4EKIA

Crystal structure of dot1l in complex with epz004777
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
319
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 319
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ekiA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ekiA02
1SKMA 4GEKA 5E2AA 1UFKA 5EIWA 3DMHA 3SSMA 1Q0TA 2A14A 3P97A 2ZLBA 1F3LA 3UA4A 4E31A 3KPWA 4GOOD 1UIRA 4LWPA 1M6EX 4CTJA 2ESRA 2Y1XA 3HCEA 2K4MA 1FP2A 5DLYA 1JQ3A 3A27A 3MTIA 4OQDA 1EG2A 5DXAA 3G8BA 3QOWA 3R3HA 2NXEA 3ELYA 5E9WA 3I64A 5DX1A 1MJFA 1N2XA 1NW5A 3MGGA 3HCBA 3E7PA 2FPOA 5T6BA 1L1EA 3K0BA 2BH2A 2P8JA 2R3SA 2ZW9A 1N7IA 3EVGA 2AOWA 1EQAA 3FYDA 5FQNA 2IDJA 3B7PA 5DSXA 3SR4A 4AZSA 3Q87B 2YQZA 1VE3A 2R6ZA 1KHHA 4QTTB 4C04A 3BGVA 4ATNA 2ZVJA 5E9JA 3X0DA 3UJCA 2ZFUA 5ICFA 3EVDA 4YV2A 2AOTB 2O05A 3G5TA 1KPIA 3GWZA 4EKGA 1WZNA 2FHPA 2OBFA 2ZULA 4M37A 2JH8A 3ANXA 3MHTA 4AZVA 2UYHA 4YV1A 4RWZA 1YF3A 4AZTA 3BGIA 3PS9A 3PT9A 5F2OA 4C4AA 4YV0A 4BLVA 4EKIA 2FK7A 3M6UA 4X1OA 3EVFA 2GB4A 4QQKA 1QAOA 2HV9A 3FYCA 4RTOA 1SUSA 2GS9A 1JG4A 4RYLA 1KIAA 4CKBA 3DTNA 3LCVB 1TPYA 2AOVA 2HTEA 3BWMA 3EGEA 1TW3A 3NWBA 3DR5A 5GOZA 4EVIA 5KYGA 3ID6C 3MB5A 5M5BA 1RI5A 3O7WA 2P41A 1NBHA 3M4XA 5K09A 5E1BA 5DRTA 3BGDA 2PXXA 4HTFA 1QAMA 3MERA 3SVZA 3HVJA 3HTXA 3D2LA 3LDGA 1SG9A 4CWAA 1JG1A 2P3LA 3AXTA 3FUTA 4POOA 3C3YA 5EMJA 4E2YA 5HOQA 1BOOA 2G1PA 3HM2A 3LDUA 2NNWB 3G7UA 1VL5A 3HEMA 4M38A 3JWIA 5GM1A 3FUWA 5C0OE 4MTLA 9MHTA 3UJ9A 5LQUA 2QY6A 2CWWA 3GGDA 4GUAA 1WXXA 4KRGA 5FADA 1ORHA 3CCFA 2AOUA 1G60A 1UWVA 3LBYA 4RVFA 3PX2A 5DM4A 3UJDA 1M0EA 3KKZA 2B2CA 5CVUA 1L3BA 3FZGA 2AOUB 1NW6A 1R8YA 2HR1A 1U2ZA 1XXLA 3C3PA 4DQ0A 3ME5A 3KR2A 4XUDA 4FT4A 1AQIA 4RVGA 4E33A 5FA5A 1R8XA 2VDWA 3DXZA 3TKAA 3ER9A 3KQMA 2NP7A 1ORIA 4KWCA 1KPHA 1TW2A 2C7PA 4AUKA 2AVDA 2NYUA 3LPMA 1ZKDA 3R6TA 3HP7A 1BHJA 2ZWVA 4PIPA 2JJQA 3LCCA 1RJDA 4C03A 3I9FA 2O57A 1JG3A 2Z6AA 2IPXA 2BZGA 3UJAA 4YUVA 2PLWA 2C7QA 3PLAE 2XYRA 4L7VA 3TLJA 2BR4A 2PV0A 3KPVA 3DMFA 2HMYB 3AJDA 4R6XA 2HWKA 3G8AA 3V8VA 3EVZA 4BLUA 3OZRA 5MHTA 1V39A 2NP6A 3P9KA 3PB3A 5K0LA 4ER7A 3OCJA 5T64A 3RIEA 5ICEA 3CC8A 4GC9A 1F38A 3ELDA 1RI3A 3G89A 1NW7A 2PX2A 2AOXA 4V0QA 4KIGA 4X60A 4F84A 1AQJA 3FUUA 4YUYA 2IGTA 4M7RA 4Y30A 2UYOA 3ORHA 2ORED 3OU7A 4RV9A 2EJUA 5KS2A 1G38A 3T7TA 2PX8A 5DT2A 4HG2A 1MHTA 4R8SA 1M6YA 3KQWA 4P7GA 3LKDA 1RJFA 2ZIFA 4EK9A 3E8SA 3I58A 3HVHA 2IH4A 4DM3A 2ONZA 3AXSA 2H00A 5ICCA 2H1RA 3NWEA 3FRIA 1RJEA 1X1AA 5E1MA 1X1BA 1KXZA 4YUWA 3FTFA 3OU2A 2JH9A 3TKYA 5EEGA 1ZGAA 5EPEA 1RI1A 5KQRA 2ZIGA 3E05A 3SMQA 3PFHA 1G55A 5BXYA 1ZQ9A 2WA1A 3TM5A 10MHA 1Y8CA 1HNNA 3NDJA 5D1NA 3KQTA 5LQNA 3EEOA 2AN3A 3GO4A 5IKMA 1L3IA 5DPMA 3JWJA 3PX3A 2YXEA 1N7JA 2P3QA 3B3FA 3MAGA 3P8ZA 5GM2A 1X19A 4AZWA 3PTAA 5JUWA 5EKXA 5DWQA 5FQOA 5HILA 2IBTA 2XBMA 4H0NA 3NJRA 1RI2A 4PYMA 3DLIA 1I9GA 4BLWA 5FWAA 5CVDA 3KR1A 5CVJA 2ZIEA 1X1DA 4HGYA 5K8VA 4RTMA 2PX4A 2ADMA 2NXJA 3A4TA 3A7DA 1VBFA 3OE5A 1B42A 2B78A 5E8JA 5BP7A 5ICGA 5DTMA 4RX1A 3FUXA 3UJBA 3CKKA 3CVOA 4HRAA 3FUVA 1P39A 5FHRA 5GIOE 3GJYA 3NW9A 2YTZA 4NECA 2GLUA 4FZVA 3KQQA 2V7EA 1EIZA 2PWPA 3OFKA 1XTPA 2P1DA 3EVAA 5CVEA 3THSA 4RSRA 5GWXA 1WS6A 2OB1A 4OA8A 3MQ2A 1L3CA 3TPZA 3KPJA 2VDVE 1XDZA 2AN4A 4PONA 3MCTA 4RTJA 2IFTA 4ER5A 1XDUA 4IKPA 2EG5A 3HA7A 2PVCA 3G2PA 1EJ0A 2ZZKA 2PGXA 5HZMA 3OE4A 3OZTA 5EZQA 5EGSA 2PXAA 3QOXA 1EAMA 4QPPA 5FA8A 3M33A 3DOUA 4ISCA 1DCTA 1O54A 2PSSA 4DF3A 2UYQA 4HTFB 4PIMA 3QV2A 4BP1A 3ERCA 4LG1A 4R8RA 2B3TA 3B3GA 5HIMA 2NXCA 5K0CA 1KP9A 1XDSA 2QE6A 1JR4A 1L9KA 5EMMA 2I6GA 1X1CA 3DXYA 3IV6A 5U4XA 4X63A 2Z6QA 4GOMD 1VQ1A 3LL7A 4FS8A 2OXTA 4YMHA 3BKWA 3GRYA 3HA3A 4R05A 5LQRA 3HVIA 2CMGA 2BM9A 2AVNA 5EKUA 1BC5A 4EMSA 4F85A 2G8NA 4M36A 3GCZA 1QYRA 4KDCA 4CTKA 5HIKA 1T43A 4C05A 5DTRA 3LHDA 4DA4A 2QRVA 2UZ4A 2YUIA 3IEIA 4B17A 1G6Q1 3EEYA 3FPFA 4LECA 1SQGA 3KPUA 5JR3A 2B25A 1YZHA 5E1DA 3UJ6A 5EMLA 4FSXA 2XVMA 3SM3A 2BM8A 5E9QA 4QDKA 3HNRA 2YVLA 2OB2A 3DXXA 3P9NA 3NDIA 4HC4A 1AF7A 4E2WA 4LWOA 5LQCA 2YXDA 1AV6A 3FTDA 3GRVA 3UBTA 1FP1D 3DLCA 5DXJA 5CCXA 2IH2A 2HNKA 2PX5A 5EMKA 5CVVA 4YMGA 1O9GA 3EMBA 3BKXA 3LECA 1FBNA 5K0NA 3DP7A 1R74A 3IYLW 3CJRA 3G5LA 3LBFA 3L8DA 5K0BA 4RTLA 3BXOA 5T67A 3ELWA 1PRYA 1WXWA 1FJXA 4A6DA 4E2ZA 3GRUA 4IWNA 4R6WA 8MHTA 1D2HA 3P9CA 2GPYA 5CCBA 3C6KA 3BZBA 3KQOA 3M6WA 5EG5A 1ZGJA 3AWIA 3REOA 5F2KA 4DKJA 3NMUF 3I53A 4IV8A 1NV8A 2I9KA 3O4FA 2DULA 5DM2A 3FPHA 1VP9A 2EJTA 2P40A 4MIKA 2Z6UA 2YXLA 1R6AA 3DUWA 1XJ5A 2OY0A 2BR5A 4GOND 4AX8A 3JWGA 1SQFA 5K01A 2VDUE 3TQSA 3BUSA 1Q0SA 3BWYA 1SUIA 4GQBA 4O29A 5EEHA 4E30A 4UOEA 5K0EA 4E32A 5HIIA 4CXMA 4FR0A 2PY6A 4WVLA 1OR8A 2NXNA 3EGIA 2OPBA 3F4KA 5DM1A 4ER0A 1R00A 1IY9A 2XYQA 3DULA 2E5WA 1NW3A 3GRZA 3LKZA 4QDJA 1G8SA 3O31A 4GF5A 4IV0A 4XUEA 3P71T 1IM8A 3KHKA 3TFWA 3TR6A 3HCFA 1VIDA 1ZG3A 5ERGB 2GAFA 2QYOA 3R0QA 5FHQA 5FWDA 2IIPA 4FT2A 3R9XB 2IBSA 3BT7A 3TMAA 2OO3A 2H11A 4ZTBA 4YUZA 4DZRA 2I62A 4JXJA 1EJ6A 4FSDA 2I7CA 1XCLA 3ELUA 3KPYA 2P35A 3T7SA 1DL5A 1NV9A 1I4WA 3A7EA 4PYIA 