4EKIA

Crystal structure of dot1l in complex with epz004777
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
319
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 96
structure length 319
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ekiA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ekiA02
2WK1A 3K6RA 5F2KA 1NW8A 3OZSA 3AY0A 3THRA 4RTLA 4C4AA 4C08A 9MHTA 3G88A 4ATNA 3HCCA 1HNNA 1INLA 3FPGA 3LX6A 3AXSA 3HA3A 4RVDA 1AV6A 2BZGA 3SR4A 3BWBA 1NBIA 3FPFA 2OPBA 3JWIA 4GF5A 5K01A 2G72A 3CJQA 5KS2A 5KYGA 3O7WA 4RTOA 2IBTA 4ER6A 3GRUA 3HCAA 2PXAA 5C9ZA 2ZVJA 4A6DA 3HA7A 3LBYA 2Z6UA 2YQZA 2F8LA 3NJRA 3SX0A 3DMGA 3P2KA 5DTRA 4ER7A 1HMYA 3QOXA 1L9KA 4E2WA 2C7QA 2PGXA 4YUXA 4B17A 5CIYA 3KQMA 1RJFA 3EGVA 2E5WA 4LWPA 1X1AA 3CCFA 3P9NA 4PWYA 1JG2A 2BM8A 1KYWA 3B3FA 3MHTA 2ADMA 1KPGA 4OA8A 3MQ2A 4E33A 3MB5A 1SVUA 3O4FA 1NW6A 4PYQA 5HIKA 4RX1A 3FUWA 3R0QA 4WXHA 2JH8A 5FHQA 5D1HA 4QDJA 5EG5A 1YFJA 3OE4A 1L3IA 1KPHA 2UYCA 3M70A 2GB4A 1XJ5A 3AXTA 2P3QA 2BM9A 4P7JA 4YMGA 1ZHFA 5K8VA 5GINE 3KPJA 2AS0A 3UJCA 3ER9A 3KR9A 1XXLA 3GO4A 3M6WA 3GRVA 5K03A 3LBFA 5E8RA 3FTCA 1XDUA 4RWZA 2ZW9A 3HP7A 2VZ9A 1JTEA 5CCBA 3EVGA 4DQ0A 4BLUA 4DCMA 3C6MA 1RJEA 3LL7A 4YUWA 1G6Q1 1SUSA 1EJ6A 3DXXA 4KDCA 3KQOA 4JXJA 1WY7A 4R6WA 1EIZA 1NW3A 1EG2A 3GRRA 5CCXA 4E32A 3E23A 2QY6A 4QVGA 3A26A 4GOOD 4RV9A 5CM2Z 3VYWA 3C6KA 5CVDA 3FRIA 3OZRA 3UZUA 4DM3A 3G5TA 2K4MA 1VL5A 2QRVA 1RI3A 3FUVA 2CMHA 3G89A 5E9WA 1P91A 3V8VA 1IY9A 5EPEA 5LQRA 2ZTHA 1QAQA 3P9IA 5DSXA 1WS6A 2B78A 2GLUA 3ID6C 3JWJA 5T6BA 5ICEA 1WG8A 3SSOA 1FP2A 4PCAA 3P97A 3PT9A 1D2CA 4M36A 1JG1A 4PYOA 3LDGA 5DTQA 2OZVA 4X63A 5KQSA 5EMKA 3GU3A 4DMGA 4IKPA 3E8SA 3TKYA 4CWAA 1ORIA 3LECA 5CD1A 1BHJA 1X1BA 5E2BA 3EVBA 3I5UA 1ORHA 2PVCA 3MAGA 1YZHA 4FT4A 1EJ0A 2VDVE 3G7UA 3GIWA 2IIPA 3ELWA 2PX2A 3GWZA 4GC5A 1EAMA 3KQQA 5LR6A 5DM1A 2O06A 4CKEA 1D2GA 5EMJA 2LD4A 2YX1A 3BZBA 3KR2A 5EHGA 1F3LA 1G60A 5U4XA 2PX5A 1X1DA 2IPXA 4QVKA 4F85A 4U7PB 3BXOA 3PVCA 4PGGA 5EEGA 4BLWA 1YF3A 2JH9A 4GOMD 2IH2A 2ZIEA 4RTKA 2P8JA 2ERCA 2IBSA 5GIOE 2CWWA 3M6XA 3TQSA 4PNEA 4RVFA 3TFWA 3QOWA 3F4KA 3CKKA 5EC8A 3NW9A 3A7EA 3P71T 1I9GA 4ER5A 1G55A 2PWPA 4O29A 2ZULA 5E1OA 3SVZA 3THSA 3KQVA 4AUKA 3HVJA 4RVGA 1G8AA 2YXEA 4KIFA 4PIPA 3SGLA 4A6EA 2GS9A 3DXZA 3UJ6A 3UJDA 2PX8A 1D2HA 1DL5A 3PB3A 2Y1WA 2IH4A 2HNKA 5F2NA 4HRAA 1QYRA 2HV9A 2IDKA 3NDJA 3PFGA 5FUBA 3LGAA 2Z6QA 4CKCA 2G1PA 1M6EX 3CJRA 3T7RA 1ZGAA 3DTNA 4GEKA 5FADA 1AF7A 5T64A 2I9KA 2QRVB 5E9QA 4Y2HA 4U7TB 4GOND 4DKJA 2AVDA 3LDUA 2AOUA 2P1DA 3HM2A 3MTIA 1V39A 4FSXA 3SM3A 2C7PA 3FRHA 3GJYA 3Q7EA 2XYVA 3ORHA 2EJTA 3NWBA 2PLWA 5HEKA 1B42A 3TRKA 2HTEA 5KQRA 3HVKA 3Q87B 5MHTA 2NYUA 5ICCA 2PXCA 3REOA 4FZVA 3FTFA 2O57A 2JHAA 2P7HA 3DULA 3P2EA 5GIPE 4EKIA 1YB2A 3FUTA 3FPJA 3KPUA 4OBWA 1BKYA 3G5LA 5DSTA 5EVJA 2ONZA 1TW2A 1JQEA 4EMSA 4F84A 5K0BA 4QPNA 1NW5A 3I58A 4E2ZA 4YV2A 2NP6A 3E05A 3SMQA 1QANA 3EMDA 2OYRA 1TW3A 2GA9A 2QE6A 3FUUA 4LECA 5FQOA 2IGTA 4YMHA 5LQNA 1NW7A 3OFJA 5EOVA 4POOA 2YTZA 3T7SA 3NVKI 3G2QA 3G2PA 4E70A 5K0GA 4M38A 1Z3CA 2PXXA 5ICFA 3M33A 1Q0SA 4HC4A 2EX4A 3OE5A 3BUSA 5KVAA 4Z2YA 2NXCA 5JR3A 3CVOA 3EVAA 2OY0A 3LDFA 5FA8A 5HOQA 1QAOA 4DA4A 3HCFA 5C1IA 4PYNA 5DT2A 4MQ4A 3KQTA 5FQNA 3OFKA 4FS8A 4MIKA 2AOTA 3GCZA 2CMGA 2I6GA 1N2XA 2AOWA 1VP3A 2O05A 3RW9A 3A7DA 2R3SA 3TOSA 4MWZA 3UJ9A 2V74B 2XYQA 2YXDA 4PCLA 3HCDA 2P3OA 2AVNA 2AOTB 4QQKA 1M6YA 2AN4A 3EVZA 3FYCA 4XUEA 5E1MA 3ERCA 2AZTA 3MCTA 5P8WA 1I4WA 3R24A 3VC2A 1RJDA 2P3LA 1NV8A 3CJTA 3DUWA 2ZCJA 1KPIA 2FK8A 3NTVA 4C05A 5H02A 2ZSUA 2XBMA 1JTFA 5E9JA 1X19A 5B1SA 4YUYA 2KW5A 4AZVA 5EMMA 3MCZA 2H1RA 2C7RA 1KP9A 2JHPA 2A14A 2R6ZA 2ZBPA 1P1BA 2I62A 1T43A 2P40A 4LWOA 2YXLA 3ER8A 1L3BA 3EVDA 1JQDA 3LKDA 3U81A 4RTJA 5DPMA 3BKWA 4KDRA 4X41A 1BOOA 2PT6A 3DH0A 3DMFA 5LQJA 3GRYA 3VC1A 3P8ZA 4R6XA 1AQIA 2JJQA 3RIEA 5DWQA 1R18A 4BP3A 4X1OA 1N7JA 2JHCA 1U2ZA 5HZMA 4QDKA 1AQJA 5BW5A 1NBHA 1JQ3A 2VDUE 1KHHA 3X0DA 3UA4A 3DP7A 3EVCA 4IV8A 5EMLA 1JSXA 1G38A 5E1DA 1L3CA 3FPHA 1XVAA 2AOUB 2V7EA 1WZNA 5CVJA 2B2CA 5IH3A 1JG3A 3HCEA 4PYKA 1PJZA 2FK7A 1EQAA 3KR0A 4GQBA 5FCDA 1ZG3A 1R8XA 2YVLA 3LPMA 3UFBA 5DLYA 3IEIA 3HA5A 1M0EA 2ZZKA 3ELUA 3M6UA 5CUQA 1UIRA 3GGDA 5D1NA 4PIMA 1DCTA 4YV0A 2Z6AA 2NNWB 3M4XA 2ONYA 3BGVA 4G56A 2FRXA 3KQYA 2QYOA 1RJGA 3C0KA 4FR0A 4EQZA 1YZ3A 3DOUA 1NKVA 2WA1A 3ELYA 3UBTA 4BY9E 2OKCA 3TMAA 5BW4A 3NDIA 1RI5A 4QPPA 4RSRA 3CGGA 4PGHA 5GM2A 2OXTA 2BR3A 4HTFB 1SKMA 3BKXA 2PWYA 3L8DA 2BH2A 5FHRA 3EPPA 3I53A 4E2YA 2PKWA 3LCVB 2AOXA 5LQCA 2BR4A 2NXEA 1TPYA 2G70A 2O0LA 3V97A 2ZBQA 2CL5A 1FPQA 3FYDA 1RI1A 5F2OA 3KHKA 1F38A 3LKZA 4ER3A 2UYHA 1ZKDA 5IKMA 2Y1XA 2FPOA 3UWPA 3EMBA 3G2OA 3PLAE 2DULA 8MHTA 3VSEA 1O9HA 2YUIA 4PYJA 1SQFA 1N7IA 3B3GA 2CKDA 5FTWA 4XUCA 3UJ8A 1YFLA 4QTTB 1VLMA 3TM5A 4UOEA 3C3PA 5HIJA 4NECA 3BT7A 4C03A 2EG5A 2ZZMA 4DCGA 5K05A 2ZBRA 4ISCA 5DX0A 4IWNA 5K0FA 3HTXA 3TR6A 2QM3A 5G02A 4BLVA 5EHIA 4OA5A 3EGIA 3SXJA 5HIIA 1SG9A 5EKXA 2VP3A 2H11A 2YR0A 4AZWA 2Q41A 4PINA 5HILA 2GPYA 3G8BA 3M6VA 