4O8BA

Crystal structure of transcriptional regulator bswr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
101
structure length
101
Chain Sequence
MLGTRLKAARIRAGYSQKQLGMLVGMDEFSASARMNQYERERHSPNMRTSEQLAMVLQVPMAYLYCPEDELAELILKVSSLTPEFKKELTRFIEQLLAAQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BswR controls bacterial motility and biofilm formation in Pseudomonas aeruginosa through modulation of the small RNA rsmZ.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Dna binding protein
molecule keywords Uncharacterized protein
total genus 39
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4o8bA00
4X4FA 3KJXA 3RZZA 2ICTA 4FBIA 4NDWA 2PUDA 2GZUA 3OP9A 3OQMA 2XIUA 1HF0A 3MLFA 2AXVA 2KEKA 2EWTA 2R1JL 1RZRA 3ZHMA 1JFTA 2A6CA 2MQKA 4X4GA 1WIZA 1XWRA 4Z59A 1AU7A 2IVBA 1ZZBA 1PERL 2BNNA 1UXCA 3OMTA 3G7DA 2OFYA 1QPZA 2XCJA 1DW9A 3PXPA 1PNRA 2XSDC 4IA8A 1R69A 1ZZ8A 4PU7A 4YARA 3OQNA 3U3WA 4I8TA 1WH8A 1LQCA 2AWIA 3F51A 4PU8A 2OR1L 2WIUB 4X4CA 1LLIA 1ZS4A 2LYJA 3KXAA 4I6TA 2H8RA 4JCXA 3B7HA 1ZZ7A 2LYPA 1ZZ6A 1YSEA 2BNOA 2IVQA 2L49A 1ZZ9A 2O38A 4YG1A 1Y9QA 1VPWA 1QQAA 4F8DA 1PRAA 2MEZA 2BNMA 1JWLA 1RPEL 4FN3A 1ZAYA 3S8QA 1POUA 2D5VA 2IV1A 3FYAA 2PUFA 3F6WA 2JVLA 2ICPA 3CECA 1CQTA 2LYLA 2O4AA 1RIOA 3L1PA 4X4HA 1L1MA 3LFPA 2CSFA 3SCFA 1IC8A 3GN5A 3LISA 2KEIA 2AW6A 3H5TA 2PUAA 4IVZA 3QYXA 2R63A 2XI8A 3SCHA 4X4EA 1X2LA 1RZSA 3UFDA 1ZVVA 1GT0C 1X57A 4Z5DA 1BDIA 4YG4A 1QP7A 3BD1A 2JCGA 3JXBC 2LCVA 4X4DA 2LYSA 2PIJA 2EF8A 1OSLA 3O9XA 4Z5CA 2PE5A 1WETA 1UTXA 2FJRA 4O8BA 1CJGA 1QP0A 1QQBA 1DWKA 4MCXA 2AXZA 2EBYA 4YBAA 3KZ3A 1BDHA 2IUOA 2LYKA 3IVPA 3EUSA 3TRBA 2PPXA 3F52A 2KPJA 2AXUA 1O4XA 2AUWA 2HSGA 1LCCA 3VK0A 3GN5B 2XJ3A 4JQDA 2CROA 4IWRA 3ZKCA 2HINA 3G5GA 3OQOA 4X4BA 3QQ6A 3FYMA 4Z5HA 3JXDL 3HZIB 2IVGA 2PUBA 1NEQA 1RZRD 3D1NI 4JCYA 1JH9A 2L8NA 4PU3C 4I6UA 4GQMA 1S7EA 4PU4C 2PUCA 2KZ8A 3SCGA 1JFSA 2B5AA 3CLCA 2GRLA 5K98B 5A7LA 1R63A 1LCDA 1OCTC 4OB4A 3JXCL 1PRUA 3QF3A 1EFAA 1QP4A 2IU7A 1UXDA 4Y42A 1Y7YA 3R1FA 1NERA 3QWGA 3GBFA 4I6RA 1B0NA 2PUEA 3CROL 3BS3A 2PUGA 4MCTA 3ZHIA 1E3OC 1ZPQA 4J1XA 1ZZCA 2O49A 3DNVB 1SQ8A 4X4IA 4GHJA 4Z58A 2LYQA 1LMB3 1ZUGA 2KEJA 2WUSR 1ADRA 3FMYA 2GRMA 2BJCA 3BDNA 2LYRA 4J1WA 1WH6A 4YG7B 1PRVA
