1CQTA

Crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
134
Chain Sequence
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*CP*AP*AP*AP*TP*AP*AP*GP*G)-3')
publication title Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/dna
total genus 36
structure length 134
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1cqtA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1cqtA01
1XC5A 2DA2A 2K9QA 4O8BA 3HDDA 1PUFB 2JJ7A 2KPJA 3QWGA 3HOXJ 1RZRD 3CQZJ 1X2NA 3VK0A 4NDLA 3OP9A 3DEWA 1TWHJ 3ZHMA 2PUGA 2JWTA 2O8KA 3BR2A 4JCYA 1TWFJ 5EZHA 3GTKJ 2DMQA 1VPWA 1SFOJ 2PUDA 2XPUA 2LFBA 1ETOA 2NS8A 2AW6A 4X4EA 3ZQHA 2R93J 2Y2ZA 3LSRA 1POUA 2E2HJ 1FTTA 1PRUA 3IH4A 2R7ZJ 1BW5A 2R5ZA 2ID3A 3F6WA 4BY7J 4EEFG 3MLFA 3IH3A 1ZQ3P 1IDYA 3RKQA 1K83J 2M9HA 4GHJA 2NVQJ 2O38A 1ZUGA 4XK4A 4YARA 1ZZ9A 1OFCX 3JXDL 2L7ZA 1XG1A 1LLIA 1I50J 3HOZJ 1Z77A 5F04A 3KJXA 3G5GA 1QRYA 5K98B 1WCMJ 1FIPA 2M34A 5FLMJ 1H8AC 3OQOA 4IEJA 2HYJA 4MFDA 3LSPA 1QQAA 4JYKA 4AUXA 5E3MA 3K7AJ 2HSGA 3JRBA 3NARA 4JCXA 2LCVA 5GP9A 1UTXA 3Q0UA 1QVUA 1B8IA 2PPXA 5EGOB 2Y31A 3TP3A 2DA4A 1B0NA 4DW6A 5FKNA 2CSFA 2RAEA 5IYBJ 1B72A 1IC8A 3PO3J 2O4AA 1MBKA 4JP0A 2LKXA 3PM1A 1ZAYA 2XPWA 3QPLA 3RZZA 2PUAA 2EH3A 5IOYA 3S1NJ 3BTJA 1IG7A 2EBYA 1LE8A 4Z5DA 4IHYA 4AYBN 1IJWC 2DN0A 3PO2J 5JLWA 1JKRC 2H1KA 2VKEA 2PUCA 2WB1N 1RKTA 4C3HJ 3KZ3A 3S8QA 3HOWJ 4W97A 3IVPA 1JTYA 1WH6A 2IVQA 5FKLA 2NVXJ 3D1NI 1WH8A 1Y9QA 2JN6A 3HEFA 2DA1A 2K40A 2EZKA 1Y1WJ 4A3KJ 1ORKA 1SANA 4A69C 5IOZA 1ZZ7A 4JX5A 2JA5J 2NVTJ 2MG4A 3JRHA 2XIUA 3SCGA 1RKWA 4C3JJ 1ZR2A 4Y42A 3JXBC 2LK2A 5K7FA 4MCXA 1MBFA 2O7OA 2IAIA 1PNRA 2MQKA 5GPCA 2N8GA 4M3FA 2IV1A 2CJJA 5K7HA 1FEXA 1RZSA 1LCDA 4A3MJ 4RBOA 1JGGA 1GUUA 2GRMA 2OR1L 5K7ZA 1QP4A 2YUSA 3OSGA 1MBJA 4B1RA 5E3NA 3BTCA 1JUPA 3BR3A 1X2MA 3BDNA 2CRGA 3E7LA 1DU6A 2KEIA 1ZPQA 3BG9A 3BG5A 5M3FJ 1SQ8A 5IP7J 3GN5B 4DZJA 2PUBA 4C2MJ 5EZGA 2HQ5A 2IEKA 5F27A 1WETA 1WGXA 2HOTA 1UMQA 3W6VA 1H88C 1L1MA 2COBA 3Q3SA 5J1YA 3L1PA 1NTCA 4CYCB 2ECCA 4JQDA 4BKXA 1ZZ6A 3F52A 4D7NA 1UXCA 4M3GA 5IP6A 3HZIB 4QSHA 2R1JL 2JA6J 2E2IJ 3O8HA 2FJRA 1YSEA 3PXPA 4UUSB 5GPAA 1PERL 2ME0A 2R5YB 2DMPA 1ZKGA 2LLKA 5FKMA 5C3EJ 1GDTA 1MNMC 1ETKA 1VF9A 1YRNB 1RETA 1WH7A 3OOUA 2LYPA 3LFPA 3QPSA 2HI3A 1G2HA 2JVLA 4OB4A 3ZOBA 1VI0A 4M3DA 1WIZA 2EZIA 5DS9A 3C2BA 1ZGWA 2AXUA 2MW8A 2X9DA 2JA8J 4FTHA 4B3AA 4AC0A 4JX6A 1W0TA 3QF3A 2PMZN 1UG2A 2EWTA 3UKGA 3S17J 2R92J 2LR8A 1DU0A 2M0CA 3HB9A 3GTGJ 1LCCA 1JT6A 2LVSA 1ADRA 4XRMA 3A01B 2LYSA 3DCFA 2IU7A 4BXXJ 1JT0A 2DA5A 2D5VA 2GM4A 4DZPA 3LNQA 5F1JA 2PE5A 1GVDA 1U9NA 4FE4A 1XS9A 1Z0XA 3IH2A 4HNVA 4A3IJ 3CROL 5EF6A 3FYMA 5M5YJ 1IGNA 4UUTA 2XI8A 2L7FP 4C3IJ 2XB0X 2AUWA 2FJ1A 2CUFA 2L0KA 3FIWA 4D7MA 5FJ8J 4A3DJ 1JJ6C 1RR7A 3LOCA 3ZQLA 3OMTA 1RPWA 4MO7A 1ITYA 4I6RA 2JMWA 3JXCL 2VKVA 5DTDA 1IUFA 5J3LA 2TRTA 1MH4A 1NEQA 4W1UA 2EQRA 3HKZN 3WHCA 1W0UA 4Z59A 2LTPA 1DW9A 2EZLA 1QP7A 3ZQFA 2OF7A 1AHDP 5FLVA 3U3WA 3QYXA 4FBIA 3BR1A 2H8RA 5C44J 5EG0A 3OQMA 5A7LA 3F51A 3CLCA 2DMUA 3O9XA 4F8DA 4IHVA 3H5TA 4I6UA 1A5JA 2KEKA 4NDWA 4M6VA 4YG7B 2PUEA 1TC3C 4RDUA 4MFEA 5M3MJ 1HDPA 3G1LA 4A3LJ 3QQAA 3S2HJ 3DNVB 1JH9A 2WUSR 4IHXA 2B63J 4A93J 2R63A 2EBIA 3CMYA 4PU7A 2BNOA 2PUFA 3BTIA 4XRSG 3GBFA 2L8NA 1VFCA 2XPVA 1CJGA 1QVTA 2R0QC 2R5YA 2LYQA 1OJLA 5EDNA 1YRNA 3VPRA 3TRBA 1HF0A 1QPZA 4XIDA 4ABZA 5E3LA 3Q0WA 2DA3A 3A03A 3B6AA 1PUFA 3SFIA 2E1OA 5IP9J 4BY1J 3HOUJ 4L5EA 1GV5A 1NERA 4PU3C 1VNDA 4J1WA 1O4XA 1GV2A 4IWRA 2Y9YA 1R9TJ 1RIOA 3S1MJ 4XICA 2HOSA 1H89C 4X4GA 5HODA 2XCJA 3EUSA 4A3CJ 2DMTA 1ETWA 3A01A 1PRVA 2LYKA 4FN3A 2P81A 1ZVVA 2ICTA 4X4HA 1HDDC 2GBYA 3A02A 3HBLA 1FJLA 5C4XJ 1P7IA 1HLVA 2AHQA 2K9NA 1OCPA 4DYQA 3BR5A 2EZHA 4D5CA 2AXZA 1JWLA 4IHWA 1RESA 4B4CA 2AO9A 3MN2A 1GT0C 2NOGA 2BNNA 2FX0A 1JKPC 4I8TA 2Y30A 1B72B 1POGA 3BG3A 1OCTC 2CU7A 1D5YA 3H0GJ 3HGGA 1BL0A 3I4MJ 4GFBA 1Q1VA 1ETYA 4X6AJ 5EGOA 2BJCA 3TEDA 3S1QJ 4JX4A 4Z5CA 2Y0SN 1MSFC 1RPEL 1EFAA 2I10A 1FIAA 4V2FA 2O9LA 1ZK8A 4FISA 3B7HA 1ZS4A 3M3YJ 4X4DA 3SCHA 2E2JJ 1WPKA 2OPTA 2FQ4A 5C4JJ 1F36A 1U8BA 1JKOC 4X4IA 2K9SA 1AU7A 1QPIA 3FKIJ 4YG4A 2L49A 4Y52J 1T56A 3H3VK 2CQXA 2QCOA 2XGCA 1R63A 1UXDA 3LISA 4IVZA 1CQTA 1PRAA 2W48A 2KZ8A 1Y7YA 3RZOJ 1ETVA 2AWIA 3CDLA 4S0HB 2GLOA 3QQ6A 2NVYJ 3BTLA 2X48A 1JTXA 2HXIA 4J1XA 4PU8A 2LY9A 4J19A 2MSYA 1DWKA 3BD1A 1P7JA 2M2EA 4A3JJ 3JRFA 1BA5A 2IUOA 2DJNA 3ZHIA 2LP0A 5M5XJ 1LFUP 5IYDJ 1I3QJ 2X6OA 5F0HA 3FK7A 2VI6A 2NS7A 4I6ZA 1IDZA 3RQIA 1EF4A 2QF7A 2XB5A 3JRDA 3SJMA 5E3OA 4GQMA 2CUEA 1AKHB 2LYRA 2JA7J 2PIJA 2IVBA 3BR0A 4DYRA 3I4NJ 1ZR4A 2O49A 1JUSA 2CQQA 3BR6A 2AXVA 4M3EA 5IYCJ 4XRSA 3IV5A 1MBEA 3K2AA 2YS9A 4BBSJ 2GRLA 3Q0VA 3G7DA 2ELKA 1A6IA 2DA7A 3JRCA 1JJ8C 3JR9A 1TWCJ 4A3BJ 2VPRA 4G12A 5EYRA 2VUMJ 2TCTA 1WH5A 2XRLA 1R69A 3HGYA 3TW7A 2ZB9A 1E3OC 3GN5A 4PU4C 4A3FJ 1NK2P 5F0CA 4A3EJ 4X4CA 2XGDA 4Z5HA 2DA6A 1X58A 2M8GX 1IRZA 1ZZCA 3BQZA 3FISA 3MKLA 5BNGA 2WIUB 4MIMA 2ICPA 9ANTA 3HM5A 4CYCA 4V2GA 3BS3A 1RZRA 3KXAA 4MCTA 4D5FA 2DMNA 2IBDA 5F0FA 3G1OA 1ZZ8A 3S15J 3FYAA 4I76A 1JUMA 2JK3A 4UUSA 1JKQC 3CCYA 4M3BA 1IV6A 4I6TA 2ID6A 2MGQA 3JREA 1HOMA 4Y7NJ 3LSGA 2KDZA 4IA8A 4YBAA 1Y1VJ 2ECBA 2Y9ZA 3WHBA 1QP0A 2L9RA 1JFTA 3OIOA 1X57A 1QQBA 1HCRA 3OQNA 5IPAA 2G0EA 2HXOA 3GTMJ 1FTZA 1K61A 2LYLA 4X1EA 1I6HJ 3CECA 4QTRA 3GTQJ 3F0CA 4QIWN 2R5ZB 3OSFA 1MBHA 1U78A 2XJ3A 2LYJA 3UFDA 3JRGA 2KEJA 2ME6A 4X4FA 1S7EA 2YU9J 1ETXA 3S1RJ 2WV1A 1MSEC 3B6CA 3M4OJ 2B5AA 1F43A 1ENHA 4MLOA 1BDIA 3FMYA 2MEZA 2IVGA 5F08A 3GTPJ 1BJZA 2JCGA 2BNMA 3JRAA 3GTOJ 3HOYJ 4FE7A 3ZQCA 2FD5A 3GTJJ 3SCFA 1B8IB 1BDHA 3O8GA 3G1MA 3FK6A 3TP0A 2HOAA 2XSDC 5JLXA 1AKHA 2WAQN 1OSLA 4A3GJ 3NAUA 2L7MP 1BW6A 3GTLJ 3S14J 3S16J 3ZQIA 5EG0B 2E19A 3MVPA 2A6CA 1LQCA 1NK3P 1LE8B 2EF8A 4DYCA 1MBGA 1U9OA 1APLC 1ZTRA 3SDGA 1TWGJ 5M5WJ 3ZKCA 1ETQA 1LFBA 3LSJA 5EEAA 3JRIA 3RZDJ 1MH3A 4X4BA 4LOCA 4BBRJ 5J1UA 4YG1A 1ZZBA 3HOVJ 4Z58A 2KT0A 3TW6A 4FCYA 1WI3A 5FKKA 3ZQGA 1XWRA 2DTZA 2LD5A 2XGEA 1LMB3 3BT9A 3R1FA 1JFSA 3GBGA 2HDDA 1UHSA 3BQYA 1X2LA 2GZUA 1T33A 2HINA 1TWAJ 5J1RA 2OFYA 5FKOA 3S2DJ 2CROA
chains in the Genus database with same CATH superfamily
2R7VA 2MYSA 3ASOH 2K9QA 4O8BA 2HR3A 4I0BA 4CZZA 3QWGA 4Z6YA 3HOXJ 3RKWA 3EETA 2DQLA 3F6OA 1RZRD 4NDLA 4G6DA 3ZHMA 2VASA 1WRJA 4PUSA 5J47A 3S8PA 4G94A 4JCYA 4EJOA 4B43A 5EZHA 1LDJA 2QKLB 1LNWA 2NS8A 1PVEA 3M8EA 1IRXA 2EIKH 2HGCA 3HHHA 5AIQA 4X0GA 3OY9A 3JAMZ 5D6EA 3IH3A 2UXXA 2M9HA 2O38A 4RLFA 1ZUGA 4RMNA 2F5FA 4XRFA 1QHHD 3F3XA 1UFMA 3N4MA 3J7YJ 1LLIA 1I50J 2GA2A 5F04A 1UELB 4XQFA 4II3A 3RJPA 1B9NA 4LB5A 2AXTC 1LQ1A 4IEJA 4MFDA 4MEXF 1IXSB 3PNVA 2IS6A 3V8JA 4P5OA 1X3UA 4ZDOA 4JCXA 2ZBKA 1YO5C 5DTMA 1FMVA 1KU9A 5EGOB 2DO7A 1YG2A 5TISC 4DW6A 2ZNZA 2RAEA 5HLHA 4KNYA 4GCVA 1I5ZA 1BBYA 1MBKA 4JP0A 1ZAYA 4HQMA 3KCCA 2PUAA 3DV8A 2F48A 4LK0F 2JSPA 3U1KA 3MZYA 4KIFA 1K6YA 4C2TA 4IHYA 1TNTA 1JKRC 1HSJA 5EEHA 3LSMA 1R22A 3LMMA 3DTIA 3S8QA 4MTEA 1RZ4A 2PXBA 2DW4A 2NNYA 4W97A 4V19K 3IVPA 1K6OA 1WH6A 2IVQA 2NVXJ 2K9MA 2R7RA 3M7GA 1D0ZA 5LGTA 2FMLA 4B3XA 1SFXA 2VBYA 1J2XA 3GFIA 4A3KJ 2ZFWA 4B48A 4TV7A 1SD4A 3ZPXA 3KEOA 3U2RA 2ELJA 4JX5A 2JA5J 3H9JA 1E17A 4BXFA 2D2WA 4IHSA 5K5RA 2XIUA 3ABTA 3KP7A 3VYTB 4S05A 3CCRI 4J00A 1YITI 1PNRA 4M73A 2N8GA 1LVAA 2IV1A 2CJJA 1FEXA 2XGXA 3OYBA 5BPDA 4A3MJ 4E6KG 2QLZA 4BNCA 3B73A 2O3FA 4G6TB 1XB4A 1ON1A 4PSWA 3KIOA 1DPUA 3M9AA 3BP8A 3E7LA 1DU6A 4XN0A 5M3FJ 1KQ8A 4RAZA 5F1RA 4RLQA 3BJOA 3HUGB 1R5ID 5IP7J 2XDVA 2HVRA 3VSLA 2BEOA 4C2MJ 2PUBA 3FMQA 2IEKA 2CH0A 4IQ4A 3ZCOA 1MMSA 2M7BA 1WETA 4BGDA 2GQQA 3R60A 1L1MA 1H88C 3ZMZA 2COBA 2QVOA 2FA5A 4BKXA 4UHTA 3O3KA 4UY8I 3V7CA 3O8HA 4LIVA 1YSEA 1F1ZA 1FOYA 3PXPA 3ERMA 4EGZA 1G3YA 4HRAA 1B59A 2YX4A 5CQGA 5DM6F 1K4SA 2DMPA 2EA4A 4LFUA 5D8LB 5C3EJ 5JFRA 2W25A 5B1BH 1MNMC 1ETKA 1VF9A 4CCMA 2LYPA 5K5OA 3BDDA 2EV5A 4RGUA 5IT9K 2HI3A 2WA0A 5L3BA 5CVJA 4PFPA 5FFXA 1OQYA 2JA8J 1R71A 5D5WB 1X1AA 4AC0A 4FTHA 4CCKA 4ZYEA 1PYVA 2PMZN 3JCUC 3QAHA 3UKGA 1A35A 2R92J 2KLOA 2LR8A 2LREA 1LCCA 1W36D 3ZQQA 2PXDA 2MABA 2Y0SA 1YS7A 4XRMA 1O7LA 2UXNA 2HFZA 2XUBA 2IU7A 3V7SA 5L3DA 4WWCA 4BXXJ 2DA5A 2D5VA 1EJ9A 1F9NA 2D1VA 3V42A 4UNOA 1R1VA 3T8RA 5LRSA 2QSHX 4WXDA 3S3MA 1GVDA 2VODA 3GZNB 5E8GA 3IH2A 4A3IJ 3DLAA 5EF6A 3PIPF 4N9HA 1IO2A 4FX0A 3C7JA 2XC7A 1YE9A 4XSZF 1IGNA 2A07F 1ZG5A 2L7FP 4RB3C 4LG0B 2L0KA 3I64A 3HHGA 1J0RA 4A3DJ 3MMYB 3VWSA 4HDUA 4HX8A 3DBRB 3QYEA 3LOCA 2R3SA 5K1YA 3ZQLA 3W6JB 4MO7A 4FETA 3CZ6A 2GOXB 2EB7A 2TRTA 1MH4A 2IGKA 1I1GA 1WJFA 3PFYA 4W1UA 1BM9A 2W85A 1U3EM 2LTPA 1KONA 4BQOA 2EZLA 2ACJA 2LLWA 3E6DA 5LHGA 5FLVA 1FOWA 1V4RA 3CP2A 1ZLJA 5C44J 1L0OC 3OS0A 2R7WA 4XKVA 5A7LA 5JVGF 2A6EF 2QKMB 3LQXA 3G6EI 1FPQA 2DMUA 2IA1A 3O9XA 4IHVA 2V26A 1ON2A 1R6RA 1SFKA 1MGTA 2PXTA 2PUEA 4YIFA 1FWZA 3K69A 3K4LA 5AONA 3W2VA 1UZCA 2ZSHB 3IKTA 2WUSR 4HQEA 2R63A 1JH9A 1FBUA 1SVOA 2EBIA 3CMYA 3J80Z 1TQIA 2PUFA 4XRSG 4EJVA 1VQ8I 2XXAA 4EVIA 4BQQA 3G71I 2L2OA 1OJLA 1BR1A 1VQ9I 1YRNA 4CUGA 2M7AA 1LDKB 5D8KB 1HF0A 3H9QA 2DPDA 3PSFA 4AIHA 3B6AA 3WGIA 3RSNA 2CV2A 4B44A 1REPC 1U2ZA 1GHCA 1U5TA 1JHFA 4OIOF 4UB8C 2ZXHA 1FBQA 1R49A 1SFUA 2Y75A 3I0TA 1RIOA 1MJBA 5KVRA 3B02A 4P55A 3GVAA 2DMTA 4OINF 1ETWA 2V6CA 4AYBA 4FN3A 1ZVVA 4LIUA 3FMSA 4RGXA 4IO9F 4X4HA 1LJ9A 2CMPA 4A6EA 2IA2A 3A02A 4RAGA 4HF1A 5GAHJ 5FO5A 2XAFA 2AHQA 2HNHA 1V55H 2KIMA 3CJTB 2EZHA 3VYRB 4D5CA 1K7AA 4RB2C 5F64A 5DCMA 1OCRH 4XKCA 4Q5SF 2DLLA 1SC7A 4DJAA 3A9YA 1JKPC 3SHFA 3A0HC 3DU6A 3ZMVA 1POGA 3BG3A 3HGGA 1BL0A 1BC7C 3I4MJ 5ILSA 5LD2C 1Q1VA 2QBYA 4X6AJ 2KJCA 4NHJA 2BJCA 4JX4A 4Z5CA 3HXLA 2PQ8A 1ZGJA 2ZFUA 4V2FA 1V5GA 2VT3A 3GXOA 2MLKA 4XM3A 3VDXA 3M3YJ 2JRMA 2E2JJ 2RREA 4EKGA 2OPTA 2VXZA 2HFHA 1HKQA 1AU7A 4ER3A 4CXFA 1PDNC 3FKIJ 3K10A 3H3VK 1R63A 2QCOA 4IVZA 3OYDA 2W48A 4PJMA 4HG2A 2FFHA 4AIDA 1ETVA 2X6XA 3CDLA 2AWIA 3CMAI 2X48A 1BI1A 3GFJA 2IGNA 4M74A 4A12A 1P7JA 4A3JJ 3GWZA 1BA5A 4G9YA 1R36A 2HKXA 4L0ZB 4OAZA 2VEOA 1LFUP 3RCOA 1USTA 2X6OA 3LQQA 3RQIA 4OU0A 3CDIA 2XB5A 3JRDA 3SJMA 4B09A 2CUEA 2JA7J 2IVBA 1J5YA 1JUSA 3F8FA 2DDBA 5LLQA 3BR6A 2AXVA 4M3EA 5IYCJ 3IV5A 1MBEA 3ML6A 4WVLA 2VKHA 3K2AA 1S8NA 2BY0A 3DTKA 3SEZA 3CCUI 1X4PA 4BBSJ 4MTDA 5D5UB 3G7DA 2FOWA 2KFDA 2L4AA 3CCMI 1ZGAA 1IN4A 2DA7A 4E7ZA 3JRCA 1YIJI 2X1CA 2V6EA 2FU4A 1JJ8C 