4Y30A 3P9CA 1R00A 2PV0A 4XCXA 5C0OE 2VDWA 4PYLA 4QTUB 2IDJA 3PX3A 2FYTA 4RVHA 1Y8CA 3CBGA 4YUVA 3R9XB 4L7VA 4ER0A 2ESRA 3A4TA 3KPWA 4KIGA 3KQPA 1VIDA 1FBNA 1ZGJA 2B9EA 2AR0A 5FWDA 1KYZA 1R74A 2PT9A 3KKZA 4CXMA 5DRYA 1SUIA 3DR5A 3QV2A 5LQUA 2AOVA 1KXZA 2VS1A 2G8NA 4DF3A 2G71A 3H2BA 3FTDA 1NE2A 2ZWVA 5EKUA 4R8SA 4XUDA 5E2AA 3IYLW 3A27A 3DMHA 2UZ4A 1MHTA 4GUAA 5GP1A 4ZTBA 4AZTA 1XDSA 2PSSA 3P2IA 5FULA 3HEMA 4RTQA 3BWYA 4P7GA 2C7OA 2P35A 3OU6A 3C3YA 2HMYB 3FZGA 4PONA 3NMUF 1O54A 2ZZNA 2DPMA 1I1NA 1JG4A 3HVHA 1L1EA 2N47A 3GRZA 4GBED 4P7FA 4RTPA 4X61A 4KW7A 3JWHA 3O31A 5DM0A 3R6TA 4RTSA 3T7TA 3ME5A 4OBXA 3BWMA 2JG3A 2IP2A 3ELDA 2ORED 3PS9A 4M7RA 1QAMA 3SSMA 4CTKA 3KR1A 3BGIA 4BP1A 2NXJA 4V0RA 4AX8A 1IM8A 3TLJA 3DXYA 4YUZA 3RODA 5K0CA 5EIWA 5K0EA 2WA2A 5ERGB 3IV6A 3ANXA 3D2LA 3UA3A 3EEOA 2PBFA 2BR5A 5BXYA 4PYIA 1R6AA 3I64A 4YV1A 1KIAA 1NV9A 3E7PA 3B3JA 2IH5A 1QZZA 3EEYA 4MHTA 1WXXA 5CVVA 4E30A 2HR1A 3GNLA 3GXOA 2ZIGA 3BGDA 5K0LA 1XCLA 5E8JA 5JUWA 4CKBA 3TPZA 3BWCA 5FA5A 3FTEA 2OB1A 4RYLA 4E2XA 2AN3A 3SSNA 5EEHA 4RTRA 5CVEA 3P9KA 1UFKA 2OO3A 1RI4A 3HVIA 4HTFA 5CVUA 5LQAA 5EGSA 4RTMA 10MHA 2H00A 4V0QA 4OQDA 3TM4A 2IFTA 2ZFUA 1ZQ9A 4R8RA 3NVMB 5GWXA 3TKAA 5EQJB 7MHTA 1VPTA 2AN5A 2UYQA 5DM4A 4EKGA 4P58A 1MJFA 3A25A 3OZTA 4HG2A 3PX2A 1P39A 2UYOA 2XVMA 3R3HA 1G8SA 4R05A 1FJXA 1UWVA 3G2MA 4KRGA 3EVEA 2FHPA 5K0NA 3JWGA 3KQWA 4RTNA 1JSZA 2B25A 2B3TA 2OB2A 3B89A 1SQGA 3DLCA 1BC5A 1KR5A 2I7CA 5EZQA 5BP7A 3LCUA 4GC9A 2HWKA 5DX8A 3NWEA 4HSGA 4P7KA 3AWIA 1Q0TA 1VQ1A 3MTEA 5K0JA 5DXAA 1P1CA 4K6MA 5K09A 2P41A 3UJBA 4EK9A 3PTAA 4OQEA 1VBFA 1YUBA 3OCJA 4C06A 5DTMA 3UJAA 5E1BA 3B7PA 2GAFA 3G8AA 5EIFA 5ICGA 5HFJA 3KQSA 3KPYA 1VE3A 3S68A 3WSTA 4HGZA 5DRTA 2NP7A 3LHDA 1OR8A 3OU2A 1H1DA 1VP9A 4FSDA 5LQKA 3EGEA 3MERA 4EVIA 4PYMA 1XCJA 3KU1A 1FP1D 2PY6A 1JR4A 2EJUA 2O07A 2ZIFA 3B5IA 5DX1A 4FT2A 1PRYA 2XVAA 2FCAA 3LCCA 4FP9A 5T67A 4KWCA 4FGZA 4IV0A 5GOZA 3IHTA 5DXJA 1DUSA 4HH4A 1XTPA 4C07A 4HGYA 4KVZA 3HNRA 4MTLA 4E31A 2ZWAA 3MGGA 4H0NA 3K0BA 4X60A 3PFHA 4QQNA 3LSTA 2ZLBA 4CTJA 2XYRA 3I9FA 5EZSA 4C04A 1RI2A 5LSAA 2PJDA 4DZRA 5DM2A 1R8YA 3FUXA 4GOLD 4OX9Y 1O9GA 2NXNA 3OU7A 4LG1A 3DLIA 5M5BA 4M37A 2GH1A 3FPEA 3T0IA 3CC8A 1WXWA 3EVFA 1IXKA 3UJ7A 1X1CA 2PX4A 1NT2A 1XDZA 2EFJA 2OBFA 3GDHA 3KPVA 3AJDA 3OPNA 5GM1A 4F86A 4AZSA 3HCBA 5FWAA 2P7IA 4WVLA 5HIMA
chains in the Genus database with same CATH superfamily
3K6RA 2VFAA 3EUAA 2Z6VA 4ENPA 2ZIVB 4DCPA 4EO7A 1HBJA 2B1IA 4QU9A 9MHTA 2I4RA 5B6JA 3HCCA 2EHJA 2P75A 4BV2A 3CRQA 4DTIA 5I7VA 2NGRA 4RVDA 3HXOA 1G5IA 1XZLA 1PRUA 2BZ1A 2ZSBA 3GC6A 3K5PA 2P65A 3BSSA 4O5OA 2O38A 4ZVTA 2OMKA 3O1IC 1E5LA 3KVNA 2Z8XA 3BIWA 2OV1A 3HN2A 3OC0A 2HGSA 2R4TA 4ZOQI 1SIOA 1TCUA 1DXQA 3R5XA 4LSZA 3WR5A 2B8NA 5C9ZA 5JRZA 1T3HA 3MWYW 1PWEA 4KVGA 4LMAA 4Q9HA 3S1LA 3SJCA 5LFAA 1JIKA 4GM1A 4TYPA 2O50A 5K20A 4A6PA 1KO4A 1IDN1 2O0HA 3DDUA 4D6YA 1RJFA 1RR6A 1CEXA 1VFNA 2YOHA 5JAIA 3QXJA 5BSKA 1I7DA 2PGOA 2N46A 1TA0A 3RPEA 2LNDA 3BB3A 3VYVA 2Q9AA 2Y4OA 1PFUA 3EXHB 4HDRB 3WGIA 1REQB 3MJCA 4B32A 4H1WA 4V1CI 3E61A 5CA0B 1MTZA 3U3DA 1K1EA 4YDHB 2ZWMA 1J6UA 4L0MA 4J7XA 2RHBA 2XB4A 3ZHZA 5J4HA 4NZNA 2EQ5A 4X0EA 1WKCA 2OP0A 3I2GA 4E4YA 2NN3C 3FTNA 4KXUA 3HRHA 4N3AA 3U62A 1I3MA 2EGHA 5I5GA 3ZVRA 5K8VA 1XI2A 2YWDA 3GFQA 1KNQA 4Q0MA 3EY9A 5C4IA 4MIEA 3M6WA 4IM7A 3WQRA 3ET5A 4FYWA 2C77A 4BFCA 1CRWG 1VECA 3UMMA 1YHYA 3PU6A 3ZTYA 5A9RA 2X42A 3IBTA 1JTEA 4M1ZA 4HXGA 4RA6A 4RMGA 3LCRA 1R9NA 3VHRA 4DCMA 4YG7B 1RFGE 1YR2A 1M2FA 4URYR 2PT5A 1NF9A 4CW7A 5LQSA 1OXXK 4I19A 4ECAA 4I9FA 1E92A 2I7VA 5FNVF 4XR4A 3WL4A 1TZJA 5IUJC 4KR7A 3PJGA 4FQ5A 4CIAA 2FUEA 5JZBA 4D0SA 2VJPA 1ZH6A 4PHCA 3G89A 3IIJA 4J43A 4JEUA 2A9RA 2OZLB 3AF5A 4MV8A 2HLHA 2LPMA 4X84A 5CK4A 1PNRA 5FV7A 4DA7A 5LQRA 2ENUA 4RNCA 2XQVA 3GFFA 4YG4A 2P2SA 5BNTA 1SVKA 5C32A 3LTNC 3JQBA 1ADFA 4P33A 5AJHA 1ZX1A 1OFUA 5CR9A 1QZUA 4D9IA 1VE7A 5SZJA 1R2QA 1YOBA 4EG6A 1DSSG 5A3RA 2BWJA 5K6AA 4ARUA 3GEDA 4KMMA 1L7EA 4JBHA 1DXYA 1J5EB 2XGMA 2C9MA 3BMOB 1WB4A 3NHWA 3O8LA 4BASA 4BNVA 4YEDA 5AVWA 3E3MA 4R9SA 1N9GA 3H97A 5E2BA 3LK7A 1Z17A 2ODRD 5A7HA 5H70A 4ZT6A 5JROA 1EJ0A 3O82A 3GWZA 4P34A 2UUOA 5IM5A 4CKXA 4GC5A 1SVOA 4JQCA 3IE1A 2FEWB 2JJ1D 1QPGA 2GD0A 2DUUA 2NT3A 4M89A 4NU6A 1JH8A 1GPDG 4PHTA 5ADWA 3QEKA 1S1MA 5FTNA 3GT4A 2HHJA 3SQWA 1YF3A 2BKAA 3EZLA 1ZU4A 3OIFA 2P8JA 3GD5A 3QFTA 1YI0A 4KLCA 3TQSA 3WKAA 4NCHA 1NAHA 4R2JA 2Y71A 2NU7A 1R6BX 3I9MA 2X0DA 1KWKA 1MO6A 5C4GB 1IJEA 2ZULA 5D85A 3THSA 1RRGA 2MQKA 3R5FA 4I55B 1GQ2A 5FF9A 5AJVB 4PO3X 3T9DA 4BV3A 2Q6TA 4QFCA 5GGYA 2YVAA 5FI3A 1T9KA 1WQ1R 2Q3JA 3I45A 3NBXX 4JLJA 3U80A 2I6XA 5I01A 3MPUA 4EVRA 2HQOA 1GG9A 1X80A 4Y1FA 5DT9A 5T8KA 1B8NA 2BELA 5BWNA 2ZRBA 2JK0A 2W2NA 4H6PA 1VIAA 3NIGB 4IIJF 4UCQA 3QLVA 5FUBA 3E3NA 3FVRA 4EFDA 2B99A 2GPNA 4JLNA 2GXAA 3HKCA 2F43B 4AS3A 2TECE 4X44A 2IUUA 1B2LA 2QTHA 5DV9A 4BO8A 1O95A 1ZH0A 1AUXA 2QA5A 4RHTA 1PU2A 2JJ2A 2ODWA 1P2SA 2G08A 4FZ5A 2R68A 4ZQGA 5AI6A 3FI9A 3NXSA 4FUTA 2QHXA 5CIWA 2W2TA 2WI8A 4LFAB 