO A;  4M3F A;  2FX0 A;  3S14 J;  2FXA A;  3K7A J;  1DPR A;  4FQG A;  4C2M J;  1ZAY A;  1TNT A;  5E3L A;  3RYR A;  2CG4 A;  1R9T J;  4ANJ A;  3OYI A;  4ENJ A;  4AIH A;  3HPH A;  4WXH A;  2FQ3 A;  3MVP A;  1V55 H;  4HNU A;  1YRN A;  5F64 A;  3WGI A;  5E17 F;  2BVL A;  3NWT A;  3CLC A;  2G7H A;  3EDP A;  1G6N A;  2PE5 A;  1ZHF A;  1T0F C;  4ESJ A;  3TEP A;  2PMZ N;  3MMY B;  3PIP F;  3OQM A;  3IRQ A;  4LLL A;  5TGT A;  3DBL B;  4IVN A;  2I5U A;  4XIC A;  4D1Q A;  1O3T A;  1UG0 A;  3JRE A;  1L1M A;  2PUF A;  5ICE A;  1OCZ H;  5B66 C;  4E70 A;  4HX4 A;  3S1R J;  3HPG A;  3GTP J;  1K78 A;  1D8K A;  3BTJ A;  4Z6Y A;  3TO6 A;  3RYP A;  4R79 A;  1W36 D;  2QBY B;  3PIO F;  2LNM A;  1DU0 A;  2DPD A;  5H6R A;  2AXU A;  2NAZ A;  1QZY A;  5TRD A;  2H1K A;  5FFZ A;  2NOJ B;  3Q5F A;  2HVS A;  3HSR A;  2BNO A;  4EM0 B;  2STW A;  2VQC A;  5D6F A;  3QYX A;  1E3O C;  1YRN B;  1DP3 A;  4EJU A;  2GXB A;  5HLI A;  3WHB A;  5HS8 A;  3ONQ A;  5LRR A;  5K98 B;  3TDU C;  1VQ5 I;  3LSJ A;  2L8N A;  3DPT A;  2LR8 A;  3HRM A;  4XKV A;  5EF6 A;  4L5E A;  4KNY A;  2PMU A;  3DLL F;  5BMZ A;  2VC1 A;  1S72 I;  3WTY C;  3DKX A;  4LGW A;  4O6J A;  1H89 C;  3TED A;  1ETX A;  2HYJ A;  3SCH A;  2MLK A;  4RMN A;  1FNN A;  4ZTJ A;  1MNM C;  1WJC A;  2IRF G;  1FSH A;  2E1O A;  1RR8 C;  2XJ3 A;  5GTI C;  1QRY A;  5F0C A;  3X2Q H;  4EM1 A;  4F92 B;  4IX7 A;  1MMS A;  2HTJ A;  3OYD A;  5H2F C;  3BTI A;  1LDD A;  3H5R A;  2RDP A;  4BAY A;  3ZN0 A;  5FLV A;  4EJO A;  2FU4 A;  1SMT A;  2CRG A;  1YYV A;  2DQL A;  3OIQ A;  3ISP A;  2ELK A;  2DPU A;  3H9J A;  1VQL I;  3DWL E;  1NER A;  2FJR A;  3KZZ A;  1ZKG A;  1OYY A;  2O5R A;  2RN7 A;  4E7L A;  1HW2 A;  1QZX A;  4LD5 A;  3LSI A;  2IA2 A;  1OFC X;  5D5X B;  2D45 A;  1X58 A;  1IXC A;  4BQQ A;  4A3I J;  4NHJ A;  2OCC H;  2XCJ A;  1IUF A;  2BXY A;  2DFF A;  2EA2 A;  2Y0S N;  3JSO A;  3V7C A;  4F91 B;  3TW7 A;  1W36 C;  3SR4 A;  3IH2 A;  5K5Q A;  2DDB A;  2PLY A;  1RUN A;  1MDM B;  2EQR A;  5FO5 A;  2JVL A;  2L5Q A;  4W1U A;  1BR4 A;  2BV6 A;  1NG6 A;  4BHP A;  2Y48 A;  2AHQ A;  2ZJR F;  1FP1 D;  3H35 A;  2AQE A;  2JSP A;  4HEA 2;  5BQT A;  2H6B A;  2EB7 A;  5DDG A;  1YIJ I;  4DGW B;  2M7A A;  2LG4 A;  3WTU C;  3V42 A;  3R1F A;  2M3A A;  2OV7 A;  2KZ8 A;  4WF2 A;  3CF5 F;  2DJI A;  4UHT A;  4XID A;  2A68 F;  3OYA A;  1Y1V J;  1QPI A;  1JKQ C;  4N0B A;  4J1X A;  3M7G A;  4AVP A;  1VTN C;  4FBI A;  2H8R A;  2X4H A;  1XGM A;  3FBN B;  3GTQ J;  3JW4 A;  2K5C A;  2R93 J;  3CCM I;  3GBG A;  1O57 A;  3PNV A;  3CME I;  1VFC A;  2E60 A;  4R1H A;  2B9S A;  3OWT A;  4EMS A;  2KIM A;  2LMD A;  5K1Y A;  4HV6 A;  2JWT A;  4FX4 A;  2EFW A;  3ZQC A;  1XN7 A;  2QKM B;  5D6E A;  3JRC A;  2PN6 A;  4MGR A;  3ERE D;  3CMY A;  3S2H J;  1W1W E;  2H1L A;  1MBH A;  2R7U A;  3GZ6 A;  1FBQ A;  2HSG A;  4I01 A;  4G8X A;  5GAH J;  3D5L A;  1DGR M;  5DD8 A;  1FMV A;  3D0S A;  2ZO4 A;  3JR9 A;  2PFB A;  3RKX A;  3QPS A;  1RIO