4A3BJ 4G12A 1VQLI 2VUMJ 4NBQA 1T38A 2VT2A 2OAZA 3TW7A 4ER5A 2XAQA 1NK2P 4X4CA 3PSIA 5HDGA 1W36C 1X58A 1IRZA 1VQMI 2GXAA 3FISA 2L9NA 4MIMA 3DKYA 4U0WA 2P8TA 3HM5A 1DGWY 4V2GA 3E5UA 5E17F 3GZDA 3H36A 2ZJPF 2QQ9A 4GRIA 1DUXC 3EUHA 3H92A 4HPQA 3ABUA 4E7HA 4A5MA 1JKQC 3GUDA 2IW5A 3QODA 4HV6A 2PXKA 5FLXZ 3CDHA 5HLIA 2VBWA 4IQJA 4Y7NJ 2BW3A 4GYIA 3L7WA 3RPQA 4YBAA 4RAYA 4U0YA 2EV6A 3WHBA 2E1CA 3F22A 1WQ2A 1YX3A 2KIQA 3OIQA 4L9TA 2L9VA 4M6XA 5IPAA 4O3MA 3DEUA 1K61A 3SXYA 3CECA 4HOBA 4L18B 4QIWN 3TFLA 1T0FC 3SZPA 1U78A 4EQQA 2LYJA 4EM1A 3NROA 4X4FA 1S7EA 2RV8A 3HRUA 2MFZA 4XN3A 2Z9OA 3K6GA 1E0EA 3B6CA 5DYMA 1KYZA 3A9ZA 2EINH 3F9KA 4L9JA 1K78A 2MEZA 2WB1A 2IVGA 1YX5A 1IW7F 2ODRD 3JRAA 1XMAA 3FZVA 3GTOJ 2KQRA 1W4MA 2E34A 3PFIA 4FE7A 1R4MB 4BHPA 4CA0A 3R6SA 2CQKA 2HKOA 3FK6A 3G1MA 1NG7A 4HLYA 1O3TA 2XF7A 5GADJ 2DDAA 3IRRA 1OCOH 3WG7H 3VSKA 2HPMA 3IAM2 3HYIA 3NAUA 2L7MP 2H6BA 2F5EA 1XN7A 2IRFG 2K4JA 4CGZA 2LYCA 3MVPA 3CTAA 1VQ7I 3I58A 1U9OA 1APLC 4OAYA 3SDGA 4ZDPA 3K2ZA 1ETQA 5EEAA 3LSJA 5FD5A 1QO0D 4LOCA 2XIGA 4LK1F 4PJ0C 3CD6I 4YG1A 4IKFA 3H3ZA 3BY6A 1J59A 1U0JA 3CLOA 3K70D 2KT0A 2LSOA 3TW6A 1WI3A 2DTZA 3KP3A 4QLCU 4UVBA 2J5PA 2PI0A 3R1FA 2LG4A 3DWLE 3GBGA 4EJUA 1UHSA 2W4SA 4ON0A 4B47A 2HINA 2O6GE 5J1RA 3J7AY 4I2OA 3ZQ7A 1LVKA 1XC5A 2RNJA 1Z91A 3HDDA 1Z1DA 2D1HA 3SEQA 3OYMA 2VJIA 2CQ7A 1IRFA 2EK5A 2ZMEC 1LDDA 3KLNA 5D5XB 2Z5UA 2R7FA 3KYLA 1X2NA 4ZC3A 1O3QA 3OP9A 2V3CC 1FY7A 1BOBA 3BR2A 3RYRA 2HU9A 3AFHA 4FHTA 3GTKJ 2DMQA 3FX3A 3CCJI 3R0AA 4YFNF 1L3LA 2XPUA 1ERDA 2LFBA 3R4KA 1ETOA 2AW6A 4X4EA 3ZQHA 2R93J 3WODF 3OIPA 2Y2ZA 3ZR8X 2KHMA 3IL2A 1VQKI 2GA1A 2R7ZJ 2QQAA 1YOVB 2KKOA 1B1BA 4BY7J 3FXQA 1QPMA 1IDYA 1UJ8A 3GX4X 4GHJA 3CJNA 2HWVA 2A61A 1ZELA 5HDKA 1OFCX 3K0LA 2PXLA 3W6KB 2L7ZA 2DJIA 1NH3A 2XKOA 3HOZJ 2A6TA 3FWEA 2GWRA 5K98B 5FLMJ 5LGNA 1QQAA 4JYKA 4XLNF 3K7AJ 4HAMA 3T5XA 2DK5A 2LCVA 2VIXA 3TDZC 4MEYF 4I02A 1QVUA 2V4JC 2GIZA 3ZMTA 1B8IA 2QBYB 3OV8A 3TP3A 3VEPA 2LNMA 3QYFA 2CSFA 1TT5B 2O4AA 4MNUA 3S93A 2OUMA 3HPHA 1FSHA 1A6QA 2AS5F 2LKXA 3P9CA 2JRTA 3RZZA 2EH3A 3ZXSA 3S1NJ 2EBYA 4G7ZF 2F2EA 2QENA 2QSGX 1E3PA 4ESBA 1MKMA 3GW2A 3NQOA 5JLWA 3OWQA 2QM3A 1ZLKA 1HW5A 3HZJA 3KZ3A 1B4AA 2X85A 1SD5A 3HKZA 1Z6RA 3CO6C 2OTLI 5FKLA 5BS6A 2ZMEB 3D1NI 4Q48A 1Y1WJ 2EZKA 2KPMA 4XL9A 1S7AA 4LLGF 2FMYA 2VLAA 1LB2A 1RUNA 5BPIA 1SANA 3BZ6A 1ZZ7A 2VB6A 2MG4A 4YIRX 1QBJA 1Y8QB 5CVVA 2VBXA 1ZR2A 1MBFA 1O57A 4D9JA 2MQKA 2E7WA 5GPCA 4PGGA 1RZSA 1LCDA 5EEGA 5E1WA 1JGGA 2XXPA 3OYCA 4RGSA 2P6TA 2W57A 2XVCA 3BLYA 5E3NA 3G73A 1SEUA 3RPUA 2DPUA 3BR3A 1MD0A 1GXQA 2KEIA 2G7UA 1IXRC 3BG9A 1ZPQA 3E6CC 2KRHA 2IGOA 3FXMA 4BAYA 4DZJA 1WJDA 2ZXJA 3NWTA 3H5AA 3H9GA 1F4KA 3QU6A 5LHIA 1IN8A 1BOAA 3GO5A 3L1PA 4WCGA 2ECCA 2GXBA 1ZZ6A 2X4HA 4D7NA 4KITB 4L5IA 4M3GA 5HS8A 5J6XA 1FLIA 3HZIB 2E2IJ 1U6GA 1ZG1A 5DEQA 2F4MB 2BGCA 2M0MA 3CP8A 2ME0A 3TBIA 2OTJI 2R5YB 3K9TA 2K3FA 3CMEI 2MA3A 5CVUA 2BW3B 2QQ8A 1GDTA 1PP8F 3MZHA 2K9LA 2M4KA 1F5TA 4Y13A 1X3WB 3OOUA 4IRHA 4E7LA 2WY7Q 4CICA 2VKDA 1Z3XA 2HCNA 4OB4A 1C0WA 1VI0A 4XSXF 3WTXC 4Q47A 4FQGA 4G7HF 3DKXA 1ZGWA 2MW8A 1KU3A 2CUZA 4N4OB 3DP7A 3ZP5A 1UG2A 2CS3A 1Y0UA 1OYYA 3WG9A 3GTGJ 3HB9A 3F8BA 1S29A 1JT6A 2STWA 2DODA 3U1DA 2KIFA 4G6QA 4IL6C 5DUKA 3R0JA 4LD5A 3LAPA 1ODDA 2CROA 2GM4A 4F3QA 4ZTFA 3GEZA 2ZKZA 4EM0B 5F1JA 2PE5A 4I7HA 3SDBA 2HYGD 1U9NA 4ZH4F 3CROL 1Z0XA 2PXVA 4HNVA 3K70C 4OMZA 3P5JA 2W82A 3FYMA 1HW1A 2XI8A 5FJ8J 1YW9A 3FIWA 4D7MA 2P5VA 1QU3A 4HA8A 1ULYA 1T6SA 2PMHA 5E1ZB 1R7JA 1UHMA 2PEXA 4YG2F 5FROA 2CV1A 2JMWA 2K5CA 3L00A 5J3LA 2W84A 1BJAA 3LA3A 3H35A 1NEQA 2MD5A 2EQRA 3WHCA 1T08B 3TGNA 4AU7A 1AHDP 3U3WA 4NB5A 4KIGA 5EG0A 3OQMA 3JTGA 3F51A 3CLCA 4L0YB 3H5TA 3PL8A 3A4CA 4I6UA 1TW2A 4NDWA 2P6SA 4P96A 1MMNA 1Y56A 1TNSA 3ZN0A 3QQAA 3CUQC 2F6CA 3DNVB 4PU7A 2WAEA 2VXDA 4GYGA 2JSCA 2CO5A 2BNOA 4JOMA 4E7JA 4Z2YA 3ULQB 4KISA 1CJGA 3GCMA 1QVTA 2PFBA 5HOOA 2RC4A 3I5UA 5D5VB 2Q0OA 3BG7A 3VPRA 3VYUB 1J7KA 4FX4A 2COMA 3UR3C 3TRBA 4XIDA 3KPHA 1QPZA 2JZYA 3FDYA 3A9XA 1W7PA 1SVMA 1IAWA 3SFIA 1PUEE 1QZXA 4BY1J 1KYWA 1YJ9I 4OWRB 3MKWB 1ZARA 4ZTJA 4ESJA 4L5EA 1GV5A 2AXLA 1VNDA 2QWWA 1O4XA 1PP7U 1R9TJ 2LBFB 3S1MJ 2HOSA 3SZGA 4BE2A 4X4GA 4HNUA 2JVGA 3EUSA 2KP6A 2ZJQF 4UV9A 3A01A 2QQBA 1HC8A 2E1NA 3RYPA 2ICTA 1I3AA 1YTYA 1D3YA 1HDDC 2D45A 2GBYA 4DE8A 1FJLA 1P7IA 1HLVA 5FRNA 2K9NA 3FXJA 4YFXF 1X4OA 2Y48A 4IHWA 3TQNA 4BACA 4B4CA 2FF4A 2M30A 1MJAA 4OBMA 3GZCA 1GT0C 3OYHA 1T2KA 3OYGA 1AOYA 1YS6A 5B3SH 3WTSC 3ERED 5FFZA 1X1CA 3FXLA 2DT7B 3BC8A 2CU7A 1D5YA 2DAOA 4WX9A 3H0GJ 2MC4A 1WJCA 3PUBA 1ETYA 5KCMA 4HF0A 3QOXA 5L3FA 3S1QJ 1W5CC 2Y0SN 4CYDA 1XMXA 3KLOA 1FIAA 2O9LA 3CUQB 4HV5A 4PJNA 1OISA 4BS9A 3LA2A 3HOTA 1WPKA 3SCHA 2FQ4A 3TO9A 4XMYA 4KDPA 4H4KC 3E5XA 4RB0A 2BZTA 3QP6A 2HVSA 2WAQA 4O5VA 3ELKA 1QZYA 2VL8A 4Y52J 2CUJA 3LSTA 2WC2A 1UXDA 3OWTA 4HX7A 2CW7A 2OA4A 3G4SI 3SQNA 3QQ6A 2NVYJ 3OKZA 2K27A 2W7NA 3E0JB 3QU3A 4EZIA 2IUOA 1BI2A 1WZ2A 2DJNA 2DYRH 1DULA 3ZHIA 3GZ6A 3HTSB 1E2XA 1QZEA 4XOTA 5M5XJ 1I3QJ 1TQPA 2K4BA 2ICWG 2L4MA 2NS7A 4HZFA 1K79A 1IDZA 2A05A 1XSXA 2IVMA 2JUCA 4A0XA 5E3OA 4HW0A 1YHQI 1AKHB 2PIJA 2XHKA 1TL8A 4HRIA 4DYRA 3I4NJ 3ECHA 1ZR4A 4BL0B 2Z2SB 2CQQA 2O49A 4WF2A 3C18A 4XRSA 2OQGA 1N77A 1R1TA 2HZDA 2TDXA 4XLAA 4L5JA 5JVTA 5E18F 3Q0VA 4BQNA 2R7TA 3GLXA 2VBZA 3TOAA 2A5WA 1A6IA 3TELA 3FM5A 2CSOA 2CYYA 2VQCA 5EYRA 1WH5A 4PU4C 5DUIA 3U21A 4A3EJ 2NYXA 3F8CA 2UUZA 1ZZCA 3KFWX 4C30A 1IN7A 3T8TA 9ANTA 2PBIA 4F55A 2BHZA 4CYCA 4YEJA 3BS3A 3KXAA 2M1BA 4D5FA 2DMNA 5F0FA 3G1OA 1B6AA 4KJZA 5GAGi 3OS1A 1OMIA 1VQNI 3A1YA 4M3BA 2X0LA 1IV6A 5J4VA 1T39A 2MGQA 3K4NA 2VOOA 3ZMUA 4XONA 1HOMA 2WV0A 5GTIC 4XNFA 3ESWB 4XLHA 3COAC 1S72I 1BI3A 2Y9ZA 2L9RA 5KAFC 4DE9A 1FOXA 4K2EA 3KEQA 4LITA 1I39A 3GTMJ 4F91B 5F6FA 2LYLA 3OYFA 1FT9A 2JA2A 5CKTA 1XDUA 3F0CA 1XDSA 1J09A 4N9IA 5CQEA 1MBHA 3JAMK 3DBHB 2BXYA 2K3PA 3I59A 4R1HA 3S3NA 2XAJA 2YU9J 1Z7LA 4ANJA 3KEYA 5JHFA 3J81Z 4KN7X 1F43A 3PNYA 4IVNA 3H3UA 4MLOA 1KQ0A 1BDIA 3M8FA 3LL7A 3KP6A 2IS2A 3BZCA 2DFIA 2I8DA 3NDBB 2I5UA 2JCGA 2BNMA 1T0FA 5JI6A 4BE0A 2ZXIA 3V4GA 3SCFA 4CZCA 3GTJJ 3SZTA 1DPRA 2XSJC 3MD2A 4A2UA 2XSDC 5JLXA 2WAFA 4CCJA 1OSLA 1DGRM 5H20A 4A3GJ 2BY1A 4CHUA 3H5NA 1J75A 2EFPA 1ZAOA 3JW4A 2E1MC 4WXCA 3RKXA 3ZQIA 5EG0B 1LQCA 1XSDA 1NK3P 3I4PA 3RI4A 1OCCH 3N05A 5M5WJ 1LFBA 1V5EA 4X4BA 1MH3A 2EFWA 4BBRJ 5JR3A 2F4IA 5J1UA 4BEHA 1ZZBA 2GXGA 1V5FA 3BPXA 2R7OA 3Q5FA 2UWMA 3OL4A 5FKKA 5DDGA 1XWRA 5IT3A 4CCLA 2XAGA 1Z3YA 1LMB3 1UG0A 1JFSA 2M4GA 2E60A 3QPHA 2HDDA 1X2LA 2YSRA 3BQYA 1T33A 2IPQX 5DTQA 5FKOA 3MCZA 4GDFA 4OIPF 1B9MA 2F5CA 1Z6TA 2DA2A 4A6DA 5EJCA 2YPRA 3OS2A 1USSA 2DOFA 2EA2A 1G6NA 3BJ6A 1RRJA 2E5NA 3EYYA 3DEWA 4ZZDA 1TWHJ 2PUGA 2O8KA 2O5RA 2LC2A 4ENNA 3WTYC 1IXCA 1XX5A 4XBFA 2PUDA 3WTWC 5LFAA 1UAAA 1MMAA 3AG1H 3CCVI 2RQPA 3KX2A 1V54H 1PRUA 3HRMA 2HS5A 3U9GA 1FTTA 1POUA 3SX0A 2CQNA 1BW5A 2R5ZA 3F6WA 1X19A 2H6CA 2M87A 3RKQA 3RDIA 2CGPA 4YARA 3OYLA 2KRFA 3ROUA 1ZZ9A 2MH2A 1XG1A 2V79A 4G8XA 5E79C 1Z77A 2EPFA 5GTHC 3AKZA 4BE1A 3G5GA 2NOJB 1FIPA 2M34A 5L3CA 2V1UA 3DEEA 3W2AA 4RB1A 4HSRA 4DBRA 3LSIA 3I55I 3OQOA 2CFOA 1VQPI 1LPQA 2HSGA 4XR6A 3NXHA 2E1MB 2VJ5A 3NARA 1D1AA 3WGHA 2VONA 1JXSA 2OU2A 5GP9A 5KHDA 4PFOA 4Q4ZF 3KETA 3A0BC 3F21A 1UTXA 4CO8A 2L9SA 1B0NA 2ADUA 3DM5A 1Z9CA 2MD0A 5FD6A 1N25A 2K86A 2A68F 1BC8C 3PM1A 1KZHA 3QPLA 1JE8A 2Y0MA 4BJ6C 2JTVA 2VN2A 1LE8A 4F7ZA 2OZUA 4Z5DA 4YFKF 1IJWC 3PO2J 3M9LA 1CF7A 4BHBA 2H1KA 2PUCA 4ZYGA 2WB1N 1D8KA 1RKTA 2DFEA 3VFZA 1OLTA 3HL2A 3N97A 4ENMA 3L09A 3M1EA 4IRIA 2FE3A 2CWEA 2DA1A 4PDKA 2VC1A 5A2QZ 1ORKA 3GUUA 4A69C 5IOZA 1G8XA 2MC3A 3WU1B 2NVTJ 2BOLA 5HLTA 2OCCH 3SCGA 2XXQA 1MFQC 4C3JJ 3DPUA 3JXBC 3J7ZI 1XTAA 5K7FA 1JI8A 2IAIA 1Y8RB 3E5QA 2LDUA 3GLLA 4N4NB 4RBOA 5ILUA 2QEXI 1GUUA 2GRMA 2OR1L 1LKXA 5K7ZA 4UB6C 1QHGA 1MBJA 4B1RA 1OR7A 3HOSA 3KE2A 2PJPA 1R5GA 3AL0B 4IRGA 3KYCB 5D4RA 3LFUA 3V8KA 3WTTC 1SQ8A 2EIMH 4U7BA 5DD4A 1R4NB 4NQWA 5F27A 4A5NA 4ZYHA 1YJWI 2DT5A 4L9VA 1TP4A 2VQGA 3QPTA 3W6VA 4KFCA 2BVLA 3E97A 1D8JA 5J1YA 1NTCA 4CYCB 5H6RA 1WI9A 2ISYA 1UXCA 1BN5A 1HXDA 5IP6A 2Z1DA 4QSHA 4CH7A 3J80K 2QUFA 2JA6J 2FJRA 1EH8A 3C2HA 1FYLA 2CFXA 5J8FA 2FSWA 5GPAA 3S3OA 3QWLA 4EJTA 1PERL 4IPAA 4LLLA 3WE2A 3F8NA 5B1AH 2LLKA 1H9TA 4CCOA 2Q2EA 3OMYA 4D0PA 1YRNB 4PZJA 1RETA 1WH7A 3DPTA 2EFNA 2MLGA 1P4XA 3KYDB 1S9HA 2ZJ2A 3LFPA 5DT2A 4ZZLA 1ZHFA 3QPSA 1WWXA 3DKWA 4I98B 4R79A 3FXOA 1OCZH 4M3DA 1WIZA 4O6JA 1Z7UA 3C2BA 5DS9A 2AXUA 2V9PA 1LEBA 1U5TB 4B3AA 2X51A 5HLGA 3K4KA 4JX6A 1W0TA 2WTEA 4C2UA 2O8XA 4XKBA 3HSFA 1DU0A 2DBBA 2M45A 3I59B 2RKHA 5CVRA 1ADRA 1ONVA 2LYSA 3DCFA 1EV7A 1JT0A 2KMUA 4DZPA 1OYWA 4E7KA 1FX7A 1T8IA 1WFXA 4IHTA 1MNDA 4D1QA 4RA2A 2A6HF 4Y4RA 5M5YJ 4E70A 4RAFA 4UUTA 5DCMB 4HDVA 2FQ3A 4KT5C 2BXZA 4C3IJ 2AUWA 2DXIA 3IC7A 1JJ6C 1RR7A 3OMTA 3L2QA 4I6RA 1G4DA 2VKVA 5DTDA 2J7WA 3P9IA 3W2WA 2X6WA 4HYEA 3TL4X 4BJTA 3HKZN 1W0UA 4Z59A 4OMYA 2IA0A 2V1DA 3WGGA 1DW9A 1HQ1A 4BHCA 1P4AA 1QP7A 3GZDC 2GIVA 3ZRGA 2OF7A 3QYXA 3EUHC 2WY8Q 3WTUC 1FZPB 2H27A 2H8RA 1G3WA 3FM3A 3HUGA 1GLNA 3AG4H 3EUKL 1SD7A 3Q9VA 5D6FA 4M6YA 2UV1A 5ICGA 3DFGA 4I99C 4M6VA 2VE9A 4NNJA 1TC3C 2JT1A 4MFEA 1HDPA 1KGSA 3G1LA 4BYYA 4A3LJ 3S2HJ 1K4TA 2M4HA 3DLLF 4CCNA 2LOOA 3BTIA 2R7XA 2PJRA 2HPIA 2L8NA 2P5KA 2ZCWA 4KICA 3DTEA 4FT8A 1OPCA 3CLQA 2CG4A 2FBIA 4JK1X 1NG6A 5J40A 4A0ZA 2C6YA 3D5RC 5EDNA 1KU7A 1EA3A 2OV7A 3E3VA 5IT9Z 3OYJA 4WXHA 4XLFA 5E3LA 2DA3A 3G2BA 1PUFA 1MDMA 3KP5A 5KNLA 2XRNA 1D1CA 3WU0A 2W24A 3HOUJ 1XMKA 2Z99A 5BMZA 1NERA 1IZ1A 1XD7A 4PU3C 2OQRA 2QYOA 3NEUA 2M8EA 3ABLH 4J1WA 1GV2A 2Y9YA 3PUFA 1SAUA 2IT0A 1R1UA 2DOAA 1Z21A 4XICA 2R7SA 4LJZF 3F23A 5HODA 2XCJA 1YW7A 2JVHA 1TQMA 3O6BB 1Y39A 2LYKA 3V8LA 2P81A 1S6LA 3LWFA 3EDPA 4Y33A 2O03A 3HBLA 3BCBA 4S04A 1TBXA 3MFKA 1TLHB 4U88A 4MGRA 4DYQA 4NC6A 3ABKH 2AXZA 5CVIA 1TW3A 1R00A 1RESA 2M5WA 3TEPA 2AO9A 4M9SA 2BE5F 2NOGA 4LG0A 3AAFA 2BNNA 2FX0A 1XGMA 2Y30A 2HTJA 1UHWA 1OCTC 3SYTA 1ZREA 1GXPA 3HG9A 3PIOF 4GFBA 1ZG3A 2VPLA 5FLXK 2DT6A 2DOEA 3CO7C 3LA7A 1YFHA 2F4OB 4I09A 3B7HA 1CF7B 4X4DA 3I3LA 2NS0A 3FF5A 5C4JJ 1U8BA 1F36A 4UUVA 2JPCA 3CCEI 4X4IA 2L7KA 2WADA 2KISA 3VB2A 4KN4X 2K9SA 3MAJA 1QPIA 3CC7I 4EATA 4YG4A 2L49A 1U8RA 3HTUA 3IWZA 2XGCA 3G3ZA 1ZYRF 3K4CA 1YIOA 5TRDA 1CQTA 