4EKIA

Crystal structure of dot1l in complex with epz004777
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
319
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 319
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ekiA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ekiA02
2IGTA 2NXNA 3G7UA 4LWPA 4FR0A 4B17A 4ZTBA 2YR0A 5EQJB 5EOVA 4RTQA 1X1CA 2PX8A 2PT9A 4C07A 3BGIA 3MCTA 3DMFA 4IV0A 1JQEA 2CL5A 3KPVA 5JR3A 3P97A 1QANA 4M36A 2PX5A 4AZVA 4C4AA 4RTLA 5FWDA 2PV0A 2Z6AA 3T0IA 4KIGA 5DT2A 3K0BA 1FPQA 1ZQ9A 1KPHA 1JR4A 3CC8A 4FS8A 2IPXA 3V97A 3H2BA 2YX1A 2OBFA 4RYLA 2P1DA 2B3TA 3BUSA 5FA8A 2HMYB 4M38A 3LPMA 3MGGA 5HIJA 1I9GA 3P2KA 3CBGA 3KQMA 3KQTA 4IWNA 2P7HA 4KDCA 3UFBA 5KQRA 4CKEA 1VIDA 3C3YA 2I7CA 2JH9A 4GOOD 1Z3CA 2AN4A 4ER0A 3C6MA 1KPGA 2I6GA 2NP7A 4RVDA 3O4FA 5EPEA 4WVLA 5KYGA 4OBXA 4X1OA 2ZIFA 5K0FA 5IKMA 3MTEA 1G6Q1 3UWPA 3L8DA 4PYIA 4E2YA 5C9ZA 2ZFUA 2PY6A 3KKZA 3P2EA 4FGZA 1JTFA 2ZIEA 5JUWA 4RX1A 3EGEA 4EMSA 3BWMA 3FPJA 3BKXA 3LKDA 4M37A 2PXAA 4JXJA 1L9KA 3KQVA 3ERCA 1BOOA 3SSOA 4R05A 2WA2A 3R9XB 2B78A 3DP7A 3IEIA 4K6MA 4QTUB 1VL5A 5EMMA 5EVJA 3OE5A 4LECA 4C05A 5BP7A 2PXXA 1P91A 1R74A 1YZHA 3D2LA 4HG2A 5K0NA 3ANXA 5C0OE 2C7PA 4OA8A 4ATNA 1TW2A 3BGDA 3KQOA 4QTTB 1RJEA 3SVZA 2BR4A 4QPPA 2P35A 3PB3A 5FHRA 2UYCA 3DUWA 4AZTA 2QY6A 1AF7A 1ORHA 5EC8A 3HP7A 1VQ1A 3ELDA 3Q87B 3HCCA 4PYKA 2IBSA 3BWCA 3ELUA 3IHTA 3T7TA 4DA4A 3NVKI 1UFKA 5LQCA 2I9KA 3M6WA 3TMAA 3TQSA 5FQOA 1HNNA 2ERCA 2EJTA 5D1HA 4PONA 5E1OA 4CTJA 3KR1A 3LDUA 4EVIA 4PYQA 5BXYA 4QPNA 5ICGA 4RWZA 5EZQA 2ADMA 1KIAA 1QYRA 2PJDA 2ORED 2PGXA 1FJXA 1L3IA 2PBFA 3GWZA 3E8SA 5GIPE 4DMGA 3LSTA 5HIKA 4PYNA 4E2ZA 2NYUA 3GXOA 4QQKA 4FSXA 4POOA 2GS9A 1NW6A 3A7EA 2FCAA 5FWAA 3GRUA 5IH3A 