4EKIA

Crystal structure of dot1l in complex with epz004777
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
319
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 96
structure length 319
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ekiA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ekiA02
5CVEA 4G56A 5BP7A 5EEHA 2UZ4A 2C7QA 2Z6QA 4CXMA 4OX9Y 3PX2A 1F3LA 3M6WA 3FTCA 4RTNA 5DX0A 1XCJA 3PFGA 4HGZA 5FQOA 4FT4A 2JHPA 4P58A 3HVHA 4P7FA 4GBED 4B17A 4E2ZA 5C0OE 3LBFA 2ZFUA 4KWCA 4P7JA 4RTQA 3CCFA 5DM4A 5FQNA 3R0QA 5CVUA 3EVCA 5H02A 1RI3A 5LQRA 1P91A 3BGIA 1JSZA 4PGGA 1P39A 4DKJA 5P8WA 10MHA 3M6VA 4RTOA 1P1CA 2O0LA 1RI5A 2NXCA 5DPMA 2EX4A 3GIWA 5EKXA 5BW4A 1YFLA 2JG3A 4X1OA 2ZW9A 4MWZA 4E2YA 3HVJA 5JR3A 2NP6A 3SVZA 1AF7A 4CKEA 3GGDA 2VZ9A 3KPJA 4GC5A 4E30A 1UIRA 1VL5A 2QY6A 5CCBA 3LCUA 1VP9A 5ICGA 3FPJA 3HCEA 5K05A 5KYGA 3HP7A 2BR3A 3JWGA 1JQDA 3Q7EA 3UJBA 2HV9A 3BKWA 3TPZA 3VC1A 4RX1A 1WZNA 4X41A 3LSTA 3UJDA 3GDHA 1M6YA 4X61A 2IDJA 4YUVA 3G2MA 3IV6A 3KPUA 1U2ZA 4PIPA 3SGLA 1JG2A 5FUBA 3ID6C 1Q0TA 4U7TB 2P7HA 2IBSA 1IM8A 2OKCA 1RI2A 3F4KA 4LG1A 4FGZA 1M0EA 2ZIEA 4EKIA 2FHPA 2H11A 2UYOA 3CJRA 3ERCA 1QAMA 3EGEA 4GOMD 3LL7A 3MTEA 3SXJA 5E1BA 1RJDA 2YXLA 3GRVA 3MB5A 4KDCA 5EZSA 3DH0A 1D2HA 3GCZA 5LR6A 3ORHA 4QDKA 5LQJA 3HVIA 2ZVJA 3ME5A 3D2LA 3WSTA 4GOND 1ZG3A 2NXJA 2OBFA 2EJTA 5E2AA 2AN4A 2P35A 1R74A 2JHAA 5DWQA 4KRGA 3MHTA 3SR4A 2ZIFA 4A6EA 5DXJA 4E2WA 3FTFA 2R6ZA 1VLMA 1NW7A 5ERGB 3VC2A 3RW9A 2NYUA 1UFKA 5F2NA 3OFKA 4OQDA 3TKAA 3T7SA 3DUWA 5GINE 4H0NA 2XVAA 1XXLA 2PWPA 2ZBPA 1TW2A 3G88A 3G8AA 3P9KA 4F86A 3SM3A 2E5WA 3BUSA 4E33A 3CC8A 1IY9A 3EEYA 4BP1A 5GIPE 3Q87B 3G5LA 3JWJA 2P3LA 4WXHA 5E9QA 3EVDA 4HTFB 5EIWA 1EQAA 3G2QA 9MHTA 5CM2Z 2QYOA 3CJTA 4FSXA 4M36A 2ONYA 2I62A 3EVGA 1JQEA 3EMBA 2YVLA 3DR5A 2ZLBA 3C6MA 4HGYA 5EPEA 4CKCA 3PS9A 2ESRA 4PYKA 2AN3A 1N7JA 4YMHA 2IH5A 3ANXA 3FUUA 1INLA 5D1NA 2IPXA 3EVEA 4AZWA 4BLWA 2XVMA 5D1HA 1R8YA 4GOOD 1EIZA 3TLJA 3I53A 5DTMA 2A14A 3UJ9A 5LQCA 3G89A 4HC4A 4V0QA 3PLAE 2WK1A 3UJAA 5E9WA 5K0JA 1JSXA 3GRYA 3QOXA 3B7PA 1QAQA 4C08A 3LKZA 2YXDA 3PT9A 3EPPA 4LWOA 5GP1A 3M6XA 4XUDA 3O31A 1MJFA 1NBHA 4MHTA 2IH2A 4PYJA 3LDFA 1KPHA 3C6KA 4ER7A 4XCXA 2OXTA 4PCLA 2C7PA 4Y30A 4RTPA 1M6EX 4KW7A 4UOEA 2AOUA 1PRYA 3HCFA 3U81A 4Z2YA 1XDSA 4RTMA 2NP7A 4NECA 3P71T 2AR0A 1SQFA 1B42A 2ZBRA 3FUWA 2GPYA 2AVNA 2PVCA 2PT6A 3C0KA 3KQYA 4M7RA 3MTIA 3NDIA 4R8RA 2JH9A 4IV8A 2ZWVA 7MHTA 1NKVA 3KQSA 1IXKA 4YUZA 3P97A 1I4WA 2YTZA 3MCZA 4QVKA 4V0RA 2VS1A 4PONA 5K0GA 1R8XA 5LQUA 4GUAA 5E1DA 1EAMA 5K8VA 2ERCA 2KW5A 4GF5A 3B89A 3RIEA 1JR4A 4RTLA 1XDZA 2VDVE 3LDGA 4EMSA 3DMFA 1XCLA 3OE5A 3SSMA 4E32A 3AY0A 4F85A 4OBXA 2O07A 5E8JA 2UYQA 4KIGA 3HA5A 3M70A 2PX8A 3KQOA 2PBFA 2PXCA 2AOTA 2Z6UA 5HIIA 4FR0A 3SSNA 3H2BA 2B78A 3OZSA 2F8LA 3BKXA 1WY7A 5DSTA 4E31A 4ISCA 4OBWA 5BW5A 3OE4A 3EGVA 1G8AA 3ELUA 4DMGA 5DRYA 5CVVA 3R9XB 1ORIA 3HCCA 2K4MA 4GC9A 4PYMA 4QPNA 4IKPA 1ZQ9A 5LSAA 4HRAA 2IFTA 4GOLD 2GS9A 2OZVA 2PY6A 2BM8A 3BGVA 1R18A 5F2OA 1TW3A 5M5BA 1EJ0A 3KKZA 2FCAA 4PYOA 3BXOA 5CVDA 1VBFA 4PIMA 1WS6A 5CVJA 4DA4A 1FJXA 4GEKA 3A27A 3P2EA 3TMAA 3P8ZA 5HIMA 2I9KA 2JHCA 3BWBA 1JG4A 3P2KA 5CUQA 2Y1WA 5FCDA 1SQGA 4HH4A 3E7PA 4HG2A 4O29A 1DCTA 1SUIA 4QQNA 2HNKA 5EEGA 3HTXA 1NT2A 4P7KA 3BWYA 3KPVA 2XYQA 2NXNA 3DTNA 4PWYA 1T43A 3LECA 5EQJB 3KU1A 3UFBA 4YUWA 5EMKA 3HCDA 3ER9A 2Q41A 3LPMA 2UYHA 4EK9A 4QQKA 5GIOE 1WG8A 3OU2A 3FZGA 2YQZA 4XUEA 2EG5A 3CBGA 3KPYA 4X60A 5K0FA 4BP3A 1KYZA 2B3TA 2WA1A 2QRVA 3CGGA 1R00A 2IP2A 5JUWA 3LGAA 5DX1A 5ICFA 4FT2A 1P1BA 5T64A 3THSA 4K6MA 5ICEA 4U7PB 3R6TA 1NV9A 3E23A 2OPBA 2YR0A 3AWIA 3KQWA 5FWDA 4AZVA 3DP7A 2ZSUA 2GB4A 1L3CA 4ER0A 1O9GA 3OZTA 3I5UA 2PX5A 1YUBA 2P3QA 3MAGA 3EVAA 3SMQA 3TKYA 4RSRA 2ADMA 4IWNA 2G1PA 1NW6A 3M6UA 5HOQA 2BR5A 1RJEA 2P1DA 3TFWA 2P7IA 1ZGJA 3R24A 5FHRA 3E8SA 2OO3A 3K0BA 5FWAA 3E05A 3EMDA 4OA5A 2YX1A 3FUXA 4YUYA 4RTKA 1Y8CA 3FTDA 3KPWA 3B5IA 1KHHA 2P41A 3RODA 1FPQA 3SSOA 5BXYA 1EG2A 1KR5A 2ZULA 1XDUA 3EVFA 3KHKA 5EOVA 4AZSA 3FTEA 2LD4A 3TRKA 1I1NA 5EIFA 1AQIA 2NNWB 4HTFA 3BZBA 2AOTB 3MQ2A 5EZQA 3EEOA 4LECA 4E70A 3ER8A 2IIPA 2G8NA 2GAFA 1ZHFA 4MQ4A 3LX6A 3FPGA 3O7WA 2EJUA 3DMGA 1VPTA 4MTLA 5KQSA 3FRHA 4EKGA 2OB1A 1VQ1A 1SG9A 3GRUA 3FYCA 3PTAA 1O54A 4X63A 2YUIA 3QV2A 4RTJA 3VSEA 1JG3A 2AOWA 4RV9A 4Y2HA 2VP3A 4C04A 5DM0A 2V7EA 1I9GA 5MHTA 5E2BA 2PV0A 2AN5A 3GJYA 3THRA 4PGHA 3ELDA 3S68A 1ZKDA 2DPMA 1ORHA 3C3PA 3G2PA 3GRZA 4PINA 5HILA 4CTJA 1L9KA 4IV0A 4DCGA 2Y1XA 2HR1A 2PX4A 5FA8A 4FS8A 4F84A 1BKYA 2FK8A 4QTTB 5HIKA 1DUSA 3KQPA 3G8BA 1RJGA 3PX3A 3UJ8A 1AQJA 1KP9A 3KR2A 2ZZNA 4C05A 3FUVA 3HCAA 5LQNA 1DL5A 5HIJA 4YV2A 8MHTA 4GQBA 2OY0A 1VP3A 3PB3A 2AOVA 4DZRA 2ZCJA 5K0LA 2BH2A 3P9IA 3TM5A 2XYVA 2CWWA 2GH1A 3JWIA 2NXEA 2PSSA 5K0EA 1YF3A 1YZHA 2AOXA 3EGIA 4QTUB 5DT2A 5GM2A 4C03A 2Z6AA 3O4FA 4R6XA 1KXZA 2R3SA 3HNRA 2JH8A 5B1SA 2G72A 3P9CA 2AS0A 3FYDA 3KR9A 1XVAA 1QANA 2P8JA 3NTVA 5DM1A 5GM1A 5FTWA 4FP9A 2VDUE 3TR6A 2PXAA 3G5TA 5LQAA 1H1DA 5E8RA 1D2CA 2ZWAA 