chains in the Genus database with same CATH superfamily
4NDWA 2XIUA 3MLFA 2AXVA 1RZRA 1JFTA 1AU7A 2LLVA 4DE8A 5DTMA 2OFYA 3UWPA 1WH8A 3F51A 2PXPA 4X4CA 2LYJA 3KXAA 4I6TA 1U2ZA 3M9LA 2O38A 1Y9QA 1QQAA 4F8DA 2MEZA 1ZAYA 2D5VA 3ME5A 3LISA 2KEIA 3QOWA 1RZSA 5DTQA 4EZIA 5DRTA 2JCGA 1NW3A 2EF8A 4Z5CA 5DTRA 2PE5A 1WETA 1CJGA 2EBYA 2IUOA 2LYKA 3IVPA 3TRBA 1LCCA 2CROA 3ZKCA 3G5GA 3OQOA 3QQ6A 3FYMA 4Z5HA 2PUBA 1NEQA 4EKIA 3D1NI 2HCNA 1JH9A 2PXFA 1R63A 3ZPXA 1PRUA 3TELA 2J7UA 1QP4A 3QWGA 1B0NA 2PUGA 2O49A 3ZHIA 1LMB3 4Z58A 1ADRA 2GRMA 3NDBB 2HCSA 3VWSA 2EWTA 2PXLA 2MQKA 3G0TA 1XWRA 1ZZBA 3OMTA 3G7DA 2XCJA 1DW9A 4YARA 3OQNA 4PU8A 3GZDC 2WIUB 4ER0A 1LLIA 2H8RA 3B7HA 1ZZ7A 1YSEA 2BNOA 2L49A 1ZZ9A 1VPWA 2V3CC 3FYAA 2PUFA 1CQTA 4ER5A 3QFIA 4X4HA 2YBDA 1L1MA 3LFPA 3SCFA 2AW6A 2PUAA 4IVZA 2XXAA 3UFDA 1X2LA 5DSXA 1X57A 3A9YA 4EQZA 1BDIA 3BD1A 4X4DA 1OSLA 3LQXA 4YBAA 2KPJA 2AXUA 5GAHi 2XJ3A 2PXEA 3JXDL 5JUWA 2IVGA 3GZDA 4PU3C 1S7EA 2PXBA 2B5AA 3DM5A 1EFAA 2IU7A 2PUEA 4Y42A 1Y7YA 4JCXA 3BS3A 4MCTA 1E3OC 1ZPQA 4J1XA 1ZZCA 3DNVB 4X4IA 2PXKA 4YG7B 3PXPA 1PRVA 4X4FA 2PUDA 2GZUA 3OP9A 2R1JL 3ZHMA 1WIZA 4EKGA 2IVBA 5DT2A 3QOXA 1QPZA 2XSDC 4IA8A 1ZZ8A 4I8TA 4PU7A 3U3WA 2OR1L 3GZCA 3NZLA 2LYPA 3OQMA 4YG1A 2IVQA 1PRAA 1RPEL 1JWLA 4WVLA 1POUA 2IV1A 2O4AA 1RIOA 3L1PA 1DULA 2CSFA 3GN5A 3QYXA 2R63A 4X4EA 1QP7A 2M4HA 2LYSA 2PIJA 2FJRA 4O8BA 1QP0A 1DWKA 4MCXA 2AXZA 2VEOA 1BDHA 4ER7A 3EUSA 2AUWA 3VK0A 2JQEA 4IWRA 3R09A 2HINA 4X4BA 4JCYA 3TFLA 1RZRD 4I6UA 4Q2JA 1HQ1A 2PUCA 2KZ8A 2XXQA 3SCGA 3MEJA 2GRLA 5K98B 2LNMA 1LCDA 2ODRD 4OB4A 3JXCL 3QF3A 2PXUA 1SQ8A 3A9ZA 4GHJA 2LYQA 2KEJA 2WUSR 2FFHA 4J1WA 1WH6A 3H5TA 3KJXA 3RZZA 4ER3A 2ICTA 4FBIA 2PXTA 1HF0A 2KEKA 2A6CA 3NROA 4X4GA 4Z59A 1PERL 2BNNA 1UXCA 2PXDA 5GAGi 4HRAA 1PNRA 2J7WA 1R69A 1LQCA 2AWIA 1ZS4A 4ER6A 2LLWA 1ZZ6A 1QZXA 2BNMA 4DE9A 4FN3A 3S8QA 3F6WA 2JVLA 2ICPA 3CECA 2LYLA 