4U7TB 4OBXA 4Y2HA 5D1HA 3T0IA 2B9EA 3GRRA 3LGAA 1H1DA 3NVMB 2PKWA 4K6MA 4A6EA 1SVUA 1VP3A 2AS0A 2WA2A 5LQJA 3DMGA 4MWZA 1NE2A 1QZZA 4RTSA 4KIFA 3T7RA 1P91A 4F86A 3I5UA 4MQ4A 4ER3A 1VLMA 3EGVA 2IP2A 5BW5A 5CD1A 1HMYA 2G71A 3G2MA 3C6MA 2V74B 1KYWA 2AR0A 5E2BA 2XVAA 2P3OA 3PFGA 5FUBA 5DRYA 3LDFA 5EZSA 3SGLA 3G2OA 3VSEA 2GH1A 2JG3A 1NBIA 2P7IA 4FP9A 5EHIA 3H2BA 5B1SA 3AY0A 3FPGA 5HFJA 3U81A 4G56A 4PGHA 5BW4A 5DTQA 3FTEA 1JTEA 3C0KA 4KW7A 5EOVA 2AOTA 1DUSA 2KW5A 3GU3A 5G02A 4RTKA 5LSAA 1R18A 3ER8A 3HCCA 5LQAA 4BP3A 5GINE 4PYOA 3FPJA 3KQPA 3SSOA 4BY9E 1XVAA 4RTQA 1WG8A 4DCGA 4WXHA 3EVEA 5EHGA 4MHTA 1YUBA 3EPPA 2CMHA 1RI4A 5GP1A 4C07A 3OFJA 4FGZA 4P7KA 1FPQA 2PT6A 4QPNA 2OKCA 3EVCA 4PYQA 2PBFA 1VPTA 3B3JA 4PYKA 2OYRA 3RW9A 1YFJA 2IDKA 5K0GA 1NW8A 1XCJA 2ZZNA 2ERCA 3BWCA 5K0FA 3EMDA 4PWYA 4RVHA 3KQYA 5DX0A 2AN5A 5E1OA 2VP3A 2FK8A 5DSTA 4RTPA 1KYZA 2O07A 3A26A 3GDHA 3KU1A 3GNLA 1JQDA 1Z3CA 4GBED 4KDRA 3UA3A 4YUXA 3NVKI 5E8RA 2JHCA 4PYLA 2FCAA 4RTRA 4QVGA 3CJTA 5DX8A 3G88A 5HIJA 4HSGA 4OQEA 4C08A 2CKDA 5LR6A 3K6RA 4Z2YA 1KPGA 2ZWAA 4RTNA 4PCLA 4ER6A 2G72A 2PXCA 3GXOA 3OZSA 3UZUA 3UWPA 1QANA 2PJDA 4CKEA 2LD4A 3E23A 2ZTHA 1JG2A 5K05A 4RVDA 3B89A 2JHPA 2YX1A 3LX6A 2QRVB 3HCAA 3UFBA 5GIPE 3FRHA 3VYWA 4KVZA 4X61A 4P7FA 2WK1A 1I1NA 4E70A 4GOLD 1WY7A 3THRA 1QAQA 4P7JA 1JSZA 3MTEA 1G8AA 4OA5A 3EVBA 3KQSA 3V97A 1JTFA 2VS1A 4PCAA 2C7RA 2C7OA 5HEKA 2PT9A 1ZHFA 4PGGA 2FYTA 4EQZA 7MHTA 3OU6A 1D2GA 1KR5A 2F8LA 5EQJB 3WSTA 4C06A 4OBWA 3SX0A 1IXKA 2OZVA 2CL5A 3BWBA 2PWYA 3VC1A 5KVAA 2FRXA 3FPEA 3HVKA 4XUCA 3CBGA 1RJGA 1YB2A 3LCUA 4P58A 3GIWA 2ZSUA 5H02A 4DMGA 3MCZA 2Q41A 5C9ZA 2XYVA 5F2NA 1NKVA 3LSTA 3M6VA 2GA9A 2QM3A 3G2QA 3IHTA 3TRKA 3Q7EA 2O0LA 3CGGA 5P8WA 3M70A 1BKYA 2JHAA 5K0JA 1JSXA 4HH4A 5CM2Z 4QVKA 4PNEA 3KR9A 3SSNA 2UYCA 2IH5A 5IH3A 2DPMA 4U7PB 3DH0A 2EX4A 1D2CA 1JQEA 2N47A 3M6XA 3TOSA 2O06A 2ONYA 5K03A 5LQKA 2AZTA 2YR0A 4PINA 5EIFA 2BR3A 5FCDA 3A25A 3HCDA 3NTVA 3CJQA 4QTUB 2ZCJA 1YFLA 4GC5A 4PYNA 4XCXA 3TM4A 1PJZA 2VZ9A 4DCMA 4PYJA 5DM0A 3OPNA 3JWHA 3KR0A 1NT2A 4E2XA 3P2IA 1P1CA 3P9IA 3P2KA 2ZBRA 3S68A 3PVCA 2ZBQA 4OX9Y 2P7HA 3VC2A 5FULA 2EFJA 2Y1WA 1O9HA 3FTCA 3KQVA 5CUQA 5EC8A 5C1IA 3HA5A 3RODA 5FTWA 5CIYA 4CKCA 4V0RA 3R24A 5KQSA 3P2EA 3B5IA 4HGZA 2G70A 2ZBPA 4QQNA 3SXJA 1INLA 1YZ3A 3UJ7A 2ZZMA 3UJ8A 1P1BA 4X41A 5EVJA
chains in the Genus database with same CATH superfamily
1PRAA 1SKMA 1P1IA 4GEKA 5CCDA 1DAKA 4LISA 1HV8A 1YI0A 2A14A 2QN6A 4F38A 2I1LA 5LNK6 3SE0A 1EQUA 1HE5A 1XALA 4B2YA 1ECPA 1PZNA 4Y7DA 4EJ0A 2E87A 4I3GA 2QGZA 1CUFA 2ZROA 3I01M 4BUJA 1UP4A 3DE7X 4AKGA 4AI6A 1UOQA 3OF5A 1TO6A 2PMFA 1OXXK 1E3TA 1XK6A 5E9WA 5AKIA 4BDSA 1OILA 1OI7A 2PXHA 3DAPA 3HCBA 1Z08A 5TS2A 4DQDA 4O4HB 5IULC 2A9RA 3D3JA 3DZKA 2P8JA 2QXTA 4PG6A 4EFKA 5DGIA 3QKUA 1YJXA 5KOHB 4X7MA 1Z6QA 1H23A 2AFHE 2NUBA 3IKLA 2HMVA 1VE3A 4FNGA 4M87A 3AEUB 3K32A 5E7QA 5EYPA 3U62A 3W9UA 5IJWA 4Z2AA 1I10A 2IHTA 5LOVF 4QXMA 5DGXA 3OETA 3W04A 1DEKA 1EQ2A 4AJOA 3DUFA 3KHUA 3R0VA 1T5SA 2AEMA 2EVWX 3KSZO 1SG6A 4CEJB 4FBMA 1BU8A 4AWBA 3FDZB 2GBCA 1Z5WA 4AVYA 3ZHZA 1U1EA 4YX9A 4D0SA 2O50A 2YFKA 3ZWPA 5EHXA 2FR1A 2WTNA 1QWSA 1WB9A 1J8YF 2P9EA 3IAEA 2ICPA 2ZUUA 1TJYA 3K9BA 4G0OA 4OQ4A 4OUDB 3STWA 4XRGA 2XYGA 2AL7A 1B8UA 3NBUA 5C8YB 2I3ZA 2OV1A 1FP4B 4X4GA 3DR5A 3DVAA 3QE4A 1I13A 1H8HA 5G0WA 3TJMA 4RDCA 4B3RB 1RI5A 1SHLA 2Q6OA 2I3GA 3M4XA 4K6GA 2HT6A 4G4SO 1X1TA 5AJYA 3IQIX 4DRXB 3GHHA 1H2BA 3AO0B 3BAFA 1YHNA 3BSFA 3E9RA 3LUDA 4JP3A 4ZOLB 3TQCA 3V7NA 2Z4TA 3ZQKA 3S40A 1RD4A 3P4UA 4TRJA 4UJ5A 5JIBA 1B74A 4U4AA 1OFGA 1PL6A 2ZBVA 3PC8C 1E66A 3HEMA 5GTDA 1MMFB 3ENQA 3BULA 5P21A 1QG4A 4I4TB 1J70A 5CFOA 5EFOA 2JI7A 5DN6D 5KDDA 9MHTA 4GUAA 3IRVA 1KJYA 2DWPA 2LYPA 3N2GA 3PX2A 4RVFA 4U7FA 3WWZA 4EHJA 5JT1A 4J3NA 5KVVA 3VWSA 1NU8A 3L7IA 4OQPA 5J4VA 2HR1A 2G6TA 1U2ZA 3ZXYA 4YAFA 4DAOA 3TIIA 3G85A 3QYFA 1JP7A 1JALA 3EK2A 4Z6KA 1GL7A 1NF2A 5FNZA 1GGJA 1LTKA 4RLHA 2GK7A 1TC1A 2CFSA 5CX4A 1Q2XA 4KEAA 2TMYA 4H16A 4S3MA 4YLEA 4UNRA 2OFPA 3R6TA 1OAAA 4ZQCB 2OUKA 1ZX1A 3OJXA 2JJQA 3AYZB 2AFHB 3RJTA 4Q3NA 1XZNA 3C6ZA 3FMVA 3CZPA 2Y0DA 1EFPA 5JATA 4XYLA 1I24A 1T6ZA 2P62A 3PKJA 4B83A 1LH0A 3IPAA 1TZKA 4LJ6A 4Z9YA 1MOPA 3KKOA 3R3WA 1XROA 1N2JA 3AJDA 4KWHA 1FF9A 4GEGA 4ZYWA 2XEDA 4PLWA 3P9KA 1RQXA 2MMGA 3A1NA 3AM5A 5FYQA 5T64A 3Q2OA 4W5WA 1Y6QA 1X80A 2C07A 1KAHA 1RQ2A 4M9CA 5HS4A 4CL2A 4F4IA 1O6ZA 1JZQA 3QWAA 2UVDA 2UYOA 3ORHA 3E2IA 2I8CA 3BIOA 3LX8A 4QODA 3G0CA 1JKFA 4XVHA 4ACAA 3N87A 4J76A 2QTWB 2FZCA 3BFXA 5SZIA 2C5BA 2LZ0A 1XTSA 1Z0UA 2ZB4A 4LJSA 2PUVA 4BNKA 4CLOB 4CKXA 2UUCB 1NUTA 1V3VA 1A5ZA 1E2BA 1NR7A 1O4WA 1RPAA 4PNHA 1UAYA 3WR5A 3BRSA 3AXSA 3ICCA 3E6AA 2WDPA 3NWEA 1VHTA 2JHFA 2NSHA 3OQMA 5FBHA 3OZUA 4LSWA 4N8SA 3UK0A 2G36A 2QKYA 3OFND 4P83A 3GUZA 5AK5A 3TLCA 3HKBB 1T4CA 4UCFA 1JXMA 5I7SA 2ONKA 1JWLA 1ZGAA 2NIPA 1QE3A 2EGUA 1KYYA 3PFHA 1G3MA 3AJRA 3DWFA 3FB4A 1ID1A 4C0QC 4ZO7A 1P4HA 3E9ZA 4DC9A 3W7VA 1Y8CA 5C34B 3OLCX 3L1PA 2B30A 1SUBA 3M49A 4O4HF 4AKHA 2TMDA 4Q9KA 1L4NA 