H;  4NDW A;  2OQR A;  3HOV J;  2DAO A;  2M87 A;  3E5U A;  1A31 A;  2VKE A;  4U0W A;  4WWC A;  4L0Z B;  3BZ6 A;  1QNT A;  2DMU A;  4UNO A;  1HDD C;  4OAZ A;  2KJB A;  2PXU A;  1UHM A;  5J1R A;  3PJR A;  4CYC B;  3QF3 A;  3G0T A;  4WCG A;  4ZYD A;  1GDT A;  3AAF A;  2DOF A;  4OMZ A;  3M4O J;  1U2W A;  3IP4 B;  2L7K A;  4IHT A;  1XD7 A;  1QP7 A;  2HCS A;  1IN8 A;  2X6O A;  2ZXI A;  2OTL I;  2LF7 A;  1FBU A;  1JUM A;  2ZFU A;  4FCY A;  4UY8 I;  1XB4 A;  4A3M J;  1WCM J;  5GAG i;  5L3C A;  1ZUG A;  1IDZ A;  3BZK A;  3ROU A;  2R7D A;  5FKK A;  4IQ4 A;  3TBI A;  3JAM Z;  3JRB A;  2WIU B;  2CQN A;  1QBJ A;  1D5V A;  2JZY A;  2V3C C;  2QUF A;  4E4H A;  1UMQ A;  4I6Z A;  5IT9 Z;  4A69 C;  3E0J B;  3K4B A;  2XIG A;  3ZMZ A;  2W25 A;  2Y9Y A;  1K6O A;  1X57 A;  1ZZ8 A;  4AC0 A;  4Q4Z F;  3FYA A;  1PUE E;  2QSG X;  3V8J A;  1B4A A;  2FUG 2;  4B09 A;  2O0Y A;  3CUQ B;  2Y0M A;  5J3L A;  3B73 A;  5ICG A;  1OJL A;  5DRT A;  2IA0 A;  3P5J A;  1X4O A;  3MZ8 A;  3OL4 A;  3ME5 A;  4WK8 F;  3E3V A;  2VKD A;  3W2A A;  2XUB A;  3HIF A;  2CFX A;  1FP2 A;  5L3E A;  4M73 A;  2LP0 A;  1V4R A;  3E6M A;  3KZY A;  4ZZD A;  3F23 A;  4OIO F;  2PIJ A;  2PXV A;  2KZV A;  2CH0 A;  1R1U A;  3KEO A;  3SZP A;  1FJL A;  1ZRC A;  1BR1 A;  2QQ8 A;  4OMY A;  3R60 A;  1I39 A;  3FXR A;  1FOW A;  2P4W A;  2HOE A;  3DCF A;  3JXD L;  4P55 A;  3I0T A;  3SZT A;  1ZPQ A;  4I2O A;  1V54 H;  2IAI A;  3K6G A;  2GWR A;  1KON A;  3A03 A;  3SXY A;  2DTR A;  4M71 A;  4I0A A;  1Z1D A;  3SQN A;  2L4A A;  4JX4 A;  2NOG A;  3SFI A;  1HST A;  3NRO A;  4JX5 A;  1GHC A;  1VI0 A;  4ESF A;  2LNB A;  4G9Y A;  4MHG A;  1UG2 A;  2R5Y B;  2KDZ A;  4NC7 A;  1SFO J;  2K3P A;  4XLP F;  1FOX A;  2VAS A;  3HKZ N;  1YI2 I;  5KHD A;  2MD0 A;  3HTS B;  2O49 A;  2F5D A;  2KEI A;  4HNV A;  1XCB A;  1ETK A;  4I8T A;  4Z2Y A;  5HS9 A;  2WC2 A;  1PNR A;  1FBS A;  1J5Y A;  3F0C A;  2K9N A;  1XGO A;  4MLO A;  4Z5D A;  1YIT I;  3DQV C;  1IV8 A;  3CJT B;  2HQ5 A;  4DJA A;  4OAY A;  5JHF A;  1MBK A;  1G3Y A;  1ERD A;  5A2Q K;  2IU7 A;  3PQJ A;  1E3P A;  5BOX A;  5FKN A;  3M07 A;  3A1Y A;  4JX6 A;  3WU0 A;  1ENH A;  3K70 D;  1I1S A;  3PUB A;  4YFX F;  1SFE A;  3FXM A;  3HZJ A;  3KYD B;  3ECH A;  5IP6 A;  1P4A A;  1R23 A;  3TQN A;  1YX5 A;  1JKP C;  3I56 I;  2PJR A;  2TDX A;  3SDG A;  3ZR8 X;  3NZL A;  3LST A;  1K83 J;  3L7W A;  3G6E I;  3FXK A;  5E1X A;  2NS8 A;  4Y17 A;  5JLW A;  2JJ7 A;  2QLZ A;  3AL0 C;  2HFZ A;  4LLG F;  4RS8 A;  2O61 A;  3GLX A;  4Y4R A;  1W7P D;  5DUK A;  1LMB 3;  2NNN A;  3DU5 A;  1TL8 A;  1HW1 A;  3RSN A;  3VYS B;  2L7F P;  4IVZ A;  3PQK A;  5ERI A;  2HPM A;  3T0Y A;  5K5R A;  4ZYA A;  1FY7 A;  1RZR A;  2W84 A;  2AXT C;  5L3G A;  1W0U A;  2M0C A;  3OYF A;  3DEW A;  2K9M A;  4BBS J;  3LL7 A;  4BE2 A;  4M3D A;  1ITY A;  1ETY A;  3HHG A;  3CDL A;  3DPU A;  2XGD A;  5LGU A;  1K4S A;  1QU3 A;  2IS4 A;  2PG4 A;  1LFB A;  3ABK H;  2PUD A;  2M7B A;  4IRI A;  2CQ7 A;  