1CQTA

Crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
134
Chain Sequence
b'EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*CP*AP*AP*AP*TP*AP*AP*GP*G)-3')
publication title Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/dna
total genus 36
structure length 134
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1cqtA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1cqtA01
1EFAA 2BNMA 3ZHMA 4M3EA 3OIOA 1MBFA 1BDIA 1U78A 1ETVA 4BKXA 3JRHA 1PRAA 3DCFA 2WUSR 3KZ3A 2LK2A 3Q0WA 3S17J 2X9DA 2O4AA 2GRLA 4Z59A 1F36A 3BT9A 2AXUA 2EH3A 1JUMA 2COBA 5J3LA 4JP0A 1FTTA 2FD5A 3G1LA 4ABZA 1A5JA 4DZJA 4XIDA 2P81A 1WI3A 1VNDA 2R7ZJ 4W97A 4YG7B 5DS9A 2R5ZA 3HDDA 1WH6A 3BD1A 4I6RA 1JKQC 2ICPA 3BQYA 3ZQFA 4D7NA 2LYQA 1S7EA 2JCGA 2XIUA 1JJ8C 1Y1VJ 2JMWA 1NEQA 2AXVA 3ZHIA 4IHXA 2G0EA 3LOCA 4Z5CA 4UUSB 1B72A 3H0GJ 1HOMA 4JCYA 2LTPA 3KJXA 1RETA 2LYPA 3SCHA 1NK3P 2WB1N 2XGDA 1WGXA 2Y2ZA 2XJ3A 3S8QA 2CROA 3RZZA 2QCOA 3I4NJ 5E3OA 1TWFJ 2XGCA 2DMQA 5DTDA 5EF6A 1RPWA 4M3GA 5EGOB 2LP0A 2A6CA 3QQ6A 1ZR4A 4CYCB 4MO7A 2NVXJ 5E3LA 2IU7A 3ZQGA 4OB4A 3A03A 5FKMA 2DA5A 1X2NA 3HOZJ 4X4DA 1ETKA 1B8IA 3OSFA 3GTQJ 1JH9A 3TW6A 3IV5A 1JT6A 1POUA 2H8RA 1HF0A 2BJCA 5J1RA 1U9NA 2OFYA 5FKKA 5HODA 3S14J 4GHJA 1QVTA 1LFUP 2EZKA 1UTXA 3A02A 2M8GX 1FIAA 3BR6A 2JA7J 5C44J 1FEXA 1QP0A 3LFPA 3JRCA 4RBOA 5FJ8J 1WCMJ 2YUSA 1AKHA 1IUFA 3HOUJ 2DA3A 1NERA 4YBAA 1JJ6C 2HQ5A 4MCTA 4C3HJ 4S0HB 4IEJA 3JXDL 2NS7A 2AO9A 3QF3A 1QPZA 4L5EA 3BTIA 2ID6A 2W48A 3GBGA 2XB5A 1RPEL 3CLCA 2R0QC 1CJGA 3CROL 2EBYA 1MSEC 1UMQA 3HB9A 3G5GA 1R69A 1RKWA 1B72B 2BNNA 1IC8A 5F04A 2AXZA 2XGEA 5J1UA 3B7HA 4MIMA 2JJ7A 1QQAA 2B5AA 2K9QA 4DZPA 1D5YA 4IA8A 1U9OA 4I6UA 2KEKA 3OOUA 2PPXA 4M3FA 5EYRA 4JQDA 2PUFA 9ANTA 1K83J 2GM4A 2XSDC 3IH3A 1DU0A 2MSYA 2HYJA 4UUSA 2DA2A 1GDTA 2CSFA 3S1NJ 2L49A 2XCJA 4A93J 4A3JJ 5FKLA 2JN6A 3HBLA 2HXOA 5M3FJ 3SCGA 2TRTA 2KZ8A 4I76A 1EF4A 3ZKCA 1MBHA 1IDYA 4Z5DA 4X4GA 5C4XJ 4BBSJ 2VKVA 4Y7NJ 3R1FA 1BA5A 2JA5J 2XB0X 4A3FJ 3JXBC 2GRMA 3S15J 4CYCA 3QYXA 2DA4A 1ZZCA 1TWCJ 3I4MJ 2LYLA 1Y7YA 4EEFG 1Y9QA 1Z77A 3KXAA 5GPAA 2K9SA 2E2IJ 1P7JA 2RAEA 3Q0UA 1G2HA 2XPUA 3E7LA 1ITYA 1T33A 4JX4A 2DJNA 3CQZJ 3OSGA 3BTCA 3SJMA 5GPCA 1GV5A 2M0CA 3BR0A 3HEFA 2LR8A 3BG3A 3GTGJ 1BL0A 1NTCA 3HM5A 5IPAA 2JA8J 2KPJA 1XWRA 4JYKA 2R63A 2KEJA 3OQOA 1ZUGA 1B0NA 1LFBA 2ID3A 1GT0C 2DA6A 3BR1A 4AC0A 1MNMC 2R5YB 3JR9A 4C3IJ 2CUEA 2ICTA 1F43A 4X4FA 3OQMA 3GN5B 5E3NA 1H88C 2E19A 4XICA 5E3MA 3LSGA 2CQQA 1BJZA 5K7FA 1FIPA 1UG2A 1I3QJ 2HI3A 4V2GA 3BTJA 4G12A 3MN2A 1SANA 1R9TJ 2L9RA 2LD5A 2CRGA 3S16J 5IP9J 3JXCL 2NVTJ 1YRNB 1ETXA 1LCCA 3S2HJ 4QIWN 1VFCA 2IBDA 1MSFC 1OJLA 3BS3A 5GP9A 1DW9A 2LY9A 3B6CA 2M2EA 4QTRA 3DNVB 3JRGA 3WHCA 3BR3A 1FJLA 1MBEA 1ZVVA 3W6VA 3TEDA 3ZQHA 4MCXA 5BNGA 3CCYA 3O8GA 4RDUA 1YSEA 3GTKJ 1X2LA 1RESA 2E1OA 1OFCX 3SFIA 3NARA 2QF7A 1I50J 3QPLA 4JX6A 5M3MJ 2AW6A 4JX5A 4Y52J 1ZS4A 4X4IA 1BW5A 1FTZA 5F0HA 3F6WA 1PNRA 3OQNA 2GZUA 1IV6A 1ZTRA 4A3MJ 4QSHA 2DN0A 2XPWA 3HGYA 3HOVJ 4D5CA 2X48A 3GTPJ 3O8HA 5IOYA 4MFDA 4B1RA 5IYDJ 3F51A 3FYMA 2EZLA 5K7ZA 3G1OA 1WH5A 1GV2A 2AWIA 1XC5A 5FLVA 3S2DJ 4IHYA 1NK2P 4XRSA 4A3GJ 2EF8A 5JLXA 5EG0B 2HOTA 2LFBA 1SFOJ 3G7DA 2FX0A 1ZZBA 3LSJA 4I8TA 4B3AA 4I6TA 3H5TA 2L0KA 2N8GA 4A69C 2KT0A 3A01B 2PUEA 4C2MJ 5EEAA 3GTOJ 3MLFA 2M9HA 2K9NA 4FE4A 3TW7A 2O7OA 2HSGA 1ZQ3P 1OCTC 2R5YA 1HDDC 5IP7J 2OPTA 3SDGA 4IWRA 3ZQCA 5F1JA 1K61A 3RZDJ 1IRZA 1JFTA 3GN5A 3K7AJ 4PU4C 2XRLA 3ZQLA 4A3EJ 1LLIA 4FBIA 1X2MA 4J1WA 3SCFA 2IUOA 1X58A 1PRVA 1OSLA 5IP6A 5C3EJ 4GQMA 3L1PA 2MGQA 4YG1A 3RZOJ 2IVGA 1P7IA 1O4XA 4YG4A 3M4OJ 1YRNA 2JVLA 2E2HJ 2FJRA 2Y30A 4BY7J 4A3KJ 5EZHA 1PRUA 1RZSA 1WH7A 3JRAA 3QPSA 1T56A 4XRSG 3LSPA 2DTZA 2XPVA 4X1EA 3PO2J 3HOXJ 1ZZ6A 2DA1A 1IG7A 4DYQA 2GLOA 1DU6A 2B63J 3IVPA 4MLOA 2CUFA 2L7MP 2Y0SN 1PERL 3IH2A 2M34A 1WPKA 2JA6J 2PE5A 3ZQIA 1TWAJ 4I6ZA 1JT0A 5F27A 3M3YJ 2PUCA 4FISA 3RKQA 3BG5A 3BQZA 4IHWA 2NOGA 1W0UA 2VUMJ 2KEIA 3PXPA 1QP7A 5M5YJ 4XRMA 1LQCA 3DEWA 3FMYA 2EQRA 5F08A 2PUDA 1JWLA 1ZK8A 1VI0A 1TWHJ 2DA7A 1AU7A 4LOCA 1CQTA 3O9XA 1ZZ7A 1HDPA 2LLKA 1XG1A 3IH4A 3BG9A 1ETOA 2IAIA 1AHDP 1APLC 2L8NA 2O49A 1DWKA 1OCPA 1ZGWA 2EZHA 4NDWA 3HKZN 2O8KA 4YARA 4FCYA 1QP4A 2R93J 1VPWA 1GUUA 4X4BA 3Q0VA 2BNOA 1MBJA 4Z58A 2VKEA 2NVYJ 3LSRA 5EZGA 4X4EA 3TP3A 3VK0A 5EG0A 3S1QJ 3PO3J 3S1MJ 3TRBA 2CQXA 4IHVA 3HZIB 2D5VA 2WV1A 1BW6A 3CDLA 3NAUA 3JRIA 3A01A 4DW6A 1ETWA 2I10A 1ADRA 4A3CJ 2LCVA 2MW8A 1ETYA 5A7LA 5FLMJ 1RR7A 4X4CA 3LISA 4Z5HA 2OF7A 1HLVA 2PUBA 1ENHA 2KDZA 1RZRD 1ZKGA 4C3JJ 1LMB3 3G1MA 2HDDA 3JREA 1UXCA 1QVUA 4PU8A 3FKIJ 3MVPA 2MEZA 4A3DJ 4B4CA 3EUSA 5F0CA 1IGNA 3FIWA 1MBKA 4M6VA 4D7MA 1U8BA 4FE7A 3ZOBA 1E3OC 1JGGA 2Y9YA 2R92J 3MKLA 4V2FA 4X6AJ 2H1KA 1GVDA 2HXIA 2HOSA 2YU9J 3H3VK 4NDLA 1X57A 1BDHA 1WETA 2VI6A 2JWTA 4DYRA 2EZIA 2MG4A 3FISA 2NVQJ 1IJWC 1PUFA 3GTLJ 2LYRA 1A6IA 2ZB9A 3GBFA 4O8BA 1JTYA 1XS9A 4BY1J 2LKXA 1JKRC 2L7ZA 3CMYA 1JUPA 1ORKA 2PMZN 4J1XA 1L1MA 3B6AA 1LE8B 2AUWA 3FK6A 1MH4A 2VPRA 1QPIA 3JRDA 2IVBA 4X4HA 2K40A 2PIJA 1MBGA 3QWGA 4D5FA 4MFEA 1UHSA 3BDNA 3BR2A 4J19A 1QRYA 3JRFA 3UKGA 4FN3A 4A3BJ 1ZR2A 1HCRA 1JKOC 5K7HA 2Y9ZA 4M3BA 4A3LJ 1Y1WJ 3K2AA 2DMPA 2PUGA 3PM1A 4BBRJ 2NS8A 2EWTA 4UUTA 5C4JJ 3OMTA 2E2JJ 2ECBA 1MH3A 3UFDA 1WIZA 1RZRA 1SQ8A 1RKTA 1JFSA 2AHQA 2DMNA 2R5ZB 1JKPC 2GBYA 3D1NI 3HOYJ 2TCTA 1WH8A 2MQKA 4F8DA 5IOZA 2IEKA 2LYJA 2IV1A 2O38A 2O9LA 4DYCA 2XI8A 2Y31A 3S1RJ 5IYCJ 3FK7A 4M3DA 5F0FA 4PU3C 1ZZ8A 4AUXA 5M5XJ 5K98B 3OP9A 1ZAYA 3C2BA 4HNVA 3F52A 5FKNA 5IYBJ 4FTHA 3TP0A 1W0TA 2R1JL 2ECCA 2LYKA 2JK3A 1LCDA 2PUAA 1ZPQA 2L7FP 4Y42A 1JTXA 2ME0A 3Q3SA 4GFBA 2DMUA 2LVSA 1PUFB 4JCXA 2WAQN 3GTJJ 5M5WJ 4A3IJ 1RIOA 1ZZ9A 3LNQA 3BTLA 1Z0XA 1VF9A 3QQAA 2IVQA 4IVZA 3VPRA 2LYSA 1ETQA 4AYBN 1UXDA 3RQIA 2DMTA 1Q1VA 2WIUB 1R63A 5J1YA 3JRBA 3FYAA 3WHBA 3U3WA 2ME6A 1TC3C 4BXXJ 2CU7A 1B8IB 3BR5A 1IDZA 2YS9A 3CECA 3GTMJ 2OR1L 5EGOA 5JLWA 2X6OA 5EDNA 1LE8A 1I6HJ 1TWGJ 2FJ1A 1JUSA 2FQ4A 2CJJA 1H89C 4W1UA 1QQBA 3HGGA 4PU7A 4XK4A 2EBIA 2HOAA 2ELKA 3F0CA 2HINA 5FKOA 3HOWJ 1AKHB 1H8AC 1POGA
chains in the Genus database with same CATH superfamily
3IAM2 3VODA 2BY1A 1U78A 3JRHA 4E7ZA 2O4AA 1G3TA 2GRLA 2A05A 2NOJB 1GLNA 1F36A 2K3FA 3F9KA 3NWTA 3PIOF 1VQKI 5DD8A 4XKBA 2FD5A 3OYBA 2KIUA 1ZRCA 4BQOA 4DZJA 2HTJA 3T0YA 4CGZA 1WI3A 4W97A 4ZTFA 1V5EA 1VQ4I 1QHHD 1VQPI 3G4SI 2ZJPF 5CVIA 1ZRFA 5DM7F 2AQFA 5FLXK 4M72A 1ZH5A 4HX8A 2JA2A 2JMWA 3KYLA 2AXVA 4KFCA 2XIUA 4Z5CA 4B3XA 1B72A 3H0GJ 1L0OC 2VC1A 4JCYA 3CO7C 3I59B 2OZUA 2WBMA 3SZTA 4OAYA 2LTPA 3SEQA 4AM3A 3KJXA 1FY7A 3ZMUA 5HLHA 3MKWB 1WGXA 4BXUA 4U7DA 2XJ3A 1FBUA 3RZZA 2K9LA 1U5TB 1TWFJ 2XGCA 1FOWA 2VBXA 5EF6A 5BS6A 4EV0A 5CYVA 1EH7A 2R7RA 2NNYA 5E3LA 4ZTJA 3K1MA 3QP6A 3CUQB 3RPUD 3OIQA 2V1UA 1X2NA 2W00A 3RKWA 3HOZJ 2XDVA 4IRHA 3CESA 1JH9A 5LGNA 1U3EM 5ILSA 2PFBA 3I71A 2ZMEB 3ZXSA 5HVQC 1HF0A 2OFYA 3G3ZA 4ZZLA 3P9KA 3ZCOA 2LREA 2EZKA 5ERIA 1UTXA 1LNWA 5GAGJ 3WGGA 5C44J 2EB7A 1QP0A 1KU7A 3QYBA 3HUGB 4RB2C 2HVRA 2GQQA 3C1DA 3M1EA 1WCMJ 3SEZA 2E1MB 1NERA 2XXAA 1YFHA 3PUFA 5D8KB 1SFXA 2HPMA 4MCTA 4J00A 4S0HB 2CQKA 5HDGA 5GAHi 1BOAA 3LAPA 4JQFA 4RAZA 2PJRA 2X0LA 3NZLA 4L5EA 2ID6A 3J80K 4ZDLA 1V54H 4E6KG 1R71A 2Q0OA 1R69A 1A35A 1MFQC 3OYMA 2EV6A 2XGEA 4RMNA 4MTDA 1R5GA 2B5AA 3H0DA 1ZG1A 1U9OA 3GLXA 2BOLA 2KEKA 2FE3A 5EYRA 1ULYA 9ANTA 2XASA 2GM4A 3C2HA 3A0BC 1TNTA 2MBFA 2UXXA 5BMZA 4DE8A 5HDNA 5ICGA 3S1NJ 2YX7A 1DQUA 2Z2SB 2MLKA 4RS8A 5FKLA 1YS7A 1X3UA 1M1EB 1JI8A 2PEXA 3T8TA 1XSDA 2Y75A 4FT8A 2NAZA 1K79A 5F1RA 1UJ8A 5HS9A 2GRMA 2DBBA 3GUUA 4CYCA 1RRJA 1RUNA 4C2UA 3BJOA 5D6FA 2DA4A 2Z5UA 3QYXA 2CW0F 1TWCJ 3L2WA 1YW8A 1X1CA 4EEFG 3VWSA 3KXAA 4IRGA 3KETA 4ZDPA 2HQAA 3Q0UA 1TW3A 4BHBA 5FLXZ 1G2HA 5BOXA 1EH6A 2VONA 3E7LA 3F6VA 2ZC2A 3IC7A 1ITYA 3F8CA 1T33A 4UVCA 4JX4A 3CQZJ 3ASOH 3SJMA 4R8HA 5GPCA 1E3PA 3B02A 1FBQA 3FXJA 2VT3A 1MNEA 1IZ1A 3KX2A 3GTGJ 2H6CA 4F93B 1U8RA 4AVZA 2KPJA 1G3YA 3DBRB 3DF8A 2PXPA 2EV5A 2LDUA 2NXNB 4MGRA 1ZUGA 3PSIA 4ZZDA 2ZXIA 2ID3A 2HEOA 1STZA 4FX4A 4AC0A 2HDCA 1DPRA 3SXYA 4CO8A 3PE5A 4H4KC 2BBYA 4YIIA 2CFXA 2M7BA 2DK5A 5E3NA 4DGWB 2E19A 1UZCA 5LRSA 1H88C 6PAXA 3LSGA 2VEOA 1X3WB 4V2GA 2L1PA 5JUWA 2LD5A 3JXCL 2X85A 4HZFA 2XAGA 3N97A 1OJLA 1DW9A 2LY9A 3B6CA 3CDHA 1UG0A 2IA0A 3DTIA 1DGRM 3JRGA 1R4NB 2ZFWA 1F5TA 3FXOA 5LLQA 3GYHX 5BNGA 2J7WA 4RDUA 3CCVI 3GTKJ 2VQCA 2HZDA 1X2LA 2D1HA 1K6YA 2OCCH 2XF5A 4M6YA 4A0ZA 1DP3A 2QF7A 3QPLA 2DPUA 4JX6A 3J81K 4JX5A 2B9SA 1G59A 4PGGA 3J80Z 4WWCA 4E4HA 3CMAI 3LL7A 3RKXA 3ABUA 1XX5A 3F6WA 4U7BA 3OQNA 1EH8A 3BP8A 4NC8A 2GZUA 2LF8A 4IVNA 2Z33A 3HSFA 1YOVB 2KRCA 4A3MJ 2XPWA 4UY8I 3DPUA 3HOVJ 4G7ZF 2OBPA 5BPDA 2X48A 3GTPJ 5IOYA 3S3NA 3F51A 2EIMH 2W85A 2A68F 3VOEA 1XC5A 3A1YA 5FLVA 3LQXA 3QP5A 2BVLA 1X3ZB 4L5JA 4L9NA 1IN8A 3C2GA 2J5PA 4XQFA 3WGHA 2WWYA 1QZZA 2HFHA 2I8DA 3I58A 3KPHA 3CF2A 4HSTA 2MABA 3DU5A 3NXHA 2PUEA 5AONA 3IL2A 1XGOA 4OIQF 5DRTA 5DRYA 1XGMA 2PMZA 3ECHA 1E2XA 1K78A 3MLFA 2BY3A 1ZQ3P 2EFPA 3T5XA 4UHTA 1HDDC 1WHUA 2EA4A 2KPMA 2OPTA 3GFJA 1K61A 3RZDJ 4LGWA 3GN5A 3EUHA 3SX0A 2GIZA 1IN5A 2J7UA 4PU4C 3DPTA 3CLOA 2YBDA 1LLIA 4FQGA 4ER5A 1X58A 3RI4A 1S72I 5C3EJ 2JSPA 1ACIA 2MGQA 4YG1A 3IWFA 1P7IA 2M8EA 3M4OJ 1YRNA 2HFZA 1IN7A 2TDXA 3HXLA 3RCOA 4MHGA 5FFXA 1VQ5I 2ISYA 2K7LA 3AL0B 2IA1A 4X1EA 5HLTA 2IS2A 5J40A 3GZDA 2KFDA 2RQQA 3IVPA 1EKEA 4ZYGA 2JA6J 1TP4A 3ZQIA 1TWAJ 3E5QA 4N4OB 3OV8A 3LSMA 2NS0A 2DO7A 4Y13A 3HL2A 1J7KA 3RKQA 3BG5A 2KEIA 4IHWA 2NOGA 3HJEA 3CMMA 1BI2A 2VUMJ 3PXPA 1QP7A 4XRMA 3KCCA 4XBFA 3VSLA 1AU7A 2L9SA 3OOPA 4XLEA 1HDPA 2IA2A 2W7NA 1ETOA 3E5XA 4RGUA 1FT9A 2OU2A 1DWKA 1OCPA 4TV7A 4CZCA 2PXFA 1LKXA 4CH7A 2WA0A 4FCYA 1SD6A 1KYZA 2DU9A 1J9IA 2QQAA 3FX3A 2JZYA 3Q0VA 5H6RA 1HA8A 2EJRA 2VKEA 3OYKA 1U0JA 1XGNA 2Z99A 4AYBA 1G3SA 2X6YA 2YX4A 3FXQA 3ML6A 4U0VA 3S1MJ 3DKYA 2HPIA 4IHVA 4RLQA 3V8LA 3RIRA 3TEPA 3AFHA 2YSRA 2IVMA 1D0XA 4EGZA 3GFLA 3J81Z 5KNLA 2MW8A 1MMDA 1OYIA 1RR7A 4Z5HA 1MMNA 2VL8A 1HLVA 4HYEA 2PUBA 4YRVA 5GTHC 3KZZA 3FKJA 2DT7B 5DTQA 1OKRA 4ZJZA 2O5RA 4C3JJ 4II2A 2ACJA 1WWXA 4AWXB 1QVUA 2DFIA 4A3DJ 4D9JA 5F0CA 1JGGA 5CPRB 2IGNA 2BYVE 1X57A 2HOSA 1UCRA 3H3VK 4EQQA 2LSOA 3HRSA 3NQOA 3ISPA 3GO5A 5DCMB 2OTLI 2MG4A 3GTLJ 2LYRA 1MKMA 3TOAA 5LGUA 3P9CA 3GBFA 4DBRA 