3PX3A 3E7WA 5GM1A 4AZWA 3GZ4A 4B4DA 3AUSA 3WLIA 8GPBA 4DT1B 4PFSA 5JJIA 3ETCA 4Q4LA 2C4VA 2CY0A 1KERA 4V0ME 3MWLA 2HQOA 4YP7A 3ZU6A 5CVJA 2VYFA 3SFTA 2GYWA 2ZIZA 4JI7B 1Z0SA 1DSSG 1RLMA 1UMBB 3RE1A 4RTMA 1NG1A 1A7JA 1N25A 1UDBA 5TS3A 4LJKA 3E9EA 3BE4A 4QEDA 5I9MA 1GKIA 2DWCA 3UY4A 4URVR 4ZK2A 6PFKA 4X3CA 1OWOA 3FUXA 4GPAA 4O2BB 1GXSB 4KACA 1SQ6A 5IZ4A 1YHZA 3IAXA 1YFKA 1ZICA 2HCNA 1OZ0A 3FHCB 1PFGA 1UPUA 2Q62A 1BTOA 3FYAA 5JDCC 2RI1A 3U3JA 1F51E 2C4TA 2CLEB 3BREA 3QUCA 4WLEA 2P1DA 4BVEA 5CT8A 3ANYB 4CVNA 3FYUA 1NVAA 4RD3A 1H0SA 3IILA 5KNCH 4I4NA 4D6XA 1GPLA 1M72A 4K9KA 5ESRA 3T7IA 2PBLA 4P5PA 4RPJA 5KPJA 1VE9A 4KBFA 2HRZA 3ES9A 4KK3A 1MNQA 1RXUA 4RANA 1GQ2A 2QZSA 5LZ7A 3ZNPA 5JANA 1Z36A 3R77A 1A88A 1QIIA 3UMCA 1OI2A 4U5XA 2XB8A 4ZOLF 2OA0A 2GKGA 3EBLA 3WSWA 2D2XA 4JZKA 1JXQA 3EUAA 3W78A 1XRPA 1U81A 2DQZA 2H57A 3FTQA 3QKRA 3WYNA 3G0IA 3L8YA 4WNAB 1D4AA 3R1IA 4Z8YA 5ALRA 4C4RA 2UZ1A 4FBGA 1EJ2A 5AKYA 1GIAA 3RASA 5M04A 1DRKA 1EK2A 4I4TF 3QEBZ 4QNMA 1DEHA 4GECA 4CU2A 2PUBA 2FW0A 5ECGC 4LF7B 3K0HA 3DPUA 3UV6A 4Y9TA 5EZYB 4OATA 2QUZA 1IPHA 4GPTA 1D2MA 1V95A 4DV4B 2GZ3A 3FFTA 4UU1A 1UFOA 3UMRA 1FIUA 4KXQA 3NALA 4O2LA 1C3XA 4Y2RA 2CJPA 2ISSD 1SC1A 1SOWA 3JQ9C 1HG1A 2J3JA 5HCIA 3GDWA 3OE1A 4XD2A 3S70A 2UZ4A 2NTVA 3IEIA 4CQLB 3T9AA 1FUUA 1FSZA 4INOA 4DV1B 1AGPA 3VR4A 2ZJFA 4H6VA 4XKJA 3D8UA 3JCZA 3VHLB 1MP0A 3OLVA 3V34A 2D2EA 3U5TA 3OE7D 1W5FA 2F48A 2BBOA 3DTYA 3Q3CA 3UM9A 2GXUA 2YVLA 2MOKA 3MFYA 3P9NA 4L9AA 2F4NA 4HC4A 3BFKA 5K4AA 1AV6A 3GZCA 4RCZA 2DBVO 2WFLB 1E1NA 1E9CA 4YWHA 4I08A 1QVAA 1ZCAA 4I6EA 5IJZA 1PT8A 3FLAA 1SA0A 3DFKA 3O3OB 1T3SA 3ZZUA 2QS9A 4C30A 2LR0A 3FMOB 2QZPA 4JNKA 3RFFA 4OI2A 2BFNA 2CUTA 1J0XO 1YSCA 3BXOA 1J5EB 2IXGA 2P5YA 3NHJA 3KIPA 3NHKA 1I32A 4ZICA 4RHXA 4L0CA 2Q0HA 1XTKA 2JGMA 2R2GA 3NAGA 1ZGJA 2O49A 3RS0A 1IEQA 5BSEA 3M9LA 2FZGA 2J5RA 3PVSA 4GNRA 5JZMA 2I9KA 3X3HA 5DM2A 3W6ZA 4Z3OA 2YZNA 3GLHE 3I3OA 3I9MA 5JXHA 1VP9A 2X23A 3IXLA 3B7HA 2P40A 2XR1A 3L82B 1DT3A 2F3QA 3R4CA 4HH0A 4I8TA 4JL5A 2GEDA 4YPVA 5IXJA 1YACA 2H8GA 4GXQA 5BUSA 2OSVA 4D4JA 1Q0SA 1WX1A 4R16A 4H9GA 4E30A 3BX1A 4Y9DA 4EKDA 2H5JA 2YIMA 3RUFA 2C82A 2WB4A 1MZVA 1YB6A 1WCXA 3CIOA 4P2GA 3VAZA 3F52A 5K8IA 4JI0B 3R7WB 2BFPA 3B6EA 4QYIA 4JKIA 2FE1A 1OW3B 1JLSA 1CQJB 4EHBA 1GY8A 2PIJA 5B1HA 3VU9B 4GMDA 1N32B 5LB2A 2R87A 2VJPA 1YASA 1N8NA 4P3PA 3BT7A 3QWHA 4D0NA 1LFAA 5B58T 5LJLA 1N5KA 1E61A 1UBGA 2VHQA 3A7EA 2PJUA 5D1HA 1WIWA 3OHMA 5G3YA 4AJJA 4DMLA 4ZCTA 4RULA 5IXSA 4O2BF 4BEVA 3OWOA 1IJFA 1R15A 3NOVA 1UADA 2YNMA 3K2QA 2P67A 4UU7A 2AH5A 4UMVA 2V4UA 4MWZA 3K7EA 4RTSA 5CD1A 4MV4A 2YYZA 4PPNA 1DG9A 1HE3A 2NOAA 2OZLB 3X43A 3G2MA 4AXBA 3DHNA 4F46A 1BSVA 2KB0A 2XUDA 3QE9Y 1Y8ZA 4LZJA 2YN0A 2UZIR 3DTVD 1M2KA 2JFNA 4L5BA 5EQTA 4L0QA 5GONB 3AY0A 4D42A 2H4YA 3PWKA 1Y82A 2JAUA 3AUKA 4QQRA 1VLLA 4NABA 3LBAA 2BI8A 5CTJA 3FWHA 1T26A 1Y9EA 2ET6A 4GGPA 4MKXA 4QDXA 4PGAA 1JDUA 3EY4A 3HCCA 3QWGA 4WKGA 1B14A 1Y4UA 4AZ0A 4D9EA 1Z2CA 2B98A 3ZBUA 5IMSA 3L8FA 5JADA 3A9TA 2YC4C 1RYFA 1PEDA 5TMDA 4MKHA 2WD8A 3L9WA 2Q3CA 5COQA 3CE6A 3GLHB 3IXQA 2XTNA 4CU5A 5TVGA 3JATB 3TWOA 3AHGA 2PYDA 4KG7A 4YJ2B 4ABYA 1AQUA 3S55A 5FB3A 5EZYF 1SY7A 3GN5A 4B43A 5FH9A 2TSYB 5EXXA 3GH3A 3GH1A 3IIMA 4RK7A 4NBLA 3WRXC 1SZDA 3A1CA 4UBMA 4BN4A 2WYOA 2HA0A 3KU1A 2FPRA 4RD2A 1MX1A 1Y9QA 4JMPA 3A1FA 3VR6A 1OXBB 2JKYA 1SBZA 4C88A 4RTRA 1DARA 1HFKA 3K0KA 2Z4SA 2FZ4A 3LHIA 4KPUB 4PLVA 5IKXA 4V3BA 5AJWA 2X0JA 1BVHA 5G2OA 1L2TA 2QRGA 1QRSA 4B34A 1N5MA 3Q15C 3IJPA 5LIPA 4YI5A 1OAOA 5DYYA 5KPDA 3ACCA 4B32A 4FR5A 5C7OO 5M7EA 2X7XA 3NP7A 2XUJA 3F96A 3CPEA 4L73A 1IEXA 5EIXA 5JLJA 1AS3A 1QFJA 3KJXA 3AM3A 2ICTA 3F6BX 4ALIA 1QMGA 5EIHA 2GK4A 2JIZA 3LI2A 2RHWA 3VC3A 5CJ2A 2VJNA 1U3TA 4MVXA 3GZNA 3ZIAD 1XZGA 5KTRA 1IUNA 1KXJA 1NTRA 3ET5A 3G6KA 1WAMA 4PGGA 4RETA 3S8YA 2JFZA 2XA9A 3FHOA 2DWOA 4L4XA 4OXRA 3E3NA 5CX1A 4OBWA 4BQIA 4DYDA 3ICQB 5AM3A 1I6WA 3TOVA 1XYGA 5AIBA 2FRXA 3TD9A 4HZUA 1ZH4A 1W1UA 5DB4A 4UVDA 3DCYA 1UEJA 3GIWA 4FB5A 4J3JA 3UOAB 3HL4A 4XFJA 4UNQA 4U2FA 3V2GA 2IZ5A 1H6BA 4CLRB 4EJSB 4HNTA 2BYTA 4DMMA 2AUWA 3FTPA 1BMFD 3HRHA 4IUYA 1UANA 2GA9A 4TLAA 4ZHSA 5ES3A 1SIOA 3DDNA 5K45A 4X94A 5ICSA 1CUEA 1CKEA 1G21E 3ZC3A 3KR9A 1UP7A 5D5QA 4TS1A 2DPMA 1QIEA 2W22A 1E2NA 1D2CA 2AXQA 3P9YA 4LYAA 4AU1A 5H81A 2N47A 2WZDA 3Q3JB 5T5QA 3KAQA 2VWPA 4U7HA 4XARA 4B3CA 2XGMA 2I4IA 2CFIA 1W34A 4RQAA 2N0SA 5B55A 4QHYA 2C99A 1YQ9A 1NJ1A 3ENZA 1EHIA 3TLGA 2PUAA 1EBUA 1P2SA 2KZ8A 1IULA 1UQUA 1XXHE 2CJYA 5FI3A 3LT4A 3W6OA 3E22B 1O94A 4ZEVA 5KJ6A 3MQFA 2RONA 3DE3X 5KYXB 1G59A 3OM9A 1XYYA 5LWQA 1P1HA 3NGLA 3DG9A 3ZWQA 4M0EA 1W46A 3RTBA 3HB9A 1FDIA 4H0FA 3H5IA 5MGBA 4P84A 1XKQA 1B4DA 1UPCA 4IIJA 3SHOA 1JU9A 2XSZA 1FDUA 4NJEA 2G70A 2ZAMA 1O4XA 3V1NA 1KRHA 2GZHA 1WPQA 3FIJA 3UJ8A 1ZK0A 5EY5B 4KO1S 4A0RA 1ZZBA 1OROA 1CETA 4I6TA 5CYOA 3RS5A 3G2LA 3SS7X 2BUBA 1ECLA 1NVMB 1PVVA 1NNLA 2RK3A 4JBGA 3PJEA 5E2IA 3G02A 4QG3A 5EIWA 1NZJA 2JIBA 4CRWB 4KPEC 1UIRA 3IALA 3PQCA 2ECPA 5M3BA 4BNLA 2H2AA 2IYWA 1X7HA 3OP1A 1YBMA 