1CQTA

Crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
134
Chain Sequence
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*CP*AP*AP*AP*TP*AP*AP*GP*G)-3')
publication title Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 134
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1cqtA02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1cqtA01
3JRCA 2DA3A 1W0TA 1B72A 3S2HJ 3JRHA 2HINA 3S1NJ 1F43A 4IWRA 1A6IA 1LFBA 2DA7A 1OJLA 3BR3A 1OFCX 2YS9A 4PU4C 4X4DA 2OF7A 2IVBA 2HOTA 1DU0A 2DMTA 4DZJA 1JKQC 3A03A 2ME0A 1JJ6C 2B5AA 1RR7A 2X6OA 4LOCA 1APLC 2HDDA 2AXZA 2MQKA 2R5ZB 3GN5A 2XPVA 3FISA 5F0FA 5GPCA 2XPUA 2VUMJ 3KZ3A 1JFTA 4X4IA 3IVPA 4GFBA 3B7HA 2TRTA 3SJMA 3LSPA 5F04A 3LOCA 5EGOA 1LQCA 1MBFA 2X9DA 2LTPA 2O7OA 3IV5A 2EZIA 3QF3A 2L49A 2E2JJ 2BNOA 3B6CA 2L7ZA 3G5GA 3GTKJ 4DYRA 1VNDA 3R1FA 1VI0A 2B63J 3F52A 1HOMA 1WH8A 2L0KA 3LSJA 5F27A 4Y42A 3ZKCA 3LSRA 2DJNA 4C2MJ 2Y31A 4DW6A 1O4XA 3BD1A 2MG4A 4MCTA 4Z5HA 4A3EJ 3MLFA 1U9OA 4X4BA 1GDTA 1YRNB 4XK4A 2PMZN 4A3DJ 3BG9A 1ETQA 4I6UA 1K61A 1XS9A 1YSEA 3O8HA 2WB1N 4V2GA 1TWHJ 1QQBA 5J1UA 1WGXA 2DMPA 1QPZA 1FIPA 3OSFA 2AWIA 4A93J 4J19A 1XWRA 4O8BA 3EUSA 1FEXA 1T33A 1UXCA 4X6AJ 3PO2J 2H8RA 1GV2A 2I10A 2K40A 3ZQHA 2FD5A 4S0HB 2NVYJ 9ANTA 2MW8A 1ZZ9A 3RKQA 2HOAA 5EYRA 1BDHA 3BQZA 4CYCA 4A3JJ 2JVLA 2PUAA 4UUTA 4AYBN 3HOVJ 4D7MA 3RZDJ 5EF6A 1BL0A 2WIUB 4I6TA 5IP6A 2HYJA 3CQZJ 3BG5A 3HB9A 3Q0WA 2CROA 2XIUA 1GV5A 2EF8A 5EGOB 1UMQA 2IU7A 1ZGWA 2ICPA 2XPWA 1QP0A 4M3GA 2AHQA 2CU7A 2MSYA 4OB4A 3HEFA 4M3BA 2DMUA 4A3FJ 4I6RA 2EZHA 2LFBA 1R69A 2AW6A 2EH3A 1I3QJ 3VPRA 2L7MP 2EZKA 3IH2A 2LYKA 1RZRD 5F0HA 3BR1A 2LYSA 4XRMA 3D1NI 4G12A 2AXVA 2IV1A 5JLWA 5IOZA 1GUUA 1BW6A 3A01B 2M0CA 4W1UA 3S16J 2GLOA 2GRMA 1X57A 2TCTA 3BR5A 1JT6A 1JUPA 4B3AA 1P7JA 1U8BA 4DYCA 2COBA 3GBGA 4D5CA 1EF4A 4IEJA 4AC0A 2WAQN 4GHJA 3VK0A 1ZZCA 1LE8A 2A6CA 3FYMA 3S15J 3BR0A 3RZZA 3O9XA 2FX0A 4UUSA 2LLKA 2R1JL 2DMNA 3DCFA 1I50J 4A3LJ 3S8QA 1EFAA 2AO9A 1FTTA 2LYPA 4PU3C 2ID3A 2R93J 5M5WJ 4M6VA 5C4XJ 4IHXA 1UXDA 5FKOA 3JRFA 1PRUA 1QVTA 1WIZA 2CJJA 3ZHIA 1P7IA 1QP7A 4W97A 4D5FA 3FK7A 1E3OC 1H89C 1FIAA 3QYXA 3CMYA 5J1RA 4PU7A 2HXIA 3HOYJ 2XRLA 4MFEA 2OFYA 1QPIA 1RZSA 2O49A 1ENHA 3QPLA 2CRGA 1PRAA 1BDIA 1WH7A 2E19A 4X4HA 3WHCA 1X2NA 1VPWA 3BG3A 2LVSA 2IAIA 1JT0A 2BJCA 4C3HJ 5EZHA 1JKOC 1ETWA 2KZ8A 4V2FA 2PUBA 1UG2A 5M3FJ 1SQ8A 4BY7J 1Q1VA 2E1OA 1FJLA 1R63A 2XI8A 4JX6A 2JN6A 5EZGA 1JUSA 3ZQCA 1BA5A 2ELKA 3JRDA 2LKXA 2PE5A 5IYDJ 5C44J 1LCCA 4IHVA 2N8GA 4EEFG 1ZUGA 4IHYA 1PERL 2LYLA 1UHSA 2FJ1A 2O38A 4B4CA 5JLXA 1MH4A 3HZIB 1CJGA 1PNRA 4X1EA 3S1MJ 2JMWA 1WI3A 1B0NA 5IP7J 3SDGA 1RIOA 3TP3A 5EG0A 3FK6A 5F0CA 3MVPA 3LNQA 2ZB9A 4YARA 1AKHA 2GRLA 4JCYA 2CUFA 1ITYA 4JQDA 4DYQA 1X2LA 3M4OJ 4L5EA 2NS7A 1B72B 5M5YJ 2K9NA 4B1RA 3H3VK 1ZS4A 1MBHA 3GTGJ 4BKXA 1ZZ7A 5FKMA 1Y7YA 3H0GJ 1PUFA 2DA4A 2VKVA 3QWGA 3G1MA 3GTLJ 1JH9A 1SFOJ 2X48A 2XGDA 2H1KA 4JCXA 3OQMA 3ZHMA 1ZQ3P 1RETA 1OCPA 2CUEA 3BTCA 3JRBA 4PU8A 5IP9J 3PM1A 3Q3SA 2VPRA 5EDNA 2E2HJ 1A5JA 3JRAA 3OOUA 3GTJJ 3Q0UA 3GN5B 4QTRA 2AXUA 3JXCL 4YG7B 5C3EJ 2W48A 2LYJA 1SANA 1U9NA 3BTIA 5C4JJ 4JP0A 3G7DA 1JWLA 3FIWA 2JA7J 1IC8A 2Y30A 3BQYA 3CLCA 4IA8A 2KEKA 4YG4A 4J1WA 1ZK8A 2R63A 3OMTA 2KEIA 3H5TA 3G1LA 4FE4A 1B8IA 4DZPA 2GZUA 2LK2A 1IDYA 1Z77A 3GTOJ 4YG1A 2NOGA 1IUFA 5M3MJ 5IYCJ 2EQRA 2GBYA 2NVQJ 1TWGJ 2DA6A 2KDZA 3GTQJ 1MBGA 2QF7A 3ZQGA 1JKRC 4F8DA 5EG0B 1LLIA 1ZAYA 2XB0X 4Z5CA 2EBYA 1WH5A 4MLOA 2PPXA 2XGCA 1D5YA 3F6WA 1ZKGA 3IH3A 2Y9YA 1MNMC 3OQNA 1JTXA 3TEDA 1OCTC 1HDDC 2LD5A 2M34A 4Y7NJ 2Y9ZA 1PRVA 3QQAA 4A3MJ 3ZQLA 2DTZA 1GVDA 1JKPC 1DWKA 1ZZ6A 1VF9A 3NARA 2E2IJ 3B6AA 4NDLA 3UKGA 1MBEA 3C2BA 4HNVA 1TWAJ 3MKLA 4BBRJ 1IG7A 2R0QC 2P81A 1HLVA 2JK3A 2ID6A 2HSGA 4BBSJ 4FN3A 1POUA 1ZZ8A 2R5ZA 2DMQA 3W6VA 4CYCB 2GM4A 1QVUA 1MSEC 1POGA 4M3DA 1HDPA 1MSFC 2LCVA 2XSDC 3SCHA 5J3LA 5DS9A 2XB5A 4I8TA 5K7ZA 1X2MA 2NVXJ 5F08A 1AHDP 3O8GA 3PO3J 1ORKA 2R5YA 3SFIA 1ZR2A 1B8IB 4X4GA 2PUCA 3F51A 4X4EA 1T56A 5E3MA 4I76A 4FTHA 1CQTA 2JA5J 1UTXA 2EWTA 1H8AC 2WUSR 2JA8J 1IJWC 2LYQA 2G0EA 3HDDA 1MBKA 1FTZA 2XGEA 1JTYA 2L8NA 1ETOA 1NTCA 2IVGA 3CROL 3OSGA 1TWFJ 4J1XA 3BS3A 2RAEA 1YRNA 3FKIJ 4A3BJ 5FLMJ 2HI3A 3TRBA 3S17J 1MH3A 2AUWA 4Z58A 3BTLA 1S7EA 1ZZBA 1L1MA 4A3IJ 3JXDL 4FE7A 2JCGA 2PUFA 3DEWA 1LE8B 2LR8A 3SCFA 4XICA 2CQXA 4UUSB 1F36A 2FQ4A 3HGGA 3MN2A 2O4AA 2PIJA 2OR1L 1Y1VJ 2XJ3A 5K7HA 4A3GJ 4JYKA 4XRSA 3I4NJ 4GQMA 2DA5A 1BW5A 2CSFA 3S2DJ 5FKLA 3GTPJ 3CDLA 1TC3C 1GT0C 1IRZA 4QIWN 2XCJA 1WPKA 1JGGA 2KEJA 1Y9QA 5M5XJ 3OIOA 5K98B 3GBFA 2OPTA 3LISA 2IEKA 4MO7A 5E3OA 2O9LA 1IDZA 2KPJA 2CQQA 2ECCA 3JRGA 2R5YB 3LFPA 2LYRA 2LY9A 4A69C 3JRIA 2PUDA 5IPAA 2ICTA 3E7LA 3CECA 3BDNA 4MCXA 1XG1A 3HM5A 2PUGA 1WETA 2NVTJ 1NK2P 4XRSG 2LP0A 2EBIA 4M3FA 4A3CJ 5A7LA 5DTDA 3UFDA 3LSGA 2IBDA 4QSHA 3HKZN 2QCOA 5GP9A 3FYAA 1AU7A 4FBIA 4Z5DA 1OSLA 3A01A 1X58A 3RQIA 2JJ7A 4C3IJ 4RBOA 1RPWA 2VI6A 4FISA 4AUXA 4FCYA 1IGNA 3I4MJ 4MFDA 2KT0A 3JREA 5J1YA 3S14J 3BT9A 2R7ZJ 2EZLA 4NDWA 3HOUJ 2D5VA 1Z0XA 4RDUA 4XIDA 4IHWA 2JA6J 4X4FA 2NS8A 1RKWA 1U78A 1H88C 2HQ5A 3BTJA 1TWCJ 3SCGA 2DA1A 1LFUP 2PUEA 5EEAA 1JJ8C 2VKEA 1ZR4A 4D7NA 1RZRA 2K9QA 2HOSA 1ZPQA 3OP9A 2JWTA 1RPEL 2L7FP 2MGQA 1LCDA 1RKTA 2MEZA 2FJRA 1AKHB 1JUMA 3QPSA 4MIMA 2Y2ZA 2Y0SN 1ADRA 3F0CA 3TW7A 1ETYA 3ZQIA 3ZOBA 3JXBC 1JFSA 3HBLA 3HOWJ 1HCRA 3JR9A 5BNGA 2DA2A 3WHBA 2R92J 4BXXJ 1QP4A 5E3NA 3KJXA 3G1OA 2M8GX 1NERA 5K7FA 4M3EA 2HXOA 3ZQFA 3GTMJ 1ZTRA 3NAUA 1PUFB 3A02A 1ETXA 1HF0A 1Y1WJ 4IVZA 2L9RA 1ETKA 5FKNA 4A3KJ 2ME6A 3QQ6A 5HODA 3CCYA 1W0UA 1RESA 2K9SA 3PXPA 1G2HA 2O8KA 1BJZA 5FJ8J 4Z59A 3U3WA 1IV6A 1QRYA 5F1JA 4ABZA 3IH4A 4I6ZA 1WH6A 3K7AJ 1NK3P 4YBAA 2IVQA 3FMYA 2YUSA 1I6HJ 4C3JJ 1QQAA 3HGYA 5FKKA 5FLVA 3S1QJ 1DW9A 3BR6A 3HOXJ 3OQOA 1VFCA 1MBJA 3TW6A 1ETVA 4JX4A 1ZVVA 2WV1A 5IOYA 5GPAA 1WCMJ 3TP0A 2IUOA 1XC5A 4JX5A 3KXAA 3DNVB 5IYBJ 3M3YJ 2M2EA 1NEQA 2BNNA 3S1RJ 2DN0A 3L1PA 3Q0VA 1LMB3 2ECBA 3K2AA 2YU9J 2M9HA 1R9TJ 4X4CA 2BNMA 3BR2A 4BY1J 3RZOJ 4Y52J 5E3LA 1DU6A 1K83J 3HOZJ
chains in the Genus database with same CATH superfamily
5H6RA 3S2HJ 2VXDA 1OCZH 4XLCA 4OU0A 3GZDC 2HINA 4LB5A 2E60A 1T0FA 3N4MA 4B3XA 1F43A 1P4WA 4OWRB 2HQAA 2M7BA 2OU2A 3S32A 1R4NB 4NC8A 3EPZA 1LFBA 2DA7A 3EUKL 1YTYA 2YS9A 5DRTA 4PU4C 1Z3XA 2K9MA 2OF7A 2B0LA 3AG2H 2VXZA 3KEQA 1DU0A 2DMTA 1JKQC 2ME0A 1ZGAA 1JJ6C 3FXQA 3LQXA 4XM3A 3F6VA 1RR7A 3AL0B 1APLC 2DTRA 5GAHi 4GO1A 3VOEA 2RREA 2ZXWH 3M1EA 1LDKB 1MGTA 4F7ZA 3WTUC 2F48A 3B7HA 2VQCA 2V1DA 5JVGF 3LSPA 2QEXI 5J8CA 5F04A 5EGOA 2XAHA 3H35A 1MBFA 1LQCA 2O7OA 3OKZA 4OIRF 3BOQA 3LQQA 2RNJA 1O3QA 3CUOA 3LWFA 4OIPF 2L7ZA 3D5RC 2QENA 2XRNA 3C2HA 3QWLA 4DYRA 3G5GA 2KISA 1Y8RB 5HS9A 3WTSC 2B63J 1G3YA 3F52A 3M9AA 4OBMA 3CF5F 3LMMA 4PSXA 2O5RA 4HPQA 2DJNA 5FO5A 2Y31A 4DW6A 1BI2A 1O4XA 2UV1A 5LEKA 3MFKA 4Z5HA 4P96A 3BP8A 4RB1A 2PMZN 4HV5A 2GOXB 2BW3A 2OC6A 3BG9A 4I02A 1XS9A 1S7OA 5BS6A 3SDBA 1E2XA 1VQPI 5ICCA 2YU3A 3JCUC 2AWIA 4J19A 1IF1A 3CC7I 3ZMZA 2OQRA 2GA1A 3L00A 2KKOA 4X6AJ 5DSXA 2H8RA 2P5LC 3FMRA 4KISA 3G2BA 3QOXA 2NVYJ 5H2FC 4ANJA 2HOAA 3MQ0A 1DP7P 3S8PA 3P5JA 1BDHA 2JVLA 4DGWB 1A35A 1SFUA 3MCZA 3RZDJ 2VPLA 5BMZA 1BL0A 2WIUB 4I6TA 2XAGA 1VQ5I 6PAXA 1XGMA 4I01A 1ON2A 1ZHFA 2XIUA 2F5VA 1TP4A 4LLNA 4M9XA 5D4SA 3ZQQA 5DTMA 4HSRA 3CCJI 3F8CA 4RA2A 1K6OA 2QM3A 2CU7A 3FXLA 3M07A 1P4XA 3HKZA 4A3FJ 2M1BA 2XDVA 5K5RA 1EA3A 4EM0B 1MNEA 1OLTA 1F9NA 3GVAA 3IH2A 2LYKA 3C7JA 1QBJA 3A1YA 4LLGF 3BR1A 4KIFA 4HW0A 4XRMA 4G12A 1HQCA 5KCMA 2AXVA 2IV1A 3OS2A 1I1GA 3A01B 4E7SA 3S16J 1VQKI 1WI9A 2HTJA 1X57A 1U8BA 2W25A 5ED4A 3BWGA 3FKJA 4D5CA 3IL2A 1STZA 4BYYA 2XVCA 2GXBA 3LSMA 1ZZCA 1LE8A 1G3WA 2DQLA 3S15J 3GCMA 2A6CA 3BR0A 4XMYA 2LLKA 2VJ5A 1EFAA 3KP3A 4BAYA 2A68F 4PU3C 1IO2A 2H1LA 1ZG1A 2HQNA 2R93J 5M5WJ 3TFLA 1IRXA 4M6VA 5C4XJ 4IHXA 3MKYB 1WJCA 2A07F 1YW7A 4ZTJA 2EWNA 4I09A 2CUJA 2YX7A 2Q2EA 2ZNYA 3FK7A 3RKYA 4LK0F 4KJZA 2ZXHA 1H89C 3BROA 3DTKA 2HXIA 2ACJA 3BG6A 2KIUA 2GA2A 4DBRA 1FOXA 1USSA 3EETA 4CO8A 2JA2A 3PE5A 2E36A 4MFEA 2OFYA 1QPIA 3RCOA 1XMAA 1JGSA 2DXIA 2CRGA 5HLGA 4F93B 2DW4A 3T0YA 1VPWA 3BG3A 4L5JA 4U7BA 3FBIB 5EZHA 1X4OA 1ETWA 3WGIA 2BJCA 2PUBA 5GTHC 2QLZA 2LKPA 2E1OA 1FJLA 2PEXA 1KU2A 1LEAA 4JX6A 4AM3A 1BA5A 3M1CA 2HPMA 1T08B 3CJRB 3J80K 2KDOA 2PE5A 4EKGA 2DU9A 3SX0A 2KP6A 3A9ZA 4LFUA 2N8GA 2LRDA 3KYLA 4IHYA 1QHGA 1BR2A 2LYLA 2IT0A 4B4CA 2O38A 3S1MJ 2JMWA 2Z2SB 1B0NA 3SDGA 5E1ZB 5EG0A 2DOAA 4MEXF 3MVPA 1QA6A 3OWQA 2LKSA 2HNHA 2GRLA 2PXEA 3TEPA 4JCYA 1OPCA 2IXSA 4YIRX 4EGZA 3GFIA 4Q2JA 2A6HF 4WWCA 2OD5A 1VTNC 1B72B 2JRTA 2VEOA 4BS9A 1WVRA 3HPHA 4LITA 5FKMA 4E7JA 1K79A 2XAQA 5D4RA 1A31A 4UY8I 3H0GJ 2H94A 4Q47A 2VKVA 3QWGA 1YW9A 4RB2C 1SFOJ 2BHYA 2XGDA 2H1KA 3OQMA 3DEUA 1RETA 1OCPA 3BTCA 5DCMB 4PU8A 3C18A 5IP9J 5EDNA 2E2HJ 2DODA 3JRAA 3E5XA 3GTJJ 4QTRA 1Q1HA 4L9JA 1B9NA 1JWLA 1SANA 5C4JJ 3BTIA 3IKVA 2LMDA 3CLQA 2JA7J 4Y3OA 3PIPF 2Y30A 4Y33A 4IA8A 2KEKA 4J1WA 4XLEA 3G1LA 1GLNA 2HFHA 3R61A 2F5FA 4DZPA 5L3DA 2HKOA 3RSNA 1VZ0A 2GZUA 2ZO4A 2V6EA 3GTOJ 4YG1A 2R7XA 2HZDA 2EQRA 2W24A 3TOAA 2MD5A 1LDJA 1SVMA 2VL8A 3HRMA 2V26A 2K85A 3TMOA 5TRDA 3WGHA 1MBGA 2NAZA 5CQGA 2QF7A 3ZQGA 4ESBA 1XGNA 4OINF 2XB0X 2WB1A 4Z5CA 5LRSA 2FOWA 4KT6A 2PPXA 4IQJA 2R7TA 1FP2A 2F5CA 1LFPA 3H5RA 2FUG2 3TO9A 4J00A 1U5TB 1JTXA 3TEDA 4BDZA 4IHSA 3LL7A 2BGCA 3U1DA 1P2FA 2M34A 1XDUA 3MMYB 3ZQLA 2DTZA 3H9JA 1NH3A 1GVDA 3VODA 1MMSA 4OIOF 2E2IJ 1YX5A 4NDLA 2E1CA 2HVRA 3WGGA 1MBEA 1TWAJ 1XMXA 2E5ZA 4DOZA 5CJ9A 4LB6B 2MBFA 1O3TA 1L3LA 2F4MB 1BIAA 1ZRDA 2JK3A 4E6KG 1QHHD 2HSGA 3DKYA 1R22A 2KQRA 2FBIA 2M45A 3C2GA 3TOBA 3ZPXA 2FA5A 1I6XA 3W6VA 3MKZA 3LQRA 2FMYA 4ENKA 1UZCA 4M3DA 4HOBA 2LCVA 3EYYA 2L7KA 2GIZA 2XB5A 3U2RA 5DS9A 2PMHA 3DLLF 3C1DA 3A9XA 2K4BA 2KRFA 1MJ9A 5IT9K 3IHUA 2UXNA 2H8WA 3DKWA 1ZR2A 4X4GA 3GLXA 3F51A 1J09A 1TW2A 2A5WA 4EMSA 3H9GA 3LSIA 4UB8C 2JA5J 2V79A 1UTXA 4ESJA 2JA8J 2LYQA 5B1BH 3VYSB 1S8NA 2HYGD 4E7ZA 1BR4A 1JTYA 3KZYA 4ETSA 2X6XA 1IAWA 1ETOA 2IVGA 3OSGA 2LLVA 4XLAA 4FASD 4M71A 2QUFA 2RAEA 1ZH5A 2A6EF 4HV6A 3GXOA 2L54A 2AUWA 1IN5A 1EV7A 1ZZBA 5A2QK 1OCRH 1FBQA 1YI2I 3JXDL 1K4TA 1Z1DA 2BVMA 3DEWA 4U7DA 2W82A 1RZ4A 2CQXA 4UUSB 3SZGA 1F36A 3I4PA 5CQEA 2O4AA 1D1AA 1BM9A 1LNWA 1X1AA 3LFUA 4GQMA 3L2VA 