5K0GA 3EVBA 4P7FA 5FQNA 2PWYA 5EKUA 5K0JA 5DM4A 1YFLA 2IDJA 4RTSA 3KPWA 5DM2A 5K09A 2O06A 4P58A 2AOVA 2FK8A 5F2KA 5EEGA 5K0LA 2BM8A 2YXDA 2UYHA 2K4MA 3P9IA 2LD4A 4LG1A 3GNLA 1YFJA 4DKJA 1P1CA 2G1PA 2ZCJA 4MIKA 2OPBA 1G38A 2N47A 5GM2A 1JSXA 4AUKA 3TKAA 2O0LA 4YV0A 3G5TA 2P3OA 1NV9A 4PYOA 2YQZA 1ZHFA 5DTMA 4AX8A 4E30A 3DLCA 1QAQA 3UJAA 4ER5A 1EJ6A 4HTFA 4AZWA 1M6YA 2AN5A 3G2PA 4YUZA 3DXXA 3M70A 1RI2A 1R18A 3HCFA 1FBNA 3LL7A 4NECA 4F85A 1SUIA 2IH4A 4L7VA 1SKMA 2NXEA 4BLUA 2ZBRA 3EVGA 4MQ4A 4HTFB 2A14A 3OZSA 1WY7A 5E8JA 5G02A 4AZSA 4C04A 2G70A 5DXJA 5FADA 2XYVA 4PINA 4RTRA 4U7TB 1ZGAA 3A4TA 5EHIA 3FPGA 4M7RA 2GLUA 8MHTA 1INLA 1D2HA 1EIZA 2AVDA 5C1IA 2FPOA 2GB4A 1NT2A 3KR9A 1X1DA 5E9QA 3OFJA 3JWHA 1NKVA 1WXWA 3HCDA 4QQNA 2VP3A 2GH1A 4DQ0A 4DZRA 4CXMA 1QAOA 5P8WA 4EK9A 3O31A 1VP3A 3FRHA 5EIWA 3NJRA 3QOWA 1YF3A 1XDZA 3PLAE 3MERA 3LCUA 1ZG3A 3E05A 3KR0A 3GDHA 3G8AA 5LQUA 4KRGA 5HEKA 4RTPA 2V7EA 3BXOA 2H11A 2NNWB 1RI3A 4PGGA 4BLVA 2ZZNA 4ER3A 3REOA 5GWXA 4GOLD 3OFKA 1N7IA 1HMYA 4QVKA 5EGSA 2PSSA 4GC9A 4E33A 2C7QA 3EMBA 1KR5A 4YUYA 5LQRA 4YV1A 3P9CA 5EEHA 3CKKA 3GRYA 1SVUA 3FUXA 5CCXA 5MHTA 1SUSA 1XCJA 4GEKA 4RTJA 1D2CA 3P9NA 3G2QA 1AV6A 3KPYA 1BC5A 1YUBA 2IFTA 3AJDA 3I9FA 1JSZA 2BZGA 3KU1A 2CMHA 3CJRA 3SMQA 5DRTA 2R3SA 3AXTA 2YXEA 2OXTA 2Q41A 3OE4A 4U7PB 2GAFA 3SM3A 3C0KA 4CKCA 3KQWA 5LQJA 1N7JA 3PVCA 5BW4A 2FRXA 2R6ZA 5K0EA 3HA5A 4FSDA 1NW3A 3T7SA 1SG9A 2NXCA 3RW9A 5EMKA 2BM9A 2WA1A 5K05A 2VDUE 3G89A 1RJFA 2P3QA 3FPHA 1XCLA 3NVMB 4FT4A 1RI1A 1Q0TA 3IYLW 3FRIA 5K8VA 1T43A 3QV2A 2EJUA 5EIFA 1RJGA 3CGGA 4E2XA 1NW7A 3HCAA 2ZIGA 3B3JA 3I64A 4GQBA 2QE6A 1NW5A 2QM3A 4MTLA 3G2OA 3TPZA 10MHA 3DOUA 4DCMA 4RSRA 4Z2YA 3C6KA 1JQDA 4HH4A 1JG4A 1WG8A 3BWBA 1DCTA 3R3HA 