3Q3VA 4Y6PA 2XZLA 3EH1A 4MYTA 4PPQA 4X44A 4MJ3A 4DE9A 2LXNA 2OGZA 3X1WA 5GONF 4JJ6A 2HF2A 5BYKA 3IEVA 1I3CA 3DNFA 2ZVPX 2C9MA 3WRWA 2BPOA 3DKPA 2IS2A 1K6IA 4H77A 4CIDA 1JLHA 1DEXA 1GAQA 4P3YA 4URYR 3FYDA 4CG3A 5FUQA 3FBWA 1WXIA 5DXFA 4QM6A 3OQBA 2ZRMA 2N75A 2MU1A 1GUBA 4URHA 2YQZA 2O3QA 4PHGA 1H4QA 3BGVA 4KUGA 5E9JA 3SPXA 3U16A 1YSEA 1Z45A 1ACLA 1KPIA 2E49A 2J3KA 5BW6B 1HNWB 1MEJA 3EEQA 4YJ2F 3RS3A 1G21B 1AUOA 1WJGA 3VKWA 4MKZA 1JHZA 1Y89A 3QE3A 4FHZA 2EQBA 2H7CA 2R7AA 4PS0A 4RD1A 5LDHA 4NU8X 1CZRA 1MAAA 4IDQA 4MS3A 3ZY5A 1FA9A 3JYHA 4BLVA 4CZ2A 4N48A 1M2OA 4LOKA 3PGA1 2KS6A 4BGEA 2ZUDA 3T6KA 3P52A 1PZHA 1SUSA 3B9BA 1D5WA 3QG1A 4GKVA 4Q15A 4P3OA 4CM4A 3PEYA 2BMDA 1YONA 1XXHB 3FWYA 3QE2A 1ZI6A 2NPFA 1UM9A 2A0XA 2HAEA 4LTNA 5K8JB 4HB0A 3G9UA 1XX6A 4O2AA 2B35A 5ALLA 3RU9A 2ISCA 3DZGA 3WP1B 5JZOA 4NRDA 3CZ5A 1NBHA 1G64A 1PZXA 2FF7A 2Z08A 5ISMA 5K09A 2F43A 5E1BA 2ID8A 2P6PA 5KIAA 4ZD6A 1JFSA 3H1PA 5L3SA 4J07A 1QAMA 3T94A 1ZDMA 3BJRA 3RIXA 5HKBA 4YRDA 3CEMA 2BOVA 3QUSA 4HEQA 1ZNYA 4MB0A 8AT1A 2Q3BA 4Y2TA 4BNZA 4EUFA 2G1PA 3MTGA 4X20B 4BWGA 3GL9A 2HM7A 2XUQA 4GP6A 1ISRA 2JBHA 4ZU3A 1J24A 5GJVC 1NI5A 1SCQA 4C0WA 5J2TB 1UBNA 1EBFA 3PUIA 2R1ZA 1SCJA 2GO7A 3OY7A 3MF4A 2AOUA 4J1WA 5JO9A 3LA6A 4P3KA 5DM4A 5LA6A 3X1MA 1VIYA 1QC5A 1B26A 2ZUEA 3QW2A 4F7DA 5IEJA 3S1SA 1F48A 3CVYA 4MJ7A 4MW2A 1XXLA 4RJKA 3TN7A 1GQFA 2C2HA 5BWNA 4L08A 2RAPA 1VSTA 3WGQA 4XUDA 1FW6A 4FHEA 2VSFA 4YR9A 3L7YA 1NT4A 2HADA 4G5OA 2R7NA 1V7PC 1M73E 3ZV4A 3AR8A 3AR7A 3BN3A 4BVHA 2REOA 4G0YA 2DM6A 5A62A 2A7XA 3V7UA 3NASA 3BE8A 1UKBA 1H94A 3TRDA 2Z2JA 1M0SA 1BWQA 2VZEA 4QHTA 1XSEA 3I76A 5CNMA 1JFFB 2IPXA 1YV9A 4QU9A 3LQXA 1K92A 4PO8A 1CR4A 1I3NA 4HNAA 2BFWA 1K3TA 3IBFA 4QNRA 2H1IA 4XQ0A 4OG2A 3EFOB 2Y76A 1EU1A 4YRKA 4TQ9A 4FDTA 5ITVA 1BEZA 3G2HA 3K5PA 3EVZA 3PU6A 1E4OA 4K8OA 3EX7C 3PB3A 4H7IA 3R5HA 2PUCA 5HDQA 2XKKA 2D62A 3ZWVA 1KE2A 3V4OA 1Q12A 3DZBA 3Q3GE 4JXKA 1AO0A 2PX2A 4WN9B 4ZCLA 3UQYS 2CBZA 1SH7A 4CI9A 4ZZ0A 4A2PA 3AJ8A 4FUQA 1Z15A 2NACA 1XVIA 1GV1A 2AFVA 3EHEA 3KVYA 4A8HA 2VHWA 4EH1A 4LXTA 4HQLA 1IC8A 3RSLA 4ZYYA 3UK2A 4BCBA 3Q4GA 4QBFA 1HDIA 1I2BA 1NM5C 4JP1A 5AW8A 1RWMA 1HDXA 3AB3A 1XL0A 1TNDA 4LDQA 4ONEA 4YQEA 3H5VA 1XPUA 2ZBFA 2ONZA 4G2NA 2H1RA 4MA4A 2GQ0A 2R6R1 4IQGA 3BCSA 1UF9A 3QU7A 1DTWB 3KKNA 4QTYA 2FFRA 3BXZA 1O5OA 1EESA 2OEPA 1F3OA 2JBWA 5CG1A 5K3EA 4UHFA 1DFIA 3DS8A 1JQJC 4UQLA 1KQPA 1O6GA 4NZPA 4JVNA 3JRNA 4ETWA 1KQFA 4EF4A 1Y9ZA 1XYVA 5AP9A 3D8RA 3GO4A 3RI3A 4UBOA 3CISA 1E1CB 5I5GA 2IV7A 2QP3A 5LMNB 1N75A 2BEJA 4HP8A 5GM2A 2H0QA 2CB0A 1E7MA 2NO6A 4U63A 1OH8A 4LZPA 5JPCA 2FEXA 5DCWA 3K2EA 4PTZA 4ZVNA 1LW7A 3I8XA 5FWAA 1X8KA 1US8A 2GESA 2O5EA 3ODGA 4FEYA 4HGYA 4RY8A 1B16A 3EB9A 3GEGA 4L72A 2X8BA 1N1MA 3PE3A 5JISA 1JI0A 2M6RA 2IPAB 1HLGA 3A0RB 3U3MA 4LNUA 1M8KA 2PR7A 3FMYA 1KSJA 3EZYA 3F6PA 1OGYA 3W5HA 3PUXA 4KXYA 4JXXA 3RSCA 2JIOA 1FDSA 4M7OA 4NECA 3RKUA 2HFZA 4F9GA 1JHAA 3LH5A 1YO6A 3KQQA 1I4TD 5JSUA 3PDIA 2J9RA 5K8CA 4JFAA 3IP5A 4R84A 5HUJA 4JB8A 3ED1A 4MHOA 4UVEA 4BPBA 1QYCA 2CGEA 2Q50A 4DDHA 1HQYE 3E7FA 4IEFB 2AKAB 2CHVA 2VOEA 2DE0X 1DC7A 1EZZA 5MN4A 2ACWA 3DMNA 1WQ3A 3D3KA 5TSDA 1J1IA 3K1ZA 1CRQA 1G5HA 4X6XA 3T5MA 5KSWB 1FFSA 3LE8A 4FHCA 1U8YA 3ZXSA 1UZNA 3ORQA 5HFNA 4B2IA 2DBYA 2A57A 3REQB 3FB1A 2R8PA 2RHJA 1AXEA 1RQLA 3SF8A 5I01A 1THMA 4LHXA 3JZFA 2JJ8A 5J2TF 4Z4QA 4BP1A 1RLOA 4D9MA 4DR3B 1IJBA 4OYRA 4CCWA 1EFRD 1F2VA 1XAGA 2E2WA 5FOUA 3AVVA 3GJTA 1P33A 3QH4A 4Q4AA 5CURA 1PR6A 2HA4A 3DXYA 1M8GA 1EP2B 2DJ5A 3JZIA 4MV9A 3LL7A 1A5BB 1G98A 1YZNA 3NIFB 3ZHBA 3CPJB 2FXIA 1OTYA 4Z99A 1WXGA 5CYGA 2WZQA 4JYBA 1LA2A 3RBZA 3P2MA 5TT0A 4FFOA 4NNOA 1X8XA 4M36A 1PTJC 5EHNA 1NSYA 1PO7A 1QTRA 4IDOA 2BHLA 1CQPA 2DC1A 3UKOA 1KAMA 4EG6A 1PD1A 2DOKA 2OAGA 1KZYC 3SE7A 4YREA 5JCJA 1UK7A 2YFQA 3LLUA 2OBNA 1DMRA 3QVGB 2RKOA 4NPHA 5JR3A 2DGDA 3SSAA 5A3SA 1TUBB 1Y4SA 4YRRA 8OHMA 3U44A 4QGFA 2YJ6A 3CZCA 4EUEA 3S8EA 4DUYB 3O8LA 4OM8A 1G2QA 4JT9A 3U3RA 1EPUA 1CF9A 3ND9A 2IU0A 4Q7EA 5FBLB 5C7IO 1RIIA 2DWQA 2I4MA 1RLJA 2YJ4A 4O8ZA 5ALWA 2B69A 5HP4A 3H2KA 4AW9A 5CVVA 2VQEB 1G8JA 3A9YA 1UMDB 4RD6A 1T36A 3ROPA 3AOEA 3GN2A 3C24A 3LBFA 4U2CA 1IRXA 1EUDB 1YQQA 4E2ZA 4M6WB 2FEAA 1VCHA 2ICAA 4O0LA 4KOAA 4BNNA 2QRPA 3KETA 3HS3A 5C18A 3UJNA 2X15A 1SOUA 2RH8A 1C1DB 1PV4A 5JZVA 3VPAA 2PIAA 5LLSA 221PA 4YNBA 2ZTLA 1MKYA 3KYBA 3QWFA 4M83A 2V5VA 3SI7A 3W79A 4BFZA 3T15A 2GJ8A 3JD0A 1VYVA 4A92A 1R6AA 3O9VA 1RP1A 1ZSNA 1ZSVA 2QPAA 2XGOA 3GVCA 3TLEA 2F67A 3F5SA 3HMKA 3VO1A 2I65A 4M1WA 3TZQA 1WEHA 1GLGA 2W6JA 3K5HA 1YZVA 3M6LA 4JIGA 3GEMA 3LLCA 1Q57A 5MFZA 3R3ZA 1T13A 1LI7A 1SO8A 4B81A 3E27A 2OPBA 1ICEA 4DR6B 1G63A 4ER0A 5DM1A 3GRZA 4D9HA 1IATA 5KNDD 3EAGA 1AZTA 4JBXA 5GJCA 2EOAA 1SEVA 2J4FA 5LZ2A 3IQHX 3ZIDA 5KYUA 2O1XA 3BQNB 3DBVO 4RKWA 2RIPA 4JOBA 4BAZA 1MW9X 3HCFA 3UXMA 1ZG3A 1OIWA 2VJMA 2LYQA 2GAFA 3ND7A 5A6SB 3QUBA 2IIPA 4WZ6A 2Q8NA 3W5DA 1N8TA 1KAGA 1GEEA 2CHUA 2GCNA 2H11A 2X86A 3QMVA 2P78A 4CKCA 3BRWD 3QTBA 2P35A 3AVQA 2HIAA 1I4WA 2IIVA 4DILA 2OD7A 4S24A 