2A69F 2OD5A 4BY1J 2OJED 1S7OA 2LKXA 4CHUA 1JKRC 2DODA 2ISZA 4BH9A 1ORKA 2PMZN 4IQ4A 3F8FA 3GW2A 4KMUX 1MH4A 2VPRA 1QPIA 2K40A 4IL6C 4RB3C 4JBAA 2CQ7A 2LNBA 3W2WA 4D5FA 5LEJA 3F23A 4EKGA 1D1CA 2VJJA 2L4MA 1V3FA 3JRFA 5FFZA 5HS8A 3H5RA 1JKOC 2CWEA 4M3BA 2Y9ZA 2WB1A 2ZBKA 4IJAA 1OCZH 2PUGA 3SHFA 1LFPA 2NS8A 1OYYA 2VC0A 5C4JJ 3OYFA 1EJ9A 1TZLA 3HHHA 3UFDA 1MH3A 3K4CA 2RNJA 3VSKA 3KE2A 3DLLF 1SFEA 2R7SA 2R3SA 1JFSA 1SEUA 1RNLA 2AHQA 2DMNA 1WH8A 2TCTA 2R7QA 4F8DA 3QOPA 1WZ2A 2O9LA 2Q1ZB 3I56I 4EQZA 3KIOA 4LK1F 1YI2I 2X51A 3FK7A 4M3DA 1BI0A 4HLXA 4AUXA 2P0WA 5M5XJ 3F52A 2BW3A 5FKNA 3K2ZA 1E0EA 2QENA 2LYKA 1G6NA 3S3OA 1ZPQA 1MMGA 2E5NA 3V8JA 3OYGA 4NHJA 3Q3SA 4PSXA 1P2FA 4GFBA 2K3PA 3VB2A 2QSFX 2DMUA 2LVSA 1PUFB 1A31A 2LY2A 2PXTA 2WAQN 2X1CA 2M87A 1BI3A 4LG3A 1ZZ9A 1PDNC 1Z0XA 2E71A 3R61A 3F6OA 4GO1A 4CCLA 3ZGKA 4Y15A 3PQKA 2DFFA 3ZN0A 3GFIA 4AYBN 2PBIA 1PP8F 2DMTA 3BCAA 2WIUB 4G8XA 4KN4X 2JQ7A 3FYAA 3BC8A 5J1YA 1Y0NA 4HV5A 3WHBA 2IT0A 3HZJA 3U3WA 3R4KA 3W6JB 1TC3C 2EV0A 5F6FA 3ZMVA 1IDZA 3CECA 3GTMJ 5JLWA 1G3WA 2AS5F 4HX7A 5EDNA 1LE8A 1I5ZA 4UB8C 1TWGJ 2D1VA 2FQ4A 2CO5A 3B73A 4PFOA 1ZG3A 4U0YA 3EETA 2HOAA 2R7XA 2FFHA 1V5FA 3F8BA 5DSXA 1YW7A 1AWCA 1TLHB 2QYOA 3CCMI 3W3CA 3OIOA 1BDIA 2F4IA 1IAWA 1ETVA 2HVSA 4LK0F 3S17J 4ZH4F 4I98B 4Z59A 4L0YB 2AXUA 4L9VA 2EH3A 1JUMA 2COBA 1CF7A 3U1DA 4DOZA 1FTTA 4ABZA 3E0JB 3ZMTA 1R1UA 5L3GA 5JVTA 4ER6A 2KISA 4EJTA 2Y0SA 2KHMA 4IF4A 4LG0B 1XB4A 1VQ6I 4YG7B 4WCGA 3K69A 2R5ZA 2R7UA 1WH6A 1KGSA 4I6RA 2ICPA 3BPXA 2HGCA 1IO2A 2DJIA 3BCBA 1Y1VJ 1NEQA 2L01A 2IW5A 3C3WA 2FA5A 3QOXA 3M8FA 4LB6B 3RYPA 2MA3A 4PJMA 4CICA 3E5UA 2H1LA 2WB1N 4C9YA 2Y2ZA 4F91B 3W2VA 3OYHA 3U2RA 2VBZA 1Y39A 5E3OA 1UB9A 2L4AA 2PQ8A 3RSNA 5EGOB 1GXPA 5JR3A 1LVAA 4CYCB 1YTYA 3U1KA 4HNTA 2IU7A 4OB4A 3A03A 3WTTC 2DA5A 4HRAA 4IZZA 2XKPA 1TT5B 1F9NA 1B8IA 3GTQJ 2P5VA 2MD5A 1JT6A 1K7AA 2ELJA 2H8RA 5J1RA 2QBYA 1U9NA 2V7FA 4M9SA 5FKKA 3S14J 4GHJA 2MC3A 1LFUP 2M8GX 3BR6A 3OR2C 2JA7J 1D5VA 5E20A 4R1HA 3TFLA 2XF7A 4ER7A 3JRCA 2KRFA 4RGSA 3VYSB 5FJ8J 4RBOA 3OYCA 1IUFA 3DEEA 1JJ6C 2E36A 2KIFA 1IXRC 2F4MB 2IGOA 2DDAA 4IEJA 1EV7A 2HVQA 3QF3A 2BY2A 2A61A 4DE9A 2W48A 4EKIA 2H8WA 2XB5A 4HW0A 4ENNA 3CROL 1YG2A 1Z21A 1UMQA 2K85A 1E17A 5ICCA 4AIDA 1IC8A 3FHNA 4IOCF 2PJPA 5J6XA 2O0YA 2BGCA 3C7JA 4DZPA 2Y69H 1SFUA 1LPQA 5ILUA 4CCOA 4RB1A 5EEHA 2V79A 3WTYC 2XSDC 3DTKA 4GDFA 3BPVA 1YLFA 2DA2A 1LDKB 3KP2A 1GDTA 5DT2A 4MTEA 2XROA 1H0MA 2CSFA 2PXEA 4PJLA 4HSRA 2CH0A 3GF2A 3EUAA 2EWNA 3R6SA 2P6TA 1YJNI 2RN7A 3F8NA 3HPGA 2W25A 3HBLA 5M3FJ 2M4HA 2XAJA 2TRTA 1PYVA 1EF4A 1C0WA 4Z5DA 2DPDA 4BJ5C 2CQNA 4BBSJ 4Y7NJ 1KQ8A 4EM1A 2XB0X 2PXDA 2P8TA 3A9YA 3BROA 4OMYA 2CV2A 2Q2EA 2LOOA 1UHWA 4CCNA 2LYLA 3KZYA 1U6GA 5CKTA 2LMDA 2BE5F 2EIKH 2H27A 2PXUA 2X6WA 1SMTA 2RAEA 3DFGA 3S32A 3K10A 3OSGA 2DQRA 3VYRB 4I0AA 2QEXI 2E7XA 2M0CA 1XD7A 2X4HA 1W5CC 2LR8A 5E1XA 2MFZA 3M9AA 2PLYA 3EYYA 3CCEI 2X1DA 2E34A 3D0SA 1OR7C 3DWLE 3CP2A 4LJZF 2JUCA 4XM3A 4UXNA 2KEJA 3A0HC 2G7UA 5LGTA 1X4OA 1K78B 1LFBA 1GT0C 3CJQB 4QPOA 1MNMC 4C3IJ 3PNYA 1ZN2A 2VBYA 1ZHFA 2XAUA 2DT5A 4OIRF 2ADUA 1I27A 3OQMA 5J4YA 3CTAA 3VDXA 3AAFA 3GN5B 2BHZA 4YFXF 1FIPA 1UG2A 1WJBA 2F2EA 4HOBA 1Z67A 3BTJA 4G12A 4Y17A 1SANA 1R9TJ 3QOWA 1Z05A 2PX9A 3NROA 2G7HA 1AA7A 3KYCB 3HKZA 1YRNB 4QIWN 1LCCA 2LKSA 4G7HF 4OIPF 2C6YA 4ZYDA 3J7YJ 2PN6A 4QTRA 1X1DA 1X4PA 1ZVVA 2HTSA 3ABLH 4HAMA 1VQMI 1KU3A 3O8GA 5FRMA 2M5WA 2R7WA 4I7HA 1XGSA 1D0YA 3SFIA 3NARA 3MZ8A 3TO9A 5FO5A 4PSWA 5M3MJ 1FNNA 3TQNA 3ZMSA 4AU7A 1ZARA 4HNUA 3HTSB 5F0HA 1T8IA 3K4NA 5BQTA 1WJDA 2DN0A 1P4WA 3ABKH 2CYYA 3M8EA 1PJRA 3W2AA 3HGYA 3E6MA 3BJAA 2VJ4A 3O8HA 4PFPA 4MFDA 4B1RA 2HQNA 5IYDJ 1SAXA 3K4JA 4EGYA 3ERMA 4BQQA 4GXOA 2A6TA 4NNJA 1X1AA 4ESFA 2HDWA 2HZTA 1RZ4A 3S2DJ 1VTNC 3WU1B 1I39A 4XRSA 4A3GJ 3CD6I 2QQBA 5JLXA 3JAMK 2HOTA 1SFOJ 2FF4A 4CCJA 3G7DA 3I9V2 4YEJA 1P92A 4Q48A 2IPQX 3ESWB 4ITVA 3DQVC 3TW7A 3OYIA 3BJ6A 4M71A 3MKZA 1IF1A 5IP7J 2AXLA 4HQMA 5ICEA 1S6LA 1X2MA 4QPQA 5JFRA 1OISA 4J1WA 3QOEA 5CQEA 3SCFA 3RPUA 1P6RA 4FETA 1SD7A 1O4XA 4YG4A 2YPRA 2E2HJ 2WY7Q 2O3FA 4Q47A 3T1BA 3ZP5A 2E1CA 2JRMA 3ROUA 1T56A 3H36A 2FBKA 2DTZA 2XPVA 2OQRA 1IG7A 1KA8A 5J8CA 2FNAA 4DYQA 2GLOA 3K0LA 4M9ZA 2CUFA 4MLOA 5LHHA 3GX4X 2RQPA 1W7PD 3P7NA 2LC2A 2PXBA 2MH9A 1AKHB 2IS1A 1KYWA 4EJUA 3KP3A 4HBLA 3OS2A 4FISA 2VT2A 3BQZA 3JTGA 1UFMA 3FMYA 2O8XA 3DEWA 2EQRA 2XXQA 1JWLA 1ZK8A 4OWRB 1VI0A 1TWHJ 4F7ZA 2RVCA 3CDIA 3O9XA 1ZZ7A 3IHUA 1JHHA 2LLKA 1YITI 2O49A 4XORA 3HPHA 3RKYA 2BZTA 4M6XA 1ZGWA 4F55A 4NDWA 3HKZN 4M73A 1YJWI 2HYFA 1IN4A 3TGNA 4GYGA 5E1ZB 1QP4A 4DQ2A 4X4BA 3S93A 1WKMA 3DXJF 4U0WA 1F4KA 1B9NA 3ELKA 4BEHA 2NVYJ 2UXNA 4UV8A 3LSRA 2VJIA 2W57A 3QODA 3PO3J 2CQXA 4I01A 2D5VA 1BW6A 3NAUA 3TDZC 4BGDA 3JRIA 1FX7A 1LUJB 1ETWA 2FU4A 2I10A 3A2KA 4EVIA 1ADRA 2LCVA 1KZHA 4X4CA 3J7AO 1K4TA 2D2WA 5B5EC 2BW3B 3K4MA 2HCNA 2LLVA 4X0GA 1GHCA 4II3A 4IOAF 3DBHB 3G1MA 4L9JA 4Z6YA 4ENKA 3KYDB 1UXCA 1W7PA 1R1VA 4ASNA 5CVRA 3EUSA 4HRIA 1HBXG 2HOEA 3FIWA 2IJLA 1MBKA 4D7MA 1B4AA 4JK1X 3ZOBA 1U8BA 1E3OC 1R58A 4V2FA 2YU9J 1GVDA 2HXIA 3CCLI 4UNOA 1XMKA 3UWPA 1BC7C 3OS0A 1WETA 2W4SA 3U9GA 1ODDA 3KLNA 3EYIA 3FISA 3JAMZ 5JI6A 2NVQJ 1LEBA 5E8IA 1FBSA 1ZELA 4BUPA 1FYKA 2VODA 3R09A 1S7AA 1RUOA 2EK5A 4ER0A 2L7ZA 4FHTA 2VXDA 3ZQQA 1LE8B 2IGMA 3HC7A 5D4RA 3JRDA 2O6GE 3AG1H 5B1AH 4N0BA 2B7EA 3QWGA 4NQWA 3QRFF 2ESNA 4MFEA 2STTA 4J19A 4O6JA 3K1PA 4FN3A 3UKGA 2OQGA 4A3BJ 5K7HA 4AIJA 1Y1WJ 3K2AA 4GYIA 3FBNB 1V55H 1J09A 2M1BA 2KP6A 3H9GA 4EJVA 2ZSHB 1I6XA 4L5IA 4B44A 1NG6A 2F5VA 3FXUA 2KMUA 2CGPA 1MW7A 1PUEE 5CVJA 4OBMA 3P9IA 1X1BA 4HPQA 1W36C 1VQ7I 2ELHA 1IV8A 1SQ8A 3ZR8X 4IHTA 4LITA 1AOYA 2R5ZB 1JKPC 2GBYA 3HOYJ 2MQKA 1X1PA 3L7WA 4E7IA 2M30A 2F5CA 1G8XA 4O5VA 2IV1A 1VQ8I 4PZJA 5L3EA 3CLQA 1R5HA 2Y31A 3I55I 3S1RJ 5IYCJ 1SMYF 2PI0A 3CCJI 2VBWA 4KA4A 5D5UB 2V6EA 1FYMA 5K98B 1TW2A 3I64A 3OP9A 1FC3A 4FTHA 3OYAA 3E3VA 2P6SA 3WTVC 2GXGA 3SR4A 1T2KA 3H3UA 1Z7LA 4Q2JA 2L7FP 1MMSA 3R0AA 4BXFA 1V4RA 3LQRA 2NNNA 3MZYA 2WY8Q 2ZJRF 2IRFG 2STWA 1TNSA 2F5DA 2CMPA 3WGIA 1RIOA 4LLNA 1ZLKA 3BTLA 2LRDA 3L09A 4P55A 4O3MA 1GXQA 3I59A 1R6RA 3G2BA 2KL4A 2BV6A 2LLWA 1I1SA 5A2QK 3RQIA 4E7SA 4PJNA 2XF6A 2QA4I 4P9UA 1USSA 3V7RA 5D4SA 4BXXJ 1B8IB 2BVMA 3HSEA 3BR5A 3OYDA 1OR7A 3PSFA 2OR1L 3R60A 2X6OA 2QBYB 1SAUA 1T98A 3FWEA 5E8GA 5GTIC 1I6HJ 5LBQA 2FJ1A 1JUSA 2L02A 4LFUA 2A6HF 3ZMZA 3DKXA 4PGHA 3OKZA 3MZHA 3LA7A 3H5AA 1JGSA 1POGA 3ZHMA 1R4MB 4M3EA 1MBFA 3O2PE 4NC7A 4BKXA 1ZREA 2WUSR 1PRAA 2K4BA 2LK2A 2X9DA 2LKPA 3HUGA 5J3LA 3F22A 4XOPA 1A5JA 1WJAA 1R22A 2A5WA 4XIDA 5FB2A 3AG2H 2A07F 3F8MA 3I4PA 2R7ZJ 1ZYRF 3H1CA 5DS9A 2XVCA 3HDDA 5DM6F 3FHZA 2PMHA 1HW5A 1JKQC 3CC2I 4BU2A 1DPUA 1X19A 3KEYA 2DYSH 3ZQFA 2LYQA 1S7EA 2RDPA 1CGPA 1JJ8C 4B47A 3M8JA 4XKCA 3LOCA 5KAIC 2E5ZA 4WXDA 4E7HA 3WTWC 4BQNA 2ZJ2A 2Q8KA 1HOMA 1LVKA 2QQ8A 1QO0D 1O3RA 1RETA 3PUBA 2HU9A 2B0LA 1YE9A 3DM5A 3OS1A 1NK3P 3SCHA 1YJ9I 2XGDA 4R79A 3S8QA 2QCOA 3I4NJ 4GRIA 5K1YA 5DTDA 1OLTA 2VOOA 2QZ8A 4XONA 4CSWA 3TO7A 1OMIA 5AIQA 2LP0A 4MO7A 4Z2YA 2WAEA 1R36A 3RQ4A 5FKMA 1P4AA 2XGXA 2DXIA 3VFZA 4HV6A 3TELA 3LQQA 2FXAA 4IKFA 3TW6A 3IV5A 1IXSB 1POUA 2KDOA 2BJCA 1R5ID 5HODA 3BDDA 2VPLA 5DTRA 5J47A 4YG2F 1QVTA 2BXYA 1FIAA 2K86A 3A9ZA 4BDYA 3HYIA 2IXSA 5JHUA 4Y4RA 2A5YB 3BLYA 5J4VA 3GCMA 1WFXA 2GAUA 2K27A 2W82A 3F21A 4YBAA 5K5QA 1ON1A 3ME5A 3ZMDA 1ON2A 1B59A 1OQYA 1FP2A 4KYWA 2QWWA 5B3SH 2CV1A 3GBGA 5A2QZ 3L2QA 2R0QC 1BR1A 1MSEC 5KK1A 3HB9A 1EA3A 1RKWA 1MIJA 2OCEA 3OMYA 1B72B 2BNNA 3WODF 2AXZA 3B7HA 4MIMA 2JJ7A 1QQAA 2K9QA 4BE0A 1Z6RA 2HKXA 4EJOA 4M3FA 4JQDA 2PUFA 4G9YA 4KITB 2HQRA 1XSXA 3IH3A 5BPIA 2MSYA 4UUSA 4RM3A 5DTMA 4G6TB 1TT0A 4LMYA 3PNVA 3M9LA 2XKOA 3VWBA 2H6BA 2HXOA 2DOAA 5LFAA 3E6CC 4I76A 5AIPA 3UR3C 3ZKCA 2X1EA 4ON0A 1IDYA 3MD2A 4X4GA 3EQLF 4PJJA 2V9KA 2VKVA 1BA5A 2JA5J 4A3FJ 3JXBC 1HSJA 1BI1A 1B9MA 1LDJA 3JSOA 1MJ9A 3I4MJ 1Y7YA 3OL3A 5CJ9A 4EJWA 1TQPA 3PJRA 1SVOA 1HC8A 2JPCA 2VKHA 1FSHA 3BTCA 1OCRH 3J7ZI 2KQRA 2ZKZA 2XAFA 4RM2A 5B66C 2PJRB 3MMYB 5IT3A 4V19K 4XLAA 4RLFA 5J8FA 1MD0A 1W36D 3HM5A 3UNGC 3TBIA 5IPAA 2FEZA 5H2FC 3ERED 2JA8J 2V9PA 1ZGAA 2FMYA 2R63A 2DAOA 1B0NA 4K2EA 1D1AA 3I5UA 4L9TA 4DNCA 1ZLJA 1QNTA 3QYEA 1T39A 3JR9A 4ZYEA 2LF7A 2JUGA 3MQ0A 5K5RA 2UZKA 3L00A 1DDNA 4X4FA 4ZYAA 3HIFA 2EFWA 1FOKA 2PG4A 2DDBA 1BJZA 3M07A 1B6AA 4FX0A 3HRUA 4LLGF 2HI3A 3QPHA 5E1WA 3MN2A 1MDMA 2L9RA 4C30A 3MCZA 2CRGA 4XLNF 2NVTJ 1ETXA 2IBDA 5GP9A 1IRXA 2Y48A 4BL0B 2HWVA 2LG4A 4XKVA 1Z3XA 4EMSA 3DNVB 3Q9SA 3L2CA 1FJLA 3KEOA 2W84A 3LSKA 2KJBA 4BAYA 1ONVA 1YYVA 3NEUA 3TEDA 3HOTA 1J75A 1DP7P 4MCXA 2GXBA 5GAEJ 3BOQA 5E18F 2CV0A 4PDKA 1YSEA 4IHSA 4LIUA 2E1OA 1OFCX 1S29A 4BNCA 1I50J 3F72A 2J5OA 1Y8RB 4Y52J 3OWTA 1FTZA 4EM2A 3HOSA 4CUGA 4XOTA 1IV6A 2XXPA 1FOYA 1DULA 4QSHA 4HLYA 4IRIA 4WXCA 4UVAA 2EFQA 2KKOA 2WAFA 1QB2A 4DBQA 3WTZA 2JQEA 2M0MA 4BE1A 1MJBA 3FYMA 5K7ZA 3CJNA 1UAAA 3G1OA 4ETSA 2FSWA 1P4XA 1GV2A 1U2WA 2EIJH 2O03A 4KIFA 4BEHB 3OYLA 1NK2P 3V7SA 2EF8A 2LFBA 2QKLB 3FDYA 1ZZBA 1KQ9A 3LSJA 5D8LB 4I8TA 4EZIA 2L0KA 1TTYA 2N8GA 5DUIA 2MLGA 4C2MJ 3GTOJ 4ESJA 2M9HA 4A0YA 2K9NA 2AXTC 2O7OA 2HSGA 1FLIA 1OCTC 2R5YA 2E35A 3WU2C 3BWGA 3SDGA 4IWRA 4CCKA 3G73A 5CVVA 5D6EA 1Z91A 1JFTA 4KJZA 1NH3A 5HLIA 1H9TA 3JCUC 1N25A 2XRLA 3PQJA 4A3EJ 3WE3A 4FBIA 1DUXC 4HA8A 4HF2A 1J0RA 1FWZA 3COAC 3L1PA 4KDPA 2CW7A 4AD9A 2IVGA 3F3XA 3O6BB 2BEOA 4CYDA 2CFOA 1TQMA 2Y30A 2FNPA 4BY7J 2XV4S 3PFYA 1WH7A 2OA4A 3CZ6A 3QPSA 4EATA 5TRDA 1K6OA 4XRSG 3LSPA 2IGKA 2FBIA 3HOXJ 2DA1A 4A2UA 3QAHA 2L9VA 5K5OA 4MQVA 2B63J 2OUMA 3KFWX 2Y0SN 4Q4ZF 3N05A 4WK8F 4P9FA 1S8NA 1WPKA 2HNHA 2RC4A 2EPFA 1BR4A 2DFHA 2PE5A 4QLCU 1JT0A 2H09A 5F27A 3EPZA 4A6DA 4A6EA 5LD2C 1W0UA 3PL8A 3BG7A 2M4KA 2QUFA 2JRTA 5F08A 3LAJA 4NQWB 1IXCA 2DA7A 3V8KA 4JOMA 3QWLA 1BBYA 1AHDP 1APLC 1QZXA 2OTJI 3GMEA 1S5LC 3P5JA 1U5TC 3GZ6A 2KIMA 3GLLA 3SZPA 2EILH 4YARA 1T0FC 4BQAA 1WSUA 2DOFA 2DQLA 5D5VB 2MXDA 1S9HA 5HDKA 1MBJA 1F1ZA 3CUQC 5EZGA 3DV8A 3TP3A 3VK0A 1VZ0A 4KIGA 3TL4X 5EG0A 3S1QJ 4F3QA 1HKTA 3TRBA 1BN5A 2ZMEC 3S3MA 4M9XA 3DEUA 3A01A 4XNFA 4Y33A 4A3CJ 2GOXB 5L3FA 1ETYA 1T95A 2HS5A 2HCSA 2WV0A 2O61A 4HF0A 2OF7A 3GEZA 2L7KA 2E1MC 2FBHA 4LB5A 3V4GA 2R7TA 3G71I 3REOA 4XLPF 2MEZA 3MVPA 4L0ZB 3FXMA 