1TPYA 3C3PA 3ORHA 4C03A 4KWCA 2FYTA 3EVCA 3FPFA 3GCZA 3VC2A 4E32A 1EJ0A 1NBHA 1NV8A 1Y8CA 3M4XA 4X60A 2AOWA 4R6WA 1MHTA 1JTEA 4G56A 3SXJA 5E1DA 5HZMA 4RVGA 4HSGA 5GM1A 2V74B 5CVVA 4KW7A 3FTEA 1BKYA 2VDWA 2OO3A 2ZLBA 1VLMA 1KP9A 5CD1A 4QDJA 4RTOA 3BGVA 9MHTA 3EMDA 1XJ5A 4EKGA 2PX4A 2JHPA 3HM2A 3UJ6A 4RVFA 5CCBA 3FTFA 3HTXA 3SGLA 3UA4A 5LQAA 5GIOE 3LECA 3TM5A 3BKWA 2BH2A 5DSTA 3GJYA 3HVHA 2PWPA 2AR0A 3KHKA 4R8SA 2HNKA 2XVMA 3HEMA 1IY9A 5DTQA 1D2GA 2YXLA 3DXYA 4R6XA 1AQIA 1UIRA 5B1SA 2P41A 3AWIA 3NWBA 3LCCA 5DX8A 3NTVA 5F2OA 3FZGA 4DF3A 2NXJA 3NMUF 5EG5A 3RODA 3B89A 4V0RA 2ZZMA 3VC1A 3A26A 1FP1D 3EPPA 3MCZA 2B2CA 1Q0SA 3KPUA 4E2WA 2QYOA 3ID6C 2AS0A 4ER6A 2IDKA 3HVJA 3SX0A 3UBTA 3B3GA 5LSAA 3BT7A 2O07A 3FYCA 3DULA 2OB2A 3MB5A 2Y1XA 5EMJA 2HR1A 1V39A 4PIMA 2YTZA 4OBWA 3EVFA 3M6UA 1YB2A 4P7JA 1MJFA 1KHHA 3FUWA 3UJ9A 1NBIA 4GUAA 3FPEA 4OQDA 4OA5A 1AQJA 2IIPA 3THRA 3LDGA 2Z6QA 4RTMA 3EVEA 1PJZA 4GOND 5DLYA 3OU7A 4PIPA 4F84A 5K0CA 5BW5A 1XDUA 4RV9A 3E23A 3DXZA 2AOXA 5U4XA 3DLIA 3HA3A 5HFJA 2XBMA 5HIMA 2ZBQA 1F38A 1P39A 2F8LA 2G71A 3GU3A 3BWYA 3PS9A 2ZTHA 5T64A 2G8NA 5LQNA 3G2MA 5EZSA 3FUUA 2UYOA 3G8BA 2B9EA 1OR8A 2PKWA 4PYMA 2OZVA 2OYRA 3MAGA 4RTNA 3GIWA 3B5IA 4GOMD 4PYLA 3UJBA 4F86A 3LHDA 4X61A 1R8XA 5DPMA 3T7RA 4BP3A 4YUWA 4BY9E 4MWZA 3HVIA 4MHTA 4BLWA 4YUVA 3FYDA 1XDSA 2AZTA 5FUBA 3B3FA 3KQSA 5FULA 1KYWA 3WSTA 3UJCA 3B7PA 3TKYA 3I5UA 5DM0A 4E70A 2BR3A 3K6RA 3TR6A 3VSEA 2ZW9A 2AVNA 3PFHA 4CKBA 3P71T 2KW5A 3PX3A 1RI5A 3ELYA 5CVJA 3TRKA 5FA5A 3OCJA 7MHTA 5E2AA 1O54A 4PNEA 2P3LA 5CIYA 3DMGA 3HVKA 3RIEA 4ISCA 5KVAA 1PRYA 5FCDA 5HOQA 1UWVA 4Y2HA 5ICEA 4HC4A 4IV8A 4X41A 2CWWA 2H00A 1EAMA 3KQPA 1XVAA 4HGZA 3UJ7A 1R6AA 4H0NA 5H02A 1DUSA 3DR5A 4OX9Y 4GC5A 1JG3A 2C7OA 