3HUG A;  2NVT J;  1GXQ A;  3RPQ A;  2DMP A;  4NQW B;  1IUY A;  3RKW A;  4X6A J;  3QRF F;  4IOA F;  4UB8 C;  5DCF A;  5FLX K;  1BR2 A;  2FBI A;  4RAF A;  2OU2 A;  3H1C A;  3ZOB A;  5FD6 A;  3QPT A;  5FRM A;  4I7H A;  3QWG A;  2K3F A;  3S8Q A;  2BJC A;  2HQN A;  1O3S A;  2AQF A;  2A6C A;  4PJL A;  2EV0 A;  3BG5 A;  3LA7 A;  2OR1 L;  4BAC A;  3ZN1 A;  2GIZ A;  1D1C A;  1DQU A;  5EYR A;  3VWS A;  2V4J C;  3QOE A;  2IA1 A;  2ADU A;  3GME A;  5E1Z B;  3CJQ B;  1QGP A;  2ODR D;  2DFI A;  3HSF A;  4PJM A;  3CES A;  3TDZ C;  1TT5 B;  5LLQ A;  1GV5 A;  1S8N A;  4XN0 A;  4CCM A;  3B7H A;  3BR5 A;  2ZB9 A;  3GCM A;  4B1R A;  2CWE A;  4XKC A;  1ZRE A;  5BS6 A;  4PGG A;  5GPC A;  1IN5 A;  1MSE C;  5DM7 F;  4PK4 A;  1LJ9 A;  2A61 A;  4DBQ A;  1N75 A;  3EUH A;  2OC6 A;  2W48 A;  4M9S A;  4XOT A;  1STZ A;  4XR6 A;  5GAD J;  1T38 A;  2LYS A;  1ON1 A;  2PXT A;  4YFN F;  3K69 A;  1HOM A;  2DJN A;  3OYB A;  1U3E M;  1IN4 A;  2LYQ A;  2LKS A;  4DQ2 A;  2W7N A;  1FIA A;  2R7X A;  5E8I A;  2ECC A;  5EZG A;  2LBF B;  2VE8 A;  4E7J A;  2EBY A;  4YG4 A;  4A3K J;  2Z2S B;  3BDD A;  1JHF A;  1ZG5 A;  1TWG J;  4RLF A;  2HTS A;  5HNF A;  1GVJ A;  4RB1 A;  4EGY A;  4Z59 A;  2VIX A;  2EIN H;  3R0A A;  4ZZL A;  1GV2 A;  2A3S A;  2OF7 A;  2EZK A;  2OD5 A;  1J9I A;  1TWA J;  2DK8 A;  5M5Y J;  3BR2 A;  1WJ5 A;  1BJA A;  3CUQ A;  4C3H J;  1IG7 A;  4M6X A;  3EYI A;  2W4S A;  1YSE A;  2HR3 A;  5C4J J;  3V8L A;  4KMF A;  1JI8 A;  1MMG A;  3V7S A;  2TRT A;  2VOP A;  1PRV A;  4IQJ A;  1ZZ9 A;  2MD5 A;  2Q8K A;  2X6X A;  3J7A Y;  4F52 A;  3F3X A;  1HXD A;  2IGM A;  3C2H A;  3ZQL A;  5H6Q A;  3SJM A;  1LB2 A;  3BD1 A;  2M4H A;  2LSO A;  3GTK J;  4NNJ A;  2IW5 A;  3FKJ A;  4ZDL A;  3REO A;  2DOD A;  9ANT A;  2GRM A;  2JQE A;  1SFX A;  1O7F A;  2AWI A;  5ED4 A;  1RZ4 A;  4OIR F;  1V5E A;  2WTE A;  1U8B A;  4Q2J A;  4A5M A;  5LGN A;  1Z77 A;  4FIS A;  1VQP I;  4FET A;  2X85 A;  2E2I J;  4HF1 A;  2IPQ X;  5IT3 A;  1FTZ A;  3GZD C;  2MEZ A;  3ZHI A;  2X0L A;  4X4E A;  1WWX A;  3BQY A;  2W57 A;  1IC8 A;  3I54 A;  1Y7Y A;  2VON A;  1WQ2 A;  1TLH B;  1OR7 C;  1DDN A;  1WI3 A;  5JLX A;  3ZMV A;  1OPC A;  1SAU A;  2XAF A;  1RUO A;  5E20 A;  3HEF A;  1SVL A;  2VBW A;  3QAH A;  3OIO A;  2VOD A;  3S2D J;  2JVH A;  3UFD A;  2ACJ A;  2EZH A;  2PXK A;  4II3 A;  1UXD A;  4G6Q A;  1JH9 A;  2MLG A;  4BS9 A;  4EKI A;  5M5W J;  3OL3 A;  4X1E A;  5HDK A;  5J4Y A;  4R8H A;  2E2H J;  5DUI A;  3MWM A;  2JA6 J;  1MMD A;  2KP6 A;  2PMH A;  3DTE A;  1Z67 A;  4XLH A;  4MQ9 F;  4QPQ A;  4EJW A;  3HXL A;  3IKV A;  3S1M J;  5F08 A;  5DCM B;  3Q0V A;  2DXI A;  2Z3Y A;  1QP4 A;  2L9S A;  2Q1Z B;  1SFU A;  4M3E A;  3M1E A;  3KP5 A;  3EUH C;  4Y42 A;  4WXC A;  4RM2 A;  1P2F A;  4RDU A;  1TQM A;  4Y3O A;  2X1C A;  4C9Y A;  2VUM J;  3QOP A;  2MG4 A;  1B9N A;  3HOZ J;  2XXA A;  4ESB A;  1WJF A;  5E1W A;  3CJN A;  3G1L A;  1MH4 A;  5LHH A;  4J01 A;  2JMW A;  3CLQ A;  3MKZ A;  