2CMGA 5K0NA 3IHTA 3NJRA 3LKDA 4P7GA 3LHDA 3HEMA 4YV0A 3OCJA 3CKKA 3UJCA 4EQZA 2QM3A 3BWCA 3GNLA 2HTEA 3UZUA 1X19A 3NWEA 4PYQA 2AZTA 1QZZA 4KDRA 3HA7A 4OA8A 1PJZA 2ONZA 1JQ3A 5C9ZA 4FSDA 4L7VA 3TM4A 5IKMA 3A7DA 4RVDA 5FHQA 3TQSA 1G38A 5DXAA 1NBIA 5DX8A 2PJDA 5FULA 3CJQA 3UA3A 5KVAA 5T67A 4M37A 1FBNA 4ZTBA 3R3HA 5HFJA 2FK7A 5EMMA 5F2KA 2CKDA 2CMHA 3FPEA 4YUXA 4QPPA 2O05A 4QDJA 1O9HA 3OPNA 3V97A 1X1BA 3A7EA 1WXXA 3KQTA 3LCVB 3MCTA 5CIYA 2ORED 5KS2A 3A26A 1L1EA 3EVZA 1BHJA 1N7IA 3HCBA 3NWBA 4RTSA 1G6Q1 2OYRA 3HM2A 4ATNA 2BR4A 4EVIA 5G02A 3OFJA 4YMGA 3AXSA 3L8DA 3KQMA 2YXEA 3KQQA 2PGXA 3DLCA 3JWHA 3UBTA 4LWPA 1AV6A 4BY9E 3LDUA 1JTFA 3SX0A 4RVHA 3MGGA 5EHGA 5KQRA 5CD1A 4RTRA 3VYWA 3T7TA 3HA3A 1X1AA 4OQEA 1NE2A 2BM9A 1Z3CA 4JXJA 4R05A 3C3YA 2ZBQA 1OR8A 1RI4A 3G2OA 3A25A 4C06A 3ELYA 5DTRA 4AZTA 1X1DA 4E2XA 3FUTA 5DTQA 1VE3A 3OU6A 3UA4A 3GXOA 5DM2A 3FPFA 3NDJA 4PYIA 1JTEA 3M4XA 4PYLA 4RVFA 5EC8A 5K09A 3DLIA 5C1IA 4WVLA 1KPGA 2PWYA 3NMUF 3MERA 5DRTA 1JG1A 4DQ0A 3REOA 5K01A 1BOOA 5DSXA 1G8SA 1KPIA 2H1RA 2H00A 2IBTA 3FRIA 5LQKA 4FZVA 3DULA 5FA5A 5FADA 3M33A 4RWZA 1UWVA 5K0CA 5T6BA 4XUCA 2QRVB 1NW8A 1Q0SA 3B3GA 3GWZA 3P2IA 4MIKA 5EVJA 2BZGA 1XTPA 3I58A 3KR1A 2XBMA 4C07A 5GWXA 3A4TA 1MHTA 3DOUA 4BLUA 2DULA 2P40A 1N2XA 3PFHA 3BWMA 5EGSA 4AUKA 3X0DA 1HNNA 2O57A 2I6GA 1BC5A 3KQVA 3I9FA 4DM3A 1RJFA 2CL5A 5U4XA 3DXXA 3PVCA 2UYCA 3BT7A 1ZGAA 2I7CA 1SVUA 1HMYA 2AVDA 2PT9A 4KVZA 2N47A 2HMYB 2EFJA 1YZ3A 4ER6A 1FP2A 3KR0A 5E9JA 3UJ7A 3B3FA 3QOWA 5HEKA 2XYRA 2OB2A 4PYNA 5HZMA 3V8VA 2FRXA 3TOSA 2ZZMA 3DXYA 1G55A 3T7RA 1SUSA 3NVMB 4RYLA 5K0BA 2V74B 1VIDA 3BGDA 5E1MA 3EVBA 5CCXA 2ZTHA 5EG5A 4DF3A 4ER5A 3FPHA 4BLVA 5K03A 4C4AA 4QVGA 1EJ6A 2P3OA 3GO4A 2ZZKA 3G7UA 3B3JA 4M38A 4CKBA 1QAOA 1WXWA 1R6AA 1NW3A 1KIAA 2G70A 2IH4A 3I64A 1YB2A 5IH3A 1FP1D 3DXZA 2C7RA 5ICCA 1RI1A 3IYLW 3CVOA 2HWKA 3ELWA 2FPOA 1G60A 3GU3A 1X1CA 2FYTA 5DLYA 5GOZA 4PNEA 4KIFA 3OU7A 3UWPA 3P9NA 4RVGA 5EMJA 2B9EA 3LBYA 2QE6A 5EKUA 4ER3A 1F38A 2B2CA 2IGTA 3GRRA 1YFJA 3NW9A 4AX8A 2PX2A 4A6DA 2ZIGA 2GLUA 2GA9A 2PKWA 2JJQA 2PXXA 4CWAA 4R6WA 4DCMA 2VDWA 2C7OA 1NW5A 1XJ5A 4POOA 3HVKA 3DMHA 5EMLA 1L3BA 3LCCA 3UJ6A 5EHIA 3T0IA 5E1OA 4CTKA 4HSGA 3NVKI 2O06A 1TPYA 4YV1A 1QYRA 2B25A 1L3IA 2WA2A 3K6RA 2PLWA 2AOUB 4PCAA 4R8SA 2IDKA 1D2GA 2G71A 1V39A 3AJDA 3OZRA 1SKMA 1NV8A 3AXTA 1KYWA 3IEIA
chains in the Genus database with same CATH superfamily
1HLDA 1IQ0A 4TX1A 3ISVA 3TK1A 1NPYA 4RK1A 2FPSA 5DN9A 2YIVX 2ZAYA 5IT0A 3B1YA 3H9UA 3F3KA 3L8MA 1MENA 3PQCA 2PUTA 3WLKX 4CIDA 5I7RA 2R5NA 2OCLA 3PGA1 1D5CA 3WSVA 4GLJA 4MVJH 3BE4A 4PTZA 3RQIA 5JSZA 3EA4A 1WV1A 2JFGA 4LZPA 4GPBA 1BDHA 1V1MA 1YJBA 4KGVA 4R8KA 5E38A 4X4HA 2ZJ0A 3FOFC 1OILA 3K0FB 1SXJB 1IN6A 4G5HA 4EMTA 4G0WA 3V1YA 3M6VA 3S2EA 1ADYA 2HEGA 5KYKA 2E9SA 2QAJA 1V48A 4F60A 3GA0A 3R9XA 1D0IA 4C5CA 3CF4A 5J4LA 5BNFA 4DDVA 4F71A 2NP6A 4PX2A 2IF2A 4L4XA 3IP7A 1PQUA 1UC9A 1QK4A 3AL3A 5B1EA 1ECPA 2QY6A 4FGWA 1DADA 3CW8X 3AF1A 4FC7A 5DU2A 2V45A 1DXYA 3CIOA 1YQEA 4Q47A 3BSSA 4XB6B 2KYRA 4ZT3A 2Z4TA 3C8HA 2NN3C 1I33A 4GQIA 3JWGA 4Q1BA 1CULC 4F06A 5K1ZA 1EJBA 5HYVA 4LF8B 3RTCA 1T8PA 3H2HA 1H3NA 1CNEA 1GN9A 2RHBA 3BKWA 1Z17A 4AECA 4XVQA 5HGJA 3RRBA 1Z63A 5B2EA 1KZ6A 3EXG1 3OKAA 3TLKA 1CR2A 1R0WA 1QG6A 2F3RA 2J4DA 4HGNA 4WERA 1NFQA 2PGDA 5F9MA 3ZD9A 3HWX1 3D8BA 2O7VA 4QJIA 3LXUX 5BSHA 2DVMA 1N6IA 2A9OA 2D13A 3HWWA 3O2NA 3O3NB 3UKDA 5IUJC 3SGLA 2ECKA 2Q6OA 3OM9A 5P21A 3GUUA 3HA2A 3K4QA 1IWOA 3KG2A 1TM7E 4JCYA 1TK9A 2VQ3A 4Q93A 3SLKA 1M0EA 5E2IA 2JD2A 3UPDA 1EUCA 4DJEC 3DFKA 3MTEA 2G0NA 5E1BA 1I7QB 4BB9A 4Z4QA 4MS3B 1TT7A 1W19A 3TSCA 5TPWB 1LMB3 1B26A 1PJ3A 3AH8A 1MG5A 5CFZA 1SAYA 2H92A 2NXJA 4S2EA 2X9NA 3QUBA 4BJ1A 4E5UA 4R81A 3LDHA 3MCWA 1TFRA 3D0KA 3SPXA 5IMSA 2UU9B 2CMFA 1UBEA 3H4VA 4LY3A 3CX8A 3AKEA 1BN6A 2FTKE 3OUUA 3TW8A 4DMKA 5EP4A 3FTFA 3DGEC 4P1ZA 4A82A 1KJZA 1X8LA 4NMWA 4K6KA 4MEBA 3RG2A 4OLFA 4BO2A 2B1GA 2C97A 4WKPA 4DV7B 2C98A 1BDMA 3WHPA 2ZUCA 2CXNA 2VLIA 4RS4A 5T57A 4R8LA 2QRNA 3KV3O 1FLNA 4ZEVA 3PV0A 3UH1A 4FILA 3G5LA 3QK7A 1M8PA 1KDOA 1ZVMA 1IPEA 2ABWA 2BOVA 2I3GA 2VT3A 3DDOA 3J7TA 1EQAA 1WU8A 1Y82A 3G2QA 5ALLA 5F5LA 3P96A 4G0YA 4BLTA 3MCUA 4I81A 4YT8A 3MWDA 3B20A 3Q6IA 1DMRA 1O89A 3I37X 4N0QA 1I0ZA 1L4UA 5EPEA 2NQ2C 4BC1A 2ESRA 2HU2A 4X85A 3KAQA 3OM1A 5TS3A 5SYNA 3HJHA 3ANXA 5FPKA 1DQNA 2HGZA 5KWJA 5DYGA 4QGHA 2NADA 2ZVQX 4JI0B 3RCBA 3HDGA 4BLWA 4HQOA 1BKSB 4QTZA 3AV0B 3BDAA 1QVAA 4YJ3A 5FBRB 4ZJZA 2E49A 2QT1A 2GGSA 3QU4A 1AC5A 1W4CA 3G89A 2H4HA 2WWRA 3B78A 4D6PA 5AYVA 3AW8A 4NS1A 3CTMA 4MGKR 3B7PA 4EFMA 2PJUA 3WGUA 4C6TA 3EPPA 1M6VA 1PSWA 5SZHB 3DPUA 4AKHA 4ZAFA 2YVKA 1JB9A 2DC1A 4CE6A 4P4SB 2FDCA 1G4AE 3A04A 1ZA1A 1WCIA 2F00A 3H2YA 2HJGA 3QW2A 1ACJA 2IV7A 2R66A 3BEDA 4XFDA 4P53A 4B5LA 4RTMA 1W49A 3FZNA 2B8EA 3HU1A 5K4AA 2H1FA 2V8OA 1DCFA 3O47A 2D4AA 1W36C 1HWYA 2VRWA 3KZKA 3J81k 3NC1C 3K8ZA 5HJ5A 1LPMA 4HGOA 1S7CA 1I7LA 1KSHA 4HQNA 3W8NA 1VCMA 3WAKA 1ZLXA 2J7UA 1LXCA 2G6TA 4KN5A 4NFYA 4QVKA 5DLEA 1Z56C 2WVGA 3HFJA 