4XLLA 3C3AA 2FPGA 5MHTA 1B42A 3VBCA 2ZE7A 4V0ME 2JGDA 3VBEA 3ESDA 4YDSA 4TTSA 1P7PA 4BZPA 2DHQA 2C5LA 2Y1LA 5P21A 1FYVA 1U3WA 4DJDC 5AJUA 3FHJA 2C1ZA 3DULA 4GLOA 2F6RA 4KX5A 1VHWA 4MV4A 3BE8A 5ECDA 3SS8A 1IXYA 4A0QA 2HPVA 3D9QX 2EDAA 3OOEA 1ZUHA 1YULA 5DSTA 4QVIA 1OA1A 4URWR 1DCMA 1RRFA 5EZ5A 3W9UA 4ANFA 4MQEA 2H1HA 3F4BA 4FFSA 5DP1A 1W73A 4Z51A 5F2EA 1ZJYA 3BMOA 4W5QA 2QE6A 3FUUA 3VPDA 1VCHA 3EODA 1KI6B 3OE7D 3VHLB 1GN9A 1PSWA 2BFOA 2FLVA 3Q9NA 3JWPA 1E99A 1XVIA 3W5VA 1KEPA 3JQBC 3MGKA 4DG8A 2PXXA 1OGYA 4HFMA 4YRLA 1J5PA 1F5SA 4B3CA 2YY7A 3TNJA 1A4RA 2J0SA 5FWXA 1FXSA 4BMPB 3NBZC 1XU4A 1KBQA 3LDFA 4AMYA 4EITA 1E0DA 1CULC 2CLCX 5JSHA 2B2XA 4I66A 2J5KA 3OAAD 2I3BA 3GCZA 4MUNA 4D4MA 4EYGA 1NNUA 2PUTA 2JFVA 4ZCSA 4DEVA 3E4CA 5ES4B 4BIMA 3OX1A 3LUPA 2JDIA 1A7AA 2RGCA 4F5WA 1XYVA 2HWYA 3PC6A 5E1MA 1BZYA 2I5PO 3RYFB 1IL0A 2H1FA 3C4VA 1Z7WA 5D3QA 3EA5A 3KKEA 4QICA 2OZLA 2XWQA 2D3WA 1CE8A 1TCBA 2WWVD 2FJPA 1J9ZA 1C7IA 3F6RA 3MWFA 3QVXA 5K4HA 3FLEA 1X19A 4NCBA 4B8YA 2H1RA 4IQFA 2YXPX 4C14A 3O74A 4V2IA 5KTNA 3OVMA 1QHIA 4PO8A 4KPYA 4LWOA 3WLSA 2A1TS 1M2EA 2YQ4A 4YAOA 3C41J 2PLFA 4JR1A 5JBNA 1K63A 4N5LA 3PWZA 3WLNA 1VBKA 2EBFX 3BKWA 2C84A 3RYIA 4QG3A 4BX8A 5HCNA 2HDHA 2IZ0A 2B6HA 2B1GA 1E3EA 1KDPA 1X0XA 5HFNA 2OCBA 4US2R 4YR9A 1LI5A 4QOGA 1MR3F 2BE7A 3F5SA 1MGOA 3RIEA 3BIFA 4DA9A 4CM8B 5TIIA 2XKJE 4CR6A 3ZHQA 1VG9B 2YV2A 3QTLA 1DEHA 1RHUA 1NBHA 1I5EA 2VRWA 3TD2A 1DBVO 5KYYA 1G38A 2R7AA 3LQYA 4DSTA 3GRCA 4BLTA 2J85A 2KYRA 1O58A 3GJZA 1QS0A 3QSGA 3U0VA 1ISRA 3HCEA 1FMFA 1PJZA 4OGFA 3KFVA 1BN7A 4UDYX 4AJ9A 2Y1KA 1GUAA 3EXHA 1V0JA 2IHVA 3DONA 3OIGA 3CX3A 3Q0IA 3QP9A 1QOZA 3CO5A 1YV9A 2W42A 1GTSA 1B6TA 3FR7A 4MV6A 4EQZA 1C7FA 1TI7A 1BG6A 3NBMA 4QXAA 1TJ4A 1U8ZA 4WCFC 1J2YA 1ORWA 5GM2A 1KY5A 4B1FA 4NMXB 1HZZC 1PRAA 1JDJA 3E2IA 5FHRA 4M8IA 3PC7A 3RAPR 3UM9A 3UT0A 5CFZA 3ERCA 2IYAA 1CUFA 1YZQA 4N39A 3EBPA 3ZQ4A 1KVSA 1P33A 1STOA 4K28A 4D5EA 3KC2A 2OBLA 3DMTC 2YZ7A 1SBZA 3GIDA 3C6QA 4IZIA 4L8VA 5AKHA 2ZETA 3W7BA 2QUKA 3UOAB 5SYMA 3IH5A 4AAYA 1LNQA 2DBZA 3H7IA 5LNK1 4QREA 3B1WA 3DAYA 1TB4A 2J5XA 3H8VA 1E1CA 3N86A 4YMWA 4QUKA 5AVVA 4KITB 4EMUA 2C31A 1E6CA 3MS2A 2WIDA 2E85A 4LY0A 3B6JA 1A9XA 1QO9A 2ZBRA 5BV1A 1RAEA 2HB6A 1AGYA 4XARA 5F64A 5LUBA 1A88A 3LZDA 2X2OA 3HSYA 4IDCA 5ADVA 2B7BA 1BAPA 4EA7A 2UUAB 1GAEO 4ZQEA 4P31A 2Q41A 4JA0A 2PXFA 2KLHA 1BE0A 1PRVA 1NLZA 2I2AA 3V00A 5BW6B 3CVWA 2OA0A 4ZHQF 4PYLA 1D7OA 2X7JA 2QDXA 1JAYA 4L7VA 2CHUA 4A2QA 3C6ZA 2VC2B 4KK3A 3UAZA 4P81A 1VIDA 2AW3A 4AKEA 3PK0A 1BKDR 1P1HA 1T3SA 2QM7A 4GR5A 4KXFB 3K6JA 2CXNA 3ZJTA 4G01B 4BRWA 3HDYA 1VKOA 1R6VA 4LRWA 2FWBA 4NYIQ 3SC4A 3X2FA 3CH5A 2QRPA 4ZTBA 4E3WA 4LNHA 1R4NB 1SKQA 2ID4A 4HB3A 4IPTA 4JNCA 4F2HA 3BWYA 1ZXLA 3L3BA 1GYPA 2SCUA 3FDZB 3CUKA 1CY6A 1ZMRA 2FWPA 1NUQA 4LYAA 2QTRA 3DTYA 3N87A 2BFFA 4AVYA 1Q7EA 2ZJ1A 5KZMB 1RBZA 5FOWA 4DLVA 1H2RS 3PWKA 5HFAA 3UYLA 2H1VA 3KAQA 4V0MA 1NRIA 1N0WA 2AGVA 2QLMA 1KFBB 1UBHS 1WPXA 4H3SA 4UHFA 4CKWB 1EESA 1SWVA 1FQKA 2J33A 2ZBEA 3D4OA 3PQ5A 2DX7A 3WX0A 1M1UA 3KFLA 3RODA 4ZMRA 1YJAA 5JSUA 3T5DA 1L5HA 4S1WA 4OMCA 1TRKA 2PBFA 1ABFA 3O8QB 4LQDA 3TLXA 5DM60 1HG0A 1G7RA 4BQEA 4KFSA 5F7XA 3EEYA 4TYWA 4GE3A 4KO2S 5JSZA 2AUNA 3QE0A 4LOHA 5DK4A 1XZ8A 4KTTE 1F8FA 2ZWPA 2VNAA 4BX3A 1C7JA 5J4YA 1E9CA 5KYKA 2Z2JA 1SCBA 1NN5A 5K0LA 5JUWA 4YBAA 2FW7A 1GAJA 4DGSA 4ZDWA 1RM4A 1D4AA 3L6OO 3R09A 3ECAA 2PUCA 1WDTA 2NU6A 1FS5A 3R5HA 1RI4A 3GLQA 3VR5A 5HZGA 1Z75A 1C0LA 1W25A 4YCAA 1DDOA 3HDQA 2IFTA 2VTKA 3IQIX 2VSOA 1UDXA 3PUZA 2IPNA 2NYAA 2BF4A 2HO4A 4DR2B 1ZN2A 2O1WA 3ZGNA 4YMTA 1KFJB 1W52X 2IHJA 2LKDA 3OZTA 1T5BA 4U2CA 1UKZA 1IMOA 4WZBA 2VDWB 2XDWA 5BN3B 1CJVC 1A9YA 4U1RA 5WRFA 2Z2YA 2UDPA 3Q7SA 2ZYDA 2QXYA 4TTTS 1PLLA 3AKEA 3RYHA 3ADCA 2O7RA 2GAOA 1XD2A 2GERA 2FEPA 3RTGA 1OSNA 4YRFA 5BSHA 3C5WP 4LV6A 1SQGA 2QK4A 2TRSB 4MR7B 4YAWA 5AM1A 2RJ3A 5FBHA 4P22A 1BDIA 4QGSA 1FRNA 1G42A 1R66A 1XXHA 4X1IB 5BP7A 3ZNOA 3TIFA 3EA4A 3SC6A 4LSMA 2GZUA 2K7ZA 4ZI7A 5HF9A 4L4YA 3ZKCA 4DFDA 1T6YA 1KQ3A 4Y8VA 1D04A 1R0SA 1Z47A 3AWIA 4XIGS 1R0YA 1VQ1A 3OZEA 3LISA 1TAHA 2VNIA 3ZV6A 5DXAA 2XITA 3H5RA 4BMVA 4O4HB 4GP7A 4N7RA 2IIBA 4BX2A 4BC0A 5IXYA 3WZ2A 2JVLA 2P41A 3UH1A 1JXMA 2B1JA 4POAA 4RQAA 4Y2VA 1NPDA 2RHCA 3QVTA 4MSUA 1I2MA 1SUBA 2Q5OA 3JZMA 3ZQKA 1M8KA 1BA2A 2Q0QA 1RM3A 3IDOA 2QG9A 3OIWA 4Q9DA 3SS9X 4YRSA 3GDWA 3ZXXA 4EQ6B 1Y0BA 3IEXA 3RS5A 1H1DA 1VP9A 5G41A 3O8CA 4JHXA 4JCYA 4MVYA 4AJPA 5LQKA 5J40A 2WB2A 1H4SA 4YRJA 2WB4A 4ROTA 2OD2A 2FSIA 3WOVA 4PG8A 1VPWA 1W4LA 3QY0A 2XVAA 2ZYWX 4Z86A 1CRQA 3TTWA 1P75A 3GZJA 2XNKA 4DDUA 3HRKA 4AO6A 1EHCA 1ZZBA 5IC6A 4F06A 3KXDA 5TEWA 4U3JB 1K8YB 4ZEVA 1KQGA 2CZGA 4EJMA 4IDBA 3VVMA 1QDLB 4Q00A 4OQYA 1UC4B 4C7KA 2O3TA 1K8RA 1EE9A 3JQAB 5IUNC 4DZRA 2UXBB 2ZYIA 4JIGA 2XTNA 1VJ1A 2P1ZA 3DB2A 1HH4A 1BE8A 1KI8A 1SC1A 1SCQA 3CSSA 1OBHA 3Q72A 5KKCA 2YICA 4O2AB 2NYRA 3FYHA 3EFHA 3KYCB 2GH1A 4IS3A 4M37A 3W2EA 1TYBE 3CB4A 3DO8A 3KTDA 4OXRA 3P0EA 3WDMA 4YALA 4HBGA 4AZ3A 3KPVA 1NQUA 3FCAA 1RLOA 4K9KA 3KVOA 4UE2A 3LZCA 