4EKIA

Crystal structure of dot1l in complex with epz004777
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
319
Chain Sequence
b'KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 319
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ekiA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ekiA02
3UJ6A 3FUWA 4DA4A 3HM2A 2P3LA 3MQ2A 5P8WA 1BOOA 5H02A 5K0GA 3BUSA 3EVZA 2DULA 1ZHFA 1ZG3A 3R3HA 3BGDA 4ER3A 2YQZA 1ZQ9A 1PJZA 1SUSA 3GDHA 1TW3A 3TR6A 1XTPA 2XVMA 5E8JA 3KPWA 2ZW9A 2PJDA 3I9FA 3JWGA 3GGDA 5EMMA 2HWKA 10MHA 5DSXA 2YUIA 3UJDA 3X0DA 3LKZA 2ZZMA 3TKYA 4YUZA 5LQCA 1QAMA 3FUTA 5KS2A 4P7FA 1QAQA 3G2OA 2B2CA 2PX4A 1QANA 3SSNA 1R8XA 3E7PA 4BP3A 1AV6A 4U7PB 3BKWA 1U2ZA 1VLMA 2B25A 3FPJA 1G38A 1XJ5A 2BR3A 5C0OE 2O06A 1X19A 3CGGA 3R0QA 4GBED 3SM3A 4RTJA 3NMUF 3E05A 4ER0A 4M38A 4Y30A 4KW7A 1FBNA 2CL5A 1WS6A 2R6ZA 2Y1WA 3ID6C 4X60A 3UJ8A 5EMLA 4PGGA 4F85A 2IH2A 2HR1A 5ICEA 1SUIA 2FK8A 3A4TA 2OXTA 5EIFA 2I62A 2OYRA 5LQKA 1VIDA 3BGIA 4GC9A 3BZBA 3Q87B 4IWNA 1EAMA 3KQPA 4K6MA 5DM2A 5ICCA 4EKGA 1KIAA 3BWYA 3B5IA 5EHIA 4AUKA 4QTTB 5HFJA 3GRVA 3R6TA 4POOA 5DRYA 2XBMA 3KPYA 5GIPE 1SKMA 3G8AA 3P71T 2QYOA 1JTFA 3CCFA 5JUWA 3DLCA 3M33A 1NV8A 5DT2A 5CVUA 4RTLA 1WXWA 2A14A 3BGVA 4FSDA 5ICGA 3UFBA 2UZ4A 3EVBA 3DH0A 4RTOA 4PIMA 3KR2A 2NP7A 4YV1A 5G02A 3UJ7A 2Q41A 2KW5A 4ER6A 3L8DA 4PGHA 1KR5A 2I7CA 5EZQA 2AS0A 2NYUA 4CWAA 4QDKA 4RTRA 1QZZA 1I1NA 2PX5A 4X61A 5GIOE 3OCJA 3M6XA 5CVJA 2PWYA 1NV9A 2ONZA 2IDJA 3NWBA 3TM4A 4DCGA 4LG1A 3HCBA 1YUBA 2UYCA 2YTZA 2H1RA 3LCCA 2CWWA 3KPJA 1JQ3A 5GWXA 1XDUA 1D2GA 5DLYA 2OPBA 3HCAA 4G56A 3V97A 3E23A 1DCTA 4E2XA 3HEMA 3OZTA 4ISCA 2QRVB 5CUQA 3DOUA 5EMJA 4C05A 3FTFA 3IHTA 4O29A 4X41A 5CM2Z 1JSXA 5DTQA 1ZKDA 4QQNA 2PT6A 2P7HA 3KR1A 1KYZA 3ME5A 3D2LA 2XVAA 2IFTA 3M6UA 5BP7A 3U81A 3EEOA 3OU7A 5K0JA 2IGTA 2IDKA 2FYTA 1P1CA 4PONA 2CKDA 3LCVB 1XDSA 4MHTA 1PRYA 4M36A 5E1MA 1XXLA 1NE2A 3AY0A 2HNKA 3GWZA 3NTVA 5CVVA 3PLAE 4R8SA 4YUXA 1TPYA 3I5UA 1YFLA 1L9KA 3M4XA 5B1SA 4E33A 2Y1XA 4DM3A 5FQNA 3KR0A 2C7OA 2IBTA 1D2CA 2JH9A 3GRYA 3K0BA 3KQTA 4RVGA 1X1AA 2P1DA 2VDWA 3TMAA 5JR3A 2AN5A 2PLWA 2VZ9A 1RJFA 5HOQA 3EVFA 3TRKA 1Y8CA 5EOVA 2P7IA 3CJRA 4JXJA 3UJCA 2XYQA 3HA5A 4FT2A 3ELWA 4PCAA 3QOXA 2CMGA 3OE4A 4F86A 2FPOA 2YVLA 4MWZA 1O9GA 3TFWA 4RTMA 2WA1A 4EK9A 4B17A 1AQIA 4PYQA 4GEKA 2EJTA 4KDCA 3P8ZA 4XUCA 3LECA 2EG5A 4HRAA 3P9IA 5K0LA 3HP7A 2GPYA 4BY9E 1ORHA 3OZRA 2PV0A 3E8SA 1SQFA 2BM8A 2JHAA 3LBYA 2I9KA 5EPEA 1SVUA 3LCUA 5MHTA 2PBFA 1VQ1A 5FQOA 3UJAA 2YXLA 1R74A 5T6BA 2ZFUA 3ANXA 3MAGA 3KPVA 3TLJA 3QOWA 1L3IA 1R00A 2EX4A 3KHKA 3P2EA 4HG2A 1N2XA 1KHHA 4AZWA 5GINE 3TPZA 5K01A 5LSAA 3HVKA 3JWIA 3BWMA 3K6RA 5EC8A 4C04A 4C08A 2O07A 5LQJA 3UA4A 1Q0SA 2PSSA 3EGVA 1JTEA 2IP2A 5C1IA 4HC4A 2ZCJA 5DTMA 2YXDA 3DLIA 3G7UA 4HTFB 2B9EA 3PX3A 3SSMA 3RW9A 1NBHA 3SXJA 1XCLA 5E1OA 3Q7EA 3G2MA 4YV0A 4PYIA 3MCTA 3BWBA 5DRTA 3CVOA 5KVAA 3MB5A 1NW6A 3NDIA 2QM3A 5BXYA 3B3FA 3LL7A 3P9CA 4MIKA 4EVIA 5GM1A 1H1DA 5LQAA 1AF7A 1F38A 3EEYA 3EPPA 3O4FA 3IEIA 3DXZA 1WXXA 4R05A 2K4MA 2OKCA 2PGXA 3THRA 3O7WA 1XCJA 4QDJA 5T64A 5DTRA 1EQAA 3KQWA 5KQRA 3HVHA 4OBWA 4E2WA 5EEHA 4P7KA 2ZIGA 3HA3A 1G8AA 1YZHA 5HIJA 5DX8A 3KQOA 2G71A 3B3GA 3EVEA 4QPPA 3UBTA 2C7QA 1KPGA 3AJDA 3GNLA 5GOZA 1G8SA 4E31A 3C3PA 4ER7A 4IKPA 2PX8A 4OQDA 2AN3A 2ZLBA 3LDGA 5HZMA 4CXMA 3OE5A 2JHPA 1EG2A 2FRXA 4CKBA 2ZWVA 3BT7A 2V7EA 2P8JA 2P35A 5E2AA 1X1BA 4FT4A 4P58A 3G2PA 2ZBPA 3A7DA 2ZSUA 4NECA 4GOOD 3M70A 2ZIFA 5D1NA 4YMGA 1WG8A 3MTEA 1VBFA 3QV2A 2XYRA 3T0IA 2OZVA 2ERCA 1KYWA 3FPEA 1WZNA 2ZZNA 3FTDA 1G55A 4L7VA 2ZZKA 3DMFA 1BC5A 1M6YA 3HNRA 2NXNA 4LWPA 4E2ZA 4U7TB 5K03A 2C7PA 3A25A 4GC5A 1VPTA 2ZIEA 2OO3A 4XUEA 3HTXA 4CKEA 5CD1A 4GOND 5GM2A 3PFHA 4EKIA 2AOXA 2AOTB 4PYKA 3GCZA 3DMHA 3DMGA 1RJGA 5BW5A 1X1DA 1RI5A 1OR8A 3CJQA 3DR5A 3FYCA 3OPNA 5FA5A 2AVDA 4FSXA 2CMHA 1DL5A 1JG3A 2G72A 3GO4A 3KPUA 3HVIA 4QVKA 5EHGA 4UOEA 1JSZA 2ZBQA 5EQJB 5EG5A 3GJYA 2F8LA 4R6XA 5DM0A 4PYOA 1RI3A 2IH5A 1JG2A 2YX1A 2JH8A 2NP6A 4E70A 4RX1A 2ADMA 2FHPA 3S68A 5EGSA 3V8VA 3PTAA 4DKJA 3G8BA 3EVDA 4RVFA 5CCXA 3ER9A 4PYMA 4WVLA 2AOTA 1G6Q1 5EKXA 3EMBA 3R24A 4MTLA 4PNEA 1QYRA 2BM9A 3GRZA 3PFGA 1KXZA 1F3LA 5BW4A 5F2KA 2QRVA 1XVAA 2JHCA 3EVAA 2LD4A 3GXOA 2ZULA 4PYLA 3KR9A 1KP9A 4XCXA 3DXYA 3FTCA 4BLUA 5LQNA 5K8VA 4RVHA 3MHTA 4QVGA 5E2BA 1NBIA 2PKWA 4QQKA 3AWIA 2AR0A 3G88A 4FP9A 5K05A 4XUDA 3MCZA 4GOLD 3LSTA 4PCLA 3PVCA 1JQDA 5EIWA 7MHTA 2IBSA 1R6AA 3FUXA 3SR4A 3DXXA 3NVMB 3KQQA 4GQBA 2QE6A 5DPMA 1YB2A 5EMKA 5CIYA 5K0EA 1VP3A 5KQSA 1RI2A 5FHQA 1HMYA 2AOUB 4BLWA 4DQ0A 1IY9A 2GA9A 1HNNA 3IV6A 4V0QA 5DX0A 5K0FA 1O54A 2AN4A 4RYLA 3GU3A 2ZWAA 1KPIA 5D1HA 4DCMA 3MGGA 3NW9A 4C07A 4RTNA 1JQEA 3BXOA 2PWPA 2PXXA 3LDUA 4CKCA 3REOA 4YV2A 1N7JA 2Z6QA 2YR0A 2HMYB 5DXJA 3P2IA 2PVCA 2GAFA 3AXTA 2VP3A 3HCEA 4P7GA 5DM1A 4C4AA 3VYWA 1SQGA 2GLUA 2XYVA 3EGIA 4WXHA 2PXCA 3ELUA 4ATNA 1UWVA 4AZSA 1DUSA 2NXJA 4CTJA 3SMQA 3ELDA 3FPFA 2NXCA 1L3BA 1G60A 4LECA 2AOWA 3CJTA 1NW3A 1INLA 3GIWA 5DSTA 3TM5A 4PYJA 3I58A 