4EK9A 3A9XA 1IC8A 2XI8A 3SCHA 1ZVVA 1GT0C 4Z5DA 4YG4A 3JXBC 2LCVA 3O9XA 4OBMA 1UTXA 1QQBA 2L1PA 1MFQC 3KZ3A 5DRYA 2PPXA 3F52A 1O4XA 2HSGA 4JQDA 3GN5B 3SR4A 3HZIB 2HFZA 3OKZA 2L8NA 4GQMA 4PU4C 2XXPA 1JFSA 2MXDA 2PXVA 3CLCA 2PXQA 5A7LA 1OCTC 3NXHA 1QB2A 1UXDA 3OWQA 3R1FA 1NERA 4I6RA 3GBFA 3TEPA 3CROL 3KL4A 3SX0A 1ZUGA 3FMYA 3PE5A 2BJCA 3BDNA 2LYRA 3GUUA
chains in the Genus database with same CATH topology
4X4FA 3KJXA 3RZZA 2ICTA 4FBIA 4NDWA 2PUDA 2GZUA 3OP9A 3OQMA 2XIUA 1HF0A 3MLFA 2AXVA 2KEKA 2EWTA 2R1JL 1RZRA 3ZHMA 1JFTA 2A6CA 2MQKA 4X4GA 1WIZA 1XWRA 4Z59A 1AU7A 2IVBA 1ZZBA 1PERL 2BNNA 1UXCA 3OMTA 3G7DA 2OFYA 1QPZA 2XCJA 1DW9A 3PXPA 1PNRA 2XSDC 4IA8A 1R69A 1ZZ8A 4PU7A 4YARA 3OQNA 3U3WA 4I8TA 1WH8A 1LQCA 2AWIA 3F51A 4PU8A 2OR1L 2WIUB 4X4CA 1LLIA 1ZS4A 2LYJA 3KXAA 4I6TA 2H8RA 4JCXA 3B7HA 1ZZ7A 2LYPA 1ZZ6A 1YSEA 2BNOA 2IVQA 2L49A 1ZZ9A 2O38A 4YG1A 1Y9QA 1VPWA 1QQAA 4F8DA 1PRAA 2MEZA 2BNMA 1JWLA 1RPEL 4FN3A 1ZAYA 3S8QA 1POUA 2D5VA 2IV1A 3FYAA 2PUFA 3F6WA 2JVLA 2ICPA 3CECA 1CQTA 2LYLA 2O4AA 1RIOA 3L1PA 4X4HA 1L1MA 3LFPA 2CSFA 3SCFA 1IC8A 3GN5A 3LISA 2KEIA 2AW6A 3H5TA 2PUAA 4IVZA 3QYXA 2R63A 2XI8A 3SCHA 4X4EA 1X2LA 1RZSA 3UFDA 1ZVVA 1GT0C 1X57A 4Z5DA 1BDIA 4YG4A 1QP7A 3BD1A 2JCGA 3JXBC 2LCVA 4X4DA 2LYSA 2PIJA 2EF8A 1OSLA 3O9XA 4Z5CA 2PE5A 1WETA 1UTXA 2FJRA 4O8BA 1CJGA 1QP0A 1QQBA 1DWKA 4MCXA 2AXZA 2EBYA 4YBAA 3KZ3A 1BDHA 2IUOA 2LYKA 3IVPA 3EUSA 3TRBA 2PPXA 3F52A 2KPJA 2AXUA 1O4XA 2AUWA 2HSGA 1LCCA 3VK0A 3GN5B 2XJ3A 4JQDA 2CROA 4IWRA 3ZKCA 2HINA 3G5GA 3OQOA 4X4BA 3QQ6A 3FYMA 4Z5HA 3JXDL 3HZIB 2IVGA 2PUBA 1NEQA 1RZRD 3D1NI 4JCYA 1JH9A 2L8NA 4PU3C 4I6UA 4GQMA 1S7EA 4PU4C 2PUCA 2KZ8A 3SCGA 1JFSA 2B5AA 3CLCA 2GRLA 5K98B 5A7LA 1R63A 1LCDA 1OCTC 4OB4A 3JXCL 1PRUA 3QF3A 1EFAA 1QP4A 2IU7A 1UXDA 4Y42A 1Y7YA 3R1FA 1NERA 3QWGA 3GBFA 4I6RA 1B0NA 2PUEA 3CROL 3BS3A 2PUGA 4MCTA 3ZHIA 1E3OC 1ZPQA 4J1XA 1ZZCA 2O49A 3DNVB 1SQ8A 4X4IA 4GHJA 4Z58A 2LYQA 1LMB3 1ZUGA 2KEJA 2WUSR 1ADRA 3FMYA 2GRMA 2BJCA 3BDNA 2LYRA 4J1WA 1WH6A 4YG7B 1PRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4F