1OPCA 1FMWA 1IGNA 4XRFA 4NC6A 2Y9YA 2R92J 4X6AJ 3S8PA 1BDHA 4RAYA 4NDLA 2VI6A 3IKVA 2JWTA 1NW3A 4DYRA 2OC6A 2VB6A 1IJWC 1PUFA 1N77A 3HRTA 1R49A 4O8BA 2YR2A 1XS9A 2QQ9A 2MD0A 1D1BA 1YHQI 5KAFC 2GZWA 1Y8QB 5H20A 4ER3A 4PUSA 1L1MA 3B6AA 2FUG2 4GGGA 3GZCA 2AUWA 3FK6A 3L2UA 4ENMA 1BC8C 2EFNA 3GXOA 1U2ZA 1LQ1A 3PFIA 1S3JA 1MBGA 5FGMA 2PIJA 1XMAA 2DOEA 3MFKA 4PJ0C 1QA6A 1UHSA 2JTVA 3CMEI 3BR2A 3GVAA 3I0TA 3WTXC 1HW2A 1QRYA 3GWZA 4E7KA 1XMXA 1Q1HA 1NHAA 4XSZF 1HCRA 1N78A 4GCVA 1R7JA 1QHGA 4EK9A 2UV1A 2EFOA 4CDGA 1WQ2A 2ZXWH 4BJ6C 4UUTA 3MEJA 3OMTA 2XSJC 2DTRA 2UUZA 1WIZA 4XSXF 2R7DA 3A4CA 4OU0A 5TJJA 2GA2A 4WF2A 2DYRH 3D1NI 2JVHA 3FM5A 4CXFA 3CJTB 4DYCA 3LWFA 2W24A 3LSTA 1D8KA 4PU3C 1ZZ8A 4AIKA 3HG9A 2HYGD 2OZ6A 3C2BA 5IYBJ 2R1JL 4LG0A 3TP0A 4RGXA 1SVMA 1QU3A 2JK3A 2V6CA 1HQ1A 1LCDA 2PUAA 2MC4A 4MNUA 1JTXA 2ME0A 4IXAA 4Y42A 2PXQA 2LNMA 2AQEA 2K02A 3ASNH 3BG6A 4JCXA 4A3IJ 1O3QA 3LNQA 3VYUB 3ABMH 2E1NA 2IVQA 4IVZA 3VPRA 2LYSA 2V9VA 1A36A 3MKYB 1RC9A 1ETQA 1UXDA 3LSIA 2DI3A 3WTSC 3RPQA 1R63A 3JRBA 4LD5A 3H3ZA 1Z3YA 3WU0A 2P5LC 2RV8A 1HKQA 2ME6A 3KP4A 1GVJA 2CU7A 1FSEA 2DK8A 3EDPA 3GZNB 4DIQA 2YS9A 1WJFA 4J01A 4HG2A 5EGOA 1LJ9A 1W4MA 3JW4A 4XN0A 3ZPLA 3GFMA 2CJJA 2P7CB 1QQBA 3HGGA 4HDUA 3Q5FA 4XK4A 2ELKA 3F0CA 3CO6C 5FKOA 3HTUA 4I99C 2XHKA 1H8AC 1EFAA 2ESHA 3DTEA 2BNMA 1HQCA 3K1NA 2QSGX 2QVOA 1BIBA 3KZ3A 1I1GA 3S2WA 3DCFA 2DCEA 2ZO4A 3Q0WA 1YS6A 1VQLI 3BT9A 3PNTA 2Z1DA 2RKHA 4JP0A 3G1LA 5H6QA 1SD5A 3IUOA 1SD4A 2D45A 2P81A 2UWMA 1VNDA 1RIOH 1Z6TA 3CF5F 2VXZA 1IRFA 3NDBB 1OYWA 4QWQA 2EA2A 4BACA 1H9GA 3BD1A 3ONQA 4I02A 2PXVA 3BQYA 2M4GA 2XIGA 3I54A 2R7OA 4D7NA 2JCGA 3RDIA 3ZHIA 4IHXA 5ILVA 2G0EA 4RAFA 3FMRA 4UUSB 3M7GA 3G0TA 3CCRI 1JXSA 4RAGA 4UVBA 5LEKA 3IWZA 1QZYA 3H5NA 3R0JA 1FP1D 4KICA 4HQEA 2LYPA 4ENJA 1LEAA 1T08B 1BJAA 2CROA 1YW9A 2DMQA 4G94A 1RPWA 3QFIA 4M3GA 5B1BH 5KVRA 1HKSA 4ZYHA 2K5CA 4IX7A 2I5UA 2LBFA 3CP8A 1ZG5A 2A6CA 3QQ6A 3L9FA 1ZR4A 1XTAA 1JHFA 1ZRDA 2NVXJ 3QYFA 1UELB 3ZQGA 4B48A 2QSHX 3TDUC 2K9MA 4X4DA 4U87A 3IKTA 1ETKA 3IRQA 3OSFA 1WJ5A 5LHIA 2WC2A 2ZNYA 3TMOA 5D5WB 2VLAA 3QU6A 3FMQA 2BY0A 2R4GA 2VQLA 3AL0C 2ZXHA 4WVLA 3A02A 1A6QA 1FEXA 1REPC 5GAHJ 3E1SA 1CF7B 1HSTA 3LFPA 2V3CC 2QLZA 5DV5A 2YUSA 2P4WA 1AKHA 3SZGA 1ZAOA 2DA3A 3HOUJ 4HF1A 2HQ5A 1MZBA 5EEGA 3IRRA 3MEXA 5LRRA 2JT1A 4YELA 4C3HJ 2H94A 3JXDL 4E7LA 2NS7A 1QGPA 2AO9A 3E6DA 3BZ6A 3KZIC 3AG3H 2L54A 2ZNZA 1QPZA 3ZN1A 3BTIA 1RPEL 3CLCA 1CJGA 1YO5C 4OOIA 2EBYA 2COMA 3G5GA 2MYSA 2JVGA 2WADA 5F04A 1QBJA 3LSHA 5TISC 5HS7A 5J1UA 1FZPB 4UUVA 5DEQA 3RJPA 1MDMB 4IA8A 1D5YA 4I6UA 3QU3A 4UV9A 1WI9A 2XRNA 3BZKA 2GOMA 3OOUA 4XL9A 2PPXA 4N9IA 1KU2A 2IS6A 1K83J 1DU0A 1MGTA 2HYJA 2GWRA 3FM3A 3TO6A 3KLOA 3I53A 1FMVA 2OAZA 1W1WE 2L49A 2FRHA 2XCJA 4A93J 4A3JJ 3FXLA 3H35A 2JN6A 2JSCA 1XN7A 3QPTA 2JPBA 5L3BA 4YIFA 3SCGA 3L2RA 1U5TA 2KZ8A 4YIRX 2LYCA 1MBHA 1T0FA 3KP5A 3K4KA 4FASD 2LY1A 5C4XJ 3R1FA 3DP7A 2VQGA 3D5LA 4XN3A 3S15J 2ODRD 2KJCA 3CUQA 3FXRA 3PIPF 2NRAC 1ZZCA 4NB5A 1J2XA 4I0BA 2KRHA 3AKZA 1Z77A 1J59A 1Y9QA 5GPAA 4KMFA 2QGUA 4PCQA 2K9SA 2E2IJ 1P7JA 1IUYA 2F4OB 2XPUA 2ZMEA 1SC7A 2DJNA 2M7AA 2F48A 2PMUA 1GV5A 3BR0A 3GZ5A 4KT5C 4KNYA 4A5MA 3HEFA 5DYMA 3BG3A 2Z9OA 4ANJA 4LLLA 1BL0A 1NTCA 5LHGA 2WAQA 4XLCA 1XWRA 2IS4A 4XR6A 4JYKA 2DT6A 3OQOA 4YFNF 1BR2A 5KCMA 4F92B 2YU3A 5EJCA 5FD6A 2DA6A 3BR1A 3SQNA 2R5YB 5CVUA 2CUEA 2QM3A 5DUKA 2ICTA 4E70A 2IP2A 1YX5A 3D5SC 1F43A 2RNGA 3WG7H 4NBQA 4XICA 5E3MA 2CQQA 4OAZA 5K7FA 3FBIB 2CSOA 3T8RA 1I3QJ 1BOBA 3WE2A 1MNDA 1LB2A 3ULQB 5IP9J 3S16J 4WX9A 3S2HJ 1VFCA 1MSFC 1BM9A 1PVEA 3BS3A 3MAJA 3WTUC 3IP4B 2M2EA 2V4JC 2NVUB 1BIAA 3WHCA 3BR3A 4BYYA 1MBEA 1FPQA 1UHMA 5IY5H 2KZGA 5HOOA 3W6VA 2VE9A 3ZQHA 3CCYA 3CJRB 2Q2EB 5E17F 4ZC3A 4LIVA 2E60A 4S05A 1RESA 1D0ZA 2AW6A 3K4BA 2VKDA 1ZS4A 2W1OA 5KHDA 4X4IA 1BW5A 4BJTA 3N4MA 1KQ0A 3H92A 1PNRA 2PXKA 4I09A 1Z9CA 1WVRA 3AG4H 1ZTRA 3DBLB 3KEQA 1K4SA 1OCOH 3LMMA 4NUBA 4D5CA 3G6EI 2M3AA 4PK4A 3K70C 1W5SA 2EZLA 4F52A 1WH5A 2AWIA 2BXZA 4B09A 2GIVA 2PXLA 2FQ3A 4AVPA 4IHYA 4EM0B 3SDBA 3ZQ7A 5EG0B 2FX0A 1TBXA 2E7WA 2ICWG 3ZPXA 4B3AA 4I6TA 3H5TA 3K4LA 3FZVA 3O3KA 4A69C 2KT0A 2GA1A 3A01B 3K9TA 5EEAA 5CLSA 3VEPA 2F5FA 4FE4A 1KONA 2XC7A 3FMSA 3JTHA 5JHFA 1T6SA 4A12A 2L3DA 4HDVA 3ZQCA 3LA3A 2NYXA 5F1JA 3LFUA 3JSPA 1IRZA 4BE2A 1MMAA 3K7AJ 2ETHA 3ZQLA 2ZXJA 1YX3A 2EINH 2CUJA 2R7FA 3OIPA 1FYLA 2IUOA 1PRVA 1OSLA 5IP6A 2V1XA 4U88A 4BHCA 4GQMA 3RZOJ 3E6BA 2ZJQF 3CC7I 1YQAA 4KIBA 2JVLA 1E3HA 1R1TA 4KISA 4IPAA 1XDSA 2FJRA 4A3KJ 5EZHA 1PRUA 1RZSA 1SVLA 2XAHA 3JRAA 2VJ5A 4G6QA 3U21A 5L3DA 1ZZ6A 1N75A 4BDZA 3PO2J 4MEXF 1G4DA 1A04A 2VASA 5IT9K 4DJAA 3HRMA 4XLHA 1DU6A 2DFEA 3V7CA 1NG7A 4ESBA 2L7MP 2M45A 1WJEA 3A9XA 1B1BA 1PERL 3IH2A 1XPXA 2M34A 4D0PA 2KIQA 4I6ZA 1Y0UA 4KT6A 3M3YJ 2PUCA 3RYRA 2XAQA 3ECOA 5M5YJ 4I2OA 1HXDA 1LQCA 5DDGA 2PUDA 5CQGA 4LOCA 1CQTA 2MH2A 4KUMA 1I3AA 1XG1A 3IH4A 1W5TA 2IAIA 3BG9A 3V42A 1JE8A 4G7OF 4Q5SF 2L8NA 2OV7A 1XSVA 4UB6C 3TOBA 2EZHA 4IQJA 1RI7A 2O8KA 3WG9A 2L2OA 1OCCH 1TQIA 2R93J 1VPWA 1GUUA 5FROA 1IRGA 2BNOA 3SYTA 4Z58A 1USTA 3Q9VA 5DCFA 1VQOI 4MEYF 3ZRGA 4X4EA 2FMLA 4H0EA 1R23A 4CA0A 1QPMA 1LDDA 2ZCWA 5HNFA 3OWQA 3HZIB 2V1NA 2WV1A 3CDLA 4E7JA 2QKMB 4BS9A 5L3CA 4L18B 4DW6A 2A6EF 1D8JA 2CG4A 1XDUA 1O7FA 2VN2A 3OYNA 5A7LA 5D5XB 5FLMJ 4P1WA 3LISA 2Z16A 1ENHA 4RB0A 2KDZA 1YIJI 3DLAA 1ZKGA 1RZRD 3NWSA 4RGRA 4OIOF 1LMB3 2VQHA 2R7VA 2HDDA 3M1CA 3MWMA 3JREA 4MQ9F 3BY6A 3W6KB 3FKIJ 4PU8A 4B43A 1KU9A 3D5RC 4B4CA 1O3TA 3CC4I 3TKYA 4P5OA 1VQNI 2F5EA 3I3LA 3K6GA 4M6VA 2FOWA 3E97A 4FE7A 2K4JA 2P5KA 4P96A 2ZFUA 5FRNA 3MKLA 1Z7UA 2Y0MA 5E79C 2H1KA 2KZVA 4ZDOA 3FF5A 2EZIA 4Y3OA 2KLOA 2CUZA 4G6DA 5F64A 1A6IA 2ZB9A 1P9QC 1XCVA 1JTYA 3DKWA 2X6XA 2RGVA 3GUDA 5GADJ 1Y56A 3CMYA 1JUPA 4J1XA 4IO9F 4XMYA 2FOKA 5DD4A 4HX4A 3OYJA 2G9WA 4CZZA 2IVBA 4X4HA 2L9NA 1O7LA 1T38A 2Z3YA 4BHPA 1IN6A 2WTEA 3OR1C 3BDNA 2F6CA 3C18A 2BHYA 4N9HA 3DU6A 1FOXA 1DGWY 3DPLC 1ZR2A 4A3LJ 2HR3A 1TL8A 1ERDA 4D1QA 2DMPA 3HHGA 2GXAA 2A3SA 2ZSIB 3PM1A 4BBRJ 1WJCA 3KP7A 3BZCA 2LH9A 2EWTA 2E2JJ 2CS3A 2ECBA 1V5GA 1RZRA 1XCBA 5IT9Z 1J5YA 3RTRA 3NRVA 1RKTA 1D3YA 5HNHA 3KL4A 5GAGi 1O3SA 1PP7U 4XLFA 3HSRA 5IOZA 2IEKA 2LYJA 2O38A 1W7PB 4OINF 2XI8A 1SFKA 1HW1A 1ZGJA 5F0FA 4A0XA 4S04A 5FD5A 5ED4A 3KP6A 1ZAYA 4HNVA 2RREA 1W0TA 5JVGF 2ECCA 3J7AY 3FXKA 3H9JA 1O57A 3CUOA 3VYTB 1YIOA 2VIXA 2L5QA 3L2VA 2CW8A 3IAS2 3GTJJ 5M5WJ 2DLLA 2V1DA 3ABTA 3CCUI 1VF9A 3QQAA 1Z1DA 2XUBA 2VE8A 3LA2A 4A5NA 3OYEA 3CCQI 1RR8C 1MJAA 2VOPA 1L3LA 2LBFB 1VQ9I 1Y6IA 3CCSI 3EUHC 1Q1VA 4CCMA 4AIHA 5DCMA 3H9QA 4C2TA 4M74A 4OMZA 3EUKL 3OL4A 1QZEA 1QQIA 5ICFA 5HLGA 3SFZA 4B8XA 4RA2A 4KN7X 2V26A 1R00A 3X2QH 4W1UA 3K70D 1H89C 4WXHA 4XKWA 3GZDC 3LFKA 4PU7A 1IW7F 2P7VB 3OY9A 2EBIA 2HINA 5TGTA 2HKOA 4N4NB 4YFKF 4HEA2 3HOWJ 2DW4A 1WRJA
chains in the Genus database with same CATH topology
1EFAA 2BNMA 3ZHMA 4M3EA 3OIOA 1MBFA 1BDIA 1U78A 1ETVA 4BKXA 3JRHA 1PRAA 3DCFA 2WUSR 3KZ3A 2LK2A 3Q0WA 3S17J 2X9DA 2O4AA 2GRLA 4Z59A 1F36A 3BT9A 2AXUA 2EH3A 1JUMA 2COBA 5J3LA 4JP0A 1FTTA 2FD5A 3G1LA 4ABZA 1A5JA 4DZJA 4XIDA 2P81A 1WI3A 1VNDA 2R7ZJ 4W97A 4YG7B 5DS9A 2R5ZA 3HDDA 1WH6A 3BD1A 4I6RA 1JKQC 2ICPA 3BQYA 3ZQFA 4D7NA 2LYQA 1S7EA 2JCGA 2XIUA 1JJ8C 1Y1VJ 2JMWA 1NEQA 2AXVA 3ZHIA 4IHXA 2G0EA 3LOCA 4Z5CA 4UUSB 1B72A 3H0GJ 1HOMA 4JCYA 2LTPA 3KJXA 1RETA 2LYPA 3SCHA 1NK3P 2WB1N 2XGDA 1WGXA 2Y2ZA 2XJ3A 3S8QA 2CROA 3RZZA 2QCOA 3I4NJ 5E3OA 1TWFJ 2XGCA 2DMQA 5DTDA 5EF6A 1RPWA 4M3GA 5EGOB 2LP0A 2A6CA 3QQ6A 1ZR4A 4CYCB 4MO7A 2NVXJ 5E3LA 2IU7A 3ZQGA 4OB4A 3A03A 5FKMA 2DA5A 1X2NA 3HOZJ 4X4DA 1ETKA 1B8IA 3OSFA 3GTQJ 1JH9A 3TW6A 3IV5A 1JT6A 1POUA 2H8RA 1HF0A 2BJCA 5J1RA 1U9NA 2OFYA 5FKKA 5HODA 3S14J 4GHJA 1QVTA 1LFUP 2EZKA 1UTXA 3A02A 2M8GX 1FIAA 3BR6A 2JA7J 5C44J 1FEXA 1QP0A 3LFPA 3JRCA 4RBOA 5FJ8J 1WCMJ 2YUSA 1AKHA 1IUFA 3HOUJ 2DA3A 1NERA 4YBAA 1JJ6C 2HQ5A 4MCTA 4C3HJ 4S0HB 4IEJA 3JXDL 2NS7A 2AO9A 3QF3A 1QPZA 4L5EA 3BTIA 2ID6A 2W48A 3GBGA 2XB5A 1RPEL 3CLCA 2R0QC 1CJGA 3CROL 2EBYA 1MSEC 1UMQA 3HB9A 3G5GA 1R69A 1RKWA 1B72B 2BNNA 1IC8A 5F04A 2AXZA 2XGEA 5J1UA 3B7HA 4MIMA 2JJ7A 1QQAA 2B5AA 2K9QA 4DZPA 1D5YA 4IA8A 1U9OA 4I6UA 2KEKA 3OOUA 2PPXA 4M3FA 5EYRA 4JQDA 2PUFA 9ANTA 1K83J 2GM4A 2XSDC 3IH3A 1DU0A 2MSYA 2HYJA 4UUSA 2DA2A 1GDTA 2CSFA 3S1NJ 2L49A 2XCJA 4A93J 4A3JJ 5FKLA 2JN6A 3HBLA 2HXOA 5M3FJ 3SCGA 2TRTA 2KZ8A 4I76A 1EF4A 3ZKCA 1MBHA 1IDYA 4Z5DA 4X4GA 5C4XJ 4BBSJ 2VKVA 4Y7NJ 3R1FA 1BA5A 2JA5J 2XB0X 4A3FJ 3JXBC 2GRMA 3S15J 4CYCA 3QYXA 2DA4A 1ZZCA 1TWCJ 3I4MJ 2LYLA 1Y7YA 4EEFG 1Y9QA 1Z77A 3KXAA 5GPAA 2K9SA 2E2IJ 1P7JA 2RAEA 3Q0UA 1G2HA 2XPUA 3E7LA 1ITYA 1T33A 4JX4A 2DJNA 3CQZJ 3OSGA 3BTCA 3SJMA 5GPCA 1GV5A 2M0CA 3BR0A 3HEFA 2LR8A 3BG3A 3GTGJ 1BL0A 1NTCA 3HM5A 5IPAA 2JA8J 2KPJA 1XWRA 4JYKA 2R63A 2KEJA 3OQOA 1ZUGA 1B0NA 1LFBA 2ID3A 1GT0C 2DA6A 3BR1A 4AC0A 1MNMC 2R5YB 3JR9A 4C3IJ 2CUEA 2ICTA 1F43A 4X4FA 3OQMA 3GN5B 5E3NA 1H88C 2E19A 4XICA 5E3MA 3LSGA 2CQQA 1BJZA 5K7FA 1FIPA 1UG2A 1I3QJ 2HI3A 4V2GA 3BTJA 4G12A 3MN2A 1SANA 1R9TJ 2L9RA 2LD5A 2CRGA 3S16J 5IP9J 3JXCL 2NVTJ 1YRNB 1ETXA 1LCCA 3S2HJ 4QIWN 1VFCA 2IBDA 1MSFC 1OJLA 3BS3A 5GP9A 1DW9A 2LY9A 3B6CA 2M2EA 4QTRA 3DNVB 3JRGA 3WHCA 3BR3A 1FJLA 1MBEA 1ZVVA 3W6VA 3TEDA 3ZQHA 4MCXA 5BNGA 3CCYA 3O8GA 4RDUA 1YSEA 3GTKJ 1X2LA 1RESA 2E1OA 1OFCX 3SFIA 3NARA 2QF7A 1I50J 3QPLA 4JX6A 5M3MJ 2AW6A 4JX5A 4Y52J 1ZS4A 4X4IA 1BW5A 1FTZA 5F0HA 3F6WA 1PNRA 3OQNA 2GZUA 1IV6A 1ZTRA 4A3MJ 4QSHA 2DN0A 2XPWA 3HGYA 3HOVJ 4D5CA 2X48A 3GTPJ 3O8HA 5IOYA 4MFDA 4B1RA 5IYDJ 3F51A 3FYMA 2EZLA 5K7ZA 3G1OA 1WH5A 1GV2A 2AWIA 1XC5A 5FLVA 3S2DJ 4IHYA 1NK2P 4XRSA 4A3GJ 2EF8A 5JLXA 5EG0B 2HOTA 2LFBA 1SFOJ 3G7DA 2FX0A 1ZZBA 3LSJA 4I8TA 4B3AA 4I6TA 3H5TA 2L0KA 2N8GA 4A69C 2KT0A 3A01B 2PUEA 4C2MJ 5EEAA 3GTOJ 3MLFA 2M9HA 2K9NA 4FE4A 3TW7A 2O7OA 2HSGA 1ZQ3P 1OCTC 2R5YA 1HDDC 5IP7J 2OPTA 3SDGA 4IWRA 3ZQCA 5F1JA 1K61A 3RZDJ 1IRZA 1JFTA 3GN5A 3K7AJ 4PU4C 2XRLA 3ZQLA 4A3EJ 1LLIA 4FBIA 1X2MA 4J1WA 3SCFA 2IUOA 1X58A 1PRVA 1OSLA 5IP6A 5C3EJ 4GQMA 3L1PA 2MGQA 4YG1A 3RZOJ 2IVGA 1P7IA 1O4XA 4YG4A 3M4OJ 1YRNA 2JVLA 2E2HJ 2FJRA 2Y30A 4BY7J 4A3KJ 5EZHA 1PRUA 1RZSA 1WH7A 3JRAA 3QPSA 1T56A 4XRSG 3LSPA 2DTZA 2XPVA 4X1EA 3PO2J 3HOXJ 1ZZ6A 2DA1A 1IG7A 4DYQA 2GLOA 1DU6A 2B63J 