3LISA 4U7DA 2DI3A 1PRAA 1EH6A 2R7QA 2G9WA 2F5VA 3D5LA 2P4WA 5KK1A 3RZOJ 1MJ9A 4S0HB 2GLOA 2FRHA 1JTXA 3ZMSA 2R4GA 4J19A 1K78B 2ZSIB 2ZC2A 3JRFA 3CCLI 3IHUA 1SD6A 1P9QC 3FMRA 1WSUA 3CC4I 4ER0A 4G7OF 4EK9A 5JUWA 4Y17A 4ASNA 5L3GA 2MH9A 4I6ZA 2Z3YA 1IN5A 1LEAA 2KZGA 3KL4A 4ER6A 4GQMA 3FBNB 3G0TA 5ICEA 3BR0A 3M07A 2JQEA 1LFPA 3EQLF 1D0XA 4IF4A 2HCSA 4PCQA 3C2GA 1W7PD 3MQ0A 1FC3A 4GGGA 2IGMA 2YS9A 2GRLA 4NQWB 2VQHA 2KIUA 5HVQC 1XGSA 2DYSH 4OIQF 1TWCJ 2VPRA 2TCTA 1QB2A 3GN5A 2XF6A 1OKRA 1TT0A 4A3FJ 2Z33A 3FKJA 4KUMA 5F0CA 2XGDA 2LLVA 4Z5HA 2DA6A 5FGMA 4R8HA 3MKLA 5BNGA 3O2PE 1JGSA 1X1PA 3IAS2 3L2RA 5CYVA 2HTSA 1RZRA 4MCTA 2Q2EB 2FBHA 2BY3A 2RN7A 2MBFA 3FYAA 1HA8A 5H2FC 4I76A 1JUMA 2EILH 3M1CA 4UUSA 3CCYA 4I6TA 2VC0A 4GO1A 2ID6A 4BU2A 2HOEA 3F72A 2HYFA 3DF8A 2KDZA 4Y15A 5GAHi 2ECBA 2DK8A 5CLSA 3I9V2 1QNTA 1X57A 4Q2JA 1HCRA 3OQNA 1FTZA 2HXOA 1I1SA 2VE8A 2LMDA 1I6HJ 2YU3A 2MXDA 2A5YB 2RQQA 4I0AA 3UFDA 4EJWA 4PK4A 3JRGA 2ME6A 3L9FA 3JSPA 1TZLA 3F6VA 5FRMA 3QP5A 3DQVC 2L01A 2V7FA 2DTRA 3REOA 2L02A 3OYKA 1MSEC 3M4OJ 2B5AA 2HZTA 3VODA 1NW3A 2LKPA 5DD8A 4QPQA 2VJ4A 4KIBA 3ZMDA 1IUYA 5F08A 2K7LA 1BJZA 4HBLA 4JBAA 2XROA 1RUOA 1BDHA 1B8IB 4ITVA 2HOAA 3IKVA 3CCSI 4MQ9F 1WJAA 2WAQN 3CF2A 4H0EA 3M8JA 1G3SA 1G3TA 4MQVA 5E1XA 4LB6B 1R23A 2KL4A 1BW6A 2JPBA 2HQAA 3S14J 3CESA 3W3CA 1UB9A 1O3RA 3I53A 1BIBA 5D4SA 2IJLA 4UVAA 3MZ8A 3JRIA 3RZDJ 3BOQA 4HF2A 3ZN1A 3L2UA 1D0YA 2OD5A 3HOVJ 4Z58A 3H5RA 3RTRA 3LSHA 3ZQGA 2H94A 3IP4B 2LD5A 1DQUA 2PJRB 2KRCA 4IJAA 1A04A 2O61A 1P92A 4HLXA 1HKSA 2R7DA 1ZN2A 2E35A 4I01A 5LBQA 3V7RA 5E20A 1PUFB 3MEXA 2FBKA 1MDMB 2JJ7A 2KPJA 4ESFA 4CSWA 4CDGA 1SMTA 3CQZJ 3VK0A 4PSXA 1DP7P 2JWTA 3AG2H 1TWFJ 1VPWA 1SFOJ 3FHZA 2YX7A 1P4WA 2JUGA 4YIIA 3CF5F 4A0YA 3LSRA 2E2HJ 4ZYAA 1FYKA 3IH4A 1RIOH 3OYAA 2ID3A 4KYWA 2VOPA 3TKYA 4EEFG 2HQRA 3MLFA 1ZQ3P 1K83J 2NVQJ 1IN6A 2F5DA 4XK4A 3IRQA 3FXKA 3T0YA 1VQOI 3P7NA 5LEKA 3JXDL 2LF8A 1RNLA 2KJBA 3BPVA 3K4JA 3NWSA 2J5OA 3KJXA 4LGWA 2PMZA 1QRYA 4L9NA 1WCMJ 4AIKA 1H8AC 1N78A 2HYJA 3LSPA 2PLYA 2L3DA 3RQ4A 4AUXA 3PJRA 5E3MA 4EV0A 3UWPA 3JRBA 4J01A 2BV6A 2AQFA 4BDYA 2M3AA 3Q0UA 3PQJA 2PPXA 3MWMA 4M9ZA 2Y31A 2PN6A 2DA4A 3T1BA 4C9YA 5FKNA 4BQAA 5IYBJ 3OYEA 2LY1A 1B72A 1IC8A 3PO3J 4ER7A 4P9UA 3S32A 2XPWA 2QSFX 2Q8KA 2A3SA 5IOYA 3BTJA 4IXAA 5ILVA 3KZIC 1IG7A 1ZH5A 2STTA 1WJBA 3HRTA 3MKYB 4AYBN 2DN0A 5DCFA 2VKEA 4C3HJ 4HEA2 3VOEA 3HOWJ 4M72A 1S7OA 1JTYA 4ENKA 2HVQA 2NNNA 5FB2A 2X6YA 1RR8C 1WH8A 4QWQA 2NXNB 1Y9QA 2JN6A 2K40A 3HEFA 1GVJA 1H9GA 1XCVA 2LKSA 3AG3H 4XLPF 1AA7A 3JRHA 1RKWA 4Y42A 2X1DA 4RGRA 1A31A 2LK2A 3PE5A 4MCXA 2O7OA 3A2KA 5DRYA 4M3FA 5K7HA 1OYIA 3K4BA 1X3ZB 2PXPA 1EH7A 1QP4A 2YUSA 2V1NA 3OSGA 3BTCA 5ICFA 3R61A 3OR2C 1JUPA 1X2MA 3BDNA 2CRGA 1FP1D 2XAHA 2AQEA 2DQRA 2PXFA 3BG5A 1QGPA 1WJEA 3GN5B 1R5HA 3RKYA 3WTZA 2O0YA 1FYMA 2P7CB 5EZGA 3KZZA 2HQ5A 4XLCA 2DU9A 1WGXA 3OR1C 2HOTA 2ZO4A 1UMQA 2BYVE 4OOIA 3Q3SA 5ED4A 2ISZA 4JQDA 4UVCA 3F52A 5DRTA 2K85A 2CW8A 2DFHA 2R1JL 4UUSB 1FMWA 3L2CA 1R58A 3FBIB 2EFOA 1MNEA 4P1WA 1ZKGA 2FOKA 5FKMA 3MKZA 1Z67A 1HQCA 2ESNA 4EM2A 4PJLA 4ZJZA 1W5TA 1W7PB 3CJQB 2YR2A 1G2HA 2JVLA 3ZOBA 4BUPA 3UNGC 1HBXG 3Q9SA 2E36A 4RM3A 2EZIA 1FP2A 2X9DA 5LRRA 3QF3A 5ERIA 3TMOA 4Y3OA 2WWYA 2EWTA 5K5QA 3HPGA 3S17J 3GF2A 3HSRA 2M0CA 2NVUB 2Y69H 2IXSA 2LVSA 4M9XA 3JSOA 1G59A 2RNGA 3K1PA 3I54A 3CC2I 3A01B 1CGPA 4DGWB 5DTRA 2ZMEA 2ZJRF 2VQLA 1YYVA 3LNQA 1YW8A 4XLEA 1Q1HA 2XKPA 4F52A 3FHNA 4FE4A 1XS9A 4IOAF 4DOZA 2B0LA 2LNBA 3RIRA 3EPZA 1XPXA 3AL0C 1PJRA 1BR4A 3DBLB 3LSKA 5KAIC 4DBQA 4YRVA 2XB0X 2FJ1A 2CUFA 1UCRA 2OCEA 2FNAA 3OYIA 2NAZA 2GAUA 4AM3A 2ELHA 3C1DA 1RPWA 1ITYA 3JXCL 1XGOA 1IUFA 2LH9A 2QGUA 1MMDA 2X1EA 3KP2A 4DNCA 3SR4A 5HS7A 2YBDA 1Y6IA 3J7AO 3ZQFA 2RVCA 3GYHX 4P9FA 4FBIA 5H6QA 3BR1A 1J9IA 1KA8A 3KP4A 5DM7F 4ENJA 5J4YA 3D0SA 4ZYDA 4F8DA 2UZKA 1O7FA 4AVZA 1SAXA 1A5JA 1FOKA 2KEKA 2ESHA 2FXAA 5ICCA 4YG7B 2EIJH 2OJED 4NC7A 2W00A 5M3MJ 2ZXWH 4RDUA 4E7SA 4WK8F 4IHXA 2B63J 1SVLA 5E8IA 4A93J 4E4HA 1QQIA 2EWNA 4E7IA 2BY2A 2BHYA 3GBFA 3S2DJ 1U5TC 2XPVA 1VFCA 2PXQA 2R0QC 3H1CA 2R5YA 1BIAA 1D5VA 2IS1A 2LYQA 3FXRA 3ZGKA 2ZNYA 2L1PA 2KZVA 3QOPA 1T98A 4ABZA 4F93B 3Q0WA 3A03A 1DDNA 2JQ7A 3GFLA 2E1OA 5IP9J 3WE3A 2IP2A 1IF1A 3OOPA 4BDZA 4HNTA 2FUG2 4XKWA 1ACIA 4BH9A 3ZPLA 2WBMA 3HSEA 4IWRA 2H8WA 2DCEA 4NUBA 5GAGJ 1H89C 4IZZA 1P6RA 2GZWA 1YI2I 3X2QH 4A3CJ 2RGVA 1PRVA 2E5ZA 1WHUA 3TOBA 3LAJA 3QOEA 1YJNI 1V3FA 3SFZA 1QZZA 4LMYA 2LRDA 5C4XJ 2A69F 1OCPA 5AIPA 2R7UA 3BR5A 4RS8A 1JWLA 1XGNA 3P9KA 5GAEJ 4QPOA 3MN2A 2E71A 4JQFA 3QYBA 1Z05A 2Q1ZB 1RI7A 2XF5A 3I71A 4I8TA 1B72B 3K4MA 2EFQA 4AIJA 1JHHA 1I27A 1X1BA 2XASA 1QA6A 1VQ5I 3ABMH 3DPLC 4M71A 2PG4A 5EGOA 3IUOA 4YELA 3TEDA 1RPEL 1YQAA 1MSFC 4UV8A 1EFAA 2HDCA 2I10A 5BOXA 1KQ9A 2QZ8A 1ZK8A 4FISA 1ZS4A 2B9SA 1O3SA 2OZ6A 1N75A 3NRVA 5TGTA 1XSVA 4IOCF 5B66C 1JKOC 2XAUA 4UXNA 4XOPA 3VYSB 4AD9A 2PX9A 3WTVC 3OL3A 2W1OA 1H0MA 1T56A 1S3JA 2CQXA 4II2A 5B5EC 1IRGA 1EKEA 1M1EB 4NC8A 2EV0A 1KU2A 1WVRA 2L5QA 2PXEA 2KZ8A 4XORA 1Y7YA 2QA4I 5IY5H 3TDUC 3J81K 3GMEA 3BTLA 2PXUA 2HXIA 5BQTA 4J1XA 4PU8A 2LY9A 3BD1A 2MSYA 1ZRFA 1DWKA 4PJJA 5HNFA 2M2EA 3E6MA 1ZRCA 4IX7A 2P7VB 2LP0A 3MEJA 5IYDJ 1FNNA 3HRSA 3CMMA 5L3EA 3EYIA 2P0WA 5CJ9A 3FK7A 5F0HA 2VI6A 1SFEA 3LQRA 1EF4A 2KDOA 1MIJA 2QF7A 3BZKA 4RM2A 2L54A 2NRAC 2LYRA 1FBSA 2VJJA 3BROA 3CJRB 1RC9A 5JHUA 4KA4A 4AVPA 2H09A 2LBFA 3HIFA 5LGUA 3E6BA 1HSTA 2ELKA 2V9VA 4LLNA 2DFFA 3JR9A 4BEHB 2XRLA 2G7HA 3HGYA 1R69A 2ZB9A 1E3OC 3QRFF 3I56I 3RPUD 3FXUA 1U2WA 2M8GX 3BQZA 3VWBA 3EUAA 3GZ5A 2CV0A 4PGHA 2WIUB 2ICPA 2K02A 1VQ6I 1WKMA 4KT6A 1STZA 3ONQA 2IBDA 3D5SC 1ZZ8A 2EJRA 3S15J 3TO7A 4LG3A 1E3HA 2JK3A 1HW2A 2J7UA 3ME5A 5HS9A 1X1DA 3JREA 4EQZA 1Y0NA 3DXJF 3LSGA 3QFIA 3PNTA 5J8CA 4IA8A 2CW0F 1Y1VJ 4B8XA 2PMUA 1QP0A 3CUQA 1D1BA 1YLFA 1JFTA 3OIOA 1QQBA 3BG6A 2FEZA 1ZRDA 2G0EA 2HEOA 3L2VA 3HC7A 4X1EA 3CCQI 2GOMA 2ETHA 1I6XA 3WU2C 4QTRA 3GTQJ 2OBPA 3HJEA 3BCAA 2R5ZB 3OSFA 3R09A 3DU5A 4F92B 4EKIA 1MZBA 3L2WA 2XJ3A 1AWCA 2KEJA 2LF7A 2IS4A 1IV8A 4HSTA 1ETXA 1HKTA 4DQ2A 3TO6A 2WV1A 3S1RJ 1DP3A 5TJJA 1ENHA 1OR7C 5DV5A 1W5SA 3ECOA 2H1LA 3GFMA 3FMYA 5HNHA 3GTPJ 5CPRB 4MHGA 2OC6A 3HOYJ 1S5LC 1XCBA 2BBYA 3S2WA 4AWXB 2FD5A 3ZQCA 4ZDLA 5LHHA 3O8GA 1NHAA 6PAXA 2BVMA 3TP0A 3F8MA 4EGYA 1VZ0A 1VTNC 1AKHA 1VQ4I 2FNPA 3LFKA 5LEJA 1SMYF 3GTLJ 2B7EA 3S16J 2E7XA 4KMUX 2E19A 3K1MA 4GXOA 2A6CA 5DSXA 1BR2A 4BXUA 1LE8B 2EF8A 1FSEA 1MW7A 3BWGA 1MBGA 4HX4A 4DYCA 4EMSA 3E1SA 1ZTRA 4DIQA 1TWGJ 4KMFA 1T95A 3NZLA 3ZKCA 4N0BA 2P5LC 3ASNH 2XV4S 2LY2A 2HQNA 2V9KA 2RDPA 1LUJB 1WJ5A 5HDNA 3H0DA 1MMGA 2HDWA 4OIRF 4U0VA 4FCYA 3KZYA 3PQKA 3QOWA 1W1WE 2XGEA 2Z16A 3BT9A 4U87A 1TTYA 4FASD 3IWFA 1P2FA 1A36A 3CUOA 4ETSA 3K1NA 3BJAA 3OYNA 3ISPA 2GZUA 5A2QK 1TWAJ 2OFYA 1BI0A 3C3WA 2V1XA 3JTHA 4BJ5C
chains in the Genus database with same CATH topology
1XC5A 2DA2A 2K9QA 4O8BA 3HDDA 1PUFB 2JJ7A 2KPJA 3QWGA 3HOXJ 1RZRD 3CQZJ 1X2NA 3VK0A 4NDLA 3OP9A 3DEWA 1TWHJ 3ZHMA 2PUGA 2JWTA 2O8KA 3BR2A 4JCYA 1TWFJ 5EZHA 3GTKJ 2DMQA 1VPWA 1SFOJ 2PUDA 2XPUA 2LFBA 1ETOA 2NS8A 2AW6A 4X4EA 3ZQHA 2R93J 2Y2ZA 3LSRA 1POUA 2E2HJ 1FTTA 1PRUA 3IH4A 2R7ZJ 1BW5A 2R5ZA 2ID3A 3F6WA 4BY7J 4EEFG 3MLFA 3IH3A 1ZQ3P 1IDYA 3RKQA 1K83J 2M9HA 4GHJA 2NVQJ 2O38A 1ZUGA 4XK4A 4YARA 1ZZ9A 1OFCX 3JXDL 2L7ZA 1XG1A 1LLIA 1I50J 3HOZJ 1Z77A 5F04A 3KJXA 3G5GA 1QRYA 5K98B 1WCMJ 1FIPA 2M34A 5FLMJ 1H8AC 3OQOA 4IEJA 2HYJA 4MFDA 3LSPA 1QQAA 4JYKA 4AUXA 5E3MA 3K7AJ 2HSGA 3JRBA 3NARA 4JCXA 2LCVA 5GP9A 1UTXA 3Q0UA 1QVUA 1B8IA 2PPXA 5EGOB 2Y31A 3TP3A 2DA4A 1B0NA 4DW6A 5FKNA 2CSFA 2RAEA 5IYBJ 1B72A 1IC8A 3PO3J 2O4AA 1MBKA 4JP0A 2LKXA 3PM1A 1ZAYA 2XPWA 3QPLA 3RZZA 2PUAA 2EH3A 5IOYA 3S1NJ 3BTJA 1IG7A 2EBYA 1LE8A 4Z5DA 4IHYA 4AYBN 1IJWC 2DN0A 3PO2J 5JLWA 1JKRC 2H1KA 2VKEA 2PUCA 2WB1N 1RKTA 4C3HJ 3KZ3A 3S8QA 3HOWJ 4W97A 3IVPA 1JTYA 1WH6A 2IVQA 5FKLA 2NVXJ 3D1NI 1WH8A 1Y9QA 2JN6A 3HEFA 2DA1A 2K40A 2EZKA 1Y1WJ 4A3KJ 1ORKA 1SANA 4A69C 5IOZA 1ZZ7A 4JX5A 2JA5J 2NVTJ 2MG4A 3JRHA 2XIUA 3SCGA 1RKWA 4C3JJ 1ZR2A 4Y42A 3JXBC 2LK2A 5K7FA 4MCXA 1MBFA 2O7OA 2IAIA 1PNRA 2MQKA 5GPCA 2N8GA 4M3FA 2IV1A 2CJJA 5K7HA 1FEXA 1RZSA 1LCDA 4A3MJ 4RBOA 1JGGA 1GUUA 2GRMA 2OR1L 5K7ZA 1QP4A 2YUSA 3OSGA 1MBJA 4B1RA 5E3NA 3BTCA 1JUPA 3BR3A 1X2MA 3BDNA 2CRGA 3E7LA 1DU6A 2KEIA 1ZPQA 3BG9A 3BG5A 5M3FJ 1SQ8A 5IP7J 3GN5B 4DZJA 2PUBA 4C2MJ 5EZGA 2HQ5A 2IEKA 5F27A 1WETA 1WGXA 2HOTA 1UMQA 3W6VA 1H88C 1L1MA 2COBA 3Q3SA 5J1YA 3L1PA 1NTCA 4CYCB 2ECCA 4JQDA 4BKXA 1ZZ6A 3F52A 4D7NA 1UXCA 4M3GA 5IP6A 3HZIB 4QSHA 2R1JL 2JA6J 2E2IJ 3O8HA 2FJRA 1YSEA 3PXPA 4UUSB 5GPAA 1PERL 2ME0A 2R5YB 2DMPA 1ZKGA 2LLKA 5FKMA 5C3EJ 1GDTA 1MNMC 1ETKA 1VF9A 1YRNB 1RETA 1WH7A 3OOUA 2LYPA 3LFPA 3QPSA 2HI3A 1G2HA 2JVLA 4OB4A 3ZOBA 1VI0A 4M3DA 1WIZA 2EZIA 5DS9A 3C2BA 1ZGWA 2AXUA 2MW8A 2X9DA 2JA8J 4FTHA 4B3AA 4AC0A 4JX6A 1W0TA 3QF3A 2PMZN 1UG2A 2EWTA 3UKGA 3S17J 2R92J 2LR8A 1DU0A 2M0CA 3HB9A 3GTGJ 1LCCA 1JT6A 2LVSA 1ADRA 4XRMA 3A01B 2LYSA 3DCFA 2IU7A 4BXXJ 1JT0A 2DA5A 2D5VA 2GM4A 4DZPA 3LNQA 5F1JA 2PE5A 1GVDA 1U9NA 4FE4A 1XS9A 1Z0XA 3IH2A 4HNVA 4A3IJ 3CROL 5EF6A 3FYMA 5M5YJ 1IGNA 4UUTA 2XI8A 2L7FP 4C3IJ 2XB0X 2AUWA 2FJ1A 2CUFA 2L0KA 3FIWA 4D7MA 5FJ8J 4A3DJ 1JJ6C 1RR7A 3LOCA 3ZQLA 3OMTA 1RPWA 4MO7A 1ITYA 4I6RA 2JMWA 3JXCL 2VKVA 5DTDA 1IUFA 5J3LA 2TRTA 1MH4A 1NEQA 4W1UA 2EQRA 3HKZN 3WHCA 1W0UA 4Z59A 2LTPA 1DW9A 2EZLA 1QP7A 3ZQFA 2OF7A 1AHDP 5FLVA 3U3WA 3QYXA 4FBIA 3BR1A 2H8RA 5C44J 5EG0A 3OQMA 5A7LA 3F51A 3CLCA 2DMUA 3O9XA 4F8DA 4IHVA 3H5TA 4I6UA 1A5JA 2KEKA 4NDWA 4M6VA 4YG7B 2PUEA 1TC3C 4RDUA 4MFEA 5M3MJ 1HDPA 3G1LA 4A3LJ 3QQAA 3S2HJ 3DNVB 1JH9A 2WUSR 4IHXA 2B63J 4A93J 2R63A 2EBIA 3CMYA 4PU7A 2BNOA 2PUFA 3BTIA 4XRSG 3GBFA 2L8NA 1VFCA 2XPVA 1CJGA 1QVTA 2R0QC 2R5YA 2LYQA 1OJLA 5EDNA 1YRNA 3VPRA 3TRBA 1HF0A 1QPZA 4XIDA 4ABZA 5E3LA 3Q0WA 2DA3A 3A03A 3B6AA 1PUFA 3SFIA 2E1OA 5IP9J 4BY1J 3HOUJ 4L5EA 1GV5A 1NERA 4PU3C 1VNDA 4J1WA 1O4XA 1GV2A 4IWRA 2Y9YA 1R9TJ 1RIOA 3S1MJ 4XICA 2HOSA 1H89C 4X4GA 5HODA 2XCJA 3EUSA 4A3CJ 2DMTA 1ETWA 3A01A 1PRVA 2LYKA 4FN3A 2P81A 1ZVVA 2ICTA 4X4HA 1HDDC 2GBYA 3A02A 3HBLA 1FJLA 5C4XJ 1P7IA 1HLVA 2AHQA 2K9NA 1OCPA 4DYQA 3BR5A 2EZHA 4D5CA 2AXZA 1JWLA 4IHWA 1RESA 4B4CA 2AO9A 3MN2A 1GT0C 2NOGA 2BNNA 2FX0A 1JKPC 