3I6MA 3TECE 4KN8A 3TSAA 3WWZA 3JV7A 4U2EA 5FPHA 2V4ZA 4FYXA 3B89A 5JNUA 4EATA 2X0RA 5F76A 1VKOA 3HS3A 4B75A 3D8RA 4JSTA 1VSTA 1O96B 2WSLA 3BHIA 3HUEA 3SSMA 4BC0A 1N3LA 3SYRA 2C3YA 2EJBA 2O07A 2QX4A 3JTEA 3TLXA 4UZSA 3I4FA 1S2MA 4KIGA 3IAS6 3NYQA 5JDCA 1XPRA 3H2KA 1JEDA 4CM8B 1E2KA 2O2DA 3D3NA 2H1CA 1ZOLA 2F8LA 4IXMA 1KO8A 4TQ9A 5DULA 4NC9A 4UEJA 3X44A 1TJ3A 1J8VA 4HVAA 3IDFA 2QTWB 4V1CA 4GC9A 3ND5A 2O38A 5F51A 1WJGA 4WJKB 2FUEA 2GHRA 2VRNA 3CSSA 2QKYA 3IH5A 2PQMA 1PS9A 2RH5A 4HFNA 4LXGA 1JJ7A 1TW3A 1EFAA 4C7OB 5M5BA 3KKZA 2P67A 3SE7A 4ARZB 4CM1A 2HMSA 4GP6A 4EI9A 1N2SA 2GRLA 1X7YA 3FVRA 3C24A 3O4HA 3BH0A 3QKRA 4NG4A 4Y0VA 2QY9A 5K98B 4BKMA 4ECAA 4DA4A 2P9BA 3O3MB 3DUFB 4REQA 3IT0A 4JI3B 1JDBC 2AJCA 2JHCA 1SULA 1QGUA 2I3AA 1KHTA 2GPSA 1L5FA 1MBZA 2ONKA 3MGAA 2BGWA 1N8SA 3D3QA 2BUBA 5CDGA 2JIZD 1OU0A 1OAAA 3KIPA 1SHJA 2BGTA 4KWHA 4OQPA 5T4HA 1FL9A 3BF8A 4ND8B 4U0KA 1Y7PA 4MQUA 2GZ2A 5AUOB 5F1OA 2IP4A 2R8PA 4M1EA 3LXRA 2XLCA 2Z5GA 3DO8A 3K6JA 2W2XA 1QHHA 4ZYUA 5EJ4A 3O93A 3T0GA 2B3TA 3N8GA 4OIMA 3V1LA 2UUPA 4IOKA 1P61B 5ENDA 5SY4A 3B7GA 1NNUA 3BYZA 3DB2A 4K6MA 3IVPA 1T8SA 5H3CA 4TSKA 1IEXA 2O8VA 4M1WA 3AWIA 1O57A 1JQLB 1ML3A 3ENKA 3KYJB 1PDVA 3V8MA 4W8HA 3QVSA 3B6KA 2WF7A 4HQLA 4G2TA 3I5UA 1OT3A 4LA4A 4UEKA 4CEIB 1J8DA 3QXSA 4HLCA 3OD5A 2ADMA 1GUZA 5FRDA 5ALFA 3EPKA 3D02A 4B2IA 3L3BA 4OH7A 5B58T 3R8FA 4L4ZA 5ITWA 1K6IA 2QVGA 3VU3A 1N32B 1P0PA 1RWBA 2ECFA 3E05A 1QG0A 4JT2A 3EAQA 1Y98A 1P75A 1XCOA 2NSYA 2O2XA 2V7TA 3H5LA 3IDQA 4FEEA 2CJXA 2WEKA 1XI2A 4JCCA 3HJUA 3SSOA 4MPJA 5EJGA 2HO5A 2VXBA 4HMOA 4MVJP 1R64A 5FOVA 2TECE 1J0EA 3MQ2A 1GTL1 1EXWA 2GHIA 5GONA 3JSAA 2OXCA 3RTDA 4B3FX 1LLUA 2DBZA 3TO5A 3B60A 2XX3A 3RKRA 3TZEA 2JIOA 3O7WA 2GBCA 4WZAE 5DGHA 2FDXA 2WV9A 5DKFA 4QU0A 5FA6A 2JAQA 1NUUA 5LZ7A 4QHTA 3KXAA 5ADWA 2D0PB 2CMKA 2R25B 3QNMA 5KX5B 5LLDA 3ROMA 3FYCA 1EHIA 4N8SA 4TRNA 3RVJA 4FFNA 3PEYA 5DI3A 3A9WA 3I72A 4R31A 1N0IA 1I9GA 3T5GA 5BT9A 1ZINA 5E2BA 4BGVA 4BFUA 1OYYA 1HYBA 1UJ6A 4CRWB 4A15A 2YV1A 4E1BA 2AYXA 2ZYSA 4UHHA 2QG4A 3DZCA 5CLQA 3SHTA 1NURA 3FVVA 2G83A 4CTJA 3NHUA 4IG4A 1U3CA 2NSLA 4WZBA 1E92A 1U28C 3TUJC 2HT6A 1XA3A 2X15A 4FMCB 1GUYA 4UHJA 1JXMA 4ACBA 3PGMA 1VLJA 2B21A 3B9QA 3AB7A 3OEEA 3JQ9C 2NT3A 4KSBA 1Z5PA 3PXBA 4LX0A 4YMLA 1D2NA 3IKLA 3AI2A 4MO9A 2C8LA 4IM7A 4GQBA 4PW0A 1O0SA 3I61A 4EG6A 1YC2A 4IIJB 2PZEA 3LX4A 4M22A 3DLTA 3ZJUA 2BH2A 5IARA 1N75A 2XMZA 3OZXA 5BQXA 3NBAA 4DY4A 3M89A 4X4BA 1QFZA 1AD2A 1UADA 4FLMA 3EPJA 1GCAA 3GCXA 3N2YA 4JR1A 4AB1A 1H69A 3EGIA 4QTUB 3K5HA 3AJAA 1L6RA 1MB4A 2EL9A 3L05A 5I3CA 1TF2A 1ECCA 4AY6A 1USGA 4M21A 4R6XA 2IWRA 2BCJQ 2D5VA 4KR3A 4Y2JA 5AVYA 1FQOA 4LZJA 5L7TA 4PRZA 4NU8X 1ML4A 4AWXA 1GPBA 1OF1A 4HDQB 3NTVA 1Y1RA 3BB3A 3QPVA 2X3FA 1QHHB 2A9FA 2M98A 3PJRA 3F97A 2A58A 3WY9A 5E8RA 2M4HA 1D2CA 3ELBA 4LKRA 2R7MA 4OQLA 5KZMB 3KXLA 1YS7A 3NHBA 2DH6A 4DA0A 3O84A 4W9MC 2GM3A 3R9XB 1JLRA 3UJCA 5FOSA 4I1UA 1K6MA 2EG9A 1R5BA 2NACA 3BWCA 3T99A 3WIEA 1F2TB 4LDRA 1Z6AA 4OHKA 1SUFA 3RQSA 5HRCA 5IDWA 2I4IA 3PL5A 4KYUA 4LE2A 4RY9A 1Y7HA 4CDNA 1P77A 2IY9A 4RVDA 3ZR4B 4QZVA 1CZUA 3MBKA 3BDIA 1PWHA 2L82A 1FBNA 2WJHA 3IEXA 2FFJA 3RHSA 4BV8A 4DC1A 2FK7A 1JN0A 3HU5A 1K9SA 4X1IB 1DX4A 5F2KA 3RUFA 4PC1A 4BASA 2DPLA 1WHTA 1VL1A 1KJ8A 1G4HA 1O9HA 4FLFA 2HRBA 3MGKA 1DUVG 4G24A 1V9LA 3A7EA 4MYHA 2BF7A 4RL4A 3EPHA 1K63A 2NO9A 2I7TA 4H35A 3AF5A 1R10A 1UFOA 1N2CB 2NYAA 2OQIA 1CW2B 1ESEA 2FVXA 1E79A 1SXHA 4ZAYA 1RQNA 1T6XA 2C29D 1PEAA 4WTOA 3OJ0A 1ZJ6A 3RVDA 3AEZA 2F1RA 4JMLA 3TD9A 3OKFA 1BHSA 1FTWA 1TGYA 4H0CA 4LYYA 2V7UA 3SX0A 4NONA 3E0XA 5CD1A 2FJUA 4M8SA 2ZS9A 2XGOA 4OQXA 3AEYA 2J9ZB 3OH8A 1SBIA 1V25A 5J2UF 1SVWA 3AKZA 3RUPA 4HAUA 4MULA 5JYBA 1NX6A 5BQ5A 2D5BA 3FY4A 1IBSA 4YRBA 3G9TA 5KBYA 3HY3A 2X7HA 1TQDA 4HN2A 1VYHA 3OU6A 1UAGA 3P27A 3GVPA 4MEAA 5DM2A 3IIMA 1P5ZB 1J6UA 4LBYA 3RVMA 3VC3A 1JGTA 4TLEA 3ZY3A 5C1IA 4WVLA 2GNAA 4DEYA 5CT4A 1BFUA 3L8ZA 5K09A 2GF0A 1W4BA 1ZM7A 5DSXA 4Z5CA 3L7DA 1T6BY 3ZNPA 2EKQA 3ONNA 4ZQGA 4A2CA 1XAJA 3RC2A 2AN9A 4TL9A 3H6HA 2WKPA 1S2IA 3L7IA 4IIJA 2V1XA 2CFIA 4I50A 4IH9A 4Q4AA 5T6BA 5EVJA 1AZSC 1UZMA 2OD7A 1AGYA 3B3GA 3K9LA 1QCCA 3BMQB 4GXQA 4IILA 1JKJB 4GFDA 5D6OA 4RJKA 3GZDA 1XNRB 1I51A 3ZDZB 3UB4A 5F3DA 2BFMA 1VPVA 3DOUA 3OE7D 4G9BA 3UKOA 4ZVTA 3FG9A 2X8JB 3N9IA 2FSHA 2O57A 3BDNA 2YYSA 4Q0MA 1G8HA 3D1NI 3EZ9A 3T0FA 1UJMA 3LUHA 5IN5A 3D6MA 4ZCRA 1E0KA 3E9DA 3H5OA 1G42A 2AVDA 2ZAOA 3WQSB 5IBQA 3D8UA 1XXHB 3VHLB 4EJ2A 2BFAA 5EHNA 4MCXA 1NPDA 4IQ4A 4JGBA 3AL0C 4ZANA 4WK2B 2PFSA 4QQ8A 1VBMA 4WEOA 2P6OA 3PXAA 4Q2JA 1U65A 4LN1A 5A4AA 3U2QA 1HDEA 3W3AA 3QEKA 4PGFA 2P27A 4RYLA 4A5SA 4GPEA 3O1IC 4DV1B 1QYWA 3H8VA 4G8CA 5DCYA 3O38A 4OUDA 1Z0FA 5EUCA 1M34E 1YC5A 3FPHA 3GT7A 4QLOA 4V0NA 4XPIB 3VR4D 4E6PA 5ADVA 5JH7A 3EGXB 1VJDA 2O2IA 2ZZKA 2F67A 1M1ZA 1Y6JA 1G8YA 1CRZA 2GXQA 4AX4A 1CR6A 2HY7A 1KIAA 1I0IA 2UVDA 2UVPB 1J97A 1FP1D 3MFYA 4KXUA 1EHYA 1YQGA 3GU3A 4IDDA 1COWD 1JJFA 5AP9A 3FWZA 2RCYA 5D3MB 3ZJYA 4CL3A 1YZLA 2CLIB 2BMVA 3M83A 4O5AA 2A7XA 1CDDA 2R1TA 