3GN5 A;  2PXP A;  1QZE A;  1S9H A;  2DMT A;  4NC6 A;  4IA8 A;  2XPW A;  4MQV A;  4M9Z A;  1VZ0 A;  2Y0S A;  1Z9C A;  3BP8 A;  3OV8 A;  1ZAO A;  2VBY A;  2HOA A;  4G6D A;  3HB9 A;  2JRT A;  5F6F A;  3LSM A;  3IH3 A;  2KIS A;  2WAD A;  1ZRF A;  5JVT A;  3TL4 X;  5HNH A;  3SEQ A;  3CO7 C;  2XAU A;  1N78 A;  3G2B A;  2FMY A;  3JTH A;  3NRV A;  5K5O A;  3IL2 A;  1LNW A;  4BJT A;  2ISZ A;  1TP4 A;  3CC2 I;  1MBJ A;  1RNL A;  1LKX A;  3MN2 A;  3WGG A;  2GXG A;  3S3O A;  3JTG A;  1R4N B;  3PSF A;  3LQQ A;  3BS3 A;  3OYN A;  3KCC A;  3RKY A;  2VT2 A;  4PJ0 C;  3KP3 A;  3KX2 A;  1HF0 A;  2QGU A;  2LF8 A;  3OYL A;  4LIU A;  4S05 A;  2FOW A;  3O3K A;  3GWZ A;  2QKL B;  1TZL A;  2ZME B;  1ETW A;  4LB6 B;  1HQ1 A;  3MKW B;  2ELJ A;  3K1P A;  3F21 A;  3SCF A;  1KU7 A;  1ADR A;  4CO8 A;  2B0L A;  3GEZ A;  2H8W A;  2XI8 A;  2BGC A;  3OSF A;  3GZD A;  3B02 A;  1XG1 A;  3WU1 B;  4HLX A;  5LD2 C;  3VWB A;  3ZKC A;  2BHY A;  4QLC U;  2KEK A;  4YEJ A;  1QQA A;  2K4J A;  2ZCW A;  2F4I A;  3ERM A;  4ZH4 F;  3PO2 J;  5DV5 A;  1REP C;  4A0Z A;  4BQO A;  1O4X A;  3RTR A;  3LOC A;  3FIW A;  3I59 B;  5KCM A;  4HRI A;  2R7T A;  3VYR B;  2EZL A;  5E8G A;  4ER5 A;  1WHU A;  2LBF A;  4RB0 A;  2COM A;  2V79 A;  1Z6T A;  2CUZ A;  3NQO A;  4XKB A;  4B3X A;  3AG1 H;  1LLI A;  2YX4 A;  5AON A;  2D1H A;  2DW4 A;  2O03 A;  4LG3 A;  3GF2 A;  3VYT B;  4C3J J;  4CIC A;  3H0D A;  4D9J A;  3OYH A;  4A3C J;  1WH8 A;  2LLV A;  2DA6 A;  2F4O B;  3H36 A;  3CC7 I;  1GT0 C;  1R71 A;  2BY0 A;  2BZT A;  2E5N A;  3M8E A;  2LC2 A;  4GYG A;  2PXL A;  5M3M J;  2HQR A;  3JRF A;  2RNJ A;  2VJ5 A;  2V9K A;  3CC4 I;  4XRF A;  3BR3 A;  2BE5 F;  1X2M A;  2GOX B;  2B5A A;  1ETQ A;  3SYT A;  3EQL F;  3JCU C;  1ORK A;  4A2U A;  2DU9 A;  2M8E A;  2MW8 A;  4MIM A;  4FX0 A;  4BJ5 C;  2IGN A;  2G9W A;  2RVC A;  3G5G A;  1WJD A;  3HKZ A;  1FLI A;  3NEU A;  4I98 B;  1Y6I A;  1E17 A;  1RET A;  1NH3 A;  1IW7 F;  2NVY J;  1S7A A;  1ZLK A;  4A12 A;  2E1M C;  1KYZ A;  4MEY F;  4MFE A;  3AG4 H;  2GBY A;  3JRG A;  4H0E A;  2KDO A;  1I3Q J;  4YIF A;  1ZLJ A;  4EJV A;  2LYL A;  1MSF C;  3OS2 A;  3H9Q A;  2O6G E;  2CSO A;  2ICP A;  1IAW A;  2P5L C;  4ZYG A;  5FD5 A;  1FX7 A;  4IWR A;  3SHF A;  2E35 A;  4RGU A;  1S7O A;  3D5S C;  4A6D A;  2VKH A;  3QYF A;  4MCX A;  4B47 A;  4UV9 A;  3L2W A;  5F04 A;  1YJW I;  2HVR A;  1B6A A;  2X9D A;  2LYC A;  1ZRD A;  1U6G A;  1JXS A;  5KVR A;  1MMN A;  4A3G J;  2Y2Z A;  1JTY A;  2GQQ A;  4V2G A;  4MCT A;  2COB A;  1TWH J;  2ZSI B;  4WVL A;  3L2U A;  3UKG A;  4CDG A;  4IRG A;  4LJZ F;  3C2G A;  1ACI A;  4I09 A;  2LYR A;  1AKH B;  3CDH A;  4Q47 A;  2VBX A;  2CW8 A;  3CCS I;  1FC3 A;  1JJ6 C;  2XPV A;  4X0G A;  1XGS A;  3CD6 I;  3OS1 A;  1QVT A;  1W7P A;  2E1N A;  2ZNZ A;  4M72 A;  1JGG A;  1MMA A;  1YG2 A;  1KQ9 A;  3F8F A;  4Y33 A;  2QZ8 A;  2E34 A;  2XSJ C;  1A6I A;  3WHC A;  1B72 A;  1OCP A;  3HZI B;  3WTS C;  4UVB A;  2L9N A;  3G3Z A;  4GRI