4O4JA 4ZV7A 3QBDA 2H17A 4LGMA 4NMXB 2NU8A 2ZRNA 1PUIA 3D81A 5AVUA 4PXAA 4O8BA 4HLNA 4Q19A 1CY8A 1JE1A 4JYMA 2AG5A 1PJBA 4ZI2A 1IM2A 1QZZA 3W1WA 4KIJA 3G2JA 1B15A 1HL3A 4LYFA 5TMPA 4O3MA 2GK6A 4G4GA 4FZ5A 2RB4A 4F96A 2BN4A 1E94E 1Z3IX 5AVJA 1Y7HA 1YRBA 721PA 2PZLA 4TTVA 3EG9B 2V7PA 5CH3A 3SGLA 5BSKA 4F93B 5KNDH 2J9ZB 1G5QA 3CINA 1NBIA 2P7IA 1CHDA 3CRVA 4QASA 3T7AA 1NI3A 3G8DA 2PU5A 2PEYA 1J23A 3GJ3A 1I2MA 3HPRA 4X1YB 5DI3B 5F51A 3AU8A 3F1LA 3N5KA 1T4BA 2Q7DA 3U1VA 3BWDD 4Z4GA 3RGWS 4LW8A 3IE0A 3QTTA 4TLEA 2EWWA 1OSNA 4DXDA 4BP3A 1QF7A 4OHVA 4UAJA 4G63A 3SKXA 4JCYA 1W49A 2IA5A 1VYHA 4RFVA 3T41A 2NAPA 3OCUA 4OBBA 1T9BA 1H2ZA 2IU4A 2VQ6A 4OLFA 4DLXA 3A9RA 3DKVA 2Q3DA 3X2EA 2HSZA 3LW7A 4L2IB 4J94A 2D1FA 1WH6A 4W5HA 2O4CA 2CCKA 1ABBA 3HXLA 1OXTA 2VHJA 4ZGGA 1SOVA 2V0GA 2GN8A 1Z8NA 2Q2WA 2R4QA 1KI4A 1NXSA 1NVEA 1R27A 3QU9A 1KZ9A 4IR7A 3DQQA 2XKBA 1E0SA 5CLIA 1GCOA 2WJJA 3WAJA 4QA9A 3R3UA 3AEYA 5EJ2A 1XCJA 2ERCA 3PYLA 3BWCA 3WKBA 2EEZA 2BGRA 2VPQA 1ECCA 1LVGA 3H0CA 5TC4A 2FPPB 1DWQA 3RR2A 1JQDA 3HC7A 3WAGA 4JUFA 4KDFA 2YY7A 4D8XA 5CDUA 2BP7A 1WMFA 3C3MA 2HLHA 1N0WA 1QH1A 1ATZA 3L07A 5HW0A 5I7OA 3U6BA 1V4NA 1YHYA 3K6RA 4MQMA 1KPGA 4LYYA 4YBZA 4R5MA 3N5CA 3BE6A 2W6CX 1TYDE 3HZOA 3ETEA 4MQEA 2VAMA 4KQ9A 1M6VA 2LKCA 2R9VA 3KD3A 2QRVB 2WM3A 1WKCA 1ND5A 4WA8A 3ZIUA 1B6SA 1B3RA 1CUHA 2QTFA 3SHQA 1QF6A 2X3YA 1GKLA 3F3MA 1BMQA 4X8HA 5KSYA 1WOMA 1VKRA 4QARA 3T35A 2QMZA 2BJHA 1EGVB 1QDLB 4IHQA 4P4SB 1K6EA 3L7OA 5D2CA 4QLAA 3TEJA 2W43A 4FX2A 1NW4A 5JTTA 4N41A 2PT9A 2VO1A 4FEAA 3ZI0A 1ESZA 2RE8A 4EQZA 5AW1A 2OILA 1D2GA 2C59A 4FXPA 3K73O 1JHUA 1E6WA 2AF4C 2WD9A 3TXXA 4BUCA 5KVAA 2QVBA 4ES6A 1JEAA 2OVFA 4G9GA 5IXYA 2A3NA 4PSAA 3O1LA 1S3FA 4FYWA 1IH8A 3AW8A 4WLOA 1KKUA 4C7XA 1CNEA 3LY8A 3OKFA 3EZ2A 3R75A 4NXMB 1QGUB 5CG2A 4GLLA 1TVCA 1KETA 1RLTA 3GQBB 1P7YA 3PPYA 4PR0A 4CDGA 4F04A 4PLZA 4MDFA 1OFUA 4I66A 3WMGA 5JYBA 2O8CB 1AZLA 2N9UA 1F1BA 1EFVA 4HLUA 1N34B 5AVZA 1AGNA 4IIXA 1JHOA 5A6VA 4FK8A 2IVGA 3UGJA 1Q1GA 5G53C 4PW0A 1Y9JA 2YVUA 4TMZA 5H16A 1PDOA 2GSWA 1E3DA 1H8HD 1LW6E 2BR3A 1EH5A 1CQZA 2QXYA 1MAHA 3RLIA 4BWFB 3AR9A 2O5VA 3C97A 2W2MA 3ZGVA 1Z6AA 1PJZA 4D4MA 3WGIA 3LNCA 4ZO8A 4J90A 2L69A 1OWPA 1C1XA 3LZDA 4EBBA 3BRCA 5J23A 2IYOA 4OB6A 1ZOLA 1CPYA 2BDTA 1BJKA 1N6RA 1PT6A 2J30A 2O2GA 2ZBQA 3I9NA 1QGZA 2HCTA 3JQAB 2R11A 5CFZA 1K7CA 5G4KA 2L0XA 4IMIB 3DQPA 5FJJA 5C1IA 1JJ7A 1A9XB 3I45A 1R6UA 4JUBA 1K63A 1UBRS 3PGXA 4Z4IA 4IMJB 2ZBPA 3NOOA 1FYXA 4OO3A 3UJ7A 1EM8B 3IMFA 1Q0LA 5GGXA 4GLFA 2HF7A 1T15A 4AKEA 2HK9A 4R3WA 3T3DA 5CB4A 4X66B 1NPDA 3GIDA 2FG7C 4JJ4A 1XZDA 1X74A 2XUHA 3DP9A 4NMWA 4AO8A 3EF3A 2JVIA 4LWPA 3AYXB 4IMRA 2K4MA 3RSGA 3H19A 5LIRA 2AK2A 2OGUA 3JQBA 4YT2A 4CR7A 1Y34E 4C6TB 7GPBA 3WXBA 4X97A 2K2WA 5CDHA 3E7PA 4TMWA 3FZYA 4G5XA 3BIXA 4JWKA 1N6HA 2FUCA 3MWDA 5F1KA 5HK9A 1HORA 1SHUX 1N7IA 1P6UA 1U4SA 2C29D 3JZAA 3FMFA 3PFWO 4QBHA 5ARDA 3ESZA 2XMRA 3GJRA 4FNMA 1OXUA 4GICA 3TK1A 1Y7TA 3OTQA 5ITZB 1BE1A 1L5HB 3GDFA 3QELB 421PA 1MGPA 4KVAA 4QJBA 3AHCA 5BR1A 3H17A 1QLHA 3G5TA 4GVXA 3W2TA 1UIMA 1F60A 1GN8A 3WJ7A 2J5BA 4BB5A 3BF7A 1FFDA 1EFUA 1ZJ4A 2NTYC 4RO0A 3LYLA 2QMHA 1DC8A 4D81A 3DEFA 3BSWA 5GADl 3HO1A 3STHA 1Z7EA 2FWJA 4TYQA 2P4UA 4G4JA 1AX9A 1JS1X 1KK1A 1Y63A 3FYCA 2JFUA 4JOQA 3QVLA 4RYLA 4CKBA 3CNEA 1CDOA 4ND3A 2CC2A 3RUHA 3D7SA 2CHFA 5IJ0A 3SR3A 1U0BB 1ANKA 3FKJA 1PR9A 1KH2A 3ON5A 3SXPA 4EL0A 1QX4A 1ZO8A 2GM4A 1TAUA 3MN1A 1FFXB 4M76B 3W90A 5HJ5A 1R2QA 4P92A 3BGDA 5CFQA 3A3OA 4DE5A 2V5AA 4R51A 3O83A 4OHKA 1XAIA 2V5UA 4Q05A 4BTLA 1YJAA 4B7XA 1YRLA 1VPEA 2QLLA 1D2RA 3WBBA 1JR3E 4BNWA 1F2TA 1QH8B 1WE2A 2CXXA 2GNAA 2RCYA 1O03A 4JJ7A 2F59A 2X9VA 5EXDA 1ESDA 5FPKA 2RBEA 3KOMA 2A1UA 3H86A 3IAM1 1XTBA 4H1UA 1KMMA 4D0GA 2W2XA 3LBYA 3VMMA 4BEWA 2I6UA 2JCGA 2VIIA 3TFOA 1VI2A 1F12A 1QZ3A 2B4YA 4NG5A 3A04A 5TJHA 4ZZ3A 2XVYA 4DCJA 1RDFA 1EZ1A 1UKYA 3AEQA 3I4LA 4AECA 1PR5A 4CMHA 3F1KA 2DYKA 3I05A 1F7VA 4FLFA 4RUKA 1NXPA 3ZBQA 1JKJB 1G42A 3OJCA 4OP1A 2XGSA 3HB0A 4MVCA 1U98A 3O8RA 4PM4A 5BNIA 2ZR7A 3DHYA 1U7ZA 2X3FA 3WMXA 2Y0BA 2OXRA 1XKLA 3T0GA 2SHKA 1MB3A 5ER9A 3FWKA 5HGJA 1L7MA 2BLLA 1PNOA 2PL1A 3P5BA 4BIMA 1WCYA 1CCWA 3C1OA 2Q1WA 3BTVA 3N53A 4REQA 5GV7A 3PDJA 1ZCFA 3MWEA 1ISHA 4QG7A 4JUCA 1FB5A 4LBVA 1DHRA 3E35A 5AOCA 5HMLA 5ADVA 5ANRB 4JEMA 4TXHA 4ER7A 3OCJA 4WLFA 2VRWA 2Q2OA 2GBGA 3ZV7A 4NTZA 1RC1A 1AURA 1CUDA 1OLXB 3ELDA 4JVMA 4V0QA 1F8XA 4X60A 2WQ7A 1GR1A 3R74A 4EA7A 3PUYA 1W6RA 3COYA 1AS0A 2ZRDA 1E2KA 2IL1A 1PK7A 2P2SA 1VKHA 2AXVA 1QFYA 2YWJA 3D2AA 3NIBA 3K0AA 3Q6MA 2DBZA 5J63A 2X2OA 3Q9LA 5B36A 3MJCA 3LKDA 5K3BA 3ROZA 2ASEA 4N01A 4N3AA 4WDQA 3SEFA 3SJ7A 1TD9A 2FW9A 4G1FA 4KFSA 1Z5OA 4IAOA 3PWTA 5EQFA 4BO4A 1MT0A 3P2YA 4F4UA 4F2WA 1NASA 1SXJE 3IE1A 2B4AA 3R6GA 1ND6A 4N0DA 3AY6A 3NRCA 5CAEA 5JCXA 1Z5UA 2CB9A 3DE0X 2PRZA 5G1OA 5DNUA 4AKIA 2NUPA 3R2JA 3B5JA 3RAPR 2J6CA 4YUWA 2QY9A 3QA3E 5EEGA 4UOQA 1N0VC 4UUQA 2EERA 4FFSA 2PDAA 2CMDA 4I9FA 3RFXA 3QQ5A 1BD4A 4KXFB 2G17A 5JALA 5D1NA 2UUBB 3HEAA 1XV5A 2CHGA 2WICA 5C5IA 