1BW5A 4RAGA 5FKLA 3VYTB 3TO6A 3CDLA 4A6EA 3ECOA 4D0PA 2MD0A 4IOCF 2VBYA 3VEPA 3F23A 1K78B 2BEOA 2OPTA 2O9LA 2P8TA 2K02A 1TL8A 2LYRA 2LY9A 4A69C 2DOEA 4L9TA 1I3AA 3CECA 1XG1A 3GUUA 3OYEA 1JI8A 4WXHA 1NK2P 1U8RA 4XRSG 3LAPA 1HKQA 2EBIA 3DV8A 5A7LA 4A3CJ 2R7FA 3R0JA 1Z21A 3FHNA 4CA0A 3I9V2 4I0BA 1Y8QB 4M73A 1H0MA 1CF7B 4RAZA 1SAUA 2EIKH 3DEEA 3FYAA 1OSLA 2VJ4A 4FBIA 4Z5DA 2JSPA 3A01A 3K1PA 4UV9A 1W4MA 4FCYA 1F5TA 2BY1A 1IGNA 5LLQA 2F2EA 2ELHA 5TISC 4IZZA 2R7ZJ 3IRRA 2DT6A 2D5VA 4RDUA 3CP2A 1Z7LA 2HS5A 2EB7A 3CO7C 1U78A 4CICA 1H88C 3S3NA 3ECHA 3BTJA 1TWCJ 2X6WA 3GZNB 1LFUP 3KLNA 3GMEA 2PUEA 1JJ8C 1RI7A 1REPC 2HOSA 5LGNA 2EILH 2MGQA 2D2WA 2EK5A 4EJVA 4N4OB 1AKHB 2STTA 1QZEA 4A2UA 4ER5A 2DT5A 4OAYA 3RPUD 2DDAA 3HBLA 3H9QA 3K4BA 3HOWJ 3QYEA 4Y13A 2DA2A 5F6FA 3A2KA 1HSTA 1QPMA 3TL4X 4LIUA 5B3SH 3KJXA 5DTRA 3J7ZI 1WJBA 2M5WA 5K7FA 3WU0A 3ZQFA 2XROA 3NAUA 4B48A 1RUNA 4L18B 1ETXA 3AG1H 1Y1WJ 1YS7A 3BCBA 4A3KJ 5FKNA 3CCRI 1OCCH 3HRTA 3OOPA 3JTGA 3CCYA 1YHQI 3PXPA 2PXDA 2JPCA 1BJZA 1XTAA 2O8KA 2OTJI 2BBYA 5AIQA 2VQHA 4YRVA 3TKYA 2VE9A 2P4WA 1QRYA 3KZZA 3E3VA 3GFMA 4BEHA 3DQVC 2R7OA 3J81K 3KL4A 1R1TA 2HWVA 1B6AA 3KFWX 2RKHA 5GAGJ 1NK3P 2IVQA 3RTRA 2KRHA 2BOLA 3QOWA 4KIBA 4II2A 1OR7A 3S1QJ 5FLVA 2Z99A 3HOXJ 5LHHA 1MBJA 5HLIA 1W36C 2WV1A 4JX5A 5KNLA 3KXAA 3HL2A 1ERDA 3OWTA 4YFNF 5IYBJ 1SMTA 4PJ0C 2BNNA 4AIKA 2DK5A 2DN0A 3K2AA 2EV6A 2RNGA 2M9HA 2R7QA 2X1DA 4Y52J 1DPRA 3GTMJ 4HQMA 4M6YA 3HOZJ 3JRCA 1HBXG 2QSGX 1B72A 1YITI 1VQ9I 2MH9A 3H3ZA 3FHZA 4BE1A 3BZKA 4XBFA 5J4VA 4ZYHA 3CO6C 2AQEA 1BR1A 1OJLA 4AVZA 1OFCX 4X4DA 2XXQA 2VT2A 3H92A 1FOWA 2HOTA 2E1NA 2R7DA 2QSHX 3G3ZA 2B5AA 2R7SA 2HDDA 3O3KA 2ZFWA 3L2RA 1YE9A 2VUMJ 3J7AO 3KZ3A 2FBKA 3RDIA 4BQOA 2WWYA 4EM1A 1ZREA 3BDDA 3IVPA 2GXGA 5J6XA 1MMAA 3HSRA 1YW8A 1G59A 2QYOA 2HDWA 2LTPA 4ZC3A 2BV6A 3A4CA 2BNOA 1EKEA 2HCNA 2VLAA 1X19A 2I8DA 3GTKJ 2BE5F 1VNDA 1VI0A 1HOMA 2L0KA 2XSJC 2FBHA 3AG4H 3B73A 1OQYA 3W2AA 3EQLF 1VQOI 4C2MJ 4UNOA 4Y17A 5CLSA 2Y48A 3BD1A 1R5GA 2MG4A 4A3EJ 1EJ9A 4X4BA 2ESHA 3KE2A 4XK4A 1U5TA 2MYSA 1O7FA 4A3DJ 3I53A 4I6UA 4H0EA 4A0XA 3HHGA 1QQBA 2J7WA 5J1UA 1WGXA 2BY2A 4A6DA 4AVPA 1XWRA 1VQ8I 3EUSA 1IN7A 1P4AA 2WA0A 2CW8A 3DBLB 1UAAA 3ONQA 4HF2A 1GV2A 2I10A 2EPFA 3EUHA 2F4OB 3ZQHA 3ABKH 2MW8A 3IAS2 5KHDA 3CUQC 2HU9A 4UUTA 4AYBN 5D6EA 2M0MA 4D7MA 4KFCA 1BN5A 1TT5B 1YG2A 5IP6A 2ELJA 3S2WA 3FX3A 2CW0F 3BG5A 2V6CA 3HB9A 3CUQB 2CROA 2BY0A 2EF8A 3SFZA 3U1KA 1UMQA 1AOYA 4OAZA 3K6GA 4XOTA 2EIJH 2GXAA 3DPUA 1ZGWA 2R3SA 2XPWA 3LA7A 1QP0A 1DUXC 2MSYA 2CYYA 2E34A 2AW6A 2PXTA 3IP4B 2IVMA 1I3QJ 3PSIA 2L7MP 3CP8A 2IGKA 1Y6IA 2OA4A 5E79C 4G8XA 2QBYB 3PQJA 4JQFA 2KZGA 3E0JB 3PUFA 4ER7A 1SC7A 4RGUA 1R58A 3HJEA 1MDMB 4GCVA 2M0CA 5ILVA 3LA2A 4IRGA 2GRMA 3CCEI 2HOEA 2P7VB 3FM3A 4KDPA 5CVJA 4AC0A 4EQZA 3FYMA 1R4MB 3O9XA 4UUSA 2XC7A 2Y75A 4CHUA 2R1JL 2IGNA 4RLFA 1S6LA 1FTTA 3SXYA 1I1SA 4HX4A 4I2OA 1UXDA 3QP5A 2C6YA 1IW7F 2Z5UA 3JRFA 4D1QA 4MGRA 3KEYA 1WIZA 1B1BA 2FRHA 2CJJA 3ZHIA 4XSZF 1QP7A 3P9CA 1D8JA 2K4JA 1XPXA 1Y56A 1E3OC 2MLKA 1Y0NA 4BJ6C 4PGHA 3QYXA 4BDYA 2EFQA 4HDUA 4U0YA 1TQPA 2PXLA 2H09A 2LNMA 1X1DA 1HQ1A 4ESFA 3CC4I 3E6BA 4KMFA 1RZSA 4MQVA 1PRAA 2E19A 4NB5A 2HEOA 2M3AA 1CF7A 2IAIA 1YLFA 2OCEA 4DNCA 4E7KA 3DWLE 5DUKA 1SFKA 1UG2A 4IPAA 1QO0D 1JHHA 1Q1VA 2FNPA 4BY7J 2QVOA 3CTAA 3DKXA 2P5KA 1K7AA 1JUSA 3REOA 4WCGA 3JRDA 2X0LA 1Z9CA 3F8MA 4BHCA 4ZYEA 3BG7A 1LUJB 2PJRB 2W85A 4G94A 4KITB 1D3YA 1Z05A 2JVGA 2MA3A 2OZUA 1LCCA 3E6CC 2LF8A 3OL4A 4EEFG 2XF7A 4A12A 4UUVA 1UHSA 5CYVA 2FJ1A 4NUBA 1FLIA 1CJGA 1MH4A 2VQGA 1TW3A 1PNRA 1BI1A 2WBMA 4QWQA 5ILSA 5ILUA 1RIOA 3TP3A 3FK6A 1LQ1A 2ZB9A 4YARA 3Q9VA 1WZ2A 1AKHA 2PXUA 2HZTA 1QGPA 1OYIA 1FX7A 2KJCA 2KZVA 5FGMA 1A36A 4JQDA 4L9NA 4DYQA 2A3SA 4ER6A 2MH2A 2EINH 1A04A 4PZJA 3L9FA 1B4AA 2ESNA 4HBLA 4ER3A 3W2VA 1ZS4A 3H3VK 2HGCA 1ZZ7A 2XF5A 3CD6I 4BE0A 3V7CA 1BJAA 2PMUA 5FB2A 3ABMH 1JH9A 1S3JA 4EGYA 1WKMA 1FC3A 2CFOA 1RUOA 1R71A 3PM1A 3Q3SA 2VPRA 2YX4A 3Q0UA 3GN5B 1Y0UA 2AXUA 2XASA 2O03A 4YG7B 4B43A 2LYJA 4EK9A 1PVEA 3V42A 1KQ9A 1IC8A 2UWMA 1OMIA 2EV0A 2JQEA 2GQQA 2ICWG 1XSDA 2R63A 3OMTA 2KEIA 5D5XB 4BL0B 1B8IA 3MKWB 1TQIA 3K69A 1NG6A 4BHPA 2E71A 2VN2A 5IYCJ 4PK4A 4DE8A 2GBYA 5LBQA 2NVQJ 2GAUA 4RLQA 3TDZC 2PMZA 2KDZA 3GTQJ 3N05A 1JKRC 1ACIA 4IX7A 2LSOA 2LBFB 2NNYA 3IRQA 2CW7A 2EBYA 3E97A 2J5OA 2LNBA 4MLOA 4BJ5C 2P6SA 2XGCA 3WTYC 3RJPA 2L2OA 1Z6TA 2Y9YA 1MNMC 4IRIA 3OQNA 4ZYDA 2ZBKA 1HDDC 3CF2A 2Y9ZA 2NYXA 4PSWA 1U2WA 1DWKA 2V1UA 3NARA 2X51A 4HNVA 4DQ2A 2FSWA 3WE3A 2K27A 3GZ6A 2ID6A 2ZJ2A 1R6RA 3FBNB 2JUCA 3CC2I 4BBSJ 3QOPA 4FN3A 2J7UA 4OOIA 3G71I 1GVJA 1POUA 1ZZ8A 4KN7X 4CYCB 5B66C 1POGA 2M4GA 3H3UA 2MC3A 2K5CA 2V1NA 1TT0A 4UVAA 4EJUA 3OR1C 3T8RA 5K7ZA 2K3PA 1X2MA 2NVXJ 2DI3A 5F08A 4XN3A 3O8GA 4ASNA 3OYMA 2R5YA 1NG7A 3SFIA 1FY7A 1QU3A 4X4EA 1T56A 3IWFA 2V9PA 4I76A 5E3MA 4FTHA 4RGXA 4ZTFA 2DAOA 1N78A 4JBAA 2G0EA 4BUPA 3HDDA 3VWBA 1MBKA 1D0YA 1MKMA 3CROL 1TWFJ 2RVCA 3BS3A 1FP1D 4RM3A 4Q4ZF 4XLNF 3R60A 3S17J 2QZ8A 3RYRA 1MH3A 2MXDA 4Z58A 3H5AA 1S7EA 1RNLA 1FYKA 4XNFA 5K5OA 2DBBA 1VQMI 3L2WA 2Z16A 5DYMA 4NNJA 2OR1L 3JTHA 4BNCA 2ZXIA 4BGDA 1TC3C 3F8BA 4HX7A 2XCJA 1WPKA 1JGGA 2OCCH 2KEJA 5M5XJ 1QNTA 3HRSA 2IGMA 3OIOA 2L9NA 4BQAA 1E3HA 2IEKA 2VJJA 4EZIA 1SMYF 1R5HA 2V7FA 4CUGA 4G7HF 2X85A 2ECCA 2YSRA 4N0BA 4NBQA 5HDNA 4V19K 4Q5SF 2VOPA 3LFPA 3ULQB 2PUDA 3H5NA 2UXXA 1SD5A 5JI6A 4CCJA 3HM5A 4R79A 2QQBA 1HW5A 1RC9A 1OKRA 4ZH4F 3NWSA 1ZG5A 4M3FA 3UFDA 2XV4S 3LSGA 3G73A 2DLLA 1MFQC 2HFZA 3K1NA 4HG2A 1MDMA 4C3IJ 3X2QH 5FFZA 4HNTA 2KHMA 3HRUA 4MFDA 4FX0A 1N25A 1ONVA 1YIOA 2QGUA 4NDWA 4IHWA 3D5LA 1O57A 2NS8A 3FMSA 3DU6A 2WY8Q 3DPTA 4IRHA 3S93A 3GFJA 3QRFF 3RYPA 3GZ5A 3L2QA 2VC0A 5GAGi 3CLOA 3A0BC 2K9QA 5HDGA 3DFGA 4UVBA 5E17F 1O3SA 2NRAC 4E7LA 2M30A 1RKTA 1XX5A 3TQNA 2MEZA 1JHFA 1T8IA 3WTTC 1T38A 2WTEA 3QPSA 1UG0A 2Y2ZA 2Y0SN 4ON0A 4DE9A 1ADRA 3A9YA 3ZOBA 2DYSH 1OYWA 3MZYA 3JR9A 1QP4A 4BXXJ 3F8FA 2FXAA 3CCUI 4IXAA 4FX4A 2PFBA 1SVLA 2VB6A 4PGGA 1FOYA 4S04A 3GZDA 1XCBA 1HW1A 1YIJI 3FXRA 5KAIC 3TBIA 1KQ0A 1C0WA 4HA8A 4KN4X 1KQ8A 1ETKA 3CCVI 2ME6A 1O3RA 5HODA 4YELA 1W0UA 1RESA 2K9SA 2FFHA 5FJ8J 4HF1A 3U3WA 4AU7A 5A2QZ 3CDIA 1WH6A 1V5GA 5ICFA 1JE8A 3K7AJ 1TTYA 1IXRC 1TNSA 3GLLA 4YG2F 3KP7A 3ZMDA 1QQAA 4AIHA 1K6YA 3OQOA 1VFCA 4HYEA 1FYLA 4P5OA 4JOMA 3TW6A 2W7NA 2H6CA 1WCMJ 4MQ9F 3TP0A 3DNVB 4ZYGA 1ZRCA 1WQ2A 4MTDA 3L1PA 1FMWA 2HVQA 1LMB3 3VSLA 4HQEA 2HTSA 2YU9J 2IS2A 4IL6C 2X4HA 4XLFA 1YJWI 2ISZA 1K83J 4AIDA 2ZMEC 1NW3A 3ZGKA 2DA3A 3TELA 4KYWA 3V7RA 1IN8A 4RMNA 3S1NJ 1O7LA 4EJWA 1MW7A 1UCRA 1BOAA 3BR3A 2XXPA 4PJLA 5GTIC 3A03A 1ZLKA 2ZJPF 2X6OA 2AXZA 1QZZA 2R5ZB 3GN5A 2DCEA 2XPVA 3FISA 5GPCA 5E1WA 5DUIA 5DD4A 1JFTA 1S9HA 5TGTA 2D1HA 1YOVB 4MTEA 2TRTA 5KVRA 3SJMA 1V5FA 2HR3A 4PJMA 2FQ3A 3WG7H 3LOCA 2BHZA 2X9DA 4ENJA 1FBUA 2EZIA 3QF3A 1IZ1A 1B9MA 3V8LA 2XF6A 4QLCU 3ME5A 3K4LA 3KIOA 2GIVA 1PP7U 2PXFA 3OS0A 1WH8A 3LSJA 5F27A 3ZMVA 3BPXA 2EJRA 5H20A 3PFYA 4CH7A 3QPTA 2R7RA 2A61A 2LBFA 1R1UA 4QPQA 5L3GA 4EM2A 3I5UA 3MLFA 1YFHA 1EH7A 1GDTA 2GZWA 5LGUA 2GOMA 2O3FA 2FU4A 2AS5F 1XN7A 4G6DA 1ETQA 1K61A 1T0FC 4AD9A 1YSEA 2XAUA 5DDGA 3O8HA 5ICEA 2Q0OA 3HG9A 5ERIA 1OISA 3LFKA 1QPZA 2BXYA 2L9VA 3O2PE 4AIJA 5FLXK 4O8BA 2NS0A 4XQFA 3M8JA 1T33A 1UXCA 3PO2J 1G4DA 2IS1A 2DDBA 2K40A 2FD5A 4OMZA 3MAJA 1FSHA 5EYRA 4EV0A 2E7XA 3BQZA 4CYCA 3S3MA 1IRFA 1H9TA 1X3UA 2PUAA 1MMDA 5D5UB 3HOVJ 3ZP5A 3E5UA 3HOTA 5HNFA 3CQZJ 3FXKA 3DF8A 3Q0WA 2VBZA 1Y39A 5EGOB 2EFOA 2ICPA 4R1HA 3DBRB 3HYIA 4DBQA 2AHQA 4ITVA 2W00A 4OB4A 3HEFA 4M3BA 1OYYA 5D8KB 2ZSHB 4F92B 3UWPA 2Q1ZB 2D1VA 5F0HA 4CGZA 3NROA 3D1NI 1SAXA 5GADJ 1VQNI 1ZGJA 3IUOA 3OYIA 1W36D 2GLOA 2TCTA 3BR5A 3L2CA 4DJAA 2COBA 2ZXJA 3ML6A 1SFXA 5FFXA 1TZLA 4IEJA 2VKDA 2WAQN 3FXMA 5D6FA 3CCSI 5HS7A 3I54A 3WE2A 2K86A 2NVUB 3CCLI 3RZZA 2FX0A 1CGPA 3DCFA 3S8QA 3AKZA 4A3LJ 2ID3A 4AWXB 3JAMK 1LPQA 1ZN2A 3WTZA 4RAYA 2YR2A 4ZDLA 2H27A 1LVKA 5CKTA 5B5EC 1PRUA 2A6TA 1QVTA 4ZJZA 1BC8C 3AFHA 2MFZA 1P7IA 3ZN1A 3EYIA 2HYFA 4D5FA 3CDHA 2LDUA 2V3CC 5J1RA 2VKHA 3NRVA 5EJCA 2G7UA 2VE8A 3H0DA 4M72A 4EJTA 3HOYJ 3L09A 4RGRA 3SEQA 2AXTC 5DD8A 3JSOA 3OYNA 2RQPA 1J5YA 1D0XA 1E17A 1F4KA 2O49A 3ZMSA 1BDIA 3HIFA 2W1OA 1KYZA 1J75A 3FXUA 2X1EA 3W3CA 3WHCA 1X2NA 1YX3A 1FWZA 4B47A 5DCMA 2KZ8A 1MNDA 2LG4A 4HEA2 5LHIA 4L9VA 5M3FJ 1SQ8A 4C2TA 1XCVA 2KJBA 1W5TA 1SD6A 3ZQ7A 2CV1A 2XI8A 2JN6A 4IVNA 3PJRA 1EH8A 3ZQCA 3WG9A 2LKXA 3HUGB 3HTUA 2DPDA 2LH9A 4X0GA 1BC7C 5C44J 3SEZA 5LD2C 2DFHA 4IHVA 3N97A 1ZUGA 1M1EB 2IP2A 4HDVA 1PERL 1FPQA 3IC7A 4XKVA 3HZIB 2OTLI 4X1EA 5IP7J 2DK8A 1XB4A 2IPQX 2Q2EB 4KT5C 5HS8A 3QAHA 2NOJB 1VQ6I 2QA4I 1LDDA 2CUFA 1ITYA 2W57A 3KP6A 1LEBA 4A0ZA 5LGTA 3M4OJ 4L5EA 5E8IA 2NS7A 1V55H 4XRFA 4M9SA 3IKTA 5M5YJ 4XL9A 1MBHA 3I64A 3GTGJ 4IF4A 1Z91A 5DCFA 4MHGA 5LHGA 4YFKF 2DA4A 3G1MA 1V5EA 2BYVE 2ZC2A 2X48A 3FDYA 1OCOH 2VIXA 3DBHB 4JCXA 4R8HA 1ZQ3P 3KPHA 2CUEA 3VYRB 3I3LA 1N77A 1PYVA 3RZOJ 1TQMA 5J8FA 1A5JA 1GHCA 3HSEA 4PUSA 3W6JB 3JXCL 5C3EJ 1AWCA 1XGSA 1R23A 1U9NA 2QKLB 3F72A 4JP0A 4EJOA 4II3A 4FHTA 3CLCA 3GEZA 2MC4A 4XORA 5DRYA 3H5TA 4FE4A 3F8NA 2LOOA 4LMYA 2LK2A 1IDYA 1Z77A 1FYMA 3U9GA 3KYCB 2O8XA 3QPHA 1T98A 4D9JA 5M3MJ 2Y69H 2CV2A 2VODA 1J59A 3NQOA 1DQUA 3CJQB 5EG0B 4KICA 2DJIA 1ZAYA 3WODF 1BBYA 1WH5A 3P9IA 2HDCA 5IT3A 3F6WA 1ZKGA 3IH3A 5AONA 4I7HA 3DPLC 5F1RA 5FD6A 4GRIA 3F22A 3E1SA 1J2XA 5K1YA 3CMEI 1PRVA 3P9KA 4L5IA 1TLHB 3QQAA 4A3MJ 2L01A 1YYVA 1JKPC 4HF0A 3VDXA 2A05A 2CMPA 4EVIA 1J0RA 3UKGA 1X1BA 4BHBA 4CCLA 3M7GA 4AYBA 4BBRJ 2ZJRF 1U3EM 3SHFA 3RPQA 2R0QC 1YS6A 2EFPA 2RDPA 4YFXF 4U87A 2R5ZA 1QVUA 5BPDA 1RIOH 2K9LA 1HDPA 2XSDC 2MABA 4I8TA 3LA3A 1F1ZA 1K78A 4FETA 3QP6A 1G8XA 1A6QA 3NWTA 3MWMA 1ORKA 1P92A 2P5VA 3HXLA 2CQKA 2KIFA 3KP5A 3CMAI 3K4KA 4L0ZB 2LLWA 4PDKA 3ZCOA 1T39A 1IV8A 1FTZA 4GGGA 2OUMA 1XGOA 4HZFA 4XN0A 2BY3A 2KMUA 5HLHA 4A3BJ 3MZ8A 5J40A 3TRBA 2IGOA 3MD2A 4LD5A 4A3IJ 3BZ6A 4Y4RA 1LB2A 2PX9A 2LR8A 3AL0C 1UJ8A 3SCFA 3TO7A 4HSTA 2FQ4A 3ZPLA 1QZXA 4P9FA 4UXNA 4XRSA 4JK1X 2O0YA 2DA5A 3HOSA 1MMNA 3GTPJ 2DO7A 3QOEA 1WWXA 2P7CB 1W7PD 5LRRA 2IRFG 1GT0C 4QIWN 3VYUB 2EV5A 2H6BA 2KIMA 4PFOA 4CCKA 5K98B 3LISA 1DULA 2KPJA 1HKTA 4KIGA 2ZJQF 2CQQA 2A69F 1D5VA 3VWSA 1UB9A 3IWZA 2L02A 2KRCA 3E7LA 3S3OA 