4E31A 2YVLA 2HTEA 4UOEA 1P1BA 2JHAA 1RJDA 3OU6A 1G60A 1L3CA 3EVZA 3F4KA 3GO4A 3UA3A 2UZ4A 3GRVA 3PT9A 4Y30A 5DX0A 1WXXA 5T67A 3ER9A 2PLWA 3DTNA 2VS1A 3JWIA 4OQEA 4IKPA 4PWYA 2QRVA 3LKZA 3I58A 4X63A 3TLJA 5DRYA 3LX6A 4R8RA 3LBYA 5ICFA 5E9WA 1O9GA 3NDIA 5DX1A 4PGHA 1M0EA 5CVDA 3M6XA 1DL5A 1FP2A 3DH0A 2QRVB 3EVAA 1KYZA 1SQFA 4WXHA 1N2XA 3EEOA 2UYQA 3FUVA 3GRRA 1I4WA 5DSXA 3IV6A 4YUXA 2ZWAA 3HNRA 5CVEA 5GINE 3EGVA 3LGAA 4RTKA 3OPNA 2ZZKA 2GPYA 3R0QA 5CUQA 3UZUA 1F3LA 3FTDA 5T6BA 3P9KA 4DCGA 3UJDA 1BHJA 2ESRA 3PFGA 4LWOA 1SQGA 3E7PA 4A6EA 1G55A 2JH8A 3CCFA 1H1DA 5CVUA 4PCAA 2EG5A 2ZULA 4ER7A 3MTIA 1RI4A 3ELWA 3M6VA 3MQ2A 4HGYA 4P7GA 4FZVA 3CVOA 2P8JA 2JHCA 2E5WA 1L1EA 4QVGA 1G8AA 3NDJA 2P7IA 3OZTA 3NW9A 2JG3A 1XTPA 2VZ9A 3S68A 3G5LA 2FHPA 3A7DA 1KXZA 3HA7A 3V8VA 2XYRA 1R00A 1X1BA 1ZGJA 2AN3A 3CJTA 1QZZA 3JWGA 5F2NA 5FTWA 4DM3A 2JJQA 1O9HA 5E1BA 2IH2A 1NW8A 4FP9A 4A6DA 3LBFA 5DWQA 2OKCA 5HIIA 5E8RA 2OY0A 1WZNA 1IXKA 2PT6A 2ZWVA 4YMHA 3A27A 4HRAA 1VBFA 5DM1A 5DTRA 3P2IA 3OZRA 2B25A 1R8YA 2ZBPA 3R24A 3VYWA 4YV2A 3ME5A 3U81A 2Z6UA 5EHGA 1NE2A 2EFJA 1EG2A 3EEYA 3FUTA 4KVZA 3THSA 4XUDA 5E9JA 2HV9A 4C08A 3O7WA 4XUCA 4RVHA 2PXCA 4GF5A 5EKXA 1QAMA 3HCEA 5E2BA 3LCVB 2XYQA 2AOTA 5K0BA 5DXAA 4PCLA 3X0DA 1I1NA 2EX4A 1TW3A 4FT2A 4EKIA 4XUEA 3AY0A 5LR6A 1JG2A 2DULA 3EVDA 2DPMA 2Y1WA 3PX2A 3DMHA 2P40A 3EGIA 3KR2A 2NP6A 1U2ZA 4EQZA 1M6EX 4V0QA 1YZ3A 1B42A 1VPTA 5GOZA 2AOTB 1VP9A 2BR5A 3KQQA 3GRZA 1ORIA 3KQYA 4CWAA 2O05A 3SR4A 4KIFA 2ZSUA 2OB1A 3SSMA 3R6TA 5HILA 5FHQA 2HWKA 4XCXA 5K01A 1L3BA 2AOUA 1IM8A 3UJ8A 4YMGA 5ICCA 3I53A 4GBED 2IH5A 3LDFA 2PX2A 5KQSA 5EMLA 5K03A 2GA9A 3FTCA 5M5BA 4QDKA 3HCBA 4BP1A 1JG1A 1VE3A 3AXSA 4C06A 2AOUB 2IP2A 2XVAA 1KPIA 3GGDA 3TFWA 1ZKDA 3G88A 