A;  2EK5 A;  3F8C A;  3K4C A;  2HXI A;  2KIU A;  3QQA A;  1JT0 A;  2E71 A;  1USS A;  3ZQF A;  1QO0 D;  1X3Z B;  2XIU A;  4I02 A;  2CW7 A;  5EG0 A;  2JSC A;  3L2V A;  5AIQ A;  3KP6 A;  4CSW A;  1WSU A;  4PDK A;  2P81 A;  2UV1 A;  3DU6 A;  3ABM H;  1VQ8 I;  3VPR A;  2B7E A;  4IRH A;  3HGY A;  3IHU A;  2JVG A;  3H0G J;  3HOY J;  2GZW A;  4BHC A;  4EGZ A;  1K7A A;  1D1B A;  2JA7 J;  1HKS A;  4ITV A;  2GA1 A;  1Y9Q A;  1XSX A;  1XMX A;  4CXF A;  3AG2 H;  4B8X A;  3WTW C;  2OBP A;  4QIW N;  4L0Y B;  4IO9 F;  3GTJ J;  1J2X A;  3K4M A;  4PFP A;  2AO9 A;  5HDG A;  4Z5H A;  3H92 A;  1D3Y A;  4J00 A;  1FIP A;  2JUG A;  2Y30 A;  2LFB A;  3TKY A;  3PUF A;  3QP5 A;  3FMS A;  1BA5 A;  2IV1 A;  1YFH A;  2EZI A;  1BC7 C;  2HI3 A;  3LAP A;  3Q0U A;  1OCT C;  2M1B A;  4FHT A;  4YFK F;  3RZD J;  2A5W A;  4BEH A;  2ZJQ F;  2CV2 A;  3DBH B;  5C44 J;  2DT5 A;  1IF1 A;  3KE2 A;  2P7V B;  3M3Y J;  3MZH A;  1YS6 A;  1I3A A;  2M8G X;  1A35 A;  5FGM A;  5J40 A;  1ZAR A;  1QZZ A;  3K4N A;  1POG A;  4RB2 C;  4RAY A;  5FLX Z;  1XGN A;  5BPI A;  2X1D A;  1OR7 A;  4CCK A;  3CMM A;  3FYM A;  1Y39 A;  4HZF A;  2HFH A;  1DUL A;  3IKT A;  2M5W A;  3P9K A;  2P6T A;  3PXP A;  1HW5 A;  1R58 A;  2UXN A;  1V5G A;  2BY3 A;  4M3B A;  3TP0 A;  5K7H A;  1AHD P;  5CLS A;  5IP7 J;  1ZN2 A;  3KPH A;  5E79 C;  3ZQ7 A;  2A6H F;  3VYU B;  1SMY F;  5B1A H;  3KFW X;  4BDZ A;  1S6L A;  3H3U A;  2HU9 A;  3FXJ A;  4DNC A;  2V6E A;  3W6V A;  2O3F A;  3JXB C;  1HC8 A;  4BEH B;  1A04 A;  1G4D A;  2HZT A;  3OR1 C;  1XWR A;  2DFE A;  1P4X A;  3KIO A;  4YEL A;  4BE1 A;  1KU2 A;  4Z5C A;  5HDN A;  1U0J A;  1PVE A;  4XLE A;  2LOO A;  4X4F A;  4JCX A;  3I9V 2;  4XMY A;  4I0B A;  3DEU A;  3FHZ A;  3CUQ C;  3V7R A;  1XS9 A;  2XF6 A;  4DIQ A;  5CKT A;  2RQP A;  3HYI A;  3OMY A;  4G6T B;  3IAM 2;  3FHN A;  4XRS A;  1XMK A;  1TW2 A;  2IS6 A;  2PI0 A;  1TW3 A;  1QPZ A;  2QVO A;  2OQG A;  3IWZ A;  4PSW A;  5EEH A;  3ULQ B;  1S3J A;  2CSF A;  4PCQ A;  4M74 A;  3OKZ A;  1W5T A;  3CCV I;  5C4X J;  2ZBK A;  5GP9 A;  4A0X A;  3DKY A;  2EJR A;  1JTX A;  1WH7 A;  2QQB A;  3S15 J;  4PU7 A;  2LKP A;  3CDI A;  5KAI C;  5KAF C;  3L2C A;  3K0L A;  3S93 A;  5M3F J;  4ENN A;  1D8J A;  2EFN A;  2XHK A;  1ONV A;  2AS5 F;  4U0Y A;  3FM3 A;  3QYE A;  1BC8 C;  2BOL A;  1BL0 A;  2DA5 A;  5CJ9 A;  4KA4 A;  3HJE A;  5E3O A;  2V1D A;  1R22 A;  4BKX A;  4N4O B;  2L0K A;  4KIC A;  4BE0 A;  3QYB A;  4KIF A;  3SZG A;  3H5T A;  3LFK A;  4HA8 A;  1XSV A;  4QWQ A;  5L3B A;  1U9N A;  3LSP A;  2PUE A;  1X4P A;  3WTV C;  1XDS A;  3ZP5 A;  2IEK A;  3ZGK A;  3VEP A;  2XRL A;  3A2K A;  4Q5S F;  1R5G A;  3L00 A;  2NRA C;  3OYE A;  1BI0 A;  3LQR A;  5D5V B;  4JQD A;  2P5V A;  2QEN A;  3BRO A;  4DW6 A;  2R7W A;  2CFO A;  1MJB A;  5D8K B;  2W85 A;  4XM3 A;  1YJN I;  1EA3 A;  2L9V A;  4DYC A;  3R0J A;  5CVR A;  2A07 F;  1O3R A;  1X2L A;  3J81 Z;  3M8F A;  4IHY A;  4NQW A;  1R5I D;  2D5V A;  3W6K B;  2K85 A;  1QPM A;  2CUE A;  3I3L A;  4PJN A;  2WV0 A;  4FE7 A;  3U1K A;  4YAR A;  2KZG A;  5BPD A;  2VPL A;  2VJJ A;  1KQ8 A;  2MQK A;  4G94 A;  3FXQ A;  1OKR A;  2ELH A;  3TW6 A;  5LFA A;  2UWM A;  1POU A;  1ZZ6 A;  3KZ3 A;  1QQB A;  2V6C A;  2V9P A;  2O8K A;  1N77 A;  3FZV A;  3SCG A;  1Y56 A;  3IWF A;  3BG7 A;  2XRO A;  2Z16 A;  4L5J A;  4RAG A;  2EFO A;  5FKM A;  1ZH5 A;  4BL0 B; 