1G6NA 4MCXA 2V9KA 2RV8A 2GWRA 2NVTJ 3OYKA 1AA7A 3V8JA 3OYBA 5LFAA 3CZ6A 5J47A 4N4NB 1SD7A 4F52A 4QSHA 3HKZN 2Z33A 5DM7F 2ISYA 2IA0A 1D1CA 5FROA 3OS1A 1X58A 2WADA 3RQIA 1PP8F 3I56I 4RBOA 1RPWA 2VI6A 1VQ4I 4XSXF 1W7PB 3ZMUA 4HLYA 3I4MJ 2KT0A 5J1YA 2MLGA 5JVTA 1KU3A 2TDXA 3HOUJ 3KCCA 1Z0XA 3ZMTA 3RPUA 4XIDA 2JA6J 4X4FA 3HSFA 2ETHA 5CVRA 3ZXSA 3QFIA 5L3BA 4S05A 2HQ5A 3PSFA 3SCGA 1R5ID 2EA4A 1B59A 3GWZA 4F55A 5EEAA 4F91B 3QYFA 2G9WA 2X1CA 3OP9A 5FRMA 2JWTA 1RPEL 4GDFA 2L7FP 4CSWA 1IN6A 4Z6YA 2FJRA 2CUZA 3RQ4A 1JUMA 4MIMA 3F0CA 3K9TA 2CH0A 1W1WE 2FNAA 3JXBC 4ZYAA 4E7HA 5CPRB 3ESWB 3R4KA 3W6KB 2JTVA 3WHBA 5BNGA 5D8LB 2L5QA 3CJTB 3EUAA 4BH9A 3OIPA 2WAFA 4NC7A 2M8GX 1DGWY 1SD4A 4M3EA 1ZTRA 1DP3A 2V4JC 1PUFB 1Z3YA 2EIMH 3A02A 3FXJA 2L9RA 5F64A 1HW2A 4J01A 2XHKA 3DU5A 2QQAA 5HDKA 1UHMA 5BOXA 3TGNA 1G2HA 4LGWA 5DV5A 3R0AA 4EKIA 3ERMA 1V54H 2G7HA 1J9IA 4CYDA 3ELKA 3HUGA 3J80Z 5B1AH 3G0TA 1HKSA 3BPVA 5F1JA 4ABZA 3IH4A 3ISPA 4I6ZA 4P1WA 5E8GA 1SEUA 5EEGA 3H1CA 4RB0A 4WX9A 3FXOA 4C2UA 4ENMA 4RS8A 2XAJA 3OYAA 4CXFA 1V3FA 3FMYA 2YUSA 3IAM2 1I6HJ 4C3JJ 3HGYA 5FKKA 1ZELA 1I27A 1YJNI 1KA8A 2P0WA 3V8KA 1P9QC 2V1XA 3DLAA 5GPAA 1JXSA 1X4PA 1X3WB 4A5MA 1L0OC 2FEZA 3NDBB 4O3MA 1NEQA 2M2EA 4IHTA 4LG0B 1IRGA 3S1RJ 2Z9OA 1KU7A 1VQLI 3VFZA 3K10A 4B44A 2Z3YA 3BR2A 4BY1J 4G6QA 3EDPA 2IA1A 4BE2A 1DU6A 1W0TA 3KP4A 4MEYF 3CCMI 3JRHA 2R7UA 1MMGA 3P7NA 2F4IA 3QU3A 2VBXA 4IWRA 3ASNH 3BLYA 1KZHA 1A6IA 2PN6A 3I58A 3KETA 4K2EA 1U2ZA 1WRJA 1LVAA 4B09A 3KP2A 1KGSA 2IVBA 2QQ8A 4XR6A 4DZJA 4M6XA 1RRJA 2EA2A 1T6SA 4ER0A 4LOCA 2M7AA 3J7YJ 3AAFA 1KONA 2MQKA 1GXQA 2F6CA 1ZRFA 4U0VA 2CWEA 5F0FA 2XPUA 4PJJA 4P9UA 1Z6RA 4X4IA 4GFBA 3GO5A 3BC8A 1WJFA 4KMUX 3CUQA 3BJ6A 3BJAA 4BEHB 1MJAA 2DQRA 1QQIA 1YQAA 3RKXA 4Y15A 2RC4A 1OR7C 3IV5A 5HVQC 3M9LA 2L49A 3KYDB 1HSJA 3D0SA 2E2JJ 4EATA 1W5CC 3B6CA 1ZARA 2Z1DA 3R1FA 4M74A 4UVCA 3T5XA 1WJDA 1I5ZA 4Y42A 3ZKCA 2UUZA 3LSRA 4LLLA 2VBWA 2QBYA 1UHWA 3F9KA 5DEQA 4GXOA 4XLHA 3I59B 4MCTA 4BXUA 3HHHA 1U9OA 1R00A 2ZSIB 3CESA 1YRNB 1XMKA 4IO9F 4IOAF 4GYGA 4YEJA 1SVOA 3C3WA 3ZR8X 3T1BA 5JHUA 2VT3A 2WB1N 2ZCWA 3HZJA 1TWHJ 4V2GA 4BQNA 5LEJA 2DMPA 1FIPA 4O6JA 3H36A 3OSFA 1E0EA 2FE3A 2STWA 4A93J 1V4RA 1WJAA 1YO5C 1FEXA 3K4NA 4I0AA 2JQ7A 4G9YA 4ZZDA 2KPMA 4XONA 5GAHJ 4S0HB 4XOPA 9ANTA 1SFEA 3QU6A 3RKQA 1ZZ9A 5FRNA 4A3JJ 3OYHA 2RN7A 3CMMA 4HRIA 1G3SA 3Q9SA 4UHTA 5EF6A 3PIOF 4U88A 1IXSB 2HYJA 1WFXA 2RGVA 3OL3A 2JUGA 1GV5A 1W5SA 1ZLJA 1R49A 4G6TB 5IT9Z 2KLOA 2YPRA 2OZ6A 2E35A 2IU7A 3OYDA 4M3GA 3VB2A 3OIQA 2DMUA 3U21A 4I6RA 2EZHA 2LFBA 2X6YA 1R69A 3KLOA 2EH3A 4WXDA 2EFWA 2PXVA 1ZAOA 2DOFA 2B7EA 3VPRA 4N9HA 3T8TA 2EZKA 3RIRA 1KYWA 1RZRD 1U5TC 3GYHX 1VQ7I 3F21A 2PG4A 2LYSA 2Y0MA 5H6QA 5KK1A 5JLWA 3K4CA 5IOZA 1GUUA 1BW6A 1DGRM 4W1UA 5AIPA 4F8DA 1JT6A 1JUPA 4B3AA 1P7JA 4DYCA 3D5SC 3GBGA 4NQWB 1EF4A 3HPGA 4TV7A 2R7VA 2QQ9A 3VK0A 2PJRA 4GHJA 3EUHC 2K3FA 3ERED 1D8KA 1FBSA 1WHUA 3E6MA 1LJ9A 1D1BA 2DMNA 4IJAA 1I50J 5JR3A 2AO9A 2RQQA 2LYPA 3G4SI 4WXCA 2LY2A 3NEUA 1IUYA 5JHFA 2CQ7A 5FKOA 2K7LA 1Z67A 3B02A 2Y0SA 2V9VA 2NNNA 1BIBA 2CFXA 2I5UA 2O6GE 2JRMA 2ZFUA 4W97A 2WC2A 2JVHA 4Z2YA 5JFRA 1FIAA 3K4JA 3CMYA 1I39A 4PU7A 3BZCA 2ODRD 3M8EA 4XKCA 4O5VA 4CCMA 3Q5FA 2HQRA 2L4AA 4P55A 2B9SA 4MNUA 1H9GA 2XRLA 2CGPA 1DDNA 2DYRH 1ENHA 3QPLA 2COMA 2VONA 1WH7A 2ZMEB 4X4HA 3HC7A 2HKXA 3CJNA 5CVIA 2LVSA 2PQ8A 1ZG3A 2HPIA 3LAJA 4C3HJ 1JT0A 1JKOC 4V2FA 2KL4A 1HC8A 3DTEA 2VASA 3TDUC 2M4KA 1ON1A 1W7PA 1R63A 4RM2A 5EZGA 2ELKA 3RKWA 5FLXZ 2PJPA 2HVSA 5IYDJ 3LSKA 1ODDA 3ABUA 1R1VA 3R6SA 2W84A 4WF2A 4KA4A 2CG4A 1T2KA 5IY5H 1XDSA 3GFLA 2AQFA 5JLXA 3A0HC 1WI3A 2LF7A 5ICGA 4U0WA 5E18F 3L7WA 2JSCA 2PI0A 1TBXA 2CO5A 5F0CA 5L3CA 3LNQA 4N9IA 1NHAA 3ASOH 4OIQF 4E70A 4I98B 3QYBA 1S29A 2M8EA 1S5LC 2PLYA 3LSTA 1X2LA 3ABLH 4RAFA 3DM5A 3WU2C 2ADUA 2K9NA 4B1RA 3KX2A 2DFFA 3SZTA 4BKXA 1FSEA 1Y7YA 1G3TA 1U6GA 3BJOA 1BOBA 3RI4A 2CS3A 2L9SA 1PUFA 3GTLJ 1HXDA 2PXKA 3E5QA 3ZHMA 4M9ZA 1HA8A 3PFIA 3JRBA 1D0ZA 2WAEA 3MEXA 3FM5A 3OOUA 2KIQA 1EH6A 2DT7B 1UFMA 2W48A 3G7DA 2OJED 3FIWA 3J81Z 1IXCA 3BQYA 3GX4X 4B8XA 2PBIA 1BI0A 4C9YA 1ZK8A 3WTXC 4YG4A 4LG3A 4KNYA 3COAC 3MEJA 2O61A 5L3EA 2IS4A 2DFEA 3JAMZ 3KZIC 2AXLA 1PJRA 2NOGA 1IUFA 4LJZF 4RB3C 2FOKA 2L4MA 3FZVA 1FOKA 1TWGJ 2DA6A 4G7ZF 4BACA 3KEOA 3ABTA 3PNYA 5J4YA 1LLIA 4LG0A 1XD7A 2PXQA 1R7JA 1D5YA 3F6OA 2IW5A 5HLTA 2YBDA 2BW3B 3JW4A 2WV0A 1OCTC 2LD5A 4Y7NJ 3SZPA 2OQGA 3W2WA 1ZZ6A 1VF9A 4QPOA 3B6AA 5CVUA 1X1CA 3C2BA 5BPIA 4WK8F 3ZN0A 3MKLA 2JPBA 4HRAA 2IJLA 1IG7A 5EEHA 2P81A 1HLVA 4HLXA 2LYCA 2DMQA 4I99C 1LKXA 5BQTA 2GM4A 1MSEC 3OYGA 5D5WB 1MSFC 3SCHA 5J3LA 1FT9A 3PUBA 2XGXA 2E1MC 3CCQI 3MZHA 1YJ9I 1QZYA 2WY7Q 3BY6A 4F3QA 1RR8C 3PQKA 5KAFC 1AHDP 3PO3J 3ROUA 2XKOA 3V7SA 2CQNA 2L3DA 2E5NA 1B8IB 2E1MB 2PUCA 1MD0A 1CQTA 3OYFA 2EWTA 2WUSR 1H8AC 4G7OF 1IJWC 3K0LA 1DPUA 3GW2A 4YIFA 3HTSB 3QODA 2CV0A 2XGEA 1IN4A 4NC6A 3E6DA 4OMYA 2L8NA 3FWEA 5DT2A 4HNUA 1NTCA 4BQQA 2ZKZA 3I59A 1QB2A 4J1XA 2WAQA 2DPUA 1YRNA 4WVLA 3FKIJ 2LREA 2FMLA 4C30A 5FLMJ 2HI3A 3PL8A 1S72I 5HOOA 2XAFA 3BTLA 5JUWA 1L1MA 1J7KA 2Q8KA 3L2UA 4FE7A 2JCGA 2JT1A 3I55I 2PUFA 1XSVA 4A0YA 3WU1B 4DIQA 3OR2C 1LE8B 1P6RA 2EFNA 3V4GA 4XICA 3K4MA 3OYCA 1TNTA 1UELB 4CDGA 5L3FA 3HGGA 3MN2A 2M87A 3OY9A 2PIJA 3DTIA 2F5EA 1Y1VJ 2BXZA 2XJ3A 5K7HA 4A3GJ 1FNNA 4JYKA 1PDNC 3K1MA 4H4KC 3I4NJ 4HAMA 2OAZA 2CSFA 3S2DJ 3UNGC 3GZCA 3SR4A 1IRZA 3WTVC 1KU9A 1WJ5A 3PNTA 1Y9QA 3NXHA 3GBFA 4MO7A 5E3OA 1IDZA 4CCOA 2BVLA 2CSOA 3JRGA 2R5YB 1ZYRF 3JRIA 5IPAA 2ICTA 3BDNA 2F5DA 2QKMB 3DP7A 1WETA 2PUGA 2LC2A 2PXBA 1X1PA 2LP0A 2OV7A 1FZPB 5FD5A 1BI3A 5DTDA 2XKPA 4E7IA 1MIJA 3BCAA 3UR3C 2IBDA 2A5YB 2QCOA 4Q48A 5GP9A 1AU7A 1K4SA 3K2ZA 5D5VB 2IS6A 2JJ7A 3SQNA 4FISA 4NQWA 4AUXA 2XXAA 3LSHA 4GYIA 3JREA 2XIGA 3S14J 4ZZLA 3BT9A 4L0YB 2EZLA 3I71A 3FF5A 2IA2A 1FMVA 1RKWA 3GF2A 3DXJF 2DFIA 3F3XA 3O6BB 2DA1A 5K5QA 4XKWA 2NXNB 2VKEA 3FMQA 1ZR4A 4IQ4A 2BZTA 5DTQA 4D7NA 1RZRA 1ZPQA 3JSPA 4UB6C 4E4HA 2QSFX 1R36A 2R7WA 1LCDA 1E3PA 1T95A 2R4GA 4LK1F 2W4SA 2LY1A 3TW7A 1ETYA 3ZQIA 2ZNZA 5CVVA 3M8FA 1JFSA 1HCRA 2KFDA 2R92J 5E3NA 3R09A 2FF4A 3G1OA 1WSUA 1WJEA 3OYLA 1PUEE 1NERA 2ZMEA 2HXOA 4ZDPA 2VQLA 3WTWC 4ENNA 2VJIA 5TJJA 2D45A 1HF0A 4IVZA 4A5NA 1S7AA 4YIIA 3K70D 3QQ6A 4PCQA 5GAEJ 2P6TA 4ZDOA 3VSKA 4BXFA 4FQGA 4Z59A 3GUDA 2JZYA 1XSXA 5DM6F 1IV6A 2HCSA 4PJNA 1ULYA 4LIVA 4FT8A 4RGSA 3I0TA 4EQQA 2J5PA 3ZRGA 1GXPA 2VC1A 1N75A 4HX8A 4YBAA 3PNVA 4PFPA 2L1PA 2XUBA 1USTA 1MZBA 4CZCA 3BR6A 1DW9A 2M4HA 1X3ZB 4BJTA 3K70C 2PXPA 2VOOA 3NZLA 1ETVA 4JX4A 2E7WA 2QWWA 3OV8A 4KUMA 4BU2A 4CCNA 5IOYA 2UZKA 2IUOA 1XC5A 4IKFA 1ZVVA 4UV8A 1U0JA 5HNHA 3OYJA 5E20A 3M3YJ 3AG3H 1MJBA 3OMYA 2OBPA 3Q0VA 2ECBA 5E1XA 3J7AY 1Z7UA 3SYTA 4CZZA 1R9TJ 4X4CA 4XLPF 4XKBA 2BNMA 3G6EI 4NHJA 5E3LA
chains in the Genus database with same CATH topology
3JRCA 2DA3A 1W0TA 1B72A 3S2HJ 3JRHA 2HINA 3S1NJ 1F43A 4IWRA 1A6IA 1LFBA 2DA7A 1OJLA 3BR3A 1OFCX 2YS9A 4PU4C 4X4DA 2OF7A 2IVBA 2HOTA 1DU0A 2DMTA 4DZJA 1JKQC 3A03A 2ME0A 1JJ6C 2B5AA 1RR7A 2X6OA 4LOCA 1APLC 2HDDA 2AXZA 2MQKA 2R5ZB 3GN5A 2XPVA 3FISA 5F0FA 5GPCA 2XPUA 2VUMJ 3KZ3A 1JFTA 4X4IA 3IVPA 4GFBA 3B7HA 2TRTA 3SJMA 3LSPA 5F04A 3LOCA 5EGOA 1LQCA 1MBFA 2X9DA 2LTPA 2O7OA 3IV5A 2EZIA 3QF3A 2L49A 2E2JJ 2BNOA 3B6CA 2L7ZA 3G5GA 3GTKJ 4DYRA 1VNDA 3R1FA 1VI0A 2B63J 3F52A 1HOMA 1WH8A 2L0KA 3LSJA 5F27A 4Y42A 3ZKCA 3LSRA 2DJNA 4C2MJ 2Y31A 4DW6A 1O4XA 3BD1A 2MG4A 4MCTA 4Z5HA 4A3EJ 3MLFA 1U9OA 4X4BA 1GDTA 1YRNB 4XK4A 2PMZN 4A3DJ 3BG9A 1ETQA 4I6UA 1K61A 1XS9A 1YSEA 3O8HA 2WB1N 4V2GA 1TWHJ 1QQBA 5J1UA 1WGXA 2DMPA 1QPZA 1FIPA 3OSFA 2AWIA 4A93J 4J19A 1XWRA 4O8BA 3EUSA 1FEXA 1T33A 1UXCA 4X6AJ 3PO2J 2H8RA 1GV2A 2I10A 2K40A 3ZQHA 2FD5A 4S0HB 2NVYJ 9ANTA 2MW8A 1ZZ9A 3RKQA 2HOAA 5EYRA 1BDHA 3BQZA 4CYCA 4A3JJ 2JVLA 2PUAA 4UUTA 4AYBN 3HOVJ 4D7MA 3RZDJ 5EF6A 1BL0A 2WIUB 4I6TA 5IP6A 2HYJA 3CQZJ 3BG5A 3HB9A 3Q0WA 2CROA 2XIUA 1GV5A 2EF8A 5EGOB 1UMQA 2IU7A 1ZGWA 2ICPA 2XPWA 1QP0A 4M3GA 2AHQA 2CU7A 2MSYA 4OB4A 3HEFA 4M3BA 2DMUA 4A3FJ 4I6RA 2EZHA 2LFBA 1R69A 2AW6A 2EH3A 1I3QJ 3VPRA 2L7MP 2EZKA 3IH2A 2LYKA 1RZRD 5F0HA 3BR1A 2LYSA 4XRMA 3D1NI 4G12A 2AXVA 2IV1A 5JLWA 5IOZA 1GUUA 1BW6A 3A01B 2M0CA 4W1UA 3S16J 2GLOA 2GRMA 1X57A 2TCTA 3BR5A 1JT6A 1JUPA 4B3AA 1P7JA 1U8BA 4DYCA 2COBA 3GBGA 4D5CA 1EF4A 4IEJA 4AC0A 2WAQN 4GHJA 3VK0A 1ZZCA 1LE8A 2A6CA 3FYMA 3S15J 3BR0A 3RZZA 3O9XA 2FX0A 4UUSA 2LLKA 2R1JL 2DMNA 3DCFA 1I50J 4A3LJ 3S8QA 1EFAA 2AO9A 1FTTA 2LYPA 4PU3C 2ID3A 2R93J 5M5WJ 4M6VA 5C4XJ 4IHXA 1UXDA 5FKOA 3JRFA 1PRUA 1QVTA 1WIZA 2CJJA 3ZHIA 1P7IA 1QP7A 4W97A 4D5FA 3FK7A 1E3OC 1H89C 1FIAA 3QYXA 3CMYA 5J1RA 4PU7A 2HXIA 3HOYJ 2XRLA 4MFEA 2OFYA 1QPIA 1RZSA 2O49A 1ENHA 3QPLA 2CRGA 1PRAA 1BDIA 1WH7A 2E19A 4X4HA 3WHCA 1X2NA 1VPWA 3BG3A 2LVSA 2IAIA 1JT0A 2BJCA 4C3HJ 5EZHA 1JKOC 1ETWA 2KZ8A 4V2FA 2PUBA 1UG2A 5M3FJ 1SQ8A 4BY7J 1Q1VA 2E1OA 1FJLA 1R63A 2XI8A 4JX6A 2JN6A 5EZGA 1JUSA 3ZQCA 1BA5A 2ELKA 3JRDA 2LKXA 2PE5A 5IYDJ 5C44J 1LCCA 4IHVA 2N8GA 4EEFG 1ZUGA 4IHYA 1PERL 2LYLA 1UHSA 2FJ1A 2O38A 4B4CA 5JLXA 1MH4A 3HZIB 1CJGA 1PNRA 4X1EA 3S1MJ 2JMWA 1WI3A 1B0NA 5IP7J 3SDGA 1RIOA 3TP3A 5EG0A 3FK6A 5F0CA 3MVPA 3LNQA 2ZB9A 4YARA 1AKHA 2GRLA 4JCYA 2CUFA 1ITYA 4JQDA 4DYQA 1X2LA 3M4OJ 4L5EA 2NS7A 1B72B 5M5YJ 2K9NA 4B1RA 3H3VK 1ZS4A 1MBHA 3GTGJ 4BKXA 1ZZ7A 5FKMA 1Y7YA 3H0GJ 1PUFA 2DA4A 2VKVA 3QWGA 3G1MA 3GTLJ 1JH9A 1SFOJ 2X48A 2XGDA 2H1KA 4JCXA 3OQMA 3ZHMA 1ZQ3P 1RETA 1OCPA 2CUEA 3BTCA 3JRBA 4PU8A 5IP9J 3PM1A 3Q3SA 2VPRA 5EDNA 2E2HJ 1A5JA 3JRAA 3OOUA 3GTJJ 3Q0UA 3GN5B 4QTRA 2AXUA 3JXCL 4YG7B 5C3EJ 2W48A 2LYJA 1SANA 1U9NA 3BTIA 5C4JJ 4JP0A 3G7DA 1JWLA 3FIWA 2JA7J 1IC8A 2Y30A 3BQYA 3CLCA 4IA8A 2KEKA 4YG4A 4J1WA 1ZK8A 2R63A 3OMTA 2KEIA 3H5TA 3G1LA 4FE4A 1B8IA 4DZPA 2GZUA 2LK2A 1IDYA 1Z77A 3GTOJ 4YG1A 2NOGA 1IUFA 5M3MJ 5IYCJ 2EQRA 2GBYA 2NVQJ 1TWGJ 2DA6A 2KDZA 3GTQJ 1MBGA 2QF7A 3ZQGA 1JKRC 4F8DA 5EG0B 1LLIA 1ZAYA 2XB0X 4Z5CA 2EBYA 1WH5A 4MLOA 2PPXA 2XGCA 1D5YA 3F6WA 1ZKGA 3IH3A 2Y9YA 1MNMC 3OQNA 1JTXA 3TEDA 1OCTC 1HDDC 2LD5A 2M34A 4Y7NJ 2Y9ZA 1PRVA 3QQAA 4A3MJ 3ZQLA 2DTZA 1GVDA 1JKPC 1DWKA 1ZZ6A 1VF9A 3NARA 2E2IJ 3B6AA 4NDLA 3UKGA 1MBEA 3C2BA 4HNVA 1TWAJ 3MKLA 4BBRJ 1IG7A 2R0QC 2P81A 1HLVA 2JK3A 2ID6A 2HSGA 4BBSJ 4FN3A 1POUA 1ZZ8A 