3IVPA 4MLOA 2CUFA 2L7MP 2Y0SN 1PERL 3IH2A 2M34A 1WPKA 2JA6J 2PE5A 3ZQIA 1TWAJ 4I6ZA 1JT0A 5F27A 3M3YJ 2PUCA 4FISA 3RKQA 3BG5A 3BQZA 4IHWA 2NOGA 1W0UA 2VUMJ 2KEIA 3PXPA 1QP7A 5M5YJ 4XRMA 1LQCA 3DEWA 3FMYA 2EQRA 5F08A 2PUDA 1JWLA 1ZK8A 1VI0A 1TWHJ 2DA7A 1AU7A 4LOCA 1CQTA 3O9XA 1ZZ7A 1HDPA 2LLKA 1XG1A 3IH4A 3BG9A 1ETOA 2IAIA 1AHDP 1APLC 2L8NA 2O49A 1DWKA 1OCPA 1ZGWA 2EZHA 4NDWA 3HKZN 2O8KA 4YARA 4FCYA 1QP4A 2R93J 1VPWA 1GUUA 4X4BA 3Q0VA 2BNOA 1MBJA 4Z58A 2VKEA 2NVYJ 3LSRA 5EZGA 4X4EA 3TP3A 3VK0A 5EG0A 3S1QJ 3PO3J 3S1MJ 3TRBA 2CQXA 4IHVA 3HZIB 2D5VA 2WV1A 1BW6A 3CDLA 3NAUA 3JRIA 3A01A 4DW6A 1ETWA 2I10A 1ADRA 4A3CJ 2LCVA 2MW8A 1ETYA 5A7LA 5FLMJ 1RR7A 4X4CA 3LISA 4Z5HA 2OF7A 1HLVA 2PUBA 1ENHA 2KDZA 1RZRD 1ZKGA 4C3JJ 1LMB3 3G1MA 2HDDA 3JREA 1UXCA 1QVUA 4PU8A 3FKIJ 3MVPA 2MEZA 4A3DJ 4B4CA 3EUSA 5F0CA 1IGNA 3FIWA 1MBKA 4M6VA 4D7MA 1U8BA 4FE7A 3ZOBA 1E3OC 1JGGA 2Y9YA 2R92J 3MKLA 4V2FA 4X6AJ 2H1KA 1GVDA 2HXIA 2HOSA 2YU9J 3H3VK 4NDLA 1X57A 1BDHA 1WETA 2VI6A 2JWTA 4DYRA 2EZIA 2MG4A 3FISA 2NVQJ 1IJWC 1PUFA 3GTLJ 2LYRA 1A6IA 2ZB9A 3GBFA 4O8BA 1JTYA 1XS9A 4BY1J 2LKXA 1JKRC 2L7ZA 3CMYA 1JUPA 1ORKA 2PMZN 4J1XA 1L1MA 3B6AA 1LE8B 2AUWA 3FK6A 1MH4A 2VPRA 1QPIA 3JRDA 2IVBA 4X4HA 2K40A 2PIJA 1MBGA 3QWGA 4D5FA 4MFEA 1UHSA 3BDNA 3BR2A 4J19A 1QRYA 3JRFA 3UKGA 4FN3A 4A3BJ 1ZR2A 1HCRA 1JKOC 5K7HA 2Y9ZA 4M3BA 4A3LJ 1Y1WJ 3K2AA 2DMPA 2PUGA 3PM1A 4BBRJ 2NS8A 2EWTA 4UUTA 5C4JJ 3OMTA 2E2JJ 2ECBA 1MH3A 3UFDA 1WIZA 1RZRA 1SQ8A 1RKTA 1JFSA 2AHQA 2DMNA 2R5ZB 1JKPC 2GBYA 3D1NI 3HOYJ 2TCTA 1WH8A 2MQKA 4F8DA 5IOZA 2IEKA 2LYJA 2IV1A 2O38A 2O9LA 4DYCA 2XI8A 2Y31A 3S1RJ 5IYCJ 3FK7A 4M3DA 5F0FA 4PU3C 1ZZ8A 4AUXA 5M5XJ 5K98B 3OP9A 1ZAYA 3C2BA 4HNVA 3F52A 5FKNA 5IYBJ 4FTHA 3TP0A 1W0TA 2R1JL 2ECCA 2LYKA 2JK3A 1LCDA 2PUAA 1ZPQA 2L7FP 4Y42A 1JTXA 2ME0A 3Q3SA 4GFBA 2DMUA 2LVSA 1PUFB 4JCXA 2WAQN 3GTJJ 5M5WJ 4A3IJ 1RIOA 1ZZ9A 3LNQA 3BTLA 1Z0XA 1VF9A 3QQAA 2IVQA 4IVZA 3VPRA 2LYSA 1ETQA 4AYBN 1UXDA 3RQIA 2DMTA 1Q1VA 2WIUB 1R63A 5J1YA 3JRBA 3FYAA 3WHBA 3U3WA 2ME6A 1TC3C 4BXXJ 2CU7A 1B8IB 3BR5A 1IDZA 2YS9A 3CECA 3GTMJ 2OR1L 5EGOA 5JLWA 2X6OA 5EDNA 1LE8A 1I6HJ 1TWGJ 2FJ1A 1JUSA 2FQ4A 2CJJA 1H89C 4W1UA 1QQBA 3HGGA 4PU7A 4XK4A 2EBIA 2HOAA 2ELKA 3F0CA 2HINA 5FKOA 3HOWJ 1AKHB 1H8AC 1POGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFA A;  2BNM A;  3ZHM A;  4M3E A;  3OIO A;  1MBF A;  1BDI A;  1U78 A;  1ETV A;  4BKX A;  3JRH A;  1PRA A;  3DCF A;  2WUS R;  3KZ3 A;  2LK2 A;  3Q0W A;  3S17 J;  2X9D A;  2O4A A;  2GRL A;  4Z59 A;  1F36 A;  3BT9 A;  2AXU A;  2EH3 A;  1JUM A;  2COB A;  5J3L A;  4JP0 A;  1FTT A;  2FD5 A;  3G1L A;  4ABZ A;  1A5J A;  4DZJ A;  4XID A;  2P81 A;  1WI3 A;  1VND A;  2R7Z J;  4W97 A;  4YG7 B;  5DS9 A;  2R5Z A;  3HDD A;  1WH6 A;  3BD1 A;  4I6R A;  1JKQ C;  2ICP A;  3BQY A;  3ZQF A;  4D7N A;  2LYQ A;  1S7E A;  2JCG A;  2XIU A;  1JJ8 C;  1Y1V J;  2JMW A;  1NEQ A;  2AXV A;  3ZHI A;  4IHX A;  2G0E A;  3LOC A;  4Z5C A;  4UUS B;  1B72 A;  3H0G J;  1HOM A;  4JCY A;  2LTP A;  3KJX A;  1RET A;  2LYP A;  3SCH A;  1NK3 P;  2WB1 N;  2XGD A;  1WGX A;  2Y2Z A;  2XJ3 A;  3S8Q A;  2CRO A;  3RZZ A;  2QCO A;  3I4N J;  5E3O A;  1TWF J;  2XGC A;  2DMQ A;  5DTD A;  5EF6 A;  1RPW A;  4M3G A;  5EGO B;  2LP0 A;  2A6C A;  3QQ6 A;  1ZR4 A;  4CYC B;  4MO7 A;  2NVX J;  5E3L A;  2IU7 A;  3ZQG A;  4OB4 A;  3A03 A;  5FKM A;  2DA5 A;  1X2N A;  3HOZ J;  4X4D A;  1ETK A;  1B8I A;  3OSF A;  3GTQ J;  1JH9 A;  3TW6 A;  3IV5 A;  1JT6 A;  1POU A;  2H8R A;  1HF0 A;  2BJC A;  5J1R A;  1U9N A;  2OFY A;  5FKK A;  5HOD A;  3S14 J;  4GHJ A;  1QVT A;  1LFU P;  2EZK A;  1UTX A;  3A02 A;  2M8G X;  1FIA A;  3BR6 A;  2JA7 J;  5C44 J;  1FEX A;  1QP0 A;  3LFP A;  3JRC A;  4RBO A;  5FJ8 J;  1WCM J;  2YUS A;  1AKH A;  1IUF A;  3HOU J;  2DA3 A;  1NER A;  4YBA A;  1JJ6 C;  2HQ5 A;  4MCT A;  4C3H J;  4S0H B;  4IEJ A;  3JXD L;  2NS7 A;  2AO9 A;  3QF3 A;  1QPZ A;  4L5E A;  3BTI A;  2ID6 A;  2W48 A;  3GBG A;  2XB5 A;  1RPE L;  3CLC A;  2R0Q C;  1CJG A;  3CRO L;  2EBY A;  1MSE C;  1UMQ A;  3HB9 A;  3G5G A;  1R69 A;  1RKW A;  1B72 B;  2BNN A;  1IC8 A;  5F04 A;  2AXZ A;  2XGE A;  5J1U A;  3B7H A;  4MIM A;  2JJ7 A;  1QQA A;  2B5A A;  2K9Q A;  4DZP A;  1D5Y A;  4IA8 A;  1U9O A;  4I6U A;  2KEK A;  3OOU A;  2PPX A;  4M3F A;  5EYR A;  4JQD A;  2PUF A;  9ANT A;  1K83 J;  2GM4 A;  2XSD C;  3IH3 A;  1DU0 A;  2MSY A;  2HYJ A;  4UUS A;  2DA2 A;  1GDT A;  2CSF A;  3S1N J;  2L49 A;  2XCJ A;  4A93 J;  4A3J J;  5FKL A;  2JN6 A;  3HBL A;  2HXO A;  5M3F J;  3SCG A;  2TRT A;  2KZ8 A;  4I76 A;  1EF4 A;  3ZKC A;  1MBH A;  1IDY A;  4Z5D A;  4X4G A;  5C4X J;  4BBS J;  2VKV A;  4Y7N J;  3R1F A;  1BA5 A;  2JA5 J;  2XB0 X;  4A3F J;  3JXB C;  2GRM A;  3S15 J;  4CYC A;  3QYX A;  2DA4 A;  1ZZC A;  1TWC J;  3I4M J;  2LYL A;  1Y7Y A;  4EEF G;  1Y9Q A;  1Z77 A;  3KXA A;  5GPA A;  2K9S A;  2E2I J;  1P7J A;  2RAE A;  3Q0U A;  1G2H A;  2XPU A;  3E7L A;  1ITY A;  1T33 A;  4JX4 A;  2DJN A;  3CQZ J;  3OSG A;  3BTC A;  3SJM A;  5GPC A;  1GV5 A;  2M0C A;  3BR0 A;  3HEF A;  2LR8 A;  3BG3 A;  3GTG J;  1BL0 A;  1NTC A;  3HM5 A;  5IPA A;  2JA8 J;  2KPJ A;  1XWR A;  4JYK A;  2R63 A;  2KEJ A;  3OQO A;  1ZUG A;  1B0N A;  1LFB A;  2ID3 A;  1GT0 C;  2DA6 A;  3BR1 A;  4AC0 A;  1MNM C;  2R5Y B;  3JR9 A;  4C3I J;  2CUE A;  2ICT A;  1F43 A;  4X4F A;  3OQM A;  3GN5 B;  5E3N A;  1H88 C;  2E19 A;  4XIC A;  5E3M A;  3LSG A;  2CQQ A;  1BJZ A;  5K7F A;  1FIP A;  1UG2 A;  1I3Q J;  2HI3 A;  4V2G A;  3BTJ A;  4G12 A;  3MN2 A;  1SAN A;  1R9T J;  2L9R A;  2LD5 A;  2CRG A;  3S16 J;  5IP9 J;  3JXC L;  2NVT J;  1YRN B;  1ETX A;  1LCC A;  3S2H J;  4QIW N;  1VFC A;  2IBD A;  1MSF C;  1OJL A;  3BS3 A;  5GP9 A;  1DW9 A;  2LY9 A;  3B6C A;  2M2E A;  4QTR A;  3DNV B;  3JRG A;  3WHC A;  3BR3 A;  1FJL A;  1MBE A;  1ZVV A;  3W6V A;  3TED A;  3ZQH A;  4MCX A;  5BNG A;  3CCY A;  3O8G A;  4RDU A;  1YSE A;  3GTK J;  1X2L A;  1RES A;  2E1O A;  1OFC X;  3SFI A;  3NAR A;  2QF7 A;  1I50 J;  3QPL A;  4JX6 A;  5M3M J;  2AW6 A;  4JX5 A;  4Y52 J;  1ZS4 A;  4X4I A;  1BW5 A;  1FTZ A;  5F0H A;  3F6W A;  1PNR A;  3OQN A;  2GZU A;  1IV6 A;  1ZTR A;  4A3M J;  4QSH A;  2DN0 A;  2XPW A;  3HGY A;  3HOV J;  4D5C A;  2X48 A;  3GTP J;  3O8H A;  5IOY A;  4MFD A;  4B1R A;  5IYD J;  3F51 A;  3FYM A;  2EZL A;  5K7Z A;  3G1O A;  1WH5 A;  1GV2 A;  2AWI A;  1XC5 A;  5FLV A;  3S2D J;  4IHY A;  1NK2 P;  4XRS A;  4A3G J;  2EF8 A;  5JLX A;  5EG0 B;  2HOT A;  2LFB A;  1SFO J;  3G7D A;  2FX0 A;  1ZZB A;  3LSJ A;  4I8T A;  4B3A A;  4I6T A;  3H5T A;  2L0K A;  2N8G A;  4A69 C;  2KT0 A;  3A01 B;  2PUE A;  4C2M J;  5EEA A;  3GTO J;  3MLF A;  2M9H A;  2K9N A;  4FE4 A;  3TW7 A;  2O7O A;  2HSG A;  1ZQ3 P;  1OCT C;  2R5Y A;  1HDD C;  5IP7 J;  2OPT A;  3SDG A;  4IWR A;  3ZQC A;  5F1J A;  1K61 A;  3RZD J;  1IRZ A;  1JFT A;  3GN5 A;  3K7A J;  4PU4 C;  2XRL A;  3ZQL A;  4A3E J;  1LLI A;  4FBI A;  1X2M A;  4J1W A;  3SCF A;  2IUO A;  1X58 A;  1PRV A;  1OSL A;  5IP6 A;  5C3E J;  4GQM A;  3L1P A;  2MGQ A;  4YG1 A;  3RZO J;  2IVG A;  1P7I A;  1O4X A;  4YG4 A;  3M4O J;  1YRN A;  2JVL A;  2E2H J;  2FJR A;  2Y30 A;  4BY7 J;  4A3K J;  5EZH A;  1PRU A;  1RZS A;  1WH7 A;  3JRA A;  3QPS A;  1T56 A;  4XRS G;  3LSP A;  2DTZ A;  2XPV A;  4X1E A;  3PO2 J;  3HOX J;  1ZZ6 A;  2DA1 A;  1IG7 A;  4DYQ A;  2GLO A;  1DU6 A;  2B63 J;  3IVP A;  4MLO A;  2CUF A;  2L7M P;  2Y0S N;  1PER L;  3IH2 A;  2M34 A;  1WPK A;  2JA6 J;  2PE5 A;  3ZQI A;  1TWA J;  4I6Z A;  1JT0 A;  5F27 A;  3M3Y J;  2PUC A;  4FIS A;  3RKQ A;  3BG5 A;  3BQZ A;  4IHW A;  2NOG A;  1W0U A;  2VUM J;  2KEI A;  3PXP A;  1QP7 A;  5M5Y J;  4XRM A;  1LQC A;  3DEW A;  3FMY A;  2EQR A;  5F08 A;  2PUD A;  1JWL A;  1ZK8 A;  1VI0 A;  1TWH J;  2DA7 A;  1AU7 A;  4LOC A;  1CQT A;  3O9X A;  1ZZ7 A;  1HDP A;  2LLK A;  1XG1 A;  3IH4 A;  3BG9 A;  1ETO A;  2IAI A;  1AHD P;  1APL C;  2L8N A;  2O49 A;  1DWK A;  1OCP A;  1ZGW A;  2EZH A;  4NDW A;  3HKZ N;  2O8K A;  4YAR A;  4FCY A;  1QP4 A;  2R93 J;  1VPW A;  1GUU A;  4X4B A;  3Q0V A;  2BNO A;  1MBJ A;  4Z58 A;  2VKE A;  2NVY J;  3LSR A;  5EZG A;  4X4E A;  3TP3 A;  3VK0 A;  5EG0 A;  3S1Q J;  3PO3 J;  3S1M J;  3TRB A;  2CQX A;  4IHV A;  3HZI B;  2D5V A;  2WV1 A;  1BW6 A;  3CDL A;  3NAU A;  3JRI A;  3A01 A;  4DW6 A;  1ETW A;  2I10 A;  1ADR A;  4A3C J;  2LCV A;  2MW8 A;  1ETY A;  5A7L A;  5FLM J;  1RR7 A;  4X4C A;  3LIS A;  4Z5H A;  2OF7 A;  1HLV A;  2PUB A;  1ENH A;  2KDZ A;  1RZR D;  1ZKG A;  4C3J J;  1LMB 3;  3G1M A;  2HDD A;  3JRE A;  1UXC A;  1QVU A;  4PU8 A;  3FKI J;  3MVP A;  2MEZ A;  4A3D J;  4B4C A;  3EUS A;  5F0C A;  1IGN A;  3FIW A;  1MBK A;  4M6V A;  4D7M A;  1U8B A;  4FE7 A;  3ZOB A;  1E3O C;  1JGG A;  2Y9Y A;  2R92 J;  3MKL A;  4V2F A;  4X6A J;  2H1K A;  1GVD A;  2HXI A;  2HOS A;  2YU9 J;  3H3V K;  4NDL A;  1X57 A;  1BDH A;  1WET A;  2VI6 A;  2JWT A;  4DYR A;  2EZI A;  2MG4 A;  3FIS A;  2NVQ J;  1IJW C;  1PUF A;  3GTL J;  2LYR A;  1A6I A;  2ZB9 A;  3GBF A;  4O8B A;  1JTY A;  1XS9 A;  4BY1 J;  2LKX A;  1JKR C;  2L7Z A;  3CMY A;  1JUP A;  1ORK A;  2PMZ N;  4J1X A;  1L1M A;  3B6A A;  1LE8 B;  2AUW A;  3FK6 A;  1MH4 A;  2VPR A;  1QPI A;  3JRD A;  2IVB A;  4X4H A;  2K40 A;  2PIJ A;  1MBG A;  3QWG A;  4D5F A;  4MFE A;  1UHS A;  3BDN A;  3BR2 A;  4J19 A;  1QRY A;  3JRF A;  3UKG A;  4FN3 A;  4A3B J;  1ZR2 A;  1HCR A;  1JKO C;  5K7H A;  2Y9Z A;  4M3B A;  4A3L J;  1Y1W J;  3K2A A;  2DMP A;  2PUG A;  3PM1 A;  4BBR J;  2NS8 A;  2EWT A;  4UUT A;  5C4J J;  3OMT A;  2E2J J;  2ECB A;  1MH3 A;  3UFD A;  1WIZ A;  1RZR A;  1SQ8 A;  1RKT A;  1JFS A;  2AHQ A;  2DMN A;  2R5Z B;  1JKP C;  2GBY A;  3D1N I;  3HOY J;  2TCT A;  1WH8 A;  2MQK A;  4F8D A;  5IOZ A;  2IEK A;  2LYJ A;  2IV1 A;  2O38 A;  2O9L A;  4DYC A;  2XI8 A;  2Y31 A;  3S1R J;  5IYC J;  3FK7 A;  4M3D A;  5F0F A;  4PU3 C;  1ZZ8 A;  4AUX A;  5M5X J;  5K98 B;  3OP9 A;  1ZAY A;  3C2B A;  4HNV A;  3F52 A;  5FKN A;  5IYB J;  4FTH A;  3TP0 A;  1W0T A;  2R1J L;  2ECC A;  2LYK A;  2JK3 A;  1LCD A;  2PUA A;  1ZPQ A;  2L7F P;  4Y42 A;  1JTX A;  2ME0 A;  3Q3S A;  4GFB A;  2DMU A;  2LVS A;  1PUF B;  4JCX A;  2WAQ N;  3GTJ J;  5M5W J;  4A3I J;  1RIO A;  1ZZ9 A;  3LNQ A;  3BTL A;  1Z0X A;  1VF9 A;  3QQA A;  2IVQ A;  4IVZ A;  3VPR A;  2LYS A;  1ETQ A;  4AYB N;  1UXD A;  3RQI A;  2DMT A;  1Q1V A;  2WIU B;  1R63 A;  5J1Y A;  3JRB A;  3FYA A;  3WHB A;  3U3W A;  2ME6 A;  1TC3 C;  4BXX J;  2CU7 A;  1B8I B;  3BR5 A;  1IDZ A;  2YS9 A;  3CEC A;  3GTM J;  2OR1 L;  5EGO A;  5JLW A;  2X6O A;  5EDN A;  1LE8 A;  1I6H J;  1TWG J;  2FJ1 A;  1JUS A;  2FQ4 A;  2CJJ A;  1H89 C;  4W1U A;  1QQB A;  3HGG A;  4PU7 A;  4XK4 A;  2EBI A;  2HOA A;  2ELK A;  3F0C A;  2HIN A;  5FKO A;  3HOW J;  1AKH B;  1H8A C;  1POG A; 