A;  3KJX A;  3RZZ A;  2ICT A;  4FBI A;  4NDW A;  2PUD A;  2GZU A;  3OP9 A;  3OQM A;  2XIU A;  1HF0 A;  3MLF A;  2AXV A;  2KEK A;  2EWT A;  2R1J L;  1RZR A;  3ZHM A;  1JFT A;  2A6C A;  2MQK A;  4X4G A;  1WIZ A;  1XWR A;  4Z59 A;  1AU7 A;  2IVB A;  1ZZB A;  1PER L;  2BNN A;  1UXC A;  3OMT A;  3G7D A;  2OFY A;  1QPZ A;  2XCJ A;  1DW9 A;  3PXP A;  1PNR A;  2XSD C;  4IA8 A;  1R69 A;  1ZZ8 A;  4PU7 A;  4YAR A;  3OQN A;  3U3W A;  4I8T A;  1WH8 A;  1LQC A;  2AWI A;  3F51 A;  4PU8 A;  2OR1 L;  2WIU B;  4X4C A;  1LLI A;  1ZS4 A;  2LYJ A;  3KXA A;  4I6T A;  2H8R A;  4JCX A;  3B7H A;  1ZZ7 A;  2LYP A;  1ZZ6 A;  1YSE A;  2BNO A;  2IVQ A;  2L49 A;  1ZZ9 A;  2O38 A;  4YG1 A;  1Y9Q A;  1VPW A;  1QQA A;  4F8D A;  1PRA A;  2MEZ A;  2BNM A;  1JWL A;  1RPE L;  4FN3 A;  1ZAY A;  3S8Q A;  1POU A;  2D5V A;  2IV1 A;  3FYA A;  2PUF A;  3F6W A;  2JVL A;  2ICP A;  3CEC A;  1CQT A;  2LYL A;  2O4A A;  1RIO A;  3L1P A;  4X4H A;  1L1M A;  3LFP A;  2CSF A;  3SCF A;  1IC8 A;  3GN5 A;  3LIS A;  2KEI A;  2AW6 A;  3H5T A;  2PUA A;  4IVZ A;  3QYX A;  2R63 A;  2XI8 A;  3SCH A;  4X4E A;  1X2L A;  1RZS A;  3UFD A;  1ZVV A;  1GT0 C;  1X57 A;  4Z5D A;  1BDI A;  4YG4 A;  1QP7 A;  3BD1 A;  2JCG A;  3JXB C;  2LCV A;  4X4D A;  2LYS A;  2PIJ A;  2EF8 A;  1OSL A;  3O9X A;  4Z5C A;  2PE5 A;  1WET A;  1UTX A;  2FJR A;  4O8B A;  1CJG A;  1QP0 A;  1QQB A;  1DWK A;  4MCX A;  2AXZ A;  2EBY A;  4YBA A;  3KZ3 A;  1BDH A;  2IUO A;  2LYK A;  3IVP A;  3EUS A;  3TRB A;  2PPX A;  3F52 A;  2KPJ A;  2AXU A;  1O4X A;  2AUW A;  2HSG A;  1LCC A;  3VK0 A;  3GN5 B;  2XJ3 A;  4JQD A;  2CRO A;  4IWR A;  3ZKC A;  2HIN A;  3G5G A;  3OQO A;  4X4B A;  3QQ6 A;  3FYM A;  4Z5H A;  3JXD L;  3HZI B;  2IVG A;  2PUB A;  1NEQ A;  1RZR D;  3D1N I;  4JCY A;  1JH9 A;  2L8N A;  4PU3 C;  4I6U A;  4GQM A;  1S7E A;  4PU4 C;  2PUC A;  2KZ8 A;  3SCG A;  1JFS A;  2B5A A;  3CLC A;  2GRL A;  5K98 B;  5A7L A;  1R63 A;  1LCD A;  1OCT C;  4OB4 A;  3JXC L;  1PRU A;  3QF3 A;  1EFA A;  1QP4 A;  2IU7 A;  1UXD A;  4Y42 A;  1Y7Y A;  3R1F A;  1NER