2R5ZA 2DMQA 3W6VA 4CYCB 2GM4A 1QVUA 1MSEC 1POGA 4M3DA 1HDPA 1MSFC 2LCVA 2XSDC 3SCHA 5J3LA 5DS9A 2XB5A 4I8TA 5K7ZA 1X2MA 2NVXJ 5F08A 1AHDP 3O8GA 3PO3J 1ORKA 2R5YA 3SFIA 1ZR2A 1B8IB 4X4GA 2PUCA 3F51A 4X4EA 1T56A 5E3MA 4I76A 4FTHA 1CQTA 2JA5J 1UTXA 2EWTA 1H8AC 2WUSR 2JA8J 1IJWC 2LYQA 2G0EA 3HDDA 1MBKA 1FTZA 2XGEA 1JTYA 2L8NA 1ETOA 1NTCA 2IVGA 3CROL 3OSGA 1TWFJ 4J1XA 3BS3A 2RAEA 1YRNA 3FKIJ 4A3BJ 5FLMJ 2HI3A 3TRBA 3S17J 1MH3A 2AUWA 4Z58A 3BTLA 1S7EA 1ZZBA 1L1MA 4A3IJ 3JXDL 4FE7A 2JCGA 2PUFA 3DEWA 1LE8B 2LR8A 3SCFA 4XICA 2CQXA 4UUSB 1F36A 2FQ4A 3HGGA 3MN2A 2O4AA 2PIJA 2OR1L 1Y1VJ 2XJ3A 5K7HA 4A3GJ 4JYKA 4XRSA 3I4NJ 4GQMA 2DA5A 1BW5A 2CSFA 3S2DJ 5FKLA 3GTPJ 3CDLA 1TC3C 1GT0C 1IRZA 4QIWN 2XCJA 1WPKA 1JGGA 2KEJA 1Y9QA 5M5XJ 3OIOA 5K98B 3GBFA 2OPTA 3LISA 2IEKA 4MO7A 5E3OA 2O9LA 1IDZA 2KPJA 2CQQA 2ECCA 3JRGA 2R5YB 3LFPA 2LYRA 2LY9A 4A69C 3JRIA 2PUDA 5IPAA 2ICTA 3E7LA 3CECA 3BDNA 4MCXA 1XG1A 3HM5A 2PUGA 1WETA 2NVTJ 1NK2P 4XRSG 2LP0A 2EBIA 4M3FA 4A3CJ 5A7LA 5DTDA 3UFDA 3LSGA 2IBDA 4QSHA 3HKZN 2QCOA 5GP9A 3FYAA 1AU7A 4FBIA 4Z5DA 1OSLA 3A01A 1X58A 3RQIA 2JJ7A 4C3IJ 4RBOA 1RPWA 2VI6A 4FISA 4AUXA 4FCYA 1IGNA 3I4MJ 4MFDA 2KT0A 3JREA 5J1YA 3S14J 3BT9A 2R7ZJ 2EZLA 4NDWA 3HOUJ 2D5VA 1Z0XA 4RDUA 4XIDA 4IHWA 2JA6J 4X4FA 2NS8A 1RKWA 1U78A 1H88C 2HQ5A 3BTJA 1TWCJ 3SCGA 2DA1A 1LFUP 2PUEA 5EEAA 1JJ8C 2VKEA 1ZR4A 4D7NA 1RZRA 2K9QA 2HOSA 1ZPQA 3OP9A 2JWTA 1RPEL 2L7FP 2MGQA 1LCDA 1RKTA 2MEZA 2FJRA 1AKHB 1JUMA 3QPSA 4MIMA 2Y2ZA 2Y0SN 1ADRA 3F0CA 3TW7A 1ETYA 3ZQIA 3ZOBA 3JXBC 1JFSA 3HBLA 3HOWJ 1HCRA 3JR9A 5BNGA 2DA2A 3WHBA 2R92J 4BXXJ 1QP4A 5E3NA 3KJXA 3G1OA 2M8GX 1NERA 5K7FA 4M3EA 2HXOA 3ZQFA 3GTMJ 1ZTRA 3NAUA 1PUFB 3A02A 1ETXA 1HF0A 1Y1WJ 4IVZA 2L9RA 1ETKA 5FKNA 4A3KJ 2ME6A 3QQ6A 5HODA 3CCYA 1W0UA 1RESA 2K9SA 3PXPA 1G2HA 2O8KA 1BJZA 5FJ8J 4Z59A 3U3WA 1IV6A 1QRYA 5F1JA 4ABZA 3IH4A 4I6ZA 1WH6A 3K7AJ 1NK3P 4YBAA 2IVQA 3FMYA 2YUSA 1I6HJ 4C3JJ 1QQAA 3HGYA 5FKKA 5FLVA 3S1QJ 1DW9A 3BR6A 3HOXJ 3OQOA 1VFCA 1MBJA 3TW6A 1ETVA 4JX4A 1ZVVA 2WV1A 5IOYA 5GPAA 1WCMJ 3TP0A 2IUOA 1XC5A 4JX5A 3KXAA 3DNVB 5IYBJ 3M3YJ 2M2EA 1NEQA 2BNNA 3S1RJ 2DN0A 3L1PA 3Q0VA 1LMB3 2ECBA 3K2AA 2YU9J 2M9HA 1R9TJ 4X4CA 2BNMA 3BR2A 4BY1J 3RZOJ 4Y52J 5E3LA 1DU6A 1K83J 3HOZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRC A;  2DA3 A;  1W0T A;  1B72 A;  3S2H J;  3JRH A;  2HIN A;  3S1N J;  1F43 A;  4IWR A;  1A6I A;  1LFB A;  2DA7 A;  1OJL A;  3BR3 A;  1OFC X;  2YS9 A;  4PU4 C;  4X4D A;  2OF7 A;  2IVB A;  2HOT A;  1DU0 A;  2DMT A;  4DZJ A;  1JKQ C;  3A03 A;  2ME0 A;  1JJ6 C;  2B5A A;  1RR7 A;  2X6O A;  4LOC A;  1APL C;  2HDD A;  2AXZ A;  2MQK A;  2R5Z B;  3GN5 A;  2XPV A;  3FIS A;  5F0F A;  5GPC A;  2XPU A;  2VUM J;  3KZ3 A;  1JFT A;  4X4I A;  3IVP A;  4GFB A;  3B7H A;  2TRT A;  3SJM A;  3LSP A;  5F04 A;  3LOC A;  5EGO A;  1LQC A;  1MBF A;  2X9D A;  2LTP A;  2O7O A;  3IV5 A;  2EZI A;  3QF3 A;  2L49 A;  2E2J J;  2BNO A;  3B6C A;  2L7Z A;  3G5G A;  3GTK J;  4DYR A;  1VND A;  3R1F A;  1VI0 A;  2B63 J;  3F52 A;  1HOM A;  1WH8 A;  2L0K A;  3LSJ A;  5F27 A;  4Y42 A;  3ZKC A;  3LSR A;  2DJN A;  4C2M J;  2Y31 A;  4DW6 A;  1O4X A;  3BD1 A;  2MG4 A;  4MCT A;  4Z5H A;  4A3E J;  3MLF A;  1U9O A;  4X4B A;  1GDT A;  1YRN B;  4XK4 A;  2PMZ N;  4A3D J;  3BG9 A;  1ETQ A;  4I6U A;  1K61 A;  1XS9 A;  1YSE A;  3O8H A;  2WB1 N;  4V2G A;  1TWH J;  1QQB A;  5J1U A;  1WGX A;  2DMP A;  1QPZ A;  1FIP A;  3OSF A;  2AWI A;  4A93 J;  4J19 A;  1XWR A;  4O8B A;  3EUS A;  1FEX A;  1T33 A;  1UXC A;  4X6A J;  3PO2 J;  2H8R A;  1GV2 A;  2I10 A;  2K40 A;  3ZQH A;  2FD5 A;  4S0H B;  2NVY J;  9ANT A;  2MW8 A;  1ZZ9 A;  3RKQ A;  2HOA A;  5EYR A;  1BDH A;  3BQZ A;  4CYC A;  4A3J J;  2JVL A;  2PUA A;  4UUT A;  4AYB N;  3HOV J;  4D7M A;  3RZD J;  5EF6 A;  1BL0 A;  2WIU B;  4I6T A;  5IP6 A;  2HYJ A;  3CQZ J;  3BG5 A;  3HB9 A;  3Q0W A;  2CRO A;  2XIU A;  1GV5 A;  2EF8 A;  5EGO B;  1UMQ A;  2IU7 A;  1ZGW A;  2ICP A;  2XPW A;  1QP0 A;  4M3G A;  2AHQ A;  2CU7 A;  2MSY A;  4OB4 A;  3HEF A;  4M3B A;  2DMU A;  4A3F J;  4I6R A;  2EZH A;  2LFB A;  1R69 A;  2AW6 A;  2EH3 A;  1I3Q J;  3VPR A;  2L7M P;  2EZK A;  3IH2 A;  2LYK A;  1RZR D;  5F0H A;  3BR1 A;  2LYS A;  4XRM A;  3D1N I;  4G12 A;  2AXV A;  2IV1 A;  5JLW A;  5IOZ A;  1GUU A;  1BW6 A;  3A01 B;  2M0C A;  4W1U A;  3S16 J;  2GLO A;  2GRM A;  1X57 A;  2TCT A;  3BR5 A;  1JT6 A;  1JUP A;  4B3A A;  1P7J A;  1U8B A;  4DYC A;  2COB A;  3GBG A;  4D5C A;  1EF4 A;  4IEJ A;  4AC0 A;  2WAQ N;  4GHJ A;  3VK0 A;  1ZZC A;  1LE8 A;  2A6C A;  3FYM A;  3S15 J;  3BR0 A;  3RZZ A;  3O9X A;  2FX0 A;  4UUS A;  2LLK A;  2R1J L;  2DMN A;  3DCF A;  1I50 J;  4A3L J;  3S8Q A;  1EFA A;  2AO9 A;  1FTT A;  2LYP A;  4PU3 C;  2ID3 A;  2R93 J;  5M5W J;  4M6V A;  5C4X J;  4IHX A;  1UXD A;  5FKO A;  3JRF A;  1PRU A;  1QVT A;  1WIZ A;  2CJJ A;  3ZHI A;  1P7I A;  1QP7 A;  4W97 A;  4D5F A;  3FK7 A;  1E3O C;  1H89 C;  1FIA A;  3QYX A;  3CMY A;  5J1R A;  4PU7 A;  2HXI A;  3HOY J;  2XRL A;  4MFE A;  2OFY A;  1QPI A;  1RZS A;  2O49 A;  1ENH A;  3QPL A;  2CRG A;  1PRA A;  1BDI A;  1WH7 A;  2E19 A;  4X4H A;  3WHC A;  1X2N A;  1VPW A;  3BG3 A;  2LVS A;  2IAI A;  1JT0 A;  2BJC A;  4C3H J;  5EZH A;  1JKO C;  1ETW A;  2KZ8 A;  4V2F A;  2PUB A;  1UG2 A;  5M3F J;  1SQ8 A;  4BY7 J;  1Q1V A;  2E1O A;  1FJL A;  1R63 A;  2XI8 A;  4JX6 A;  2JN6 A;  5EZG A;  1JUS A;  3ZQC A;  1BA5 A;  2ELK A;  3JRD A;  2LKX A;  2PE5 A;  5IYD J;  5C44 J;  1LCC A;  4IHV A;  2N8G A;  4EEF G;  1ZUG A;  4IHY A;  1PER L;  2LYL A;  1UHS A;  2FJ1 A;  2O38 A;  4B4C A;  5JLX A;  1MH4 A;  3HZI B;  1CJG A;  1PNR A;  4X1E A;  3S1M J;  2JMW A;  1WI3 A;  1B0N A;  5IP7 J;  3SDG A;  1RIO A;  3TP3 A;  5EG0 A;  3FK6 A;  5F0C A;  3MVP A;  3LNQ A;  2ZB9 A;  4YAR A;  1AKH A;  2GRL A;  4JCY A;  2CUF A;  1ITY A;  4JQD A;  4DYQ A;  1X2L A;  3M4O J;  4L5E A;  2NS7 A;  1B72 B;  5M5Y J;  2K9N A;  4B1R A;  3H3V K;  1ZS4 A;  1MBH A;  3GTG J;  4BKX A;  1ZZ7 A;  5FKM A;  1Y7Y A;  3H0G J;  1PUF A;  2DA4 A;  2VKV A;  3QWG A;  3G1M A;  3GTL J;  1JH9 A;  1SFO J;  2X48 A;  2XGD A;  2H1K A;  4JCX A;  3OQM A;  3ZHM A;  1ZQ3 P;  1RET A;  1OCP A;  2CUE A;  3BTC A;  3JRB A;  4PU8 A;  5IP9 J;  3PM1 A;  3Q3S A;  2VPR A;  5EDN A;  2E2H J;  1A5J A;  3JRA A;  3OOU A;  3GTJ J;  3Q0U A;  3GN5 B;  4QTR A;  2AXU A;  3JXC L;  4YG7 B;  5C3E J;  2W48 A;  2LYJ A;  1SAN A;  1U9N A;  3BTI A;  5C4J J;  4JP0 A;  3G7D A;  1JWL A;  3FIW A;  2JA7 J;  1IC8 A;  2Y30 A;  3BQY A;  3CLC A;  4IA8 A;  2KEK A;  4YG4 A;  4J1W A;  1ZK8 A;  2R63 A;  3OMT A;  2KEI A;  3H5T A;  3G1L A;  4FE4 A;  1B8I A;  4DZP A;  2GZU A;  2LK2 A;  1IDY A;  1Z77 A;  3GTO J;  4YG1 A;  2NOG A;  1IUF A;  5M3M J;  5IYC J;  2EQR A;  2GBY A;  2NVQ J;  1TWG J;  2DA6 A;  2KDZ A;  3GTQ J;  1MBG A;  2QF7 A;  3ZQG A;  1JKR C;  4F8D A;  5EG0 B;  1LLI A;  1ZAY A;  2XB0 X;  4Z5C A;  2EBY A;  1WH5 A;  4MLO A;  2PPX A;  2XGC A;  1D5Y A;  3F6W A;  1ZKG A;  3IH3 A;  2Y9Y A;  1MNM C;  3OQN A;  1JTX A;  3TED A;  1OCT C;  1HDD C;  2LD5 A;  2M34 A;  4Y7N J;  2Y9Z A;  1PRV A;  3QQA A;  4A3M J;  3ZQL A;  2DTZ A;  1GVD A;  1JKP C;  1DWK A;  1ZZ6 A;  1VF9 A;  3NAR A;  2E2I J;  3B6A A;  4NDL A;  3UKG A;  1MBE A;  3C2B A;  4HNV A;  1TWA J;  3MKL A;  4BBR J;  1IG7 A;  2R0Q C;  2P81 A;  1HLV A;  2JK3 A;  2ID6 A;  2HSG A;  4BBS J;  4FN3 A;  1POU A;  1ZZ8 A;  2R5Z A;  2DMQ A;  3W6V A;  4CYC B;  2GM4 A;  1QVU A;  1MSE C;  1POG A;  4M3D A;  1HDP A;  1MSF C;  2LCV A;  2XSD C;  3SCH A;  5J3L A;  5DS9 A;  2XB5 A;  4I8T A;  5K7Z A;  1X2M A;  2NVX J;  5F08 A;  1AHD P;  3O8G A;  3PO3 J;  1ORK A;  2R5Y A;  3SFI A;  1ZR2 A;  1B8I B;  4X4G A;  2PUC A;  3F51 A;  4X4E A;  1T56 A;  5E3M A;  4I76 A;  4FTH A;  1CQT A;  2JA5 J;  1UTX A;  2EWT A;  1H8A C;  2WUS R;  2JA8 J;  1IJW C;  2LYQ A;  2G0E A;  3HDD A;  1MBK A;  1FTZ A;  2XGE A;  1JTY A;  2L8N A;  1ETO A;  1NTC A;  2IVG A;  3CRO L;  3OSG A;  1TWF J;  4J1X A;  3BS3 A;  2RAE A;  1YRN A;  3FKI J;  4A3B J;  5FLM J;  2HI3 A;  3TRB A;  3S17 J;  1MH3 A;  2AUW A;  4Z58 A;  3BTL A;  1S7E A;  1ZZB A;  1L1M A;  4A3I J;  3JXD L;  4FE7 A;  2JCG A;  2PUF A;  3DEW A;  1LE8 B;  2LR8 A;  3SCF A;  4XIC A;  2CQX A;  4UUS B;  1F36 A;  2FQ4 A;  3HGG A;  3MN2 A;  2O4A A;  2PIJ A;  2OR1 L;  1Y1V J;  2XJ3 A;  5K7H A;  4A3G J;  4JYK A;  4XRS A;  3I4N J;  4GQM A;  2DA5 A;  1BW5 A;  2CSF A;  3S2D J;  5FKL A;  3GTP J;  3CDL A;  1TC3 C;  1GT0 C;  1IRZ A;  4QIW N;  2XCJ A;  1WPK A;  1JGG A;  2KEJ A;  1Y9Q A;  5M5X J;  3OIO A;  5K98 B;  3GBF A;  2OPT A;  3LIS A;  2IEK A;  4MO7 A;  5E3O A;  2O9L A;  1IDZ A;  2KPJ A;  2CQQ A;  2ECC A;  3JRG A;  2R5Y B;  3LFP A;  2LYR A;  2LY9 A;  4A69 C;  3JRI A;  2PUD A;  5IPA A;  2ICT A;  3E7L A;  3CEC A;  3BDN A;  4MCX A;  1XG1 A;  3HM5 A;  2PUG A;  1WET A;  2NVT J;  1NK2 P;  4XRS G;  2LP0 A;  2EBI A;  4M3F A;  4A3C J;  5A7L A;  5DTD A;  3UFD A;  3LSG A;  2IBD A;  4QSH A;  3HKZ N;  2QCO A;  5GP9 A;  3FYA A;  1AU7 A;  4FBI A;  4Z5D A;  1OSL A;  3A01 A;  1X58 A;  3RQI A;  2JJ7 A;  4C3I J;  4RBO A;  1RPW A;  2VI6 A;  4FIS A;  4AUX A;  4FCY A;  1IGN A;  3I4M J;  4MFD A;  2KT0 A;  3JRE A;  5J1Y A;  3S14 J;  3BT9 A;  2R7Z J;  2EZL A;  4NDW A;  3HOU J;  2D5V A;  1Z0X A;  4RDU A;  4XID A;  4IHW A;  2JA6 J;  4X4F A;  2NS8 A;  1RKW A;  1U78 A;  1H88 C;  2HQ5 A;  3BTJ A;  1TWC J;  3SCG A;  2DA1 A;  1LFU P;  2PUE A;  5EEA A;  1JJ8 C;  2VKE A;  1ZR4 A;  4D7N A;  1RZR A;  2K9Q A;  2HOS A;  1ZPQ A;  3OP9 A;  2JWT A;  1RPE L;  2L7F P;  2MGQ A;  1LCD A;  1RKT A;  2MEZ A;  2FJR A;  1AKH B;  1JUM A;  3QPS A;  4MIM A;  2Y2Z A;  2Y0S N;  1ADR A;  3F0C A;  3TW7 A;  1ETY A;  3ZQI A;  3ZOB A;  3JXB C;  1JFS A;  3HBL A;  3HOW J;  1HCR A;  3JR9 A;  5BNG A;  2DA2 A;  3WHB A;  2R92 J;  4BXX J;  1QP4 A;  5E3N A;  3KJX A;  3G1O A;  2M8G X;  1NER A;  5K7F A;  4M3E A;  2HXO A;  3ZQF A;  3GTM J;  1ZTR A;  3NAU A;  1PUF B;  3A02 A;  1ETX A;  1HF0 A;  1Y1W J;  4IVZ A;  2L9R A;  1ETK A;  5FKN A;  4A3K J;  2ME6 A;  3QQ6 A;  5HOD A;  3CCY A;  1W0U A;  1RES A;  2K9S A;  3PXP A;  1G2H A;  2O8K A;  1BJZ A;  5FJ8 J;  4Z59 A;  3U3W A;  1IV6 A;  1QRY A;  5F1J A;  4ABZ A;  3IH4 A;  4I6Z A;  1WH6 A;  3K7A J;  1NK3 P;  4YBA A;  2IVQ A;  3FMY A;  2YUS A;  1I6H J;  4C3J J;  1QQA A;  3HGY A;  5FKK A;  5FLV A;  3S1Q J;  1DW9 A;  3BR6 A;  3HOX J;  3OQO A;  1VFC A;  1MBJ A;  3TW6 A;  1ETV A;  4JX4 A;  1ZVV A;  2WV1 A;  5IOY A;  5GPA A;  1WCM J;  3TP0 A;  2IUO A;  1XC5 A;  4JX5 A;  3KXA A;  3DNV B;  5IYB J;  3M3Y J;  2M2E A;  1NEQ A;  2BNN A;  3S1R J;  2DN0 A;  3L1P A;  3Q0V A;  1LMB 3;  2ECB A;  3K2A A;  2YU9 J;  2M9H A;  1R9T J;  4X4C A;  2BNM A;  3BR2 A;  4BY1 J;  3RZO J;  4Y52 J;  5E3L A;  1DU6 A;  1K83 J;  3HOZ J; 