4R6WA 1X1CA 3EVGA 3ORHA 5FWDA 1YF3A 2IPXA 2AZTA 3EVCA 4RTKA 1NW8A 3HVJA 4QTUB 3PT9A 4DMGA 3A7EA 3SX0A 4YMHA 1MJFA 1FP1D 3TOSA 1N7IA 2JJQA 4OQEA 3BKXA 5FHRA 3MERA 2N47A 2P40A 5FCDA 4A6DA 5LQRA 4IV8A 5CVDA 1T43A 2DPMA 2OBFA 3BWCA 3C6KA 3DULA 5E9WA 2EFJA 3KQYA 2IIPA 5FUBA 4KDRA 3OZSA 4X1OA 5EZSA 1M0EA 1IM8A 2QY6A 3DUWA 4H0NA 3B3JA 4HTFA 3VSEA 1ZGAA 1BHJA 3SVZA 3JWHA 3A27A 4KVZA 1EIZA 1RI4A 4AZVA 4KRGA 4YUWA 2R3SA 3G5LA 5CVEA 1I9GA 3UJ9A 5FA8A 5K0NA 4PWYA 2NXEA 5E9QA 3GRUA 5F2NA 1B42A 1M6EX 2EJUA 3T7SA 5M5BA 5E1DA 4AZTA 2O57A 1SG9A 2B3TA 2V74B 3G2QA 2H00A 4BLVA 5FWAA 2OB1A 1RI1A 3M6WA 2C7RA 3LKDA 2WA2A 4FGZA 3G5TA 5HILA 2VDUE 3KQSA 1VP9A 4ER5A 4EQZA 1VE3A 5C9ZA 3NVKI 2UYQA 2VDVE 3O31A 2AOVA 2P41A 4R8RA 2HTEA 3DP7A 1D2HA 4P7JA 4AX8A 1XDZA 3VC2A 1ORIA 3T7TA 2IH4A 1KPHA 4C03A 4RTSA 3NWEA 5E9JA 3FRHA 2Z6AA 3VC1A 4DF3A 3MTIA 2FK7A 4RVDA 1P1BA 1R8YA 3KKZA 3TQSA 5T67A 5K0BA 1I4WA 3LPMA 3P97A 3B89A 1O9HA 1UFKA 4ZTBA 2AVNA 2B78A 3ELYA 3NJRA 4FS8A 3A26A 5LR6A 2VS1A 3LHDA 4GUAA 3UA3A 4HSGA 3LGAA 2G70A 1P91A 1R18A 4YUYA 3KU1A 5FULA 1BKYA 2HV9A 3LBFA 3FUVA 3P9NA 1EJ0A 1UIRA 2O0LA 2ORED 3OFKA 1WY7A 4PINA 4OBXA 3ER8A 4RTQA 4HH4A 2PY6A 4GOMD 2GH1A 4F84A 2H11A 5E1BA 1AQJA 2FCAA 1JR4A 2ZBRA 1IXKA 2PXAA 3OFJA 4KWCA 4BP1A 4FR0A 1RJEA 8MHTA 4HGZA 1VL5A 3LDFA 3P9KA 5K09A 5LQUA 3FPGA 1FPQA 3LX6A 4PYNA 1NW7A 3OU2A 4E30A 3KQMA 1Q0TA 4QPNA 5DM4A 3WSTA 5ERGB 5DX1A 2ZVJA 2OB2A 4Z2YA 1FJXA 2YXEA 4CTKA 1RJDA 3F4KA 5HIIA 5FADA 3UZUA 1P39A 3PX2A 3T7RA 5CCBA 2G8NA 4M37A 4DZRA 4E32A 3UJBA 3HA7A 5GP1A 3KQVA 5HIKA 3FYDA 4GF5A 5DWQA 3RODA 3EMDA 1L1EA 1JG1A 1YZ3A 2UYOA 2P3QA 4RWZA 2ESRA 3PS9A 4A6EA 5KYGA 4MQ4A 4RV9A 2NNWB 2P3OA 5ICFA 2JG3A 1NW5A 5F2OA 2GB4A 4OX9Y 4RSRA 3FRIA 3SSOA 5EVJA 3CBGA 3EGEA 4FZVA 5E8RA 1V39A 2E5WA 2I6GA 4M7RA 3B7PA 1FP2A 3DTNA 2BH2A 5EEGA 4PIPA 4KIFA 3C6MA 3G89A 4EMSA 3ERCA 5DXAA 2BZGA 1NT2A 3FUUA 2GS9A 4Y2HA 1NKVA 3FZGA 3GRRA 4E2YA 3FTEA 3SGLA 5EKUA 2G1PA 3M6VA 5FTWA 1TW2A 1EJ6A 1L3CA 5HIMA 1MHTA 4OA8A 2ZTHA 4OA5A 9MHTA 1ZGJA 3THSA 3HCCA 1Z3CA 2ONYA 3IYLW 5IKMA 1JG4A 1QAOA 2Z6UA 3R9XB 2BR5A 2AOUA 5IH3A 4HGYA 4IV0A 3PB3A 3CC8A 3JWJA 3RIEA 2OY0A 2O05A 3HCFA 3CKKA 3OU6A 2PX2A 3C0KA 3I53A 4LWOA 4X63A 5U4XA 3FPHA 5K0CA 2UYHA 2PT9A 3AXSA 4YUVA 4KIGA 3HCDA 2BR4A 3H2BA 3TKAA 4C06A 3C3YA 3P2KA 1YFJA 4RTPA 3UWPA 3I64A 5HEKA 4V0RA 2WK1A 3NDJA
chains in the Genus database with same CATH superfamily
3FUWA 1ZW1A 1GQQA 1FJ2A 2JLVA 3FKSA 4LNUB 3BUSA 4I4TB 3QUBA 5CLQA 4BMSA 4S0XA 2IUYA 2VHCA 3U7EB 4TPKA 1OI3A 4EGSA 1TW3A 5AIBA 1L1QA 5EYPB 4AJ9A 1E89A 3G85A 1VFNA 3FKSD 3KPWA 3GBVA 2VJMB 4X4GA 3FVVA 2QQEA 5HQ3A 3K70D 2KI5A 1QP7A 2ZTLA 3PUIA 1MC5A 4JOQA 5CAEA 4DR2B 3GV0A 1MTOA 4DR4B 2FXVA 4EPXA 4AICA 1D2EA 3S2UA 3RZZA 1IIRA 1JIKA 2GNPA 2GARA 2I4NA 2ANBA 1Z68A 3AM5A 3EG9B 3FBTA 3H2SA 3LHFA 3V8PA 1SD1A 2RJ3A 3ITNA 2W90A 3TTSA 2XMSA 4FFBB 1PL8A 2ZSEA 1F8UA 3F6EX 4N1AA 2NU9B 1D2MA 3EXEA 1TYEB 1KWKA 1NLUA 5F1YA 3NWOA 4M38A 2K87A 3MNFA 2Q9UA 2VNKA 5A5FA 2J0UB 4TT3A 1SUIA 5JJKA 1ZM7A 2JFHA 3HLKA 3I2FA 3KJZA 3BGIA 1QH9A 3OKFA 2Z3ZA 3RGGA 3KQPA 2I3AA 4GGMX 3S2FA 4TT3D 3GDFA 1E5QA 3GLTA 2DY0A 1ZS9A 3HP1A 4LYHA 1E2DA 5DKFA 2J5KA 1BX1A 1T2CA 2R97A 3L7BA 1Q5PA 4OIFA 3KPYA 5ER6A 5HFJA 5IVDA 1WUJS 4JI4B 2QYOA 3OSZA 2FWAA 2IUOA 3JAWA 3LXUX 3S4YA 2Z2JA 1E3OC 3OJWA 4L5BA 4LOHA 3IEMA 3UFBA 4UM9B 4RM2A 2CNBA 2WWWA 1CB0A 2YXPX 3IQZA 1MFZA 1USWA 1K4KA 1DRKA 4IVPA 4CM9A 1MX5A 5F7XA 5JVDA 5KWIA 4TTQA 5K1ZA 1H42A 1QQ7A 1JVBA 1E2IA 2H85A 4PGHA 1Y1RA 1PYGA 4QFCA 4TWAA 1C3LA 1WV1A 2OK7A 3DZHA 4JBGA 4MTCA 3I05A 2QUHA 3A6FA 2IDZA 3PDIB 4CM9D 3KJHA 4W5HA 1Y37A 1Q3KA 1P4SA 1PLKA 2QD1A 1PKXA 1NV9A 5H83A 3E7FA 3WRVA 5A2GA 4N9WA 2HY7A 2NYAA 4W8HA 3SS9X 1UJNA 3JQFC 3IKJA 3DV0B 4LF9B 2WTNA 4QUEA 2XKKA 2PH5A 3C3XA 3HC7A 5JECA 2YS7A 4GKAA 3JWPA 3RHZA 2AMLA 2A0KA 1GTJ1 2B4TO 2BKUA 2ZCUA 3BIFA 5HVNA 2O6HA 3BULA 1BOFA 3DMDA 3RABA 3H9EO 2PT6A 1B8VA 1OFHA 1AKVA 4INPA 1HG0A 3ME5A 1BW9A 2XQGA 3MBKA 2E7ZA 4P08A 5A9SB 2ZAMA 1A1SA 4CMIA 5ALXA 1O8BA 4PSKA 3IUMA 2BISA 6LDHA 4C21A 3IBTA 4EY6A 4Q47A 1XG5A 2XKAA 3LCVB 4UHKA 5AIAA 3PFIA 1U63A 4NZMA 1WHSA 4YMVA 4Q9NA 1PZXA 4YUXA 4H27A 1CS0A 1XU7A 2G63A 1YS6A 2C92A 3HVUA 3HY3A 1KP3A 1F1JA 5FBWB 4CM7A 1ZPDA 4KBYA 4UAGA 5I7SA 3HKEA 4OJKA 4G9GA 3RUEA 2PUCA 4G0PA 4ZTZB 3ZWXA 4DR1B 1RKBA 1YCHA 1D2CA 2H16A 1TAQA 3K1YA 4J90A 4LMBA 3TZBA 4MR7A 2DWUA 1A9ZA 2AN5A 1KEUA 2VZ9A 4EHKA 3VBCA 4RQUA 1FNDA 1IOVA 1CJBA 4JXJA 1XQWA 2NW6A 2DLCX 2IPLA 3AERA 1H93A 1QV9A 3L4JA 3TL2A 2O7SA 2FZKA 4PO1A 1PWYE 1Q44A 2JNWA 2EEZA 3IUEA 5E4YA 5EQDA 4C78A 4NAUA 1BN7A 2YJ3A 4DA9A 1MO6A 1OJ7A 4GOKA 3C3WA 1G21A 3F8SA 1GARA 2O8DA 2EG5A 3COSA 4NJMB 4EHHA 3LTNC 1IY0A 3IJ5A 3QKRA 2WPNA 3N6RA 4WNAA 5C52B 2WTUA 4J1NA 4RPLA 1FQWA 4ETMA 4Y6RA 4DAOA 4JLMA 2PRZA 1PL7A 2H06A 4A5SA 5MHTA 2D54A 2AN9A 4Z4FA 3T61A 1ZA2A 5HFNA 5ELXA 2DHRA 2EZ8A 3HY4A 4UMDA 3MK31 1DLIA 4NBSA 2O5RA 4YQFA 1YZTA 4TWJA 5BVHA 1E94E 4I1RA 4FWIB 3WADA 1XC7A 3EDRA 3CWQA 3NKVA 4G81A 3F7OA 4KV7A 4LC0A 5K3SA 2D74A 