3C7CB 2G4VA 1R5NA 1N3IA 3DJYA 2XSDC 5CK5A 2Q9UA 4MUIA 4R9RA 3UFDA 4NBNA 3VX4A 1EXVA 2QQFA 4TV8A 1U8TA 3DMHA 5LNK6 2QL9A 4JVOA 2PXFA 3BXGA 5HCIA 5BYBA 3K6RA 3ISTA 2WP8J 4EKYA 4PC6A 4U4AA 4UREA 1AY0A 5COBA 5E7QA 3QY9A 3IAHA 3L49A 4NG5A 2PQ6A 1XE3A 3JYNA 2R60A 4GPD1 4WQMA 3ZTWA 3ILHA 1K7YA 3ZLTA 4EA7A 3EVTA 2IYXA 2ZE5A 4GZ5A 2BTQB 5FQOA 1EFVB 4ZWNA 2QENA 2C2MA 1REQB 1KMHB 3QVJA 4P58A 5C5CA 3ZLVA 2H4ZA 1ZPDA 3HXTA 3ISJA 4IHKA 3LA8A 5FNZA 1HL7A 1RTKA 3JTMA 3GGJA 3P7MA 4GX2A 5CVUA 1O6BA 3RC9A 1ZD8A 1YKSA 4ZYZA 1VG8A 5EVCA 1V9SA 5TPZA 4UW9A 2VJMA 3A1FA 2NO5A 4BMZA 4DKJA 1O4XA 1XVVA 1RADA 3DNVB 2D1RA 3BMOB 1W59A 4YN3A 2E5LB 4EF4A 4B81A 1Z34A 4DFDA 2Y4NA 4OK5A 1VE9A 4FOOA 2HNAA 2D5CA 2RAFA 2NVOA 2H9YA 4DXAA 1XL0A 3KPJA 1TM1E 2A5DA 2ZWOA 3P94A 3F71A 1VP9A 1GGKA 9ABPA 3PPVA 4N41A 3HP7A 4G36A 5KMGB 2QRKA 1I1OA 3Q9LA 1E3WB 5KYYB 1K66A 2Y9PB 4MKZA 1F8UA 4AM8A 3JRWA 4PZAA 1ONPA 1Y3DE 2ISSD 4OHBA 3TN7A 2FRDA 3R3XA 4X41A 3QQ6A 3QKIA 3LQ4A 1TYAE 2PL9A 1IEQA 2FPXA 4X44A 3GDOA 1GLNA 3QXHA 1Y9QA 3OQVA 1RXCA 5C7YA 1EQ2A 4A16A 5EWJA 5KJFA 4DDTA 4IDQA 3CXUA 3TRDA 5FL7A 3QQ5A 4Q1EA 1VSUA 4B3XA 3Q4GA 4L51A 3ZOZA 4BGEA 3U26A 4BVHA 2BFFB 2ZXEA 3T3IA 3ENZA 1KY3A 2PQ2A 3Q85A 1R6TA 2H11A 2PZLA 3HB4X 3VSCA 2QP3A 3ILYA 5FORA 5BWNA 3TELA 1WNFA 5KTNA 3PGJA 2YXLA 4N6OA 4PFKA 4ZEXA 5D5HA 3RFTA 1QB8A 1SOVA 3HKBB 4K9LA 3WWDA 1BE6A 3T3EA 4E94A 4Y6RA 4IIYA 4QDKA 4OLHA 1JDJA 4BGIA 3AVWA 3RDPA 1EWKA 2OBFA 2EJTA 3U1TA 2BEUB 2DKOA 1C9NA 1YDGA 2B7CA 4XDGA 3ZNOA 2WV7A 4EO7A 3FOEC 3FKSD 2JHAA 2NTVA 1FOEB 1DEKA 3AEQB 4G4SP 4YRCA 1DKQA 3A6KA 3QKTA 4GRAA 4R2MA 4TTPA 3TSOA 3GJTA 5IBRA 1TJPB 2JIDA 3PZRA 4P7BA 3TH5A 3UAGA 4KAFA 5HKAA 1IVNA 2HLHA 3DFMA 3UK7A 1UFKA 5IDQA 5JNSA 3IUYA 3P45A 3DUWA 5IJWA 4QOHA 3DJFA 1OXVA 2QL5A 2HX1A 4ENSA 2L42A 4YMIA 3STWA 4BB5A 3L0SA 4LW8A 1X8JA 2E5WA 2KPOA 5DLPA 1U99A 3F5SA 4O2BB 4B0OA 1J21A 2B1RA 4HEA1 1N1MA 1NYTA 1QO9A 2WYVA 1XVIA 2LDBA 3AR6A 2OQRA 1V0JA 2OQ2A 2XWPA 3I0ZA 4R4JA 2CK3D 1G5HA 3EC1A 2HB6A 4FI3F 4CIYA 3GPCA 3F49S 3LP6A 4WUTA 5F73A 1H2YA 5CITA 3F6RA 3CJTA 3DZ8A 3SZMA 2QQEA 4I4LA 1Y8RA 4IR7A 3MMNA 4N12A 4DZTA 2XDYA 4DMRA 3B51X 3I9MA 1JIIA 1M1YA 4PU0A 1J2TA 4YCBA 4NJEA 2QX8A 4N48A 3B6ZA 4HDNB 1JR3D 1HFKA 3UMJA 3GLIE 3RE1A 2QXTA 2CYCA 3K5IA 3PDIA 4UUQA 3KKOA 1IMJA 1VHLA 3LNTA 3MD9A 1XKLA 2C3OA 2XVMA 2CSFA 4D9EA 6ADHA 3A6FA 4ZYVA 4O63O 4JHLA 2BJWA 3TTXA 2A14A 3PLAE 1ZUGA 2XB4A 1NBWB 3QU2A 4IHJF 3GAMA 4QQRA 2XKKA 4MDFA 1PZFA 4P3PA 4LRSB 9ATCA 5IZCC 4LKOA 1X42A 2HW8A 5IHPA 1NJGA 2X23A 3R7WB 1RAGA 1I10A 2VXOA 1XVLA 1BCRA 1TM5E 2C5BA 2R97A 2PCJA 3G2LA 3TZBA 4B8ZA 4EY5A 1JDNA 1R5OA 2NMVA 4J2HA 1MVOA 1T1IA 1X7GA 4JLMA 3HCFA 4RV5A 4XB1A 3VMFA 4BCDA 5BWOA 1RACA 2EWMA 2VCYA 2ZYDA 5L4SA 5IUNC 1N5KA 2VYCA 3FIUA 3WGJA 3ZXXA 2SHKA 2NGRA 5K8LA 5IC5A 2JLCA 1YU9A 1EK6A 1U28A 4PLTA 3RYHA 3B2NA 3ZI0A 1HE5A 4AIIA 4F1WA 1KH2A 2IIBA 3OO1A 4QDZA 2FZ5A 4C6RA 3I1FA 3ORSA 4G0MA 4RKQA 1QF6A 2W93A 5FPQA 1QJ4A 5IAEA 3IQZA 3IQIX 1B2RA 1IH8A 3GEDA 3GGOA 4GP9A 1IBKB 4Z4IA 1JBEA 4DMLA 2VDVE 1G21B 1NMQA 1LV7A 2UYGA 2PXKA 1XCLA 2E4ZA 4CL0A 3DM9B 4FGJA 3K96A 4AJOA 4NARA 2YY6A 1CY4A 3Q12A 2HHJA 3NEYA 2W42A 1XLTA 4KMMA 1Q21A 2PCLA 4H1VA 1GZ4A 4GZ3A 4NEHB 3A31A 3WBJA 4B76A 1KI6B 1C50A 3KKPA 3LT1A 4OHWA 4YBZA 4WFKA 1P5RA 2P91A 1UJBA 3AJEA 4YCCA 5IMBA 3VNQA 1B4DA 3KQNA 3WL3A 4QOEA 2R11A 2P2NA 3M9XA 5FUQA 3LUAA 1XUOA 1BROA 4QJ5A 4QGBA 1QORA 5CT5A 2Z1DA 4GKVA 3CVYA 1PX2A 2IV2X 3PE4A 4X62B 3QLVC 2OAEA 4RELA 2LLVA 3KUXA 4BX0A 5FBKA 3FUCA 2FCAA 3TG8A 1TO1E 1ZQ1A 1ZJJA 2IVBA 2OECA 3F2IA 4D4HA 3FFBA 4FMPA 2QUZA 2WM8A 3U7RA 1HO3A 1VZ2A 1Z7BA 4FHEA 5TQJA 4LFBB 3E7PA 4YP5A 4B84A 2FW9A 2MDTA 3KZVA 2WU3A 2OFFA 3C2QA 5H3HA 1OH7A 4X4CA 4IFTA 2FKAA 1UDXA 3PR1A 3ER9A 1EFKA 1X9IA 4ILEA 4XYGA 4A26A 1Z0IA 3BWXA 3IODA 3AERA 2QR2A 4NPCA 3RVSA 3L4BA 4EKEA 1GQSA 5BUCA 3W4IA 1LRKA 1JE0A 1K4MA 4X9XA 2YV2A 4XE5A 1FVFA 4U8GA 2QRVA 2IP2A 3T34A 1T3ZA 2A1UB 5CAEB 2Y77A 3GK3A 1JAXA 3L9XA 3GFFA 2J7WA 1VGRA 2OPBA 4M0MA 3FNEA 3NEPX 4MSUA 5CX1B 1A1VA 4PG5A 1GYPA 3BFXA 2P11A 1YHZA 2GN8A 3GIDA 2ACKA 3RJ5A 4EHHA 2OVFA 4KNVA 3J7AC 5JMOA 4U2DA 1SQ0A 1V95A 4OXNA 3UATA 2J33A 1AHHA 4RTQA 1GO2A 4BQNA 1ST3A 5AKIA 3ZX5A 5LYYA 4Y1RB 2M6RA 2UZ1B 2ZB7A 4OUKX 4A2WA 2EKBA 4OA5A 1WB6A 2DF8A 5EJAA 4PHFA 4XQEA 3CRQA 3OPYI 4X1KA 3SICE 1Q7GA 3OA2A 4AZSA 1Y34E 2HA0A 5E4FA 1Q95A 1MX3A 2HD4A 2WVAA 2ZYGA 5CLIA 5ALIA 1VJRA 1UEIA 5EIAA 3G0DA 5HDBB 1F7VA 3EEOA 1FTSA 2HBQA 1ZC3A 4TKUB 3EGDB 2OV8A 5AKYA 1BDIA 2OV6A 4TXHA 4B35A 4LV5B 3SEZA 1JHYA 1SVOA 3FPGA 3TVDA 5IT9A 4LIPD 4ARIA 1VPTA 1EKXA 2XZTA 2PMDA 2MWMA 4LVOA 3WWOA 4LJLA 2IU7A 4WBNB 2ZYAA 2I2FA 4ZI7F 3G6WA 3GRFA 2Q6IA 3IB3A 1XQ6A 3MINA 4X63A 4O1HA 3AKDA 3MFQA 2ZI7A 5JZOA 3DE0X 3JXEA 3LW7A 1WVMA 1IM5A 1W581 3CKYA 3ITNA 4J3FA 4R16A 1HLPA 1ZKDA 3FJYA 5LBUA 1C3OB 3GRZA 2C0PA 5F3WB 3HLKA 4JLNA 1Z38A 7REQA 5JWRA 3CNLA 2Y1XA 3FWPA 3TQHA 5JS8A 3KO8A 4GR4A 4ZYLA 3A2KA 2NIPA 3D1JA 3G8BA 1G3RA 3A28A 1KP9A 3OX3A 3DWFA 1A4RA 5FH9A 4V0KA 4CI0B 1DBIA 1QIDA 1ODCA 2AJTA 