2ZPTX 3J7TA 3ZUPA 2V4MA 3VR4D 4E03A 5JNTA 1E2EA 3MG9A 4INJA 4B6RA 1UINA 2SBTA 4J0GA 1DKQA 3MAGA 5TPWA 5BMOA 1FNCA 1Q11A 4BP9A 1QSGA 2EFCB 3U4IA 4BWVA 5DWQA 2FU5C 2G07A 4FYIA 4IVRA 4JP2A 1JW9B 1CQTA 3Q98A 2D8AA 4IP0A 4QFBA 3THWB 3V80A 2F1HA 4Y3UA 1FUEA 2BM1A 2X6QA 4TQAA 5KHLB 2FZWA 3IX7A 4IGEA 2UDPA 4OHRA 4MEJA 3H7AA 3E0XA 3LQKA 3K9FC 2PMKA 4TKVB 5IAAA 1FVFA 2L2QA 1OFUX 4ZU1X 5CFRA 1OX4B 2A0YA 2QG9A 2HO4A 2XT6A 3QPVA 4ZEXA 5LWHA 5ALYA 3TW0A 4OBEA 3DBHA 4GBJA 2B61A 2WPDA 4H7KA 5FHRA 3D6JA 3OPYA 1T5DX 3FFBA 3DVQX 4GOXA 4RKFA 3PC8A 1OJLA 1KNQA 2B1IA 1WS6A 3VR4H 4B1FA 4EHDA 1E3QA 1GZVA 1OLSA 4MROA 5CXXA 1R37A 5FFFA 3PUKA 5LB4A 1VE6A 3IQGX 1ZN7A 4EY3A 1VE7A 4IDAA 4TS4A 4U9IS 4F8EA 3V1KA 1U8ZA 4OLBA 5FBWB 4TM8A 1MX9A 2J9FB 2C4HA 1N2EA 4N54A 4ZIRA 2PVCA 2XOKA 1D09A 3JS5A 3KDPA 4R9NA 1TKRA 3TXAA 2IVBA 1ZN2A 4EL5A 3E3AA 1T1SA 2PSSA 3A8TA 2ZJAA 4DF3A 1C7QA 1DBIA 1SXJB 1FNDA 1VSBA 2GI4A 1FP7A 1TYZA 3B3GA 1JTVA 3HDQA 4UAGA 5K0CA 3R8FA 3ZE6A 2C2KA 1JR4A 1L9KA 1F2DA 1K75A 1GL3A 4LC9A 2IC5A 1X1CA 4MS4B 5KNLA 4WGGA 1HQCA 4QREA 5T4BA 3OJLA 3H3JA 1EB8A 1X1QA 1QFMA 2BE9A 2C2YA 3VV3A 4FVTA 2W6IA 3HVIA 4KDEA 1N1DA 3TFLA 2CMGA 2IZ6A 4F2PA 3FI0A 1HYGA 3NEPX 3QKTA 2OL4A 2FMXA 3HMQA 3C7KA 4IM7A 1LX6A 3MTQA 5LZ4A 3O9MA 3NAMA 2X42A 2XGGA 4GR9A 1EWYA 3OQHA 1JJVA 1U0JA 2JAOA 3URKA 3VR5A 4C3ZA 2X7JA 1EUYA 1S2LA 2YNMD 2PXEA 2VXCA 4BO6A 4EHAA 4FSHA 1YK0A 2C61A 4LF9B 1XRJA 3I34X 3WBFA 3AP2A 3R5JA 4J7XA 4HYTA 3UJ6A 4ITVA 3UK7A 1WETA 3B1VA 2DFVA 2E82A 2XVMA 1VE5A 1MAWA 1GG2A 3PA6A 5I9SA 1PZEA 4BQNA 1FDRA 2GRJA 1C9MA 1GA6A 1RQNA 1UXHA 2JGAA 3G9TA 3I1JA 2IP4A 3F9IA 1P73A 3H4VA 4DJJA 5JI2E 1PHRA 1TCBA 3E9DA 4F7WA 5DHFA 4G0WA 3EDYA 1WNFA 3JQ6A 1YQDA 4HFJA 3M1AA 4M1KA 4YQYA 3JXDL 2L42A 1J7JA 2H6EA 3EMBA 4P93A 1U99A 3VC2A 1N5OX 4BMXA 4X7BA 4LSMA 4UPVA 3G5LA 3THOA 2JLUA 1MNAA 4IHJF 5KJFA 4BC1A 5J4KA 1GPNA 3MBOA 3OJ0A 3QKSA 4WD3A 3PDHA 1T5OA 1NVFA 4R6WA 4J0IA 3R1FA 3P9CA 2GILA 2O2HA 3PBKA 5BSUA 4BTEA 2BDUA 3CNQS 2P77A 1GYRA 3CLUC 4CFYA 3LWBA 1HLFA 3Q7TA 5B64A 1GT91 2CK3A 3L0ZA 1ZJZA 3E5RA 3RJMA 3WKEA 1R0BA 2DH5A 4N7JA 3M0EA 3O4FA 4HGOA 3W7BA 3UMMA 3AESB 3HWX1 1RRFA 1XLTC 2PRSA 1VKJA 2X5XA 4OQNA 5ALVA 4N3CA 2XT0A 4KVGA 4UCWA 1XZJA 2EZ9A 5HF9A 4J75A 1IY2A 5IH7A 4AX8A 1F0KA 4YJ3A 5KC9A 4MQFA 1M2GA 2DZDA 3VR6D 1JVBA 1L4MA 4GQBA 2QUBA 3NUGA 3ITNA 2PS0A 3PC3A 3JVDA 2C1XA 3O8QA 2LCQA 1PJ8A 2KEIA 1MIHA 2GO1A 5DGCA 4I50B 1BX0A 3DB1A 3MJRA 3RHSA 4H7EA 4Q7JB 2ZR9A 5D3ZA 3ZKAA 1UJ4A 1DBWA 2DPYA 2R1JL 2E5WA 1E6MA 3PXGA 4DUZB 2IZZA 3FKSA 3V1TC 2HU8A 1ORVA 1D1QA 3JYLA 2EZTA 5ENVA 2PK3A 3R5FA 2J9YB 1IM8A 1XDGA 3AF2A 3KHKA 3QYJA 4S0XA 3PT5A 4V0SA 3TQHA 2PT5A 1C9JA 1DZIA 2CNLA 3FCXA 4LKRA 1S9HA 2PUWA 2OTCA 2WAYA 2Z2IA 1X7GA 5JDCA 2UVPB 1LLIA 3EWAA 1DDOA 4ENSA 1ZRMA 2OFWA 2JIZD 3S2SA 4OV6B 2C98A 2Y0CA 5ERYA 4AJ9A 2A4KA 1K6MA 4WQMA 5DOZA 2BGMA 2PD4A 4BLQA 2DUJA 2KHZA 4HUQA 4EFMA 1Z75A 3JQ8B 3KKMA 4KSYA 3VKVA 1BVYF 3LPCA 3N8IA 4CM5A 2C31A 2JA1A 3A6LA 2ANBA 2P2NA 3K1JA 3VR6H 1B0AA 3CURA 5HJ7A 3TF5A 3ZVNA 3IOEA 4ER3A 1LLQA 3EGVA 2IP2A 3LM8A 1XZKA 3AUXA 3RIGA 9GPBA 2IEYA 2RGRA 2V74B 3BEOA 3CLVA 2QYHA 3UICA 2JFOA 2AW5A 1E7WA 4G0ZA 1RHRA 4PX9A 3WFZA 1VGQA 1DQPA 5EZSA 1EUCB 2J6BA 3Q7PA 1NFRA 2XUIA 1EGAA 2ACVA 2F1IA 1O0BA 4G0NA 2Z58A 2O8FB 2HU5A 1HZZC 2JAQA 3WX0A 3BMCA 1ZIPA 1NR5A 1MQ9A 3BDVA 2FPWA 2PQ2A 1JEDA 5EESA 1E1RA 3NHBA 4EI8A 1ZMTA 2GXSA 5HOEA 1E0AA 2OWEA 4I5DA 2VYNA 1N5IA 2QP4A 2ZJ5A 2DKFA 4ISBA 3JQ9A 4Q1FA 1O94D 1LZLA 2QU8A 2VDOB 2XUPA 2XCLA 1KEVA 3CTPA 3L79A 2IYQA 4Q24A 4PQYA 1OHHA 3PP8A 4RMIA 4YASA 3BZWA 1QO9A 1C0KA 4LRWA 3EY9A 4PWZA 3ZXIA 4BBZA 5C4IA 1II8B 3ELBA 1NW8A 1PGJA 1FDOA 3KB2A 4YJGB 2VF8A 1C7JA 2VQFB 2CV1A 2XSZD 4Z0PA 3K4QA 4CF6A 3OEEA 1HDOA 5LYJA 1JHYA 1GHTA 2DY0A 2GK3A 1DKMA 1YIAA 1A0OA 1VG9B 1MDBA 2ORYA 5BN5B 4CKWB 1YR7A 1RAEA 3WYAA 5L4SA 1NQOA 1FFBA 1QGYA 2AFIA 4MKFA 3NHYA 3WLRA 4X95A 1QJ4A 4FFBA 1PFKA 5DT9A 4I8XA 5E3IA 3NEAA 5ARBA 3AF1A 1X94A 3GJ6A 5HSGA 1M6WA 3QUQA 4KQHA 1VCMA 2XB2A 3LPDA 4YP9A 2OG1A 4DLBA 4P0TA 1OYVA 2CUZA 2YJ5A 1ZIXA 3C6YA 1Z74A 4G8DA 4RVDA 2W83A 4W1PA 3HCAA 4ZVKA 1KSGA 2NVWA 3G49A 4F9FA 5CBKA 2IW1A 4TT8A 4F6LA 4W5OA 1XLUA 4E5KA 3DBLB 3MTEA 2HJSA 4BNDA 4CMEC 3RS2A 3G13A 2PSFA 2GFQA 4DCTA 3EPLA 1RHKA 1JSRA 5HEKA 2VHZA 3IQEA 1AHNA 3VXKA 3WP0A 3P9SA 4URZR 3H5NA 5DYWA 2ES4A 2F8LA 1V3QE 2IK8A 4MUAA 2HHCA 1P72A 1RYYA 3BWBA 1AJEA 1LDYA 3M6MD 5MF6A 2A3RA 2EATA 3WK7A 5J47A 1C0IA 4UUPA 2J7UA 3ZWAA 3BERA 4XYGA 5GVRA 2YCLA 3BGSA 4H3HB 1Q91A 2VCHA 4U0JA 1H05A 1GEGA 4WACA 3FVRA 1K8ZB 3GUCA 4NJMA 3L4JA 2EFYA 3CGGA 3KXDA 2XDQA 2B83A 1GZ6A 5B3JC 1T1IA 3FZEA 3QU2A 4K0KB 2X4DA 3WFJA 3VKFA 3FNQA 3WLKX 3ZZ1A 5AUPB 1KO7A 4LC1A 3W2GA 4R0MA 2JGDA 1LBSA 2AZTA 4XSVA 1K1EA 1FOEB 5AT1A 4DQVA 4BO7A 4HAXA 4I50F 1ULHA 4D3ZA 1JQLB 3UKDA 2D2VA 4XCXA 1W581 2IZ0A 4JBIA 3DKIA 3IKTA 1FZQA 3VNUA 2Q27A 4RDHA 2Q9BA 1AU9A 5DP2A 3GBFA 1BXKA 2HSGA 3S68A 5D84A 1N2ZA 3LF2A 2WJAA 2GJSA 1Q22A 3MS7A 3HDYA 1UKVY 5FOXA 3VHQA 4PLFA 5KX5B 1A4UA 3V9AA 3ZGZA 4RF4A 5EC8A 