3MBIA 5AKZA 3T3DA 1RAAA 1U0OC 4QTYA 5A71A 4FKZA 4OSPA 1JYFA 4NFHA 3IUBA 4C4XA 2GK3A 1XZJA 1KI8A 1NFQA 2Q6TA 4TTAA 1F0PA 4UM7A 4ZOAA 3G7UA 2A92A 4IHJA 2XTNA 3DE2X 1JAIA 2XDQA 5ALHA 3QX9A 2CXRA 1OX4A 1YR9A 1NBHA 2X14A 3C8DA 4L0MA 2OHVA 1C0IA 3OJ0A 1NYLA 4J0HA 2JDID 3C43A 4TSFD 4DSOA 3B36A 3RTAA 1MEEA 2YMPA 5DGHA 3A6HA 2DF8A 3EWSA 4YG4A 4EI7A 1MW8X 1A9XB 4IL5A 2OKCA 4NU6A 4U63A 1Z4LA 3DYIA 4INJA 1EWTA 1PDVA 2V9PA 4Q1AA 4EFDA 5EXPA 2VDOB 3PJGA 2W93A 1JZTA 2GVNA 1LBHA 4K1LA 2JJ1A 4PQFA 5FPYA 5JCOC 3OCXA 3ZLJA 1L4MA 4PLPA 1RACA 4HRVA 4JBHA 4QRIA 4DPKA 3TINA 3C3PA 1WH6A 1C0EA 1AO3A 1YRYE 4OXRA 1G3IA 1QYVA 2JJ1D 4WXMA 1Z6GA 4F3RA 4DR7B 2X86A 3VDQA 3UPUA 3PK0A 4LSGA 1T34A 2HBRA 2XQFA 5EJ4A 2Y1DA 3H4VA 2EHDA 3FPBA 4RJLA 4YXWA 3V80A 5E2AA 4DDTA 4FT4A 1KNXA 1Y81A 2FN3A 5JEEA 4NH4A 4PU8A 1A95A 1U0LA 4J07A 5EZYF 2QYSA 3AF2A 2ATVA 5LPNA 2BFOA 3T0IA 4B3GA 4MW9A 1KSJA 4HQFA 1RM3A 1YQEA 1BD4A 2QN6A 4C76A 1AGYA 1BC5A 1W1IA 4KI0A 5DF1A 2CFSA 4U7TB 4ZAFA 3W4KA 4FINA 4F06A 3ZVMA 5DN6A 3ZDXB 3QWHA 4R1PA 3TSCA 2ZJ7A 3BA6A 4PYKA 3GCZA 1RDFA 3UWDA 4G1MB 3W5IA 3WIUA 5BW5A 3W5UA 4YMTA 3SFZA 5AESA 3H9QA 4RM3A 3H11A 3DR5A 1YHYA 2CMHA 2HA4A 4GZ3A 1Y9QA 4YGYA 3KKPA 5KTMA 2QTRA 5KU1A 5COQA 2BMDA 2Z04A 1GOTA 1P77A 3WL4A 2QQ0A 1T9ZA 2YHUA 2XUIA 1HTWA 3IDZA 5EJ5A 5LDGA 2HYDA 3WYFA 1CPYA 4PC6A 3IOEA 3J7TA 2Q2VA 2Q27A 3FB4A 5AW5A 5TPZA 2GNAA 3TUJC 1OAOC 2BHSA 2YZKA 4C7XA 5A06A 2PUJA 1IDOA 5DHUA 4YI5A 1ONOA 2DLDA 3MWDB 4NABA 1U6IA 5TPZD 2MTBA 3DVAA 3TLYA 1LBTA 1M72A 4ZYTA 5KKCA 1H66A 1SQ0A 3QU9A 1ZRHA 1XEAA 2Q1TA 3B12A 5ELLA 3NT5A 1P2VA 2ZM5A 4EO7A 2BFEB 1CUJA 2GM5A 4OB7A 4PNZA 3N05A 2HCSA 1TQ8A 2X6TA 2XY4A 4EMBA 4B3SB 1A98A 4ZVQA 3U4DA 2FFQA 4GHWA 2WG1A 5FOWA 2B5AA 3KDPA 3ETNA 3CRVA 4DIDA 5DGIA 1DEHA 1RWOA 2G88A 3GNSA 4IJKA 4YDRA 2VCHA 3CIOA 1ESNA 4D8VA 5I7UA 3U61B 3EB9A 2JRCA 2PHZA 1KJ8A 2ZWAA 4QUBA 4K05A 4E22A 1EE2A 4DT1A 2VYVA 3PQ4A 2YR0A 1RYYA 3AKDA 3LHKA 4R0NA 5HF9A 2A4MA 5BOVA 3V3KA 4E2FA 2VT3A 4G85A 2ZKLA 4ZT4A 1POUA 4UZSA 5JCJA 3VYWA 3K6SB 9LDBA 5BWOA 3EGIA 2OO5C 1B73A 3KTOA 1UWVA 2OYSA 3ETDA 4MWOA 4KUEA 2HLHA 4O2AA 3A14A 1DBRA 1MIOB 3FDZB 4OHCA 1V8OA 5H68A 3RYTC 2BFFA 4BMPB 4C4PA 5JCJD 2JLUA 3QXXA 4NCAA 2N9UA 2F9MA 3FI0A 4UTRA 4ITVA 5FWXB 3D8RA 4AY2A 3HJGA 4YAIA 2AZTA 1IXZA 1EDBA 1MD9A 2AMYA 4DIKA 2X0JA 3GFPA 5LWHA 4DMGA 2XUPA 1BDMA 1K5GA 1ZSYA 2GHRA 5AVTA 2G25A 3BKXA 4DM7A 3QXHA 4X8HA 1PP4A 2YV1A 3RRXA 1OXXK 2NLOA 2QTTA 3I1FA 4N5IX 3T5GA 1XUOA 1NXWA 4LZPA 3ESDA 1DC3A 5ENVA 5EZSA 3QQ5A 2I1LA 3DUWA 2VQFB 2DR2A 4QPJC 3IALA 1N9GB 1Y4UA 3HFSA 4EHIA 1E2UA 1KSHA 3JQ9C 1C30A 1LDMA 1K8XB 5KEIA 1CFJA 1D0SA 1SA0A 1VG8A 1Y3AA 3FMOB 3G0DA 2Q28A 1T1IA 3K8YA 5CGZA 2R3SA 3AEQB 4AN1A 3B5EA 4FEGA 4LA4A 2JF0A 4CDNA 3C8ZA 2Q0XA 3AEYA 1M6EX 1NVGA 3DEHA 3NKFA 3EA4A 1D09A 2C2HA 4AJIA 5TRTA 2B3TA 3U80A 1TU0A 3VOSA 2FW6A 5FWAA 2OB1A 4DIFA 4LZJA 5EJAA 1ODSA 1BHO1 1CJCA 5DLEA 5B3AA 1ZK4A 3BZWA 5JMTA 3G02A 3G5TA 1QRSA 4U7GA 2UYQA 4B6OA 2K7ZA 3TLMA 3GB9A 4R3UC 4I08A 2RHTA 2Z5VA 2DPHA 1UDAA 4FMCB 4KQHA 4RE5A 4X1IB 4F0JA 4F3CA 1JKJA 1PR6A 3S70A 2DB3A 4TXMA 5FT9A 3ZWWA 4PR3A 4HD8A 5FWYB 1ABEA 4IQ0A 1OZGA 4BNDA 1XLTC 1M9NA 4I5IA 3ZE0B 1NG1A 2ZCVA 1O6ZA 3SQWA 1FNBA 4AQ7A 3MXOA 4EH1A 3MMSA 1UMCA 2WJ6A 3SIWA 1ZZBA 2AVNA 3I04M 4PSVA 2VP2A 4BU1A 4AX4A 1VPEA 2WT8A 2W4MA 2ZQYA 2XXAB 1YUNA 3BMOA 1OKKD 4IDAA 1OH8A 2H51A 4DQKA 1WABA 2LYPA 3R1FA 2ON6A 3AY6A 3O38A 4HPWA 4TV9B 3PITA 1B8OA 4O3MA 3EFOA 4X3PA 1K97A 4OQ4A 4D9EA 1SUDA 1ZH6A 3QBTA 4JCCA 4ZICA 1PJQA 4UU0A 2IP1A 4GSLA 5BQFA 2LYJA 3L1JA 4YRFA 4J1TA 3LS2A 4CQNA 2V5VA 2PXAA 4L74A 2VA9A 4K8RB 4D44A 2JLXA 2IEYA 2EIXA 1RE0A 2F3QA 4C0KA 2P75A 1CUUA 1RBMA 1A2OA 2DHEA 4Q21A 3NIBA 5K3OA 3HHPA 2CHVA 2OBBA 4OLJA 3HRIA 5DM4A 3QU5A 4BVLA 2NV2B 3R3YA 3E22B 2IK8A 1O08A 1QYXA 3GDOA 3KEGA 1AT1A 3ZNPA 4OHFA 4YRZA 1IEVA 1FFEA 3RSQA 1I0LA 2QJTA 3E6AA 2ACKA 2G82A 1EVEA 2FEOA 1HGXA 1E7WA 1SBIA 2JLZA 5HIKA 3CH6A 3M5CA 2WF8A 2QBYB 1QVVA 4GF5A 4QA9A 1BSVA 2BDEA 2D6FA 1EVKA 1W52X 4R2WA 3FDXA 2ERYA 2BI4A 3IEPA 2FEKA 2QA5A 3QWAA 3JQDA 1JJ7A 2P3OA 1RZVA 2FUKA 2EGGA 3ESQA 4HZUB 4PS1A 4B6FA 1LPAB 5HUHA 5LJIA 5TS3A 2TRSB 4K0RA 4YDQA 2E5WA 2MJLA 3GLQA 5REQA 3O4IA 2CE2X 4Z7OB 4ZV7A 1VCHA 4KIFA 3G89A 3TK1A 4BNWA 3RYIB 2IYOA 3FUUA 1GTG1 4MVJI 4M1MA 2YZGA 3TAHA 3V1UA 1OSNA 1WW8A 2C8JA 4MJ7A 1TAGA 3OC0A 3OQJA 4NL4H 4JI6B 5IFLA 4QUGA 1UDWA 2OAQ1 3I4LA 3Q2KA 2ID8A 3VMMA 1ZN8A 4QUAA 3OIDA 2P79A 2KYRA 5FLXA 3CT6A 9MHTA 3A9SA 1Z2NX 3G3EA 2JLYA 2C1ZA 1K1EA 5H9WA 1HYGA 3TRJA 3ZVLA 4I2NA 3WHIA 1HYBA 4Z51A 5DHPA 3F6CA 4HXGA 4KSYA 4Q4DA 1A04A 4YCSA 1TYBE 2FWPA 2ZB7A 3M4NA 1ZNQO 1QLWA 4CLOB 2HF9A 4RLQA 1E3LA 5KHOC 5FI0B 1FUUA 3I64A 1E1CB 1Q7GA 4G5FA 5HEKA 1UQTA 3W5VA 3WQQA 3NHZA 4BNMA 3U4MA 1W0KD 3EBPA 3HBJA 1M7BA 2NU6B 4G25A 4MB0A 4QOIA 2JJ2A 2C98A 2OZKA 1M1UA 3Q8XB 5I4KA 2E3JA 3VSDA 3WTCA 3KKMA 5F33A 4BNLA 1JFSA 2VQ6A 1BWSA 1V5GA 3D1LA 3GDHA 1Y8AA 4HNAA 3RSLA 1M8FA 3ILYA 1QUFA 1MOSA 2JJ2D 2F6RA 4LDAA 1SCBA 2GQ0A 4FLEA 3EZ6A 4KR3A 2CLLB 4Q9LA 2RHBA 4O5OA 3T52A 