#chains in the Genus database with same CATH homology
 2NVX J;  2IVB A;  3QPL A;  1VPW A;  3MKL A;  1B8I A;  1BW5 A;  1ZZ9 A;  3OQN A;  3ZHM A;  3L1P A;  3D1N I;  1VF9 A;  3ZQL A;  1ZS4 A;  3SJM A;  3BD1 A;  2X48 A;  4X4G A;  5GPA A;  3GTK J;  5EG0 B;  3F51 A;  3I4N J;  3ZQH A;  2XPU A;  3GTG J;  2E19 A;  3HOU J;  4M3F A;  1BJZ A;  2FX0 A;  3S14 J;  4A3D J;  2AXV A;  3LFP A;  3E7L A;  3K7A J;  2PPX A;  4C2M J;  9ANT A;  2GRM A;  1ZAY A;  3PM1 A;  5E3L A;  5HOD A;  5IYD J;  4IHW A;  1R9T J;  2AWI A;  1MBF A;  5IYC J;  3OSG A;  2BNN A;  2YU9 J;  3BR0 A;  5K7F A;  4A3B J;  3GN5 B;  5E3M A;  1WET A;  2LK2 A;  3LSG A;  3Q3S A;  1WIZ A;  4Y52 J;  3MVP A;  1U8B A;  1RIO A;  1LCC A;  1JKO C;  1YRN A;  4PU3 C;  1Z77 A;  4FIS A;  3DNV B;  2E2I J;  4BY7 J;  1FTZ A;  3CLC A;  3BT9 A;  3ZHI A;  2MEZ A;  1JWL A;  4X4E A;  3CRO L;  1IC8 A;  3BQY A;  2E2J J;  3F52 A;  2PUB A;  1Y7Y A;  2R5Y A;  2PE5 A;  2YS9 A;  1A5J A;  1WI3 A;  5IYB J;  2EBI A;  5JLX A;  2LKX A;  2PMZ N;  2DA2 A;  3OQM A;  4YG7 B;  1PUF B;  3Q0W A;  4YBA A;  3HEF A;  4XIC A;  5F0H A;  1CQT A;  2PUF A;  3OIO A;  3JRE A;  2DMQ A;  1L1M A;  3S2D J;  3S1R J;  2AW6 A;  3GTP J;  3UFD A;  2FQ4 A;  3BTJ A;  2EZH A;  3C2B A;  2R5Z A;  1UXD A;  2GM4 A;  1DU0 A;  2DTZ A;  2AXU A;  1JH9 A;  2LY9 A;  3KXA A;  5M5W J;  1LFU P;  4X1E A;  2H1K A;  1P7I A;  2E2H J;  4F8D A;  2JA6 J;  2BNO A;  2O9L A;  2LLK A;  4A3J J;  3S1M J;  2ICT A;  2KT0 A;  5F08 A;  5DS9 A;  3Q0V A;  5J1Y A;  1Y1W J;  3QYX A;  1E3O C;  2OFY A;  1H8A C;  1QP4 A;  1YRN B;  4JP0 A;  3VK0 A;  2XB0 X;  5M5X J;  3WHB A;  1R69 A;  4M3E A;  1ZK8 A;  5K98 B;  3LSJ A;  2L8N A;  4Y42 A;  1G2H A;  2LR8 A;  5EF6 A;  1ETV A;  1ZZB A;  4L5E A;  4RDU A;  3ZQG A;  4UUS A;  2VUM J;  4UUT A;  2CUF A;  2FJ1 A;  4PU8 A;  2MG4 A;  3HOZ J;  3RKQ A;  1H89 C;  3S1Q J;  2R63 A;  3TED A;  1ETX A;  2HYJ A;  5FKL A;  1PRU A;  3G1L A;  1MH4 A;  3SCH A;  3LSR A;  2JMW A;  2DN0 A;  2ID6 A;  3GN5 A;  4X4C A;  2CJJ A;  2DMT A;  4IA8 A;  2XPW A;  1W0T A;  1K61 A;  3H3V K;  1RPE L;  3JRH A;  1MNM C;  4I6T A;  1RZS A;  3TRB A;  2LCV A;  2E1O A;  2HOA A;  2MGQ A;  3BR1 A;  4D7M A;  2XJ3 A;  1QRY A;  3HB9 A;  2LYJ A;  3OMT A;  1DU6 A;  5FLM J;  5F0C A;  4J1W A;  3BR6 A;  3IH3 A;  2AUW A;  2O4A A;  4A3F J;  5F0F A;  1SAN A;  3CCY A;  4AYB N;  1B72 B;  3BTI A;  1MBJ A;  5FLV A;  4JCY A;  3MN2 A;  4IEJ A;  2CRG A;  2ELK A;  1UHS A;  1IV6 A;  2CU7 A;  1NER A;  2FJR A;  1ZKG A;  3JRI A;  2NS7 A;  2IUO A;  1IDY A;  3OP9 A;  1IRZ A;  1OFC X;  1FTT A;  1X58 A;  