2IKSA 1DGQA 5KHAA 2VA8A 2D2VA 1HF3A 2QTFA 4L16A 4LZZA 4ZAXA 1U11A 5FRDA 4TL8A 1IZ8A 3LVBA 3DC2A 1N2GA 4MGYR 2F64A 1EGQA 1NI5A 2JLCA 1Z5PA 1GU1A 1ZN8A 4KODA 2R62A 2G04A 3PRJA 5TMBA 2M6KA 2E7ZA 2I2XB 3DQZA 3DYVA 5G1PA 1XMVA 5TB5A 3O1LA 3B1JA 2QENA 2PXTA 1WXFA 2LXNA 3O0DA 3SHTA 2PUVA 4JJEA 3KXAA 2OC4A 4R98A 4E3ZA 3SC3A 1FLAA 4ZI7B 1KO8A 3VPBA 4D8YA 1F4PA 1HO3A 2YWCA 3O95A 1OU4A 4UMDA 1PZNA 2NLOA 2VUTA 3EXHC 3R7WB 2YWXA 3ESRA 4TUYB 5F7ZA 3CG0A 2Z4SA 3KEFA 5FIUA 3T4UA 5ALIA 2C7QA 1QG0A 2ECQA 2VTDA 3COZA 4D4LA 4YUXA 1NLYA 3CY6A 3TFLA 4PQYA 2VTEA 1XDGA 4LWPA 2F90A 3U4DA 2HMUA 4M1SA 4WT7A 2ADFA 2IE0A 4FXOA 1DT5A 1PBNA 4GX2A 2ADMA 4MVJM 2VP0A 2FZ5A 3CV3A 1OIWA 3AO0B 3OLQA 3ZJVA 5ALRA 3SJZA 3Q9UA 1S8NA 3QUBA 1Q3HA 3GGJA 2JJ1A 5H3CA 2FE4A 4DB2A 3NB0A 1XZEA 2O4AA 2ZE5A 1KAGA 3QHAA 4HWKA 4D4JA 5JS7A 2IOQA 2UYCA 3JQAA 4NBUA 2EZUA 2XXJA 3URKA 3J81A 4HJRA 1U0NA 1N6OA 1AD2A 2C1XA 3FBTA 4M49A 4MULA 4EENA 1RCFA 3AY3A 1GXSB 1SY7A 1ADGA 2NZUG 2XUHA 1J06A 2IIVA 4I6RA 1UBGA 2OV6A 2PX0A 1E9DA 5B1HA 4QJ4A 4DV5B 1SFRA 3CLCA 4JBGA 4V0NA 3V4LA 5EJ2A 5JWOA 1DZ3A 1WM1A 4GKAA 2OP1A 1HOTA 1U7PA 4XIYA 3OX4A 1EJ6A 1IPFA 1ZAKA 3OFND 2K6GA 4RY2A 3BWXA 1MABA 2W0SA 3EQZA 1X1TA 4NPCA 5AM4A 1V5GA 1FTWA 1VGVA 3HV0A 3S8EA 2H1CA 1GITA 1H23A 3TQIA 3AZOA 5D51S 2AK3A 3Q2IA 1YS4A 1MQ9A 3R5KA 3L4KA 4JLKA 4HFJA 2QYSA 4JYAB 3WHIA 1G6KA 2OHJA 4BQRA 2AJCA 2E1RA 2G07A 1WS6A 2APJA 4A5SA 3QLVC 1G59A 1J0AA 1RIIA 2PRIA 3O9ZA 1QTRA 3EQ6A 3CINA 5HDBB 4MH0R 3PKZA 3ND7A 3QLEA 5E7IA 2J09A 2QUJA 1J7KA 1Z5VA 4X8LA 5SZKB 4DDVA 1JHDA 4ENVA 3WYEA 5KEIA 5ALXA 5G1NA 4L3VA 3GRKA 1GG5A 2ZRDA 2ID9A 3G0OA 1M6WA 4XB1A 1KEEB 1G20A 1M2WA 2RI6A 3FFWA 4XVHA 1IBLB 5BSVA 1PJ2A 3AESA 4MDYA 3CR7A 1ZLXA 4CQLB 4D9JA 1U2SA 3OEHA 3ZK8A 3MWEA 1EAMA 3PD0A 3IQFA 1O7JA 4HN2A 1SWWA 2PTGA 1F1BA 2MXDA 2VXOA 3DHEA 4YVFA 2OSBA 1IZ9A 2GPAA 5E6SB 4G4SP 5EEGA 1MC8A 3M6XA 3PFWO 4J0HA 4RZ2A 5KYWB 1W76A 1T6ZA 1OASA 3EXG2 1G3IA 5AHRA 4XEHA 4YYEA 1LPNA 1V8DA 3QF3A 3TVDA 2NYVA 2JAWA 1QHEA 3F6SA 3ETCA 4J29A 4JNKA 4NOLA 3UKDA 1JEYB 2J87A 3SGLA 2AI3A 3UJ6A 7ADHA 2PX8A 5BR8B 3VAAA 1N2EA 3Q3HA 2NAPA 1X39A 5HQTA 2QTAA 1MD9A 3QWIA 3L4EA 3SYKA 1GQSA 1DOZA 4I4TF 3X2EA 1P0FA 1Z2CA 2Z09A 2G1PA 2YXBA 2Q4BA 1NDHA 2OV3A 2G5CA 1DADA 1CUEA 4JLWA 1D4ZA 5CYFA 4ZC8A 3AYZB 2Q5QA 4GR9A 5JW6A 5D01A 3TIXB 5IULC 2ZRKA 3UOGA 2BONA 2X9QA 5C1PA 1I32A 3CBQA 1DBRA 1DT3A 1W0CA 1XKQA 2BFNA 1U2RA 4H7IA 2VAVA 5T3YA 3UUGA 1LPMA 4OCZA 3WHLA 3HEBA 1VPVA 2C7BA 3AK4A 2C7PA 3S2SA 1US8A 1LJLA 2EJTA 4HJXA 3OZFA 4PRKA 3ZLJA 3SKXA 2HPZA 4JWKA 3IIMA 2QWXA 3BZWA 3KEMA 4EHAA 1FRZA 2GXQA 1NNI1 2ZK7A 3OMTA 4YQZA 1OVGA 4ENSA 1N3BA 1TEVA 1L5SA 1XKXA 4H77A 1CJUC 2O57A 2FW9A 4OQPA 3FMGA 4YRGA 5HJ7A 4R2HA 3ZCTA 1RXEA 1NUHA 3DMTA 5KNBH 3R9WA 3GMDA 2QPTA 3UN1A 1Y5RA 3WA6A 3S55A 1JIUA 2XRYA 3Q6MA 1JQKA 3S1AB 5AI5A 3I58A 3C15C 4QLBA 2FOXA 1YDHA 4YCJA 2NOAA 3GLIE 1T34A 2R6DA 4O4HF 4YMIA 1PFGA 4N1AA 1NGSA 4M0MA 4Y2PA 4BEBA 2IGTA 4PFSA 1UL1X 3KJXA 3QU9A 1NI3A 3R3UA 1YAJA 1A5BB 4PRZA 4HS9A 1HDIA 1XMJA 5EZYF 2HT6A 5LZ7A 1PZHA 2ACWA 1QXSA 1Q95A 2JAUA 4FN3A 2XXPA 1Y3BE 3UMFA 1I3NA 1C4XA 1WHTB 1T6XA 2ISSD 2P9BA 3IKVA 4ZT3A 1IWOA 1N9KA 5JI3E 3EIHA 5C46F 5BT9A 4JT9A 5HX7A 2BZSA 2BDTA 1B3BA 5DT2A 4NJOA 4ZT7A 4FS8A 2HJ9A 4FE7A 1DPFA 1DUVG 3W90A 2UZ1A 1P60A 2ZRGA 4KLRA 4DEYA 4TVSA 4A36A 2R1JL 2MHCA 3BXPA 2PJRA 1SUDA 2LP4Y 4JUFA 2HJSA 3WRXC 1UDBA 2V7GA 3LT2A 2XYQA 4X92A 1UJBA 2HA7A 2AOTB 3OFVA 1NULA 3ABZA 1QGAA 1I4OA 1SBNE 1W35A 3OZCA 4FOSA 3VC2A 3GV0A 5EE0A 1HTBA 1KQPA 2CDCA 3D1NI 1NV8A 2ZUDA 4HDOB 3EA0A 3SYNA 1YAHA 4J3JA 3DMYA 5AD1A 3UHAA 2Z2ZA 1DX9A 3TIIA 3CVVA 2R6GA 5KSZA 3C3KA 1FX1A 1TM4E 3RD5A 4D98A 1YB5A 1SB8A 3PXAA 4KO4S 1KC1A 3FF4A 2J41A 3GUVA 4KLZA 4DRYA 1C30B 3ZE2B 1XRSB 3FNBA 3DWFA 4L72A 3SWWA 1IB6A 4FHGA 3NAMA 3QG5A 4DAEA 2W37A 5EIBC 4AMVA 3U81A 2FR1A 1MDFA 3HU5A 1LSOA 4WZAE 5LYYA 4MVJI 1Z7YA 4NIMA 1OX4A 1D8AA 1W36C 1CF4A 3A9XA 3D3KA 4QGFA 3KB2A 4I08A 4WOPA 1M76A 1YBHA 3PUWA 4RIEA 5LZ8A 2M6LA 3V32A 1DC8A 2PQMA 1XMXA 2HF2A 1V3VA 1JHOA 4BEWA 5HZMA 4KPGA 4K0KB 3VO1A 3GLUA 4J0QA 1KEUA 1QVAA 2BHLA 5DO9A 3QE2A 3SKYA 5F7OA 1Y37A 5E1DA 1L3CA 4XB6B 3DL4A 1UK9A 2X15A 1U8CB 1DHTA 3A6HA 4JB3A 3DDCA 4IIYA 5I7AA 5CLQA 3MGBA 1KDTA 2PIAA 4IDEA 1U2GA 3QPVA 1T24A 3NDPA 4M9RA 4YG1A 1A9RA 3ZXYA 2PO7A 4CMIB 2W6JD 4WLNA 5IK2A 1WB9A 4Q1BA 3NIWA 2NVBA 4BNMA 1XZFA 3IERA 3M6LA 2Z6AA 2VHUA 4TXJA 2QYOA 2IW1A 5AW2A 4DS3A 4YHHB 4GPZA 4O4IA 3H1FA 5TE9A 4BY9E 4J94A 4LQLA 1O03A 4MW1A 1BCSA 1FP4A 3RRXA 1M2GA 3DDWA 3L0SA 4QLOA 1MH9A 5LQCA 4HZGA 1ULSA 4I50A 1P7CA 5EHNA 5K51A 1L8LA 1AKEA 2UV8A 1BMQA 1DW9A 4FILA 4AQ7A 3A1FA 4G24A 1CY0A 1U8TA 2J9GA 3CNQS 4WN9B 3HCRA 3TQQA 2HIAA 3ACDA 4LQCA 3VKVA 1XTIA 4EY8A 4H4DA 4UTXA 3VDNB 5A4IS 3P9RA 4IIVA 5AO9A 5C7IO 2EP5A 2IITA 2ZJOA 1ZA2A 1WXIA 5JVDB 2QAGA 2ZRFA 1MG5A 2VSFA 4CU5A 4U2EA 1GTJ1 1KJNA 3Q7PA 3DEJA 4XKJA 4ZODA 3V8NA 4B6SA 4B48A 2EW8A 1ECJA 4QYMA 3USZA 4C7MA 4RDXA 8ATCA 5K0FA 2QXTA 5DLPA 1IK6A 2QM3A 3JCZA 3PBKA 3N74A 4QYIB 5G02A 5BR4A 2ZIXB 