5JBIA 4IR7A 2ZZMA 5AWFC 4YUZA 2V45A 4B3MB 4KIWA 4YBRA 3TCKA 2IIVA 2I7TA 3T3NA 3IVPA 4XW2A 2XZTA 3DZDA 3ZQUA 4CMGA 4DQLA 4W7HA 1WEKA 1WHTB 4S1TA 1U8EA 1U0GA 4U7PB 1PD0A 3KV3O 1WF3A 4I46A 1N5KA 2J8ZA 4OH7A 1UPFA 4MIYA 1O77A 1BS2A 3CGGA 2O8FB 1XIVA 4MW5A 4NKRA 4QELA 4B47A 2Q3CA 2Z1DA 3M9LA 1TQ6A 5H0IA 1XYGA 4YRSA 4BWGA 4IUCS 2ILVA 4MRRA 4X60A 3VNUA 4RF2A 2MYPA 1LW6E 4X4IA 1LPNA 1FRZA 1X94A 3MW8A 2OESA 2JH3A 1LB1B 4F21A 1P5RA 5LQMA 5H8WA 3R7WA 1I51A 4XJTA 4ZVSA 1WMFA 3KXAA 2FQXA 1IPEA 1POXA 3ISTA 3EQZA 4KLAA 4POOA 4AJKA 2PUFA 3CLRD 5EE5B 2J85A 1VTKA 3N8DA 1KDTA 3KSRA 2A5LA 1XCPA 3GMDA 2DG2A 4KITB 1X7ZA 1JQAA 1T5LA 2GBCA 3K09C 3IMEA 2HX1A 3GJXC 3IERA 3H04A 4KQEA 2WUWE 1Z34A 3SZRA 2F1OA 3VYUB 3BRWD 2NP7A 2QMOA 4ER6A 1N0VC 1ZP6A 2FH5B 1P44A 3FR7A 4OMUA 1BCRB 4UZFA 2XB9A 2IHNA 3OX3A 1IHUA 4UNIA 1I1NA 2H4XA 3F90A 4CBVA 3ESRA 2BONA 5CNJA 1E9DA 3AUSA 3RT1A 1FFWA 1LNZA 1NUTA 5KTRA 2DM6A 3FNRA 1O96B 4J7AA 1FDTA 3RTBA 3KSDO 5B37A 1D4AA 4K6KA 3UMGA 2G0NA 5JCXA 1D2GA 1Q3TA 4RVOA 4ZDKA 1QYCA 1JAHA 2BMEA 2VBGA 2Y77A 1F8FA 2F1JA 2XE8A 3AT1A 3GZTB 2ZU0C 1LTKA 3IURA 4BMXA 3QX3A 3JS5A 4ISCA 1YS9A 1C3VA 2A4KA 1ADFA 2GX6A 2PKEA 2QX4A 2R4QA 3BQNB 4IXWA 4KFUA 4V2IA 2P2CA 5AW3A 5AJUA 3IT1A 4IPTA 3LISA 3TELA 1GCUA 2GKGA 4BIIA 3WK8A 4EA8A 3G0CA 5U4QA 2WU4A 1JDBC 1V3QE 3RIXA 1ZJWA 3IOBA 3NYWA 4FE3A 5CK4A 1HE1C 2FFAA 1VHWA 2YIJA 3USES 3QTBA 2QKYA 1N1DA 4MGYR 3QOYA 3R9KA 1S3SA 2Z1MA 1V1RB 1PR1A 4Y1GA 1L7XA 3JSXA 2BT4A 3C3CA 1GNVA 3UMFA 3ACCA 2A86A 4IF6A 3B70A 1P0IA 4NWIA 1W4AA 2WAAA 1QTIA 1EWQA 5EGNA 1RHQA 1LLUA 4JYMA 1V16B 4R68A 1ZCAA 4M0FA 2C5BA 3ANMA 3FYUC 2OM6A 4WFKA 4HQNA 2CMGA 5DHFA 3F3MA 3SXUA 1RLIA 2IKQA 1EUCA 4N40A 1U0SY 2NTYC 4JA0A 3WWEA 4A6XA 2GO7A 1IBSA 3DR3A 5TNXA 5KOJA 3DDHA 2W2QA 4YQEA 4KDCA 4ZEVA 1O94D 3BXZA 2CXQA 4JR2A 4Q3DA 4B8YA 1LPBB 1PJLA 4OQLA 3DO8A 1UBTS 3OJOA 2EQAA 4BLSA 3ROFA 3OZRA 5BO5A 4O4LF 4R1OA 3MLAA 1Y4ZA 2P6MA 1G3UA 2HPVA 3L7LA 4LSZA 4EHFA 1XK7A 1S9HA 2PQMA 2XZDA 3ZS8A 1R74A 4WVFA 2XJ4A 5DCYA 4CI0B 1M1YA 4WCDA 1XEFA 4NYIR 5I7VA 1EFRA 3N07A 1KJJA 3BJRA 1L8AA 4XOUA 4ZK6A 3QF7A 2PSSA 2QXTA 2JVJA 2V5UA 4G0QA 1QHGA 1RXEA 1JMYA 1EFRD 3BTOA 2P2SA 1JXOA 2YXDA 1LSJA 2C4VA 3URKA 3SLGA 2PMWB 4ZVMA 3RWOA 5IBPA 2V3WA 4ENRA 1E69A 1M34A 1NUUA 2NVOA 4HNTA 1NZFA 3NBMA 5J40A 1KQFA 5KVAA 4AO8A 4NCBA 2DWCA 5E9AA 4V02A 1SU8A 1KBQA 4WY8A 3RVKA 2FOLA 2JD0A 5DNAA 1T15A 1MXFA 1RBYA 1TM5E 2MINB 2GCGA 3NP9A 3WNBA 3U19A 2G1AA 3EEYA 1PR9A 2ECFA 1UC4B 2IX9A 5D00A 3WL8A 3H9BA 4R05A 2QSJA 5EFOA 4TM8A 1OWMA 2DSTA 1QJ4A 4CE6A 4M53A 1XCJA 4JP8A 3FHLA 1XDWA 3TOCA 3LNTA 3QFRA 4UOZA 3WK5A 4BRWA 5KCZA 1YOVB 2RGRA 3IDFA 4EI9A 3LC2O 2O3QA 4Z5HA 3IUJA 4JBWA 2YWRA 1CBUA 1TA4A 1S89A 1Z7GA 1Y8QA 2R8PA 3DGFC 2QN3A 4K5QA 3AIKA 3QVMA 2NSDA 4RMNA 5KDDA 1U80A 3A7DA 1RC8A 2EF8A 3FRJA 3M70A 4YMGA 2A59A 1K4MA 1UM9B 1EM8B 4UBNA 3D5EA 4BYGA 1Z5NA 2I6SA 1BMQA 4ZVRA 4PCVA 4HFMA 5FUWA 1ZNZA 3RAGA 4EYGA 3WNCA 5KHLB 1ZJ4A 2OSVA 2J7KA 4NPHA 3UB2A 4O0LA 5EZYA 3GJ0A 2NXNA 3ZHTA 4YAGA 4E3ZA 2OKGA 4EW3A 4E6PA 3FCXA 3NYIA 1PFKA 1AQYA 3PGVA 3DV9A 3A9YA 4H6WA 1F2UB 1G2PA 3OJLA 3HFJA 3PA8A 3DT9A 5IP5A 2B8NA 1A69A 2MSKA 2W98A 2DH5A 2BFCB 2Z2ZA 3KYIB 4GVLA 4LE2A 2WM3A 3CJQA 1DQSA 1LRJA 1R8QA 5FA5A 2QRLA 1E18A 2VHVA 2G72A 1ZNYA 3HWRA 1PEDA 1SC1A 2IVBA 3AKYA 2HBZA 3ML1A 4PYOA 2HHHB 2W00A 1JG2A 4LCEA 4IFBA 5IC5A 1KMCA 3H42B 5BOSB 2J6BA 3WS7A 3EVDA 3TMKA 1MU0A 1R4AA 2IQ5A 4AXBA 3QXGA 1HQ1A 3SFVA 3G8DA 1G6Q1 3PE5A 1LWNA 4B9EA 4M1KA 1BX0A 3W2IA 4PNEA 4AAYA 1VE6A 3IB3A 3JARB 4LWZA 2IHJA 4L4ZA 3RQSA 3F52A 1QV7A 5AVQA 1EB8A 1SVSA 4K7JA 4UMFA 4V39A 4EUEA 4CQLA 5D8DA 3TG2A 1QTQA 2XVXA 4JQZA 4E14A 2OFYA 3IPAA 1JQLB 4BFYA 3UTDA 1GVNB 3HK2A 3G88A 4ZWNA 1Z06A 3P19A 2QR3A 4AJ2A 2XKJE 1XMVA 4PCLA 1HNZB 1T24A 3PVCA 3X43A 2J59A 3VKWA 3H3FA 5CU7A 2C8VA 1XCMA 4L76A 3TRHA 4OUDA 5I4BA 3MJEA 3SCHA 2PUEA 2NVUB 3AUFA 2GCOB 2XYHA 4MRVA 1AU9A 1U31A 3FYTA 3EGWA 3KWFA 3ZNOA 1GCAA 4G63A 1U2SA 3B38A 4EI2A 5FH9A 2ZXUA 3S1LA 4Z9XA 4YMIA 4PX9A 2C2ZA 3AFIA 4PXSA 3WLTA 1E2KA 4DCMA 1NVEA 1Q0ZA 1NBME 5J58A 2V6JA 1ADJA 5AI6A 2R5WA 2IU6A 3WB1A 1K88A 4AJLA 2HMYB 4TLLB 2HK8A 3W05A 4JUAA 1RAEA 3OA0A 5HK8A 2Q1UA 4C4AA 4HSEA 2H4ZA 2Z30A 3IOMA 3ZE9A 2MWMA 4QYXA 1GLGA 2HQSA 2PANA 3LP5A 3V8EA 1HBJA 1MNAA 2WFLB 5DK6A 3VNAA 1FX1A 1X42A 1P0CA 2RG7A 2HDWA 4IIGA 2OCIA 4RC9A 4BHTA 1R0KA 3CJTA 4J2OA 3N9IA 2XECA 4PTYA 3U9LA 5JBNA 2CD9A 4UBOA 2IF2A 2WV9A 1HYHA 3ORHA 2Q6LA 3DBLA 3ILSA 1W5FA 4FSHA 5TEVA 2R85A 3JY6A 3AEKA 3A4IA 1Z5WA 3OJCA 4M54A 3W5AA 5LP1A 3GLGE 1IAQA 2NO7A 1BRTA 3TLGB 1T5OA 4RPKA 4BVHA 3TB6A 5BSVA 4N3CA 2P5SA 1DZ3A 3NTRA 1Z4IA 2CF6A 2FRVA 4IKEA 3GPDG 1P0PA 4JC4A 4ML3A 4E88A 2DPMA 4EZEA 3CF4G 1DIAA 1H3NA 4FD3A 2RGEA 4FK8A 3RYFA 4GX0A 1HO3A 4CMEA 2FP3A 4DUPA 2IYUA 3NT4A 1QP8A 3HNOA 5ECYA 4LQCA 3RKUA 1RXUA 4FJ1A 2QQ5A 4NV3A 1RTTA 2FJ0A 7REQB 3DMNA 1BHJA 4RUKA 2ZUUA 3JWHA 4Q18A 5BVGB 4UUNA 4Z4QA 2AXUA 1PG2A 5IX8A 1YZGA 5D86A 1IEQA 3COPA 1REQA 2XOEA 4KI7A 4YRNA 4N18A 3GFOA 4KRGA 4N7RA 1BMFD 3G5LA 5CVEA 3IO3A 