3BS3 A;  2R1J L;  1JJ8 C;  4A3I J;  1ZZ7 A;  2M2E A;  2XCJ A;  1IUF A;  4BXX J;  2AXZ A;  1RZR D;  1HF0 A;  4B3A A;  5EGO B;  2Y0S N;  4QTR A;  1PER L;  2I10 A;  3EUS A;  2R0Q C;  2HOT A;  3TW7 A;  3K2A A;  1RES A;  1ETW A;  3IH2 A;  4FTH A;  3SCF A;  1ADR A;  2L7M P;  2XI8 A;  3FIS A;  3HOW J;  3OSF A;  2EQR A;  4MFD A;  1U9O A;  2JVL A;  1XG1 A;  4W1U A;  3GTO J;  1EF4 A;  3GBF A;  2L9R A;  3ZKC A;  2EWT A;  2OPT A;  2AHQ A;  5IP9 J;  5EDN A;  2KEK A;  1QQA A;  2PUG A;  1LE8 B;  2YUS A;  1I50 J;  1SQ8 A;  3G1M A;  3PO2 J;  1JFS A;  3R1F A;  2GLO A;  5K7Z A;  4DYR A;  4YG1 A;  4I6U A;  1O4X A;  1HCR A;  5E3N A;  2KZ8 A;  3LOC A;  3FIW A;  3O8G A;  2HDD A;  1F36 A;  2EZL A;  4XID A;  3I4M J;  1Y1V J;  1BDH A;  1UTX A;  4G12 A;  1QPI A;  1JKQ C;  4J1X A;  4FBI A;  1LLI A;  2H8R A;  3GTQ J;  5EZH A;  4M3G A;  4C3J J;  2JA8 J;  2WAQ N;  2R93 J;  1LCD A;  2ME0 A;  4A3C J;  3GBG A;  1WH8 A;  4GHJ A;  1RPW A;  2DA6 A;  1VFC A;  1UXC A;  1MBE A;  1GT0 C;  1S7E A;  1MBG A;  2LTP A;  2XSD C;  2JWT A;  1JUP A;  5M3M J;  3JRF A;  3S17 J;  3ZQC A;  3JRC A;  1JKR C;  2CQQ A;  3BR3 A;  1X2M A;  2B5A A;  1ETQ A;  3CMY A;  1ORK A;  4QSH A;  3S2H J;  2HOS A;  1MBH A;  2MW8 A;  2EF8 A;  2BNM A;  1GUU A;  2HSG A;  4Z58 A;  4MIM A;  2G0E A;  3G1O A;  1NTC A;  3LIS A;  3JR9 A;  2O7O A;  3G5G A;  3QPS A;  4NDW A;  2JK3 A;  2GRL A;  2K9S A;  5BNG A;  3HOV J;  1RET A;  1TWC J;  4NDL A;  5J1U A;  2NVY J;  2Y31 A;  2VKE A;  1F43 A;  2ME6 A;  2DMU A;  3TP3 A;  4MFE A;  1HDD C;  2GBY A;  3JRG A;  1IJW C;  2LYL A;  1I3Q J;  3F6W A;  1MSF C;  5J1R A;  4D5C A;  4CYC B;  3BTL A;  3QF3 A;  4B4C A;  2LYP A;  2ICP A;  4X4B A;  3A02 A;  2DA1 A;  4IHX A;  1HLV A;  1GDT A;  1D5Y A;  4DYQ A;  3BTC A;  2PUA A;  4IWR A;  3B6A A;  3M4O J;  1ZGW A;  4GFB A;  1ZVV A;  1QP7 A;  4A3E J;  4MCX A;  2VI6 A;  2X6O A;  4X4I A;  1JUM A;  4FCY A;  2M9H A;  5F04 A;  1WCM J;  2HXO A;  4A3M J;  1ZUG A;  1IDZ A;  2X9D A;  5FKK A;  2R5Z B;  3IH4 A;  2LVS A;  5EEA A;  4A3G J;  3JRB A;  2Y2Z A;  2WIU B;  1JTY A;  1TWF J;  4V2G A;  4MCT A;  4X4H A;  2KEJ A;  3O8H A;  2COB A;  1TWH J;  2DA3 A;  1UMQ A;  4I6Z A;  3UKG A;  1T33 A;  3JRD A;  4A69 C;  2DA7 A;  3NAR A;  2Y9Y A;  2LYR A;  4ABZ A;  1AKH B;  4PU4 C;  1X57 A;  1R63 A;  4AC0 A;  1ZZ8 A;  4O8B A;  3GTM J;  2N8G A;  1JJ6 C;  2XPV A;  3FYA A;  1EFA A;  1GVD A;  3NAU A;  4RBO A;  1QVT A;  2IVG A;  1U78 A;  2MSY A;  5J3L A;  1OJL A;  2VKV A;  1JGG A;  4BY1 J;  3HBL A;  4AUX A;  2WV1 A;  1A6I A;  3WHC A;  1B72 A;  1OCP A;  2K40 A;  5DTD A;  3S16 J;  3HZI B;  4I76 A;  3QQA A;  2HXI A;  2LP0 A;  1JT0 A;  2PIJ A;  3OOU A;  3HOX J;  1ZR2 A;  3ZQF A;  2R7Z J;  2XIU A;  4CYC A;  1FJL A;  5F1J A;  5EG0 A;  2CRO A;  2P81 A;  2DMN A;  3U3W A;  4D7N A;  1QP0 A;  3VPR A;  3DCF A;  3JXD L;  3HGY A;  3PO3 J;  3H0G J;  3HOY J;  1ZPQ A;  2IAI A;  4OB4 A;  4J19 A;  2JA7 J;  1B8I B;  1PRA A;  5EGO A;  4DZJ A;  5FJ8 J;  