3NWEA 1G8SA 5KS2A 2C7RA 2IBTA 2PVCA 2VDVE 5GP1A 3KPJA 2ZVJA 3MHTA 3TOSA 4PYJA 4P7KA 2FK7A 4O29A 3M33A 3CJQA 3ER8A 3SSNA 2ONYA 1XXLA 1X19A 3Q7EA 2CMGA 2I62A 2YUIA 5ERGB 3QOXA 2O57A 4KDRA 5D1NA 2H1RA 3JWJA 2WK1A 1JQ3A 2CKDA 1EQAA 1X1AA 3A25A 5CM2Z 3OU2A 3P8ZA 3PTAA 4CTKA 5LQKA 5E1MA 2ONZA 1WS6A 3BZBA 3TM4A 2G72A
chains in the Genus database with same CATH superfamily
3QPUA 3A1TA 1NATA 2CEKA 4B17A 2YR0A 2G28A 2C03A 5IVIA 1XDBA 4NP6A 1X1CA 4WNAB 1NLZA 1G7CA 3S99A 2YN2A 3KCNA 3RAJA 3LWBA 3UO8B 4YPFA 3FETA 3ZJUA 4AKHA 2WAOA 3AINA 4P33A 3DD5A 3SSAA 4C1NA 2A7XA 4RE5A 2ZYIA 3K7EA 4L73A 4P36A 4MVCA 1AG9A 4K81B 1GTVA 4ARSA 1PNQA 1RYDA 2VNIA 1CUFA 2CXOA 4YJKA 3U1TA 5FA8A 3WXMA 3OF5A 5FF9A 4CQMA 1G38A 2GRAA 1LTQA 3TQIA 3KHUA 3WTBA 1ZSNA 1ZXXA 1HRKA 1RWWA 5TT1A 4EO9A 1JMYA 1N1DA 1XEAA 4M1ZA 4YDSA 1Y34E 4CR8A 1U9IC 2JFPA 2OCIA 1QZ3A 3CUEF 3GJ0A 4RVDA 5JASA 2NV0A 2PRIA 1ATIA 4ZRDA 2ZB8A 3FFAA 1SZCA 1B1AA 1RQRA 3CNQS 4N6OA 1QO0A 1ABFA 3C3MA 3DOJA 3DWIA 4IIXA 4MB0A 2YS7A 4NBRA 3FVVA 4G5FA 1OC2A 2IHZA 2RG7A 1YE3A 3GJ8A 4FE7A 4JXJA 4C9BA 5M04A 1XXHA 2YC4C 1BVUA 2WJ3A 3FLBA 2VT2A 2XQKA 1IPEA 1PEDA 4IIHA 4CQLB 2ZWPA 3IEIA 3GELA 3EXG1 3RSHA 3JTMA 1I2BA 1XHLA 5DU2A 3KKOA 1FMCA 1YZHA 3H16A 3TSWA 421PA 2PMWB 1U3TA 1XJ0A 5I7SA 1W93A 1XTUA 4ZCSA 3UV6A 4FKBA 3ND5A 4RVCA 2R1TB 2QNIA 2XNSA 2YC2C 3NB0A 4G0PA 3VUFA 2LYLA 2C7GA 3P96A 4R5MA 3TK1A 4HN4B 4MRPA 2N3ZA 1PX2A 4GL4A 4ZT2A 1T0BA 3NI2A 4M0EA 3T7AA 4PZPA 3UV7A 4ND6A 5GZ1A 4Y9RA 4R7TA 3CEMA 4G41A 3LDUA 4UARA 4WGGA 4EL5A 4BV2A 1U8EA 1LVGA 1SKYB 1WOMA 2JJ1A 4R8VA 5BXYA 4MMXB 2HNBA 5J58A 2JFQA 2DTEA 2ZRIA 3COSA 3GVPA 3U4DA 3WLPA 1U9CA 5JS2A 1W88B 5DM70 4FUQA 1W94A 3KTDA 4HPJB 3PQ3A 4JB8A 3W5DA 1VM6A 3RK4A 5EP2A 3LGXA 2CL7X 4R9UC 