#chains in the Genus database with same CATH topology
 3IAM 2;  3VOD A;  2BY1 A;  1U78 A;  3JRH A;  4E7Z A;  2O4A A;  1G3T A;  2GRL A;  2A05 A;  2NOJ B;  1GLN A;  1F36 A;  2K3F A;  3F9K A;  3NWT A;  3PIO F;  1VQK I;  5DD8 A;  4XKB A;  2FD5 A;  3OYB A;  2KIU A;  1ZRC A;  4BQO A;  4DZJ A;  2HTJ A;  3T0Y A;  4CGZ A;  1WI3 A;  4W97 A;  4ZTF A;  1V5E A;  1VQ4 I;  1QHH D;  1VQP I;  3G4S I;  2ZJP F;  5CVI A;  1ZRF A;  5DM7 F;  2AQF A;  5FLX K;  4M72 A;  1ZH5 A;  4HX8 A;  2JA2 A;  2JMW A;  3KYL A;  2AXV A;  4KFC A;  2XIU A;  4Z5C A;  4B3X A;  1B72 A;  3H0G J;  1L0O C;  2VC1 A;  4JCY A;  3CO7 C;  3I59 B;  2OZU A;  2WBM A;  3SZT A;  4OAY A;  2LTP A;  3SEQ A;  4AM3 A;  3KJX A;  1FY7 A;  3ZMU A;  5HLH A;  3MKW B;  1WGX A;  4BXU A;  4U7D A;  2XJ3 A;  1FBU A;  3RZZ A;  2K9L A;  1U5T B;  1TWF J;  2XGC A;  1FOW A;  2VBX A;  5EF6 A;  5BS6 A;  4EV0 A;  5CYV A;  1EH7 A;  2R7R A;  2NNY A;  5E3L A;  4ZTJ A;  3K1M A;  3QP6 A;  3CUQ B;  3RPU D;  3OIQ A;  2V1U A;  1X2N A;  2W00 A;  3RKW A;  3HOZ J;  2XDV A;  4IRH A;  3CES A;  1JH9 A;  5LGN A;  1U3E M;  5ILS A;  2PFB A;  3I71 A;  2ZME B;  3ZXS A;  5HVQ C;  1HF0 A;  2OFY A;  3G3Z A;  4ZZL A;  3P9K A;  3ZCO A;  2LRE A;  2EZK A;  5ERI A;  1UTX A;  1LNW A;  5GAG J;  3WGG A;  5C44 J;  2EB7 A;  1QP0 A;  1KU7 A;  3QYB A;  3HUG B;  4RB2 C;  2HVR A;  2GQQ A;  3C1D A;  3M1E A;  1WCM J;  3SEZ A;  2E1M B;  1NER A;  2XXA A;  1YFH A;  3PUF A;  5D8K B;  1SFX A;  2HPM A;  4MCT A;  4J00 A;  4S0H B;  2CQK A;  5HDG A;  5GAH i;  1BOA A;  3LAP A;  4JQF A;  4RAZ A;  2PJR A;  2X0L A;  3NZL A;  4L5E A;  2ID6 A;  3J80 K;  4ZDL A;  1V54 H;  4E6K G;  1R71 A;  2Q0O A;  1R69 A;  1A35 A;  1MFQ C;  3OYM A;  2EV6 A;  2XGE A;  4RMN A;  4MTD A;  1R5G A;  2B5A A;  3H0D A;  1ZG1 A;  1U9O A;  3GLX A;  2BOL A;  2KEK A;  2FE3 A;  5EYR A;  1ULY A;  9ANT A;  2XAS A;  2GM4 A;  3C2H A;  3A0B C;  1TNT A;  2MBF A;  2UXX A;  5BMZ A;  4DE8 A;  5HDN A;  5ICG A;  3S1N J;  2YX7 A;  1DQU A;  2Z2S B;  2MLK A;  4RS8 A;  5FKL A;  1YS7 A;  1X3U A;  1M1E B;  1JI8 A;  2PEX A;  3T8T A;  1XSD A;  2Y75 A;  4FT8 A;  2NAZ A;  1K79 A;  5F1R A;  1UJ8 A;  5HS9 A;  2GRM A;  2DBB A;  3GUU A;  4CYC A;  1RRJ A;  1RUN A;  4C2U A;  3BJO A;  5D6F A;  2DA4 A;  2Z5U A;  3QYX A;  2CW0 F;  1TWC J;  3L2W A;  1YW8 A;  1X1C A;  4EEF G;  3VWS A;  3KXA A;  4IRG A;  3KET A;  4ZDP A;  2HQA A;  3Q0U A;  1TW3 A;  4BHB A;  5FLX Z;  1G2H A;  5BOX A;  1EH6 A;  2VON A;  3E7L A;  3F6V A;  2ZC2 A;  3IC7 A;  1ITY A;  3F8C A;  1T33 A;  4UVC A;  4JX4 A;  3CQZ J;  3ASO H;  3SJM A;  4R8H A;  5GPC A;  1E3P A;  3B02 A;  1FBQ A;  3FXJ A;  2VT3 A;  1MNE A;  1IZ1 A;  3KX2 A;  3GTG J;  2H6C A;  4F93 B;  1U8R A;  4AVZ A;  2KPJ A;  1G3Y A;  3DBR B;  3DF8 A;  2PXP A;  2EV5 A;  2LDU A;  2NXN B;  4MGR A;  1ZUG A;  3PSI A;  4ZZD A;  2ZXI A;  2ID3 A;  2HEO A;  1STZ A;  4FX4 A;  4AC0 A;  2HDC A;  1DPR A;  3SXY A;  4CO8 A;  3PE5 A;  4H4K C;  2BBY A;  4YII A;  2CFX A;  2M7B A;  2DK5 A;  5E3N A;  4DGW B;  2E19 A;  1UZC A;  5LRS A;  1H88 C;  6PAX A;  3LSG A;  2VEO A;  1X3W B;  4V2G A;  2L1P A;  5JUW A;  2LD5 A;  3JXC L;  2X85 A;  4HZF A;  2XAG A;  3N97 A;  1OJL A;  1DW9 A;  2LY9 A;  3B6C A;  3CDH A;  1UG0 A;  2IA0 A;  3DTI A;  1DGR M;  3JRG A;  1R4N B;  2ZFW A;  1F5T A;  3FXO A;  5LLQ A;  3GYH X;  5BNG A;  2J7W A;  4RDU A;  3CCV I;  3GTK J;  2VQC A;  2HZD A;  1X2L A;  2D1H A;  1K6Y A;  2OCC H;  2XF5 A;  4M6Y A;  4A0Z A;  1DP3 A;  2QF7 A;  3QPL A;  2DPU A;  4JX6 A;  3J81 K;  4JX5 A;  2B9S A;  1G59 A;  4PGG A;  3J80 Z;  4WWC A;  4E4H A;  3CMA I;  3LL7 A;  3RKX A;  3ABU A;  1XX5 A;  3F6W A;  4U7B A;  3OQN A;  1EH8 A;  3BP8 A;  4NC8 A;  2GZU A;  2LF8 A;  4IVN A;  2Z33 A;  3HSF A;  1YOV B;  2KRC A;  4A3M J;  2XPW A;  4UY8 I;  3DPU A;  3HOV J;  4G7Z F;  2OBP A;  5BPD A;  2X48 A;  3GTP J;  5IOY A;  3S3N A;  3F51 A;  2EIM H;  2W85 A;  2A68 F;  3VOE A;  1XC5 A;  3A1Y A;  5FLV A;  3LQX A;  3QP5 A;  2BVL A;  1X3Z B;  4L5J A;  4L9N A;  1IN8 A;  3C2G A;  2J5P A;  4XQF A;  3WGH A;  2WWY A;  1QZZ A;  2HFH A;  2I8D A;  3I58 A;  3KPH A;  3CF2 A;  4HST A;  2MAB A;  3DU5 A;  3NXH A;  2PUE A;  5AON A;  3IL2 A;  1XGO A;  4OIQ F;  5DRT A;  5DRY A;  1XGM A;  2PMZ A;  3ECH A;  1E2X A;  1K78 A;  3MLF A;  2BY3 A;  1ZQ3 P;  2EFP A;  3T5X A;  4UHT A;  1HDD C;  1WHU A;  2EA4 A;  2KPM A;  2OPT A;  3GFJ A;  1K61 A;  3RZD J;  4LGW A;  3GN5 A;  3EUH A;  3SX0 A;  2GIZ A;  1IN5 A;  2J7U A;  4PU4 C;  3DPT A;  3CLO A;  2YBD A;  1LLI A;  4FQG A;  4ER5 A;  1X58 A;  3RI4 A;  1S72 I;  5C3E J;  2JSP A;  1ACI A;  2MGQ A;  4YG1 A;  3IWF A;  1P7I A;  2M8E A;  3M4O J;  1YRN A;  2HFZ A;  1IN7 A;  2TDX A;  3HXL A;  3RCO A;  4MHG A;  5FFX A;  1VQ5 I;  2ISY A;  2K7L A;  3AL0 B;  2IA1 A;  4X1E A;  5HLT A;  2IS2 A;  5J40 A;  3GZD A;  2KFD A;  2RQQ A;  3IVP A;  1EKE A;  4ZYG A;  2JA6 J;  1TP4 A;  3ZQI A;  1TWA J;  3E5Q A;  4N4O B;  3OV8 A;  3LSM A;  2NS0 A;  2DO7 A;  4Y13 A;  3HL2 A;  1J7K A;  3RKQ A;  3BG5 A;  2KEI A;  4IHW A;  2NOG A;  3HJE A;  3CMM A;  1BI2 A;  2VUM J;  3PXP A;  1QP7 A;  4XRM A;  3KCC A;  4XBF A;  3VSL A;  1AU7 A;  2L9S A;  3OOP A;  4XLE A;  1HDP A;  2IA2 A;  2W7N A;  1ETO A;  3E5X A;  4RGU A;  1FT9 A;  2OU2 A;  1DWK A;  1OCP A;  4TV7 A;  4CZC A;  2PXF A;  1LKX A;  4CH7 A;  2WA0 A;  4FCY A;  1SD6 A;  1KYZ A;  2DU9 A;  1J9I A;  2QQA A;  3FX3 A;  2JZY A;  3Q0V A;  5H6R A;  1HA8 A;  2EJR A;  2VKE A;  3OYK A;  1U0J A;  1XGN A;  2Z99 A;  4AYB A;  1G3S A;  2X6Y A;  2YX4 A;  3FXQ A;  3ML6 A;  4U0V A;  3S1M J;  3DKY A;  2HPI A;  4IHV A;  4RLQ A;  3V8L A;  3RIR A;  3TEP A;  3AFH A;  2YSR A;  2IVM A;  1D0X A;  4EGZ A;  3GFL A;  3J81 Z;  5KNL A;  2MW8 A;  1MMD A;  1OYI A;  1RR7 A;  4Z5H A;  1MMN A;  2VL8 A;  1HLV A;  4HYE A;  2PUB A;  4YRV A;  5GTH C;  3KZZ A;  3FKJ A;  2DT7 B;  5DTQ A;  1OKR A;  4ZJZ A;  2O5R A;  4C3J J;  4II2 A;  2ACJ A;  1WWX A;  4AWX B;  1QVU A;  2DFI A;  4A3D J;  4D9J A;  5F0C A;  1JGG A;  5CPR B;  2IGN A;  2BYV E;  1X57 A;  2HOS A;  1UCR A;  3H3V K;  4EQQ A;  2LSO A;  3HRS A;  3NQO A;  3ISP A;  3GO5 A;  5DCM B;  2OTL I;  2MG4 A;  3GTL J;  2LYR A;  1MKM A;  3TOA A;  5LGU A;  3P9C A;  3GBF A;  4DBR A;  2A69 F;  2OD5 A;  4BY1 J;  2OJE D;  1S7O A;  2LKX A;  4CHU A;  1JKR C;  2DOD A;  2ISZ A;  4BH9 A;  1ORK A;  2PMZ N;  4IQ4 A;  3F8F A;  3GW2 A;  4KMU X;  1MH4 A;  2VPR A;  1QPI A;  2K40 A;  4IL6 C;  4RB3 C;  4JBA A;  2CQ7 A;  2LNB A;  3W2W A;  4D5F A;  5LEJ A;  3F23 A;  4EKG A;  1D1C A;  2VJJ A;  2L4M A;  1V3F A;  3JRF A;  5FFZ A;  5HS8 A;  3H5R A;  1JKO C;  2CWE A;  4M3B A;  2Y9Z A;  2WB1 A;  2ZBK A;  4IJA A;  1OCZ H;  2PUG A;  3SHF A;  1LFP A;  2NS8 A;  1OYY A;  2VC0 A;  5C4J J;  3OYF A;  1EJ9 A;  1TZL A;  3HHH A;  3UFD A;  1MH3 A;  3K4C A;  2RNJ A;  3VSK A;  3KE2 A;  3DLL F;  1SFE A;  2R7S A;  2R3S A;  1JFS A;  1SEU A;  1RNL A;  2AHQ A;  2DMN A;  1WH8 A;  2TCT A;  2R7Q A;  4F8D A;  3QOP A;  1WZ2 A;  2O9L A;  2Q1Z B;  3I56 I;  4EQZ A;  3KIO A;  4LK1 F;  1YI2 I;  2X51 A;  3FK7 A;  4M3D A;  1BI0 A;  4HLX A;  4AUX A;  2P0W A;  5M5X J;  3F52 A;  2BW3 A;  5FKN A;  3K2Z A;  1E0E A;  2QEN A;  2LYK A;  1G6N A;  3S3O A;  1ZPQ A;  1MMG A;  2E5N A;  3V8J A;  3OYG A;  4NHJ A;  3Q3S A;  4PSX A;  1P2F A;  4GFB A;  2K3P A;  3VB2 A;  2QSF X;  2DMU A;  2LVS A;  1PUF B;  1A31 A;  2LY2 A;  2PXT A;  2WAQ N;  2X1C A;  2M87 A;  1BI3 A;  4LG3 A;  1ZZ9 A;  1PDN C;  1Z0X A;  2E71 A;  3R61 A;  3F6O A;  4GO1 A;  4CCL A;  3ZGK A;  4Y15 A;  3PQK A;  2DFF A;  3ZN0 A;  3GFI A;  4AYB N;  2PBI A;  1PP8 F;  2DMT A;  3BCA A;  2WIU B;  4G8X A;  4KN4 X;  2JQ7 A;  3FYA A;  3BC8 A;  5J1Y A;  1Y0N A;  4HV5 A;  3WHB A;  2IT0 A;  3HZJ A;  3U3W A;  3R4K A;  3W6J B;  1TC3 C;  2EV0 A;  5F6F A;  3ZMV A;  1IDZ A;  3CEC A;  3GTM J;  5JLW A;  1G3W A;  2AS5 F;  4HX7 A;  5EDN A;  1LE8 A;  1I5Z A;  4UB8 C;  1TWG J;  2D1V A;  2FQ4 A;  2CO5 A;  3B73 A;  4PFO A;  1ZG3 A;  4U0Y A;  3EET A;  2HOA A;  2R7X A;  2FFH A;  1V5F A;  3F8B A;  5DSX A;  1YW7 A;  1AWC A;  1TLH B;  2QYO A;  3CCM I;  3W3C A;  3OIO A;  1BDI A;  2F4I A;  1IAW A;  1ETV A;  2HVS A;  4LK0 F;  3S17 J;  4ZH4 F;  4I98 B;  4Z59 A;  4L0Y B;  2AXU A;  4L9V A;  2EH3 A;  1JUM A;  2COB A;  1CF7 A;  3U1D A;  4DOZ A;  1FTT A;  4ABZ A;  3E0J B;  3ZMT A;  1R1U A;  5L3G A;  5JVT A;  4ER6 A;  2KIS A;  4EJT A;  2Y0S A;  2KHM A;  4IF4 A;  4LG0 B;  1XB4 A;  1VQ6 I;  4YG7 B;  4WCG A;  3K69 A;  2R5Z A;  2R7U A;  1WH6 A;  1KGS A;  4I6R A;  2ICP A;  3BPX A;  2HGC A;  1IO2 A;  2DJI A;  3BCB A;  1Y1V J;  1NEQ A;  2L01 A;  2IW5 A;  3C3W A;  2FA5 A;  3QOX A;  3M8F A;  4LB6 B;  3RYP A;  2MA3 A;  4PJM A;  4CIC A;  3E5U A;  2H1L A;  2WB1 N;  4C9Y A;  2Y2Z A;  4F91 B;  3W2V A;  3OYH A;  3U2R A;  2VBZ A;  1Y39 A;  5E3O A;  1UB9 A;  2L4A A;  2PQ8 A;  3RSN A;  5EGO B;  1GXP A;  5JR3 A;  1LVA A;  4CYC B;  1YTY A;  3U1K A;  4HNT A;  2IU7 A;  4OB4 A;  3A03 A;  3WTT C;  2DA5 A;  4HRA A;  4IZZ A;  2XKP A;  1TT5 B;  1F9N A;  1B8I A;  3GTQ J;  2P5V A;  2MD5 A;  1JT6 A;  1K7A A;  2ELJ A;  2H8R A;  5J1R A;  2QBY A;  1U9N A;  2V7F A;  4M9S A;  5FKK A;  3S14 J;  4GHJ A;  2MC3 A;  1LFU P;  2M8G X;  3BR6 A;  3OR2 C;  2JA7 J;  1D5V A;  5E20 A;  4R1H A;  3TFL A;  2XF7 A;  4ER7 A;  3JRC A;  2KRF A;  4RGS A;  3VYS B;  5FJ8 J;  4RBO A;  3OYC A;  1IUF A;  3DEE A;  1JJ6 C;  2E36 A;  2KIF A;  1IXR C;  2F4M B;  2IGO A;  2DDA A;  4IEJ A;  1EV7 A;  2HVQ A;  3QF3 A;  2BY2 A;  2A61 A;  4DE9 A;  2W48 A;  4EKI A;  2H8W A;  2XB5 A;  4HW0 A;  4ENN A;  3CRO L;  1YG2 A;  1Z21 A;  1UMQ A;  2K85 A;  1E17 A;  5ICC A;  4AID A;  1IC8 A;  3FHN A;  4IOC F;  2PJP A;  5J6X