A;  3QWG A;  3GBF A;  4I6R A;  1B0N A;  2PUE A;  3CRO L;  3BS3 A;  2PUG A;  4MCT A;  3ZHI A;  1E3O C;  1ZPQ A;  4J1X A;  1ZZC A;  2O49 A;  3DNV B;  1SQ8 A;  4X4I A;  4GHJ A;  4Z58 A;  2LYQ A;  1LMB 3;  1ZUG A;  2KEJ A;  2WUS R;  1ADR A;  3FMY A;  2GRM A;  2BJC A;  3BDN A;  2LYR A;  4J1W A;  1WH6 A;  4YG7 B;  1PRV A; 
#chains in the Genus database with same CATH topology
 4NDW A;  2XIU A;  3MLF A;  2AXV A;  1RZR A;  1JFT A;  1AU7 A;  2LLV A;  4DE8 A;  5DTM A;  2OFY A;  3UWP A;  1WH8 A;  3F51 A;  2PXP A;  4X4C A;  2LYJ A;  3KXA A;  4I6T A;  1U2Z A;  3M9L A;  2O38 A;  1Y9Q A;  1QQA A;  4F8D A;  2MEZ A;  1ZAY A;  2D5V A;  3ME5 A;  3LIS A;  2KEI A;  3QOW A;  1RZS A;  5DTQ A;  4EZI A;  5DRT A;  2JCG A;  1NW3 A;  2EF8 A;  4Z5C A;  5DTR A;  2PE5 A;  1WET A;  1CJG A;  2EBY A;  2IUO A;  2LYK A;  3IVP A;  3TRB A;  1LCC A;  2CRO A;  3ZKC A;  3G5G A;  3OQO A;  3QQ6 A;  3FYM A;  4Z5H A;  2PUB A;  1NEQ A;  4EKI A;  3D1N I;  2HCN A;  1JH9 A;  2PXF A;  1R63 A;  3ZPX A;  1PRU A;  3TEL A;  2J7U A;  1QP4 A;  3QWG A;  1B0N A;  2PUG A;  2O49 A;  3ZHI A;  1LMB 3;  4Z58 A;  1ADR A;  2GRM A;  3NDB B;  2HCS A;  3VWS A;  2EWT A;  2PXL A;  2MQK A;  3G0T A;  1XWR A;  1ZZB A;  3OMT A;  3G7D A;  2XCJ A;  1DW9 A;  4YAR A;  3OQN A;  4PU8 A;  3GZD C;  2WIU B;  4ER0 A;  1LLI A;  2H8R A;  3B7H A;  1ZZ7 A;  1YSE A;  2BNO A;  2L49 A;  1ZZ9 A;  1VPW A;  2V3C C;  3FYA A;  2PUF A;  1CQT A;  4ER5 A;  3QFI A;  4X4H A;  2YBD A;  1L1M A;  3LFP A;  3SCF A;  2AW6 A;  2PUA A;  4IVZ A;  2XXA A;  3UFD A;  1X2L A;  5DSX A;  1X57 A;  3A9Y A;  4EQZ A;  1BDI A;  3BD1 A;  4X4D A;  1OSL A;  3LQX A;  4YBA A;  2KPJ A;  2AXU A;  5GAH i;  2XJ3 A;  2PXE A;  3JXD L;  5JUW A;  2IVG A;  3GZD A;  4PU3 C;  1S7E A;  2PXB A;  2B5A A;  3DM5 A;  1EFA A;  2IU7 A;  2PUE A;  4Y42 A;  1Y7Y A;  4JCX A;  3BS3 A;  4MCT A;  1E3O C;  1ZPQ A;  4J1X A;  1ZZC A;  3DNV B;  4X4I A;  2PXK A;  4YG7 B;  3PXP A;  1PRV A;  4X4F A;  2PUD A;  2GZU A;  3OP9 A;  2R1J L;  3ZHM A;  1WIZ A;  4EKG A;  2IVB A;  5DT2 A;  3QOX A;  1QPZ A;  2XSD C;  