3EWNA 4UCQA 2OY0A 3V3KA 3R2JA 4MUEA 2ZCJA 3SS7X 3P9IA 5AOVA 5CJPA 4TLMB 3RTGA 3F5QA 3VSAA 1AKTA 3ONDA 3UFXA 4CMHA 3EB9A 3I9LA 2D0OB 5ETJA 4K9SA 1E2IA 2J0QA 1T5HX 1NXVA 3BHNA 2JANA 1N6KA 3HKCB 4LOKA 4UJ5A 3CT6A 3BMNB 1NGSA 5D51S 3SG0A 1P2TA 1T3GA 2BZ0A 2FV8A 4F56A 1RBQA 4EG0A 2WF8A 1HY3A 1UM9B 4FXOA 4H6PA 1V4VA 4U5QA 1VCIA 4W9NC 2IBMA 3KR9A 1OZAA 1VPLA 1IDOA 3L6RA 4Q3EA 3EY9A 4EYEA 1OROA 1J1IA 1Z0SA 2GAOA 2PXAA 3IA7A 1FMCA 3T38A 1LBQA 3E61A 3LFUA 2R8ZA 3EXHA 4AJEA 4I4TA 3IE0A 2HQBA 4JIMA 4L5IA 3GNLA 3D2BA 4X97A 3JQAA 1UFVA 2PYIA 4P3YA 3UK0A 1QZZA 3RRNA 1DRKA 1SVSA 4OFZA 3L0YA 1IWPB 3NT5A 1MB2A 2O2SA 1WXHA 1N57A 2XCUA 3V33A 3E3NA 4ENVA 3V4OA 1TQ8A 1QHGA 2W58A 5B4TA 3KZCA 4TVSA 4ENTA 4H59A 3FWHA 2QIPA 3DTVA 4UBLA 3THYB 3TLMA 4HXYA 2NPOA 4M49A 3B38A 1KF0A 1ZD5A 4XASA 3N05A 4B40A 5JJCA 1OH5A 1Y6GA 1C0EA 2C8KA 2XRYA 1F48A 3BA6A 4FVTA 3PYLA 1N33B 3EIQA 1G6Q1 1ZZ6A 3IS3A 4L4SA 1SBNE 2PG3A 3HM2A 4ATNA 3QWAA 4LXTA 4YLEA 5KVSA 5EZYA 2ZT7A 3R5XA 2NUAA 5AKLA 1EM8B 4IKOA 3NNSA 3B3QA 3UAOA 1OB2A 1PR6A 3GPLA 5HNKA 2VHXA 2WU4A 5FOTA 3NG1A 3V4FA 2L49A 1PFWA 3QOYA 4PS0A 3U4HA 3U7FB 4MRNA 5I8ZA 1VXRA 1YB5A 2B4RO 3ER6A 1M2KA 1Q19A 3KJIA 4MUXA 4WGFA 3WWCA 5LIPA 3LC2O 3W34A 4U7JA 6REQA 4EL0A 5ES4B 1G4UR 2WIJA 5C80A 3VDRA 3OOHA 4YAJA 1TT5A 3KQUA 4BB6A 2AE2A 3DLIA 3T3GA 3IA2A 2P8SA 2XCSB 1K92A 4DQ0A 3SBEA 5JAPA 1BOOA 4XEUA 2IBTA 5JSQA 1W93A 2QIOA 2RGRA 5TEVA 1TM4E 1TADA 2RHMA 1UAYA 3NFRA 3R7BA 3UQYS 4AJNA 4Q3BA 4CFZA 4D0GA 1GTSA 2UUAB 4G0VA 1Y9JA 4ARBA 3A3PA 2JHFA 2BFCB 5JEDA 2ONCA 1TAUA 1QX3A 5L6LB 1W5EA 4KREA 3VVMA 1QC5B 2BTOA 1G9TA 1LI5A 2NWQA 4ZI2A 3A4TA 1OAOC 1TKCA 3NZLA 4FB5A 1EFRA 2NUTB 3THOA 2BFEB 3NP9A 3L4KA 3TLEA 1HNNA 2WJ6A 3VZBA 4DIFA 3I9FA 4N1AA 1RJFA 1OX4A 1BE1A 2PPVA 3D31A 1UBRS 4LTNA 4NFHA 3O8QB 1XR3A 4JLOA 3CPHA 3IBYA 4X71A 1YZUA 3PJFA 4N0MA 3SHVA 3T9DA 1JKFA 1HYHA 1JZQA 1HMYA 3K92A 3OHPA 5KSWB 3BULA 2O8DB 4J43A 1W1WA 2HMYB 3OQ6A 1Z4OA 3D6VA 1E2MA 2EDCA 2VJLA 4O5OA 3NM4A 1IIRA 1U8YA 1ILEA 4QULA 1RKQA 3IPRA 2R9VA 4JYPA 2ZJAA 1YWGO 4B44A 2WJWA 1BE0A 2UZIR 3RYFA 1ANKA 4I4NA 3RUDA 3OF3A 5K0BA 2HSWA 3WICA 3S1SA 1I80A 2CXXA 2ATVA 4N5LA 2PGIA 4N76A 1YVPA 4DF3A 1KI9A 5JEEA 1R6BX 3TOCA 1MO2A 2CV1A 3SDSA 1KJIA 3DKVA 1EJ6A 5I7VA 5ER9A 4D3FA 2GPNA 4AKSA 4URFA 3WLAA 3AM5A 4R1UA 1ULTA 1A27A 1GDDA 1XLUA 2N1BA 3C3JA 5AJVB 3RRXA 4AK9A 4F92B 1AKRA 4S05A 2IX3A 4NICA 5A4KA 4KZKA 1UBNA 3N39C 2V7VA 4ZC8A 4BVEA 1SKYB 3EBOA 2FPOA 4H17A 3CSUA 3H16A 4JKYA 4UFNA 1K86A 4S2UA 5FEUA 3GEMA 2HYDA 1ZIXA 4RLQA 1A1SA 5EMJA 2DR2A 4LF7B 3AUJB 2RBEA 3UWKA 2QVZX 2Y0PA 3ZZUA 2RI1A 3JPYA 3TGLA 3UMCA 5JY6A 2EVWX 1YB6A 3KHSA 2PS0A 3DWEX 3VPAA 4OJNA 4F3YA 1XF9A 1FNSA 3FIJA 2ILTA 1E18A 3LY7A 3MJTA 3A4LA 1JFSA 5A0VA 1QYRA 2PXQA 1CFJA 2B25A 2XB9A 4PX3A 2AOUB 4P4LA 4XB2A 2QSZA 4A8TA 4QT4A 2HADA 1KYWA 4H7EA 4GM4A 4RQAA 2HZBA 2QMQA 1VXOA 1M76A 3DL7A 5EEHA 1MIOB 1XU7A 2XLBA 1HT3A 5TQVA 4Q3OA 3C3MA 1JQAA 2G77B 2WYHA 4FKBA 4RPGA 4U02A 5E6SB 3WL4A 4EVRA 5B64A 5JXJA 2QX9A 2O8DA 1NHWA 2C61A 1F2UA 1JT2A 3HSSA 3T95A 4B17A 5J2TA 3LBFA 1ZAYA 2NNLD 2VSNA 2NZUG 4KVFA 2PIAA 5H02A 2AFIE 2DSNA 2AUNA 2PMKA 4B3HA 3A6HA 3OOJA 4H31A 5ALGA 4GI7A 3DVQX 1XYGA 2REQA 4DCOA 2Q4DA 1OGYA 4RTOA 1WUTA 5J5AA 2NUTA 3HXKA 4YPOA 3G5AA 2ZRQA 4YJ2F 1WRBA 2VPPA 3O8NA 3SP1A 4NDZA 5AWFC 2HU8A 4CKEA 1LK7A 1SK8A 4LWQA 1XA4A 4MRSA 3ZQ4A 2AG0A 1ZIPA 2DFLA 4P93A 3FPJA 2E2WA 3PWTA 1UT8A 2BE7A 4GYWA 1G18A 1Q0LA 4L28A 4RJLA 5LWQA 4YO7A 4WUVA 1ZU4A 4KQGA 1IWBB 3GWGA 2G36A 3EJWA 1PHRA 3PFFA 1FF9A 4XSHA 5G2OA 2IY8A 2Q4RA 2Q3EA 2AR9A 2J3JA 4F5ZA 4MJXA 1I32A 1W47A 2GASA 1CS0B 2IDJA 2VLBA 4WDQA 5CT6A 1Q0PA 1FU4A 3EQ9A 1NDQA 3KPUA 1BS9A 4K1XA 3F6YA 4B09A 3CT4A 4U9HS 2JGLA 4WOPA 5ECWA 1OPRA 2AC2A 2AR7A 4LFCB 4KIJA 5L3SB 1U2DA 4XI9A 4FZJA 1CQWA 3E27A 3SMVA 4NHEA 4D42A 4WBNF 3TNFA 3MLEA 4D92A 1JE1A 1D1QA 1EYZA 2BKAA 2A3NA 3OIWA 4KMRA 2BUCA 2PKQO 3E22A 4HNHA 2FQQA 5B53A 3UAZA 4EPXA 1AUQA 1NI4B 2YHUA 1WCV1 3D2LA 5KWIA 4Z6KA 2BNMA 3M1LA 5ALNA 4S04A 5E2AA 2IHKA 4ES6A 3WQHA 3DE3X 2GAIA 4X8OA 3BIJA 5FUYA 5EPOA 3DMPA 3ZGYA 1OWMA 2JLBA 5ADUS 4TM7A 1WPGA 2BFFA 1KC1A 1YCHA 2KMLA 5BRNA 3KSBC 1IVYA 1K4YA 2VP2A 2GVZC 3SKYA 1ADCA 1FYWA 3OZBA 4BNKA 1MP0A 2G76A 4J0HA 2LCIA 5IXSA 4FBMA 2RGCA 2X2EA 4C43A 4D8UA 3ZEAA 4CVNA 5B6IA 4ILKA 4EH1A 1QVVA 4H0NA 1AA6A 3DZJA 4PLGA 1XXLA 4V0SA 2OD9A 2PWPA 5ALWA 5LNK1 1T6YA 4OHZA 1OYVA 3DBRB 1TMYA 1AZLA 1XD2A 4BP1A 4C5AA 3IMCA 1VDMA 4UUAA 5LC1A 3G0CA 1NNEA 2XYPA 4PZEA 1DFIA 2CNKA 5CLLA 5TGDA 1Z06A 2IXAA 4IUDS 4MUGA 2O8CA 5BQ3A 1N2GA 1E2PA 1ZNWA 1A9SA 1KDVA 1EE1A 2EZTA 2I62A 3M2PA 2ZTLA 3NB0A 5LP6C 1PYOA 3GVCA 2O8CB 4FGUA 4FLEA 2VNSA 4GXNA 4CCAA 2FPLA 3ENNA 2MSLA 3LT0A 4UTVA 4BTLA 1GZ5A 1INLA 1YS9A 3D7RA 3LXMA 1PT6A 3SCGA 1L1QA 2I54A 5EHQA 2FE4A 2V59A 1Z39A 3N8HA 2QRMA 2ZUBA 1ZEMA 1BVRA 2IW3A 3RTBA 1E1RD 1Q6ZA 2E4YA 2HRDA 3PDHA 1S7GA 2WT9A 2WK1A 3UJAA 4HDMA 3COZA 2DR3A 2YYZA 1CEXA 2VP9A 2BMWA 3M5DA 4AY4A 2HA7A 5IJ0A 5BORA 2HIAA 4Q3NA 1ZKMA 3LD9A 1G6KA 4OQQA 1LLIA 1DI0A 3LE8A 4IUYA 4S1TA 5EE0A 