3A03 A;  1WGX A;  2XB5 A;  1Y9Q A;  4JX4 A;  3FK7 A;  2NOG A;  3SFI A;  4JX5 A;  3FKI J;  1VI0 A;  4QIW N;  3RZZ A;  3LNQ A;  3GTJ J;  1UG2 A;  1VND A;  1BW6 A;  2KDZ A;  2R5Y B;  1SFO J;  2AO9 A;  4Z5H A;  4IHV A;  2PUC A;  3HGG A;  4EEF G;  1FIP A;  3HKZ N;  2Y30 A;  2IBD A;  2LFB A;  4XRM A;  2O49 A;  1WH6 A;  2KEI A;  4HNV A;  4I8T A;  1ETK A;  1PNR A;  1BA5 A;  1AKH A;  2IV1 A;  2EZI A;  3HM5 A;  2HI3 A;  3F0C A;  2K9N A;  2B63 J;  4MLO A;  3Q0U A;  1OCT C;  2DA4 A;  3RZD J;  4A93 J;  4Z5D A;  2HQ5 A;  5IOY A;  2GZU A;  5C44 J;  3M3Y J;  1MBK A;  2RAE A;  4A3L J;  1MH3 A;  2WUS R;  2IU7 A;  1JFT A;  1T56 A;  2M8G X;  4Y7N J;  5FKN A;  2TCT A;  4JX6 A;  1ENH A;  2JCG A;  2ID3 A;  1POG A;  4FE4 A;  3ZQI A;  1NEQ A;  1I6H J;  4JYK A;  5IP6 A;  1JKP C;  1NK3 P;  3KJX A;  4I6R A;  3FYM A;  3RQI A;  1CJG A;  2QCO A;  3SDG A;  3BDN A;  1ZR4 A;  1K83 J;  3PXP A;  2IVQ A;  2ECB A;  3TP0 A;  2NS8 A;  4M3B A;  2O38 A;  5K7H A;  1AHD P;  2XGC A;  5JLW A;  3G7D A;  2JJ7 A;  4V2F A;  3IVP A;  5IP7 J;  4UUS B;  1ZQ3 P;  1LMB 3;  4M6V A;  2XGE A;  1DW9 A;  1LQC A;  2L7F P;  4IVZ A;  3W6V A;  3JXB C;  1RZR A;  2FD5 A;  4D5F A;  1W0U A;  2KPJ A;  2M0C A;  3BQZ A;  3DEW A;  4BBS J;  1XWR A;  3A01 B;  1X2N A;  4M3D A;  2Y9Z A;  1ITY A;  1ETY A;  3CDL A;  3MLF A;  2XGD A;  2LYK A;  2L7Z A;  1ZZC A;  3CEC A;  4Z5C A;  3IV5 A;  1LFB A;  2PUD A;  1HDP A;  3QQ6 A;  1AU7 A;  2NVT J;  4X4F A;  4JCX A;  1WH5 A;  3S1N J;  2DMP A;  4BBR J;  4LOC A;  4X6A J;  5FKO A;  1XS9 A;  3ZOB A;  2LD5 A;  3QWG A;  3FK6 A;  4DZP A;  2WB1 N;  3S8Q A;  2BJC A;  4W97 A;  1RR7 A;  1ZTR A;  4XRS A;  2A6C A;  1BDI A;  3BG5 A;  2OR1 L;  1QPZ A;  2CSF A;  5IPA A;  5EYR A;  2QF7 A;  2R92 J;  5C4X J;  1P7J A;  1XC5 A;  5GP9 A;  1Z0X A;  1APL C;  2HIN A;  5F27 A;  1B0N A;  1JTX A;  1WH7 A;  3S15 J;  4PU7 A;  4S0H B;  2K9Q A;  3A01 A;  1RKW A;  2CQX A;  1GV5 A;  5M3F J;  2L49 A;  3B7H A;  4X4D A;  3BR5 A;  2ZB9 A;  3O9X A;  1BL0 A;  4B1R A;  2DA5 A;  1DWK A;  1RKT A;  5E3O A;  3B6C A;  4BKX A;  1Q1V A;  2L0K A;  5GPC A;  1ETO A;  1MSE C;  3H5T A;  3OQO A;  1U9N A;  3LSP A;  1NK2 P;  1FEX A;  2PUE A;  2JA5 J;  2W48 A;  2VPR A;  1WPK A;  2LYS A;  3FMY A;  3JXC L;  2IEK A;  1HOM A;  2DJN A;  5C3E J;  2XRL A;  3JRA A;  1QVU A;  2LYQ A;  2M34 A;  1FIA A;  3HDD A;  4JQD A;  4DW6 A;  4MO7 A;  2ECC A;  5EZG A;  5A7L A;  2EBY A;  4GQM A;  4A3K J;  4YG4 A;  1OSL A;  1PUF A;  1TWG J;  4DYC A;  1X2L A;  1TC3 C;  1LE8 A;  5IOZ A;  4C3I J;  4IHY A;  2D5V A;  4Z59 A;  3RZO J;  2CUE A;  1GV2 A;  2OF7 A;  2NVQ J;  2EZK A;  4FE7 A;  4YAR A;  1TWA J;  4XK4 A;  3GTL J;  5M5Y J;  1IGN A;  1H88 C;  3BG9 A;  1JUS A;  3BR2 A;  2MQK A;  3TW6 A;  1QQB A;  1POU A;  4C3H J;  1ZZ6 A;  2EH3 A;  2JN6 A;  1IG7 A;  2O8K A;  3KZ3 A;  3CQZ J;  1JT6 A;  4FN3 A;  3SCG A;  1YSE A;  5C4J J;  4XRS G;  5FKM A;  3BG3 A;  2TRT A;  1PRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...