4I8TA 2Y30A 1B72B 1POGA 3BG3A 1OCTC 2CU7A 1D5YA 3H0GJ 3HGGA 1BL0A 3I4MJ 4GFBA 1Q1VA 1ETYA 4X6AJ 5EGOA 2BJCA 3TEDA 3S1QJ 4JX4A 4Z5CA 2Y0SN 1MSFC 1RPEL 1EFAA 2I10A 1FIAA 4V2FA 2O9LA 1ZK8A 4FISA 3B7HA 1ZS4A 3M3YJ 4X4DA 3SCHA 2E2JJ 1WPKA 2OPTA 2FQ4A 5C4JJ 1F36A 1U8BA 1JKOC 4X4IA 2K9SA 1AU7A 1QPIA 3FKIJ 4YG4A 2L49A 4Y52J 1T56A 3H3VK 2CQXA 2QCOA 2XGCA 1R63A 1UXDA 3LISA 4IVZA 1CQTA 1PRAA 2W48A 2KZ8A 1Y7YA 3RZOJ 1ETVA 2AWIA 3CDLA 4S0HB 2GLOA 3QQ6A 2NVYJ 3BTLA 2X48A 1JTXA 2HXIA 4J1XA 4PU8A 2LY9A 4J19A 2MSYA 1DWKA 3BD1A 1P7JA 2M2EA 4A3JJ 3JRFA 1BA5A 2IUOA 2DJNA 3ZHIA 2LP0A 5M5XJ 1LFUP 5IYDJ 1I3QJ 2X6OA 5F0HA 3FK7A 2VI6A 2NS7A 4I6ZA 1IDZA 3RQIA 1EF4A 2QF7A 2XB5A 3JRDA 3SJMA 5E3OA 4GQMA 2CUEA 1AKHB 2LYRA 2JA7J 2PIJA 2IVBA 3BR0A 4DYRA 3I4NJ 1ZR4A 2O49A 1JUSA 2CQQA 3BR6A 2AXVA 4M3EA 5IYCJ 4XRSA 3IV5A 1MBEA 3K2AA 2YS9A 4BBSJ 2GRLA 3Q0VA 3G7DA 2ELKA 1A6IA 2DA7A 3JRCA 1JJ8C 3JR9A 1TWCJ 4A3BJ 2VPRA 4G12A 5EYRA 2VUMJ 2TCTA 1WH5A 2XRLA 1R69A 3HGYA 3TW7A 2ZB9A 1E3OC 3GN5A 4PU4C 4A3FJ 1NK2P 5F0CA 4A3EJ 4X4CA 2XGDA 4Z5HA 2DA6A 1X58A 2M8GX 1IRZA 1ZZCA 3BQZA 3FISA 3MKLA 5BNGA 2WIUB 4MIMA 2ICPA 9ANTA 3HM5A 4CYCA 4V2GA 3BS3A 1RZRA 3KXAA 4MCTA 4D5FA 2DMNA 2IBDA 5F0FA 3G1OA 1ZZ8A 3S15J 3FYAA 4I76A 1JUMA 2JK3A 4UUSA 1JKQC 3CCYA 4M3BA 1IV6A 4I6TA 2ID6A 2MGQA 3JREA 1HOMA 4Y7NJ 3LSGA 2KDZA 4IA8A 4YBAA 1Y1VJ 2ECBA 2Y9ZA 3WHBA 1QP0A 2L9RA 1JFTA 3OIOA 1X57A 1QQBA 1HCRA 3OQNA 5IPAA 2G0EA 2HXOA 3GTMJ 1FTZA 1K61A 2LYLA 4X1EA 1I6HJ 3CECA 4QTRA 3GTQJ 3F0CA 4QIWN 2R5ZB 3OSFA 1MBHA 1U78A 2XJ3A 2LYJA 3UFDA 3JRGA 2KEJA 2ME6A 4X4FA 1S7EA 2YU9J 1ETXA 3S1RJ 2WV1A 1MSEC 3B6CA 3M4OJ 2B5AA 1F43A 1ENHA 4MLOA 1BDIA 3FMYA 2MEZA 2IVGA 5F08A 3GTPJ 1BJZA 2JCGA 2BNMA 3JRAA 3GTOJ 3HOYJ 4FE7A 3ZQCA 2FD5A 3GTJJ 3SCFA 1B8IB 1BDHA 3O8GA 3G1MA 3FK6A 3TP0A 2HOAA 2XSDC 5JLXA 1AKHA 2WAQN 1OSLA 4A3GJ 3NAUA 2L7MP 1BW6A 3GTLJ 3S14J 3S16J 3ZQIA 5EG0B 2E19A 3MVPA 2A6CA 1LQCA 1NK3P 1LE8B 2EF8A 4DYCA 1MBGA 1U9OA 1APLC 1ZTRA 3SDGA 1TWGJ 5M5WJ 3ZKCA 1ETQA 1LFBA 3LSJA 5EEAA 3JRIA 3RZDJ 1MH3A 4X4BA 4LOCA 4BBRJ 5J1UA 4YG1A 1ZZBA 3HOVJ 4Z58A 2KT0A 3TW6A 4FCYA 1WI3A 5FKKA 3ZQGA 1XWRA 2DTZA 2LD5A 2XGEA 1LMB3 3BT9A 3R1FA 1JFSA 3GBGA 2HDDA 1UHSA 3BQYA 1X2LA 2GZUA 1T33A 2HINA 1TWAJ 5J1RA 2OFYA 5FKOA 3S2DJ 2CROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC5 A;  2DA2 A;  2K9Q A;  4O8B A;  3HDD A;  1PUF B;  2JJ7 A;  2KPJ A;  3QWG A;  3HOX J;  1RZR D;  3CQZ J;  1X2N A;  3VK0 A;  4NDL A;  3OP9 A;  3DEW A;  1TWH J;  3ZHM A;  2PUG A;  2JWT A;  2O8K A;  3BR2 A;  4JCY A;  1TWF J;  5EZH A;  3GTK J;  2DMQ A;  1VPW A;  1SFO J;  2PUD A;  2XPU A;  2LFB A;  1ETO A;  2NS8 A;  2AW6 A;  4X4E A;  3ZQH A;  2R93 J;  2Y2Z A;  3LSR A;  1POU A;  2E2H J;  1FTT A;  1PRU A;  3IH4 A;  2R7Z J;  1BW5 A;  2R5Z A;  2ID3 A;  3F6W A;  4BY7 J;  4EEF G;  3MLF A;  3IH3 A;  1ZQ3 P;  1IDY A;  3RKQ A;  1K83 J;  2M9H A;  4GHJ A;  2NVQ J;  2O38 A;  1ZUG A;  4XK4 A;  4YAR A;  1ZZ9 A;  1OFC X;  3JXD L;  2L7Z A;  1XG1 A;  1LLI A;  1I50 J;  3HOZ J;  1Z77 A;  5F04 A;  3KJX A;  3G5G A;  1QRY A;  5K98 B;  1WCM J;  1FIP A;  2M34 A;  5FLM J;  1H8A C;  3OQO A;  4IEJ A;  2HYJ A;  4MFD A;  3LSP A;  1QQA A;  4JYK A;  4AUX A;  5E3M A;  3K7A J;  2HSG A;  3JRB A;  3NAR A;  4JCX A;  2LCV A;  5GP9 A;  1UTX A;  3Q0U A;  1QVU A;  1B8I A;  2PPX A;  5EGO B;  2Y31 A;  3TP3 A;  2DA4 A;  1B0N A;  4DW6 A;  5FKN A;  2CSF A;  2RAE A;  5IYB J;  1B72 A;  1IC8 A;  3PO3 J;  2O4A A;  1MBK A;  4JP0 A;  2LKX A;  3PM1 A;  1ZAY A;  2XPW A;  3QPL A;  3RZZ A;  2PUA A;  2EH3 A;  5IOY A;  3S1N J;  3BTJ A;  1IG7 A;  2EBY A;  1LE8 A;  4Z5D A;  4IHY A;  4AYB N;  1IJW C;  2DN0 A;  3PO2 J;  5JLW A;  1JKR C;  2H1K A;  2VKE A;  2PUC A;  2WB1 N;  1RKT A;  4C3H J;  3KZ3 A;  3S8Q A;  3HOW J;  4W97 A;  3IVP A;  1JTY A;  1WH6 A;  2IVQ A;  5FKL A;  2NVX J;  3D1N I;  1WH8 A;  1Y9Q A;  2JN6 A;  3HEF A;  2DA1 A;  2K40 A;  2EZK A;  1Y1W J;  4A3K J;  1ORK A;  1SAN A;  4A69 C;  5IOZ A;  1ZZ7 A;  4JX5 A;  2JA5 J;  2NVT J;  2MG4 A;  3JRH A;  2XIU A;  3SCG A;  1RKW A;  4C3J J;  1ZR2 A;  4Y42 A;  3JXB C;  2LK2 A;  5K7F A;  4MCX A;  1MBF A;  2O7O A;  2IAI A;  1PNR A;  2MQK A;  5GPC A;  2N8G A;  4M3F A;  2IV1 A;  2CJJ A;  5K7H A;  1FEX A;  1RZS A;  1LCD A;  4A3M J;  4RBO A;  1JGG A;  1GUU A;  2GRM A;  2OR1 L;  5K7Z A;  1QP4 A;  2YUS A;  3OSG A;  1MBJ A;  4B1R A;  5E3N A;  3BTC A;  1JUP A;  3BR3 A;  1X2M A;  3BDN A;  2CRG A;  3E7L A;  1DU6 A;  2KEI A;  1ZPQ A;  3BG9 A;  3BG5 A;  5M3F J;  1SQ8 A;  5IP7 J;  3GN5 B;  4DZJ A;  2PUB A;  4C2M J;  5EZG A;  2HQ5 A;  2IEK A;  5F27 A;  1WET A;  1WGX A;  2HOT A;  1UMQ A;  3W6V A;  1H88 C;  1L1M A;  2COB A;  3Q3S A;  5J1Y A;  3L1P A;  1NTC A;  4CYC B;  2ECC A;  4JQD A;  4BKX A;  1ZZ6 A;  3F52 A;  4D7N A;  1UXC A;  4M3G A;  5IP6 A;  3HZI B;  4QSH A;  2R1J L;  2JA6 J;  2E2I J;  3O8H A;  2FJR A;  1YSE A;  3PXP A;  4UUS B;  5GPA A;  1PER L;  2ME0 A;  2R5Y B;  2DMP A;  1ZKG A;  2LLK A;  5FKM A;  5C3E J;  1GDT A;  1MNM C;  1ETK A;  1VF9 A;  1YRN B;  1RET A;  1WH7 A;  3OOU A;  2LYP A;  3LFP A;  3QPS A;  2HI3 A;  1G2H A;  2JVL A;  4OB4 A;  3ZOB A;  1VI0 A;  4M3D A;  1WIZ A;  2EZI A;  5DS9 A;  3C2B A;  1ZGW A;  2AXU A;  2MW8 A;  2X9D A;  2JA8 J;  4FTH A;  4B3A A;  4AC0 A;  4JX6 A;  1W0T A;  3QF3 A;  2PMZ N;  1UG2 A;  2EWT A;  3UKG A;  3S17 J;  2R92 J;  2LR8 A;  1DU0 A;  2M0C A;  3HB9 A;  3GTG J;  1LCC A;  1JT6 A;  2LVS A;  1ADR A;  4XRM A;  3A01 B;  2LYS A;  3DCF A;  2IU7 A;  4BXX J;  1JT0 A;  2DA5 A;  2D5V A;  2GM4 A;  4DZP A;  3LNQ A;  5F1J A;  2PE5 A;  1GVD A;  1U9N A;  4FE4 A;  1XS9 A;  1Z0X A;  3IH2 A;  4HNV A;  4A3I J;  3CRO L;  5EF6 A;  3FYM A;  5M5Y J;  1IGN A;  4UUT A;  2XI8 A;  2L7F P;  4C3I J;  2XB0 X;  2AUW A;  2FJ1 A;  2CUF A;  2L0K A;  3FIW A;  4D7M A;  5FJ8 J;  4A3D J;  1JJ6 C;  1RR7 A;  3LOC A;  3ZQL A;  3OMT A;  1RPW A;  4MO7 A;  1ITY A;  4I6R A;  2JMW A;  3JXC L;  2VKV A;  5DTD A;  1IUF A;  5J3L A;  2TRT A;  1MH4 A;  1NEQ A;  4W1U A;  2EQR A;  3HKZ N;  3WHC A;  1W0U A;  4Z59 A;  2LTP A;  1DW9 A;  2EZL A;  1QP7 A;  3ZQF A;  2OF7 A;  1AHD P;  5FLV A;  3U3W A;  3QYX A;  4FBI A;  3BR1 A;  2H8R A;  5C44 J;  5EG0 A;  3OQM A;  5A7L A;  3F51 A;  3CLC A;  2DMU A;  3O9X A;  4F8D A;  4IHV A;  3H5T A;  4I6U A;  1A5J A;  2KEK A;  4NDW A;  4M6V A;  4YG7 B;  2PUE A;  1TC3 C;  4RDU A;  4MFE A;  5M3M J;  1HDP A;  3G1L A;  4A3L J;  3QQA A;  3S2H J;  3DNV B;  1JH9 A;  2WUS R;  4IHX A;  2B63 J;  4A93 J;  2R63 A;  2EBI A;  3CMY A;  4PU7 A;  2BNO A;  2PUF A;  3BTI A;  4XRS G;  3GBF A;  2L8N A;  1VFC A;  2XPV A;  1CJG A;  1QVT A;  2R0Q C;  2R5Y A;  2LYQ A;  1OJL A;  5EDN A;  1YRN A;  3VPR A;  3TRB A;  1HF0 A;  1QPZ A;  4XID A;  4ABZ A;  5E3L A;  3Q0W A;  2DA3 A;  3A03 A;  3B6A A;  1PUF A;  3SFI A;  2E1O A;  5IP9 J;  4BY1 J;  3HOU J;  4L5E A;  1GV5 A;  1NER A;  4PU3 C;  1VND A;  4J1W A;  1O4X A;  1GV2 A;  4IWR A;  2Y9Y A;  1R9T J;  1RIO A;  3S1M J;  4XIC A;  2HOS A;  1H89 C;  4X4G A;  5HOD A;  2XCJ A;  3EUS A;  4A3C J;  2DMT A;  1ETW A;  3A01 A;  1PRV A;  2LYK A;  4FN3 A;  2P81 A;  1ZVV A;  2ICT A;  4X4H A;  1HDD C;  2GBY A;  3A02 A;  3HBL A;  1FJL A;  5C4X J;  1P7I A;  1HLV A;  2AHQ A;  2K9N A;  1OCP A;  4DYQ A;  3BR5 A;  2EZH A;  4D5C A;  2AXZ A;  1JWL A;  4IHW A;  1RES A;  4B4C A;  2AO9 A;  3MN2 A;  1GT0 C;  2NOG A;  2BNN A;  2FX0 A;  1JKP C;  4I8T A;  2Y30 A;  1B72 B;  1POG A;  3BG3 A;  1OCT C;  2CU7 A;  1D5Y A;  3H0G J;  3HGG A;  1BL0 A;  3I4M J;  4GFB A;  1Q1V A;  1ETY A;  4X6A J;  5EGO A;  2BJC A;  3TED A;  3S1Q J;  4JX4 A;  4Z5C A;  2Y0S N;  1MSF C;  1RPE L;  1EFA A;  2I10 A;  1FIA A;  4V2F A;  2O9L A;  1ZK8 A;  4FIS A;  3B7H A;  1ZS4 A;  3M3Y J;  4X4D A;  3SCH A;  2E2J J;  1WPK A;  2OPT A;  2FQ4 A;  5C4J J;  1F36 A;  1U8B A;  1JKO C;  4X4I A;  2K9S A;  1AU7 A;  1QPI A;  3FKI J;  4YG4 A;  2L49 A;  4Y52 J;  1T56 A;  3H3V K;  2CQX A;  2QCO A;  2XGC A;  1R63 A;  1UXD A;  3LIS A;  4IVZ A;  1CQT A;  1PRA A;  2W48 A;  2KZ8 A;  1Y7Y A;  3RZO J;  1ETV A;  2AWI A;  3CDL A;  4S0H B;  2GLO A;  3QQ6 A;  2NVY J;  3BTL A;  2X48 A;  1JTX A;  2HXI A;  4J1X A;  4PU8 A;  2LY9 A;  4J19 A;  2MSY A;  1DWK A;  3BD1 A;  1P7J A;  2M2E A;  4A3J J;  3JRF A;  1BA5 A;  2IUO A;  2DJN A;  3ZHI A;  2LP0 A;  5M5X J;  1LFU P;  5IYD J;  1I3Q J;  2X6O A;  5F0H A;  3FK7 A;  2VI6 A;  2NS7 A;  4I6Z A;  1IDZ A;  3RQI A;  1EF4 A;  2QF7 A;  2XB5 A;  3JRD A;  3SJM A;  5E3O A;  4GQM A;  2CUE A;  1AKH B;  2LYR A;  2JA7 J;  2PIJ A;  2IVB A;  3BR0 A;  4DYR A;  3I4N J;  1ZR4 A;  2O49 A;  1JUS A;  2CQQ A;  3BR6 A;  2AXV A;  4M3E A;  5IYC J;  4XRS A;  3IV5 A;  1MBE A;  3K2A A;  2YS9 A;  4BBS J;  2GRL A;  3Q0V A;  3G7D A;  2ELK A;  1A6I A;  2DA7 A;  3JRC A;  1JJ8 C;  3JR9 A;  1TWC J;  4A3B J;  2VPR A;  4G12 A;  5EYR A;  2VUM J;  2TCT A;  1WH5 A;  2XRL A;  1R69 A;  3HGY A;  3TW7 A;  2ZB9 A;  1E3O C;  3GN5 A;  4PU4 C;  4A3F J;  1NK2 P;  5F0C A;  4A3E J;  4X4C A;  2XGD A;  4Z5H A;  2DA6 A;  1X58 A;  2M8G X;  1IRZ A;  1ZZC A;  3BQZ A;  3FIS A;  3MKL A;  5BNG A;  2WIU B;  4MIM A;  2ICP A;  9ANT A;  3HM5 A;  4CYC A;  4V2G A;  3BS3 A;  1RZR A;  3KXA A;  4MCT A;  4D5F A;  2DMN A;  2IBD A;  5F0F A;  3G1O A;  1ZZ8 A;  3S15 J;  3FYA A;  4I76 A;  1JUM A;  2JK3 A;  4UUS A;  1JKQ C;  3CCY A;  4M3B A;  1IV6 A;  4I6T A;  2ID6 A;  2MGQ A;  3JRE A;  1HOM A;  4Y7N J;  3LSG A;  2KDZ A;  4IA8 A;  4YBA A;  1Y1V J;  2ECB A;  2Y9Z A;  3WHB A;  1QP0 A;  2L9R A;  1JFT A;  3OIO A;  1X57 A;  1QQB A;  1HCR A;  3OQN A;  5IPA A;  2G0E A;  2HXO A;  3GTM J;  1FTZ A;  1K61 A;  2LYL A;  4X1E A;  1I6H J;  3CEC A;  4QTR A;  3GTQ J;  3F0C A;  4QIW N;  2R5Z B;  3OSF A;  1MBH A;  1U78 A;  2XJ3 A;  2LYJ A;  3UFD A;  3JRG A;  2KEJ A;  2ME6 A;  4X4F A;  1S7E A;  2YU9 J;  1ETX A;  3S1R J;  2WV1 A;  1MSE C;  3B6C A;  3M4O J;  2B5A A;  1F43 A;  1ENH A;  4MLO A;  1BDI A;  3FMY A;  2MEZ A;  2IVG A;  5F08 A;  3GTP J;  1BJZ A;  2JCG A;  2BNM A;  3JRA A;  3GTO J;  3HOY J;  4FE7 A;  3ZQC A;  2FD5 A;  3GTJ J;  3SCF A;  1B8I B;  1BDH A;  3O8G A;  3G1M A;  3FK6 A;  3TP0 A;  2HOA A;  2XSD C;  5JLX A;  1AKH A;  2WAQ N;  1OSL A;  4A3G J;  3NAU A;  2L7M P;  1BW6 A;  3GTL J;  3S14 J;  3S16 J;  3ZQI A;  5EG0 B;  2E19 A;  3MVP A;  2A6C A;  1LQC A;  1NK3 P;  1LE8 B;  2EF8 A;  4DYC A;  1MBG A;  1U9O A;  1APL C;  1ZTR A;  3SDG A;  1TWG J;  5M5W J;  3ZKC A;  1ETQ A;  1LFB A;  3LSJ A;  5EEA A;  3JRI A;  3RZD J;  1MH3 A;  4X4B A;  4LOC A;  4BBR J;  5J1U A;  4YG1 A;  1ZZB A;  3HOV J;  4Z58 A;  2KT0 A;  3TW6 A;  4FCY A;  1WI3 A;  5FKK A;  3ZQG A;  1XWR A;  2DTZ A;  2LD5 A;  2XGE A;  1LMB 3;  3BT9 A;  3R1F A;  1JFS A;  3GBG A;  2HDD A;  1UHS A;  3BQY A;  1X2L A;  2GZU A;  1T33 A;  2HIN A;  1TWA J;  5J1R A;  2OFY A;  5FKO A;  3S2D J;  2CRO A; 