A;  2O0Y A;  2BGC A;  3C7J A;  4DZP A;  2Y69 H;  1SFU A;  1LPQ A;  5ILU A;  4CCO A;  4RB1 A;  5EEH A;  2V79 A;  3WTY C;  2XSD C;  3DTK A;  4GDF A;  3BPV A;  1YLF A;  2DA2 A;  1LDK B;  3KP2 A;  1GDT A;  5DT2 A;  4MTE A;  2XRO A;  1H0M A;  2CSF A;  2PXE A;  4PJL A;  4HSR A;  2CH0 A;  3GF2 A;  3EUA A;  2EWN A;  3R6S A;  2P6T A;  1YJN I;  2RN7 A;  3F8N A;  3HPG A;  2W25 A;  3HBL A;  5M3F J;  2M4H A;  2XAJ A;  2TRT A;  1PYV A;  1EF4 A;  1C0W A;  4Z5D A;  2DPD A;  4BJ5 C;  2CQN A;  4BBS J;  4Y7N J;  1KQ8 A;  4EM1 A;  2XB0 X;  2PXD A;  2P8T A;  3A9Y A;  3BRO A;  4OMY A;  2CV2 A;  2Q2E A;  2LOO A;  1UHW A;  4CCN A;  2LYL A;  3KZY A;  1U6G A;  5CKT A;  2LMD A;  2BE5 F;  2EIK H;  2H27 A;  2PXU A;  2X6W A;  1SMT A;  2RAE A;  3DFG A;  3S32 A;  3K10 A;  3OSG A;  2DQR A;  3VYR B;  4I0A A;  2QEX I;  2E7X A;  2M0C A;  1XD7 A;  2X4H A;  1W5C C;  2LR8 A;  5E1X A;  2MFZ A;  3M9A A;  2PLY A;  3EYY A;  3CCE I;  2X1D A;  2E34 A;  3D0S A;  1OR7 C;  3DWL E;  3CP2 A;  4LJZ F;  2JUC A;  4XM3 A;  4UXN A;  2KEJ A;  3A0H C;  2G7U A;  5LGT A;  1X4O A;  1K78 B;  1LFB A;  1GT0 C;  3CJQ B;  4QPO A;  1MNM C;  4C3I J;  3PNY A;  1ZN2 A;  2VBY A;  1ZHF A;  2XAU A;  2DT5 A;  4OIR F;  2ADU A;  1I27 A;  3OQM A;  5J4Y A;  3CTA A;  3VDX A;  3AAF A;  3GN5 B;  2BHZ A;  4YFX F;  1FIP A;  1UG2 A;  1WJB A;  2F2E A;  4HOB A;  1Z67 A;  3BTJ A;  4G12 A;  4Y17 A;  1SAN A;  1R9T J;  3QOW A;  1Z05 A;  2PX9 A;  3NRO A;  2G7H A;  1AA7 A;  3KYC B;  3HKZ A;  1YRN B;  4QIW N;  1LCC A;  2LKS A;  4G7H F;  4OIP F;  2C6Y A;  4ZYD A;  3J7Y J;  2PN6 A;  4QTR A;  1X1D A;  1X4P A;  1ZVV A;  2HTS A;  3ABL H;  4HAM A;  1VQM I;  1KU3 A;  3O8G A;  5FRM A;  2M5W A;  2R7W A;  4I7H A;  1XGS A;  1D0Y A;  3SFI A;  3NAR A;  3MZ8 A;  3TO9 A;  5FO5 A;  4PSW A;  5M3M J;  1FNN A;  3TQN A;  3ZMS A;  4AU7 A;  1ZAR A;  4HNU A;  3HTS B;  5F0H A;  1T8I A;  3K4N A;  5BQT A;  1WJD A;  2DN0 A;  1P4W A;  3ABK H;  2CYY A;  3M8E A;  1PJR A;  3W2A A;  3HGY A;  3E6M A;  3BJA A;  2VJ4 A;  3O8H A;  4PFP A;  4MFD A;  4B1R A;  2HQN A;  5IYD J;  1SAX A;  3K4J A;  4EGY A;  3ERM A;  4BQQ A;  4GXO A;  2A6T A;  4NNJ A;  1X1A A;  4ESF A;  2HDW A;  2HZT A;  1RZ4 A;  3S2D J;  1VTN C;  3WU1 B;  1I39 A;  4XRS A;  4A3G J;  3CD6 I;  2QQB A;  5JLX A;  3JAM K;  2HOT A;  1SFO J;  2FF4 A;  4CCJ A;  3G7D A;  3I9V 2;  4YEJ A;  1P92 A;  4Q48 A;  2IPQ X;  3ESW B;  4ITV A;  3DQV C;  3TW7 A;  3OYI A;  3BJ6 A;  4M71 A;  3MKZ A;  1IF1 A;  5IP7 J;  2AXL A;  4HQM A;  5ICE A;  1S6L A;  1X2M A;  4QPQ A;  5JFR A;  1OIS A;  4J1W A;  3QOE A;  5CQE A;  3SCF A;  3RPU A;  1P6R A;  4FET A;  1SD7 A;  1O4X A;  4YG4 A;  2YPR A;  2E2H J;  2WY7 Q;  2O3F A;  4Q47 A;  3T1B A;  3ZP5 A;  2E1C A;  2JRM A;  3ROU A;  1T56 A;  3H36 A;  2FBK A;  2DTZ A;  2XPV A;  2OQR A;  1IG7 A;  1KA8 A;  5J8C A;  2FNA A;  4DYQ A;  2GLO A;  3K0L A;  4M9Z A;  2CUF A;  4MLO A;  5LHH A;  3GX4 X;  2RQP A;  1W7P D;  3P7N A;  2LC2 A;  2PXB A;  2MH9 A;  1AKH B;  2IS1 A;  1KYW A;  4EJU A;  3KP3 A;  4HBL A;  3OS2 A;  4FIS A;  2VT2 A;  3BQZ A;  3JTG A;  1UFM A;  3FMY A;  2O8X A;  3DEW A;  2EQR A;  2XXQ A;  1JWL A;  1ZK8 A;  4OWR B;  1VI0 A;  1TWH J;  4F7Z A;  2RVC A;  3CDI A;  3O9X A;  1ZZ7 A;  3IHU A;  1JHH A;  2LLK A;  1YIT I;  2O49 A;  4XOR A;  3HPH A;  3RKY A;  2BZT A;  4M6X A;  1ZGW A;  4F55 A;  4NDW A;  3HKZ N;  4M73 A;  1YJW I;  2HYF A;  1IN4 A;  3TGN A;  4GYG A;  5E1Z B;  1QP4 A;  4DQ2 A;  4X4B A;  3S93 A;  1WKM A;  3DXJ F;  4U0W A;  1F4K A;  1B9N A;  3ELK A;  4BEH A;  2NVY J;  2UXN A;  4UV8 A;  3LSR A;  2VJI A;  2W57 A;  3QOD A;  3PO3 J;  2CQX A;  4I01 A;  2D5V A;  1BW6 A;  3NAU A;  3TDZ C;  4BGD A;  3JRI A;  1FX7 A;  1LUJ B;  1ETW A;  2FU4 A;  2I10 A;  3A2K A;  4EVI A;  1ADR A;  2LCV A;  1KZH A;  4X4C A;  3J7A O;  1K4T A;  2D2W A;  5B5E C;  2BW3 B;  3K4M A;  2HCN A;  2LLV A;  4X0G A;  1GHC A;  4II3 A;  4IOA F;  3DBH B;  3G1M A;  4L9J A;  4Z6Y A;  4ENK A;  3KYD B;  1UXC A;  1W7P A;  1R1V A;  4ASN A;  5CVR A;  3EUS A;  4HRI A;  1HBX G;  2HOE A;  3FIW A;  2IJL A;  1MBK A;  4D7M A;  1B4A A;  4JK1 X;  3ZOB A;  1U8B A;  1E3O C;  1R58 A;  4V2F A;  2YU9 J;  1GVD A;  2HXI A;  3CCL I;  4UNO A;  1XMK A;  3UWP A;  1BC7 C;  3OS0 A;  1WET A;  2W4S A;  3U9G A;  1ODD A;  3KLN A;  3EYI A;  3FIS A;  3JAM Z;  5JI6 A;  2NVQ J;  1LEB A;  5E8I A;  1FBS A;  1ZEL A;  4BUP A;  1FYK A;  2VOD A;  3R09 A;  1S7A A;  1RUO A;  2EK5 A;  4ER0 A;  2L7Z A;  4FHT A;  2VXD A;  3ZQQ A;  1LE8 B;  2IGM A;  3HC7 A;  5D4R A;  3JRD A;  2O6G E;  3AG1 H;  5B1A H;  4N0B A;  2B7E A;  3QWG A;  4NQW A;  3QRF F;  2ESN A;  4MFE A;  2STT A;  4J19 A;  4O6J A;  3K1P A;  4FN3 A;  3UKG A;  2OQG A;  4A3B J;  5K7H A;  4AIJ A;  1Y1W J;  3K2A A;  4GYI A;  3FBN B;  1V55 H;  1J09 A;  2M1B A;  2KP6 A;  3H9G A;  4EJV A;  2ZSH B;  1I6X A;  4L5I A;  4B44 A;  1NG6 A;  2F5V A;  3FXU A;  2KMU A;  2CGP A;  1MW7 A;  1PUE E;  5CVJ A;  4OBM A;  3P9I A;  1X1B A;  4HPQ A;  1W36 C;  1VQ7 I;  2ELH A;  1IV8 A;  1SQ8 A;  3ZR8 X;  4IHT A;  4LIT A;  1AOY A;  2R5Z B;  1JKP C;  2GBY A;  3HOY J;  2MQK A;  1X1P A;  3L7W A;  4E7I A;  2M30 A;  2F5C A;  1G8X A;  4O5V A;  2IV1 A;  1VQ8 I;  4PZJ A;  5L3E A;  3CLQ A;  1R5H A;  2Y31 A;  3I55 I;  3S1R J;  5IYC J;  1SMY F;  2PI0 A;  3CCJ I;  2VBW A;  4KA4 A;  5D5U B;  2V6E A;  1FYM A;  5K98 B;  1TW2 A;  3I64 A;  3OP9 A;  1FC3 A;  4FTH A;  3OYA A;  3E3V A;  2P6S A;  3WTV C;  2GXG A;  3SR4 A;  1T2K A;  3H3U A;  1Z7L A;  4Q2J A;  2L7F P;  1MMS A;  3R0A A;  4BXF A;  1V4R A;  3LQR A;  2NNN A;  3MZY A;  2WY8 Q;  2ZJR F;  2IRF G;  2STW A;  1TNS A;  2F5D A;  2CMP A;  3WGI A;  1RIO A;  4LLN A;  1ZLK A;  3BTL A;  2LRD A;  3L09 A;  4P55 A;  4O3M A;  1GXQ A;  3I59 A;  1R6R A;  3G2B A;  2KL4 A;  2BV6 A;  2LLW A;  1I1S A;  5A2Q K;  3RQI A;  4E7S A;  4PJN A;  2XF6 A;  2QA4 I;  4P9U A;  1USS A;  3V7R A;  5D4S A;  4BXX J;  1B8I B;  2BVM A;  3HSE A;  3BR5 A;  3OYD A;  1OR7 A;  3PSF A;  2OR1 L;  3R60 A;  2X6O A;  2QBY B;  1SAU A;  1T98 A;  3FWE A;  5E8G A;  5GTI C;  1I6H J;  5LBQ A;  2FJ1 A;  1JUS A;  2L02 A;  4LFU A;  2A6H F;  3ZMZ A;  3DKX A;  4PGH A;  3OKZ A;  3MZH A;  3LA7 A;  3H5A A;  1JGS A;  1POG A;  3ZHM A;  1R4M B;  4M3E A;  1MBF A;  3O2P E;  4NC7 A;  4BKX A;  1ZRE A;  2WUS R;  1PRA A;  2K4B A;  2LK2 A;  2X9D A;  2LKP A;  3HUG A;  5J3L A;  3F22 A;  4XOP A;  1A5J A;  1WJA A;  1R22 A;  2A5W A;  4XID A;  5FB2 A;  3AG2 H;  2A07 F;  3F8M A;  3I4P A;  2R7Z J;  1ZYR F;  3H1C A;  5DS9 A;  2XVC A;  3HDD A;  5DM6 F;  3FHZ A;  2PMH A;  1HW5 A;  1JKQ C;  3CC2 I;  4BU2 A;  1DPU A;  1X19 A;  3KEY A;  2DYS H;  3ZQF A;  2LYQ A;  1S7E A;  2RDP A;  1CGP A;  1JJ8 C;  4B47 A;  3M8J A;  4XKC A;  3LOC A;  5KAI C;  2E5Z A;  4WXD A;  4E7H A;  3WTW C;  4BQN A;  2ZJ2 A;  2Q8K A;  1HOM A;  1LVK A;  2QQ8 A;  1QO0 D;  1O3R A;  1RET A;  3PUB A;  2HU9 A;  2B0L A;  1YE9 A;  3DM5 A;  3OS1 A;  1NK3 P;  3SCH A;  1YJ9 I;  2XGD A;  4R79 A;  3S8Q A;  2QCO A;  3I4N J;  4GRI A;  5K1Y A;  5DTD A;  1OLT A;  2VOO A;  2QZ8 A;  4XON A;  4CSW A;  3TO7 A;  1OMI A;  5AIQ A;  2LP0 A;  4MO7 A;  4Z2Y A;  2WAE A;  1R36 A;  3RQ4 A;  5FKM A;  1P4A A;  2XGX A;  2DXI A;  3VFZ A;  4HV6 A;  3TEL A;  3LQQ A;  2FXA A;  4IKF A;  3TW6 A;  3IV5 A;  1IXS B;  1POU A;  2KDO A;  2BJC A;  1R5I D;  5HOD A;  3BDD A;  2VPL A;  5DTR A;  5J47 A;  4YG2 F;  1QVT A;  2BXY A;  1FIA A;  2K86 A;  3A9Z A;  4BDY A;  3HYI A;  2IXS A;  5JHU A;  4Y4R A;  2A5Y B;  3BLY A;  5J4V A;  3GCM A;  1WFX A;  2GAU A;  2K27 A;  2W82 A;  3F21 A;  4YBA A;  5K5Q A;  1ON1 A;  3ME5 A;  3ZMD A;  1ON2 A;  1B59 A;  1OQY A;  1FP2 A;  4KYW A;  2QWW A;  5B3S H;  2CV1 A;  3GBG A;  5A2Q Z;  3L2Q A;  2R0Q C;  1BR1 A;  1MSE C;  5KK1 A;  3HB9 A;  1EA3 A;  1RKW A;  1MIJ A;  2OCE A;  3OMY A;  1B72 B;  2BNN A;  3WOD F;  2AXZ A;  3B7H A;  4MIM A;  2JJ7 A;  1QQA A;  2K9Q A;  4BE0 A;  1Z6R A;  2HKX A;  4EJO A;  4M3F A;  4JQD A;  2PUF A;  4G9Y A;  4KIT B;  2HQR A;  1XSX A;  3IH3 A;  5BPI A;  2MSY A;  4UUS A;  4RM3 A;  5DTM A;  4G6T B;  1TT0 A;  4LMY A;  3PNV A;  3M9L A;  2XKO A;  3VWB A;  2H6B A;  2HXO A;  2DOA A;  5LFA A;  3E6C C;  4I76 A;  5AIP A;  3UR3 C;  3ZKC A;  2X1E A;  4ON0 A;  1IDY A;  3MD2 A;  4X4G A;  3EQL F;  4PJJ A;  2V9K A;  2VKV A;  1BA5 A;  2JA5 J;  4A3F J;  3JXB C;  1HSJ A;  1BI1 A;  1B9M A;  1LDJ A;  3JSO A;  1MJ9 A;  3I4M J;  1Y7Y A;  3OL3 A;  5CJ9 A;  4EJW A;  1TQP A;  3PJR A;  1SVO A;  1HC8 A;  2JPC A;  2VKH A;  1FSH A;  3BTC A;  1OCR H;  3J7Z I;  2KQR A;  2ZKZ A;  2XAF A;  4RM2 A;  5B66 C;  2PJR B;  3MMY B;  5IT3 A;  4V19 K;  4XLA A;  4RLF A;  5J8F A;  1MD0 A;  1W36 D;  3HM5 A;  3UNG C;  3TBI A;  5IPA A;  2FEZ A;  5H2F C;  3ERE D;  2JA8 J;  2V9P A;  1ZGA A;  2FMY A;  2R63 A;  2DAO A;  1B0N A;  4K2E A;  1D1A A;  3I5U A;  4L9T A;  4DNC A;  1ZLJ A;  1QNT A;  3QYE A;  1T39 A;  3JR9 A;  4ZYE A;  2LF7 A;  2JUG A;  3MQ0 A;  5K5R A;  2UZK A;  3L00 A;  1DDN A;  4X4F A;  4ZYA A;  3HIF A;  2EFW A;  1FOK A;  2PG4 A;  2DDB A;  1BJZ A;  3M07 A;  1B6A A;  4FX0 A;  3HRU A;  4LLG F;  2HI3 A;  3QPH A;  5E1W A;  3MN2 A;  1MDM A;  2L9R A;  4C30 A;  3MCZ A;  2CRG A;  4XLN F;  2NVT J;  1ETX A;  2IBD A;  5GP9 A;  1IRX A;  2Y48 A;  4BL0 B;  2HWV A;  2LG4 A;  4XKV A;  1Z3X A;  4EMS A;  3DNV B;  3Q9S A;  3L2C A;  1FJL A;  3KEO A;  2W84 A;  3LSK A;  2KJB A;  4BAY A;  1ONV A;  1YYV A;  3NEU A;  3TED A;  3HOT A;  1J75 A;  1DP7 P;  4MCX A;  2GXB A;  5GAE J;  3BOQ A;  5E18 F;  2CV0 A;  4PDK A;  1YSE A;  4IHS A;  4LIU A;  2E1O A;  1OFC X;  1S29 A;  4BNC A;  1I50 J;  3F72 A;  2J5O A;  1Y8R B;  4Y52 J;  3OWT A;  1FTZ A;  4EM2 A;  3HOS A;  4CUG A;  4XOT A;  1IV6 A;  2XXP A;  1FOY A;  1DUL A;  4QSH A;  4HLY A;  4IRI A;  4WXC A;  4UVA A;  2EFQ A;  2KKO A;  2WAF A;  1QB2 A;  4DBQ A;  3WTZ A;  2JQE A;  2M0M A;  4BE1 A;  1MJB A;  3FYM A;  5K7Z A;  3CJN A;  1UAA A;  3G1O A;  4ETS A;  2FSW A;  1P4X A;  1GV2 A;  1U2W A;  2EIJ H;  2O03 A;  4KIF A;  4BEH B;  3OYL A;  1NK2 P;  3V7S A;  2EF8 A;  2LFB A;  2QKL B;  3FDY A;  1ZZB A;  1KQ9 A;  3LSJ A;  5D8L B;  4I8T A;  4EZI A;  2L0K A;  1TTY A;  2N8G A;  5DUI A;  2MLG A;  4C2M J;  3GTO J;  4ESJ A;  2M9H A;  4A0Y A;  2K9N A;  2AXT C;  2O7O A;  