1CIJA 5AR1A 3L7NA 4MRVA 3U49A 3ETLA 3MHPA 4K5QA 3WIUA 3U4GA 4NFLA 3DMYA 1GA1A 1WHSB 1V37A 3QH4A 2R7AA 4ZCQA 4INAA 1PRYA 2BGMA 3OG9A 3T4UA 2A4MA 5AJWA 1I30A 4EB6B 1U02A 3SCFA 1QUEA 1B42A 2ZIXB 2FEXA 4NZPA 1NBEA 5LVAA 3Q8MA 3FROA 3FCYA 4Q4AB 2M1ZA 2DWOA 2GEDA 3O3CA 5SY9A 4Y67A 5BUQA 4O2BF 2CFTA 4RCVA 4I36A 3WLHA 5KTKA 5I9IA 3OMWA 3RAFC 3LPLA 1L4EA 4RL6A 1FDTA 2OZKA 5WRFA 1DZ3A 4Y9TA 1KE2A 1RHKA 1K5GA 2QRGA 5E1DA 1OFTA 3EF3A 4MVJG 1E3OC 1K7CA 1Y3BE 3GHHA 4NJMB 1UF9A 1K9VF 2J0UA 4GYJA 4TRJA 3WDMA 5A2QA 5CDHA 4AIRA 2X8LA 1A7JA 1OYOA 4UCFA 2Y0CA 3UB3A 1JZSA 1HQDA 1ZD1A 1E3WA 5AMXA 3IP6A 2HJSA 2FEMA 3PHHA 3HB1A 4F7WA 5E8JA 2SICE 2WUVA 2UYQA 3E84A 3G8DA 4WRRA 4Y6SA 2O3SA 2P2SA 1DJNA 2GFHA 4JC4A 3N7TA 4NABA 1EPUA 1SIOA 4OHOA 4B3TB 3K1AA 3ZC3A 3NKVA 3ZYCA 1WSAA 1Y8QA 3RT7A 2C9BA 2YDXA 1FFXA 4DR6B 3OZIA 1JHAA 2CLKB 4FYKA 3CG0A 3RWOA 4ZICA 3SQXA 3IMKA 2LE0A 2A0YA 1F6DA 3TUIC 4KYTA 4E03A 1MPXA 4JELA 1R0YA 3DE2X 5L4NA 1PCXA 4Q00A 2PAFA 1RW4A 3HACA 1Y7TA 2BM8A 2GDJA 2D1QA 1LQTA 4P6VF 3A6JA 2ZUUA 3DF9A 1SXJA 4PE5B 4RLSA 4XZ3A 1DIGA 4P38A 1U3WA 4H7HA 1DTWA 4ZI7A 4F8YA 4DG5A 3SZRA 2WG2A 4M9ZA 1YR8A 1VBFA 1XDBA 1ELOA 1JECA 2EFCB 4NOJA 2WYIA 2UV8A 1RYHA 4US2R 3CRVA 5KYNA 3DOEA 4BNVA 1ES9A 1WNTA 2EIXA 2WNIA 3DE4X 4H1TA 4MA0A 3UQZA 1EX6A 1O08A 3GFGA 1V5IA 4JI2B 4YO8A 1Y9ZA 3LRTA 1VI2A 4QT0A 1PW5A 3C70A 2AE1A 3IR6A 3ZCXA 2FXIA 1U5AA 4IJWA 4KJXA 3L8GA 1H23A 1HLFA 5FLYA 1AT1A 4EIWA 1ONBA 5AVUA 4WY2A 1VHDA 3IPXA 3RASA 3MT8A 4BO9A 5FUVA 1I1HA 1TE2A 3FZGA 5K6AC 2LYJA 1DLIA 1R4NA 4X60A 3BVPA 2HCBA 5JSKA 3B6JA 1YAJA 4H7KA 1WIWA 4BV9A 2EEZA 4IIDA 4UBNA 4DM4A 5B55A 3ODGA 4DBZA 3SHOA 1Z2CA 2NPIA 5FWDA 3TCXB 1SIBE 4EJFA 2ZSUA 2ICAA 2F9LA 3QWGA 4L5CA 4L78A 4KRFA 2F9MA 3HUDA 3T9AA 1JU4A 1MNAA 3HPQA 1YUBA 3TSZA 1B8VA 3OT1B 4MDEA 2O8EB 1IY2A 1PR9A 3F78A 1GZ7A 3ZVLA 1C8LA 3AOEA 2DQSA 2XKBA 2HMAA 2OZPA 3L46A 2BR5A 2PRZA 3GLHB 3PQ2A 1K6XA 1PZXA 1MNQA 2ID8A 5K2MA 1RVDA 2ZPAA 4GRDA 5L3RA 2FGKA 2Z3WA 5CBPA 2HRQA 1MGOA 1OWLA 5DNWA 2P9GA 1BA3A 3HJAA 4HNTA 3B5IA 1FPQA 1QZTA 1E20A 4DGQA 2ZULA 4ETIA 1C80A 4IVPA 4IHQA 1A8QA 4XIFA 3J81A 5B3KA 5EIFA 5K3AA 2Q49A 4HYYA 1S01A 3VZRA 1WQ3A 2JFOA 2VNAA 5EYPA 1W2HA 1YR3A 2GAFA 1JR2A 3GRAA 4WN9B 5TQ2A 4Z1MA 3CYFA 1XQVA 1SC9A 4IX1A 3T9CA 4RNDB 4MTLA 3FRHA 1F0PA 3FYHA 2C42A 3NRCA 4J7AA 1JB1A 2E87A 2ZJ3A 3MWEA 5JO9A 3R7AA 4TN1A 1JFFA 3PXXA 4HDSA 4TUYA 3UHFA 3QV2A 3RTAA 3VZDA 1N5OX 3ZGXA 2QTCA 5DM0A 4B5KA 1ZL2A 2ZI9A 1UZNA 1QQ6A 2AG6A 2Q0QA 1E5TA 1UKBA 3FTQA 4EHNA 4MINA 4PGHA 3WIVA 5J4YA 1U0NA 3I83A 1UP4A 2WTXA 1LBIA 1WB9A 3T1VA 4N3GA 5LFAA 1VGQA 3HB5X 1FSFA 5F9FA 1Q3KA 3BA1A 4MRMB 4F2WA 3Q1KA 1YBFA 1U1FA 1YUNA 3N59A 3OAAA 3VHQA 4C29A 5K0LA 1LK5A 3KUDA 3WP0A 5KKCA 5HF9A 2OORA 2CBZA 1RC0A 5C1BA 3OTHA 4PQEA 1OIXA 4WAUA 4HX2A 5JDCC 3T4PA 1TIKA 3O8BA 1GOTA 1YJXA 3CV3A 4INPA 5GM2A 4GX5A 4C03A 4KTTE 2O52A 3TRIA 3R4CA 1KZGB 2H31A 4OL0A 5DJ5A 3PQDA 2HCJB 2OWEA 2JCGA 3UMRA 1DB3A 3GZCA 5DM1A 3DMTC 4BNGA 3JASB 5HE8A 3TD6A 2VAVA 2BCEA 1D8AA 1DIBA 4I50F 4OSOA 3B6EA 3MIZA 2FMHA 4Y6OA 3I2HA 2CMGA 1NUHA 1ZIOA 1QFSA 4O0MA 5J23A 2J30A 4URYR 5BSWA 5DDIP 5JNWA 3DFFA 2YJ3A 4G23A 1UJCA 2QM3A 1NQ5A 3O9VA 3CH6A 1H2RS 4PHTA 1X19A 4X4IA 2Z2KA 4L73A 2EW2A 2D06A 4LXHA 4ZT4A 3HA7A 3OJFA 3R5KA 4OI4A 1L5GB 4Z5HA 1IPHA 3PNSA 5FLKA 3DEZA 1K0FA 5FHQA 3S27A 1IOVA 3GLFB 4M37A 1NVMB 1CUIA 3UPTA 4PO3X 3DBOB 1ZUNA 2WKWA 1TC1A 1W2GA 2FOXA 2Q7XA 1NP3A 3DQZA 3NLLA 5H1YA 4QPPA 4LE1A 1NJ1A 5GMOA 3S7TA 3SN6A 1QG2A 1THTA 3D3KA 3V97A 1SUCA 4BNUA 1YBVA 4MJLA 4E4TA 3PUKA 1UFRA 2PSEA 4GLLA 4LY9A 2I3BA 2D7CA 2ORED 1PD0A 1K3FA 2ODQA 3TNLA 1FRQA 2W9XA 3NOVA 5AQ1A 3DL4A 2XF8A 3CHYA 3QVMA 2ZJOA 1DCMA 5DGTA 3HI4A 3KQQA 3TIVA 3UBTA 1UXOA 5JCPA 1KFEB 4X3PA 1XHFA 4AD8A 2VRCD 2E4AA 4M99A 3VYWA 4ZVRA 1PNVA 1ENPA 4ND8A 4E5VA 3QQPA 3GVIA 1OQAA 3S1LA 5IZ4A 3EPRA 1Z6PA 2FW0A 2FMKA 1JR3E 4GM1A 3SCZA 3T7EA 2I6UA 3H0KA 4YRJA 1TZKA 4UC0A 5HMMA 5EXPA 5F5NA 3JQPA 3UANA 3PQEA 3UXMA 4G37A 3REOA 4BVBA 2P9JA 4Q4CA 3TXAA 4AP5A 1WOYA 2VCHA 1ZRSA 3IAS1 4XM1A 3TE6A 3LBIA 3DULA 1J1ZA 4FDVA 3JQRA 4C7MA 5AW6A 2FG5A 1XJCA 3WR5A 2R44A 2J5BA 5K0CA 4Z9XA 3N0WA 2QM7A 1M7HA 3QXCA 2AFHA 4NZ9A 2BFNA 3FDFA 3O8LA 2HK9A 2AG8A 3OEWA 4KQXA 5G0VA 3TZHA 4HPJB 1AMUA 1U1DA 2G0AA 3M4YA 4PRLA 1BYUA 1P3DA 3VFDA 3AT1A 1KJNA 2CHGA 2ZIVB 4EB0A 1S89A 2FSGA 1E64A 1E6CA 4FUQA 5I7UA 1PERL 1N2XA 1KI6A 1RR6A 721PA 4QM6A 4X93A 5AK3A 2O8NA 3NOXA 3PVSA 1NXQA 3OQNA 4UOQA 4BFLA 4HOYA 1T4BA 5G4KA 2PU5A 5IU6A 5BV1A 3PVCA 3RRFA 4YLYA 1T5IA 3MINB 4LJ6A 1C2YA 1VMDA 3PL1A 4KVZA 2AXZA 1PFYA 1XOIA 1P5FA 5GV8A 1SOAA 4OGWA 1GRCA 1VCHA 2ODWA 5E9JA 4D56A 4R71A 3ICQB 1OD6A 1WDMA 1J5XA 2YOGA 3R3VA 3E5NA 2ZZMA 3VOSA 1E7WA 1GCIA 1N2IA 2IVGA 4JI6B 3VR5H 1Z88A 2XTZA 4LVUA 1TMGE 1JUDA 1LPPA 1JPUA 1WP4A 3GC6A 3BS4A 3VO8A 3GZNB 5E1MA 2H8KA 3IQDB 4OM8A 1FRZA 3WYAA 4TKVB 1VA4A 5CH8A 5C46F 6YASA 3GUCA 3HKEB 5C3UA 1XVUA 2XMGA 4MCHA 2EXXA 5TT1A 4CIVA 3GO4A 2RGDA 3N0VA 4M38A 2GJSA 2QMEA 4KN9S 1BG6A 4AQYB 1RAHA 1E1CA 3R0XA 2Y05A 3K0SA 4EHIA 3LQRA 3QFCA 