#chains in the Genus database with same CATH topology
 2R7V A;  2MYS A;  3ASO H;  2K9Q A;  4O8B A;  2HR3 A;  4I0B A;  4CZZ A;  3QWG A;  4Z6Y A;  3HOX J;  3RKW A;  3EET A;  2DQL A;  3F6O A;  1RZR D;  4NDL A;  4G6D A;  3ZHM A;  2VAS A;  1WRJ A;  4PUS A;  5J47 A;  3S8P A;  4G94 A;  4JCY A;  4EJO A;  4B43 A;  5EZH A;  1LDJ A;  2QKL B;  1LNW A;  2NS8 A;  1PVE A;  3M8E A;  1IRX A;  2EIK H;  2HGC A;  3HHH A;  5AIQ A;  4X0G A;  3OY9 A;  3JAM Z;  5D6E A;  3IH3 A;  2UXX A;  2M9H A;  2O38 A;  4RLF A;  1ZUG A;  4RMN A;  2F5F A;  4XRF A;  1QHH D;  3F3X A;  1UFM A;  3N4M A;  3J7Y J;  1LLI A;  1I50 J;  2GA2 A;  5F04 A;  1UEL B;  4XQF A;  4II3 A;  3RJP A;  1B9N A;  4LB5 A;  2AXT C;  1LQ1 A;  4IEJ A;  4MFD A;  4MEX F;  1IXS B;  3PNV A;  2IS6 A;  3V8J A;  4P5O A;  1X3U A;  4ZDO A;  4JCX A;  2ZBK A;  1YO5 C;  5DTM A;  1FMV A;  1KU9 A;  5EGO B;  2DO7 A;  1YG2 A;  5TIS C;  4DW6 A;  2ZNZ A;  2RAE A;  5HLH A;  4KNY A;  4GCV A;  1I5Z A;  1BBY A;  1MBK A;  4JP0 A;  1ZAY A;  4HQM A;  3KCC A;  2PUA A;  3DV8 A;  2F48 A;  4LK0 F;  2JSP A;  3U1K A;  3MZY A;  4KIF A;  1K6Y A;  4C2T A;  4IHY A;  1TNT A;  1JKR C;  1HSJ A;  5EEH A;  3LSM A;  1R22 A;  3LMM A;  3DTI A;  3S8Q A;  4MTE A;  1RZ4 A;  2PXB A;  2DW4 A;  2NNY A;  4W97 A;  4V19 K;  3IVP A;  1K6O A;  1WH6 A;  2IVQ A;  2NVX J;  2K9M A;  2R7R A;  3M7G A;  1D0Z A;  5LGT A;  2FML A;  4B3X A;  1SFX A;  2VBY A;  1J2X A;  3GFI A;  4A3K J;  2ZFW A;  4B48 A;  4TV7 A;  1SD4 A;  3ZPX A;  3KEO A;  3U2R A;  2ELJ A;  4JX5 A;  2JA5 J;  3H9J A;  1E17 A;  4BXF A;  2D2W A;  4IHS A;  5K5R A;  2XIU A;  3ABT A;  3KP7 A;  3VYT B;  4S05 A;  3CCR I;  4J00 A;  1YIT I;  1PNR A;  4M73 A;  2N8G A;  1LVA A;  2IV1 A;  2CJJ A;  1FEX A;  2XGX A;  3OYB A;  5BPD A;  4A3M J;  4E6K G;  2QLZ A;  4BNC A;  3B73 A;  2O3F A;  4G6T B;  1XB4 A;  1ON1 A;  4PSW A;  3KIO A;  1DPU A;  3M9A A;  3BP8 A;  3E7L A;  1DU6 A;  4XN0 A;  5M3F J;  1KQ8 A;  4RAZ A;  5F1R A;  4RLQ A;  3BJO A;  3HUG B;  1R5I D;  5IP7 J;  2XDV A;  2HVR A;  3VSL A;  2BEO A;  4C2M J;  2PUB A;  3FMQ A;  2IEK A;  2CH0 A;  4IQ4 A;  3ZCO A;  1MMS A;  2M7B A;  1WET A;  4BGD A;  2GQQ A;  3R60 A;  1L1M A;  1H88 C;  3ZMZ A;  2COB A;  2QVO A;  2FA5 A;  4BKX A;  4UHT A;  3O3K A;  4UY8 I;  3V7C A;  3O8H A;  4LIV A;  1YSE A;  1F1Z A;  1FOY A;  3PXP A;  3ERM A;  4EGZ A;  1G3Y A;  4HRA A;  1B59 A;  2YX4 A;  5CQG A;  5DM6 F;  1K4S A;  2DMP A;  2EA4 A;  4LFU A;  5D8L B;  5C3E J;  5JFR A;  2W25 A;  5B1B H;  1MNM C;  1ETK A;  1VF9 A;  4CCM A;  2LYP A;  5K5O A;  3BDD A;  2EV5 A;  4RGU A;  5IT9 K;  2HI3 A;  2WA0 A;  5L3B A;  5CVJ A;  4PFP A;  5FFX A;  1OQY A;  2JA8 J;  1R71 A;  5D5W B;  1X1A A;  4AC0 A;  4FTH A;  4CCK A;  4ZYE A;  1PYV A;  2PMZ N;  3JCU C;  3QAH A;  3UKG A;  1A35 A;  2R92 J;  2KLO A;  2LR8 A;  2LRE A;  1LCC A;  1W36 D;  3ZQQ A;  2PXD A;  2MAB A;  2Y0S A;  1YS7 A;  4XRM A;  1O7L A;  2UXN A;  2HFZ A;  2XUB A;  2IU7 A;  3V7S A;  5L3D A;  4WWC A;  4BXX J;  2DA5 A;  2D5V A;  1EJ9 A;  1F9N A;  2D1V A;  3V42 A;  4UNO A;  1R1V A;  3T8R A;  5LRS A;  2QSH X;  4WXD A;  3S3M A;  1GVD A;  2VOD A;  3GZN B;  5E8G A;  3IH2 A;  4A3I J;  3DLA A;  5EF6 A;  3PIP F;  4N9H A;  1IO2 A;  4FX0 A;  3C7J A;  2XC7 A;  1YE9 A;  4XSZ F;  1IGN A;  2A07 F;  1ZG5 A;  2L7F P;  4RB3 C;  4LG0 B;  2L0K A;  3I64 A;  3HHG A;  1J0R A;  4A3D J;  3MMY B;  3VWS A;  4HDU A;  4HX8 A;  3DBR B;  3QYE A;  3LOC A;  2R3S A;  5K1Y A;  3ZQL A;  3W6J B;  4MO7 A;  4FET A;  3CZ6 A;  2GOX B;  2EB7 A;  2TRT A;  1MH4 A;  2IGK A;  1I1G A;  1WJF A;  3PFY A;  4W1U A;  1BM9 A;  2W85 A;  1U3E M;  2LTP A;  1KON A;  4BQO A;  2EZL A;  2ACJ A;  2LLW A;  3E6D A;  5LHG A;  5FLV A;  1FOW A;  1V4R A;  3CP2 A;  1ZLJ A;  5C44 J;  1L0O C;  3OS0 A;  2R7W A;  4XKV A;  5A7L A;  5JVG F;  2A6E F;  2QKM B;  3LQX A;  3G6E I;  1FPQ A;  2DMU A;  2IA1 A;  3O9X A;  4IHV A;  2V26 A;  1ON2 A;  1R6R A;  1SFK A;  1MGT A;  2PXT A;  2PUE A;  4YIF A;  1FWZ A;  3K69 A;  3K4L A;  5AON A;  3W2V A;  1UZC A;  2ZSH B;  3IKT A;  2WUS R;  4HQE A;  2R63 A;  1JH9 A;  1FBU A;  1SVO A;  2EBI A;  3CMY A;  3J80 Z;  1TQI A;  2PUF A;  4XRS G;  4EJV A;  1VQ8 I;  2XXA A;  4EVI A;  4BQQ A;  3G71 I;  2L2O A;  1OJL A;  1BR1 A;  1VQ9 I;  1YRN A;  4CUG A;  2M7A A;  1LDK B;  5D8K B;  1HF0 A;  3H9Q A;  2DPD A;  3PSF A;  4AIH A;  3B6A A;  3WGI A;  3RSN A;  2CV2 A;  4B44 A;  1REP C;  1U2Z A;  1GHC A;  1U5T A;  1JHF A;  4OIO F;  4UB8 C;  2ZXH A;  1FBQ A;  1R49 A;  1SFU A;  2Y75 A;  3I0T A;  1RIO A;  1MJB A;  5KVR A;  3B02 A;  4P55 A;  3GVA A;  2DMT A;  4OIN F;  1ETW A;  2V6C A;  4AYB A;  4FN3 A;  1ZVV A;  4LIU A;  3FMS A;  4RGX A;  4IO9 F;  4X4H A;  1LJ9 A;  2CMP A;  4A6E A;  2IA2 A;  3A02 A;  4RAG A;  4HF1 A;  5GAH J;  5FO5 A;  2XAF A;  2AHQ A;  2HNH A;  1V55 H;  2KIM A;  3CJT B;  2EZH A;  3VYR B;  4D5C A;  1K7A A;  4RB2 C;  5F64 A;  5DCM A;  1OCR H;  4XKC A;  4Q5S F;  2DLL A;  1SC7 A;  4DJA A;  3A9Y A;  1JKP C;  3SHF A;  3A0H C;  3DU6 A;  3ZMV A;  1POG A;  3BG3 A;  3HGG A;  1BL0 A;  1BC7 C;  3I4M J;  5ILS A;  5LD2 C;  1Q1V A;  2QBY A;  4X6A J;  2KJC A;  4NHJ A;  2BJC A;  4JX4 A;  4Z5C A;  3HXL A;  2PQ8 A;  1ZGJ A;  2ZFU A;  4V2F A;  1V5G A;  2VT3 A;  3GXO A;  2MLK A;  4XM3 A;  3VDX A;  3M3Y J;  2JRM A;  2E2J J;  2RRE A;  4EKG A;  2OPT A;  2VXZ A;  2HFH A;  1HKQ A;  1AU7 A;  4ER3 A;  4CXF A;  1PDN C;  3FKI J;  3K10 A;  3H3V K;  1R63 A;  2QCO A;  4IVZ A;  3OYD A;  2W48 A;  4PJM A;  4HG2 A;  2FFH A;  4AID A;  1ETV A;  2X6X A;  3CDL A;  2AWI A;  3CMA I;  2X48 A;  1BI1 A;  3GFJ A;  2IGN A;  4M74 A;  4A12 A;  1P7J A;  4A3J J;  3GWZ A;  1BA5 A;  4G9Y A;  1R36 A;  2HKX A;  4L0Z B;  4OAZ A;  2VEO A;  1LFU P;  3RCO A;  1UST A;  2X6O A;  3LQQ A;  3RQI A;  4OU0 A;  3CDI A;  2XB5 A;  3JRD A;  3SJM A;  4B09 A;  2CUE A;  2JA7 J;  2IVB A;  1J5Y A;  1JUS A;  3F8F A;  2DDB A;  5LLQ A;  3BR6 A;  2AXV A;  4M3E A;  5IYC J;  3IV5 A;  1MBE A;  3ML6 A;  4WVL A;  2VKH A;  3K2A A;  1S8N A;  2BY0 A;  3DTK A;  3SEZ A;  3CCU I;  1X4P A;  4BBS J;  4MTD A;  5D5U B;  3G7D A;  2FOW A;  2KFD A;  2L4A A;  3CCM I;  1ZGA A;  1IN4 A;  2DA7 A;  4E7Z A;  3JRC A;  1YIJ I;  2X1C A;  2V6E A;  2FU4 A;  1JJ8 C;  4A3B J;  4G12 A;  1VQL I;  2VUM J;  4NBQ A;  1T38 A;  2VT2 A;  2OAZ A;  3TW7 A;  4ER5 A;  2XAQ A;  1NK2 P;  4X4C A;  3PSI A;  5HDG A;  1W36 C;  1X58 A;  1IRZ A;  1VQM I;  2GXA A;  3FIS A;  2L9N A;  4MIM A;  3DKY A;  4U0W A;  2P8T A;  3HM5 A;  1DGW Y;  4V2G A;  3E5U A;  5E17 F;  3GZD A;  3H36 A;  2ZJP F;  2QQ9 A;  4GRI A;  1DUX C;  3EUH A;  3H92 A;  4HPQ A;  3ABU A;  4E7H A;  4A5M A;  1JKQ C;  3GUD A;  2IW5 A;  3QOD A;  4HV6 A;  2PXK A;  5FLX Z;  3CDH A;  5HLI A;  2VBW A;  4IQJ A;  4Y7N J;  2BW3 A;  4GYI A;  3L7W A;  3RPQ A;  4YBA A;  4RAY A;  4U0Y A;  2EV6 A;  3WHB A;  2E1C A;  3F22 A;  1WQ2 A;  1YX3 A;  2KIQ A;  3OIQ A;  4L9T A;  2L9V A;  4M6X A;  5IPA A;  4O3M A;  3DEU A;  1K61 A;  3SXY A;  3CEC A;  4HOB A;  4L18 B;  4QIW N;  3TFL A;  1T0F C;  3SZP A;  1U78 A;  4EQQ A;  2LYJ A;  4EM1 A;  3NRO A;  4X4F A;  1S7E A;  2RV8 A;  3HRU A;  2MFZ A;  4XN3 A;  2Z9O A;  3K6G A;  1E0E A;  3B6C A;  5DYM A;  1KYZ A;  3A9Z A;  2EIN H;  3F9K A;  4L9J A;  1K78 A;  2MEZ A;  2WB1 A;  2IVG A;  1YX5 A;  1IW7 F;  2ODR D;  3JRA A;  1XMA A;  3FZV A;  3GTO J;  2KQR A;  1W4M A;  2E34 A;  3PFI A;  4FE7 A;  1R4M B;  4BHP A;  4CA0 A;  3R6S A;  2CQK A;  2HKO A;  3FK6 A;  3G1M A;  1NG7 A;  4HLY A;  1O3T A;  2XF7 A;  5GAD J;  2DDA A;  3IRR A;  1OCO H;  3WG7 H;  3VSK A;  2HPM A;  3IAM 2;  3HYI A;  3NAU A;  2L7M P;  2H6B A;  2F5E A;  1XN7 A;  2IRF G;  2K4J A;  4CGZ A;  2LYC A;  3MVP A;  3CTA A;  1VQ7 I;  3I58 A;  1U9O A;  1APL C;  4OAY A;  3SDG A;  4ZDP A;  3K2Z A;  1ETQ A;  5EEA A;  3LSJ A;  5FD5 A;  1QO0 D;  4LOC A;  2XIG A;  4LK1 F;  4PJ0 C;  3CD6 I;  4YG1 A;  4IKF A;  3H3Z A;  3BY6 A;  1J59 A;  1U0J A;  3CLO A;  3K70 D;  2KT0 A;  2LSO A;  3TW6 A;  1WI3 A;  2DTZ A;  3KP3 A;  4QLC U;  4UVB A;  2J5P A;  2PI0 A;  3R1F A;  2LG4 A;  3DWL E;  3GBG A;  4EJU A;  1UHS A;  2W4S A;  4ON0 A;  4B47 A;  2HIN A;  2O6G E;  5J1R A;  3J7A Y;  4I2O A;  3ZQ7 A;  1LVK A;  1XC5 A;  2RNJ A;  1Z91 A;  3HDD A;  1Z1D A;  2D1H A;  3SEQ A;  3OYM A;  2VJI A;  2CQ7 A;  1IRF A;  2EK5 A;  2ZME C;  1LDD A;  3KLN A;  5D5X B;  2Z5U A;  2R7F A;  3KYL A;  1X2N A;  4ZC3 A;  1O3Q A;  3OP9 A;  2V3C C;  1FY7 A;  1BOB A;  3BR2 A;  3RYR A;  2HU9 A;  3AFH A;  4FHT A;  3GTK J;  2DMQ A;  3FX3 A;  3CCJ I;  3R0A A;  4YFN F;  1L3L A;  2XPU A;  1ERD A;  2LFB A;  3R4K A;  1ETO A;  2AW6 A;  4X4E A;  3ZQH A;  2R93 J;  3WOD F;  3OIP A;  2Y2Z A;  3ZR8 X;  2KHM A;  3IL2 A;  1VQK I;  2GA1 A;  2R7Z J;  2QQA A;  1YOV B;  2KKO A;  1B1B A;  4BY7 J;  3FXQ A;  1QPM A;  1IDY A;  1UJ8 A;  3GX4 X;  4GHJ A;  3CJN A;  2HWV A;  2A61 A;  1ZEL A;  5HDK A;  1OFC X;  3K0L A;  2PXL A;  3W6K B;  2L7Z A;  2DJI A;  1NH3 A;  2XKO A;  3HOZ J;  2A6T A;  3FWE A;  2GWR A;  5K98 B;  5FLM J;  5LGN A;  1QQA A;  4JYK A;  4XLN F;  3K7A J;  4HAM A;  3T5X A;  2DK5 A;  2LCV A;  2VIX A;  3TDZ C;  4MEY F;  4I02 A;  1QVU A;  2V4J C;  2GIZ A;  3ZMT A;  1B8I A;  2QBY B;  3OV8 A;  3TP3 A;  3VEP A;  2LNM A;  3QYF A;  2CSF A;  1TT5 B;  2O4A A;  4MNU A;  3S93 A;  2OUM A;  3HPH A;  1FSH A;  1A6Q A;  2AS5 F;  2LKX A;  3P9C A;  2JRT A;  3RZZ A;  2EH3 A;  3ZXS A;  3S1N J;  2EBY A;  4G7Z F;  2F2E A;  2QEN A;  2QSG X;  1E3P A;  4ESB A;  1MKM A;  3GW2 A;  3NQO A;  5JLW A;  3OWQ A;  2QM3 A;  1ZLK A;  1HW5 A;  3HZJ A;  3KZ3 A;  1B4A A;  2X85 A;  1SD5 A;  3HKZ A;  1Z6R A;  3CO6 C;  2OTL I;  5FKL A;  5BS6 A;  2ZME B;  3D1N I;  4Q48 A;  1Y1W J;  2EZK