5K3CA 1GG9A 2XEXA 1T5TA 1UFVA 3IC5A 3JQGB 3BRCA 2XODA 5BR1A 1L5MA 1SG9A 4PG8A 2A9QA 4LXYA 4UHHA 3TW6A 2IEZA 4ZK2A 3OZCA 4ZO8A 1Q83A 2R66A 4H9GA 5E3HA 2C1EA 5H16A 5HZGA 3A1SA 1RPNA 1E1DA 2DX7A 5FLKA 4B7CA 4WDQA 1S7GA 4OD0A 4EA9A 4H1WA 2C7QA 3NVKI 3C97A 4P2GA 2ZIZA 1WDWB 4WW0A 2E1PA 4R2HA 2W0MA 5T4HA 2P5TB 2CYAA 3L4BC 3BBLA 4R1QA 2F48A 3MGBA 2BUCA 4PU4C 3O9XA 3NWEA 5TGDA 3BD7A 1T0HB 3L3BA 5E9JA 1U3GA 2PZMA 5EP2A 1UFRA 4JYPA 2HNAA 2AJBA 1L4YA 4K0KB 2PD6A 3LOUA 4DMLA 5T67A 1FP6A 2BAGA 5ALNA 3RS7A 3GT4A 3AJRA 1TF5A 2I6XA 3KYDB 3PHJA 4XWKA 2IXTA 3ELYA 4M1ZA 1J7JA 3JQQA 1SGWA 1JIXA 2OORA 3EDCA 4EZBA 3U1VA 1M1XB 3CZ4A 1V4VA 3Q11A 3FGZA 2HWWA 4DY6A 1P91A 2RBKA 6GPBA 4EB8A 1BE1A 3ZLBA 3ZV3A 3KU1A 4DR5B 4OYRA 1KVUA 2J31A 4BO5A 1JHVA 4NZOA 4RACA 1YD7A 3HUFA 5D2CA 4FE7A 3RKRA 1QP0A 3KHSA 2J09A 3I8OA 3GPBA 4RTQA 3GPIA 2NTNA 2ORIA 2EC5A 4RE6A 2G9VA 2BZ1A 3UM9A 4LFBB 3IA2A 5BPFA 3VDXA 4E03A 4DEYA 2ZXFA 1VL5A 3RUHA 3A1VA 3LDFA 4J0DA 5G1PA 1L7OA 4LHZA 4CMBA 1LLIA 4CN8A 4F4FA 5U1PA 1ISSA 1EE1A 1HDIA 4LY0A 3UGQA 1EFUA 3WSTA 2DHCA 1UP7A 2H7XA 1P39A 3U4QA 3UWOA 1X3SA 4IH1A 3UJBA 1BEUB 4Y2UA 4GECA 5ALKA 5A6SB 2XUFA 4PZDA 3UH1A 1CIJA 3EFHA 4LHXA 2JS7A 3O90A 4URHA 1B6TA 1DNPA 4KQCA 3UFXB 3WXBA 4C01A 2UYGA 1CRPA 3A4LA 1YQQA 1RMTA 1EQ2A 1P1FA 1Y9JA 2QDKA 4JWTA 1LQ2A 1NW5A 2DBRA 2WKQA 1J8DA 1Y9DA 1WTCA 3IPXA 2FSSA 4NQZA 5HA5A 5L3QA 1V39A 5IEJA 4QSHA 2IEAA 1CF9A 3SKYA 4NZNA 2OMEA 2HGSA 3U2QA 2QWXA 4X64B 3WGGA 1K3UB 2A0YA 1X8JA 2QENA 1WQ1R 2QJWA 4QC2A 3NBXX 4YRIA 1Y3FE 4MV0A 5FIUA 3HI6A 4OK5A 4OFWA 1QTNA 5EIOA 5F5LA 3IVCA 5A3SA 2C2WA 3UJNA 3ROTA 2FEWB 4RQTA 2D4HA 2BN4A 1JFTA 5AKYA 2QAGB 3GJ4A 4Q1DA 2IX3A 4LF6B 4WFJA 4ZCPA 3V1KA 3WIDA 1CETA 4XEHA 3UKDA 5AW2A 4JP2A 4ZI2A 2ZYUX 1R63A 2VJKA 3EPHA 5F9FA 1SQSA 3ZDEA 3PB3A 3CC8A 3PF8A 2JAUA 3NHSA 5ITWA 4B4WA 1EFLA 5K6AC 1YB1A 1KR2A 2Y1OA 2ZYGA 2LPMA 4C3OB 3QELA 4KKVA 4PSCA 3HCDA 1Y4DE 3MTJA 2Y1LA 2HFZA 3FKQA 3P2KA 4CPDA 5M2QA 3I61A 4OP2A 4I1PA 4DA6A 4XR9A 1TCCA 4Q5IA 1UKCA 3SSAA 3CRZA 3JD0A 3NOQA 4U2EA 5ITVA 3LWZA 4QATA 4JBXA 3AU9A 4QE3A 3SYKA 3KL4A 1ZC3A 3MWEB 1H6CA 1UBGA 4EAQA 5K0GA 4TKVA 5E38A 3RWBA 3TZEA 1XKLA 2R11A 2M6LA 1IK4A 4ZYLA 4AJHA 4WZBA 5GONB 1KC3A 1IN7A 5JDCA 2MCFA 4O2RA 3H97A 4IZOA 2D8MA 4Q7JB 4R2LA 1IJEA 5T3YA 3UUEA 2GA8A 2HADA 5FI3A 1Z6YA 5JQWA 4MW6A 3PT5A 1SIOA 3U16A 2O3RA 3FUTA 1YSCA 2WHPA 4IXDA 5NULA 4BWVA 3W7AA 1ZMBA 4BJ3A 1HXHA 1IBRA 4DBVO 1J2TA 1A7KA 1OFUX 3JQCA 2FA9A 4GSKA 4NMLA 4RF4A 4Y18A 2Q6OA 4D25A 3D8SA 5LB2A 2IELA 2C0CA 2JLSA 4MWBA 1L4KA 1ZIXA 2O06A 5SZJA 1T25A 1IUOA 1YVPA 2TMGA 2AQHA 3WKAA 2Y1WA 1K63A 4JCXA 1I4EB 1SKYE 2C5HA 2ECPA 2Q3EA 2XOKA 2H9YA 1T8WA 2HV8A 3DVQX 4KLZA 2HR1A 3RTEA 3A4TA 1WF6A 4BMYA 1JQBA 2MSEB 2BE7A 1TRHA 3CH4B 5IBCA 3BZBA 2F9LA 1JDUA 2IHUA 1H5NA 3AHHA 3L01A 1PHRA 1M3SA 1DOAA 2HBYA 3PDUA 4U39A 2GRAA 4K8OA 2J0QA 4A0GA 1AHPA 4LRWA 1W36B 2NSHA 4IOMA 2IY9A 3NETA 1T4CB 1KEPA 3KUDA 2VNAA 1NONA 3G8AA 1BVUA 3LLCA 5COBA 3K9CA 1G4AE 5DT2A 2HBQA 4BNGA 2D62A 1HRDA 4US1R 3ZHCA 2QTAA 4MULA 1GHTA 5BORA 4BNXA 2WM8A 3DDNA 1GVHA 2V7PA 3TZ6A 4W5RA 1MPTA 2WBLC 1H2ZA 2OTCA 3ZLTA 1IBCA 1VJCA 2B9VA 2I7CA 4KXMA 4DNPA 3KVYA 2IOYA 2W6JA 5EL0A 1NZDA 1LW7A 2C42A 2XDYA 1UAGA 4RTRA 3LF2A 2VUTA 3CRRA 2PX5A 2X1LA 4Q66C 2VJYA 4YHBA 1L5HB 4CIYA 3EPJA 3W3AA 1L7MA 4OMDA 1IRIA 1G5QA 2PUHA 4JFRA 4LGVA 4DMHA 1OLXA 2XNDD 2GWHA 2HINA 4L0QA 4AMGA 3PZBA 3G6WA 3IUNA 3R75A 3W5DA 1OI7A 1N32B 4Z7NB 1KGDA 3KVOA 4E5SA 4C4ZA 2CT8A 3ES9A 3NHPA 1KEKA 1T9GR 3M6MD 5EJFA 3V97A 2BGWA 5F9HA 2C4WA 5CUQA 3FCOA 2ZAYA 3M6FA 4UFNA 1B23P 4LTDA 3ETEA 4DFDA 1DKMA 5GINE 3S1SA 1H2HA 4OQPA 4S04A 2VTBB 3NEJA 2V6GA 3DAPA 1GGMA 4Z4IA 5BP7A 2YZMA 4EBFA 4FBMA 2WYIA 4JLSA 3LUPA 1MFPA 3HJTA 3I62A 3UHOA 4LIPD 4RF3A 5LIRA 5EHXA 4JNCA 1AMOA 1F8YA 1SU6A 3M6AA 1FQJA 1P4GA 1IWBB 1IAVA 1W2GA 4FYWA 3ORFA 1UMDB 4AP5A 3DZKA 2Q49A 5TQ0B 2VUIB 5L8VA 2BUAA 3GMTA 3EXG1 3KK0A 4KXNA 1VL1A 2QOEA 4C0BA 2H57A 2HMAA 5EIXA 3NCTA 4L85A 1ACLA 4GOJA 3H0CA 2J6CA 3QNMA 4JSTA 2PD3A 3Q1LA 3WTBA 4MA5A 1E3DA 3TECE 4E5UA 3AETA 2QP3A 4I6EA 4P3XA 3HA5A 1PZEA 2ETVA 3OEWA 3PG5A 4CV3A 5KTSA 5GJCA 2FWBA 1FVFA 4G8DA 4LJ6A 4F86A 4O2LA 3A4YA 1TF7A 1Z37A 1XZPA 4AMBA 2ZRDA 5EJ8A 2ZAOA 5HJEA 1DAMA 3P8ZA 1EUDA 5AUPB 3W1VA 3BPSA 4F4UA 1Z0KA 3AM3A 3BAFA 5K0LA 4ZYYA 5EZ5A 1NJ1A 1S3FA 2M1XA 2V4UA 2PQ6A 5EKSA 4B6QA 4KMOA 5CBPA 1PW5A 1S5PA 2YQ4A 5KYWB 2A9JA 1BCSB 3WO1A 2W6MA 1ZIPA 2AXNA 3IBYA 3MM4A 4KQFA 4DV4B 1PT6A 2YV5A 3MJCA 2OFXA 5FQOA 1WXEA 5AJXA 2E9SA 2RIPA 4FGUA 2EBFX 1R00A 4PS0A 3O0TA 4O4LA 2Q8NA 3WMRA 4IIJB 1NNLA 3CMMA 4GH5A 3HVRA 2MR5A 3JVUA 1SNYA 3O8DA 1M74A 5EE0A 3DOIA 2I1QA 3ND8A 2ODBA 4LZNA 3A6JA 4G26A 5ALDA 5ALZA 3LD9A 1QGUB 1DUVG 4UQLA 2AT1A 2Q5FA 4M1QA 4DCPA 1QH1B 2C9ZA 5CG2A 4H77A 1Z83A 2WJ4A 4B46A 1CQXA 4AUEA 2H6EA 1SVMA 2Q8QA 4BQQA 3GUUA 4U9HS 1T1GA 4D4JA 2QN1A 3Q7EA 2ZITA 3G2MA 4HB4A 4XCVA 4CG0A 3JVDA 5EIEA 4TWZA 4OIMA 1Y8RA 3A6ZA 1P1HA 2XCOA 1LJLA 2D4AA 4JYBA 2B5WA 5KYKA 1PLLA 4OXXA 9ATCA 5H9VA 4UM8B 4FDUA 2A1IA 4WN9B 4UXJA 4ZYXA 4HUQB 