2R4QA 4MKIA 4O59O 3PI7A 3ELWA 5CGZA 1GPDG 3HDQA 3SJUA 4LC9A 4D5GA 5MGBA 4ZA2A 2G9RA 1JEYB 4EGQA 2PR2A 2YVQA 3O6VA 1Z22A 4XCVA 3VC7A 1Y6RA 4L3VA 2FJPA 5EJFA 2DWPA 2PWZA 3SX2A 2GLUA 2FF7A 5A4FS 1E3EA 2XQKA 1J5EB 4KQFA 4M1TA 2IP1A 3RS7A 2VDWA 4D98A 3G5UA 4NS4A 1JS1X 1X13A 3VHXA 2ZB4A 3EF1A 4FDLA 2OGWA 1W4AA 3NVKI 3E9MA 4RK5A 3R41A 4P22A 4JC5A 2AF3C 1TIPA 3GJ8A 4P4TA 3F1LA 3A14A 2YIMA 4B3DA 1TUBB 5IDXA 1VI5A 4I19A 2C88A 4W8OA 5CFPA 2C1EA 3AR9A 4CXMA 1SU7A 2YWEA 2ZYHA 1LQUA 3AONB 3L5KA 1R6DA 3JQFC 1MAHA 1PKXA 3MYRA 1T4DA 1U0LA 2FN4A 4FGLA 2TMDA 4JFRA 1GKLA 2HBYA 1I3KA 2MJLA 3KLPX 3PFGA 3UG7A 4ZCTA 1L7BA 3TS1A 4EW2A 1ESNA 3GHYA 4GO1A 5DNDA 5C81A 4CR6A 4N7BA 1LSUA 1TA0A 3OETA 4M60A 1LD3A 1H4SA 1PBNA 5LA6B 2H57A 4KNWA 1HK7A 3LHIA 5E7IA 1M6NA 1Q0QA 2FFBA 3DEYX 4HB0A 5JVDF 5E6RA 2EX4A 3IEPA 5LMNB 1ZVKA 3BRWD 2Q9BA 2Q0SA 4WD3A 4E5DA 1MEEA 4TYYA 4Q1AA 1B6SA 1KVUA 2VAXA 3AZPA 3IOBA 4KFRA 4KX5A 1A8HA 1M6WA 3QX8A 1ESDA 3TB4A 3P2YA 2PT5A 4FDAA 2CLLB 3DKRA 4DV2B 3LYAA 2O8FA 4B79A 4YGXB 1CR0A 1PLJA 3BFPA 3UJBA 3GJ5A 3PEUA 1DTSA 1DT5A 1Z4MA 2OHHA 2MSKA 4KE8A 1BAPA 4O6VA 4V0ME 5HX7A 3PXEA 1EXNA 2J1LA 4JQCA 4OQYA 3L93A 4QXAA 4MVJD 3RK4A 2W7TA 3MG9A 2RHTA 4WIAA 4DM7A 2FB9A 3H2JA 3KNZA 4X84A 3WLPA 3HBAA 4G0QA 5IS2A 4PIPA 4MW9A 1PLKA 2VPWA 1R3DA 1ZXBA 4KV9A 4OBBA 4Y1GA 5J4HA 1XZCA 3N8KA 4U7TB 4BO5A 4C7JA 1T4GA 4IYJA 1MW9X 3ETDA 4L8GA 1XZMA 4AURA 5JJKA 1M2JA 1YI8A 3NYWA 3CJRA 4MGEA 2PKEA 1N5RA 2RHLA 4KDCA 3C5CA 2B61A 3P0EA 2APJA 4BNLA 1KNQA 2E85A 4K3VA 5IAOA 3DLBA 3VDQA 1JXAA 3N74A 4B1FA 1G2QA 5CRIA 4M0CA 2V03A 4B7AA 4E22A 4H16A 4RLHA 2F48A 4P81A 2OC4A 5B5SA 5BWLA 2JIPA 4L8FA 2W6JD 1J99A 4TYMA 2X6QA 4EOGA 3KOWA 4QDOA 2B4KA 4YRZA 4A6EA 4DIUA 1YRWA 1ADRA 2CL0X 1KTVA 1VLMA 4L1KA 4E6EA 1OXKB 4Q15A 1YVRA 3RC3A 1YULA 5C4IA 3DUFA 4GXRA 5LMUB 4TXLA 1EMDA 2P9CA 4KXVA 3RU9A 3GGGA 3A1CA 4JBWA 1FNBA 1THGA 3NBFA 2W6OA 4IH1A 2ZRIA 2D62A 3U3WA 5FBQB 1M2OB 4DCPA 3Q87B 4IV5A 1JR6A 5H59A 3ZVKA 3BL6A 1PZNA 2R8RA 5FWXB 1UIMA 1DARA 1PGNA 2JIBA 1O03A 4R1QA 3D4LA 2IQ5A 3ZDBA 4F5EA 5JAIA 2YVLA 3VZCA 4BRWA 3BFVA 3EZ6A 4LC1A 2V5AA 3EUFA 3ZH2A 3ZWAA 3V2IA 4YMHA 5A4JA 4N40A 1QU3A 1HDZA 3NEAA 5JRDS 3CLSC 3B2QA 1YRBA 5F98A 3MJVA 4LBZA 1VJTA 2WFMA 1CKEA 2C5EA 4N03A 1ADFA 1UJ5A 5DYNA 4PAOA 5T5QA 5EHZA 4EY4A 1TMKA 1R8YA 2HINA 1CF2O 1FA9A 1X7XA 1TCVA 2QE7D 3AB8A 5FL3A 3GNSA 4XWKA 1UPCA 1GEGA 8ABPA 5AW0A 4N0EA 1NA5A 3FCOA 1L5RA 2R2AA 3ORRA 4D3YA 5B3JC 3FZQA 4B3CA 1FP4A 1D4AA 3IMEA 1KQ3A 1RRKA 3E5RA 4LXYA 3ZD7A 1LBEA 4A2PA 3OQJA 1ZM2A 2CZGA 3B1WA 1QUFA 1FFBA 3PUIA 4CJXA 1WX1A 4IRUB 3STXA 4FGKA 3S3TA 2JKZA 2I7DA 4MVJA 2HT1A 3GW8A 1E3JA 3V8QA 3V42A 3U81A 2QUKA 1XDSA 3H19A 3S29A 3P71T 2AR0A 3N2ZB 2ZBVA 4JU9A 2H4FA 2J9GA 1M2VB 3UJ8A 1EUDB 3C0KA 4QJ4A 3I0MA 3KT6A 3MTIA 4LHZA 4UNQA 2MTBA 3NDIA 3WJAA 3R0ZA 4IV8A 2I4OA 3CINA 3KL4A 3HLYA 4BFWA 1IUKA 1RLMA 5E4TA 1U1EA 3WZLA 1NVUQ 1U11A 4N01A 1PE0A 1PJTA 5CT8A 4EFKA 3FPCA 3C6BA 2DT8A 1LLQA 2V3WA 3F6PA 4WY5A 5DP1A 6AT1A 4MYSA 3PC4A 1DJPA 4MZXA 3IILA 2QZ9A 1OXUA 3IERA 3U4DA 2RD2A 2VK8A 3C8DA 4LOAA 3Q40A 1ZCBA 5JE8A 4EMBA 1YB7A 4X91A 1PR2A 1E5XA 3M8KA 5JASA 3MSCA 3VO2A 3WL7A 1A82A 5IDYA 5JFTA 3OE7A 1GADO 3GUVA 1U8FO 5DH9A 1PL6A 4TLBA 3G0IA 2D7JA 3W5JA 2ZUVA 1F4PA 2PH3A 5AI0A 3LV8A 2YBEA 1LTKA 1S3GA 3CF0A 3ZJTA 5HKLA 3AVOA 3MJ4A 4MVJE 5F52A 5BW5A 3GR6A 1JKJA 3BMOA 5H68A 4DSNA 3I1IA 1Q0RA 4MYUA 4CUJA 2OILA 4ZAWA 1ZQ9A 2P4SA 4Q39A 5ALZA 2NOAA 4AS1A 2PY6A 2HV8A 3P0HA 1BXGB 2KSQA 4JUDX 3PEVA 1EUQA 2GM4A 1Z4NA 5F2OA 4J90A 3O8RA 3F51A 2FSVC 3I3OA 3NC0C 4KO8A 4RZHA 3BDVA 3RVPA 1HLGA 4G1MB 1SCNE 1JHMA 5G53C 4BE9A 4JQZA 2FFQA 3TMAA 2I9KA 3IVXA 3VR4H 2QD1A 3OJXA 5DHTA 1L8QA 3K8QA 1JG4A 1TJYA 3P2KA 4ML3A 3S99A 3UJ9A 1SQGA 4C3OB 3MTJA 1T8WA 4MKRA 5AVZA 2XJ3A 4R8MA 5HGXA 4PZPA 1H65A 3UM9A 1UFQA 3AINA 4QOFA 3RAJA 4DJTA 1COWA 2V9ZA 3KD3A 4P7KA 1CZNA 3IIKA 1NI4A 1C7RA 1HOXA 3NP7A 1T5LA 4BO4A 4CMEA 2CLSA 2OC9A 4XQGA 2C4HA 3DMDA 2IITA 4DOMA 4ODIA 4EK9A 4BQQA 1E2GA 3AUKA 2P0EA 3AHEA 2P6UA 5GZ6A 4Q3DA 4QYIA 4CCWA 3S28A 2BL4A 5K0ZA 3C45A 4H18A 3CONA 2AW6A 5JUWA 3RIYA 3SHWA 5L3QB 2EFEB 4OFBA 1L1FA 1EGMB 2PBZA 4EX7A 4YXWD 3GLKA 4KNYA 4E5SA 4M1MA 2UXBB 1PK8A 5ELLA 3SX4A 1JEOA 3FDZB 3KKMA 5JCOC 5CK4A 2H65A 2WAAA 1T9HA 4GKBA 3INYA 2WIFA 1QE3A 2QJFA 3NDBB 1MRSA 3CRMA 4TS4A 3DDSA 3ZDQA 1C9JA 2Q7DA 1K7EB 5LUBA 4E3WA 3H18A 3PRYA 3O95A 3L1UA 3IAEA 4X92A 1ZGJA 2PNJA 4AYTA 2YFHA 1JMKC 2OO3A 2PE5A 5EXSA 5JAZA 4BNMA 5KREA 4Q12A 2JCSA 2YOHA 4UHFA 4R3WA 1BJKA 4UNSA 1PP4A 4WWHA 1XJ0A 3OCVA 1CJTC 1EG2A 1KR5A 3MUEA 3ZQKA 1OLSB 1I3MA 2EHJA 3KOXA 4BWGA 1HG0A 5I9MA 1E1MA 2H3HA 3BX1A 4HTFA 3A6LA 3NKFA 3CVUA 4KVGA 4Z58A 2WHQA 5L7YA 3G49A 3VTFA 2ODAA 1SY7A 1V1RA 4MQ4A 4PN7A 3KWJA 3G82C 2WAYA 5U1PA 4BVGA 1LTHR 3D8SA 1E9RA 3DMGA 4D4GA 2Z56A 1ZK1A 3OHSX 5HK8A 2B34A 1QX4A 2JI4A 4AMUA 3ZUPA 3D6NB 1SG9A 4YQFA 1EFVA 1KERA 1F2VA 1VRCA 4FGSA 3SFVA 3W7AA 4MRPA 3ZKWA 3WIBA 4YV7A 4KR9A 3AESA 4B6RA 1B1CA 4I9FA 2XW6A 4WE3A 4Q9IA 5AKEA 4BKUA 2YWCA 2JCXA 2AEFA 5DM60 1E5LA 2NYVA 1VLLA 