1NHWA 4UUMA 4W8HA 3L8GA 2GQ0A 2OO5A 3NDBB 2D1YA 3BXXA 3CF4G 3IRVA 4YWHA 2ZS7A 5CXQA 1QORA 4RHXA 3IVPA 5B5SA 1TYDE 2QPOA 1USUA 5FBZA 3N28A 1M5RA 4RVHA 4Y2UA 2CLKB 3EXEA 1JJ7A 2WICA 1DINA 2YYYA 3CBGA 4I9NA 4KWEA 4LSWA 4FMBB 3B70A 4N3NA 4WECA 2QL5A 3K32A 1EVLA 1L4LA 2QMEA 2QTBA 1YJ8A 4MYSA 3NCHA 1JS1X 3RAEC 2JBWA 1H2FA 1C8VB 1T10A 4M1OA 4M54A 4X6YA 2C9CA 3KELA 4W9RA 4W7HA 1KQNA 5LQUA 1AMUA 4Z4GA 3T9AA 2G71A 1NE2A 2C2KA 1LD3A 4Z1OA 4FGSA 4LJAA 1SKBA 5LM3A 1II8A 2PLAA 4QQRA 1NMQA 5DBIA 4OK5A 2GZRA 1ORRA 4X97A 1DWOA 4CMGA 5B1YA 4WOKA 3UFXB 4Y2TA 5CIQA 3UW1A 4RDCA 3V4SA 2CL0X 4W5JA 4B6JA 3GK3A 5HBRA 2FMXA 2GBCA 2PYIA 4JXZA 1V5IA 2CLDX 2W6NA 3PEWA 1KQFA 2XDQA 4LTMA 3GJTA 4IIBA 4OAQA 4GQMA 1QAMA 4HX9A 4CTKA 1U28C 4CFSA 5MGNA 1E1QA 1VTKA 2ZSEA 3WNZA 4BVJA 2PWAA 2PFSA 5AKXA 4KBYA 1QYCA 3PQ8A 4Q16A 3PXCX 3RT9A 1GGEA 4YONB 2IXBA 3B7WA 4FDMA 5KX5B 4Q7KA 2CV1A 5THXA 3HXTA 3TBFA 1I3LA 2WQZA 1Q22A 3OF5A 4NAUA 3K0AB 3BGDA 1UC9A 1FFEA 2LTAA 3SPXA 1R6UA 2HKIA 3IBSA 4P9NA 2ADOA 5AP9A 1JW9B 5T8KC 4DBVO 4AL4A 4DIOA 2CUKA 3I39X 4EARA 4RTRA 3P9KA 4EY6A 2WKSA 2QN1A 2OXRA 5SV2A 1J39A 3MN1A 1YVEI 1WD7A 3RYCB 4FB4A 4HUJA 1RVDA 3NV7A 3B85A 1LLQA 2LWIA 2WM9B 4NYMR 5JXGA 5HKOA 1XLVA 1FU7A 1NM5C 1Y34E 2EERA 1ZI6A 1V1RB 3A25A 1ZNQO 5GGXA 4NG4A 4CMBA 2FX3A 2DMRA 3OOJA 3WDLA 3NTRA 2Z95A 2NG1A 3IQDB 4XPZA 9LDTA 3DAPA 1ZWLA 2C29D 2PUHA 5JS8A 4FC7A 3T4EA 2HDOA 3VMMA 2X8BA 2OB2A 3MOIA 4I1OA 4INOA 3DLCA 1ZDMA 1ZU5A 3BXZA 3WBJA 2M1XA 4HGNA 4M60A 3BTOA 3VO2A 4BB9A 2O8CA 1F51E 1Q1NA 3N0VA 3O2SB 4M0EA 1B93A 3L0ZA 1Y81A 3QIAA 1II8B 5IYZF 4LRUA 4IHKA 1AXRA 2BJCA 3TEPA 3RTEA 3QQPA 3L0DA 3GBVA 4K6MA 1DDGA 4PZAA 3VNQA 3RBVA 2PK3A 5L40A 1N2CA 3D7MA 2YJZA 3W4IA 4A2PA 5T7BA 2I78A 5EJGA 1RXWA 4PLYA 3VDQA 2QIPA 1SUCA 4LIPD 1Y1KE 4CIBA 2BFDA 2R65A 1Q74A 2DHCA 5HFJA 5IFLA 2REQB 4V0OA 1UXHA 1NJSA 2XCQA 2IYLD 2CFTA 2JHFA 3ZWXA 4CZ2A 2A9OA 5IVHA 1SELA 1VJDA 4UTRA 2GNAA 3QE3A 4MVJG 2G1JA 3EGXA 2VAPA 3DE3X 4YJ3F 3CRNA 2IYZA 2BGUA 5EXTA 1CUUA 3MSCA 1WUJS 4PHHA 4AN4A 4EF6A 9ABPA 3S81A 4DARA 1CYEA 5H7XA 1ZUWA 2O07A 5D7NA 4Q4AA 1V8PA 4G37A 1XPUA 2H17A 4B74A 1JB9A 5KNCD 2CWDA 1RZ3A 3HFJA 3N05A 3DMDA 5FOXA 4V1CB 1DUSA 2F8MA 1G2OA 4KYUA 3MMPA 4Q3AA 4WWHA 3PXBA 2P9GA 2IEDA 2HOQA 1UDCA 3URMA 1W34A 3U61B 1O6BA 1CS0A 1SKUA 2ZLBA 4CDMA 5I48A 3GVIA 4C04A 1GZ7A 1EXDA 2FEMA 4PR0A 2OHFA 3GN5A 2RAUA 3D1VA 4LYYA 3MCVA 4YJ3A 4EJFA 1HZJA 4Y9SA 3D8SA 3ETHA 3FPEA 2M32A 1X1CA 2ZTUA 4RKYA 2PX4A 4LHZA 3WV4A 1Y3HA 4TMTA 1NVEA 2G9VA 2IYQA 1KRXA 1BU8A 1V26A 1E9EA 4BE7B 4L4UA 3CNHA 2A94A 2ZS8A 1OKKD 3OZSA 3AY0A 2FETA 1YZLA 3G88A 1ZRNA 4DLBA 3T1HB 3P4XA 3QU2A 4PY2A 2QJWA 2OAGA 4XTCS 1JIXA 1Z62A 3V5NA 3FPFA 4EHLA 3L7LA 1OT3A 1M73E 3O7WA 4E12A 3ZVNA 4CHGA 1UK6A 1GPWB 1HGXA 4RZ3A 1R10A 2XQIA 1E7MA 5K8CA 1L1FA 4F2WA 4EVQA 1M34A 3PQDA 4IIJB 5G0VA 4BZWA 6NULA 3JYOA 4WOCA 3A6LA 4E03A 1PW5A 4YP7A 2JIMA 2RHRA 4PNZA 4X95A 1QRDA 1P17A 3G0HA 2N0SA 5FI0B 1OXKB 4TZKA 4KGDA 3S2IA 1IM5A 1L5QA 2QAIA 3K1JA 2CJXA 2MMCA 2YWHA 4AW9A 1U0SY 3K9CA 4U7WA 1G8MA 5DHQA 3R4CA 5D2CA 3P32A 4ZQBA 1E32A 1QCDA 4HQ6A 2GZDA 4U2FA 4GL2A 4PLHA 1N6PA 1SNYA 1E4OA 5D1HA 3HBMA 1Z07A 3K09C 4QEZA 3VGPA 3C97A 1F4VA 1KPHA 5M3BA 4CV3A 4MI3A 3CLVA 5JO0A 3CF0A 2BVNA 2QIOA 3H5WA 3AUAA 2R1TA 2UXDB 2RH4A 5IKPA 3IUEA 1JSLA 2ZYGA 3AXTA 3MC1A 4EGFA 2OCGA 1QYIA 3NPAA 1IVYA 4MPPA 4XVUA 4FKBA 3SN6A 2Q3EA 5SY4A 4FHEA 3HUEA 3KJFA 1I4TD 1TA4A 3UK6A 1AQNA 4DJTA 4HN4B 3FTCA 1Z3IX 1XQ9A 1SKYE 1Y7YA 1U98A 2O4UX 3K05A 4LBVA 4TWRA 1P2FA 4KO8A 5TJHA 4DQDA 4DA4A 1VDZA 2WVGA 2PMDA 3VZDA 1ULAA 5B3LA 2DT8A 4AJ1A 3ND8A 3PEFA 4PLWA 3HDTA 2XYHA 1VMKA 4ZVKA 2I91A 1VSUA 4DIKA 3IEVA 3C3WA 1UZUA 3A6EA 2KWIA 3E23A 4MV3A 4OUDA 4GOOD 2YWGA 2OVBA 5JYBA 3H4TA 1RC8A 4Q6BA 1A2OA 5ICMA 1VC2A 1WMEA 3TLGA 4ZZ3A 5A7FA 5DSXA 1E94E 3UQZA 1CUGA 2B78A 3PD7A 1KR2A 1GPNA 2X3UA 1G5FA 1BQEA 1FP2A 1ZVMA 3ZHMA 2X5KO 4PCAA 4QXOA 1PERL 3AR4A 1JG1A 5FLEX 3LDGA 4MIOA 3TQOA 4RL6A 3W6OA 3UCXA 1SVWA 2FSGA 3OQVA 3TL2A 1XAIA 4EECA 5KYUB 3CO0S 4DQXA 1PUJA 4OYLA 1ODLA 4IDGA 4BC1A 2ZREA 5C5DA 2DY0A 2J4CA 3NT5A 4J6EA 1QS0B 3IA2A 3MLEA 1CU1A 3BMQA 2O2XA 4JH0A 5CW1A 3OZUA 1VSTA 3ORQA 4WFJA 5CT8A 2P2DA 5ALWA 1ZN9A 2PBLA 2ICTA 1DEKA 3MGAA 3GIWA 5EA2A 2XF2A 4P4GA 4FQ8A 4TLCA 4PZPA 4G65A 1IAVA 4MQFB 5EHGA 4L9SA 5EXXA 3INTA 2IPXA 1U0TA 1P80A 4XX1A 2F17A 1YJBA 2BKLA 3D8RA 3L4BA 4QUJA 3CUYA 3RJZA 4RMIA 3I1YA 3FCEA 3LW8A 1XG5A 1GDDA 1O3YA 1RXIA 2G40A 1G55A 4OOEA 1O57A 1SKYB 5EJIA 2ZR8A 2GN1A 5AWFC 1UK7A 3CHYA 3PNQA 3HVJA 1K6JA 5U9CA 3I72A 4AN0A 4QNRA 3HB4X 4YJGA 1P5RA 2A4KA 1YXMA 3NTXA 2RHMA 4F8DA 2P9YA 3GPBA 1KOLA 3DKIA 3LE8A 4FFNA 1ZUIA 5F2NA 5AK4A 2QT9A 2MEZA 3GEMA 1CE8B 2PH5A 4LRSB 1FFHA 4QXRA 3KRTA 1U65A 4QJ3A 3Q3JB 4WEQA 5IEJA 3O9XA 1OC4A 4G5SA 1KI7A 3C48A 3D4BA 4LX8A 2VYVA 3Q0TA 2OQVA 2PZKA 5DJ5A 3LDHA 5KC8A 4DKJA 3AUTA 1UJ2A 2JCYA 5TGZA 1LB1B 4BQSA 1U0BB 4AJLA 4YRDA 1HYGA 5AXAA 1HLGA 2QJFA 1PL8A 4J9UE 3VYSB 5AXBA 1Z6XA 1Z6PA 4TWAA 4I9HA 1XZGA 1MRZA 2Y05A 1DQZA 3IIEA 3QX8A 1Z83A 2YHSA 1TMOA 4D96A 2BEWA 