3THRA 1DI0A 3LDAA 4LK2A 3ZK8A 3D1NI 2WV7A 3LE8A 2D5CA 5CT8A 1Z7BA 2FMIA 4Q9JA 1N34B 1R9MA 4XIJA 4X62B 4I6JA 1WCIB 4HN9A 3FFWA 3ZU6A 2QROA 4EUKA 2JCBA 5HF6A 3EPRA 3L4KA 5ES3A 5B36A 1DFIA 3DEAA 3OKPA 4OMCA 4CZ2A 4MP3A 4MCTA 3LF1A 2ZR9A 4C7MA 4AI6A 3D4PA 1YV9A 1P5HA 2RDMA 1PCXA 1R8SA 2QRPA 3DVLA 4G36A 2CSUA 2OQVA 4CFYA 1PQ4A 3JCZA 2W37A 1WLSA 3HB7A 1UK9A 4RZSA 4DQUA 1DP4A 5HG0A 3KUUA 4HQKA 2OCLA 5F1KA 3QSGA 3ABOB 4JXKA 1WSBA 4P92A 2ODRD 1W47A 1P80A 4C6TA 4LYYA 2IUUA 4B3XA 1DIBA 4RHXA 2MQKA 2ZZNA 2WJAA 1CIVA 1N36B 3V1MA 3FX2A 3COZA 4A1OA 3CMCO 3FETA 5EKDA 4ND4A 1COWA 1HURA 2VTVA 2CMFA 3OTIA 5A6VA 1W5BA 1H8EA 3SMVA 1M67A 3BXHA 2HQRA 2AQ8A 4AP9A 1QPZA 5DTJA 5ELMA 4MCAA 3VI4B 2JI9A 1COWD 2GXUA 4G24A 1OI4A 5TMBA 1A9SA 2IZOA 3GD7A 4U2DA 2CD7A 1TVMA 3V2UA 3NWJA 4CM4A 5HQTA 3LT0A 3OQ1A 2Z43A 1GLVA 1HZJA 1NPTO 1R1DA 3FCSB 3KU4A 3PKZA 1SULA 5F1OA 4A8TA 1L5SA 3FB1A 5UKDA 1XEXB 2BEVB 2I66A 1E58A 5CLGA 3ICQB 3KDSE 4QYIB 2DRIA 3QVGA 3I45A 3S68A 4DKJA 3RS0A 4D6XA 5TQVA 4EUNA 1U28C 3BTSA 4KL8S 2B1QA 1VSBA 2VF7A 2J3IA 1VG9B 4XDZA 3SBXA 4KSCA 2OE2A 4TSRA 3K35A 2PGLA 1PGPA 2E37A 3RIYA 5BW4A 3C3DA 2HCFA 2QRVA 4GXTA 5I9MA 4PYLA 3OZEA 4V24A 1I4LD 2ZULA 3C8MA 3UOAB 3ZYCA 5IZCC 3OP9A 5LQNA 4M9XA 5BSWA 1U99A 4HHEA 1IJKA 1CY8A 1F4VA 5JLAA 3CY6A 4JBLA 5KVVA 1QPBA 3RS3A 1TAHA 4O4JF 3K2IA 3VR3A 1K86A 1WETA 2UVPA 4AUNA 4ARBA 3BK2A 3WKDA 3TZQA 2HJGA 2GMWA 4FKMA 3PEFA 3VUEA 1K7EB 2Z98A 3ZHMA 4OI0A 4E1AA 4J7UA 4G01B 1IXYA 4TZKA 1P2BA 4JODA 2QE6A 3OKZA 1SKBA 3DBHB 4DLRA 5AUNB 1KH3A 4EJ0A 1RYBA 1QHIA 2XNKA 3T3HA 2YHSA 1YDWA 4M0LA 3O2NA 3PJFA 3A6KA 5K0FA 2WEKA 2H4YA 3KEOA 3OP4A 3LW7A 4HDSA 4C07A 4WNYA 2PXBA 1RHRA 1WMSA 3VTAA 3ZGZA 3DNMA 1YZFA 2EKZA 4GZMA 4DHEA 3L0DA 3HCEA 4J0FA 1GXSA 1WCXA 3BWDD 1PE0A 4DIBA 4AZSA 3VVBA 4IZHA 4BNVA 1FP4B 2WU8A 2HU8A 5CJJA 1PK9A 1VYTA 4BFSA 3KLOA 1XWIA 3T5CA 3X2SA 5CLFA 1E9VA 1N77A 3HLTA 2G09A 4PYRA 3FW1A 2O8NA 2C96A 3EGDA 4EW1A 2MR6A 2WMYA 4HK4A 1OZHA 3VOBA 9GPBA 2N75A 1Z0FA 4UPVA 3ZHQA 2WB2A 1W2HA 2A35A 4N82A 3LX8A 4JMPA 1NJ6A 1JFRA 4Y9SA 4ZFNA 1ZH0A 3ND9A 1I24A 1P9RA 2GLXA 5GV8A 3UF0A 1ZUHA 1UAAA 4UBIA 1LBSA 2JEYA 4ZT6A 2HRDA 2PPXA 5J23A 1DS6A 5KVQA 1B41A 4LVCA 1YMVA 3L8ZA 1OVGA 1PGOA 3GUCA 3IE2A 1JZQA 4W63A 5H80A 3GEIA 3P5BA 1CUFA 3RTCA 1SCUA 4N7BA 3IP9A 3V5NA 2FI1A 3VDRA 4GMFA 1DHTA 4TYPA 2R62A 3VO1A 1XNRB 3QXCA 3CF2A 4DLSA 2W6PA 1KQPA 5JYBA 4JI5B 4LC9A 3JQBA 4BC0A 4ENPA 2IL1A 4DA7A 4AZ0B 2WZQA 2C7VA 1Z8DA 3CLKA 5FPQA 1TCVA 5IUNC 3EIOA 2LCQA 4B9AA 1D7AA 2X0NA 3JSAA 3S2ZA 1RZ3A 3NGLA 3E1GA 3U7GA 1E7SA 1R0ZA 5DLPA 1GR0A 5HILA 1U0JA 1ZGZA 3H1PA 4M3NA 5CFMA 1V8FA 4R8MA 3RARA 1BEZA 1AKRA 1MMFB 1M76A 2CB0A 3ZWMA 4IG9A 5ILQA 5C3MA 2ZWOA 1PGJA 3QENA 5IN5A 4CIDA 3ELBA 3V8BA 1SCJA 4XJSA 1US8B 4LY6A 3E9EA 1G41A 4QYSA 1SD5A 3ASZA 1CJUC 4D41A 4DMFA 4AT1A 3DFZA 4BMOB 4D0SA 2AFHE 1LCIA 3MGCA 4DF3A 2C31A 2AX3A 2BCGY 4G1FA 3SEQA 1NTOA 5DO9A 5PGMA 3U4CA 4II3A 3HKCB 3LPMA 1OBFO 4FW9A 5T4EA 5E95A 2P9GA 4KUGA 4O4HF 1LSOA 4ZC1A 4KQ1A 3VZCA 4FEAA 3AC0A 2G70A 4UHDA 5C1DA 3KZCA 1GN8A 4QU9A 3SBOA 1XTQA 3QKSB 3QX7A 5FULA 1NI4B 2HV9A 1A4IA 1YU9A 3FOCA 3P9NA 1B00A 2ORED 1E2EA 3BB4A 4FC7A 2QR5A 4RFSB 2IYVA 4XM0A 5HTKA 4REOA 4CFZA 2JI8A 2R1TB 2OAP1 3U4AA 3L6RA 3ZPXA 2L18A 2FCAA 2XB4A 3F8TA 3KLMX 2YV3A 2BDUA 2CDNA 4F56A 3QUQA 5HHTA 3EXHB 1P3DA 5FNVB 5HNKA 3JALB 1HT1E 2JGAA 1MH1A 3C3MA 1ZOSA 3ONWA 1PQYA 1NJ8A 1FPQA 3MTAA 1OIVA 3OU2A 1DAOA 1ELOA 2I33A 4FZ5A 4MS1B 4Q7EA 4E30A 1RLJA 2JIQA 5B64A 4LE1A 4EM6A 1ZCFA 3HWSA 5CB8A 5AM2A 2YWFA 2VRNA 3BCSA 1U0EA 3H5OA 3E2MA 3VBEA 1NC1A 4CMHA 1UXOA 3IR7A 1YZYA 4UW9A 5KB3A 4AXXA 4J43A 1QF9A 5IABA 4XJXA 1HE4A 1RAFA 3LUAA 1QC5A 1GA6A 2QK4A 1LLDA 1L1EA 3LK7A 3HGQA 4GS5A 3AGQA 1MBZA 2CJPA 4UHBA 2GF2A 2X0KA 5JO9A 3RREA 2FQQA 3KUXA 1GRVA 3FKJA 1V7QA 3KB2A 1HE5A 2JLBA 3C1TA 3F7MA 3GI1A 4RSRA 3CBGA 4UAJA 3UWSA 1Y6ZA 1MENA 3L7DA 4MLZA 4PHGA 4UAVA 2J87A 1CP2A 4J1XA 2XB2A 4PFJA 3PI6A 2ZG6A 3SG0A 5KNBA 4MKIA 1P29A 1ZM9A 4QLOA 4A10A 4KR2A 3QZUA 1R4MB 4FBGA 1FSZA 4J76A 2ZT5A 2YICA 3JPYA 1LBQA 2UVDA 5CW2A 1D6MA 1EJ6A 4NH0A 1PD1A 3V8NA 1FS6A 2Y6UA 3WLMA 5KTNA 5KYNA 3JR3A 2JZCA 3EGCA 1ZRNA 3K0CC 2FKNA 2HXGA 4TL8A 3MQ4A 4TN5A 3RU3A 3C70A 3DE7X 1DXHA 2WF6A 3LRPA 1KS9A 1N6NA 2JBAA 1YR2A 5U4XA 1OXTA 3FNHA 3QMWA 5C37A 3IE1A 5B58T 2QZPA 2W43A 4LJSA 4KPYA 1DJQA 3I01A 3WZMA 5FBVB 3KLBA 3PQEA 1I7LA 3H7IA 3V1TC 4A5OA 1EG7A 4BMZA 1JTVA 4KFRA 4ZCTA 3G0HA 2A67A 1E8DA 3UBMA 5DCLA 1N2CB 3A0UA 5MGNA 4C2UA 4YRBA 2ZJZA 3DEYX 4WZAB 1JEDA 4L95C 1XD9A 4CDRA 4DILA 2NQTA 4YQYA 3TR6A 2C88A 3AHDA 1SRQA 1XTPA 1SBQA 2GBGA 4MZXA 2F3TA 3I9FA 2CLCX 1XEWX 2HWKA 2OVFA 1A2BA 1K92A 2FEXA 3EEBA 1EP1B 2XNSA 1LK0A 1ZKMA 3IBCA 4W7SA 5BR4A 3JVEA 2GBLA 3TO5A 1ABFA 3SKXA 1U2DC 2BP7B 1BGVA 3SDZA 2TS1A 5TMEA 3O1JC 1KJIA 1PYOA 3FOAA 3CBQA 4X54A 4EA6A 5MN4A 2RHDA 3E0QA 3FYSA 4QPDA 3N8IA 1XJ5A 5C0OE 2ID4A 3QWIA 5BSMA 3SC6A 1X1RA 3NMUF 1N5DA 4Q3OA 4BNUA 4R7GA 3F8WA 1SCIA 3ID6C 5KYVA 1AA6A 2AFIE 2H31A 3RUIA 4Z53A 3G2NA 2AN1A 3PGMA 5AXAA 4YARA 3FVQA 4WLOA 1HR0B 