3KAJA 1O6ZA 1U7WA 3FOZA 1LBTA 3I5XA 3RRMA 3E4DA 1M0SA 3GEGA 4CLRB 1TXGA 1P4GA 4C7XA 4DRYA 5TGTA 5HKBA 4J16C 1GU0A 1ZM3A 4H0FA 1LSSA 2EJCA 4FYHA 5GQSA 3WLIA 4LV8B 2GCGA 3SD7A 3ZHMA 5CDYA 4NY1A 2LLWA 1GG8A 3DWIA 4IMRA 2OCKA 1XTZA 2XYVA 2CWWA 2H5LA 1U8EA 1C8BA 3W5AA 2PZMA 5LP1A 2R8EA 4LI0A 3F5DA 2GD2A 4BEWA 1KJWA 4GECA 3C1TA 3O8OB 3MIIA 3GOHA 1DWKA 3CRNA 3ENVA 1ATIA 1E5DA 3I5YA 3TMKA 3F8SA 3C1AA 3P9YA 2O8BB 3OJLA 2PD3A 1G8PA 4QEZA 1PEKE 4CKBB 1JHRA 4CMKA 1UCFA 1U8UA 1CYEA 1SUDA 1G6OA 2O2HA 1H1DA 4JP8A 1AUXA 4RS3A 3ZE2B 3W3ZB 3LHDA 2PZBA 1AK2A 3V2HA 4HAZA 3GQBA 2BFDB 2RC5A 4K6OA 2FF5A 4QTYA 2Q99A 3K9HA 2I1WA 2AUWA 1H9AA 2VJPA 3C74A 4M9QA 2P1ZA 3C87A 6NULA 1ZHOA 2BDUA 5C9ZA 4AKGA 1M2GA 4L7VA 5H9VA 3A7DA 5BPFA 3UXEA 4KI0A 4TGLA 4BNIA 1S4MA 1IB0A 2A0KA 5DX8A 5FULA 4CL2A 5HKOA 4EJSC 3RBZA 3OOEA 4PWZA 1US8B 2JFBA 3I6YA 1E1YA 4RAOA 2FETA 1LNZA 1D3AA 2O05A 3LM8A 3NPAA 1BXRA 2QN3A 4UU7A 3V7FA 3RYTC 3BSWA 3K5PA 1E3SA 3SZOA 3LBNA 5KNBH 1BHJA 1N7IA 4KFTA 3HCBA 5JD3A 2ZAIA 1CHDA 1L4BA 3QBDA 1NLZA 3M1IA 4HNQA 1UMCB 2K2QB 3L40A 4GAEA 1FDVA 1SVLA 3AUYA 2EWVA 5AHWA 4EVIA 3ZGNA 2YNMA 3ZHOA 2ZM5A 1AH2A 1TF5A 3K0AA 5EQDA 3ZYZA 4ZHSA 1RBZA 3ZE7A 3OPYB 1AHNA 4J6FA 5ESRA 5GAJA 5A62A 2XSZD 5KDDA 2D1SA 5BMVA 2GEVA 1IHUA 3BD9A 4ZYYA 2BBOA 2B8TA 1S2DA 2G7MC 3ETGA 3A0RB 3NCTA 4WHMA 5CNJA 3SJCA 3VU9A 1ZU5A 4MW2A 5F2EA 3R9KA 3UYKA 4ZTUB 5DGCA 1UODA 1IRIA 1QH1A 2C5LA 4ZZ1A 3K2BA 1PZGA 5DTQA 1KEEB 4Q7MB 2W6PA 3IEMA 1V6AA 1UM9A 4A36A 3D7NA 3QFTA 3RSCA 3NMUF 3HFRA 1NVEA 1F0YA 3Q3JB 2X9LA 1CZOA 1JALA 2IJGX 3M4ZA 1G8SA 3HBFA 3N2NA 4M46A 4M53A 2VT7A 5L4LA 4GBMA 5ALSA 4EHFA 1YMVA 4CDRA 1H1LB 1JWBB 2IYFA 3PQ6A 1FX0A 1N2CE 1HL3A 2QD4A 2QM8A 2IZ5A 1Q0SA 2QRVB 4G5QA 4NQZA 4IFIA 1DINA 4DRXB 1HE1C 3LC0A 2WILA 3KR1A 4PRYA 4EGSA 1E9SA 2BF4A 3CE9A 4D9IA 3ADBA 5TMEA 3KFLA 3STUA 3OCZA 1BC5A 5ES3A 4G6ZA 1L8OA 2BJVA 3ZV3A 4DM3A 4EY6A 3DXXA 3LUDA 4ND7A 4L74A 4N5HX 1C1HA 3IJPA 4JLWA 4PSCA 3SZUA 4KQ1A 2V3CC 2DBRA 3OBIA 1BKDR 1Y1QA 4OIFA 4M3NA 1B7GO 5L7WA 3VV3A 1WWKA 2KWIA 4IIBA 4C20A 1QF9A 5DGIA 3TZQA 2C8JA 3RKSA 4AJ4A 2G28A 5GGYA 3B3FA 4LOLA 3QX7A 2DTEA 3PCTA 4LMRA 1D4OA 1HI9A 2P75A 5FYDA 5BOSA 1F14A 2GCOA 3NTUA 4X3CA 3WOHA 5LQMA 3HM9A 3PD0A 1J0DA 1G55A 3ZBTA 1T36A 1FYVA 1HZZA 1S5PA 1H4VB 1UP7A 3HADA 4GWKA 1XLWA 2POQX 1SELA 3C3AA 3RI3A 4F0JA 1G5TA 4AKIA 3F2VA 5A5DA 4DJDC 1QDUA 4QO8A 1KSGA 3IIJA 5LQDA 1KMNA 3EHEA 4CIWA 1Y7LA 5JH7F 4UTXA 2D3TA 2L8NA 1Z0DA 2WKQA 1DKRA 3HSYA 4OM7A 4UBKA 5LXTF 1K8ZB 1HTTA 5E3HA 2RE8A 1QKKA 2LIPA 4MUBA 1A5SB 3A1VA 1ZRMA 1EX7A 1TEHA 1O6CA 3JASA 4HAXA 3Q3EA 1W6RA 1CU1A 4LXXA 1YI0A 6CHYA 5IH3A 1SG0A 3H1BA 3TX6A 1RXWA 2FWIA 2AW5A 1DIHA 1E9VA 1H66A 4N5MA 1X1QA 5IVDA 3QXXA 4CF7A 1MB9A 1QK5A 1SBCA 1J9GA 1WUJS 1XTQA 3E9RA 4WSOA 3UWPA 5DHPA 1AUOA 2B9EA 4X65B 1EVLA 4G0PA 3UFXB 1F38A 1V7CA 3W90A 1P0FA 3OQOA 1FQJA 2CLFB 2GNPA 1II0A 4RD3A 1Z28A 1Z3IX 3ZX4A 3CLCA 3ZKAA 1W25A 2PXXA 1U9JA 4RD0A 3JQ7A 2QXYA 3IHWA 2XUIA 4R6WA 4XUGB 3VU9B 5HKKD 2AW3A 2VUIB 4B6FA 1Z6ZA 3RS2A 3IP1A 4D6XA 4IPTA 2ORIA 4WMLA 3L43A 2ZK7A 5EHIA 3TPFA 4CTKA 1COZA 1UP6A 2RJOA 1I5RA 4AICA 3GEIA 3AJDA 1D2GA 1F8FA 3QVOA 3IESA 3QEMA 3TZKA 3L1PA 1QYIA 4H1UA 4E1VA 2O3RA 3WLRA 1G9XA 2OE2A 3NT4A 1VTKA 1PJAA 1SOMA 3DMTA 3EK2A 2QMOA 1OZFA 3B7WA 1QE0A 3FTCA 4QOGA 3M2TA 4B71A 5ERXA 4YMUA 4Z5DA 2GEBA 4FFMA 4FCWA 2A3RA 2C5AA 3LK6A 1KMIY 4KQ2A 5EJ2A 2HLDA 4U8HA 1NMZA 3HK2A 3BILA 4UTRA 5I8PA 2Y1GA 1CZLA 4TVOA 1RPEL 4J1XA 1RI3A 2DKNA 2C03A 2R96A 3G8YA 4D99A 1M54A 2HBRA 2QGZA 2Z6VA 4W1SA 5HDQA 3RSFA 2C2HA 3W1EA 5B57C 4NPAA 1UR5A 4G41A 4YCJA 1UBFA 2OESA 1M8KA 1SUPA 3I32A 4FYVA 1WABA 3TEMA 3HVJA 4AN1A 9LDBA 3VJRA 4GQMA 1KDPA 3ADKA 3GZ4A 3IUQA 3OIYA 4Q4HA 4EPVA 1N0VC 2GVNA 4G63A 2P9QA 2VHTA 5ICGA 2YV4A 5I4KA 4DN6A 1PWYE 3IUBA 1PDWA 2VF8A 3C5WP 3T94A 1V2HE 2GZ3A 1WZEA 3LLSA 2Q3DA 1K8RA 1M2NA 1BD3A 4N18A 4YJHA 1GNPA 1ZJYA 2XEXA 4ESHA 2J67A 5A9SB 1JLMA 4F2PA 1P7PA 2BFBB 1N8TA 2QPTA 3W5BA 5TF4A 1Y4ZA 2DR0A 4PC7A 4XD7A 4EEXA 1MFZA 1CX9B 1CJVC 1FS5A 3GDHA 1PTJC 4XRGA 5B58C 4Y2PA 5LJLA 2W0SA 4W5RA 3SNKA 3WKDA 2QRPA 2E18A 4IOMA 2HBZA 5LLSA 5JCJA 1T5TA 2ODPA 4DLNA 2JEOA 3FPSA 1LPBB 5C37A 4R84A 2GA8A 4A8HA 1U1GA 3STVA 4JYZA 5M34A 1MAWA 2FHPA 1LCCA 2BHTA 3QPUA 1G3UA 3HU3A 3VR5A 4BQSA 1PL7A 2I1VB 2C9YA 3W2GA 1IPFA 4MNTA 1JLLA 3GRPA 1XTUA 3AMVA 2CFRA 4NXMB 1SZJG 1TZBA 2IE0A 1WXFA 3HVIA 2IHZA 2KEIA 1TMOA 3LUJA 1EJ2A 3JQBC 1JLLB 4MS1A 1F5NA 3AILA 4NESA 3GLFE 4Q4JB 2GCEA 4QRIA 2QRJA 3GD5A 3AOEC 1GPLA 1CVLA 1MJ5A 2DUUA 2VYND 3HNOA 3PNBA 1IHXA 2ZIFA 3ESBA 4X5OA 1PQPA 5MN5A 4Z0PA 5DXJA 2GZRA 3BBPA 3ZHSA 1JFTA 3NBQA 3UGTA 4HGPA 1DJMA 1T2AA 5DN6D 5DI3B 3VK0A 5TB5A 3K9WA 1M7GA 1XTSA 3AM1A 5AM3A 3OP9A 2A88A 2JJ2A 2OGTA 2X3UA 4PPGA 5HIAA 1BIFA 1TW2A 5DYTA 5JCZA 1XALA 1TU3A 2VNJA 3CC8A 5CNIA 3KKLA 4QSHA 3V1MA 3JR3A 1R5JA 1TQHA 2VPQA 4B83A 3OWQA 2A9KA 5EIWA 1U2PA 2ZBDA 2UZAA 3BAFA 4K9PA 3DDCA 3HKEA 5L51A 4F2DA 2ONYA 1NRIA 1I13A 1VKHA 2D3WA 4TMWA 1YIAA 1SU8A 2OGZA 2QMUA 3DDHA 4AT1A 3RYFB 3AI1A 3PG5A 3O4RA 4ICIA </