2HSG A;  1FLI A;  1OCT C;  2R5Y A;  2E35 A;  3WU2 C;  3BWG A;  3SDG A;  4IWR A;  4CCK A;  3G73 A;  5CVV A;  5D6E A;  1Z91 A;  1JFT A;  4KJZ A;  1NH3 A;  5HLI A;  1H9T A;  3JCU C;  1N25 A;  2XRL A;  3PQJ A;  4A3E J;  3WE3 A;  4FBI A;  1DUX C;  4HA8 A;  4HF2 A;  1J0R A;  1FWZ A;  3COA C;  3L1P A;  4KDP A;  2CW7 A;  4AD9 A;  2IVG A;  3F3X A;  3O6B B;  2BEO A;  4CYD A;  2CFO A;  1TQM A;  2Y30 A;  2FNP A;  4BY7 J;  2XV4 S;  3PFY A;  1WH7 A;  2OA4 A;  3CZ6 A;  3QPS A;  4EAT A;  5TRD A;  1K6O A;  4XRS G;  3LSP A;  2IGK A;  2FBI A;  3HOX J;  2DA1 A;  4A2U A;  3QAH A;  2L9V A;  5K5O A;  4MQV A;  2B63 J;  2OUM A;  3KFW X;  2Y0S N;  4Q4Z F;  3N05 A;  4WK8 F;  4P9F A;  1S8N A;  1WPK A;  2HNH A;  2RC4 A;  2EPF A;  1BR4 A;  2DFH A;  2PE5 A;  4QLC U;  1JT0 A;  2H09 A;  5F27 A;  3EPZ A;  4A6D A;  4A6E A;  5LD2 C;  1W0U A;  3PL8 A;  3BG7 A;  2M4K A;  2QUF A;  2JRT A;  5F08 A;  3LAJ A;  4NQW B;  1IXC A;  2DA7 A;  3V8K A;  4JOM A;  3QWL A;  1BBY A;  1AHD P;  1APL C;  1QZX A;  2OTJ I;  3GME A;  1S5L C;  3P5J A;  1U5T C;  3GZ6 A;  2KIM A;  3GLL A;  3SZP A;  2EIL H;  4YAR A;  1T0F C;  4BQA A;  1WSU A;  2DOF A;  2DQL A;  5D5V B;  2MXD A;  1S9H A;  5HDK A;  1MBJ A;  1F1Z A;  3CUQ C;  5EZG A;  3DV8 A;  3TP3 A;  3VK0 A;  1VZ0 A;  4KIG A;  3TL4 X;  5EG0 A;  3S1Q J;  4F3Q A;  1HKT A;  3TRB A;  1BN5 A;  2ZME C;  3S3M A;  4M9X A;  3DEU A;  3A01 A;  4XNF A;  4Y33 A;  4A3C J;  2GOX B;  5L3F A;  1ETY A;  1T95 A;  2HS5 A;  2HCS A;  2WV0 A;  2O61 A;  4HF0 A;  2OF7 A;  3GEZ A;  2L7K A;  2E1M C;  2FBH A;  4LB5 A;  3V4G A;  2R7T A;  3G71 I;  3REO A;  4XLP F;  2MEZ A;  3MVP A;  4L0Z B;  3FXM A;  1OPC A;  1FMW A;  1IGN A;  4XRF A;  4NC6 A;  2Y9Y A;  2R92 J;  4X6A J;  3S8P A;  1BDH A;  4RAY A;  4NDL A;  2VI6 A;  3IKV A;  2JWT A;  1NW3 A;  4DYR A;  2OC6 A;  2VB6 A;  1IJW C;  1PUF A;  1N77 A;  3HRT A;  1R49 A;  4O8B A;  2YR2 A;  1XS9 A;  2QQ9 A;  2MD0 A;  1D1B A;  1YHQ I;  5KAF C;  2GZW A;  1Y8Q B;  5H20 A;  4ER3 A;  4PUS A;  1L1M A;  3B6A A;  2FUG 2;  4GGG A;  3GZC A;  2AUW A;  3FK6 A;  3L2U A;  4ENM A;  1BC8 C;  2EFN A;  3GXO A;  1U2Z A;  1LQ1 A;  3PFI A;  1S3J A;  1MBG A;  5FGM A;  2PIJ A;  1XMA A;  2DOE A;  3MFK A;  4PJ0 C;  1QA6 A;  1UHS A;  2JTV A;  3CME I;  3BR2 A;  3GVA A;  3I0T A;  3WTX C;  1HW2 A;  1QRY A;  3GWZ A;  4E7K A;  1XMX A;  1Q1H A;  1NHA A;  4XSZ F;  1HCR A;  1N78 A;  4GCV A;  1R7J A;  1QHG A;  4EK9 A;  2UV1 A;  2EFO A;  4CDG A;  1WQ2 A;  2ZXW H;  4BJ6 C;  4UUT A;  3MEJ A;  3OMT A;  2XSJ C;  2DTR A;  2UUZ A;  1WIZ A;  4XSX F;  2R7D A;  3A4C A;  4OU0 A;  5TJJ A;  2GA2 A;  4WF2 A;  2DYR H;  3D1N I;  2JVH A;  3FM5 A;  4CXF A;  3CJT B;  4DYC A;  3LWF A;  2W24 A;  3LST A;  1D8K A;  4PU3 C;  1ZZ8 A;  4AIK A;  3HG9 A;  2HYG D;  2OZ6 A;  3C2B A;  5IYB J;  2R1J L;  4LG0 A;  3TP0 A;  4RGX A;  1SVM A;  1QU3 A;  2JK3 A;  2V6C A;  1HQ1 A;  1LCD A;  2PUA A;  2MC4 A;  4MNU A;  1JTX A;  2ME0 A;  4IXA A;  4Y42 A;  2PXQ A;  2LNM A;  2AQE A;  2K02 A;  3ASN H;  3BG6 A;  4JCX A;  4A3I J;  1O3Q A;  3LNQ A;  3VYU B;  3ABM H;  2E1N A;  2IVQ A;  4IVZ A;  3VPR A;  2LYS A;  2V9V A;  1A36 A;  3MKY B;  1RC9 A;  1ETQ A;  1UXD A;  3LSI A;  2DI3 A;  3WTS C;  3RPQ A;  1R63 A;  3JRB A;  4LD5 A;  3H3Z A;  1Z3Y A;  3WU0 A;  2P5L C;  2RV8 A;  1HKQ A;  2ME6 A;  3KP4 A;  1GVJ A;  2CU7 A;  1FSE A;  2DK8 A;  3EDP A;  3GZN B;  4DIQ A;  2YS9 A;  1WJF A;  4J01 A;  4HG2 A;  5EGO A;  1LJ9 A;  1W4M A;  3JW4 A;  4XN0 A;  3ZPL A;  3GFM A;  2CJJ A;  2P7C B;  1QQB A;  3HGG A;  4HDU A;  3Q5F A;  4XK4 A;  2ELK A;  3F0C A;  3CO6 C;  5FKO A;  3HTU A;  4I99 C;  2XHK A;  1H8A C;  1EFA A;  2ESH A;  3DTE A;  2BNM A;  1HQC A;  3K1N A;  2QSG X;  2QVO A;  1BIB A;  3KZ3 A;  1I1G A;  3S2W A;  3DCF A;  2DCE A;  2ZO4 A;  3Q0W A;  1YS6 A;  1VQL I;  3BT9 A;  3PNT A;  2Z1D A;  2RKH A;  4JP0 A;  3G1L A;  5H6Q A;  1SD5 A;  3IUO A;  1SD4 A;  2D45 A;  2P81 A;  2UWM A;  1VND A;  1RIO H;  1Z6T A;  3CF5 F;  2VXZ A;  1IRF A;  3NDB B;  1OYW A;  4QWQ A;  2EA2 A;  4BAC A;  1H9G A;  3BD1 A;  3ONQ A;  4I02 A;  2PXV A;  3BQY A;  2M4G A;  2XIG A;  3I54 A;  2R7O A;  4D7N A;  2JCG A;  3RDI A;  3ZHI A;  4IHX A;  5ILV A;  2G0E A;  4RAF A;  3FMR A;  4UUS B;  3M7G A;  3G0T A;  3CCR I;  1JXS A;  4RAG A;  4UVB A;  5LEK A;  3IWZ A;  1QZY A;  3H5N A;  3R0J A;  1FP1 D;  4KIC A;  4HQE A;  2LYP A;  4ENJ A;  1LEA A;  1T08 B;  1BJA A;  2CRO A;  1YW9 A;  2DMQ A;  4G94 A;  1RPW A;  3QFI A;  4M3G A;  5B1B H;  5KVR A;  1HKS A;  4ZYH A;  2K5C A;  4IX7 A;  2I5U A;  2LBF A;  3CP8 A;  1ZG5 A;  2A6C A;  3QQ6 A;  3L9F A;  1ZR4 A;  1XTA A;  1JHF A;  1ZRD A;  2NVX J;  3QYF A;  1UEL B;  3ZQG A;  4B48 A;  2QSH X;  3TDU C;  2K9M A;  4X4D A;  4U87 A;  3IKT A;  1ETK A;  3IRQ A;  3OSF A;  1WJ5 A;  5LHI A;  2WC2 A;  2ZNY A;  3TMO A;  5D5W B;  2VLA A;  3QU6 A;  3FMQ A;  2BY0 A;  2R4G A;  2VQL A;  3AL0 C;  2ZXH A;  4WVL A;  3A02 A;  1A6Q A;  1FEX A;  1REP C;  5GAH J;  3E1S A;  1CF7 B;  1HST A;  3LFP A;  2V3C C;  2QLZ A;  5DV5 A;  2YUS A;  2P4W A;  1AKH A;  3SZG A;  1ZAO A;  2DA3 A;  3HOU J;  4HF1 A;  2HQ5 A;  1MZB A;  5EEG A;  3IRR A;  3MEX A;  5LRR A;  2JT1 A;  4YEL A;  4C3H J;  2H94 A;  3JXD L;  4E7L A;  2NS7 A;  1QGP A;  2AO9 A;  3E6D A;  3BZ6 A;  3KZI C;  3AG3 H;  2L54 A;  2ZNZ A;  1QPZ A;  3ZN1 A;  3BTI A;  1RPE L;  3CLC A;  1CJG A;  1YO5 C;  4OOI A;  2EBY A;  2COM A;  3G5G A;  2MYS A;  2JVG A;  2WAD A;  5F04 A;  1QBJ A;  3LSH A;  5TIS C;  5HS7 A;  5J1U A;  1FZP B;  4UUV A;  5DEQ A;  3RJP A;  1MDM B;  4IA8 A;  1D5Y A;  4I6U A;  3QU3 A;  4UV9 A;  1WI9 A;  2XRN A;  3BZK A;  2GOM A;  3OOU A;  4XL9 A;  2PPX A;  4N9I A;  1KU2 A;  2IS6 A;  1K83 J;  1DU0 A;  1MGT A;  2HYJ A;  2GWR A;  3FM3 A;  3TO6 A;  3KLO A;  3I53 A;  1FMV A;  2OAZ A;  1W1W E;  2L49 A;  2FRH A;  2XCJ A;  4A93 J;  4A3J J;  3FXL A;  3H35 A;  2JN6 A;  2JSC A;  1XN7 A;  3QPT A;  2JPB A;  5L3B A;  4YIF A;  3SCG A;  3L2R A;  1U5T A;  2KZ8 A;  4YIR X;  2LYC A;  1MBH A;  1T0F A;  3KP5 A;  3K4K A;  4FAS D;  2LY1 A;  5C4X J;  3R1F A;  3DP7 A;  2VQG A;  3D5L A;  4XN3 A;  3S15 J;  2ODR D;  2KJC A;  3CUQ A;  3FXR A;  3PIP F;  2NRA C;  1ZZC A;  4NB5 A;  1J2X A;  4I0B A;  2KRH A;  3AKZ A;  1Z77 A;  1J59 A;  1Y9Q A;  5GPA A;  4KMF A;  2QGU A;  4PCQ A;  2K9S A;  2E2I J;  1P7J A;  1IUY A;  2F4O B;  2XPU A;  2ZME A;  1SC7 A;  2DJN A;  2M7A A;  2F48 A;  2PMU A;  1GV5 A;  3BR0 A;  3GZ5 A;  4KT5 C;  4KNY A;  4A5M A;  3HEF A;  5DYM A;  3BG3 A;  2Z9O A;  4ANJ A;  4LLL A;  1BL0 A;  1NTC A;  5LHG A;  2WAQ A;  4XLC A;  1XWR A;  2IS4 A;  4XR6 A;  4JYK A;  2DT6 A;  3OQO A;  4YFN F;  1BR2 A;  5KCM A;  4F92 B;  2YU3 A;  5EJC A;  5FD6 A;  2DA6 A;  3BR1 A;  3SQN A;  2R5Y B;  5CVU A;  2CUE A;  2QM3 A;  5DUK A;  2ICT A;  4E70 A;  2IP2 A;  1YX5 A;  3D5S C;  1F43 A;  2RNG A;  3WG7 H;  4NBQ A;  4XIC A;  5E3M A;  2CQQ A;  4OAZ A;  5K7F A;  3FBI B;  2CSO A;  3T8R A;  1I3Q J;  1BOB A;  3WE2 A;  1MND A;  1LB2 A;  3ULQ B;  5IP9 J;  3S16 J;  4WX9 A;  3S2H J;  1VFC A;  1MSF C;  1BM9 A;  1PVE A;  3BS3 A;  3MAJ A;  3WTU C;  3IP4 B;  2M2E A;  2V4J C;  2NVU B;  1BIA A;  3WHC A;  3BR3 A;  4BYY A;  1MBE A;  1FPQ A;  1UHM A;  5IY5 H;  2KZG A;  5HOO A;  3W6V A;  2VE9 A;  3ZQH A;  3CCY A;  3CJR B;  2Q2E B;  5E17 F;  4ZC3 A;  4LIV A;  2E60 A;  4S05 A;  1RES A;  1D0Z A;  2AW6 A;  3K4B A;  2VKD A;  1ZS4 A;  2W1O A;  5KHD A;  4X4I A;  1BW5 A;  4BJT A;  3N4M A;  1KQ0 A;  3H92 A;  1PNR A;  2PXK A;  4I09 A;  1Z9C A;  1WVR A;  3AG4 H;  1ZTR A;  3DBL B;  3KEQ A;  1K4S A;  1OCO H;  3LMM A;  4NUB A;  4D5C A;  3G6E I;  2M3A A;  4PK4 A;  3K70 C;  1W5S A;  2EZL A;  4F52 A;  1WH5 A;  2AWI A;  2BXZ A;  4B09 A;  2GIV A;  2PXL A;  2FQ3 A;  4AVP A;  4IHY A;  4EM0 B;  3SDB A;  3ZQ7 A;  5EG0 B;  2FX0 A;  1TBX A;  2E7W A;  2ICW G;  3ZPX A;  4B3A A;  4I6T A;  3H5T A;  3K4L A;  3FZV A;  3O3K A;  4A69 C;  2KT0 A;  2GA1 A;  3A01 B;  3K9T A;  5EEA A;  5CLS A;  3VEP A;  2F5F A;  4FE4 A;  1KON A;  2XC7 A;  3FMS A;  3JTH A;  5JHF A;  1T6S A;  4A12 A;  2L3D A;  4HDV A;  3ZQC A;  3LA3 A;  2NYX A;  5F1J A;  3LFU A;  3JSP A;  1IRZ A;  4BE2 A;  1MMA A;  3K7A J;  2ETH A;  3ZQL A;  2ZXJ A;  1YX3 A;  2EIN H;  2CUJ A;  2R7F A;  3OIP A;  1FYL A;  2IUO A;  1PRV A;  1OSL A;  5IP6 A;  2V1X A;  4U88 A;  4BHC A;  4GQM A;  3RZO J;  3E6B A;  2ZJQ F;  3CC7 I;  1YQA A;  4KIB A;  2JVL A;  1E3H A;  1R1T A;  4KIS A;  4IPA A;  1XDS A;  2FJR A;  4A3K J;  5EZH A;  1PRU A;  1RZS A;  1SVL A;  2XAH A;  3JRA A;  2VJ5 A;  4G6Q A;  3U21 A;  5L3D A;  1ZZ6 A;  1N75 A;  4BDZ A;  3PO2 J;  4MEX F;  1G4D A;  1A04 A;  2VAS A;  5IT9 K;  4DJA A;  3HRM A;  4XLH A;  1DU6 A;  2DFE A;  3V7C A;  1NG7 A;  4ESB A;  2L7M P;  2M45 A;  1WJE A;  3A9X A;  1B1B A;  1PER L;  3IH2 A;  1XPX A;  2M34 A;  4D0P A;  2KIQ A;  4I6Z A;  1Y0U A;  4KT6 A;  3M3Y J;  2PUC A;  3RYR A;  2XAQ A;  3ECO A;  5M5Y J;  4I2O A;  1HXD A;  1LQC A;  5DDG A;  2PUD A;  5CQG A;  4LOC A;  1CQT A;  2MH2 A;  4KUM A;  1I3A A;  1XG1 A;  3IH4 A;  1W5T A;  2IAI A;  3BG9 A;  3V42 A;  1JE8 A;  4G7O F;  4Q5S F;  2L8N A;  2OV7 A;  1XSV A;  4UB6 C;  3TOB A;  2EZH A;  4IQJ A;  1RI7 A;  2O8K A;  3WG9 A;  2L2O A;  1OCC H;  1TQI A;  2R93 J;  1VPW A;  1GUU A;  5FRO A;  1IRG A;  2BNO A;  3SYT A;  4Z58 A;  1UST A;  3Q9V A;  5DCF A;  1VQO I;  4MEY F;  3ZRG A;  4X4E A;  2FML A;  4H0E A;  1R23 A;  4CA0 A;  1QPM A;  1LDD A;  2ZCW A;  5HNF A;  3OWQ A;  3HZI B;  2V1N A;  2WV1 A;  3CDL A;  4E7J A;  2QKM B;  4BS9 A;  5L3C A;  4L18 B;  4DW6 A;  2A6E F;  1D8J A;  2CG4 A;  1XDU A;  1O7F A;  2VN2 A;  3OYN A;  5A7L A;  5D5X B;  5FLM J;  4P1W A;  3LIS A;  2Z16 A;  1ENH A;  4RB0 A;  2KDZ A;  1YIJ I;  3DLA A;  1ZKG A;  1RZR D;  3NWS A;  4RGR A;  4OIO F;  1LMB 3;  2VQH A;  2R7V A;  2HDD A;  3M1C A;  3MWM A;  3JRE A;  4MQ9 F;  3BY6 A;  3W6K B;  3FKI J;  4PU8 A;  4B43 A;  1KU9 A;  3D5R C;  4B4C A;  1O3T A;  3CC4 I;  3TKY A;  4P5O A;  1VQN I;  2F5E A;  3I3L A;  3K6G A;  4M6V A;  2FOW A;  3E97 A;  4FE7 A;  2K4J A;  2P5K A;  4P96 A;  2ZFU A;  5FRN A;  3MKL A;  1Z7U A;  2Y0M A;  5E79 C;  2H1K A;  2KZV A;  4ZDO A;  3FF5 A;  2EZI A;  4Y3O A;  2KLO A;  2CUZ A;  4G6D A;  5F64 A;  1A6I A;  2ZB9 A;  1P9Q C;  1XCV A;  1JTY