2V6MA 4Z7QB 5C1PA 5CA1A 1KQOA 9ABPA 4WESA 5MN6A 2W2OA 4KFRA 4YXWA 1O8CA 1R69A 2QOEA 4BQSA 4Q3KA 1K6JA 4UUMA 1ZIOA 4OD0A 3CVJA 2KWIA 1A4XA 2FPIA 1NQXA 2VT6A 1G2OA 2YV4A 4K86A 1Q3TA 4W7HA 2J41A 3NU1A 1BCRB 3S2GA 1U2RA 4ZT3A 1ONNA 5LNK1 5F1OA 2O8EA 3EZFA 2FWPA 3G0OA 1Q0TA 2ODNA 1GCIA 4IWRA 1C4XA 3RARA 3F2IA 2Q3LA 2JGEA 2ESRA 4EYQA 2QE7A 3A27A 1VLQA 1E2DA 4B45A 2G77B 2DR2A 3IJRA 3WTBA 1V45E 1NQAO 1M1XB 3EXIA 1G8GA 3ELYA 4RMJA 1JV2B 2QQFA 2ZSAA 5FD8A 4EENA 1MJFA 1K5PA 4XW2A 3STYA 5I9LA 4JSYA 2B4RO 5EPUA 1UKEA 2OFFA 1Z62A 9LDBA 3K0BA 2PM8A 1E5XA 4Z9AA 3AHIA 1TYAE 2QD4A 1E1QA 3G82C 4MSUA 4UNPA 3PPWA 1JPUA 4GVPA 4WKOA 5FQNA 3RYTC 1B41A 5DSXA 1G17A 2ZM6B 4Q02A 4RIEA 4Z4HA 1HDZA 3M82A 1PJ4A 4QTXA 1Z7WA 4R2LA 3X0DA 4ZAFA 4BL5A 3SVTA 1T2UA 5ICFA 3EVDA 2DPLA 4AP6A 1CRZA 3GWZA 5BYAA 4KAFA 3QMWA 3P27A 4EKGA 1QR2A 4WKCA 3TSWA 4A7PA 4DC1A 2ZB7A 3ANXA 2EW8A 3KT0A 5IBQA 1Z8FA 2QR3A 2XMQA 4LK3A 3RUCA 1YF3A 2P9YA 2B2NA 2C94A 1CUVA 2VTKA 3OLXA 4GZLA 3HN6A 1D5CA 1JR2A 1NTOA 1USUA 2VNAA 1KI9A 4X1OA 4BQFA 3AEXA 4HJXA 5BMVA 3OIGA 5F7XA 5J2TA 4AK9A 2O2IA 2PBZA 3CXUA 1DG3A 3H5WA 3G68A 2GS9A 2NYVA 3BRQA 5TB5A 1TC2A 3H1GA 1RRKA 4N5IX 4XLLA 4EPWA 3IIEA 1DV1A 1FQWA 3WNCA 1FDWA 1HH4A 1NSTA 3PR3A 4U5QA 3WGJA 4L9SA 3WHKA 3GAFA 3GEEA 3X1ZA 2H2HA 3NR2A 1UZUA 4L74A 5AYVA 4BVFA 4QJ4A 2NNLD 4HWSA 3ZWKA 2EHDA 2XUOA 1X70A 3NP9A 2H9AA 3F8TA 4ZP1A 3KWLA 3T4XA 1TT7A 2RGDA 2ZE7A 4E2YA 1FZTA 4EYGA 1R12A 3N2YA 5J59A 1QZUA 1HM5A 1H1LA 1VL5A 1ONBA 2OCAA 4QUKA 2O8VA 2D5AA 5C0OE 4IG4A 3ZNQA 3C7AA 1F2UA 4HDSA 1AUQA 1N77A 3MGBA 2G0AA 1G1MA 2H07A 4AMVA 4BATA 1KRXA 5KQGA 5JAHA 3LLVA 4RMGA 2G7MC 3FPBA 4CQMA 3A4IA 1SCUA 3V42A 1E6UA 1G9XA 2AJLI 3KR2A 3ZDZB 1GGEA 1PEYA 4OKSA 1C8BA 1F9EA 2BUCA 4D0LB 1GPBA 5D3MB 2NMVA 3EIWA 3CUUA 4LQDA 4C2TA 3D9QX 4F6RB 3MGCA 4PO9A 3ROGA 4YRMA 2WF5A 4O5OA 3GJ5A 2C3YA 4LFBB 2ZWVA 4X1KA 4BB9A 4ZI7B 4TWRA 3LA8A 1KEKA 4OMCA 1Y42X 2FMKA 3HM9A 4NI5A 4KLCA 3OD1A 1E4EA 2J9GA 5A5EA 3BS4A 4Q0MA 3HXKA 3S27A 1JHMA 1JT2A 3ZOZA 4CCAA 3BGWA 5J4LA 5KDLA 4KP7A 5I51A 2JRCA 5J4HA 3EC1A 3V4VB 1BA2A 2WUVA 3K09C 5A4FS 2AQIA 2AXZA 1U5BA 3HJFA 2EFGA 2XF8A 4IDGA 3LKBA 1JIQA 1JGTA 4NULA 3OFVA 3HBFA 1J09A 4KBYA 3G9ZA 2OWDA 2BEUB 4RHTA 4RE6A 1A8QA 4RPGA 2KI5A 2XRFA 5KX5F 4LY9A 2F3UA 3IUPA 4QXQA 4C7MA 5IHPA 2MXDA 1PFWA 1Z5GA 2YJGA 2X9QA 3T4EA 2P2ZA 4EG4A 4TPKA 5BNWA 5D5HA 1C41A 2GD2A 3OCYA 5B5SA 4GYKA 2HPHA 4YCLA 2ZIFA 4UHCA 5JQGA 1O5TA 2FHSA 1XF1A 3LT1A 2YQ4A 2XYPA 3C5HA 4LOAA 2GN9A 4N40A 1FS5A 4R41A 2MINA 3NZLA 1VG8A 2QX4A 2JLAA 3B8EA 1X1AA 2IYUA 4NE2A 5E1MA 2HMUA 1ZMXA 3GPCA 3PA8A 3G2KA 3IB3A 2GDZA 4DPMA 4U02A 4II2A 1ULTA 2PRJA 1FXUA 3LYHA 3T0FA 3WYDA 4XGIA 5KYYA 3F9CA 1WU7A 2WJGA 5HNKA 2JNWA 2WA1A 2V55B 3K1YA 5JCJD 2H2DA 2NV2B 3RC8A 3BPSA 4QXOA 5CB6A 3B3QA 1ESEA 1ENZA 3VDXA 2PRIA 5DPMA 2C0QA 2Y67A 1NF3A 3WIVA 1E2PA 4RL4A 4QATA 4EJ6A 3R0JA 1NU6A 3O94A 4P82A 1YJQA 1ZMOA 2ZAOA 4G0PA 2AW6A 2YZMA 1QNLA 5E6SB 5ALMA 6CHYA 4H0NA 3MWJA 3F6SA 4M8SA 3N70A 4WK0B 3LRXA 1D07A 3EXFB 3N3BC 4FBLA 4DBZA 4KR0A 2FZ5A 3GB9A 3QPWA 5ALJA 3RU2A 4KMSA 4GPBA 3E18A 4EG3A 3LAWA 3PKIA 3HJHA 3CX3A 4P6VF 4R0VA 5IAOA 3AU9A 1J5XA 3SJCA 3QKIA 4J29A 4K46A 4C22A 4PLYA 4QPZA 2Q5FA 3NNSA 4OI4A 3S81A 4ARSA 5A9TA 5LP6B 4H7DA 1TGVA 2BFFB 2CFRA 4Q9HA 1O87A 1NDQA 3ETHA 4PGFA 3ZKWA 4NFLA 2ZXUA 4RADA 4EGCB 4I8DA 4B7CA 3THSA 1EP1B 4DLVA 1C9YA 4MW4A 1L5SA 3KVNA 2ZJYA 3D7LA 2HPVA 1E5QA 4LZAA 1ZJ5A 3AK4A 2FQQA 3I42A 3Q9NA 1UJ5A 1DQYA 2YRFA 1Q1NA 3JAWB 1LZKA 4QXAA 5IN5A 3WRVA 1B23P 4W1RA 3RAJA 2X0DA 3KZKA 3BICA 3KZXA 2VL7A 4YXFA 3W5JA 2O19A 4EECA 5FR1A 5LZ9A 4JY7A 4WNCA 2W6JD 2Q21A 1PV1A 3TDMA 4J1QA 4KE8A 1GPMA 1Z6PA 4RKYA 4DABA 5HZMA 3EGXA 2C5AA 2R44A 2NU9A 5JZ9A 3M33A 4M1ZA 2YHBA 2G67A 2X7HA 3M2TA 4YCMA 3MELA 1PBTA 2D8MA 4Q4HB 3R3YA 5LJIA 4NS4A 5EERA 1J42A 2PZEA 1XZFA 5KKNB 2NXCA 5DWVA 1J99A 5EMMA 1A5SB 3S7ZA 3JVUA 4Q37A 4BNIA 2YN2A 4LF4B 4JUAA 5HIAA 3U1BA 3QENA 4MCXA 1W2GA 2ZYHA 4B6OA 2NLOA 3GD7A 5LQRA 4ZODA 5FOSA 3RREA 2A59A 1T35A 2YY6A 3CLSD 1L5NA 1TF5A 2PGJA 2ZTSA 4Q18A 3ROTA 4N0EA 4UEOA 4HOYA 2NW6A 5ALGA 2G8NA 2N1BA 2BF7A 2CVZA 5JBNA 3EAFA 2VF4X 3GEDA 1KWKA 2B8JA 4M1TA 4KE7A 3SZRA 3WDSA 3VDMA 4MYCA 1RRPA 3RVDA 2O7NA 1WTAA 1YC2A 1OREA 1AIPA 1QGOA 1U02A 1XO1A 3B8HA 3EEYA 4ARAA 3KPUA 4TS9A 1EVLA 4J7AA 5E95A 2GUWA 1DKPA 3JXEA 4DADA 2IYYA 4DV5B 3K8QA 4PEVA 1D03A 1PIWA 1CF4A 3A36A 4OMDA 4B48A 4MR8A 2BM8A 1TA4A 1C8KA 3FY4A 5C8YA 5C8DA 3G7NA 4X4EA 2AW3A 3PIIA 5EIBD 5FTNA 3ZWNA 1NM5A 1QZXA 5LZ5A 4S0ZA 1U1IA 1BW9A 5LQCA 3CVVA 4ZJZA 4UVIA 5EL0A 4R1LA 5BSWA 3OJEA 4OJQA 3F74A 1AMUA 3EIHA 1HG0A 4E5SA 5CHEA 2W58A 2VHUA 4ZI5A 2FKAA 3C5CA 4ZQGA 3LL4A 1NYTA 3JQ7A 2V8BA 1UBJS 3B1FA 3JALA 1OCEA 4LF6B 2A1IA 1QS0A 3PDCA 4IJMA 3TGWA 5ILOA 3EQ7A 1QH0A 1U7DA 3DCNA 3KEQA 2NSYA 1VGRA 4M0CA 3RYCA 1SXHA 5F9FA 1SB8A 2B9VA 2R8RA 4NV3A 4YIKA 3UGQA 1S1CA 4XH9B 4WOCA 3A1EA 3ZY3A 5KYTA 1TUGA 2R5NA 3I53A 1BCSA 2IUYA 4DNPA 1IVYA 3O8DA 3DWEX 3D31A 4KGVA 4GBGA 4F4DA 5AVRA 3TG8A 1PSWA 3O8BA 4TKZA 4MIKA 4E5NA 4X4BA 1TOAA 2Z6UA 2VHVA 