4FYMA 4UAUA 3TECE 4EKIA 1X14A 1YB2A 4G8DA 4D79A 2PG3A 2NT4A 4OYYA 3RRYA 1AKQA 4F84A 1S2LA 4KIJA 4MI1A 1HE4A 2IQIA 2OK8A 2QVLA 3LV8A 5K3BA 4OHZA 2PXQA 4LDJA 1Y6FA 3HWX1 3ZGXA 4N3BA 4E07A 3EMDA 5L6LB 2ECFA 5KYXB 3WGVA 1YIOA 1Z26A 3MINB 1LWOA 5AKIA 3F1LA 2GBIA 1H2BA 4Q7MB 4R84A 1LDEA 2HSZA 4UQOA 4BNYA 3FNRA 3GEIA 2DPYA 4EW6A 3V46A 1CR6A 2TMYA 4RZIA 2QVZX 2JLBA 3G2PA 3OPYA 3EAGA 1JR2A 1AA6A 4ONEA 2GTPA 2H07A 3JVDA 2YVUA 4ZRMA 3C43A 2GEBA 4A16A 4B43A 2AXQA 5FWNA 3TRKA 1I5RA 1XNGA 1VG8A 5G2OA 4KZKA 1MQ8B 2IU6A 4KSBA 2P9EA 5FQNA 4Y6OA 3SX2A 1N2XA 3VC3A 4CCSA 4UEKA 1AVTA 4LYJA 2XQKA 4AIIA 3CLSD 3P0RA 3B13B 2WC1A 1A76A 1KP2A 1NA5A 1VOTA 3O84A 4N5MA 1WSDA 4P35A 3WGHA 1RQRA 2D5LA 2RHGB 2VZEA 4DJEC 1CIPA 1CJGA 1ML3A 1THGA 4YJDA 5LD2B 4AURA 1Y3FE 2G0TA 1YZVA 2J3EA 4Y6SA 4L4RA 1WSWA 4E0BA 4ZAZA 1NIPA 4UM5A 3ADBA 5JZSA 1GO2A 1OROA 2Y6VA 1CY4A 1NXSA 3ITKA 4TUYA 1JLKA 2ZCJA 3JALB 2FK8A 3T1QA 2AQHA 3G6KA 3YASA 2ZSUA 4YGXB 2VRCA 4TQ9A 1BE6A 2RHTA 3FDIA 1GG2A 3IKLA 1LJUA 4J0FA 4PTZA 5JV5A 1G8PA 4B4OA 5CK5A 1VGQA 1Z2AA 2A14A 4QEKA 4ABYA 4UOQA 1C7EA 1JKJB 5FBVB 3HBFA 3WYBA 1E2MA 3E1SA 1TIPA 3GLSA 4A6XA 1ZO8A 5ALSA 4DHWA 1WWKA 1JAXA 4G97A 4MUBA 3TTUA 2LYPA 2YCBA 4CM8A 1Q7BA 4NZOA 1VA4A 4JL8A 2BJWA 1JEDA 4P5DA 2RGDA 3GRYA 4OHMA 2PBRA 2EP7A 2Y68A 3MJRA 3VUFA 2VHVA 4RY9A 2YMQA 3UKJA 3DDZX 4GAEA 5KVVA 1N7JA 4QDKA 4G0XA 5BPFA 2OCXA 2NM0A 2G77B 1JQ3A 2XIJA 1KY4A 2Q4DA 5I9SA 3TTVA 4KTVE 1N0VC 4GX5A 4MX8A 1Y7PA 2SKCA 3ZGYA 2JGMA 5D00A 1K9VF 2CMFA 3AEXA 4N0EA 1PJRA 4GBMA 2AEFA 1DEAA 3BE5A 4D9MA 1QGUB 1I9CA 4U39A 4EUEA 5FNVA 3OQIB 3EWIA 2WIBA 2V7UA 4KG7A 1JT9A 2BP7B 2OGUA 2O2JA 2FNAA 4MQBA 2WHPB 2P1RA 3RO7A 2CC2A 3K8ZA 4NU0A 3LWBA 1HNZB 4BGVA 1A95A 2FPIB 2X8LA 3L06A 3NKVA 1QO7A 1CR1A 3HXKA 2BISA 1AQUA 4JP3A 4L50A 4GOXA 3TSZA 2YH2A 3HFSA 1Q57A 3L7CA 3NANA 3E9QA 4DRXB 4B0PA 1Z6GA 4JU9A 4OKNA 2KM1A 5CJ2A 2Z98A 5GONF 4DNQA 1TPYA 3FPLA 3LUJA 3L7DA 4EI9A 1E8DA 4YJGB 5J63A 3STVA 4Z4QA 1E1CB 3EY4A 1TQDA 4C0QC 1SBCA 1G1MA 4IZ6A 4M1KA 1O6ZA 5D7BA 4X66B 1PW7A 2J3JA 4P80A 1PT6A 2QZ9A 3NH9A 4C4XA 5IKMA 721PA 3KHSA 1F9EA 1UPBA 1W581 1USGA 1O9HA 3DV0A 5EERA 4PYJA 1FU8A 5ESDA 4WLUA 4X8MA 4X94A 3TH5A 4F8EA 2IRWA 4F9FA 1TJ3A 3AJ9A 1VHDA 4TRJA 3QEMA 3VR6D 1M7HA 4CTMA 5BV0A 1POXA 2D2IA 2PS3A 3FVWA 3Q4GA 5CFQA 2QRUA 5C8YA 1PL7A 4EATA 1Z08A 1M5UA 3JASA 3WYNA 5K05A 3MUOA 2R87A 2EYUA 4IGKA 3TYXA 3ZZ1A 3HTXA 5KB3A 4AY6A 4IOKA 1JPNA 1D2MA 2W6OA 3FNGA 1OXSC 2EF1A 3E9RA 3I12A 5F5LA 1FFYA 4DE9A 4XSHA 2H11A 3ZGOA 1THZA 4CG0A 3A31A 2QRHA 3SDZA 1K08A 1ZWKA 3GQBA 4XCXA 3EOAI 1Z6ZA 5I3CA 3L7NA 4R0VA 2DYKA 3R9XB 1ACLA 5JATA 2C2OA 2E4WA 1YWGO 4ZKEA 1G7SA 2RSLA 3GYBA 2WAYA 1HRDA 2PT9A 4MV5A 1RLIA 3VR6H 4TKVA 4RDIA 4CXMA 2R44A 2O2ZA 1NPTO 4PR3A 5KYYB 3AEZA 2GRJA 1FS6A 3TQCA 4D9HA 3A27A 4X1KA 4B79A 1YS2X 3QI2A 3PXGA 4BVEA 2IYRA 2R86A 1F6DA 1N3IA 4GWGA 3VFDA 4F3KA 4RTQA 3OU6A 4ZXPA 4JI1B 5FEUA 4Y9DA 3FZGA 1EINA 1QK5A 3BSFA 1RLJA 2DPMA 3EFBA 1I1NA 4W1PA 4TYNA 1JIJA 2J3HA 3NM6B 1C2TA 2XJ3A 1IB0A 3THWA 2VATA 1DLIA 3TZHA 5EJ6A 4L8YA 2HJGA 1GWNA 1UEJA 5JS2A 1Q77A 2RJOA 3BD6A 3RK1A 3ZW8A 5JFOA 2G88A 1YZTA 5BMVA 3TZBA 4F4FA 1JA1A 4M98A 4PZEA 1TUEA 4DCJA 1FNCA 5LZ9A 3PUVA 5EYPB 1CR0A 2P6UA 2W6IA 2WA2A 3OIUA 5DGCA 2PV7A 3HJAA 5H83A 1Z68A 5BXYA 1SCAA 1MA3A 2QW0X 4AQYB 2O8BA 2XGOA 2I4IA 1YQXA 3RC9A 2NU6B 5JJCA 5CVVA 2Y0CA 4MAMA 1XLWA 5F33A 3VR5D 3A3OA 3QHPA 2VK2A 4HR7A 1XCLA 1E2QA 1N8NA 1X7XB 1EZZA 4JGIA 4Y0NA 2J9FA 5KTPA 1IBKB 3FGPA 1W85A 4FFVA 4D25A 2C7GA 2OO7A 2WNHA 1JHZA 4F5ZA 1EVIA 4Z0PA 3BYZA 4NCXA 4F4IA 1KOGA 1RZRD 5ALDA 2P91A 1A3CA 1CZHA 4C30A 3TELA 1LMB3 2EYQA 3FOWA 1C7ZA 4QODA 4V0QA 5JH7F 1FSZA 2QW1A 2BI8A 1E77A 3WDSA 1LPSA 3KSBC 2I54A 2PGLA 5KNDH 5FOTA 3ND9A 1MJFA 2Q5FA 4KRYA 3IAFA 8ABPA 4CL8A 3KLNA 2IF0A 2VTBB 2EJBA 1JECA 2GEKA 1C5KA 1ZSNA 4R05A 1YZUA 3UMCA 5LWQA 1E9SA 2VBIA 2IV1A 2FHPA 2Q3DA 1CUDA 4F2PA 3KQWA 1M8FA 3WSVA 1HI9A 2OT3B 3EWAA 4QDTA 3MLAA 4ISBA 3ZV4A 1ZL0A 5KHOC 1MZPA 1PG5A 4B6RA 3O3CA 4EW1A 4J7AA 1TIBA 2VDMB 2I7XA 4MO9A 3LM8A 5FORA 3SYRA 3VUEA 1JALA 1AMNA 4KKXB 1MPTA 3INRA 3ZDDA 3RANA 4JJ8A 5JNWA 4P93A 4N7JA 2JAQA 3A1SA 4I3GA 2FPRA 3DFUA 1EGMB 2FF5A 2JGRA 3BK2A 4TWBA 3KXLA 1IQPA 3SICE 4B73A 3SNHA 4IH4A 4O4JA 1O6GA 2LR0A 2R1UA 4NEQA 4BMZA 1LDBA 1S6YA 3OCJA 2MSNA 6REQB 2CF5A 3QKUA 4H59A 1J0XO 1AOXA 1U7TA 4DQKA 5LNK6 3I1JA 3OHPA 3MM4A 3C3DA 1DOAA 2O0KA 1S89A 4BDTA 3B1XA 1MEJA 1NZDA 3G8YA 1EMDA 4B7XA 2IYYA 2YIJA 4IXMA 3M3DA 1L5YA 1BX0A 1P44A 4C3UA 3FR8A 2YW9A 2CXXA 4Q2JA 2YL2A 3AT1A 3IKMB 3PQFA 4KN9S 3OOSA 1XQYA 3HVUA 3U7HB 4L75A 3MRTA 4X71A 4KLAA 2XUKA 2UYGA 4BNJA 4HNVA 3K9FC 2HM7A 3QITA 2FU5C 3PQ4A 1WZUA 1VG1A 3ABIA 2Q7XA 4Y6GB 4GSKA 2AXVA 2XF8A 1C4WA 4WZZA 4L8LA 5JMTA 4D92A 3Q6NA 4N0DA 2XCUA 4GOLD 3V33A 2D1SA 5KTOA 2QU7A 3R7NA 3A28A 4L5AA 1TZKA 4KIWA 1T4CA 4CMHA 3LHKA 1F6WA 1PJSA 3BH6A 4BJ1A 5FUXA 1O0BA 4RKEA 3RFCA 5CX4A 2PGDA 2AWNA 3MCAA 1MC1A 3Q8XB 3TUIC 2H2GA 2H5EA 4MQMA 4K8RB 4XWTA 1GNSA 2P9HA 4AZSA 4PM4A 3HSSA 2ZSIA 4TTVA 2D5VA 2GZ3A 1J2EA 2WK1A 4JC8A 