A;  2KPM A;  4XL9 A;  1S7A A;  4LLG F;  2FMY A;  2VLA A;  1LB2 A;  1RUN A;  5BPI A;  1SAN A;  3BZ6 A;  1ZZ7 A;  2VB6 A;  2MG4 A;  4YIR X;  1QBJ A;  1Y8Q B;  5CVV A;  2VBX A;  1ZR2 A;  1MBF A;  1O57 A;  4D9J A;  2MQK A;  2E7W A;  5GPC A;  4PGG A;  1RZS A;  1LCD A;  5EEG A;  5E1W A;  1JGG A;  2XXP A;  3OYC A;  4RGS A;  2P6T A;  2W57 A;  2XVC A;  3BLY A;  5E3N A;  3G73 A;  1SEU A;  3RPU A;  2DPU A;  3BR3 A;  1MD0 A;  1GXQ A;  2KEI A;  2G7U A;  1IXR C;  3BG9 A;  1ZPQ A;  3E6C C;  2KRH A;  2IGO A;  3FXM A;  4BAY A;  4DZJ A;  1WJD A;  2ZXJ A;  3NWT A;  3H5A A;  3H9G A;  1F4K A;  3QU6 A;  5LHI A;  1IN8 A;  1BOA A;  3GO5 A;  3L1P A;  4WCG A;  2ECC A;  2GXB A;  1ZZ6 A;  2X4H A;  4D7N A;  4KIT B;  4L5I A;  4M3G A;  5HS8 A;  5J6X A;  1FLI A;  3HZI B;  2E2I J;  1U6G A;  1ZG1 A;  5DEQ A;  2F4M B;  2BGC A;  2M0M A;  3CP8 A;  2ME0 A;  3TBI A;  2OTJ I;  2R5Y B;  3K9T A;  2K3F A;  3CME I;  2MA3 A;  5CVU A;  2BW3 B;  2QQ8 A;  1GDT A;  1PP8 F;  3MZH A;  2K9L A;  2M4K A;  1F5T A;  4Y13 A;  1X3W B;  3OOU A;  4IRH A;  4E7L A;  2WY7 Q;  4CIC A;  2VKD A;  1Z3X A;  2HCN A;  4OB4 A;  1C0W A;  1VI0 A;  4XSX F;  3WTX C;  4Q47 A;  4FQG A;  4G7H F;  3DKX A;  1ZGW A;  2MW8 A;  1KU3 A;  2CUZ A;  4N4O B;  3DP7 A;  3ZP5 A;  1UG2 A;  2CS3 A;  1Y0U A;  1OYY A;  3WG9 A;  3GTG J;  3HB9 A;  3F8B A;  1S29 A;  1JT6 A;  2STW A;  2DOD A;  3U1D A;  2KIF A;  4G6Q A;  4IL6 C;  5DUK A;  3R0J A;  4LD5 A;  3LAP A;  1ODD A;  2CRO A;  2GM4 A;  4F3Q A;  4ZTF A;  3GEZ A;  2ZKZ A;  4EM0 B;  5F1J A;  2PE5 A;  4I7H A;  3SDB A;  2HYG D;  1U9N A;  4ZH4 F;  3CRO L;  1Z0X A;  2PXV A;  4HNV A;  3K70 C;  4OMZ A;  3P5J A;  2W82 A;  3FYM A;  1HW1 A;  2XI8 A;  5FJ8 J;  1YW9 A;  3FIW A;  4D7M A;  2P5V A;  1QU3 A;  4HA8 A;  1ULY A;  1T6S A;  2PMH A;  5E1Z B;  1R7J A;  1UHM A;  2PEX A;  4YG2 F;  5FRO A;  2CV1 A;  2JMW A;  2K5C A;  3L00 A;  5J3L A;  2W84 A;  1BJA A;  3LA3 A;  3H35 A;  1NEQ A;  2MD5 A;  2EQR A;  3WHC A;  1T08 B;  3TGN A;  4AU7 A;  1AHD P;  3U3W A;  4NB5 A;  4KIG A;  5EG0 A;  3OQM A;  3JTG A;  3F51 A;  3CLC A;  4L0Y B;  3H5T A;  3PL8 A;  3A4C A;  4I6U A;  1TW2 A;  4NDW A;  2P6S A;  4P96 A;  1MMN A;  1Y56 A;  1TNS A;  3ZN0 A;  3QQA A;  3CUQ C;  2F6C A;  3DNV B;  4PU7 A;  2WAE A;  2VXD A;  4GYG A;  2JSC A;  2CO5 A;  2BNO A;  4JOM A;  4E7J A;  4Z2Y A;  3ULQ B;  4KIS A;  1CJG A;  3GCM A;  1QVT A;  2PFB A;  5HOO A;  2RC4 A;  3I5U A;  5D5V B;  2Q0O A;  3BG7 A;  3VPR A;  3VYU B;  1J7K A;  4FX4 A;  2COM A;  3UR3 C;  3TRB A;  4XID A;  3KPH A;  1QPZ A;  2JZY A;  3FDY A;  3A9X A;  1W7P A;  1SVM A;  1IAW A;  3SFI A;  1PUE E;  1QZX A;  4BY1 J;  1KYW A;  1YJ9 I;  4OWR B;  3MKW B;  1ZAR A;  4ZTJ A;  4ESJ A;  4L5E A;  1GV5 A;  2AXL A;  1VND A;  2QWW A;  1O4X A;  1PP7 U;  1R9T J;  2LBF B;  3S1M J;  2HOS A;  3SZG A;  4BE2 A;  4X4G A;  4HNU A;  2JVG A;  3EUS A;  2KP6 A;  2ZJQ F;  4UV9 A;  3A01 A;  2QQB A;  1HC8 A;  2E1N A;  3RYP A;  2ICT A;  1I3A A;  1YTY A;  1D3Y A;  1HDD C;  2D45 A;  2GBY A;  4DE8 A;  1FJL A;  1P7I A;  1HLV A;  5FRN A;  2K9N A;  3FXJ A;  4YFX F;  1X4O A;  2Y48 A;  4IHW A;  3TQN A;  4BAC A;  4B4C A;  2FF4 A;  2M30 A;  1MJA A;  4OBM A;  3GZC A;  1GT0 C;  3OYH A;  1T2K A;  3OYG A;  1AOY A;  1YS6 A;  5B3S H;  3WTS C;  3ERE D;  5FFZ A;  1X1C A;  3FXL A;  2DT7 B;  3BC8 A;  2CU7 A;  1D5Y A;  2DAO A;  4WX9 A;  3H0G J;  2MC4 A;  1WJC A;  3PUB A;  1ETY A;  5KCM A;  4HF0 A;  3QOX A;  5L3F A;  3S1Q J;  1W5C C;  2Y0S N;  4CYD A;  1XMX A;  3KLO A;  1FIA A;  2O9L A;  3CUQ B;  4HV5 A;  4PJN A;  1OIS A;  4BS9 A;  3LA2 A;  3HOT A;  1WPK A;  3SCH A;  2FQ4 A;  3TO9 A;  4XMY A;  4KDP A;  4H4K C;  3E5X A;  4RB0 A;  2BZT A;  3QP6 A;  2HVS A;  2WAQ A;  4O5V A;  3ELK A;  1QZY A;  2VL8 A;  4Y52 J;  2CUJ A;  3LST A;  2WC2 A;  1UXD A;  3OWT A;  4HX7 A;  2CW7 A;  2OA4 A;  3G4S I;  3SQN A;  3QQ6 A;  2NVY J;  3OKZ A;  2K27 A;  2W7N A;  3E0J B;  3QU3 A;  4EZI A;  2IUO A;  1BI2 A;  1WZ2 A;  2DJN A;  2DYR H;  1DUL A;  3ZHI A;  3GZ6 A;  3HTS B;  1E2X A;  1QZE A;  4XOT A;  5M5X J;  1I3Q J;  1TQP A;  2K4B A;  2ICW G;  2L4M A;  2NS7 A;  4HZF A;  1K79 A;  1IDZ A;  2A05 A;  1XSX A;  2IVM A;  2JUC A;  4A0X A;  5E3O A;  4HW0 A;  1YHQ I;  1AKH B;  2PIJ A;  2XHK A;  1TL8 A;  4HRI A;  4DYR A;  3I4N J;  3ECH A;  1ZR4 A;  4BL0 B;  2Z2S B;  2CQQ A;  2O49 A;  4WF2 A;  3C18 A;  4XRS A;  2OQG A;  1N77 A;  1R1T A;  2HZD A;  2TDX A;  4XLA A;  4L5J A;  5JVT A;  5E18 F;  3Q0V A;  4BQN A;  2R7T A;  3GLX A;  2VBZ A;  3TOA A;  2A5W A;  1A6I A;  3TEL A;  3FM5 A;  2CSO A;  2CYY A;  2VQC A;  5EYR A;  1WH5 A;  4PU4 C;  5DUI A;  3U21 A;  4A3E J;  2NYX A;  3F8C A;  2UUZ A;  1ZZC A;  3KFW X;  4C30 A;  1IN7 A;  3T8T A;  9ANT A;  2PBI A;  4F55 A;  2BHZ A;  4CYC A;  4YEJ A;  3BS3 A;  3KXA A;  2M1B A;  4D5F A;  2DMN A;  5F0F A;  3G1O A;  1B6A A;  4KJZ A;  5GAG i;  3OS1 A;  1OMI A;  1VQN I;  3A1Y A;  4M3B A;  2X0L A;  1IV6 A;  5J4V A;  1T39 A;  2MGQ A;  3K4N A;  2VOO A;  3ZMU A;  4XON A;  1HOM A;  2WV0 A;  5GTI C;  4XNF A;  3ESW B;  4XLH A;  3COA C;  1S72 I;  1BI3 A;  2Y9Z A;  2L9R A;  5KAF C;  4DE9 A;  1FOX A;  4K2E A;  3KEQ A;  4LIT A;  1I39 A;  3GTM J;  4F91 B;  5F6F A;  2LYL A;  3OYF A;  1FT9 A;  2JA2 A;  5CKT A;  1XDU A;  3F0C A;  1XDS A;  1J09 A;  4N9I A;  5CQE A;  1MBH A;  3JAM K;  3DBH B;  2BXY A;  2K3P A;  3I59 A;  4R1H A;  3S3N A;  2XAJ A;  2YU9 J;  1Z7L A;  4ANJ A;  3KEY A;  5JHF A;  3J81 Z;  4KN7 X;  1F43 A;  3PNY A;  4IVN A;  3H3U A;  4MLO A;  1KQ0 A;  1BDI A;  3M8F A;  3LL7 A;  3KP6 A;  2IS2 A;  3BZC A;  2DFI A;  2I8D A;  3NDB B;  2I5U A;  2JCG A;  2BNM A;  1T0F A;  5JI6 A;  4BE0 A;  2ZXI A;  3V4G A;  3SCF A;  4CZC A;  3GTJ J;  3SZT A;  1DPR A;  2XSJ C;  3MD2 A;  4A2U A;  2XSD C;  5JLX A;  2WAF A;  4CCJ A;  1OSL A;  1DGR M;  5H20 A;  4A3G J;  2BY1 A;  4CHU A;  3H5N A;  1J75 A;  2EFP A;  1ZAO A;  3JW4 A;  2E1M C;  4WXC A;  3RKX A;  3ZQI A;  5EG0 B;  1LQC A;  1XSD A;  1NK3 P;  3I4P A;  3RI4 A;  1OCC H;  3N05 A;  5M5W J;  1LFB A;  1V5E A;  4X4B A;  1MH3 A;  2EFW A;  4BBR J;  5JR3 A;  2F4I A;  5J1U A;  4BEH A;  1ZZB A;  2GXG A;  1V5F A;  3BPX A;  2R7O A;  3Q5F A;  2UWM A;  3OL4 A;  5FKK A;  5DDG A;  1XWR A;  5IT3 A;  4CCL A;  2XAG A;  1Z3Y A;  1LMB 3;  1UG0 A;  1JFS A;  2M4G A;  2E60 A;  3QPH A;  2HDD A;  1X2L A;  2YSR A;  3BQY A;  1T33 A;  2IPQ X;  5DTQ A;  5FKO A;  3MCZ A;  4GDF A;  4OIP F;  1B9M A;  2F5C A;  1Z6T A;  2DA2 A;  4A6D A;  5EJC A;  2YPR A;  3OS2 A;  1USS A;  2DOF A;  2EA2 A;  1G6N A;  3BJ6 A;  1RRJ A;  2E5N A;  3EYY A;  3DEW A;  4ZZD A;  1TWH J;  2PUG A;  2O8K A;  2O5R A;  2LC2 A;  4ENN A;  3WTY C;  1IXC A;  1XX5 A;  4XBF A;  2PUD A;  3WTW C;  5LFA A;  1UAA A;  1MMA A;  3AG1 H;  3CCV I;  2RQP A;  3KX2 A;  1V54 H;  1PRU A;  3HRM A;  2HS5 A;  3U9G A;  1FTT A;  1POU A;  3SX0 A;  2CQN A;  1BW5 A;  2R5Z A;  3F6W A;  1X19 A;  2H6C A;  2M87 A;  3RKQ A;  3RDI A;  2CGP A;  4YAR A;  3OYL A;  2KRF A;  3ROU A;  1ZZ9 A;  2MH2 A;  1XG1 A;  2V79 A;  4G8X A;  5E79 C;  1Z77 A;  2EPF A;  5GTH C;  3AKZ A;  4BE1 A;  3G5G A;  2NOJ B;  1FIP A;  2M34 A;  5L3C A;  2V1U A;  3DEE A;  3W2A A;  4RB1 A;  4HSR A;  4DBR A;  3LSI A;  3I55 I;  3OQO A;  2CFO A;  1VQP I;  1LPQ A;  2HSG A;  4XR6 A;  3NXH A;  2E1M B;  2VJ5 A;  3NAR A;  1D1A A;  3WGH A;  2VON A;  1JXS A;  2OU2 A;  5GP9 A;  5KHD A;  4PFO A;  4Q4Z F;  3KET A;  3A0B C;  3F21 A;  1UTX A;  4CO8 A;  2L9S A;  1B0N A;  2ADU A;  3DM5 A;  1Z9C A;  2MD0 A;  5FD6 A;  1N25 A;  2K86 A;  2A68 F;  1BC8 C;  3PM1 A;  1KZH A;  3QPL A;  1JE8 A;  2Y0M A;  4BJ6 C;  2JTV A;  2VN2 A;  1LE8 A;  4F7Z A;  2OZU A;  4Z5D A;  4YFK F;  1IJW C;  3PO2 J;  3M9L A;  1CF7 A;  4BHB A;  2H1K A;  2PUC A;  4ZYG A;  2WB1 N;  1D8K A;  1RKT A;  2DFE A;  3VFZ A;  1OLT A;  3HL2 A;  3N97 A;  4ENM A;  3L09 A;  3M1E A;  4IRI A;  2FE3 A;  2CWE A;  2DA1 A;  4PDK A;  2VC1 A;  5A2Q Z;  1ORK A;  3GUU A;  4A69 C;  5IOZ A;  1G8X A;  2MC3 A;  3WU1 B;  2NVT J;  2BOL A;  5HLT A;  2OCC H;  3SCG A;  2XXQ A;  1MFQ C;  4C3J J;  3DPU A;  3JXB C;  3J7Z I;  1XTA A;  5K7F A;  1JI8 A;  2IAI A;  1Y8R B;  3E5Q A;  2LDU A;  3GLL A;  4N4N B;  4RBO A;  5ILU A;  2QEX I;  1GUU A;  2GRM A;  2OR1 L;  1LKX A;  5K7Z A;  4UB6 C;  1QHG A;  1MBJ A;  4B1R A;  1OR7 A;  3HOS A;  3KE2 A;  2PJP A;  1R5G A;  3AL0 B;  4IRG A;  3KYC B;  5D4R A;  3LFU A;  3V8K A;  3WTT C;  1SQ8 A;  2EIM H;  4U7B A;  5DD4 A;  1R4N B;  4NQW A;  5F27 A;  4A5N A;  4ZYH A;  1YJW I;  2DT5 A;  4L9V A;  1TP4 A;  2VQG A;  3QPT A;  3W6V A;  4KFC A;  2BVL A;  3E97 A;  1D8J A;  5J1Y A;  1NTC A;  4CYC B;  5H6R A;  1WI9 A;  2ISY A;  1UXC A;  1BN5 A;  1HXD A;  5IP6 A;  2Z1D A;  4QSH A;  4CH7 A;  3J80 K;  2QUF A;  2JA6 J;  2FJR A;  1EH8 A;  3C2H A;  1FYL A;  2CFX A;  5J8F A;  2FSW A;  5GPA A;  3S3O A;  3QWL A;  4EJT A;  1PER L;  4IPA A;  4LLL A;  3WE2 A;  3F8N A;  5B1A H;  2LLK A;  1H9T A;  4CCO A;  2Q2E A;  3OMY A;  4D0P A;  1YRN B;  4PZJ A;  1RET A;  1WH7 A;  3DPT A;  2EFN A;  2MLG A;  1P4X A;  3KYD B;  1S9H A;  2ZJ2 A;  3LFP A;  5DT2 A;  4ZZL A;  1ZHF A;  3QPS A;  1WWX A;  3DKW A;  4I98 B;  4R79 A;  3FXO A;  1OCZ H;  4M3D A;  1WIZ A;  4O6J A;  1Z7U A;  3C2B A;  5DS9 A;  2AXU A;  2V9P A;  1LEB A;  1U5T B;  4B3A A;  2X51 A;  5HLG A;  3K4K A;  4JX6 A;  1W0T A;  2WTE A;  4C2U A;  2O8X A;  4XKB A;  3HSF A;  1DU0 A;  2DBB A;  2M45 A;  3I59 B;  2RKH A;  5CVR A;  1ADR A;  1ONV A;  2LYS A;  3DCF A;  1EV7 A;  1JT0 A;  2KMU A;  4DZP A;  1OYW A;  4E7K A;  1FX7 A;  1T8I A;  1WFX A;  4IHT A;  1MND A;  4D1Q A;  4RA2 A;  2A6H F;  4Y4R A;  5M5Y J;  4E70 A;  4RAF A;  4UUT A;  5DCM B;  4HDV A;  2FQ3 A;  4KT5 C;  2BXZ A;  4C3I J;  2AUW A;  2DXI A;  3IC7 A;  1JJ6 C;  1RR7 A;  3OMT A;  3L2Q A;  4I6R A;  1G4D A;  2VKV A;  5DTD A;  2J7W A;  3P9I A;  3W2W A;  2X6W A;  4HYE A;  3TL4 X;  4BJT A;  3HKZ N;  1W0U A;  4Z59 A;  4OMY A;  2IA0 A;  2V1D A;  3WGG A;  1DW9 A;  1HQ1 A;  4BHC A;  1P4A A;  1QP7 A;  3GZD C;  2GIV A;  3ZRG A;  2OF7 A;  3QYX A;  3EUH C;  2WY8 Q;  3WTU C;  1FZP B;  2H27 A;  2H8R A;  1G3W A;  3FM3 A;  3HUG A;  1GLN A;  3AG4 H;  3EUK L;  1SD7 A;  3Q9V A;  5D6F A;  4M6Y A;  2UV1 A;  5ICG A;  3DFG A;  4I99 C;  4M6V A;  2VE9 A;  4NNJ A;  