1M8PA 1U2GC 1VIDA 2VUHB 4JOBA 4D0NA 4PG4A 4K6MA 4ZVTA 4EKGA 5DNCA 8OHMA 3BWYA 1N0HA 2WDZA 2WTAA 2Z4RA 5JS1A 1J21A 1FY2A 4BNTA 3IP1A 3BOSA 5TSDA 2KSQA 3A9UA 2FSUA 4FX2A 4G5XA 3ILVA 1YS4A 2YHBA 5ALFA 4B34A 4MA0A 3ESCA 1X7WA 2VK8A 4R7ZA 4JFAA 4DCSA 1LI5A 1RHKA 2UXDB 2W0SA 4ZI7B 3HZRA 5JWRA 1P6QA 3L8CA 2QPLA 5K99A 3IVGA 5CB4B 1LDGA 3CX6A 1XFDA 3OOJA 5EZQA 3L05A 5DJ5A 3CTPA 4Y98A 4CWAA 2YY6A 1OC4A 3WNQA 4GHJA 2H1OA 1IZ7A 2C3OA 1CHNA 2AYXA 2E21A 1XNJA 3D4LA 4IS2A 1UT5A 1BXGA 3ZS9A 4P98A 2COKA 1LBIA 1Z2OX 1UC9A 3D3WB 1B8NA 1L8XA 4ME6A 5J2UA 2IS1A 1MOQA 2CZCA 3L04A 1A1VA 2H2HA 1VE5A 2Q0QA 3ETLA 5LUAA 2H1RA 4LNAA 1NZJA 2BLLA 3PI7A 4Z54A 3CW2A 1LK7A 4MGZR 4CEIA 1B8UA 2OV1A 4EKYA 1QHHB 2HA3A 3PQ8A 4AC9A 4WA7A 3RUFA 1H2YA 2OPBA 4MDHA 3GF4A 4GPIB 2QT1A 3ZNNA 3L02A 2GUGA 2J7PA 2Z1NA 1A4RA 1ZH2A 2K5UA 1OZAA 2W83A 5FAKA 4FMPA 2AV6A 2W11A 4XAQA 5DTQA 3I2KA 3BWVA 5BMVB 1OGYA 3D2LA 5EE9A 2J7PD 2IFTA 1P7YA 5ALPA 2NWQA 4F5WA 4Z5DA 1ZITA 1ZBQA 1Y9EA 1UXJA 4JT2A 3V7UA 1G8HA 1RNLA 1CCWA 2EARA 2IIBA 4HWGA 4JU9A 1JDPA 1V0JA 4ZQIA 5CEEA 4XVUA 4DMRA 5EJ7A 2BFDA 4HN4B 1Q17A 1HI9A 1KMHB 2HRQA 2Q9AA 3MHPA 1NSTA 4JLAA 4R2JA 3AF4A 2Z0MA 3DLAA 3FROA 5FXMA 3L0IB 3P9SA 3AY7A 5KDLA 1XA4A 4IIDA 1KNQA 3IXMA 4LI0A 1V26A 4Y9DA 2VDWA 2PLWA 4FZ3A 1NXVA 3OT1B 1FLVA 3UT6A 4QD3A 3H6GA 4IEFB 2P7IA 2WF7A 3PGJA 4KYUA 4EJMA 1S2DA 5B3LA 1KYQA 3R5XA 2NTJA 3V6MA 1KXJA 3M5DA 4I55B 1H3EA 4TTRA 1NR5A 3UK0A 4YRCA 2C0QA 3T0FA 3PGXA 4X91A 4A03A 1I80A 2QRUA 3EDOA 2R6GA 4E09A 4WA8A 1OH6A 4D9IA 1XTKA 3WGYA 4KK3A 1JJFA 1V5IA 2OCKA 4IKOA 1T8UA 2ZYWX 4NG4A 1MT3A 1TLLA 5TEWA 4HAUA 1H1TA 2Q2NA 3DMTC 3EHDA 2AXPA 4KX5A 3BQ9A 1CLUA 2D3WA 2RKBA 2FW8A 1HE3A 4RENA 4UPDA 2JLQA 1NBMA 4Q1CA 5T6BA 5GVSA 1OD6A 3LBAA 4PG7A 2PO5A 3L5OA 4J0EA 3IQGX 4MV3A 2DPGA 2R84A 2IQIA 1AN0A 1XJWA 2VHUA 3F49S 4OGWA 4OL0A 4E11A 1NEQA 2I2AA 3K6RA 5DE3A 5EC8A 3SQXA 1RZRD 3QA3E 5LVAA 3GA0A 4U3JB 3DDSA 4F6RB 4IMRA 3E03A 1AS2A 4H7FA 4JU8A 1L6RA 2OLJA 3N2IA 1E6MA 2Y0PA 4DBZA 5LWQA 4UMEA 1V7CA 1W44A 1JDZA 4QGHA 2WLSA 4M6WB 1CQZA 1LPMA 1YQ9A 1UBUS 3W9SA 2LDBA 3JV7A 2ZQZA 1GUDA 3K1ZA 1IM5A 2WB4A 3F6BX 1T4DA 4L8FA 4R1NA 3TW4A 3A3PA 1ILWA 5A3VA 3BD6A 3LIPA 3PSHA 3GLGA 1CJSA 1NW6A 1WD5A 2GPWA 4Y3UA 4I14A 4CCYA 2NNLD 5C5EA 1NVWQ 4NR0A 5LDHA 4X6YA 1RMYA 4XFJA 1E60A 1G6HA 3FFXA 1J1ZA 3MEJA 1F38A 4K3UA 3NQ41 4FN5A 1EWYA 2RKWA 3JQFA 2P9EA 2GPAA 2VTKA 4GNRA 4JMLA 3C5WP 3L84A 1CDEA 4YONB 3SICE 5A03A 3L8MA 3RJ9A 5T64A 1K66A 1T2DA 4G4JA 3RC9A 3OBBA 4ARZB 3ZX4A 1W48A 4BO0A 1JUDA 1RXCA 2F3RA 3AY3A 3K72B 1A4UA 3BFJA 5EMNA 5TJ9A 4CT0A 1DAGA 2P9FA 1T8PA 2ZRCA 4GM4A 2CJWB 2PK3A 2OG2A 4QWWA 5DYGA 4F91B 2Q5CA 3GLIE 3L7OA 3JRNA 3EIUA 4OQDA 4NS1A 1T2FA 2A33A 3Q5DA 5LQSA 3B6MA 1YJQA 2ZI3A 3VU8A 3W8DA 1E2QA 4XFDA 3RYCB 2FRXA 2BWJA 1P81A 5HSGA 2VJDA 3L8FA 2AHOA 4WINA 5CT5A 1C29B 2GI4A 2WT4A 4N5LA 4A2PA 4AJNA 3H17A 5KDOA 2VSQA 4TROA 4IH4A 5HRUA 1VBFA 621PA 1V8PA 5G53C 1QFSA 1H6BA 2RIRA 4Q0MA 3WAKA 3D3JA 4OQMA 3BHNA 1AGRA 3OLYA 3K9FC 3HNRA 1D2AA 1PG0A 2EYQA 2VQ3A 2IOFA 3OHMA 4LWPA 4MB2A 4JJFA 1ORTA 1ORVA 3UPDA 3KVRA 1WY5A 2HCBA 1J24A 4PRLA 3OTOB 4OB4A 2XA9A 4RV5A 4YRGA 4ZN6A 2AC4A 1P9NA 5GM2A 3WHKA 3TLAA 2XGJA 3U3XA 1QJCA 1IATA 3WB2A 5AW4A 3FVWA 4RD3A 4ZCIA 1JHYA 4L3VA 2DGDA 2ZTSA 3M2TA 2QN7A 2R8OA 1RLOA 3K1AB 4P81A 4H16A 5ICSA 1NP6A 1R6XA 2PSDA 4OM7A 3AUYA 4QVKA 3TI9A 1X7YA 1L5LA 3V1NA 3A3OA 3VKUA 4WOKA 3T4XA 1VRCA 1KMQA 1ULUA 1ZHOA 1VKNA 4AZ3B 3QHAA 4HNGA 5EUQB 1FFBA 4UEJA 3EISA 5D85A 2QM7A 1NMXA 3U3RA 2AH5A 4BV3A 4WVLA 2H4JA 3EPLA 5MDHA 5CHEA 3ORYA 1ATIA 2B30A 2VHJA 5EKXA 5LLTA 1XHEA 4CMKA 1F3LA 3AP1A 1QE0A 5LB4A 3LQ4A 1Q12A 2CEAA 2ZT7A 3EQ8A 5ES4B 1EDOA 1MA3A 1IRXA 2VLBA 3KP1A 3OZDA 1DCFA 3D1VA 3DVRX 3DCNA 2QUAA 1YVDA 1UJ2A 1GUYA 2DPXA 2IP4A 2DKNA 3GGOA 3RRBA 3SR3A 4WBNA 1U4SA 3P4UA 3TTVA 4XUDA 4AS1A 1I4TD 4JIGA 3QEOA 5J2TF 4F7WA 1F60A 2KLBA 2ZIXB 5EIWA 2XHZA 4PQEA 2VPIA 2XGSA 4O4JA 2P9QA 1N5LA 3TOXA 1U5BA 3M6IA 2XCRB 4FFSA 3E3NA 3KQQA 2O7NA 5IG2A 5KSYA 3WYEA 5JC1A 4JLKA 1PUIA 3PC8C 4BEWA 3GFFA 3D6JA 5JZMA 3I6YA 4JJAA 1DC8A 1VP3A 2AJCA 2EU8A 1CQIA 1DULA 2F64A 2W7TA 5DCUA 3KWMA 1XQ9A 4HN2A 2BPOA 1KPIA 1SXJD 4JJ7A 1NI5A 2QRHA 1IG3A 2AJTA 5JW6A 2PXXA 3LDUA 2R7AA 3Q88A 2FPKA 1I14A 2OAEA 5JCOA 1VBNA 4B5KA 2V6IA 3IVXA 2IEBA 1N75A 1L5RA 4KOEC 2XYVA 3UW3A 4YMWA 3IT2A 1L5WA 2IYEA 1OXMA 1F6WA 1AGPA 3QJGA 4EARA 3PRHA 5LXTB 4LF8B 2O50A 1O03A 1QIGA 3DL0A 3GIWA 4YJ3F 4KR7A 4F2HA 2DPLA 1QVRA 2I87A 3HJRA 4JD5A 2H3HA 3B3AA 4K03A 3TBKA 3QVVA 1T1RA 4X5OA 3TDNA 5I8WA 2I4RA 1I3NA 2D5BA 2PSEA 4V0MA 2ZBFA 4E1VA 1KARA 4C14A 3A7EA 2FEAA 2O1EA 3ZOKA 1N2SA 2JJQA 5FHRA 2YQ5A 3M1YA 3MERA 4MJLA 5JD5A 4I9UA 3SX4A 3CSUA 3KWLA 4MQLA 3DO6A 3T3PB 2J6HA 2P9YA 4W6ZA 5IXSA 1OBOA 3H1BA 4RPHA 3DULA 3W4JA 3KKEA 4YJ2B 3AEUA 3LLMA 2VNHA 4BDSA 4EG5A 3LCJA 2QTLA 1UBRS 2PR2A 4I5EA 4JHXA 3LQKA 1USKA 1N2GA 5JOQA 2ZSKA 4MVJH 5E0KB 1M0EA 4KWEA 5D84A 1SPXA 1NVKA 3OESA 4H0NA 3T1OA 1N0IA 4X95A 4ALNA 4ZIRA 1ZGAA 3D7RA 2VOJA 5GGYA 4Q4CA 5ERXA 3ZJYA 4BRUA 3A27A 3HUUA 3B48A 