4Z3DA 1J8VA 4J1TC 3K16A 3OZGA 1BCRA 2BGLA 4BP3A 4U0KA 4ALNA 1CY2A 3DYBA 4QGHA 4FB5A 5A4DA 5CFMA 2QB5A 3UWSA 3DWGA 5E9AA 1DTSA 3JWIA 3EQ9A 2NV0A 1PKXA 2XB9A 3WWZA 5K4AA 1F8XA 1WW2A 3PYXA 2L18A 3QGMA 2H7YA 4KSYA 3OZVA 3ODGA 1CBUA 1U2PA 4WDRA 4WLFA 1PJ8A 2JGAA 1V25A 1XEWX 4A6DA 5JNRA 1RYNA 2ZEJA 1D6MA 3FDFA 4NBLA 5BW8A 5LXTB 3H5TA 3D0OA 2RAVA 3G9XA 4L28A 1JKIA 3F8WA 4TN1A 5GY7A 1L9KA 4M1EA 1SIWA 2ODQA 3FYSA 4PAGA 1XKTA 3C6YA 3O21A 3L0BA 1DEXA 2BGKA 2EIXA 4IW3B 1EX6A 1E3WB 1Z7GA 4NPAA 4R7GA 1YBMA 1QE0A 2BM8A 2FTKE 1B73A 3DKVA 3EQ2A 4PV7A 5ITSA 3F8SA 5JI2E 3OTOB 3BAFA 3B9BA 4XOUA 3UOWA 2EWVA 4LZAA 1NW6A 5KSWB 1VL2A 4IJWA 5M04A 3B1ZA 3C85A 5FHQA 4YREA 1J7JA 1N6IA 7AT1A 4DILA 4DY4A 2NADA 3BRSA 1QU2A 4D99A 1JPJA 2QQEA 3TUZC 4LGMA 5IJXA 4XWOA 2BGNA 3HA2A 3ZEAA 2H29A 3BOSA 3UMSA 2QLNA 2QUHA 3R8XA 1TGYA 3TCKA 5IW8A 1XRMA 3L9WA 5BYAA 5JQGB 4EA9A 1UXGA 2BBOA 3B5EA 4LI0A 2FZVA 2XLCA 1D6JA 3LAWA 4JYMA 3CRMA 1PYDA 1RVV1 1ZP6A 4AG3A 1D7AA 4RH3A 1NQWA 2N9UA 1G17A 2BW0A 1J23A 4IWYA 5A4JA 2GAAA 4V3CA 3L6DA 3R3WA 1Y6JA 5AR1A 3E27A 4U9UA 3VVLA 2OTCA 3JD4A 3BFKA 4A1OA 1NC1A 2WIAA 4G5OA 4J2OA 4X90A 1S7EA 3AOGA 4X20A 3WJ7A 4M4SA 1V4NA 1RZUA 3AR9A 3PPVA 4UUBA 4E5KA 1WMSA 1YIDA 2CMHA 2KS6A 3QA9A 3AW9A 4JDPA 4XM0A 3ZCVA 3K1AA 1LFDB 5IBPA 2XIQA 4OYRA 3P9IA 4FGLA 1ZD2P 2ZUVA 4WA8A 4KQEA 2EBYA 5BSUA 4DANA 2HA2A 3SSOA 4B3HA 3HXPA 1R0WA 3MHPA 5KQSA 1ZUD1 5B37A 1EK0A 1FJHA 2C95A 3ZX4A 2WT9A 2CDRA 1SUFA 5A03A 1UQRA 3OZWA 2GO1A 4NZ9A 1Y7LA 2FJUA 5B6IA 3HMKA 4O4LA 4Q6WA 3QEOA 2HMAA 1D1PA 4L2IA 4R81A 2HWUA 4P83A 5AW5A 1MRSA 1N57A 3SF8B 4YCSA 4M1MA 1FZTA 2PX2A 4C5CA 1G291 4HQOA 4P53A 4MWSA 4RY8A 1X13A 4FFDA 3UT5B 2H18A 3C98A 2IYNA 2JGKA 4E14A 5HXAA 4DLRA 2J9ZB 3NH6A 5HA5A 4DLXA 2DFVA 2IYEA 4YASA 4X3PA 4WTOA 4AO7A 1LS6A 2A9JA 5AKYA 1GKIA 1KMQA 2WF6A 1K97A 4E22A 4B7CA 4MCTA 2ATVA 3LLMA 4KC0A 3P9YA 2HHAA 1LTQA 3FGOA 2H1SA 3NV9A 1F12A 1JLLB 2FFHA 1F14A 3EISA 5EWJA 2IUYA 2KB0A 3D64A 3NVDA 4YT2A 2X5NA 4I50B 2XDQB 3RYTC 4D9FA 2QRZA 1PWXA 1TQHA 2H4WA 3O8NA 2AWOA 2VJOA 3KLMX 4JQOA 4RGVA 2XXBA 4RVGA 4A6EA 3F7MA 5I5EA 2AZXA 1OWPA 5ED4A 2HA3A 4YECA 3UH0A 2PYDA 2QBYA 3DTVD 1EB8A 4R1QA 2HV9A 1UJ4A 3NDJA 3OWHA 4PVCA 3QFRA 5GQSA 2SKDA 1AX9A 1H5NA 4FDAA 4HNGA 4GEKA 1QFZA 1WHSB 4UULA 4I1SA 1PZGA 1T8SA 2I9KA 2ZANA 4G84A 3VJLA 3ZDRA 4DR7B 4V03A 5E9QA 4LFCB 4U7TB 3WO0A 2XT0A 1OGIA 1PJBA 1VSVA 5CB6A 2NX2A 1HKHA 5JZOA 4X5OA 3NYQA 3U3ZA 1RYEA 4FR2A 3KEOA 2C8KA 4NBNA 2W2OA 4WJLA 2BNOA 3EZXA 2NU8A 1NMEA 2HK8A 2FN9A 2JLQA 1NP6A 4TLBA 1BGWA 5EJ5A 5HGXA 2EW1A 4IV5A 2Z58A 3KYDB 4W6ZA 3LCJA 3RRFA 5C18A 5J58A 4MDFA 2XQJA 1H2HA 3ZNQA 1BKYA 2AG0A 5GJBA 4C22A 5JPIA 3O94A 3LGXA 1Z0UA 4BV8A 2NP6A 1L4BA 3KB6A 3T3MB 4KR9A 4I14A 3CWZA 3S28A 2HU8A 1OBCA 1U3VA 1XPRA 4A27A 4B33A 2WD7A 5KNCH 4D26A 5LQNA 2C8VA 3CISA 3HCNA 4BLRA 3ZE9A 5IABA 2HT1A 4KACA 2CK3D 1Q1BA 4JN6B 4JR2A 1DV1A 4MMZB 1TADA 1Q84A 5EXPA 4RH1A 4B80A 1VB5A 4JIMA 1JQ5A 1MN6A 1Z3CA 3T9CA 4OP1A 1P81A 5EQFA 5J9FA 1PG2A 4M7PA 1M74A 1ISHA 2FGKA 2YNMC 1VFPA 1PJ4A 5JZ9A 1G3MA 1YUMA 4QXPA 3W2TA 5HOQA 3JRXA 1D4OA 3B82A 1E6MA 3NUQA 3HBLA 4NNOA 1N75A 1PEAA 3BSWA 4NV1A 1TT7A 1R8JA 2H2FA 4MIKA 3LYLA 1ST2A 1UOOA 2AOTA 1I13A 3KHUA 4MUKA 3HKDA 2IV3A 1F60A 1TVEA 4DJFC 3FPCA 3SM9A 1E3QA 3BHJA 5AVYA 5K8IA 1TO2E 2XUPA 2YXDA 3NM5A 4G25A 4IJQA 2AVNA 4MR8B 3R7DA 2NMVA 2AFRA 3X1YA 4OI0A 3WGQA 3D6HA 4NICA 4OOFA 1LZLA 3OT4A 2B9VA 3QXSA 4KO3S 1RJDA 1VMDA 1DJMA 1D9XA 4TRRA 4RLFA 1KPIA 3PLNA 4HAUA 2DPXA 2VT6A 2CFCA 4QUEA 2DF8A 3A32A 1WB6A 4EM6A 3ON5A 3F1KA 1Y33E 3QEAZ 3BIOA 3O4RA 5AI8A 3WISA 1Y9DA 4HAOA 1ZR2A 2O8FA 1GGKA 1Z0KA 1Q0QA 1QGZA 3DKPA 4Y3UA 1MLDA 5DCLA 2NSHA 2C78A 3OZIA 1L3BA 2R63A 5IVDA 1DKUA 1GQQA 2DCMA 4JYCA 3STHA 1G8FA 3EXAA 3V7FA 3EIQA 2F4NA 4LAFA 1C0PA 5LQMA 3A9SA 1IRIA 1TD1A 4MW4A 4GXTA 1XCOA 5FPQA 1MEOA 1KMHA 4UBKA 4BO6A 1GPH1 1Y9AA 1AQIA 2JFZA 2WDPA 1LSSA 3KT3A 3V4RA 4H4CA 2L1PA 4OJNA 3OMLA 1U2ZA 1VYUA 4S24A 4E15A 4EHBA 2XMGA 5K5EA 1MB0A 4GP6A 4RGBA 1JSXA 3JQ8B 1EGVB 3W79A 1GU7A 1S2NA 1SIBE 5B3JC 4UARA 3WL3A 2VJLA 4FQ7A 4Q05A 3HPRA 4NS4A 3VZCA 1EQAA 3W8FA 4WBSA 2ZI3A 1NU6A 3UANA 4QZVA 2GPJA 1Z5NA 2V3VA 5CGZA 4Q18A 2JPDA 3EZYA 4OXYA 1E2UA 2PMBA 2Q4EA 1TLFA 3HKDB 3EC7A 4TTAA 1T0IA 4MB0A 3TZEA 5C3MA 1DCTA 2QRMA 1Z88A 3O2JA 4PYRA 2DE0X 2YWRA 4HRYA 4LYDA 4MVWA 4E88A 3TMYA 1M2OB 1QDEA 2A9FA 1B2RA 1E6KA 2O1SA 3CR3C 4IAOA 3C4JA 4Y7DA 3AKDA 4BPRA 5JS6A 4JI0B 4S12A 4QBIA 1C3OB 1GPUA 1O95C 1QCYA 2Q5CA 2QNIA 1C4OA 1X7GA 2J0EA 4J2HA 3VPXA 2J46A 4CIDA 4KLNA 4RELA 4M0PA 3K09A 5DP2A 4RXMA 1V5EA 4FHZA 5HF6A 3UJ3X 2XKBA 4KB5A 1F38A 2GZ1A 4K26A 4KQGA 5A7GA 5LLTA 2WMNB 2CLEB 5CAEB 1ISFA 3DR3A 4DDWA 4COKA 1Q2XA 3PF9A 1P6UA 2BDEA 1SQFA 1G3RA 3WNQA 5K9ZA 2WIUB 2CKDA 1WCV1 2A5JA 2B2NA 4PICA 4RYDA 3GBFA 5EFZA 5CBKA 2RK4A 5JDIC 1EK6A 1H2AS 1J0EA 3EUWA 3E5MA 5HIJA 1QZTA 3LPDA 2BLLA 1SBIA 2IXGA 3PGA1 2OV8A 4GPBA 4KV9A 3K9HA 3T34A 4AU1A 2EZ9A 1NG1A 4WZAA 1FVFA 1XXHB 3DEHA 4JB8A 3T7AA 2P4EA 1XTRA 3EZNA 3FFTA 4RKFA 4AJJA 3OJOA 4V3BA 3Q3IA 4KXLA 3OEED 1H6AA 