#chains in the Genus database with same CATH topology
 5H6R A;  3S2H J;  2VXD A;  1OCZ H;  4XLC A;  4OU0 A;  3GZD C;  2HIN A;  4LB5 A;  2E60 A;  1T0F A;  3N4M A;  4B3X A;  1F43 A;  1P4W A;  4OWR B;  2HQA A;  2M7B A;  2OU2 A;  3S32 A;  1R4N B;  4NC8 A;  3EPZ A;  1LFB A;  2DA7 A;  3EUK L;  1YTY A;  2YS9 A;  5DRT A;  4PU4 C;  1Z3X A;  2K9M A;  2OF7 A;  2B0L A;  3AG2 H;  2VXZ A;  3KEQ A;  1DU0 A;  2DMT A;  1JKQ C;  2ME0 A;  1ZGA A;  1JJ6 C;  3FXQ A;  3LQX A;  4XM3 A;  3F6V A;  1RR7 A;  3AL0 B;  1APL C;  2DTR A;  5GAH i;  4GO1 A;  3VOE A;  2RRE A;  2ZXW H;  3M1E A;  1LDK B;  1MGT A;  4F7Z A;  3WTU C;  2F48 A;  3B7H A;  2VQC A;  2V1D A;  5JVG F;  3LSP A;  2QEX I;  5J8C A;  5F04 A;  5EGO A;  2XAH A;  3H35 A;  1MBF A;  1LQC A;  2O7O A;  3OKZ A;  4OIR F;  3BOQ A;  3LQQ A;  2RNJ A;  1O3Q A;  3CUO A;  3LWF A;  4OIP F;  2L7Z A;  3D5R C;  2QEN A;  2XRN A;  3C2H A;  3QWL A;  4DYR A;  3G5G A;  2KIS A;  1Y8R B;  5HS9 A;  3WTS C;  2B63 J;  1G3Y A;  3F52 A;  3M9A A;  4OBM A;  3CF5 F;  3LMM A;  4PSX A;  2O5R A;  4HPQ A;  2DJN A;  5FO5 A;  2Y31 A;  4DW6 A;  1BI2 A;  1O4X A;  2UV1 A;  5LEK A;  3MFK A;  4Z5H A;  4P96 A;  3BP8 A;  4RB1 A;  2PMZ N;  4HV5 A;  2GOX B;  2BW3 A;  2OC6 A;  3BG9 A;  4I02 A;  1XS9 A;  1S7O A;  5BS6 A;  3SDB A;  1E2X A;  1VQP I;  5ICC A;  2YU3 A;  3JCU C;  2AWI A;  4J19 A;  1IF1 A;  3CC7 I;  3ZMZ A;  2OQR A;  2GA1 A;  3L00 A;  2KKO A;  4X6A J;  5DSX A;  2H8R A;  2P5L C;  3FMR A;  4KIS A;  3G2B A;  3QOX A;  2NVY J;  5H2F C;  4ANJ A;  2HOA A;  3MQ0 A;  1DP7 P;  3S8P A;  3P5J A;  1BDH A;  2JVL A;  4DGW B;  1A35 A;  1SFU A;  3MCZ A;  3RZD J;  2VPL A;  5BMZ A;  1BL0 A;  2WIU B;  4I6T A;  2XAG A;  1VQ5 I;  6PAX A;  1XGM A;  4I01 A;  1ON2 A;  1ZHF A;  2XIU A;  2F5V A;  1TP4 A;  4LLN A;  4M9X A;  5D4S A;  3ZQQ A;  5DTM A;  4HSR A;  3CCJ I;  3F8C A;  4RA2 A;  1K6O A;  2QM3 A;  2CU7 A;  3FXL A;  3M07 A;  1P4X A;  3HKZ A;  4A3F J;  2M1B A;  2XDV A;  5K5R A;  1EA3 A;  4EM0 B;  1MNE A;  1OLT A;  1F9N A;  3GVA A;  3IH2 A;  2LYK A;  3C7J A;  1QBJ A;  3A1Y A;  4LLG F;  3BR1 A;  4KIF A;  4HW0 A;  4XRM A;  4G12 A;  1HQC A;  5KCM A;  2AXV A;  2IV1 A;  3OS2 A;  1I1G A;  3A01 B;  4E7S A;  3S16 J;  1VQK I;  1WI9 A;  2HTJ A;  1X57 A;  1U8B A;  2W25 A;  5ED4 A;  3BWG A;  3FKJ A;  4D5C A;  3IL2 A;  1STZ A;  4BYY A;  2XVC A;  2GXB A;  3LSM A;  1ZZC A;  1LE8 A;  1G3W A;  2DQL A;  3S15 J;  3GCM A;  2A6C A;  3BR0 A;  4XMY A;  2LLK A;  2VJ5 A;  1EFA A;  3KP3 A;  4BAY A;  2A68 F;  4PU3 C;  1IO2 A;  2H1L A;  1ZG1 A;  2HQN A;  2R93 J;  5M5W J;  3TFL A;  1IRX A;  4M6V A;  5C4X J;  4IHX A;  3MKY B;  1WJC A;  2A07 F;  1YW7 A;  4ZTJ A;  2EWN A;  4I09 A;  2CUJ A;  2YX7 A;  2Q2E A;  2ZNY A;  3FK7 A;  3RKY A;  4LK0 F;  4KJZ A;  2ZXH A;  1H89 C;  3BRO A;  3DTK A;  2HXI A;  2ACJ A;  3BG6 A;  2KIU A;  2GA2 A;  4DBR A;  1FOX A;  1USS A;  3EET A;  4CO8 A;  2JA2 A;  3PE5 A;  2E36 A;  4MFE A;  2OFY A;  1QPI A;  3RCO A;  1XMA A;  1JGS A;  2DXI A;  2CRG A;  5HLG A;  4F93 B;  2DW4 A;  3T0Y A;  1VPW A;  3BG3 A;  4L5J A;  4U7B A;  3FBI B;  5EZH A;  1X4O A;  1ETW A;  3WGI A;  2BJC A;  2PUB A;  5GTH C;  2QLZ A;  2LKP A;  2E1O A;  1FJL A;  2PEX A;  1KU2 A;  1LEA A;  4JX6 A;  4AM3 A;  1BA5 A;  3M1C A;  2HPM A;  1T08 B;  3CJR B;  3J80 K;  2KDO A;  2PE5 A;  4EKG A;  2DU9 A;  3SX0 A;  2KP6 A;  3A9Z A;  4LFU A;  2N8G A;  2LRD A;  3KYL A;  4IHY A;  1QHG A;  1BR2 A;  2LYL A;  2IT0 A;  4B4C A;  2O38 A;  3S1M J;  2JMW A;  2Z2S B;  1B0N A;  3SDG A;  5E1Z B;  5EG0 A;  2DOA A;  4MEX F;  3MVP A;  1QA6 A;  3OWQ A;  2LKS A;  2HNH A;  2GRL A;  2PXE A;  3TEP A;  4JCY A;  1OPC A;  2IXS A;  4YIR X;  4EGZ A;  3GFI A;  4Q2J A;  2A6H F;  4WWC A;  2OD5 A;  1VTN C;  1B72 B;  2JRT A;  2VEO A;  4BS9 A;  1WVR A;  3HPH A;  4LIT A;  5FKM A;  4E7J A;  1K79 A;  2XAQ A;  5D4R A;  1A31 A;  4UY8 I;  3H0G J;  2H94 A;  4Q47 A;  2VKV A;  3QWG A;  1YW9 A;  4RB2 C;  1SFO J;  2BHY A;  2XGD A;  2H1K A;  3OQM A;  3DEU A;  1RET A;  1OCP A;  3BTC A;  5DCM B;  4PU8 A;  3C18 A;  5IP9 J;  5EDN A;  2E2H J;  2DOD A;  3JRA A;  3E5X A;  3GTJ J;  4QTR A;  1Q1H A;  4L9J A;  1B9N A;  1JWL A;  1SAN A;  5C4J J;  3BTI A;  3IKV A;  2LMD A;  3CLQ A;  2JA7 J;  4Y3O A;  3PIP F;  2Y30 A;  4Y33 A;  4IA8 A;  2KEK A;  4J1W A;  4XLE A;  3G1L A;  1GLN A;  2HFH A;  3R61 A;  2F5F A;  4DZP A;  5L3D A;  2HKO A;  3RSN A;  1VZ0 A;  2GZU A;  2ZO4 A;  2V6E A;  3GTO J;  4YG1 A;  2R7X A;  2HZD A;  2EQR A;  2W24 A;  3TOA A;  2MD5 A;  1LDJ A;  1SVM A;  2VL8 A;  3HRM A;  2V26 A;  2K85 A;  3TMO A;  5TRD A;  3WGH A;  1MBG A;  2NAZ A;  5CQG A;  2QF7 A;  3ZQG A;  4ESB A;  1XGN A;  4OIN F;  2XB0 X;  2WB1 A;  4Z5C A;  5LRS A;  2FOW A;  4KT6 A;  2PPX A;  4IQJ A;  2R7T A;  1FP2 A;  2F5C A;  1LFP A;  3H5R A;  2FUG 2;  3TO9 A;  4J00 A;  1U5T B;  1JTX A;  3TED A;  4BDZ A;  4IHS A;  3LL7 A;  2BGC A;  3U1D A;  1P2F A;  2M34 A;  1XDU A;  3MMY B;  3ZQL A;  2DTZ A;  3H9J A;  1NH3 A;  1GVD A;  3VOD A;  1MMS A;  4OIO F;  2E2I J;  1YX5 A;  4NDL A;  2E1C A;  2HVR A;  3WGG A;  1MBE A;  1TWA J;  1XMX A;  2E5Z A;  4DOZ A;  5CJ9 A;  4LB6 B;  2MBF A;  1O3T A;  1L3L A;  2F4M B;  1BIA A;  1ZRD A;  2JK3 A;  4E6K G;  1QHH D;  2HSG A;  3DKY A;  1R22 A;  2KQR A;  2FBI A;  2M45 A;  3C2G A;  3TOB A;  3ZPX A;  2FA5 A;  1I6X A;  3W6V A;  3MKZ A;  3LQR A;  2FMY A;  4ENK A;  1UZC A;  4M3D A;  4HOB A;  2LCV A;  3EYY A;  2L7K A;  2GIZ A;  2XB5 A;  3U2R A;  5DS9 A;  2PMH A;  3DLL F;  3C1D A;  3A9X A;  2K4B A;  2KRF A;  1MJ9 A;  5IT9 K;  3IHU A;  2UXN A;  2H8W A;  3DKW A;  1ZR2 A;  4X4G A;  3GLX A;  3F51 A;  1J09 A;  1TW2 A;  2A5W A;  4EMS A;  3H9G A;  3LSI A;  4UB8 C;  2JA5 J;  2V79 A;  1UTX A;  4ESJ A;  2JA8 J;  2LYQ A;  5B1B H;  3VYS B;  1S8N A;  2HYG D;  4E7Z A;  1BR4 A;  1JTY A;  3KZY A;  4ETS A;  2X6X A;  1IAW A;  1ETO A;  2IVG A;  3OSG A;  2LLV A;  4XLA A;  4FAS D;  4M71 A;  2QUF A;  2RAE A;  1ZH5 A;  2A6E F;  4HV6 A;  3GXO A;  2L54 A;  2AUW A;  1IN5 A;  1EV7 A;  1ZZB A;  5A2Q K;  1OCR H;  1FBQ A;  1YI2 I;  3JXD L;  1K4T A;  1Z1D A;  2BVM A;  3DEW A;  4U7D A;  2W82 A;  1RZ4 A;  2CQX A;  4UUS B;  3SZG A;  1F36 A;  3I4P A;  5CQE A;  2O4A A;  1D1A A;  1BM9 A;  1LNW A;  1X1A A;  3LFU A;  4GQM A;  3L2V A;  1BW5 A;  4RAG A;  5FKL A;  3VYT B;  3TO6 A;  3CDL A;  4A6E A;  3ECO A;  4D0P A;  2MD0 A;  4IOC F;  2VBY A;  3VEP A;  3F23 A;  1K78 B;  2BEO A;  2OPT A;  2O9L A;  2P8T A;  2K02 A;  1TL8 A;  2LYR A;  2LY9 A;  4A69 C;  2DOE A;  4L9T A;  1I3A A;  3CEC A;  1XG1 A;  3GUU A;  3OYE A;  1JI8 A;  4WXH A;  1NK2 P;  1U8R A;  4XRS G;  3LAP A;  1HKQ A;  2EBI A;  3DV8 A;  5A7L A;  4A3C J;  2R7F A;  3R0J A;  1Z21 A;  3FHN A;  4CA0 A;  3I9V 2;  4I0B A;  1Y8Q B;  4M73 A;  1H0M A;  1CF7 B;  4RAZ A;  1SAU A;  2EIK H;  3DEE A;  3FYA A;  1OSL A;  2VJ4 A;  4FBI A;  4Z5D A;  2JSP A;  3A01 A;  3K1P A;  4UV9 A;  1W4M A;  4FCY A;  1F5T A;  2BY1 A;  1IGN A;  5LLQ A;  2F2E A;  2ELH A;  5TIS C;  4IZZ A;  2R7Z J;  3IRR A;  2DT6 A;  2D5V A;  4RDU A;  3CP2 A;  1Z7L A;  2HS5 A;  2EB7 A;  3CO7 C;  1U78 A;  4CIC A;  1H88 C;  3S3N A;  3ECH A;  3BTJ A;  1TWC J;  2X6W A;  3GZN B;  1LFU P;  3KLN A;  3GME A;  2PUE A;  1JJ8 C;  1RI7 A;  1REP C;  2HOS A;  5LGN A;  2EIL H;  2MGQ A;  2D2W A;  2EK5 A;  4EJV A;  4N4O B;  1AKH B;  2STT A;  1QZE A;  4A2U A;  4ER5 A;  2DT5 A;  4OAY A;  3RPU D;  2DDA A;  3HBL A;  3H9Q A;  3K4B A;  3HOW J;  3QYE A;  4Y13 A;  2DA2 A;  5F6F A;  3A2K A;  1HST A;  1QPM A;  3TL4 X;  4LIU A;  5B3S H;  3KJX A;  5DTR A;  3J7Z I;  1WJB A;  2M5W A;  5K7F A;  3WU0 A;  3ZQF A;  2XRO A;  3NAU A;  4B48 A;  1RUN A;  4L18 B;  1ETX A;  3AG1 H;  1Y1W J;  1YS7 A;  3BCB A;  4A3K J;  5FKN A;  3CCR I;  1OCC H;  3HRT A;  3OOP A;  3JTG A;  3CCY A;  1YHQ I;  3PXP A;  2PXD A;  2JPC A;  1BJZ A;  1XTA A;  2O8K A;  2OTJ I;  2BBY A;  5AIQ A;  2VQH A;  4YRV A;  3TKY A;  2VE9 A;  2P4W A;  1QRY A;  3KZZ A;  3E3V A;  3GFM A;  4BEH A;  3DQV C;  2R7O A;  3J81 K;  3KL4 A;  1R1T A;  2HWV A;  1B6A A;  3KFW X;  2RKH A;  5GAG J;  1NK3 P;  2IVQ A;  3RTR A;  2KRH A;  2BOL A;  3QOW A;  4KIB A;  4II2 A;  1OR7 A;  3S1Q J;  5FLV A;  2Z99 A;  3HOX J;  5LHH A;  1MBJ A;  5HLI A;  1W36 C;  2WV1 A;  4JX5 A;  5KNL A;  3KXA A;  3HL2 A;  1ERD A;  3OWT A;  4YFN F;  5IYB J;  1SMT A;  4PJ0 C;  2BNN A;  4AIK A;  2DK5 A;  2DN0 A;  3K2A A;  2EV6 A;  2RNG A;  2M9H A;  2R7Q A;  2X1D A;  4Y52 J;  1DPR A;  3GTM J;  4HQM A;  4M6Y A;  3HOZ J;  3JRC A;  1HBX G;  2QSG X;  1B72 A;  1YIT I;  1VQ9 I;  2MH9 A;  3H3Z A;  3FHZ A;  4BE1 A;  3BZK A;  4XBF A;  5J4V A;  4ZYH A;  3CO6 C;  2AQE A;  1BR1 A;  1OJL A;  4AVZ A;  1OFC X;  4X4D A;  2XXQ A;  2VT2 A;  3H92 A;  1FOW A;  2HOT A;  2E1N A;  2R7D A;  2QSH X;  3G3Z A;  2B5A A;  2R7S A;  2HDD A;  3O3K A;  2ZFW A;  3L2R A;  1YE9 A;  2VUM J;  3J7A O;  3KZ3 A;  2FBK A;  3RDI A;  4BQO A;  2WWY A;  4EM1 A;  1ZRE A;  3BDD A;  3IVP A;  2GXG A;  5J6X A;  1MMA A;  3HSR A;  1YW8 A;  1G59 A;  2QYO A;  2HDW A;  2LTP A;  4ZC3 A;  2BV6 A;  3A4C A;  2BNO A;  1EKE A;  2HCN A;  2VLA A;  1X19 A;  2I8D A;  3GTK J;  2BE5 F;  1VND A;  1VI0 A;  1HOM A;  2L0K A;  2XSJ C;  2FBH A;  3AG4 H;  3B73 A;  1OQY A;  3W2A A;  3EQL F;  1VQO I;  4C2M J;  4UNO A;  4Y17 A;  5CLS A;  2Y48 A;  3BD1 A;  1R5G A;  2MG4 A;  4A3E J;  1EJ9 A;  4X4B A;  2ESH A;  3KE2 A;  4XK4 A;  1U5T A;  2MYS A;  1O7F A;  4A3D J;  3I53 A;  4I6U A;  4H0E A;  4A0X A;  3HHG A;  1QQB A;  2J7W A;  5J1U A;  1WGX A;  2BY2 A;  4A6D A;  4AVP A;  1XWR A;  1VQ8 I;  3EUS A;  1IN7 A;  1P4A A;  2WA0 A;  2CW8 A;  3DBL B;  1UAA A;  3ONQ A;  4HF2 A;  1GV2 A;  2I10 A;  2EPF A;  3EUH A;  2F4O B;  3ZQH A;  