1TC3 C;  2JT1 A;  4MFE A;  1HDP A;  1KGS A;  3G1L A;  4BYY A;  4A3L J;  3S2H J;  1K4T A;  2M4H A;  3DLL F;  4CCN A;  2LOO A;  3BTI A;  2R7X A;  2PJR A;  2HPI A;  2L8N A;  2P5K A;  2ZCW A;  4KIC A;  3DTE A;  4FT8 A;  1OPC A;  3CLQ A;  2CG4 A;  2FBI A;  4JK1 X;  1NG6 A;  5J40 A;  4A0Z A;  2C6Y A;  3D5R C;  5EDN A;  1KU7 A;  1EA3 A;  2OV7 A;  3E3V A;  5IT9 Z;  3OYJ A;  4WXH A;  4XLF A;  5E3L A;  2DA3 A;  3G2B A;  1PUF A;  1MDM A;  3KP5 A;  5KNL A;  2XRN A;  1D1C A;  3WU0 A;  2W24 A;  3HOU J;  1XMK A;  2Z99 A;  5BMZ A;  1NER A;  1IZ1 A;  1XD7 A;  4PU3 C;  2OQR A;  2QYO A;  3NEU A;  2M8E A;  3ABL H;  4J1W A;  1GV2 A;  2Y9Y A;  3PUF A;  1SAU A;  2IT0 A;  1R1U A;  2DOA A;  1Z21 A;  4XIC A;  2R7S A;  4LJZ F;  3F23 A;  5HOD A;  2XCJ A;  1YW7 A;  2JVH A;  1TQM A;  3O6B B;  1Y39 A;  2LYK A;  3V8L A;  2P81 A;  1S6L A;  3LWF A;  3EDP A;  4Y33 A;  2O03 A;  3HBL A;  3BCB A;  4S04 A;  1TBX A;  3MFK A;  1TLH B;  4U88 A;  4MGR A;  4DYQ A;  4NC6 A;  3ABK H;  2AXZ A;  5CVI A;  1TW3 A;  1R00 A;  1RES A;  2M5W A;  3TEP A;  2AO9 A;  4M9S A;  2BE5 F;  2NOG A;  4LG0 A;  3AAF A;  2BNN A;  2FX0 A;  1XGM A;  2Y30 A;  2HTJ A;  1UHW A;  1OCT C;  3SYT A;  1ZRE A;  1GXP A;  3HG9 A;  3PIO F;  4GFB A;  1ZG3 A;  2VPL A;  5FLX K;  2DT6 A;  2DOE A;  3CO7 C;  3LA7 A;  1YFH A;  2F4O B;  4I09 A;  3B7H A;  1CF7 B;  4X4D A;  3I3L A;  2NS0 A;  3FF5 A;  5C4J J;  1U8B A;  1F36 A;  4UUV A;  2JPC A;  3CCE I;  4X4I A;  2L7K A;  2WAD A;  2KIS A;  3VB2 A;  4KN4 X;  2K9S A;  3MAJ A;  1QPI A;  3CC7 I;  4EAT A;  4YG4 A;  2L49 A;  1U8R A;  3HTU A;  3IWZ A;  2XGC A;  3G3Z A;  1ZYR F;  3K4C A;  1YIO A;  5TRD A;  1CQT A;  3LIS A;  4U7D A;  2DI3 A;  1PRA A;  1EH6 A;  2R7Q A;  2G9W A;  2F5V A;  3D5L A;  2P4W A;  5KK1 A;  3RZO J;  1MJ9 A;  4S0H B;  2GLO A;  2FRH A;  1JTX A;  3ZMS A;  2R4G A;  4J19 A;  1K78 B;  2ZSI B;  2ZC2 A;  3JRF A;  3CCL I;  3IHU A;  1SD6 A;  1P9Q C;  3FMR A;  1WSU A;  3CC4 I;  4ER0 A;  4G7O F;  4EK9 A;  5JUW A;  4Y17 A;  4ASN A;  5L3G A;  2MH9 A;  4I6Z A;  2Z3Y A;  1IN5 A;  1LEA A;  2KZG A;  3KL4 A;  4ER6 A;  4GQM A;  3FBN B;  3G0T A;  5ICE A;  3BR0 A;  3M07 A;  2JQE A;  1LFP A;  3EQL F;  1D0X A;  4IF4 A;  2HCS A;  4PCQ A;  3C2G A;  1W7P D;  3MQ0 A;  1FC3 A;  4GGG A;  2IGM A;  2YS9 A;  2GRL A;  4NQW B;  2VQH A;  2KIU A;  5HVQ C;  1XGS A;  2DYS H;  4OIQ F;  1TWC J;  2VPR A;  2TCT A;  1QB2 A;  3GN5 A;  2XF6 A;  1OKR A;  1TT0 A;  4A3F J;  2Z33 A;  3FKJ A;  4KUM A;  5F0C A;  2XGD A;  2LLV A;  4Z5H A;  2DA6 A;  5FGM A;  4R8H A;  3MKL A;  5BNG A;  3O2P E;  1JGS A;  1X1P A;  3IAS 2;  3L2R A;  5CYV A;  2HTS A;  1RZR A;  4MCT A;  2Q2E B;  2FBH A;  2BY3 A;  2RN7 A;  2MBF A;  3FYA A;  1HA8 A;  5H2F C;  4I76 A;  1JUM A;  2EIL H;  3M1C A;  4UUS A;  3CCY A;  4I6T A;  2VC0 A;  4GO1 A;  2ID6 A;  4BU2 A;  2HOE A;  3F72 A;  2HYF A;  3DF8 A;  2KDZ A;  4Y15 A;  5GAH i;  2ECB A;  2DK8 A;  5CLS A;  3I9V 2;  1QNT A;  1X57 A;  4Q2J A;  1HCR A;  3OQN A;  1FTZ A;  2HXO A;  1I1S A;  2VE8 A;  2LMD A;  1I6H J;  2YU3 A;  2MXD A;  2A5Y B;  2RQQ A;  4I0A A;  3UFD A;  4EJW A;  4PK4 A;  3JRG A;  2ME6 A;  3L9F A;  3JSP A;  1TZL A;  3F6V A;  5FRM A;  3QP5 A;  3DQV C;  2L01 A;  2V7F A;  2DTR A;  3REO A;  2L02 A;  3OYK A;  1MSE C;  3M4O J;  2B5A A;  2HZT A;  3VOD A;  1NW3 A;  2LKP A;  5DD8 A;  4QPQ A;  2VJ4 A;  4KIB A;  3ZMD A;  1IUY A;  5F08 A;  2K7L A;  1BJZ A;  4HBL A;  4JBA A;  2XRO A;  1RUO A;  1BDH A;  1B8I B;  4ITV A;  2HOA A;  3IKV A;  3CCS I;  4MQ9 F;  1WJA A;  2WAQ N;  3CF2 A;  4H0E A;  3M8J A;  1G3S A;  1G3T A;  4MQV A;  5E1X A;  4LB6 B;  1R23 A;  2KL4 A;  1BW6 A;  2JPB A;  2HQA A;  3S14 J;  3CES A;  3W3C A;  1UB9 A;  1O3R A;  3I53 A;  1BIB A;  5D4S A;  2IJL A;  4UVA A;  3MZ8 A;  3JRI A;  3RZD J;  3BOQ A;  4HF2 A;  3ZN1 A;  3L2U A;  1D0Y A;  2OD5 A;  3HOV J;  4Z58 A;  3H5R A;  3RTR A;  3LSH A;  3ZQG A;  2H94 A;  3IP4 B;  2LD5 A;  1DQU A;  2PJR B;  2KRC A;  4IJA A;  1A04 A;  2O61 A;  1P92 A;  4HLX A;  1HKS A;  2R7D A;  1ZN2 A;  2E35 A;  4I01 A;  5LBQ A;  3V7R A;  5E20 A;  1PUF B;  3MEX A;  2FBK A;  1MDM B;  2JJ7 A;  2KPJ A;  4ESF A;  4CSW A;  4CDG A;  1SMT A;  3CQZ J;  3VK0 A;  4PSX A;  1DP7 P;  2JWT A;  3AG2 H;  1TWF J;  1VPW A;  1SFO J;  3FHZ A;  2YX7 A;  1P4W A;  2JUG A;  4YII A;  3CF5 F;  4A0Y A;  3LSR A;  2E2H J;  4ZYA A;  1FYK A;  3IH4 A;  1RIO H;  3OYA A;  2ID3 A;  4KYW A;  2VOP A;  3TKY A;  4EEF G;  2HQR A;  3MLF A;  1ZQ3 P;  1K83 J;  2NVQ J;  1IN6 A;  2F5D A;  4XK4 A;  3IRQ A;  3FXK A;  3T0Y A;  1VQO I;  3P7N A;  5LEK A;  3JXD L;  2LF8 A;  1RNL A;  2KJB A;  3BPV A;  3K4J A;  3NWS A;  2J5O A;  3KJX A;  4LGW A;  2PMZ A;  1QRY A;  4L9N A;  1WCM J;  4AIK A;  1H8A C;  1N78 A;  2HYJ A;  3LSP A;  2PLY A;  2L3D A;  3RQ4 A;  4AUX A;  3PJR A;  5E3M A;  4EV0 A;  3UWP A;  3JRB A;  4J01 A;  2BV6 A;  2AQF A;  4BDY A;  2M3A A;  3Q0U A;  3PQJ A;  2PPX A;  3MWM A;  4M9Z A;  2Y31 A;  2PN6 A;  2DA4 A;  3T1B A;  4C9Y A;  5FKN A;  4BQA A;  5IYB J;  3OYE A;  2LY1 A;  1B72 A;  1IC8 A;  3PO3 J;  4ER7 A;  4P9U A;  3S32 A;  2XPW A;  2QSF X;  2Q8K A;  2A3S A;  5IOY A;  3BTJ A;  4IXA A;  5ILV A;  3KZI C;  1IG7 A;  1ZH5 A;  2STT A;  1WJB A;  3HRT A;  3MKY B;  4AYB N;  2DN0 A;  5DCF A;  2VKE A;  4C3H J;  4HEA 2;  3VOE A;  3HOW J;  4M72 A;  1S7O A;  1JTY A;  4ENK A;  2HVQ A;  2NNN A;  5FB2 A;  2X6Y A;  1RR8 C;  1WH8 A;  4QWQ A;  2NXN B;  1Y9Q A;  2JN6 A;  2K40 A;  3HEF A;  1GVJ A;  1H9G A;  1XCV A;  2LKS A;  3AG3 H;  4XLP F;  1AA7 A;  3JRH A;  1RKW A;  4Y42 A;  2X1D A;  4RGR A;  1A31 A;  2LK2 A;  3PE5 A;  4MCX A;  2O7O A;  3A2K A;  5DRY A;  4M3F A;  5K7H A;  1OYI A;  3K4B A;  1X3Z B;  2PXP A;  1EH7 A;  1QP4 A;  2YUS A;  2V1N A;  3OSG A;  3BTC A;  5ICF A;  3R61 A;  3OR2 C;  1JUP A;  1X2M A;  3BDN A;  2CRG A;  1FP1 D;  2XAH A;  2AQE A;  2DQR A;  2PXF A;  3BG5 A;  1QGP A;  1WJE A;  3GN5 B;  1R5H A;  3RKY A;  3WTZ A;  2O0Y A;  1FYM A;  2P7C B;  5EZG A;  3KZZ A;  2HQ5 A;  4XLC A;  2DU9 A;  1WGX A;  3OR1 C;  2HOT A;  2ZO4 A;  1UMQ A;  2BYV E;  4OOI A;  3Q3S A;  5ED4 A;  2ISZ A;  4JQD A;  4UVC A;  3F52 A;  5DRT A;  2K85 A;  2CW8 A;  2DFH A;  2R1J L;  4UUS B;  1FMW A;  3L2C A;  1R58 A;  3FBI B;  2EFO A;  1MNE A;  4P1W A;  1ZKG A;  2FOK A;  5FKM A;  3MKZ A;  1Z67 A;  1HQC A;  2ESN A;  4EM2 A;  4PJL A;  4ZJZ A;  1W5T A;  1W7P B;  3CJQ B;  2YR2 A;  1G2H A;  2JVL A;  3ZOB A;  4BUP A;  3UNG C;  1HBX G;  3Q9S A;  2E36 A;  4RM3 A;  2EZI A;  1FP2 A;  2X9D A;  5LRR A;  3QF3 A;  5ERI A;  3TMO A;  4Y3O A;  2WWY A;  2EWT A;  5K5Q A;  3HPG A;  3S17 J;  3GF2 A;  3HSR A;  2M0C A;  2NVU B;  2Y69 H;  2IXS A;  2LVS A;  4M9X A;  3JSO A;  1G59 A;  2RNG A;  3K1P A;  3I54 A;  3CC2 I;  3A01 B;  1CGP A;  4DGW B;  5DTR A;  2ZME A;  2ZJR F;  2VQL A;  1YYV A;  3LNQ A;  1YW8 A;  4XLE A;  1Q1H A;  2XKP A;  4F52 A;  3FHN A;  4FE4 A;  1XS9 A;  4IOA F;  4DOZ A;  2B0L A;  2LNB A;  3RIR A;  3EPZ A;  1XPX A;  3AL0 C;  1PJR A;  1BR4 A;  3DBL B;  3LSK A;  5KAI C;  4DBQ A;  4YRV A;  2XB0 X;  2FJ1 A;  2CUF A;  1UCR A;  2OCE A;  2FNA A;  3OYI A;  2NAZ A;  2GAU A;  4AM3 A;  2ELH A;  3C1D A;  1RPW A;  1ITY A;  3JXC L;  1XGO A;  1IUF A;  2LH9 A;  2QGU A;  1MMD A;  2X1E A;  3KP2 A;  4DNC A;  3SR4 A;  5HS7 A;  2YBD A;  1Y6I A;  3J7A O;  3ZQF A;  2RVC A;  3GYH X;  4P9F A;  4FBI A;  5H6Q A;  3BR1 A;  1J9I A;  1KA8 A;  3KP4 A;  5DM7 F;  4ENJ A;  5J4Y A;  3D0S A;  4ZYD A;  4F8D A;  2UZK A;  1O7F A;  4AVZ A;  1SAX A;  1A5J A;  1FOK A;  2KEK A;  2ESH A;  2FXA A;  5ICC A;  4YG7 B;  2EIJ H;  2OJE D;  4NC7 A;  2W00 A;  5M3M J;  2ZXW H;  4RDU A;  4E7S A;  4WK8 F;  4IHX A;  2B63 J;  1SVL A;  5E8I A;  4A93 J;  4E4H A;  1QQI A;  2EWN A;  4E7I A;  2BY2 A;  2BHY A;  3GBF A;  3S2D J;  1U5T C;  2XPV A;  1VFC A;  2PXQ A;  2R0Q C;  3H1C A;  2R5Y A;  1BIA A;  1D5V A;  2IS1 A;  2LYQ A;  3FXR A;  3ZGK A;  2ZNY A;  2L1P A;  2KZV A;  3QOP A;  1T98 A;  4ABZ A;  4F93 B;  3Q0W A;  3A03 A;  1DDN A;  2JQ7 A;  3GFL A;  2E1O A;  5IP9 J;  3WE3 A;  2IP2 A;  1IF1 A;  3OOP A;  4BDZ A;  4HNT A;  2FUG 2;  4XKW A;  1ACI A;  4BH9 A;  3ZPL A;  2WBM A;  3HSE A;  4IWR A;  2H8W A;  2DCE A;  4NUB A;  5GAG J;  1H89 C;  4IZZ A;  1P6R A;  2GZW A;  1YI2 I;  3X2Q H;  4A3C J;  2RGV A;  1PRV A;  2E5Z A;  1WHU A;  3TOB A;  3LAJ A;  3QOE A;  1YJN I;  1V3F A;  3SFZ A;  1QZZ A;  4LMY A;  2LRD A;  5C4X J;  2A69 F;  1OCP A;  5AIP A;  2R7U A;  3BR5 A;  4RS8 A;  1JWL A;  1XGN A;  3P9K A;  5GAE J;  4QPO A;  3MN2 A;  2E71 A;  4JQF A;  3QYB A;  1Z05 A;  2Q1Z B;  1RI7 A;  2XF5 A;  3I71 A;  4I8T A;  1B72 B;  3K4M A;  2EFQ A;  4AIJ A;  1JHH A;  1I27 A;  1X1B A;  2XAS A;  1QA6 A;  1VQ5 I;  3ABM H;  3DPL C;  4M71 A;  2PG4 A;  5EGO A;  3IUO A;  4YEL A;  3TED A;  1RPE L;  1YQA A;  1MSF C;  4UV8 A;  1EFA A;  2HDC A;  2I10 A;  5BOX A;  1KQ9 A;  2QZ8 A;  1ZK8 A;  4FIS A;  1ZS4 A;  2B9S A;  1O3S A;  2OZ6 A;  1N75 A;  3NRV A;  5TGT A;  1XSV A;  4IOC F;  5B66 C;  1JKO C;  2XAU A;  4UXN A;  4XOP A;  3VYS B;  4AD9 A;  2PX9 A;  3WTV C;  3OL3 A;  2W1O A;  1H0M A;  1T56 A;  1S3J A;  2CQX A;  4II2 A;  5B5E C;  1IRG A;  1EKE A;  1M1E B;  4NC8 A;  2EV0 A;  1KU2 A;  1WVR A;  2L5Q A;  2PXE A;  2KZ8 A;  4XOR A;  1Y7Y A;  2QA4 I;  5IY5 H;  3TDU C;  3J81 K;  3GME A;  3BTL A;  2PXU A;  2HXI A;  5BQT A;  4J1X A;  4PU8 A;  2LY9 A;  3BD1 A;  2MSY A;  1ZRF A;  1DWK A;  4PJJ A;  5HNF A;  2M2E A;  3E6M A;  1ZRC A;  4IX7 A;  2P7V B;  2LP0 A;  3MEJ A;  5IYD J;  1FNN A;  3HRS A;  3CMM A;  5L3E A;  3EYI A;  2P0W A;  5CJ9 A;  3FK7 A;  5F0H A;  2VI6 A;  1SFE A;  3LQR A;  1EF4 A;  2KDO A;  1MIJ A;  2QF7 A;  3BZK A;  4RM2 A;  2L54 A;  2NRA C;  2LYR A;  1FBS A;  2VJJ A;  3BRO A;  3CJR B;  1RC9 A;  5JHU A;  4KA4 A;  4AVP A;  2H09 A;  2LBF A;  3HIF A;  5LGU A;  3E6B A;  1HST A;  2ELK A;  2V9V A;  4LLN A;  2DFF A;  3JR9 A;  4BEH B;  2XRL A;  2G7H A;  3HGY A;  1R69 A;  2ZB9 A;  1E3O C;  3QRF F;  3I56 I;  3RPU D;  3FXU A;  1U2W A;  2M8G X;  3BQZ A;  3VWB A;  3EUA A;  3GZ5 A;  2CV0 A;  4PGH A;  2WIU B;  2ICP A;  2K02 A;  1VQ6 I;  1WKM A;  4KT6 A;  1STZ A;  3ONQ A;  2IBD A;  3D5S C;  1ZZ8 A;  2EJR A;  3S15 J;  3TO7 A;  4LG3 A;  1E3H A;  2JK3 A;  1HW2 A;  2J7U A;  3ME5 A;  5HS9 A;  1X1D