1ZK3A 3HUTA 3PZRA 3HN7A 2YOGA 3V4OA 1R00A 2HADA 2PCLA 4OV6B 5JJLA 1Z12A 4CFYA 1HYBA 2WYUA 1B41A 1RAHA 2VK1A 3FPAA 2ESRA 5LBTA 3I9LA 1OXUA 2O8DA 2O2DA 1B74A 1ORDA 5INTA 2GKOA 5F4ZA 2JFOA 5EEHA 3V6MA 2I0FA 3KCQA 3TDNA 5E4YA 1AB6A 3HDHA 1V8BA 3P4YA 1T1GA 2G8NA 2PRKA 4Z3KA 5CEEA 4DSNA 2ZWVA 1ZEJA 3KFXA 5EMNA 3IYLW 3FKSA 2UZ4A 2X4DA 4RHYA 2D13A 2X1LA 2PSSA 3B7GA 4R9UC 4B82A 2EAUA 1SPXA 2JIDA 4P7GA 3LVRE 1I7NA 1RYFA 1BQ3A 4X64B 1EUYA 1CJBA 5T6MA 2ARKA 2AW6A 4C4OA 2Q1UA 2QUBA 1QOQB 2D8MA 5KJCA 3HVHA 4B6EA 4DOMA 1QP7A 4LHWA 4UBLA 2WMYA 1BMFA 3NHMA 1KVTA 1SB9A 2RBGA 3L49A 6PFKA 3O31A 2VKTA 3M1LA 4E4RA 1VKHA 1EFPA 3L04A 3LMKA 4ZYTA 4OI4A 4Z9XA 1ZUNA 2PMCA 2WM8A 1IHPA 2G80A 3OICA 4JUCA 4ABTA 2ZUUA 1V71A 2BJVA 1VPDA 2BGIA 2P9ZA 1JSRA 2GN2A 3DXYA 4PPYA 5K0CA 3IB6A 1CS4C 2ZRIA 5FAXA 1WPRA 3PDWA 4HUTA 5DW0A 4Q48A 2WTEA 4OAOA 1NF8A 2N75A 4MQ5A 2GPTA 2XT9A 1NV9A 4YV1A 4TV8B 1OD6A 1A9SA 1PS9A 2BMAA 2JIZD 3QWFA 3UG7A 2FR0A 5CB4A 2ZE8A 2QD5A 1GDHA 1NVDA 1ZM2A 1VE9A 5ADHA 1LWNA 2VP9A 5GZ3A 2IT1A 1HLPA 4NTZA 3TN7A 3THYA 1U7OA 3RSOA 2JFWA 3GN2A 1TVKA 3V7YA 3GJ8A 1JG7A 5CFPA 3FYUA 3OCZA 4ZEXA 5ALMA 2BY4A 3FA2A 2ZUTA 3VR3A 1O97D 10MHA 2KEJA 3L6UA 4F2DA 5LYJB 1IEXA 1AZLA 2P2LA 3ZVKA 1YBAA 2LBPA 221PA 2OYSA 1UKAA 1XCBA 3BJRA 1GVHA 5EWLA 1KAEA 3JD1A 4OHPA 4UQLA 1WCIB 2HN9A 4KH0A 4G0ZA 2QD2A 2VBGA 4EPXA 3SP1A 2PXHA 5K3FB 1UKBA 1Z9BA 3JZAA 2UYOA 1AMOA 2H1WA 2X5OA 2R8ZA 1ETHA 4HZIA 3S2FA 3VOBA 5A3JA 3GFPA 5K2MA 1EFLA 5CYOA 1UPTA 5FX2A 1RMQA 3P0FA 1LLFA 1JSZA 4RTNA 1TCVA 3A1EA 2PSDA 3S2YA 4K9QA 1FFAA 2QN8A 5IVIA 3TVYA 1E7WA 1OCEA 1TM1E 3E9ZA 2JKZA 4L6IA 4PX5A 3LYHA 5CB4F 4HSEA 2VJBA 4TWJA 1ZAYA 3PJFA 4G8BA 4P7KA 5IJWA 3PTLA 4ZOEA 3LD9A 1XU7A 1SBQA 4F7WA 4Z5DA 2UZ0A 1GNRA 4U6QA 3V8BA 4C29A 1X7DA 5F1PA 2GZ2A 3ZJ4A 5E6UB 4HUQB 4HH0A 2AYYA 2BFCA 2R85A 2J3QA 1OH6A 1ACJA 4C87A 2E4UA 2PH3A 4NOJA 4GKKB 2D5CA 2GAFA 1P73A 2AF4C 3ZDAA 2GARA 3OJFA 4R2LA 5AVSA 5HKKA 3NHSA 4W63A 4CMJA 1U3FA 1XMPA 2JIQA 4WBNA 1D1QA 5CM8B 4U7GA 1FS4A 3HU2A 4G09A 4D3SA 1H94A 4GX1A 3G8DA 4G1BA 4GZLA 3EBLA 4I8XA 2H4HA 1GUZA 4L08A 1E6EA 5COBA 1EP1B 3U5ZB 1XCJA 3LQKA 3EHEA 2XBLA 4I55A 2NXWA 3HKEB 3W6NA 1PYOA 1Y8QA 3CLTD 4QPDA 5DXJA 5GOZA 3R76A 4BV9A 2BRUC 3F5DA 3OKFA 3P52A 4HGYA 3AR7A 2NUPB 3WYCA 3TRIA 3A2MA 4D41A 1IXZA 3GUHA 3HLTA 4CTJA 3SZUA 3AF2A 1NQOA 4I9UA 1OIXA 3PA6A 4QQFA 1ZIYA 3FUXA 1UDAA 4X4BA 4DCCA 2WW8A 1XTUA 3ONEA 4UAJA 4DSZA 2ATCA 1O94C 3PGMA 4TV9B 5DHPA 1IXKA 3CXRA 4HTAA 3UAOA 4DUGD 1YCGA 1XDZA 2JKVA 1ISSA 1GRQA 1XEAA 1H65A 3ESBA 4LCBA 3OBIA 3RV4A 3UYKA 4F86A 2AUWA 1TAQA 4OB7A 3OMXA 4Z8YA 1EVEA 2K2QB 2HK9A 1X1RA 3GLHE 4ZAYA 3R0IA 4LDNA 1FUEA 5HIMA 3SR0A 4WFKA 4IMJB 4LW8A 5BQFA 1NW8A 1OLUA 2G28A 3KB8A 5K45A 2MINB 4JLBA 4ZIRA 1SHZA 2BMWA 3HL4A 1WW8A 1AV6A 1EU1A 2ETVA 1OKKA 3CCBA 3RB8A 3N7UA 2J67A 5HYVA 3ROKA 5E3IA 4LY6A 3T7JA 2JANA 5IVKA 3AI1A 3T61A 3L4BC 3I9NA 5BN4B 4B2PA 1N9GB 4EB0A 3FZNA 3HA7A 3CUWA 4J0DA 5K99A 4EWLA 4DR4B 1FFXA 3KUXA 5F1YA 4COOA 3X1MA 4F9EA 4Y9TA 1A97A 3AR6A 4OGLA 5AJYA 3ESQA 4FLEA 4XTRA 5DN9A 1YKSA 1ISGA 4G4GA 1OH5A 2PPXA 1SC4A 3N8IA 3WB2A 2JFFA 1R37A 2COEA 5I8WA 2GNOA 3PSHA 4I5EA 1K7YA 1L7NA 5C7OO 4TT3D 2O5VA 2HSWA 1E2FA 1Z33A 3HJHA 4MUEA 4CIVA 1KPGA 1NUAA 1BFKA 3DE6X 3HJUA 3VH4A 3EXG1 4WN9A 3EGXB 5HIKA 2NQTA 2HRBA 4NV3A 2W71A 1XZJA 1FDSA 1NQ5A 3SYTA 2EJWA 4C2AA 1QRTA 2DLCX 3T5AA 1BIFA 4JXKA 1HC7A 3KT8A 3DKKA 4P4SA 5K98B 3LQ2A 4BO4A 1DDIA 3UHJA 1UADA 1OXBB 2FX2A 4QARA 3FOCA 3H2IA 1V95A 1VYVA 2EHDA 4LV5B 2FR8A 3UJCA 4JVSB 1BVUA 4G0QA 3ROZA 1XXLA 3GO4A 2FPMA 3PG5A 3CZRA 5JNTA 3GRVA 4D6XA 5E8RA 4B4VA 1M2HA 3D7LA 3HCPA 4R8MA 4RDHA 3N53A 1E0JA 1AHPA 1QYWA 2A1IA 2DBRA 4NP6A 4WKCA 2C20A 2YJGA 3AHEA 1X7ZB 3HYNA 5JQGF 1Z8NA 4A0HA 3UT6A 3KTAB 3WRXA 1L5ZA 2O2EA 4Q9AA 1O08A 4Q3KA 1TAGA 1ZZEA 3HZZA 3N2GB 4HDSB 3RTAA 4J4TA 3D6AA 3A2LA 4IA8A 4ODIA 2QZJA 1JF8A 5CM2Z 3QUCA 2OQIA 4J6FA 4HEJA 4KEAA 4RJIA 2NUAB 2C3YA 3JYPA 3OQMA 3RUFA 4BJHB 3EXFA 3KQKA 3DT6A 2H4FA 4XD2A 3E2PA 4JMPA 4WHMA 1W94A 5EPEA 3TI7A 2PD3A 5T41A 1ILWA 2Z5FA 2Z8ZA 4KV7A 4MCAA 4ALIA 3R1IA 1MO5A 4CT4B 1L4MA 1QVWA 2LCFA 3AVPA 1ZI8A 4HN9A 5DTQA 3IO5A 4O4JF 1FUKA 4G81A 4X63A 3ZKWB 2E89A 2PZMA 4DMGA 3CVUA 5IPFA 2QE7D 2JS7A 5ALYA 4BVFA 4NMHA 6ABPA 5DI9A 4A73A 4N41A 2I6TA 2Q0HA 5JAZA 1HF0A 4Z5HA 2CMKA 2FQXA 3GJ6A 1G7TA 3KOMA 2PD6A 4Y6QA 3NXHA 5DEIA 4WMLA 1EEXB 5EAIA 3K2EA 1EUCA 2YINC 3ORFA 1OQAA 5C37A 1EXWA 3JATB 4EUFA 1ZESA 2XUGA 4JI7B 5U4XA 3CR8A 3RVPA 1DMSA 2POQX 4F85A 1NJ8A 4CMCA 3EH2A 5JY1A 2ABWA 4B31A 4IO0A 1H9BA 2JK1A 3TTTA 4CMAA 2W83A 1RRKA 1ODCA 4PNEA 4H9GA 4HZUB 4EFMA 4N0MA 1WMDA 3HB5X 1RBMA 3IVAA 3R3XA 3PFBA 4BIIA 4O29A 4F6CA 4ER5A 1TGVA 3KXIA 3OZDA 2GK7A 5FR2A 1ADJA 3H0EA 4J90A 4PIVA 3T38A 4EHJA 5BYKA 1AQYA 2IHKA 2YXEA 3RS9A 4TPKA 4G4JA 4B76A 4X4GA 2O3QA 2AJTA 3PXUA 1UKEA 4IVPA 2KZ8A 4JOSA 3IBGA 5D3MB 4WCFA 3CSUA 5B3JA 1B8VA 1E7RA 3QX9A 1EFRA 1IHYA 1YZFA 4OXIA 4XQCA 4C4YA 4N6OA 1N6NA 2XUDA 2QN3A 2C9YA 1GFWA 2P78A 2WMDA 3W5JA 3IAUA 1DAOA 3Q5EA 3VAYA 1W30A 3Q1LA 3SYMA 2QN9A </