3ABK H;  2MW8 A;  3IAS 2;  5KHD A;  3CUQ C;  2HU9 A;  4UUT A;  4AYB N;  5D6E A;  2M0M A;  4D7M A;  4KFC A;  1BN5 A;  1TT5 B;  1YG2 A;  5IP6 A;  2ELJ A;  3S2W A;  3FX3 A;  2CW0 F;  3BG5 A;  2V6C A;  3HB9 A;  3CUQ B;  2CRO A;  2BY0 A;  2EF8 A;  3SFZ A;  3U1K A;  1UMQ A;  1AOY A;  4OAZ A;  3K6G A;  4XOT A;  2EIJ H;  2GXA A;  3DPU A;  1ZGW A;  2R3S A;  2XPW A;  3LA7 A;  1QP0 A;  1DUX C;  2MSY A;  2CYY A;  2E34 A;  2AW6 A;  2PXT A;  3IP4 B;  2IVM A;  1I3Q J;  3PSI A;  2L7M P;  3CP8 A;  2IGK A;  1Y6I A;  2OA4 A;  5E79 C;  4G8X A;  2QBY B;  3PQJ A;  4JQF A;  2KZG A;  3E0J B;  3PUF A;  4ER7 A;  1SC7 A;  4RGU A;  1R58 A;  3HJE A;  1MDM B;  4GCV A;  2M0C A;  5ILV A;  3LA2 A;  4IRG A;  2GRM A;  3CCE I;  2HOE A;  2P7V B;  3FM3 A;  4KDP A;  5CVJ A;  4AC0 A;  4EQZ A;  3FYM A;  1R4M B;  3O9X A;  4UUS A;  2XC7 A;  2Y75 A;  4CHU A;  2R1J L;  2IGN A;  4RLF A;  1S6L A;  1FTT A;  3SXY A;  1I1S A;  4HX4 A;  4I2O A;  1UXD A;  3QP5 A;  2C6Y A;  1IW7 F;  2Z5U A;  3JRF A;  4D1Q A;  4MGR A;  3KEY A;  1WIZ A;  1B1B A;  2FRH A;  2CJJ A;  3ZHI A;  4XSZ F;  1QP7 A;  3P9C A;  1D8J A;  2K4J A;  1XPX A;  1Y56 A;  1E3O C;  2MLK A;  1Y0N A;  4BJ6 C;  4PGH A;  3QYX A;  4BDY A;  2EFQ A;  4HDU A;  4U0Y A;  1TQP A;  2PXL A;  2H09 A;  2LNM A;  1X1D A;  1HQ1 A;  4ESF A;  3CC4 I;  3E6B A;  4KMF A;  1RZS A;  4MQV A;  1PRA A;  2E19 A;  4NB5 A;  2HEO A;  2M3A A;  1CF7 A;  2IAI A;  1YLF A;  2OCE A;  4DNC A;  4E7K A;  3DWL E;  5DUK A;  1SFK A;  1UG2 A;  4IPA A;  1QO0 D;  1JHH A;  1Q1V A;  2FNP A;  4BY7 J;  2QVO A;  3CTA A;  3DKX A;  2P5K A;  1K7A A;  1JUS A;  3REO A;  4WCG A;  3JRD A;  2X0L A;  1Z9C A;  3F8M A;  4BHC A;  4ZYE A;  3BG7 A;  1LUJ B;  2PJR B;  2W85 A;  4G94 A;  4KIT B;  1D3Y A;  1Z05 A;  2JVG A;  2MA3 A;  2OZU A;  1LCC A;  3E6C C;  2LF8 A;  3OL4 A;  4EEF G;  2XF7 A;  4A12 A;  4UUV A;  1UHS A;  5CYV A;  2FJ1 A;  4NUB A;  1FLI A;  1CJG A;  1MH4 A;  2VQG A;  1TW3 A;  1PNR A;  1BI1 A;  2WBM A;  4QWQ A;  5ILS A;  5ILU A;  1RIO A;  3TP3 A;  3FK6 A;  1LQ1 A;  2ZB9 A;  4YAR A;  3Q9V A;  1WZ2 A;  1AKH A;  2PXU A;  2HZT A;  1QGP A;  1OYI A;  1FX7 A;  2KJC A;  2KZV A;  5FGM A;  1A36 A;  4JQD A;  4L9N A;  4DYQ A;  2A3S A;  4ER6 A;  2MH2 A;  2EIN H;  1A04 A;  4PZJ A;  3L9F A;  1B4A A;  2ESN A;  4HBL A;  4ER3 A;  3W2V A;  1ZS4 A;  3H3V K;  2HGC A;  1ZZ7 A;  2XF5 A;  3CD6 I;  4BE0 A;  3V7C A;  1BJA A;  2PMU A;  5FB2 A;  3ABM H;  1JH9 A;  1S3J A;  4EGY A;  1WKM A;  1FC3 A;  2CFO A;  1RUO A;  1R71 A;  3PM1 A;  3Q3S A;  2VPR A;  2YX4 A;  3Q0U A;  3GN5 B;  1Y0U A;  2AXU A;  2XAS A;  2O03 A;  4YG7 B;  4B43 A;  2LYJ A;  4EK9 A;  1PVE A;  3V42 A;  1KQ9 A;  1IC8 A;  2UWM A;  1OMI A;  2EV0 A;  2JQE A;  2GQQ A;  2ICW G;  1XSD A;  2R63 A;  3OMT A;  2KEI A;  5D5X B;  4BL0 B;  1B8I A;  3MKW B;  1TQI A;  3K69 A;  1NG6 A;  4BHP A;  2E71 A;  2VN2 A;  5IYC J;  4PK4 A;  4DE8 A;  2GBY A;  5LBQ A;  2NVQ J;  2GAU A;  4RLQ A;  3TDZ C;  2PMZ A;  2KDZ A;  3GTQ J;  3N05 A;  1JKR C;  1ACI A;  4IX7 A;  2LSO A;  2LBF B;  2NNY A;  3IRQ A;  2CW7 A;  2EBY A;  3E97 A;  2J5O A;  2LNB A;  4MLO A;  4BJ5 C;  2P6S A;  2XGC A;  3WTY C;  3RJP A;  2L2O A;  1Z6T A;  2Y9Y A;  1MNM C;  4IRI A;  3OQN A;  4ZYD A;  2ZBK A;  1HDD C;  3CF2 A;  2Y9Z A;  2NYX A;  4PSW A;  1U2W A;  1DWK A;  2V1U A;  3NAR A;  2X51 A;  4HNV A;  4DQ2 A;  2FSW A;  3WE3 A;  2K27 A;  3GZ6 A;  2ID6 A;  2ZJ2 A;  1R6R A;  3FBN B;  2JUC A;  3CC2 I;  4BBS J;  3QOP A;  4FN3 A;  2J7U A;  4OOI A;  3G71 I;  1GVJ A;  1POU A;  1ZZ8 A;  4KN7 X;  4CYC B;  5B66 C;  1POG A;  2M4G A;  3H3U A;  2MC3 A;  2K5C A;  2V1N A;  1TT0 A;  4UVA A;  4EJU A;  3OR1 C;  3T8R A;  5K7Z A;  2K3P A;  1X2M A;  2NVX J;  2DI3 A;  5F08 A;  4XN3 A;  3O8G A;  4ASN A;  3OYM A;  2R5Y A;  1NG7 A;  3SFI A;  1FY7 A;  1QU3 A;  4X4E A;  1T56 A;  3IWF A;  2V9P A;  4I76 A;  5E3M A;  4FTH A;  4RGX A;  4ZTF A;  2DAO A;  1N78 A;  4JBA A;  2G0E A;  4BUP A;  3HDD A;  3VWB A;  1MBK A;  1D0Y A;  1MKM A;  3CRO L;  1TWF J;  2RVC A;  3BS3 A;  1FP1 D;  4RM3 A;  4Q4Z F;  4XLN F;  3R60 A;  3S17 J;  2QZ8 A;  3RYR A;  1MH3 A;  2MXD A;  4Z58 A;  3H5A A;  1S7E A;  1RNL A;  1FYK A;  4XNF A;  5K5O A;  2DBB A;  1VQM I;  3L2W A;  2Z16 A;  5DYM A;  4NNJ A;  2OR1 L;  3JTH A;  4BNC A;  2ZXI A;  4BGD A;  1TC3 C;  3F8B A;  4HX7 A;  2XCJ A;  1WPK A;  1JGG A;  2OCC H;  2KEJ A;  5M5X J;  1QNT A;  3HRS A;  2IGM A;  3OIO A;  2L9N A;  4BQA A;  1E3H A;  2IEK A;  2VJJ A;  4EZI A;  1SMY F;  1R5H A;  2V7F A;  4CUG A;  4G7H F;  2X85 A;  2ECC A;  2YSR A;  4N0B A;  4NBQ A;  5HDN A;  4V19 K;  4Q5S F;  2VOP A;  3LFP A;  3ULQ B;  2PUD A;  3H5N A;  2UXX A;  1SD5 A;  5JI6 A;  4CCJ A;  3HM5 A;  4R79 A;  2QQB A;  1HW5 A;  1RC9 A;  1OKR A;  4ZH4 F;  3NWS A;  1ZG5 A;  4M3F A;  3UFD A;  2XV4 S;  3LSG A;  3G73 A;  2DLL A;  1MFQ C;  2HFZ A;  3K1N A;  4HG2 A;  1MDM A;  4C3I J;  3X2Q H;  5FFZ A;  4HNT A;  2KHM A;  3HRU A;  4MFD A;  4FX0 A;  1N25 A;  1ONV A;  1YIO A;  2QGU A;  4NDW A;  4IHW A;  3D5L A;  1O57 A;  2NS8 A;  3FMS A;  3DU6 A;  2WY8 Q;  3DPT A;  4IRH A;  3S93 A;  3GFJ A;  3QRF F;  3RYP A;  3GZ5 A;  3L2Q A;  2VC0 A;  5GAG i;  3CLO A;  3A0B C;  2K9Q A;  5HDG A;  3DFG A;  4UVB A;  5E17 F;  1O3S A;  2NRA C;  4E7L A;  2M30 A;  1RKT A;  1XX5 A;  3TQN A;  2MEZ A;  1JHF A;  1T8I A;  3WTT C;  1T38 A;  2WTE A;  3QPS A;  1UG0 A;  2Y2Z A;  2Y0S N;  4ON0 A;  4DE9 A;  1ADR A;  3A9Y A;  3ZOB A;  2DYS H;  1OYW A;  3MZY A;  3JR9 A;  1QP4 A;  4BXX J;  3F8F A;  2FXA A;  3CCU I;  4IXA A;  4FX4 A;  2PFB A;  1SVL A;  2VB6 A;  4PGG A;  1FOY A;  4S04 A;  3GZD A;  1XCB A;  1HW1 A;  1YIJ I;  3FXR A;  5KAI C;  3TBI A;  1KQ0 A;  1C0W A;  4HA8 A;  4KN4 X;  1KQ8 A;  1ETK A;  3CCV I;  2ME6 A;  1O3R A;  5HOD A;  4YEL A;  1W0U A;  1RES A;  2K9S A;  2FFH A;  5FJ8 J;  4HF1 A;  3U3W A;  4AU7 A;  5A2Q Z;  3CDI A;  1WH6 A;  1V5G A;  5ICF A;  1JE8 A;  3K7A J;  1TTY A;  1IXR C;  1TNS A;  3GLL A;  4YG2 F;  3KP7 A;  3ZMD A;  1QQA A;  4AIH A;  1K6Y A;  3OQO A;  1VFC A;  4HYE A;  1FYL A;  4P5O A;  4JOM A;  3TW6 A;  2W7N A;  2H6C A;  1WCM J;  4MQ9 F;  3TP0 A;  3DNV B;  4ZYG A;  1ZRC A;  1WQ2 A;  4MTD A;  3L1P A;  1FMW A;  2HVQ A;  1LMB 3;  3VSL A;  4HQE A;  2HTS A;  2YU9 J;  2IS2 A;  4IL6 C;  2X4H A;  4XLF A;  1YJW I;  2ISZ A;  1K83 J;  4AID A;  2ZME C;  1NW3 A;  3ZGK A;  2DA3 A;  3TEL A;  4KYW A;  3V7R A;  1IN8 A;  4RMN A;  3S1N J;  1O7L A;  4EJW A;  1MW7 A;  1UCR A;  1BOA A;  3BR3 A;  2XXP A;  4PJL A;  5GTI C;  3A03 A;  1ZLK A;  2ZJP F;  2X6O A;  2AXZ A;  1QZZ A;  2R5Z B;  3GN5 A;  2DCE A;  2XPV A;  3FIS A;  5GPC A;  5E1W A;  5DUI A;  5DD4 A;  1JFT A;  1S9H A;  5TGT A;  2D1H A;  1YOV B;  4MTE A;  2TRT A;  5KVR A;  3SJM A;  1V5F A;  2HR3 A;  4PJM A;  2FQ3 A;  3WG7 H;  3LOC A;  2BHZ A;  2X9D A;  4ENJ A;  1FBU A;  2EZI A;  3QF3 A;  1IZ1 A;  1B9M A;  3V8L A;  2XF6 A;  4QLC U;  3ME5 A;  3K4L A;  3KIO A;  2GIV A;  1PP7 U;  2PXF A;  3OS0 A;  1WH8 A;  3LSJ A;  5F27 A;  3ZMV A;  3BPX A;  2EJR A;  5H20 A;  3PFY A;  4CH7 A;  3QPT A;  2R7R A;  2A61 A;  2LBF A;  1R1U A;  4QPQ A;  5L3G A;  4EM2 A;  3I5U A;  3MLF A;  1YFH A;  1EH7 A;  1GDT A;  2GZW A;  5LGU A;  2GOM A;  2O3F A;  2FU4 A;  2AS5 F;  1XN7 A;  4G6D A;  1ETQ A;  1K61 A;  1T0F C;  4AD9 A;  1YSE A;  2XAU A;  5DDG A;  3O8H A;  5ICE A;  2Q0O A;  3HG9 A;  5ERI A;  1OIS A;  3LFK A;  1QPZ A;  2BXY A;  2L9V A;  3O2P E;  4AIJ A;  5FLX K;  4O8B A;  2NS0 A;  4XQF A;  3M8J A;  1T33 A;  1UXC A;  3PO2 J;  1G4D A;  2IS1 A;  2DDB A;  2K40 A;  2FD5 A;  4OMZ A;  3MAJ A;  1FSH A;  5EYR A;  4EV0 A;  2E7X A;  3BQZ A;  4CYC A;  3S3M A;  1IRF A;  1H9T A;  1X3U A;  2PUA A;  1MMD A;  5D5U B;  3HOV J;  3ZP5 A;  3E5U A;  3HOT A;  5HNF A;  3CQZ J;  3FXK A;  3DF8 A;  3Q0W A;  2VBZ A;  1Y39 A;  5EGO B;  2EFO A;  2ICP A;  4R1H A;  3DBR B;  3HYI A;  4DBQ A;  2AHQ A;  4ITV A;  2W00 A;  4OB4 A;  3HEF A;  4M3B A;  1OYY A;  5D8K B;  2ZSH B;  4F92 B;  3UWP A;  2Q1Z B;  2D1V A;  5F0H A;  4CGZ A;  3NRO A;  3D1N I;  1SAX A;  5GAD J;  1VQN I;  1ZGJ A;  3IUO A;  3OYI A;  1W36 D;  2GLO A;  2TCT A;  3BR5 A;  3L2C A;  4DJA A;  2COB A;  2ZXJ A;  3ML6 A;  1SFX A;  5FFX A;  1TZL A;  4IEJ A;  2VKD A;  2WAQ N;  3FXM A;  5D6F A;  3CCS I;  5HS7 A;  3I54 A;  3WE2 A;  2K86 A;  2NVU B;  3CCL I;  3RZZ A;  2FX0 A;  1CGP A;  3DCF A;  3S8Q A;  3AKZ A;  4A3L J;  2ID3 A;  4AWX B;  3JAM K;  1LPQ A;  1ZN2 A;  3WTZ A;  4RAY A;  2YR2 A;  4ZDL A;  2H27 A;  1LVK A;  5CKT A;  5B5E C;  1PRU A;  2A6T A;  1QVT A;  4ZJZ A;  1BC8 C;  3AFH A;  2MFZ A;  1P7I A;  3ZN1 A;  3EYI A;  2HYF A;  4D5F A;  3CDH A;  2LDU A;  2V3C C;  5J1R A;  2VKH A;  3NRV A;  5EJC A;  2G7U A;  2VE8 A;  3H0D A;  4M72 A;  4EJT A;  3HOY J;  3L09 A;  4RGR A;  3SEQ A;  2AXT C;  5DD8 A;  3JSO A;  3OYN A;  2RQP A;  1J5Y A;  1D0X A;  1E17 A;  1F4K A;  2O49 A;  3ZMS A;  1BDI A;  3HIF A;  2W1O A;  1KYZ A;  1J75 A;  3FXU A;  2X1E A;  3W3C A;  3WHC A;  1X2N A;  1YX3 A;  1FWZ A;  4B47 A;  5DCM A;  2KZ8 A;  1MND A;  2LG4 A;  4HEA 2;  5LHI A;  4L9V A;  5M3F J;  1SQ8 A;  4C2T A;  1XCV A;  2KJB A;  1W5T A;  1SD6 A;  3ZQ7 A;  2CV1 A;  2XI8 A;  2JN6 A;  4IVN A;  3PJR A;  1EH8 A;  3ZQC A;  3WG9 A;  2LKX A;  3HUG B;  3HTU A;  2DPD A;  2LH9 A;  4X0G A;  1BC7 C;  5C44 J;  3SEZ A;  5LD2 C;  2DFH A;  4IHV A;  3N97 A;  1ZUG A;  1M1E B;  2IP2 A;  4HDV A;  1PER L;  1FPQ A;  3IC7 A;  4XKV A;  3HZI B;  2OTL I;  4X1E A;  5IP7 J;  2DK8 A;  1XB4 A;  2IPQ X;  2Q2E B;  4KT5 C;  5HS8 A;  3QAH A;  2NOJ B;  1VQ6 I;  2QA4 I;  1LDD A;  2CUF A;  1ITY A;  2W57 A;  3KP6 A;  1LEB A;  4A0Z A;  5LGT A;  3M4O J;  4L5E A;  5E8I A;  2NS7 A;  1V55 H;  4XRF A;  4M9S A;  3IKT A;  5M5Y J;  4XL9 A;  1MBH A;  3I64 A;  3GTG J;  4IF4 A;  1Z91 A;  5DCF A;  4MHG A;  5LHG A;  4YFK F;  2DA4 A;  3G1M A;  1V5E A;  2BYV E;  2ZC2 A;  2X48 A;  3FDY A;  1OCO H;  2VIX A;  3DBH B;  4JCX A;  4R8H A;  1ZQ3 P;  3KPH A;  2CUE A;  3VYR B;  3I3L A;  1N77 A;  1PYV A;  3RZO J;  1TQM A;  5J8F A;  1A5J A;  1GHC A;  3HSE A;  4PUS A;  3W6J B;  3JXC L;  5C3E J;  1AWC A;  1XGS A;  1R23 A;  1U9N A;  2QKL B;  3F72 A;  4JP0 A;  4EJO A;  4II3 A;  4FHT A;  3CLC A;  3GEZ A;  2MC4 A;  4XOR A;  5DRY A;  3H5T A;  4FE4 A;  3F8N A;  