A;  3DKW A;  2X6X A;  2RGV A;  3GUD A;  5GAD J;  1Y56 A;  3CMY A;  1JUP A;  4J1X A;  4IO9 F;  4XMY A;  2FOK A;  5DD4 A;  4HX4 A;  3OYJ A;  2G9W A;  4CZZ A;  2IVB A;  4X4H A;  2L9N A;  1O7L A;  1T38 A;  2Z3Y A;  4BHP A;  1IN6 A;  2WTE A;  3OR1 C;  3BDN A;  2F6C A;  3C18 A;  2BHY A;  4N9H A;  3DU6 A;  1FOX A;  1DGW Y;  3DPL C;  1ZR2 A;  4A3L J;  2HR3 A;  1TL8 A;  1ERD A;  4D1Q A;  2DMP A;  3HHG A;  2GXA A;  2A3S A;  2ZSI B;  3PM1 A;  4BBR J;  1WJC A;  3KP7 A;  3BZC A;  2LH9 A;  2EWT A;  2E2J J;  2CS3 A;  2ECB A;  1V5G A;  1RZR A;  1XCB A;  5IT9 Z;  1J5Y A;  3RTR A;  3NRV A;  1RKT A;  1D3Y A;  5HNH A;  3KL4 A;  5GAG i;  1O3S A;  1PP7 U;  4XLF A;  3HSR A;  5IOZ A;  2IEK A;  2LYJ A;  2O38 A;  1W7P B;  4OIN F;  2XI8 A;  1SFK A;  1HW1 A;  1ZGJ A;  5F0F A;  4A0X A;  4S04 A;  5FD5 A;  5ED4 A;  3KP6 A;  1ZAY A;  4HNV A;  2RRE A;  1W0T A;  5JVG F;  2ECC A;  3J7A Y;  3FXK A;  3H9J A;  1O57 A;  3CUO A;  3VYT B;  1YIO A;  2VIX A;  2L5Q A;  3L2V A;  2CW8 A;  3IAS 2;  3GTJ J;  5M5W J;  2DLL A;  2V1D A;  3ABT A;  3CCU I;  1VF9 A;  3QQA A;  1Z1D A;  2XUB A;  2VE8 A;  3LA2 A;  4A5N A;  3OYE A;  3CCQ I;  1RR8 C;  1MJA A;  2VOP A;  1L3L A;  2LBF B;  1VQ9 I;  1Y6I A;  3CCS I;  3EUH C;  1Q1V A;  4CCM A;  4AIH A;  5DCM A;  3H9Q A;  4C2T A;  4M74 A;  4OMZ A;  3EUK L;  3OL4 A;  1QZE A;  1QQI A;  5ICF A;  5HLG A;  3SFZ A;  4B8X A;  4RA2 A;  4KN7 X;  2V26 A;  1R00 A;  3X2Q H;  4W1U A;  3K70 D;  1H89 C;  4WXH A;  4XKW A;  3GZD C;  3LFK A;  4PU7 A;  1IW7 F;  2P7V B;  3OY9 A;  2EBI A;  2HIN A;  5TGT A;  2HKO A;  4N4N B;  4YFK F;  4HEA 2;  3HOW J;  2DW4 A;  1WRJ A; 
#chains in the Genus database with same CATH homology
 1EFA A;  2BNM A;  3ZHM A;  4M3E A;  3OIO A;  1MBF A;  1BDI A;  1U78 A;  1ETV A;  4BKX A;  3JRH A;  1PRA A;  3DCF A;  2WUS R;  3KZ3 A;  2LK2 A;  3Q0W A;  3S17 J;  2X9D A;  2O4A A;  2GRL A;  4Z59 A;  1F36 A;  3BT9 A;  2AXU A;  2EH3 A;  1JUM A;  2COB A;  5J3L A;  4JP0 A;  1FTT A;  2FD5 A;  3G1L A;  4ABZ A;  1A5J A;  4DZJ A;  4XID A;  2P81 A;  1WI3 A;  1VND A;  2R7Z J;  4W97 A;  4YG7 B;  5DS9 A;  2R5Z A;  3HDD A;  1WH6 A;  3BD1 A;  4I6R A;  1JKQ C;  2ICP A;  3BQY A;  3ZQF A;  4D7N A;  2LYQ A;  1S7E A;  2JCG A;  2XIU A;  1JJ8 C;  1Y1V J;  2JMW A;  1NEQ A;  2AXV A;  3ZHI A;  4IHX A;  2G0E A;  3LOC A;  4Z5C A;  4UUS B;  1B72 A;  3H0G J;  1HOM A;  4JCY A;  2LTP A;  3KJX A;  1RET A;  2LYP A;  3SCH A;  1NK3 P;  2WB1 N;  2XGD A;  1WGX A;  2Y2Z A;  2XJ3 A;  3S8Q A;  2CRO A;  3RZZ A;  2QCO A;  3I4N J;  5E3O A;  1TWF J;  2XGC A;  2DMQ A;  5DTD A;  5EF6 A;  1RPW A;  4M3G A;  5EGO B;  2LP0 A;  2A6C A;  3QQ6 A;  1ZR4 A;  4CYC B;  4MO7 A;  2NVX J;  5E3L A;  2IU7 A;  3ZQG A;  4OB4 A;  3A03 A;  5FKM A;  2DA5 A;  1X2N A;  3HOZ J;  4X4D A;  1ETK A;  1B8I A;  3OSF A;  3GTQ J;  1JH9 A;  3TW6 A;  3IV5 A;  1JT6 A;  1POU A;  2H8R A;  1HF0 A;  2BJC A;  5J1R A;  1U9N A;  2OFY A;  5FKK A;  5HOD A;  3S14 J;  4GHJ A;  1QVT A;  1LFU P;  2EZK A;  1UTX A;  3A02 A;  2M8G X;  1FIA A;  3BR6 A;  2JA7 J;  5C44 J;  1FEX A;  1QP0 A;  3LFP A;  3JRC A;  4RBO A;  5FJ8 J;  1WCM J;  2YUS A;  1AKH A;  1IUF A;  3HOU J;  2DA3 A;  1NER A;  4YBA A;  1JJ6 C;  2HQ5 A;  4MCT A;  4C3H J;  4S0H B;  4IEJ A;  3JXD L;  2NS7 A;  2AO9 A;  3QF3 A;  1QPZ A;  4L5E A;  3BTI A;  2ID6 A;  2W48 A;  3GBG A;  2XB5 A;  1RPE L;  3CLC A;  2R0Q C;  1CJG A;  3CRO L;  2EBY A;  1MSE C;  1UMQ A;  3HB9 A;  3G5G A;  1R69 A;  1RKW A;  1B72 B;  2BNN A;  1IC8 A;  5F04 A;  2AXZ A;  2XGE A;  5J1U A;  3B7H A;  4MIM A;  2JJ7 A;  1QQA A;  2B5A A;  2K9Q A;  4DZP A;  1D5Y A;  4IA8 A;  1U9O A;  4I6U A;  2KEK A;  3OOU A;  2PPX A;  4M3F A;  5EYR A;  4JQD A;  2PUF A;  9ANT A;  1K83 J;  2GM4 A;  2XSD C;  3IH3 A;  1DU0 A;  2MSY A;  2HYJ A;  4UUS A;  2DA2 A;  1GDT A;  2CSF A;  3S1N J;  2L49 A;  2XCJ A;  4A93 J;  4A3J J;  5FKL A;  2JN6 A;  3HBL A;  2HXO A;  5M3F J;  3SCG A;  2TRT A;  2KZ8 A;  4I76 A;  1EF4 A;  3ZKC A;  1MBH A;  1IDY A;  4Z5D A;  4X4G A;  5C4X J;  4BBS J;  2VKV A;  4Y7N J;  3R1F A;  1BA5 A;  2JA5 J;  2XB0 X;  4A3F J;  3JXB C;  2GRM A;  3S15 J;  4CYC A;  3QYX A;  2DA4 A;  1ZZC A;  1TWC J;  3I4M J;  2LYL A;  1Y7Y A;  4EEF G;  1Y9Q A;  1Z77 A;  3KXA A;  5GPA A;  2K9S A;  2E2I J;  1P7J A;  2RAE A;  3Q0U A;  1G2H A;  2XPU A;  3E7L A;  1ITY A;  1T33 A;  4JX4 A;  2DJN A;  3CQZ J;  3OSG A;  3BTC A;  3SJM A;  5GPC A;  1GV5 A;  2M0C A;  3BR0 A;  3HEF A;  2LR8 A;  3BG3 A;  3GTG J;  1BL0 A;  1NTC A;  3HM5 A;  5IPA A;  2JA8 J;  2KPJ A;  1XWR A;  4JYK A;  2R63 A;  2KEJ A;  3OQO A;  1ZUG A;  1B0N A;  1LFB A;  2ID3 A;  1GT0 C;  2DA6 A;  3BR1 A;  4AC0 A;  1MNM C;  2R5Y B;  3JR9 A;  4C3I J;  2CUE A;  2ICT A;  1F43 A;  4X4F A;  3OQM A;  3GN5 B;  5E3N A;  1H88 C;  2E19 A;  4XIC A;  5E3M A;  3LSG A;  2CQQ A;  1BJZ A;  5K7F A;  1FIP A;  1UG2 A;  1I3Q J;  2HI3 A;  4V2G A;  3BTJ A;  4G12 A;  3MN2 A;  1SAN A;  1R9T J;  2L9R A;  2LD5 A;  2CRG A;  3S16 J;  5IP9 J;  3JXC L;  2NVT J;  1YRN B;  1ETX A;  1LCC A;  3S2H J;  4QIW N;  1VFC A;  2IBD A;  1MSF C;  1OJL A;  3BS3 A;  5GP9 A;  1DW9 A;  2LY9 A;  3B6C A;  2M2E A;  4QTR A;  3DNV B;  3JRG A;  3WHC A;  3BR3 A;  1FJL A;  1MBE A;  1ZVV A;  3W6V A;  3TED A;  3ZQH A;  4MCX A;  5BNG A;  3CCY A;  3O8G A;  4RDU A;  1YSE A;  3GTK J;  1X2L A;  1RES A;  2E1O A;  1OFC X;  3SFI A;  3NAR A;  2QF7 A;  1I50 J;  3QPL A;  4JX6 A;  5M3M J;  2AW6 A;  4JX5 A;  4Y52 J;  1ZS4 A;  4X4I A;  1BW5 A;  1FTZ A;  5F0H A;  3F6W A;  1PNR A;  3OQN A;  2GZU A;  1IV6 A;  1ZTR A;  4A3M J;  4QSH A;  2DN0 A;  2XPW A;  3HGY A;  3HOV J;  4D5C A;  2X48 A;  3GTP J;  3O8H A;  5IOY A;  4MFD A;  4B1R A;  5IYD J;  3F51 A;  3FYM A;  2EZL A;  5K7Z A;  3G1O A;  1WH5 A;  1GV2 A;  2AWI A;  1XC5 A;  5FLV A;  3S2D J;  4IHY A;  1NK2 P;  4XRS A;  4A3G J;  2EF8 A;  5JLX A;  5EG0 B;  2HOT A;  2LFB A;  1SFO J;  3G7D A;  2FX0 A;  1ZZB A;  3LSJ A;  4I8T A;  4B3A A;  4I6T A;  3H5T A;  2L0K A;  2N8G A;  4A69 C;  2KT0 A;  3A01 B;  2PUE A;  4C2M J;  5EEA A;  3GTO J;  3MLF A;  2M9H A;  2K9N A;  4FE4 A;  3TW7 A;  2O7O A;  2HSG A;  1ZQ3 P;  1OCT C;  2R5Y A;  1HDD C;  5IP7 J;  2OPT A;  3SDG A;  4IWR A;  3ZQC A;  5F1J A;  1K61 A;  3RZD J;  1IRZ A;  1JFT A;  3GN5 A;  3K7A J;  4PU4 C;  2XRL A;  3ZQL A;  4A3E J;  1LLI A;  4FBI A;  1X2M A;  4J1W A;  3SCF A;  2IUO A;  1X58 A;  1PRV A;  1OSL A;  5IP6 A;  5C3E J;  4GQM A;  3L1P A;  2MGQ A;  4YG1 A;  3RZO J;  2IVG A;  1P7I A;  1O4X A;  4YG4 A;  3M4O J;  1YRN A;  2JVL A;  2E2H J;  2FJR A;  2Y30 A;  4BY7 J;  4A3K J;  5EZH A;  1PRU A;  1RZS A;  1WH7 A;  3JRA A;  3QPS A;  1T56 A;  4XRS G;  3LSP A;  2DTZ A;  2XPV A;  4X1E A;  3PO2 J;  3HOX J;  1ZZ6 A;  2DA1 A;  1IG7 A;  4DYQ A;  2GLO A;  1DU6 A;  2B63 J;  3IVP A;  4MLO A;  2CUF A;  2L7M P;  2Y0S N;  1PER L;  3IH2 A;  2M34 A;  1WPK A;  2JA6 J;  2PE5 A;  3ZQI A;  1TWA J;  4I6Z A;  1JT0 A;  5F27 A;  3M3Y J;  2PUC A;  4FIS A;  3RKQ A;  3BG5 A;  3BQZ A;  4IHW A;  2NOG A;  1W0U A;  2VUM J;  2KEI A;  3PXP A;  1QP7 A;  5M5Y J;  4XRM A;  1LQC A;  3DEW A;  3FMY A;  2EQR A;  5F08 A;  2PUD A;  1JWL A;  1ZK8 A;  1VI0 A;  1TWH J;  2DA7 A;  1AU7 A;  4LOC A;  1CQT A;  3O9X A;  1ZZ7 A;  1HDP A;  2LLK A;  1XG1 A;  3IH4 A;  3BG9 A;  1ETO A;  2IAI A;  1AHD P;  1APL C;  2L8N A;  2O49 A;  1DWK A;  1OCP A;  1ZGW A;  2EZH A;  4NDW A;  3HKZ N;  2O8K A;  4YAR A;  4FCY A;  1QP4 A;  2R93 J;  1VPW A;  1GUU A;  4X4B A;  3Q0V A;  2BNO A;  1MBJ A;  4Z58 A;  2VKE A;  2NVY J;  3LSR A;  5EZG A;  4X4E A;  3TP3 A;  3VK0 A;  5EG0 A;  3S1Q J;  3PO3 J;  3S1M J;  3TRB A;  2CQX A;  4IHV A;  3HZI B;  2D5V A;  2WV1 A;  1BW6 A;  3CDL A;  3NAU A;  3JRI A;  3A01 A;  4DW6 A;  1ETW A;  2I10 A;  1ADR A;  4A3C J;  2LCV A;  2MW8 A;  1ETY A;  5A7L A;  5FLM J;  1RR7 A;  4X4C A;  3LIS A;  4Z5H A;  2OF7 A;  1HLV A;  2PUB A;  1ENH A;  2KDZ A;  1RZR D;  1ZKG A;  4C3J J;  1LMB 3;  3G1M A;  2HDD A;  3JRE A;  1UXC A;  1QVU A;  4PU8 A;  3FKI J;  3MVP A;  2MEZ A;  4A3D J;  4B4C A;  3EUS A;  5F0C A;  1IGN A;  3FIW A;  1MBK A;  4M6V A;  4D7M A;  1U8B A;  4FE7 A;  3ZOB A;  1E3O C;  1JGG A;  2Y9Y A;  2R92 J;  3MKL A;  4V2F A;  4X6A J;  2H1K A;  1GVD A;  2HXI A;  2HOS A;  2YU9 J;  3H3V K;  4NDL A;  1X57 A;  1BDH A;  1WET A;  2VI6 A;  2JWT A;  4DYR A;  2EZI A;  2MG4 A;  3FIS A;  2NVQ J;  1IJW C;  1PUF A;  3GTL J;  2LYR A;  1A6I A;  2ZB9 A;  3GBF A;  4O8B A;  1JTY A;  1XS9 A;  4BY1 J;  2LKX A;  1JKR C;  2L7Z A;  3CMY A;  1JUP A;  1ORK A;  2PMZ N;  4J1X A;  1L1M A;  3B6A A;  1LE8 B;  2AUW A;  3FK6 A;  1MH4 A;  2VPR A;  1QPI A;  3JRD A;  2IVB A;  4X4H A;  2K40 A;  2PIJ A;  1MBG A;  3QWG A;  4D5F A;  4MFE A;  1UHS A;  3BDN A;  3BR2 A;  4J19 A;  1QRY A;  3JRF A;  3UKG A;  4FN3 A;  4A3B J;  1ZR2 A;  1HCR A;  1JKO C;  5K7H A;  2Y9Z A;  4M3B A;  4A3L J;  1Y1W J;  3K2A A;  2DMP A;  2PUG A;  3PM1 A;  4BBR J;  2NS8 A;  2EWT A;  4UUT A;  5C4J J;  3OMT A;  2E2J J;  2ECB A;  1MH3 A;  3UFD A;  1WIZ A;  1RZR A;  1SQ8 A;  1RKT A;  1JFS A;  2AHQ A;  2DMN A;  2R5Z B;  1JKP C;  2GBY A;  3D1N I;  3HOY J;  2TCT A;  1WH8 A;  2MQK A;  4F8D A;  5IOZ A;  2IEK A;  2LYJ A;  2IV1 A;  2O38 A;  2O9L A;  4DYC A;  2XI8 A;  2Y31 A;  3S1R J;  5IYC J;  3FK7 A;  4M3D A;  5F0F A;  4PU3 C;  1ZZ8 A;  4AUX A;  5M5X J;  5K98 B;  3OP9 A;  1ZAY A;  3C2B A;  4HNV A;  3F52 A;  5FKN A;  5IYB J;  4FTH A;  3TP0 A;  1W0T A;  2R1J L;  2ECC A;  2LYK A;  2JK3 A;  1LCD A;  2PUA A;  1ZPQ A;  2L7F P;  4Y42 A;  1JTX A;  2ME0 A;  3Q3S A;  4GFB A;  2DMU A;  2LVS A;  1PUF B;  4JCX A;  2WAQ N;  3GTJ J;  5M5W J;  4A3I J;  1RIO A;  1ZZ9 A;  3LNQ A;  3BTL A;  1Z0X A;  1VF9 A;  3QQA A;  2IVQ A;  4IVZ A;  3VPR A;  2LYS A;  1ETQ A;  4AYB N;  1UXD A;  3RQI A;  2DMT A;  1Q1V A;  2WIU B;  1R63 A;  5J1Y A;  3JRB A;  3FYA A;  3WHB A;  3U3W A;  2ME6 A;  1TC3 C;  4BXX J;  2CU7 A;  1B8I B;  3BR5 A;  1IDZ A;  2YS9 A;  3CEC A;  3GTM J;  2OR1 L;  5EGO A;  5JLW A;  2X6O A;  5EDN A;  1LE8 A;  1I6H J;  1TWG J;  2FJ1 A;  1JUS A;  2FQ4 A;  2CJJ A;  1H89 C;  4W1U A;  1QQB A;  3HGG A;  4PU7 A;  4XK4 A;  2EBI A;  2HOA A;  2ELK A;  3F0C A;  2HIN A;  5FKO A;  3HOW J;  1AKH B;  1H8A C;  1POG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...