3K20A 5L7TA 4FDMA 5JZ9A 2GN8A 5CRIA 1JPNA 5CCDA 3PEEA 1QHNA 2BE9A 1W1WA 1R6DA 4B81A 2WG2A 1B26A 1AH2A 1QIEA 3T4UA 3H1TA 4G0OA 1C7FA 4PNPA 3ZK9A 2O7VA 4LQDA 1KI6B 2ST1A 4LXXA 2A5JA 2FETA 1ULSA 2MOKA 2P0YA 5DHQA 4CTMA 5LYJB 2JIOA 2PUVA 4RWEA 3O31A 1OAOA 2POCA 3H0KA 2UZAA 4F2DA 3TXAA 4R1SA 1GNLA 1NUSA 2OAGA 3VR4A 3VU9A 3I6BA 1NMYA 3OO0A 3V3TA 3ZGOA 1CWUA 2RC6A 2VWGA 1PR3A 2ZJ5A 3I2IA 3M81A 3MYRA 3BEOA 4MKZA 4ON9A 1JKMA 2QZZA 3VR4D 1CR6A 1UKBA 4NU0A 3VU3A 3VZPA 4RZ3A 1ZCJA 1M6VA 4L8WB 4MARA 1MRZA 4XRRA 3GPLA 3INTA 2GDJA 2G9UA 3EOAI 3VI3B 5K0BA 3CUVA 3PPWA 5EWLB 3K9NA 3NJRA 3L6BA 3EYAA 3UKJA 1BRMA 4BOYA 3H19A 1T91A 2RE8A 821PA 2I1WA 2X9VA 4ABTA 3BIJA 1U90A 1GNPA 2R6FA 4UVHA 1KVTA 1H8HD 4L4SA 3VPDA 1R18A 1GPAA 1UKEA 1X7HA 2P6UA 3HCWA 3PFWO 1I1HA 3BL5A 4GM0A 2RI0A 4O4HA 2J4FA 2PAAA 4IFIA 4B87A 1HMPA 1EJ0A 2FFHA 2O0LA 3NASA 2NO9A 4NCKA 1FL9A 4ZPXA 1G9TA 4QUJA 4XEUA 4XYMA 2WUDA 5AMXA 3HUEA 2BTQB 4GOMD 4YX9A 4EPRA 3KYCB 4CEJB 3OM9A 3RNOA 2AQIA 2ZBDA 2OO5A 1WL8A 2E49A 1ZINA 3RFFA 2SKCA 1YRWA 2Q8PA 4AY4A 4IOLA 4LHSA 1XX6A 4O4IA 2Q4EA 4LF4B 3THYB 3H4MA 3IVMA 4K9OA 2DXIA 3F4KA 3R5JA 2LGJA 4D8YA 3WK9A 1YDHA 3CR8A 4Q12A 5B3KA 1FFHA 3ENNA 4TGLA 5LM3A 1DQRA 1E6LA 1UC5B 3JQ8A 1ZD8A 3IELA 4NEQA 4D46A 3TPFA 2GBIA 1H4SA 4MQ4A 1PX2A 1AIPA 5ESWA 1C9YA 2DH6A 2Q50A 1SHLA 3K2EA 3II6X 4FZVA 2OGWA 3R3SA 4RA9B 4ZVVA 4A0QA 2I6GA 2PH7A 3BXXA 1KMIY 1DV1A 3PQDA 1FP2A 4YCBA 2BCEA 1HOTA 4ZP1A 2BH2A 4XWWA 1XLUA 1OSLA 2RHOA 4FE4A 3G7DA 4MGEA 4Z7QB 3JQ9A 1ATZA 1XRJA 3N2LA 4E2YA 4N0MA 1RVV1 1VC2A 1VI5A 1WU8A 1RQNA 2OCAA 3VDMA 1L7QA 2WMOB 1QLJA 1L3CA 3VVLA 3EIHA 1IIBA 1P7WA 2QX6A 2ZTHA 3D6FA 3ODPA 2QSZA 1MDFA 4AKEA 4AULA 1X87A 4D6YA 1V48A 2VJOA 4R3WA 2WQ7A 2VL7A 1VM6A 3PXPA 2AF4C 1T2EA 4W5OA 3RIEA 4XVHA 1O57A 3C0KA 1Q50A 3MB8A 3K70B 3OCWA 1ZIDA 2AEFA 1AZSC 4JA2A 1Y82A 3L18A 1RWBA 1IZ0A 4IWXA 4J91A 2FPXA 3GP3A 5JAQA 3SBEA 2YIVX 5KVSA 5HMMA 1KWGA 2ZJ3A 4RXTA 2VPZA 4YG7B 1GRQA 1HV8A 1ZUD1 2I99A 5EHIA 2YMLA 1YR8A 1C3OA 2GEKA 2YWCA 3IUQA 4MV9A 4RCYA 4Z3KA 1PO7A 3ITDA 4B3DA 4D8UA 5ISMA 3Q1KA 2AI3A 1XLTA 3CVUA 2V6FA 1GGFA 4K1XA 2DBVO 1CUHA 4G67A 4X8MA 1PFVA 5A02A 1UT6A 1SUSA 4OB8A 4HMQA 1M75A 1NU6A 2QGZA 5D6OA 3U9SA 1P4JA 1VKOA 1XLVA 3P27A 5DISB 3F9RA 4ZHQB 1D8AA 2DE0X 3JWGA 4IP0A 3RAFC 2VPQA 3KKQA 3CX8A 1SHJA 3GMIA 1GQOA 1SXHA 3O8NA 4ADSG 1EDDA 1P74A 1DELA 1S8NA 2CVOA 3A10A 3JW8A 3BH0A 4FLFA 1YI0A 3CE9A 4BJ5A 1H0HA 4HDNB 5IANA 1FC0A 1PBTA 2NU7A 3K5IA 3BMNB 3SSNA 5GOTA 1KZ4A 5LMNB 2ZTVA 1U2ZA 1TEVA 5P21A 4CLRA 1F4PA 2VAXA 3Q5EA 5EIHA 1XD2A 3RANA 4DV2B 3QEBZ 3HACA 4KK4A 3JAWB 2B8EA 5DNUA 1IWOA 2AEEA 5K3FA 4FONA 4ER0A 2J3EA 2QZJA 4FW8A 1FBNA 3T1QA 4ZJPA 1ESDA 1QIIA 4RMHA 5B7QA 1NVDA 1OU4A 3GEMA 4BMVA 2CNWD 2Q1YA 2FK8A 3QV1A 1V8ZA 3RAEC 2CXTA 4PM4A 5JVDB 1A5AB 1BROA 4AMZA 3L8HA 2JIZA 2X40A 5M34A 4KJZA 1N6KA 4P0PB 4ZAGA 2GZMA 5FOSA 1UCFA 3D6TB 3PDJA 3VTZA 2QAGC 5JADA 1NUAA 4HVAA 4KE7A 2H2IA 4QTTB 3WGUA 1F7VA 1ZFNA 1W1UA 5BT9A 3DLTA 2ODEA 1E3SA 5HKLA 2DQYA 5L6LB 2Z95A 1EFAA 2A14A 3DEFA 1ND5A 3SQDA 5JFGA 1SQ5A 1E3MA 3CNQS 3TN7A 2XCJA 3KAPA 2BRUC 3PDWA 3L9XA 2G6BA 3FTQA 2XXBA 1JU9A 3TLEA 3K0HA 4EPTA 1CFZA 3QM1A 2PQ0A 1QCDA 3IAFA 3IP3A 3MJSA 2J67A 4PCUA 4QDKA 4RSMA 2VSNA 4M0MA 3R7NA 4X65B 4B3TB 3KXIA 4LYDA 1WZIA 5CVJA 3NWBA 1B1AA 1FFGA 2IDJA 3GK3A 3ZCXA 4U2FA 4CMIB 3W5CA 1Y3DE 2RGBA 3R40A 1WM1A 1XPRA 4LYJA 3KYJB 2YTZA 2J9RA 1EX1A 3B82A 3MYYA 3WGIA 1HTTA 3WIEA 4YRDA 3PHLA 5SZKB 3IQFA 1WHSB 3NRBA 1FW6A 4B74A 1TJNA 3NZEA 1JF8A 4ZT7A 5BWNA 1CS0B 3QWGA 1DQPA 2KB0A 2R4UA 4G56A 4FCWA 1E7MA 5CDSA 2VH1A 3WG9A 1IN1A 3CZ9A 3CYFA 5B6IA 3EPKA 2HSEA 1JSXA 2HJ9A 2G40A 4WWHA 5F5NA 1PU2A 1GTL1 1EFKA 5IF3A 3CROL 4GYWA 1T8RA 4L8YA 4MR7B 2BHTA 4M21A 2L1PA 4BQIA 1YRHA 4YRLA 3T3EA 3U81A 3OU7A 4F3YA 2QVBA 1VHJA 2P27A 3AOGA 5A7HA 1LUAA 4YPVA 1HYEA 3AERB 3BJMA 3K0FA 5DNEA 3ZU3A 4DQXA 1HORA 1XXLA 1YB6A 2ZYVX 1GYQA 1L4NA 1E99A 3GLUA 2GHTA 1A2KC 2C2OA 2NUPB 3P0HA 4QBTA 3NVAA 4MPPA 3EZXA 1UPXA 2Q2OA 3GJ6A 1Y7HA 3AI2A 2UZIR 1DIGA 4YO7A 5B1SA 1YIOA 5HE9A 1SHZA 4BBZA 4UTVA 2R0QC 1WIZA 4BN5A 3RSSA 5J1SB 1I9CA 3O9MA 4RVGA 4RAOA 3CNBA 5BRNA 4WNAB 2KPJA 1OW3B 2H5LA 2OV8A 4IUYA 3TSYA 4WZ6A 1FQKA 2R7NA 4KHZA 4WV3A 1C4XA 4D5EA 4ARCA 3HB0A 3SOPA 4BRZA 1HETA 1YACA 3JZAA 5BURA 1YNSA 4RBNA 5C4MA 2H1HA 1K3FA 2JCXA 3K9HA 4FB4A 5MN5A 2BSAA 5IC4A 3CUYA 3V9AA 2PSJA 1FXUA 4KXFB 3S3TA 2H0AA 3U3JA 2FPPB 4Y9UA 3SVTA 3CZCA 1R7RA 3GL9A 2HLDD 3AO0B 4BKPA 2D0PB 1YI1A 2RONA 5JSUA 2ADOA 2I2XB 2QR2A 3A36A 3UJHA 3QFTA 3OPVA 2PBFA 4IHJB 2XLBA 3AF6A 4X7BA 1ZHHA 2XDQB 3OICA 4KGXA 3T95A 4A1FA 4AP6A 4LYGA 3ZCUA 1OX4B 1ZLXA 3PUXA 4QU0A 4WZZA 2DEUA 2C03A 3M5WA 4OHVA 3D8NA 1ZOOA 2DR3A 2WUFA 3NBQA 4HDKA 4HGOA 1CJMA 5I51A 2GF0A 3FMYA 1N6PA 3SD7A 3K09A 3W1EA 2BGGA 3TFLA 2FGKA 4NP6A 5C3UA 5AW1A 4DHWA 1Y9AA 2AZXA 3DTVA 1RM4A 2A94A 4HH0A 4EY8A 3T3OA 3F7TA 4F5YA 4HTFB 5AK5A 4GKJB 5TT1A 1J0DA 1SUCA 3CNOA 3TAXA 5I7WA 1G5IA 1AC5A 3OBIA 1E1QA 1GTMA 1Q57A 2Z8YA 3HYLA 5FV7A 3VPAA 5DRTA 1N3YA 4I50F 3B6IA 1S8FA 4LXHA 4QNRA 1Z28A 4BO1A