2LOO A;  4LMY A;  2LK2 A;  1IDY A;  1Z77 A;  1FYM A;  3U9G A;  3KYC B;  2O8X A;  3QPH A;  1T98 A;  4D9J A;  5M3M J;  2Y69 H;  2CV2 A;  2VOD A;  1J59 A;  3NQO A;  1DQU A;  3CJQ B;  5EG0 B;  4KIC A;  2DJI A;  1ZAY A;  3WOD F;  1BBY A;  1WH5 A;  3P9I A;  2HDC A;  5IT3 A;  3F6W A;  1ZKG A;  3IH3 A;  5AON A;  4I7H A;  3DPL C;  5F1R A;  5FD6 A;  4GRI A;  3F22 A;  3E1S A;  1J2X A;  5K1Y A;  3CME I;  1PRV A;  3P9K A;  4L5I A;  1TLH B;  3QQA A;  4A3M J;  2L01 A;  1YYV A;  1JKP C;  4HF0 A;  3VDX A;  2A05 A;  2CMP A;  4EVI A;  1J0R A;  3UKG A;  1X1B A;  4BHB A;  4CCL A;  3M7G A;  4AYB A;  4BBR J;  2ZJR F;  1U3E M;  3SHF A;  3RPQ A;  2R0Q C;  1YS6 A;  2EFP A;  2RDP A;  4YFX F;  4U87 A;  2R5Z A;  1QVU A;  5BPD A;  1RIO H;  2K9L A;  1HDP A;  2XSD C;  2MAB A;  4I8T A;  3LA3 A;  1F1Z A;  1K78 A;  4FET A;  3QP6 A;  1G8X A;  1A6Q A;  3NWT A;  3MWM A;  1ORK A;  1P92 A;  2P5V A;  3HXL A;  2CQK A;  2KIF A;  3KP5 A;  3CMA I;  3K4K A;  4L0Z B;  2LLW A;  4PDK A;  3ZCO A;  1T39 A;  1IV8 A;  1FTZ A;  4GGG A;  2OUM A;  1XGO A;  4HZF A;  4XN0 A;  2BY3 A;  2KMU A;  5HLH A;  4A3B J;  3MZ8 A;  5J40 A;  3TRB A;  2IGO A;  3MD2 A;  4LD5 A;  4A3I J;  3BZ6 A;  4Y4R A;  1LB2 A;  2PX9 A;  2LR8 A;  3AL0 C;  1UJ8 A;  3SCF A;  3TO7 A;  4HST A;  2FQ4 A;  3ZPL A;  1QZX A;  4P9F A;  4UXN A;  4XRS A;  4JK1 X;  2O0Y A;  2DA5 A;  3HOS A;  1MMN A;  3GTP J;  2DO7 A;  3QOE A;  1WWX A;  2P7C B;  1W7P D;  5LRR A;  2IRF G;  1GT0 C;  4QIW N;  3VYU B;  2EV5 A;  2H6B A;  2KIM A;  4PFO A;  4CCK A;  5K98 B;  3LIS A;  1DUL A;  2KPJ A;  1HKT A;  4KIG A;  2ZJQ F;  2CQQ A;  2A69 F;  1D5V A;  3VWS A;  1UB9 A;  3IWZ A;  2L02 A;  2KRC A;  3E7L A;  3S3O A;  1G6N A;  4MCX A;  2V9K A;  2RV8 A;  2GWR A;  2NVT J;  3OYK A;  1AA7 A;  3V8J A;  3OYB A;  5LFA A;  3CZ6 A;  5J47 A;  4N4N B;  1SD7 A;  4F52 A;  4QSH A;  3HKZ N;  2Z33 A;  5DM7 F;  2ISY A;  2IA0 A;  1D1C A;  5FRO A;  3OS1 A;  1X58 A;  2WAD A;  3RQI A;  1PP8 F;  3I56 I;  4RBO A;  1RPW A;  2VI6 A;  1VQ4 I;  4XSX F;  1W7P B;  3ZMU A;  4HLY A;  3I4M J;  2KT0 A;  5J1Y A;  2MLG A;  5JVT A;  1KU3 A;  2TDX A;  3HOU J;  3KCC A;  1Z0X A;  3ZMT A;  3RPU A;  4XID A;  2JA6 J;  4X4F A;  3HSF A;  2ETH A;  5CVR A;  3ZXS A;  3QFI A;  5L3B A;  4S05 A;  2HQ5 A;  3PSF A;  3SCG A;  1R5I D;  2EA4 A;  1B59 A;  3GWZ A;  4F55 A;  5EEA A;  4F91 B;  3QYF A;  2G9W A;  2X1C A;  3OP9 A;  5FRM A;  2JWT A;  1RPE L;  4GDF A;  2L7F P;  4CSW A;  1IN6 A;  4Z6Y A;  2FJR A;  2CUZ A;  3RQ4 A;  1JUM A;  4MIM A;  3F0C A;  3K9T A;  2CH0 A;  1W1W E;  2FNA A;  3JXB C;  4ZYA A;  4E7H A;  5CPR B;  3ESW B;  3R4K A;  3W6K B;  2JTV A;  3WHB A;  5BNG A;  5D8L B;  2L5Q A;  3CJT B;  3EUA A;  4BH9 A;  3OIP A;  2WAF A;  4NC7 A;  2M8G X;  1DGW Y;  1SD4 A;  4M3E A;  1ZTR A;  1DP3 A;  2V4J C;  1PUF B;  1Z3Y A;  2EIM H;  3A02 A;  3FXJ A;  2L9R A;  5F64 A;  1HW2 A;  4J01 A;  2XHK A;  3DU5 A;  2QQA A;  5HDK A;  1UHM A;  5BOX A;  3TGN A;  1G2H A;  4LGW A;  5DV5 A;  3R0A A;  4EKI A;  3ERM A;  1V54 H;  2G7H A;  1J9I A;  4CYD A;  3ELK A;  3HUG A;  3J80 Z;  5B1A H;  3G0T A;  1HKS A;  3BPV A;  5F1J A;  4ABZ A;  3IH4 A;  3ISP A;  4I6Z A;  4P1W A;  5E8G A;  1SEU A;  5EEG A;  3H1C A;  4RB0 A;  4WX9 A;  3FXO A;  4C2U A;  4ENM A;  4RS8 A;  2XAJ A;  3OYA A;  4CXF A;  1V3F A;  3FMY A;  2YUS A;  3IAM 2;  1I6H J;  4C3J J;  3HGY A;  5FKK A;  1ZEL A;  1I27 A;  1YJN I;  1KA8 A;  2P0W A;  3V8K A;  1P9Q C;  2V1X A;  3DLA A;  5GPA A;  1JXS A;  1X4P A;  1X3W B;  4A5M A;  1L0O C;  2FEZ A;  3NDB B;  4O3M A;  1NEQ A;  2M2E A;  4IHT A;  4LG0 B;  1IRG A;  3S1R J;  2Z9O A;  1KU7 A;  1VQL I;  3VFZ A;  3K10 A;  4B44 A;  2Z3Y A;  3BR2 A;  4BY1 J;  4G6Q A;  3EDP A;  2IA1 A;  4BE2 A;  1DU6 A;  1W0T A;  3KP4 A;  4MEY F;  3CCM I;  3JRH A;  2R7U A;  1MMG A;  3P7N A;  2F4I A;  3QU3 A;  2VBX A;  4IWR A;  3ASN H;  3BLY A;  1KZH A;  1A6I A;  2PN6 A;  3I58 A;  3KET A;  4K2E A;  1U2Z A;  1WRJ A;  1LVA A;  4B09 A;  3KP2 A;  1KGS A;  2IVB A;  2QQ8 A;  4XR6 A;  4DZJ A;  4M6X A;  1RRJ A;  2EA2 A;  1T6S A;  4ER0 A;  4LOC A;  2M7A A;  3J7Y J;  3AAF A;  1KON A;  2MQK A;  1GXQ A;  2F6C A;  1ZRF A;  4U0V A;  2CWE A;  5F0F A;  2XPU A;  4PJJ A;  4P9U A;  1Z6R A;  4X4I A;  4GFB A;  3GO5 A;  3BC8 A;  1WJF A;  4KMU X;  3CUQ A;  3BJ6 A;  3BJA A;  4BEH B;  1MJA A;  2DQR A;  1QQI A;  1YQA A;  3RKX A;  4Y15 A;  2RC4 A;  1OR7 C;  3IV5 A;  5HVQ C;  3M9L A;  2L49 A;  3KYD B;  1HSJ A;  3D0S A;  2E2J J;  4EAT A;  1W5C C;  3B6C A;  1ZAR A;  2Z1D A;  3R1F A;  4M74 A;  4UVC A;  3T5X A;  1WJD A;  1I5Z A;  4Y42 A;  3ZKC A;  2UUZ A;  3LSR A;  4LLL A;  2VBW A;  2QBY A;  1UHW A;  3F9K A;  5DEQ A;  4GXO A;  4XLH A;  3I59 B;  4MCT A;  4BXU A;  3HHH A;  1U9O A;  1R00 A;  2ZSI B;  3CES A;  1YRN B;  1XMK A;  4IO9 F;  4IOA F;  4GYG A;  4YEJ A;  1SVO A;  3C3W A;  3ZR8 X;  3T1B A;  5JHU A;  2VT3 A;  2WB1 N;  2ZCW A;  3HZJ A;  1TWH J;  4V2G A;  4BQN A;  5LEJ A;  2DMP A;  1FIP A;  4O6J A;  3H36 A;  3OSF A;  1E0E A;  2FE3 A;  2STW A;  4A93 J;  1V4R A;  1WJA A;  1YO5 C;  1FEX A;  3K4N A;  4I0A A;  2JQ7 A;  4G9Y A;  4ZZD A;  2KPM A;  4XON A;  5GAH J;  4S0H B;  4XOP A;  9ANT A;  1SFE A;  3QU6 A;  3RKQ A;  1ZZ9 A;  5FRN A;  4A3J J;  3OYH A;  2RN7 A;  3CMM A;  4HRI A;  1G3S A;  3Q9S A;  4UHT A;  5EF6 A;  3PIO F;  4U88 A;  1IXS B;  2HYJ A;  1WFX A;  2RGV A;  3OL3 A;  2JUG A;  1GV5 A;  1W5S A;  1ZLJ A;  1R49 A;  4G6T B;  5IT9 Z;  2KLO A;  2YPR A;  2OZ6 A;  2E35 A;  2IU7 A;  3OYD A;  4M3G A;  3VB2 A;  3OIQ A;  2DMU A;  3U21 A;  4I6R A;  2EZH A;  2LFB A;  2X6Y A;  1R69 A;  3KLO A;  2EH3 A;  4WXD A;  2EFW A;  2PXV A;  1ZAO A;  2DOF A;  2B7E A;  3VPR A;  4N9H A;  3T8T A;  2EZK A;  3RIR A;  1KYW A;  1RZR D;  1U5T C;  3GYH X;  1VQ7 I;  3F21 A;  2PG4 A;  2LYS A;  2Y0M A;  5H6Q A;  5KK1 A;  5JLW A;  3K4C A;  5IOZ A;  1GUU A;  1BW6 A;  1DGR M;  4W1U A;  5AIP A;  4F8D A;  1JT6 A;  1JUP A;  4B3A A;  1P7J A;  4DYC A;  3D5S C;  3GBG A;  4NQW B;  1EF4 A;  3HPG A;  4TV7 A;  2R7V A;  2QQ9 A;  3VK0 A;  2PJR A;  4GHJ A;  3EUH C;  2K3F A;  3ERE D;  1D8K A;  1FBS A;  1WHU A;  3E6M A;  1LJ9 A;  1D1B A;  2DMN A;  4IJA A;  1I50 J;  5JR3 A;  2AO9 A;  2RQQ A;  2LYP A;  3G4S I;  4WXC A;  2LY2 A;  3NEU A;  1IUY A;  5JHF A;  2CQ7 A;  5FKO A;  2K7L A;  1Z67 A;  3B02 A;  2Y0S A;  2V9V A;  2NNN A;  1BIB A;  2CFX A;  2I5U A;  2O6G E;  2JRM A;  2ZFU A;  4W97 A;  2WC2 A;  2JVH A;  4Z2Y A;  5JFR A;  1FIA A;  3K4J A;  3CMY A;  1I39 A;  4PU7 A;  3BZC A;  2ODR D;  3M8E A;  4XKC A;  4O5V A;  4CCM A;  3Q5F A;  2HQR A;  2L4A A;  4P55 A;  2B9S A;  4MNU A;  1H9G A;  2XRL A;  2CGP A;  1DDN A;  2DYR H;  1ENH A;  3QPL A;  2COM A;  2VON A;  1WH7 A;  2ZME B;  4X4H A;  3HC7 A;  2HKX A;  3CJN A;  5CVI A;  2LVS A;  2PQ8 A;  1ZG3 A;  2HPI A;  3LAJ A;  4C3H J;  1JT0 A;  1JKO C;  4V2F A;  2KL4 A;  1HC8 A;  3DTE A;  2VAS A;  3TDU C;  2M4K A;  1ON1 A;  1W7P A;  1R63 A;  4RM2 A;  5EZG A;  2ELK A;  3RKW A;  5FLX Z;  2PJP A;  2HVS A;  5IYD J;  3LSK A;  1ODD A;  3ABU A;  1R1V A;  3R6S A;  2W84 A;  4WF2 A;  4KA4 A;  2CG4 A;  1T2K A;  5IY5 H;  1XDS A;  3GFL A;  2AQF A;  5JLX A;  3A0H C;  1WI3 A;  2LF7 A;  5ICG A;  4U0W A;  5E18 F;  3L7W A;  2JSC A;  2PI0 A;  1TBX A;  2CO5 A;  5F0C A;  5L3C A;  3LNQ A;  4N9I A;  1NHA A;  3ASO H;  4OIQ F;  4E70 A;  4I98 B;  3QYB A;  1S29 A;  2M8E A;  1S5L C;  2PLY A;  3LST A;  1X2L A;  3ABL H;  4RAF A;  3DM5 A;  3WU2 C;  2ADU A;  2K9N A;  4B1R A;  3KX2 A;  2DFF A;  3SZT A;  4BKX A;  1FSE A;  1Y7Y A;  1G3T A;  1U6G A;  3BJO A;  1BOB A;  3RI4 A;  2CS3 A;  2L9S A;  1PUF A;  3GTL J;  1HXD A;  2PXK A;  3E5Q A;  3ZHM A;  4M9Z A;  1HA8 A;  3PFI A;  3JRB A;  1D0Z A;  2WAE A;  3MEX A;  3FM5 A;  3OOU A;  2KIQ A;  1EH6 A;  2DT7 B;  1UFM A;  2W48 A;  3G7D A;  2OJE D;  3FIW A;  3J81 Z;  1IXC A;  3BQY A;  3GX4 X;  4B8X A;  2PBI A;  1BI0 A;  4C9Y A;  1ZK8 A;  3WTX C;  4YG4 A;  4LG3 A;  4KNY A;  3COA C;  3MEJ A;  2O61 A;  5L3E A;  2IS4 A;  2DFE A;  3JAM Z;  3KZI C;  2AXL A;  1PJR A;  2NOG A;  1IUF A;  4LJZ F;  4RB3 C;  2FOK A;  2L4M A;  3FZV A;  1FOK A;  1TWG J;  2DA6 A;  4G7Z F;  4BAC A;  3KEO A;  3ABT A;  3PNY A;  5J4Y A;  1LLI A;  4LG0 A;  1XD7 A;  2PXQ A;  1R7J A;  1D5Y A;  3F6O A;  2IW5 A;  5HLT A;  2YBD A;  2BW3 B;  3JW4 A;  2WV0 A;  1OCT C;  2LD5 A;  4Y7N J;  3SZP A;  2OQG A;  3W2W A;  1ZZ6 A;  1VF9 A;  4QPO A;  3B6A A;  5CVU A;  1X1C A;  3C2B A;  5BPI A;  4WK8 F;  3ZN0 A;  3MKL A;  2JPB A;  4HRA A;  2IJL A;  1IG7 A;  5EEH A;  2P81 A;  1HLV A;  4HLX A;  2LYC A;  2DMQ A;  4I99 C;  1LKX A;  5BQT A;  2GM4 A;  1MSE C;  3OYG A;  5D5W B;  1MSF C;  3SCH A;  5J3L A;  1FT9 A;  3PUB A;  2XGX A;  2E1M C;  3CCQ I;  3MZH A;  1YJ9 I;  1QZY A;  2WY7 Q;  3BY6 A;  4F3Q A;  1RR8 C;  3PQK A;  5KAF C;  1AHD P;  3PO3 J;  3ROU A;  2XKO A;  3V7S A;  2CQN A;  2L3D A;  2E5N A;  1B8I B;  2E1M B;  2PUC A;  1MD0 A;  1CQT A;  3OYF A;  2EWT A;  2WUS R;  1H8A C;  4G7O F;  1IJW C;  3K0L A;  1DPU A;  3GW2 A;  4YIF A;  3HTS B;  3QOD A;  2CV0 A;  2XGE A;  1IN4 A;  4NC6 A;  3E6D A;  4OMY A;  2L8N A;  3FWE A;  5DT2 A;  4HNU A;  1NTC A;  4BQQ A;  2ZKZ A;  3I59 A;  1QB2 A;  4J1X A;  2WAQ A;  2DPU A;  1YRN A;  4WVL A;  3FKI J;  2LRE A;  2FML A;  4C30 A;  5FLM J;  2HI3 A;  3PL8 A;  1S72 I;  5HOO A;  2XAF A;  3BTL A;  5JUW A;  1L1M A;  1J7K A;  2Q8K A;  3L2U A;  4FE7 A;  2JCG A;  2JT1 A;  3I55 I;  2PUF A;  1XSV A;  4A0Y A;  3WU1 B;  4DIQ A;  3OR2 C;  1LE8 B;  1P6R A;  2EFN A;  3V4G A;  4XIC A;  3K4M A;  3OYC A;  1TNT A;  1UEL B;  4CDG A;  5L3F A;  3HGG A;  3MN2 A;  2M87 A;  3OY9 A;  2PIJ A;  3DTI A;  2F5E A;  1Y1V J;  2BXZ A;  2XJ3 A;  5K7H A;  4A3G J;  1FNN A;  4JYK A;  1PDN C;  3K1M A;  4H4K C;  3I4N J;  4HAM A;  2OAZ A;  2CSF A;  3S2D J;  3UNG C;  3GZC A;  3SR4 A;  1IRZ A;  3WTV C;  1KU9 A;  1WJ5 A;  3PNT A;  1Y9Q A;  3NXH A;  3GBF A;  4MO7 A;  5E3O A;  1IDZ A;  4CCO A;  2BVL A;  2CSO A;  3JRG A;  2R5Y B;  1ZYR F;  3JRI A;  5IPA A;  2ICT A;  3BDN A;  2F5D A;  2QKM B;  3DP7 A;  1WET A;  2PUG A;  2LC2 A;  2PXB A;  1X1P A;  2LP0 A;  2OV7 A;  1FZP B;  5FD5 A;  1BI3 A;  5DTD A;  2XKP A;  4E7I A;  1MIJ A;  3BCA A;  3UR3 C;  2IBD A;  2A5Y B;  2QCO A;  4Q48 A;  5GP9 A;  1AU7 A;  