4IA8 A;  1ZZ8 A;  4I8T A;  4PU7 A;  3U3W A;  2OR1 L;  3GZC A;  3NZL A;  2LYP A;  3OQM A;  4YG1 A;  2IVQ A;  1PRA A;  1RPE L;  1JWL A;  4WVL A;  1POU A;  2IV1 A;  2O4A A;  1RIO A;  3L1P A;  1DUL A;  2CSF A;  3GN5 A;  3QYX A;  2R63 A;  4X4E A;  1QP7 A;  2M4H A;  2LYS A;  2PIJ A;  2FJR A;  4O8B A;  1QP0 A;  1DWK A;  4MCX A;  2AXZ A;  2VEO A;  1BDH A;  4ER7 A;  3EUS A;  2AUW A;  3VK0 A;  2JQE A;  4IWR A;  3R09 A;  2HIN A;  4X4B A;  4JCY A;  3TFL A;  1RZR D;  4I6U A;  4Q2J A;  1HQ1 A;  2PUC A;  2KZ8 A;  2XXQ A;  3SCG A;  3MEJ A;  2GRL A;  5K98 B;  2LNM A;  1LCD A;  2ODR D;  4OB4 A;  3JXC L;  3QF3 A;  2PXU A;  1SQ8 A;  3A9Z A;  4GHJ A;  2LYQ A;  2KEJ A;  2WUS R;  2FFH A;  4J1W A;  1WH6 A;  3H5T A;  3KJX A;  3RZZ A;  4ER3 A;  2ICT A;  4FBI A;  2PXT A;  1HF0 A;  2KEK A;  2A6C A;  3NRO A;  4X4G A;  4Z59 A;  1PER L;  2BNN A;  1UXC A;  2PXD A;  5GAG i;  4HRA A;  1PNR A;  2J7W A;  1R69 A;  1LQC A;  2AWI A;  1ZS4 A;  4ER6 A;  2LLW A;  1ZZ6 A;  1QZX A;  2BNM A;  4DE9 A;  4FN3 A;  3S8Q A;  3F6W A;  2JVL A;  2ICP A;  3CEC A;  2LYL A;  4EK9 A;  3A9X A;  1IC8 A;  2XI8 A;  3SCH A;  1ZVV A;  1GT0 C;  4Z5D A;  4YG4 A;  3JXB C;  2LCV A;  3O9X A;  4OBM A;  1UTX A;  1QQB A;  2L1P A;  1MFQ C;  3KZ3 A;  5DRY A;  2PPX A;  3F52 A;  1O4X A;  2HSG A;  4JQD A;  3GN5 B;  3SR4 A;  3HZI B;  2HFZ A;  3OKZ A;  2L8N A;  4GQM A;  4PU4 C;  2XXP A;  1JFS A;  2MXD A;  2PXV A;  3CLC A;  2PXQ A;  5A7L A;  1OCT C;  3NXH A;  1QB2 A;  1UXD A;  3OWQ A;  3R1F A;  1NER A;  4I6R A;  3GBF A;  3TEP A;  3CRO L;  3KL4 A;  3SX0 A;  1ZUG A;  3FMY A;  3PE5 A;  2BJC A;  3BDN A;  2LYR A;  3GUU A; 
#chains in the Genus database with same CATH homology
 4X4F A;  3KJX A;  3RZZ A;  2ICT A;  4FBI A;  4NDW A;  2PUD A;  2GZU A;  3OP9 A;  3OQM A;  2XIU A;  1HF0 A;  3MLF A;  2AXV A;  2KEK A;  2EWT A;  2R1J L;  1RZR A;  3ZHM A;  1JFT A;  2A6C A;  2MQK A;  4X4G A;  1WIZ A;  1XWR A;  4Z59 A;  1AU7 A;  2IVB A;  1ZZB A;  1PER L;  2BNN A;  1UXC A;  3OMT A;  3G7D A;  2OFY A;  1QPZ A;  2XCJ A;  1DW9 A;  3PXP A;  1PNR A;  2XSD