3OOHA 4G1UC 1ZM2A 3QF4B 2DJIA 3HO8A 5K01A 4IXTA 3ZGOA 4EJSC 4KAJA 2HSDA 5ESXA 2R48A 1G20A 4JOSA 1VA4A 5EI5A 5K0ZA 2EP8A 1DJLA 4AS3A 1Z4NA 4ZJYA 2F1KA 1OFHA 4JQYA 1PR0A 3F4KA 3IBSA 1NHGA 3LKZA 3VUEA 1V7QA 3O9XA 3VNRA 1MF7A 3KS9A 2DG2A 5E6UB 2CDRA 5A5VA 5KWVA 1ZHOA 2AE1A 4I3FA 4IJWA 2GCOB 4BB0A 2QHXA 1MH9A 1ZRHA 4KH0A 3FJYA 1E1MA 1E7RA 3V4SA 1YZTA 1N5RA 2P4QA 3CUEF 3D1LA 3H2IA 4GQAA 1XD2B 3C85A 4PO1A 4ERNA 2ZJBA 4JXJA 3AUYA 3KPYA 1UC4B 2FQWA 3NANA 3QG5A 4QL3A 4W82A 2ZM5A 3OA2A 1CQWA 1NX9A 3KXIA 4JKOA 3T1TA 2NSDA 5CVTA 5LP6F 2P6OA 5IDXA 2PTHA 3QU4A 5DHRA 4IKOA 3VSDA 4Q82A 3ROMA 5EJ5A 3WWPA 3CG0A 5LQSA 5CT5A 1T9GR 2WWWA 2YASA 1CRLA 4P9NA 1N7HA 2QYTA 1XC7A 3BCHA 3QSGA 5HJ2A 3RVSA 3SLGA 3IKJA 3T5BA 4CIXA 1OC2A 5JBIA 4BY9E 4QDTA 3FOWA 2H7VA 5NLLA 4PBSA 3P94A 3RS7A 3C3WA 3JPWA 5JCOA 3V1YA 1OIXA 3TZHA 3NUZA 4LGCA 4CMAA 4NCBA 2C5EA 3TL2A 3TLBA 1QU3A 2KW5A 4TN5A 1QQ5A 3F2VA 2PZBA 3QVJA 1I3MA 2ZU0C 3H5OA 3M34A 1YOVB 3IO3A 3THXA 2PSJA 3VYTB 4MUFA 4FW9A 3RBXA 4RAQA 2OECA 1PTJA 5EHGA 1UEXC 1N3LA 4ZRNA 4B5KA 3TCKA 4G23A 1V0JA 5ALQA 4Z0TA 1C50A 3P20A 5ECDA 1WSBA 3HP4A 3O8NA 4HXYA 1C7IA 1WDLA 3SP1A 4B7AA 4ZK6A 5JZBA 4FGWA 2FDRA 4YAKA 2LCVA 1QE0A 1KI3A 4U8HA 3MWFA 1J2RA 1DWOA 3EMDA 3PNMA 1OE0A 1R88A 5DX0A 1LKZA 2AN5A 3D7RA 3OQ6A 3QWBA 4A0HA 2FK8A 1PF7E 2E4VA 3TG2A 3JW8A 3K1AA 1XRNA 4BNTA 1PGNA 5E8RA 1FW8A 3AZPA 3CM0A 1A5TA 4K9PA 2IDMA 5BWLA 3ZVLA 4CHTA 2NO4A 3GVXA 4UTPA 4XWTA 3WE7A 4JP8A 3HKDB 5TQ0A 1XWFA 5K0SA 4GKKB 2YMPA 1RE0A 4IGKA 4B33A 4AJHA 1QANA 2YWGA 4EHHA 1XK7A 1MQ8B 3L8GA 1SQ0A 3GFQA 3O5AA 2O1WA 2ZIAA 3UFBA 1HT2E 4KQCA 5JNSA 2FPMA 3U3DA 4Y9SA 2WK1A 3LFTA 3I0MA 1LY1A 2R6FA 3L7JA 4YB8A 1YBFA 3PZBA 3GCGA 5I7UA 1ZA1A 3H2YA 3CROL 1C1YA 2QM7A 4KXMA 1U3WA 1Y8QB 2VS1A 3S7TA 2ZT8A 3I2YX 4AO7A 4C89A 1QKKA 3ZCPA 4XVUA 1M2VA 1U2GC 4K3VA 2ZI6A 5H8WA 3K31A 3LPLA 3IAS6 3QYPA 4MNTA 1M33A 1WDKA 2PSHA 4P7BA 1M1UA 4Z9BA 3TE7A 1WZ2A 4TYMA 2C9ZA 3EGCA 4M1QA 1RKBA 5HQJA 4D8VA 4PN3A 1QHYA 3FPSA 3ADCA 3MCZA 2GBIA 2Q41A 4OJMX 1E2LA 2PXTA 1MJNA 4F1JA 2VZLA 2D1RA 2ZIXA 2UU9B 1JPVA 1M83A 1YI1A 4FQ5A 4FYJA 1U9ZA 4MB6A 1ORRA 2A0WA 3I9JA 4ZQBA 1EAYA 4CI0B 4L9WA 5IH3A 3WGZA 2EX4A 5TEVA 3UHOA 1KK3A 4GQIA 4FU0A 1R4MB 3AP3A 1MO5A 4ZCMA 1IM5A 5JVDB 1ZBDA 2VP4A 3MZ0A 3N58A 2W4MA 5TEWA 1W36D 1NI4B 4IQ8A 4M1OA 1LPOA 3ZV3A 4BQPA 2B92A 2VHEA 4ND8A 1X6VA 2UYGA 3GF4A 3KJIA 5BN4A 4CV1A 5LN1A 3ZY2A 4XX0A 4E2XA 1GGMA 1J2YA 1UAGA 4HFRA 4MI1A 3QNMA 2ZRGA 5I4KA 4U9UA 2VPTA 4IIYA 4ODIA 3NG1A 5FULA 3Q7IA 2EFJA 2NTEA 2XWSA 3TSZA 1Y7LA 1KZ6A 2AC4A 1OBVA 2WHPB 3HA5A 1JA1A 3KBOA 2WNHA 4YRCA 5TY0A 1MX5A 1AUVA 1I2CA 1I5OA 2QB5A 3DBIA 1NFQA 4J6FA 4P1ZA 4YMSA 4IW3B 1Y8RA 4LJ4A 2ZRIA 4YPFA 2Y1LA 3PNVA 1KJNA 4GT1A 5AM2A 4L5CA 3NHFA 2C8LA 3HY3A 1Z0DA 2H92A 2X2PA 1VGVA 1T91A 2CHQA 1W52X 4JOCA 1D8AA 2ZYVX 1ISMA 5D5PA 4K7JA 2QAJA 2DWUA 2QORA 3PRJA 4AZ3B 3D1JA 3K1TA 3WGGA 3ZJTA 3C98A 2WY2D 4YJKA 4XM0A 4X84A 3ZWXA 4L6AA 5KTYA 4GPD1 1EWRA 1P7PA 2ZI7A 3HB7A 3HB4X 4HGQA 5ALUA 1MD9A 3ESCA 5IC4A 2XUGA 2H8KA 5TARA 2H18A 4UZEA 3D5TA 5BOSA 4Y6QA 1GUYA 4JXZA 2VSYA 5T3UA 4Q93A 1GYQA 1OU4A 1KVTA 5FPSA 2QN9A 4HDMB 2VK2A 5HTOA 1EVZA 1T0BA 5B2ZA 4QTTB 2IKSA 3F3KA 3OPYI 5H83A 4XEHA 3TRIA 3TX6A 4GR4A 4BLRA 2VJOA 1WKBA 3CN7A 2P65A 3KSRA 1EFDN 3HVUA 4KO2S 3UJCA 1FBTA 2OMEA 3THYB 1RW4A 2JVJA 3CG4A 2IZOA 4MKGA 5F78A 4EEZA 1A4IA 3VKUA 4ANFA 4OPMA 5JRDS 3GUUA 2PLRA 3ZOKA 3GAAA 3CX7A 1B76A 1DQSA 2AG0A 2HSWA 4OHZA 2BCJQ 2QVXX 5JSZA 1P5ZB 1WHSA 4LYDA 4N03A 3UJHA 5ALPA 4EKIA 1A4RA 4PX5A 1WW2A 3A0UA 4PLCA 3CXRA 4KUHA 3I09A 2IXDA 4US2R 1ITZA 1JKXA 4F21A 1JG4A 1NJ5A 3CBQA 1RYEA 1XPJA 1ZNZA 1E5LA 1XP5A 2C9DA 2R5WA 3E5HA 5ALNA 1L7XA 4FYMA 4KLRA 4DA8A 1W5SA 5IKEA 1IHDA 2IPNA 1F0PA 4JYZA 3OX4A 1AF4A 1Y1SA 5EP3A 1Y9AA 3ADDA 4F3TA 4QE3A 1RHQA 3LUAA 1KO1A 1EWTA 4HQOA 3WNVA 3ZDEA 2DTEA 4OYLA 3K8OE 1C4KA 2C2ZA 3N28A 2P3LA 1A50B 3N2KB 2AWOA 3R3XA 4B79A 1THGA 1FS4A 1I4EB 2XVXA 1T3LA 5GOTA 2ZRKA 2HCJB 2HQ1A 2FMHA 4ZEMA 3MIZA 4H35A 2G1UA 3ILXA 4M38A 3TW6A 2Q46A 3PHGA 3EXG1 3SJZA 2DSTA 4MRMA 3GWGA 4PC1A 1V96A 3UJDA 3WK9A 1G0NA 2CF5A 1OOEA 2OXIA 3V7WA 1SKQA 1H0RA 1XZAA 3C3PA 2OV8A 4P4NA 3V6LA 2OG2A 1IOZA 1IQUA 4GWGA 4DJDC 1IZZA 5JD6A 3N8GA 1DVRA 1A69A 4O1MA 2NP7A 1I2DA 3AETA 1SCAA 4EYEA 1WLSA 1P60A 1DRWA 3COWA 1PT7A 4LZLA 1IBLB 1HLPA 3GOHA 1D8TA 2WPDD 2Z09A 4BFVA 2JI9A 3N6XA 3VYVA 4PIPA 5G41A 3RWMB 1UQTA 2C84A 2C2OA 5CNJA 5D87A 2P91A 3EDCA 3L6DA 1QONA 4DQXA 5JVDF 2E5LB 3ZWDA 3OZGA 4MCIA 4RV5A 4YCBA 4F06A 1DKRA 1EWQA 1NQWA 1G9SA 4NAVA 3B2QA 3HABA 3W8NA 4AROA 1NOJA 3PLAE 1QTQA 1GNPA 1KJ9A 3HYRA 4YH1A 3K0CC 4UEKA 4JLNA 2IV3A 2W2KA 2RHGB 4AMYA 1W93A 2XOKD 4MWCA 5EJIA 1Z0FA 2WW8A 3DC7A 3DHWC 4J1SA 4JLUA 1TX4B 4O4IB 2FP3A 4Y30A 3R7NA 4JX9A 4A16A 2HTFA 3L8ZA 1KQGA 4RV9A 5A4AA 1THZA 2Y2VA 3ASVA 3TE6A 4FI3C 4IS3A 3TVTA 4OAPA 1GPJA 1QIHA 3COPA 3LYAA 1RJFA 5FBRB 1TCUA 3K20A 1GSHA 2M6LA 2GEVA 4EK9A 4UBJA 4LI0A 2OK8A 1Y1QA 5IEBA 4MUYA 2IH4A 1DDGA 1TJ5A 2W6ID 1CW2B 3O73A 3ZJYA 1AY0A 2ODBA 2HRQA 2YMQA 3BA6A 3CEPB 4HLDA 2EWVA