1K4S A;  3K2Z A;  5D5V B;  2IS6 A;  2JJ7 A;  3SQN A;  4FIS A;  4NQW A;  4AUX A;  2XXA A;  3LSH A;  4GYI A;  3JRE A;  2XIG A;  3S14 J;  4ZZL A;  3BT9 A;  4L0Y B;  2EZL A;  3I71 A;  3FF5 A;  2IA2 A;  1FMV A;  1RKW A;  3GF2 A;  3DXJ F;  2DFI A;  3F3X A;  3O6B B;  2DA1 A;  5K5Q A;  4XKW A;  2NXN B;  2VKE A;  3FMQ A;  1ZR4 A;  4IQ4 A;  2BZT A;  5DTQ A;  4D7N A;  1RZR A;  1ZPQ A;  3JSP A;  4UB6 C;  4E4H A;  2QSF X;  1R36 A;  2R7W A;  1LCD A;  1E3P A;  1T95 A;  2R4G A;  4LK1 F;  2W4S A;  2LY1 A;  3TW7 A;  1ETY A;  3ZQI A;  2ZNZ A;  5CVV A;  3M8F A;  1JFS A;  1HCR A;  2KFD A;  2R92 J;  5E3N A;  3R09 A;  2FF4 A;  3G1O A;  1WSU A;  1WJE A;  3OYL A;  1PUE E;  1NER A;  2ZME A;  2HXO A;  4ZDP A;  2VQL A;  3WTW C;  4ENN A;  2VJI A;  5TJJ A;  2D45 A;  1HF0 A;  4IVZ A;  4A5N A;  1S7A A;  4YII A;  3K70 D;  3QQ6 A;  4PCQ A;  5GAE J;  2P6T A;  4ZDO A;  3VSK A;  4BXF A;  4FQG A;  4Z59 A;  3GUD A;  2JZY A;  1XSX A;  5DM6 F;  1IV6 A;  2HCS A;  4PJN A;  1ULY A;  4LIV A;  4FT8 A;  4RGS A;  3I0T A;  4EQQ A;  2J5P A;  3ZRG A;  1GXP A;  2VC1 A;  1N75 A;  4HX8 A;  4YBA A;  3PNV A;  4PFP A;  2L1P A;  2XUB A;  1UST A;  1MZB A;  4CZC A;  3BR6 A;  1DW9 A;  2M4H A;  1X3Z B;  4BJT A;  3K70 C;  2PXP A;  2VOO A;  3NZL A;  1ETV A;  4JX4 A;  2E7W A;  2QWW A;  3OV8 A;  4KUM A;  4BU2 A;  4CCN A;  5IOY A;  2UZK A;  2IUO A;  1XC5 A;  4IKF A;  1ZVV A;  4UV8 A;  1U0J A;  5HNH A;  3OYJ A;  5E20 A;  3M3Y J;  3AG3 H;  1MJB A;  3OMY A;  2OBP A;  3Q0V A;  2ECB A;  5E1X A;  3J7A Y;  1Z7U A;  3SYT A;  4CZZ A;  1R9T J;  4X4C A;  4XLP F;  4XKB A;  2BNM A;  3G6E I;  4NHJ A;  5E3L A; 
#chains in the Genus database with same CATH homology
 3JRC A;  2DA3 A;  1W0T A;  1B72 A;  3S2H J;  3JRH A;  2HIN A;  3S1N J;  1F43 A;  4IWR A;  1A6I A;  1LFB A;  2DA7 A;  1OJL A;  3BR3 A;  1OFC X;  2YS9 A;  4PU4 C;  4X4D A;  2OF7 A;  2IVB A;  2HOT A;  1DU0 A;  2DMT A;  4DZJ A;  1JKQ C;  3A03 A;  2ME0 A;  1JJ6 C;  2B5A A;  1RR7 A;  2X6O A;  4LOC A;  1APL C;  2HDD A;  2AXZ A;  2MQK A;  2R5Z B;  3GN5 A;  2XPV A;  3FIS A;  5F0F A;  5GPC A;  2XPU A;  2VUM J;  3KZ3 A;  1JFT A;  4X4I A;  3IVP A;  4GFB A;  3B7H A;  2TRT A;  3SJM A;  3LSP A;  5F04 A;  3LOC A;  5EGO A;  1LQC A;  1MBF A;  2X9D A;  2LTP A;  2O7O A;  3IV5 A;  2EZI A;  3QF3 A;  2L49 A;  2E2J J;  2BNO A;  3B6C A;  2L7Z A;  3G5G A;  3GTK J;  4DYR A;  1VND A;  3R1F A;  1VI0 A;  2B63 J;  3F52 A;  1HOM A;  1WH8 A;  2L0K A;  3LSJ A;  5F27 A;  4Y42 A;  3ZKC A;  3LSR A;  2DJN A;  4C2M J;  2Y31 A;  4DW6 A;  1O4X A;  3BD1 A;  2MG4 A;  4MCT A;  4Z5H A;  4A3E J;  3MLF A;  1U9O A;  4X4B A;  1GDT A;  1YRN B;  4XK4 A;  2PMZ N;  4A3D J;  3BG9 A;  1ETQ A;  4I6U A;  1K61 A;  1XS9 A;  1YSE A;  3O8H A;  2WB1 N;  4V2G A;  1TWH J;  1QQB A;  5J1U A;  1WGX A;  2DMP A;  1QPZ A;  1FIP A;  3OSF A;  2AWI A;  4A93 J;  4J19 A;  1XWR A;  4O8B A;  3EUS A;  1FEX A;  1T33 A;  1UXC A;  4X6A J;  3PO2 J;  2H8R A;  1GV2 A;  2I10 A;  2K40 A;  3ZQH A;  2FD5 A;  4S0H B;  2NVY J;  9ANT A;  2MW8 A;  1ZZ9 A;  3RKQ A;  2HOA A;  5EYR A;  1BDH A;  3BQZ A;  4CYC A;  4A3J J;  2JVL A;  2PUA A;  4UUT A;  4AYB N;  3HOV J;  4D7M A;  3RZD J;  5EF6 A;  1BL0 A;  2WIU B;  4I6T A;  5IP6 A;  2HYJ A;  3CQZ J;  3BG5 A;  3HB9 A;  3Q0W A;  2CRO A;  2XIU A;  1GV5 A;  2EF8 A;  5EGO B;  1UMQ A;  2IU7 A;  1ZGW A;  2ICP A;  2XPW A;  1QP0 A;  4M3G A;  2AHQ A;  2CU7 A;  2MSY A;  4OB4 A;  3HEF A;  4M3B A;  2DMU A;  4A3F J;  4I6R A;  2EZH A;  2LFB A;  1R69 A;  2AW6 A;  2EH3 A;  1I3Q J;  3VPR A;  2L7M P;  2EZK A;  3IH2 A;  2LYK A;  1RZR D;  5F0H A;  3BR1 A;  2LYS A;  4XRM A;  3D1N I;  4G12 A;  2AXV A;  2IV1 A;  5JLW A;  5IOZ A;  1GUU A;  1BW6 A;  3A01 B;  2M0C A;  4W1U A;  3S16 J;  2GLO A;  2GRM A;  1X57 A;  2TCT A;  3BR5 A;  1JT6 A;  1JUP A;  4B3A A;  1P7J A;  1U8B A;  4DYC A;  2COB A;  3GBG A;  4D5C A;  1EF4 A;  4IEJ A;  4AC0 A;  2WAQ N;  4GHJ A;  3VK0 A;  1ZZC A;  1LE8 A;  2A6C A;  3FYM A;  3S15 J;  3BR0 A;  3RZZ A;  3O9X A;  2FX0 A;  4UUS A;  2LLK A;  2R1J L;  2DMN A;  3DCF A;  1I50 J;  4A3L J;  3S8Q A;  1EFA A;  2AO9 A;  1FTT A;  2LYP A;  4PU3 C;  2ID3 A;  2R93 J;  5M5W J;  4M6V A;  5C4X J;  4IHX A;  1UXD A;  5FKO A;  3JRF A;  1PRU A;  1QVT A;  1WIZ A;  2CJJ A;  3ZHI A;  1P7I A;  1QP7 A;  4W97 A;  4D5F A;  3FK7 A;  1E3O C;  1H89 C;  1FIA A;  3QYX A;  3CMY A;  5J1R A;  4PU7 A;  2HXI A;  3HOY J;  2XRL A;  4MFE A;  2OFY A;  1QPI A;  1RZS A;  2O49 A;  1ENH A;  3QPL A;  2CRG A;  1PRA A;  1BDI A;  1WH7 A;  2E19 A;  4X4H A;  3WHC A;  1X2N A;  1VPW A;  3BG3 A;  2LVS A;  2IAI A;  1JT0 A;  2BJC A;  4C3H J;  5EZH A;  1JKO C;  1ETW A;  2KZ8 A;  4V2F A;  2PUB A;  1UG2 A;  5M3F J;  1SQ8 A;  4BY7 J;  1Q1V A;  2E1O A;  1FJL A;  1R63 A;  2XI8 A;  4JX6 A;  2JN6 A;  5EZG A;  1JUS A;  3ZQC A;  1BA5 A;  2ELK A;  3JRD A;  2LKX A;  2PE5 A;  5IYD J;  5C44 J;  1LCC A;  4IHV A;  2N8G A;  4EEF G;  1ZUG A;  4IHY A;  1PER L;  2LYL A;  1UHS A;  2FJ1 A;  2O38 A;  4B4C A;  5JLX A;  1MH4 A;  3HZI B;  1CJG A;  1PNR A;  4X1E A;  3S1M J;  2JMW A;  1WI3 A;  1B0N A;  5IP7 J;  3SDG A;  1RIO A;  3TP3 A;  5EG0 A;  3FK6 A;  5F0C A;  3MVP A;  3LNQ A;  2ZB9 A;  4YAR A;  1AKH A;  2GRL A;  4JCY A;  2CUF A;  1ITY A;  4JQD A;  4DYQ A;  1X2L A;  3M4O J;  4L5E A;  2NS7 A;  1B72 B;  5M5Y J;  2K9N A;  4B1R A;  3H3V K;  1ZS4 A;  1MBH A;  3GTG J;  4BKX A;  1ZZ7 A;  5FKM A;  1Y7Y A;  3H0G J;  1PUF A;  2DA4 A;  2VKV A;  3QWG A;  3G1M A;  3GTL J;  1JH9 A;  1SFO J;  2X48 A;  2XGD A;  2H1K A;  4JCX A;  3OQM A;  3ZHM A;  1ZQ3 P;  1RET A;  1OCP A;  2CUE A;  3BTC A;  3JRB A;  4PU8 A;  5IP9 J;  3PM1 A;  3Q3S A;  2VPR A;  5EDN A;  2E2H J;  1A5J A;  3JRA A;  3OOU A;  3GTJ J;  3Q0U A;  3GN5 B;  4QTR A;  2AXU A;  3JXC L;  4YG7 B;  5C3E J;  2W48 A;  2LYJ A;  1SAN A;  1U9N A;  3BTI A;  5C4J J;  4JP0 A;  3G7D A;  1JWL A;  3FIW A;  2JA7 J;  1IC8 A;  2Y30 A;  3BQY A;  3CLC A;  4IA8 A;  2KEK A;  4YG4 A;  4J1W A;  1ZK8 A;  2R63 A;  3OMT A;  2KEI A;  3H5T A;  3G1L A;  4FE4 A;  1B8I A;  4DZP A;  2GZU A;  2LK2 A;  1IDY A;  1Z77 A;  3GTO J;  4YG1 A;  2NOG A;  1IUF A;  5M3M J;  5IYC J;  2EQR A;  2GBY A;  2NVQ J;  1TWG J;  2DA6 A;  2KDZ A;  3GTQ J;  1MBG A;  2QF7 A;  3ZQG A;  1JKR C;  4F8D A;  5EG0 B;  1LLI A;  1ZAY A;  2XB0 X;  4Z5C A;  2EBY A;  1WH5 A;  4MLO A;  2PPX A;  2XGC A;  1D5Y A;  3F6W A;  1ZKG A;  3IH3 A;  2Y9Y A;  1MNM C;  3OQN A;  1JTX A;  3TED A;  1OCT C;  1HDD C;  2LD5 A;  2M34 A;  4Y7N J;  2Y9Z A;  1PRV A;  3QQA A;  4A3M J;  3ZQL A;  2DTZ A;  1GVD A;  1JKP C;  1DWK A;  1ZZ6 A;  1VF9 A;  3NAR A;  2E2I J;  3B6A A;  4NDL A;  3UKG A;  1MBE A;  3C2B A;  4HNV A;  1TWA J;  3MKL A;  4BBR J;  1IG7 A;  2R0Q C;  2P81 A;  1HLV A;  2JK3 A;  2ID6 A;  2HSG A;  4BBS J;  4FN3 A;  1POU A;  1ZZ8 A;  2R5Z A;  2DMQ A;  3W6V A;  4CYC B;  2GM4 A;  1QVU A;  1MSE C;  1POG A;  4M3D A;  1HDP A;  1MSF C;  2LCV A;  2XSD C;  3SCH A;  5J3L A;  5DS9 A;  2XB5 A;  4I8T A;  5K7Z A;  1X2M A;  2NVX J;  5F08 A;  1AHD P;  3O8G A;  3PO3 J;  1ORK A;  2R5Y A;  3SFI A;  1ZR2 A;  1B8I B;  4X4G A;  2PUC A;  3F51 A;  4X4E A;  1T56 A;  5E3M A;  4I76 A;  4FTH A;  1CQT A;  2JA5 J;  1UTX A;  2EWT A;  1H8A C;  2WUS R;  2JA8 J;  1IJW C;  2LYQ A;  2G0E A;  3HDD A;  1MBK A;  1FTZ A;  2XGE A;  1JTY A;  2L8N A;  1ETO A;  1NTC A;  2IVG A;  3CRO L;  3OSG A;  1TWF J;  4J1X A;  3BS3 A;  2RAE A;  1YRN A;  3FKI J;  4A3B J;  5FLM J;  2HI3 A;  3TRB A;  3S17 J;  1MH3 A;  2AUW A;  4Z58 A;  3BTL A;  1S7E A;  1ZZB A;  1L1M A;  4A3I J;  3JXD L;  4FE7 A;  2JCG A;  2PUF A;  3DEW A;  1LE8 B;  2LR8 A;  3SCF A;  4XIC A;  2CQX A;  4UUS B;  1F36 A;  2FQ4 A;  3HGG A;  3MN2 A;  2O4A A;  2PIJ A;  2OR1 L;  1Y1V J;  2XJ3 A;  5K7H A;  4A3G J;  4JYK A;  4XRS A;  3I4N J;  4GQM A;  2DA5 A;  1BW5 A;  2CSF A;  3S2D J;  5FKL A;  3GTP J;  3CDL A;  1TC3 C;  1GT0 C;  1IRZ A;  4QIW N;  2XCJ A;  1WPK A;  1JGG A;  2KEJ A;  1Y9Q A;  5M5X J;  3OIO A;  5K98 B;  3GBF A;  2OPT A;  3LIS A;  2IEK A;  4MO7 A;  5E3O A;  2O9L A;  1IDZ A;  2KPJ A;  2CQQ A;  2ECC A;  3JRG A;  2R5Y B;  3LFP A;  2LYR A;  2LY9 A;  4A69 C;  3JRI A;  2PUD A;  5IPA A;  2ICT A;  3E7L A;  3CEC A;  3BDN A;  4MCX A;  1XG1 A;  3HM5 A;  2PUG A;  1WET A;  2NVT J;  1NK2 P;  4XRS G;  2LP0 A;  2EBI A;  4M3F A;  4A3C J;  5A7L A;  5DTD A;  3UFD A;  3LSG A;  2IBD A;  4QSH A;  3HKZ N;  2QCO A;  5GP9 A;  3FYA A;  1AU7 A;  4FBI A;  4Z5D A;  1OSL A;  3A01 A;  1X58 A;  3RQI A;  2JJ7 A;  4C3I J;  4RBO A;  1RPW A;  2VI6 A;  4FIS A;  4AUX A;  4FCY A;  1IGN A;  3I4M J;  4MFD A;  2KT0 A;  3JRE A;  5J1Y A;  3S14 J;  3BT9 A;  2R7Z J;  2EZL A;  4NDW A;  3HOU J;  2D5V A;  1Z0X A;  4RDU A;  4XID A;  4IHW A;  2JA6 J;  4X4F A;  2NS8 A;  1RKW A;  1U78 A;  1H88 C;  2HQ5 A;  3BTJ A;  1TWC J;  3SCG A;  2DA1 A;  1LFU P;  2PUE A;  5EEA A;  1JJ8 C;  2VKE A;  1ZR4 A;  4D7N A;  1RZR A;  2K9Q A;  2HOS A;  1ZPQ A;  3OP9 A;  2JWT A;  1RPE L;  2L7F P;  2MGQ A;  1LCD A;  1RKT A;  2MEZ A;  2FJR A;  1AKH B;  1JUM A;  3QPS A;  4MIM A;  2Y2Z A;  2Y0S N;  1ADR A;  3F0C A;  3TW7 A;  1ETY A;  3ZQI A;  3ZOB A;  3JXB C;  1JFS A;  3HBL A;  3HOW J;  1HCR A;  3JR9 A;  5BNG A;  2DA2 A;  3WHB A;  2R92 J;  4BXX J;  1QP4 A;  5E3N A;  3KJX A;  3G1O A;  2M8G X;  1NER A;  5K7F A;  4M3E A;  2HXO A;  3ZQF A;  3GTM J;  1ZTR A;  3NAU A;  1PUF B;  3A02 A;  1ETX A;  1HF0 A;  1Y1W J;  4IVZ A;  2L9R A;  1ETK A;  5FKN A;  4A3K J;  2ME6 A;  3QQ6 A;  5HOD A;  3CCY A;  1W0U A;  1RES A;  2K9S A;  3PXP A;  1G2H A;  2O8K A;  1BJZ A;  5FJ8 J;  4Z59 A;  3U3W A;  1IV6 A;  1QRY A;  5F1J A;  4ABZ A;  3IH4 A;  4I6Z A;  1WH6 A;  3K7A J;  1NK3 P;  4YBA A;  2IVQ A;  3FMY A;  2YUS A;  1I6H J;  4C3J J;  1QQA A;  3HGY A;  5FKK A;  5FLV A;  3S1Q J;  1DW9 A;  3BR6 A;  3HOX J;  3OQO A;  1VFC A;  1MBJ A;  3TW6 A;  1ETV A;  4JX4 A;  1ZVV A;  2WV1 A;  5IOY A;  5GPA A;  1WCM J;  3TP0 A;  2IUO A;  1XC5 A;  4JX5 A;  3KXA A;  3DNV B;  5IYB J;  3M3Y J;  2M2E A;  1NEQ A;  2BNN A;  3S1R J;  2DN0 A;  3L1P A;  3Q0V A;  1LMB 3;  2ECB A;  3K2A A;  2YU9 J;  2M9H A;  1R9T J;  4X4C A;  2BNM A;  3BR2 A;  4BY1 J;  3RZO J;  4Y52 J;  5E3L A;  1DU6 A;  1K83 J;  3HOZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...