C;  4IA8 A;  1R69 A;  1ZZ8 A;  4PU7 A;  4YAR A;  3OQN A;  3U3W A;  4I8T A;  1WH8 A;  1LQC A;  2AWI A;  3F51 A;  4PU8 A;  2OR1 L;  2WIU B;  4X4C A;  1LLI A;  1ZS4 A;  2LYJ A;  3KXA A;  4I6T A;  2H8R A;  4JCX A;  3B7H A;  1ZZ7 A;  2LYP A;  1ZZ6 A;  1YSE A;  2BNO A;  2IVQ A;  2L49 A;  1ZZ9 A;  2O38 A;  4YG1 A;  1Y9Q A;  1VPW A;  1QQA A;  4F8D A;  1PRA A;  2MEZ A;  2BNM A;  1JWL A;  1RPE L;  4FN3 A;  1ZAY A;  3S8Q A;  1POU A;  2D5V A;  2IV1 A;  3FYA A;  2PUF A;  3F6W A;  2JVL A;  2ICP A;  3CEC A;  1CQT A;  2LYL A;  2O4A A;  1RIO A;  3L1P A;  4X4H A;  1L1M A;  3LFP A;  2CSF A;  3SCF A;  1IC8 A;  3GN5 A;  3LIS A;  2KEI A;  2AW6 A;  3H5T A;  2PUA A;  4IVZ A;  3QYX A;  2R63 A;  2XI8 A;  3SCH A;  4X4E A;  1X2L A;  1RZS A;  3UFD A;  1ZVV A;  1GT0 C;  1X57 A;  4Z5D A;  1BDI A;  4YG4 A;  1QP7 A;  3BD1 A;  2JCG A;  3JXB C;  2LCV A;  4X4D A;  2LYS A;  2PIJ A;  2EF8 A;  1OSL A;  3O9X A;  4Z5C A;  2PE5 A;  1WET A;  1UTX A;  2FJR A;  4O8B A;  1CJG A;  1QP0 A;  1QQB A;  1DWK A;  4MCX A;  2AXZ A;  2EBY A;  4YBA A;  3KZ3 A;  1BDH A;  2IUO A;  2LYK A;  3IVP A;  3EUS A;  3TRB A;  2PPX A;  3F52 A;  2KPJ A;  2AXU A;  1O4X A;  2AUW A;  2HSG A;  1LCC A;  3VK0 A;  3GN5 B;  2XJ3 A;  4JQD A;  2CRO A;  4IWR A;  3ZKC A;  2HIN A;  3G5G A;  3OQO A;  4X4B A;  3QQ6 A;  3FYM A;  4Z5H A;  3JXD L;  3HZI B;  2IVG A;  2PUB A;  1NEQ A;  1RZR D;  3D1N I;  4JCY A;  1JH9 A;  2L8N A;  4PU3 C;  4I6U A;  4GQM A;  1S7E A;  4PU4 C;  2PUC A;  2KZ8 A;  3SCG A;  1JFS A;  2B5A A;  3CLC A;  2GRL A;  5K98 B;  5A7L A;  1R63 A;  1LCD A;  1OCT C;  4OB4 A;  3JXC L;  1PRU A;  3QF3 A;  1EFA A;  1QP4 A;  2IU7 A;  1UXD A;  4Y42 A;  1Y7Y A;  3R1F A;  1NER A;  3QWG A;  3GBF A;  4I6R A;  1B0N A;  2PUE A;  3CRO L;  3BS3 A;  2PUG A;  4MCT A;  3ZHI A;  1E3O C;  1ZPQ A;  4J1X A;  1ZZC A;  2O49 A;  3DNV B;  1SQ8 A;  4X4I A;  4GHJ A;  4Z58 A;  2LYQ A;  1LMB 3;  1ZUG A;  2KEJ A;  2WUS R;  1ADR A;  3FMY A;  2GRM A;  2BJC A;  3BDN A;  2LYR A;  4J1W A;  1WH6 A;  4YG7 B;  1PRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...