A;  3JRE A;  4EQZ A;  1Y0N A;  3DXJ F;  3LSG A;  3QFI A;  3PNT A;  5J8C A;  4IA8 A;  2CW0 F;  1Y1V J;  4B8X A;  2PMU A;  1QP0 A;  3CUQ A;  1D1B A;  1YLF A;  1JFT A;  3OIO A;  1QQB A;  3BG6 A;  2FEZ A;  1ZRD A;  2G0E A;  2HEO A;  3L2V A;  3HC7 A;  4X1E A;  3CCQ I;  2GOM A;  2ETH A;  1I6X A;  3WU2 C;  4QTR A;  3GTQ J;  2OBP A;  3HJE A;  3BCA A;  2R5Z B;  3OSF A;  3R09 A;  3DU5 A;  4F92 B;  4EKI A;  1MZB A;  3L2W A;  2XJ3 A;  1AWC A;  2KEJ A;  2LF7 A;  2IS4 A;  1IV8 A;  4HST A;  1ETX A;  1HKT A;  4DQ2 A;  3TO6 A;  2WV1 A;  3S1R J;  1DP3 A;  5TJJ A;  1ENH A;  1OR7 C;  5DV5 A;  1W5S A;  3ECO A;  2H1L A;  3GFM A;  3FMY A;  5HNH A;  3GTP J;  5CPR B;  4MHG A;  2OC6 A;  3HOY J;  1S5L C;  1XCB A;  2BBY A;  3S2W A;  4AWX B;  2FD5 A;  3ZQC A;  4ZDL A;  5LHH A;  3O8G A;  1NHA A;  6PAX A;  2BVM A;  3TP0 A;  3F8M A;  4EGY A;  1VZ0 A;  1VTN C;  1AKH A;  1VQ4 I;  2FNP A;  3LFK A;  5LEJ A;  1SMY F;  3GTL J;  2B7E A;  3S16 J;  2E7X A;  4KMU X;  2E19 A;  3K1M A;  4GXO A;  2A6C A;  5DSX A;  1BR2 A;  4BXU A;  1LE8 B;  2EF8 A;  1FSE A;  1MW7 A;  3BWG A;  1MBG A;  4HX4 A;  4DYC A;  4EMS A;  3E1S A;  1ZTR A;  4DIQ A;  1TWG J;  4KMF A;  1T95 A;  3NZL A;  3ZKC A;  4N0B A;  2P5L C;  3ASN H;  2XV4 S;  2LY2 A;  2HQN A;  2V9K A;  2RDP A;  1LUJ B;  1WJ5 A;  5HDN A;  3H0D A;  1MMG A;  2HDW A;  4OIR F;  4U0V A;  4FCY A;  3KZY A;  3PQK A;  3QOW A;  1W1W E;  2XGE A;  2Z16 A;  3BT9 A;  4U87 A;  1TTY A;  4FAS D;  3IWF A;  1P2F A;  1A36 A;  3CUO A;  4ETS A;  3K1N A;  3BJA A;  3OYN A;  3ISP A;  2GZU A;  5A2Q K;  1TWA J;  2OFY A;  1BI0 A;  3C3W A;  2V1X A;  3JTH A;  4BJ5 C; 
#chains in the Genus database with same CATH homology
 1XC5 A;  2DA2 A;  2K9Q A;  4O8B A;  3HDD A;  1PUF B;  2JJ7 A;  2KPJ A;  3QWG A;  3HOX J;  1RZR D;  3CQZ J;  1X2N A;  3VK0 A;  4NDL A;  3OP9 A;  3DEW A;  1TWH J;  3ZHM A;  2PUG A;  2JWT A;  2O8K A;  3BR2 A;  4JCY A;  1TWF J;  5EZH A;  3GTK J;  2DMQ A;  1VPW A;  1SFO J;  2PUD A;  2XPU A;  2LFB A;  1ETO A;  2NS8 A;  2AW6 A;  4X4E A;  3ZQH A;  2R93 J;  2Y2Z A;  3LSR A;  1POU A;  2E2H J;  1FTT A;  1PRU A;  3IH4 A;  2R7Z J;  1BW5 A;  2R5Z A;  2ID3 A;  3F6W A;  4BY7 J;  4EEF G;  3MLF A;  3IH3 A;  1ZQ3 P;  1IDY A;  3RKQ A;  1K83 J;  2M9H A;  4GHJ A;  2NVQ J;  2O38 A;  1ZUG A;  4XK4 A;  4YAR A;  1ZZ9 A;  1OFC X;  3JXD L;  2L7Z A;  1XG1 A;  1LLI A;  1I50 J;  3HOZ J;  1Z77 A;  5F04 A;  3KJX A;  3G5G A;  1QRY A;  5K98 B;  1WCM J;  1FIP A;  2M34 A;  5FLM J;  1H8A C;  3OQO A;  4IEJ A;  2HYJ A;  4MFD A;  3LSP A;  1QQA A;  4JYK A;  4AUX A;  5E3M A;  3K7A J;  2HSG A;  3JRB A;  3NAR A;  4JCX A;  2LCV A;  5GP9 A;  1UTX A;  3Q0U A;  1QVU A;  1B8I A;  2PPX A;  5EGO B;  2Y31 A;  3TP3 A;  2DA4 A;  1B0N A;  4DW6 A;  5FKN A;  2CSF A;  2RAE A;  5IYB J;  1B72 A;  1IC8 A;  3PO3 J;  2O4A A;  1MBK A;  4JP0 A;  2LKX A;  3PM1 A;  1ZAY A;  2XPW A;  3QPL A;  3RZZ A;  2PUA A;  2EH3 A;  5IOY A;  3S1N J;  3BTJ A;  1IG7 A;  2EBY A;  1LE8 A;  4Z5D A;  4IHY A;  4AYB N;  1IJW C;  2DN0 A;  3PO2 J;  5JLW A;  1JKR C;  2H1K A;  2VKE A;  2PUC A;  2WB1 N;  1RKT A;  4C3H J;  3KZ3 A;  3S8Q A;  3HOW J;  4W97 A;  3IVP A;  1JTY A;  1WH6 A;  2IVQ A;  5FKL A;  2NVX J;  3D1N I;  1WH8 A;  1Y9Q A;  2JN6 A;  3HEF A;  2DA1 A;  2K40 A;  2EZK A;  1Y1W J;  4A3K J;  1ORK A;  1SAN A;  4A69 C;  5IOZ A;  1ZZ7 A;  4JX5 A;  2JA5 J;  2NVT J;  2MG4 A;  3JRH A;  2XIU A;  3SCG A;  1RKW A;  4C3J J;  1ZR2 A;  4Y42 A;  3JXB C;  2LK2 A;  5K7F A;  4MCX A;  1MBF A;  2O7O A;  2IAI A;  1PNR A;  2MQK A;  5GPC A;  2N8G A;  4M3F A;  2IV1 A;  2CJJ A;  5K7H A;  1FEX A;  1RZS A;  1LCD A;  4A3M J;  4RBO A;  1JGG A;  1GUU A;  2GRM A;  2OR1 L;  5K7Z A;  1QP4 A;  2YUS A;  3OSG A;  1MBJ A;  4B1R A;  5E3N A;  3BTC A;  1JUP A;  3BR3 A;  1X2M A;  3BDN A;  2CRG A;  3E7L A;  1DU6 A;  2KEI A;  1ZPQ A;  3BG9 A;  3BG5 A;  5M3F J;  1SQ8 A;  5IP7 J;  3GN5 B;  4DZJ A;  2PUB A;  4C2M J;  5EZG A;  2HQ5 A;  2IEK A;  5F27 A;  1WET A;  1WGX A;  2HOT A;  1UMQ A;  3W6V A;  1H88 C;  1L1M A;  2COB A;  3Q3S A;  5J1Y A;  3L1P A;  1NTC A;  4CYC B;  2ECC A;  4JQD A;  4BKX A;  1ZZ6 A;  3F52 A;  4D7N A;  1UXC A;  4M3G A;  5IP6 A;  3HZI B;  4QSH A;  2R1J L;  2JA6 J;  2E2I J;  3O8H A;  2FJR A;  1YSE A;  3PXP A;  4UUS B;  5GPA A;  1PER L;  2ME0 A;  2R5Y B;  2DMP A;  1ZKG A;  2LLK A;  5FKM A;  5C3E J;  1GDT A;  1MNM C;  1ETK A;  1VF9 A;  1YRN B;  1RET A;  1WH7 A;  3OOU A;  2LYP A;  3LFP A;  3QPS A;  2HI3 A;  1G2H A;  2JVL A;  4OB4 A;  3ZOB A;  1VI0 A;  4M3D A;  1WIZ A;  2EZI A;  5DS9 A;  3C2B A;  1ZGW A;  2AXU A;  2MW8 A;  2X9D A;  2JA8 J;  4FTH A;  4B3A A;  4AC0 A;  4JX6 A;  1W0T A;  3QF3 A;  2PMZ N;  1UG2 A;  2EWT A;  3UKG A;  3S17 J;  2R92 J;  2LR8 A;  1DU0 A;  2M0C A;  3HB9 A;  3GTG J;  1LCC A;  1JT6 A;  2LVS A;  1ADR A;  4XRM A;  3A01 B;  2LYS A;  3DCF A;  2IU7 A;  4BXX J;  1JT0 A;  2DA5 A;  2D5V A;  2GM4 A;  4DZP A;  3LNQ A;  5F1J A;  2PE5 A;  1GVD A;  1U9N A;  4FE4 A;  1XS9 A;  1Z0X A;  3IH2 A;  4HNV A;  4A3I J;  3CRO L;  5EF6 A;  3FYM A;  5M5Y J;  1IGN A;  4UUT A;  2XI8 A;  2L7F P;  4C3I J;  2XB0 X;  2AUW A;  2FJ1 A;  2CUF A;  2L0K A;  3FIW A;  4D7M A;  5FJ8 J;  4A3D J;  1JJ6 C;  1RR7 A;  3LOC A;  3ZQL A;  3OMT A;  1RPW A;  4MO7 A;  1ITY A;  4I6R A;  2JMW A;  3JXC L;  2VKV A;  5DTD A;  1IUF A;  5J3L A;  2TRT A;  1MH4 A;  1NEQ A;  4W1U A;  2EQR A;  3HKZ N;  3WHC A;  1W0U A;  4Z59 A;  2LTP A;  1DW9 A;  2EZL A;  1QP7 A;  3ZQF A;  2OF7 A;  1AHD P;  5FLV A;  3U3W A;  3QYX A;  4FBI A;  3BR1 A;  2H8R A;  5C44 J;  5EG0 A;  3OQM A;  5A7L A;  3F51 A;  3CLC A;  2DMU A;  3O9X A;  4F8D A;  4IHV A;  3H5T A;  4I6U A;  1A5J A;  2KEK A;  4NDW A;  4M6V A;  4YG7 B;  2PUE A;  1TC3 C;  4RDU A;  4MFE A;  5M3M J;  1HDP A;  3G1L A;  4A3L J;  3QQA A;  3S2H J;  3DNV B;  1JH9 A;  2WUS R;  4IHX A;  2B63 J;  4A93 J;  2R63 A;  2EBI A;  3CMY A;  4PU7 A;  2BNO A;  2PUF A;  3BTI A;  4XRS G;  3GBF A;  2L8N A;  1VFC A;  2XPV A;  1CJG A;  1QVT A;  2R0Q C;  2R5Y A;  2LYQ A;  1OJL A;  5EDN A;  1YRN A;  3VPR A;  3TRB A;  1HF0 A;  1QPZ A;  4XID A;  4ABZ A;  5E3L A;  3Q0W A;  2DA3 A;  3A03 A;  3B6A A;  1PUF A;  3SFI A;  2E1O A;  5IP9 J;  4BY1 J;  3HOU J;  4L5E A;  1GV5 A;  1NER A;  4PU3 C;  1VND A;  4J1W A;  1O4X A;  1GV2 A;  4IWR A;  2Y9Y A;  1R9T J;  1RIO A;  3S1M J;  4XIC A;  2HOS A;  1H89 C;  4X4G A;  5HOD A;  2XCJ A;  3EUS A;  4A3C J;  2DMT A;  1ETW A;  3A01 A;  1PRV A;  2LYK A;  4FN3 A;  2P81 A;  1ZVV A;  2ICT A;  4X4H A;  1HDD C;  2GBY A;  3A02 A;  3HBL A;  1FJL A;  5C4X J;  1P7I A;  1HLV A;  2AHQ A;  2K9N A;  1OCP A;  4DYQ A;  3BR5 A;  2EZH A;  4D5C A;  2AXZ A;  1JWL A;  4IHW A;  1RES A;  4B4C A;  2AO9 A;  3MN2 A;  1GT0 C;  2NOG A;  2BNN A;  2FX0 A;  1JKP C;  4I8T A;  2Y30 A;  1B72 B;  1POG A;  3BG3 A;  1OCT C;  2CU7 A;  1D5Y A;  3H0G J;  3HGG A;  1BL0 A;  3I4M J;  4GFB A;  1Q1V A;  1ETY A;  4X6A J;  5EGO A;  2BJC A;  3TED A;  3S1Q J;  4JX4 A;  4Z5C A;  2Y0S N;  1MSF C;  1RPE L;  1EFA A;  2I10 A;  1FIA A;  4V2F A;  2O9L A;  1ZK8 A;  4FIS A;  3B7H A;  1ZS4 A;  3M3Y J;  4X4D A;  3SCH A;  2E2J J;  1WPK A;  2OPT A;  2FQ4 A;  5C4J J;  1F36 A;  1U8B A;  1JKO C;  4X4I A;  2K9S A;  1AU7 A;  1QPI A;  3FKI J;  4YG4 A;  2L49 A;  4Y52 J;  1T56 A;  3H3V K;  2CQX A;  2QCO A;  2XGC A;  1R63 A;  1UXD A;  3LIS A;  4IVZ A;  1CQT A;  1PRA A;  2W48 A;  2KZ8 A;  1Y7Y A;  3RZO J;  1ETV A;  2AWI A;  3CDL A;  4S0H B;  2GLO A;  3QQ6 A;  2NVY J;  3BTL A;  2X48 A;  1JTX A;  2HXI A;  4J1X A;  4PU8 A;  2LY9 A;  4J19 A;  2MSY A;  1DWK A;  3BD1 A;  1P7J A;  2M2E A;  4A3J J;  3JRF A;  1BA5 A;  2IUO A;  2DJN A;  3ZHI A;  2LP0 A;  5M5X J;  1LFU P;  5IYD J;  1I3Q J;  2X6O A;  5F0H A;  3FK7 A;  2VI6 A;  2NS7 A;  4I6Z A;  1IDZ A;  3RQI A;  1EF4 A;  2QF7 A;  2XB5 A;  3JRD A;  3SJM A;  5E3O A;  4GQM A;  2CUE A;  1AKH B;  2LYR A;  2JA7 J;  2PIJ A;  2IVB A;  3BR0 A;  4DYR A;  3I4N J;  1ZR4 A;  2O49 A;  1JUS A;  2CQQ A;  3BR6 A;  2AXV A;  4M3E A;  5IYC J;  4XRS A;  3IV5 A;  1MBE A;  3K2A A;  2YS9 A;  4BBS J;  2GRL A;  3Q0V A;  3G7D A;  2ELK A;  1A6I A;  2DA7 A;  3JRC A;  1JJ8 C;  3JR9 A;  1TWC J;  4A3B J;  2VPR A;  4G12 A;  5EYR A;  2VUM J;  2TCT A;  1WH5 A;  2XRL A;  1R69 A;  3HGY A;  3TW7 A;  2ZB9 A;  1E3O C;  3GN5 A;  4PU4 C;  4A3F J;  1NK2 P;  5F0C A;  4A3E J;  4X4C A;  2XGD A;  4Z5H A;  2DA6 A;  1X58 A;  2M8G X;  1IRZ A;  1ZZC A;  3BQZ A;  3FIS A;  3MKL A;  5BNG A;  2WIU B;  4MIM A;  2ICP A;  9ANT A;  3HM5 A;  4CYC A;  4V2G A;  3BS3 A;  1RZR A;  3KXA A;  4MCT A;  4D5F A;  2DMN A;  2IBD A;  5F0F A;  3G1O A;  1ZZ8 A;  3S15 J;  3FYA A;  4I76 A;  1JUM A;  2JK3 A;  4UUS A;  1JKQ C;  3CCY A;  4M3B A;  1IV6 A;  4I6T A;  2ID6 A;  2MGQ A;  3JRE A;  1HOM A;  4Y7N J;  3LSG A;  2KDZ A;  4IA8 A;  4YBA A;  1Y1V J;  2ECB A;  2Y9Z A;  3WHB A;  1QP0 A;  2L9R A;  1JFT A;  3OIO A;  1X57 A;  1QQB A;  1HCR A;  3OQN A;  5IPA A;  2G0E A;  2HXO A;  3GTM J;  1FTZ A;  1K61 A;  2LYL A;  4X1E A;  1I6H J;  3CEC A;  4QTR A;  3GTQ J;  3F0C A;  4QIW N;  2R5Z B;  3OSF A;  1MBH A;  1U78 A;  2XJ3 A;  2LYJ A;  3UFD A;  3JRG A;  2KEJ A;  2ME6 A;  4X4F A;  1S7E A;  2YU9 J;  1ETX A;  3S1R J;  2WV1 A;  1MSE C;  3B6C A;  3M4O J;  2B5A A;  1F43 A;  1ENH A;  4MLO A;  1BDI A;  3FMY A;  2MEZ A;  2IVG A;  5F08 A;  3GTP J;  1BJZ A;  2JCG A;  2BNM A;  3JRA A;  3GTO J;  3HOY J;  4FE7 A;  3ZQC A;  2FD5 A;  3GTJ J;  3SCF A;  1B8I B;  1BDH A;  3O8G A;  3G1M A;  3FK6 A;  3TP0 A;  2HOA A;  2XSD C;  5JLX A;  1AKH A;  2WAQ N;  1OSL A;  4A3G J;  3NAU A;  2L7M P;  1BW6 A;  3GTL J;  3S14 J;  3S16 J;  3ZQI A;  5EG0 B;  2E19 A;  3MVP A;  2A6C A;  1LQC A;  1NK3 P;  1LE8 B;  2EF8 A;  4DYC A;  1MBG A;  1U9O A;  1APL C;  1ZTR A;  3SDG A;  1TWG J;  5M5W J;  3ZKC A;  1ETQ A;  1LFB A;  3LSJ A;  5EEA A;  3JRI A;  3RZD J;  1MH3 A;  4X4B A;  4LOC A;  4BBR J;  5J1U A;  4YG1 A;  1ZZB A;  3HOV J;  4Z58 A;  2KT0 A;  3TW6 A;  4FCY A;  1WI3 A;  5FKK A;  3ZQG A;  1XWR A;  2DTZ A;  2LD5 A;  2XGE A;  1LMB 3;  3BT9 A;  3R1F A;  1JFS A;  3GBG A;  2HDD A;  1UHS A;  3BQY A;  1X2L A;  2GZU A;  1T33 A;  2HIN A;  1TWA J;  5J1R A;  2OFY A;  5FKO A;  3S2D J;  2CRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...