5T8KA 2EKLA 2BZ1A 4C3OB 3U31A 3TN7A 3QYXA 2GJ9A 3EVBA 2ZWMA 5FFNA 3GYBA 3LRTA 4W9RA 3WLKX 5IDVA 4R2HA 2O06A 4I0WB 2FK8A 5A4KA 5JS8A 4TTIA 4B46A 4Q7QA 2NTJA 3AESA 1T5DX 4YG1A 1ESEA 3L6EA 2JLWA 1BHQ1 3V33A 2RGXA 1P1IA 3I32A 3CVYA 4B09A 2ZJBA 3NQ41 4WNIA 1P1CA 3CX8A 5TVKA 3T7DA 4II2A 1JLSA 1OTHA 2OLJA 4WLNA 3R7SA 3RB8A 2VTBB 4ZN6A 4B47A 4AUKA 1GR0A 2FG6C 1GRRA 4MZDA 4OG2A 5IPFA 1ZBDA 2IUUA 4DZTA 3G5TA 3LLVA 4RPIA 2A9FA 2B99A 4GOXA 1S1MA 4L9SA 3K96A 3ZV5A 1JLLB 2IV1A 1C0KA 2GESA 2YNMC 3S2GA 1UOOA 3LZ6A 5G53C 5HK9A 3C5EA 1X7WB 3EOAI 3DTVB 6LDHA 2ZRDA 5K45A 4CL0A 2Z43A 5EPUA 1KA9H 2R5FA 1VI6A 3UUEA 1M2FA 2ACVA 3VR5D 3LL7A 3T1VA 4CDNA 2ADFA 1E6EA 5CYPA 1US8A 5TXGA 1JEQB 4BLUA 4RPGA 2R6CA 3C7CB 5I4KA 3OZSA 5TGTA 5CLIA 3Q5EA 1V7ZA 3BSYA 4JT4A 5LLTA 2WIJA 3KHTA 1WDTA 2NU6A 2W5UA 3VSBA 1CP3A 1KI6A 1D2HA 1KH3A 3CEAA 5ARCA 4GPBA 3KZ1E 1PQWA 2PIAA 3K6JA 1NT2A 2EKDA 2VP0A 3WL6A 1E9DA 1FF9A 1HDXA 1XZCA 4LQLA 3WK6A 1YRLA 2GKSA 2NZXA 1XXHE 4IGFA 2XUOA 4EAAA 4MB6A 2J59A 3QI7A 4S05A 1DI0A 3O84A 2FSPA 3EA4A 3O31A 2EEPA 2EWVA 3VTAA 1JA9A 1RQNA 4E94A 2R4UA 1NLYA 1PZEA 2Z56A 3U7QA 2O8EA 2W11A 5TQ2A 5AICA 1NT4A 3WB9A 5JAZA 5C51B 3HGTA 4WAUA 3L9XA 1T36A 2HMWA 5HZGA 1QHHA 4IXWA 3B5JA 3H9CA 4N7MA 5I9TA 3LYUA 1O77A 4KMSA 5B58T 3DGFC 3G13A 4Z3DA 4X4EA 3JZFA 4MHOA 1U11A 4RKWA 4UXIA 1WBBA 1Y9JA 2XE4A 4LXIA 2OXFA 4YA6A 4D81A 3O92A 5KNDH 1DAEA 1T4MA 3FUXA 3GFSA 3PQ5A 1M73E 5F5LA 1I7QB 1U7UA 2G07A 1ZGGA 3ZKCA 1BE6A 1LV8A 3G2QA 1SRRA 4OP1A 4MVJI 3QEBZ 2UXCB 2GVNA 2IFTA 4ZO8A 3SS8A 2ZRCA 2DUJA 1UANA 2GZDA 2YWXA 1VJDA 3KHSA 3SE7A 1OH5A 1X2BA 1BRMA 3T7SA 2XWSA 2IDZA 4BEBA 3OPYB 1CQZA 2RGCA 5JZMA 5GONA 5EQFA 5HE8A 3THYA 1H2FA 1FLVA 4JLUA 2ZRGA 2OCXA 2AK2A 2VDUE 4QNMA 1XCLA 1CUBA 5COQA 3ZHUA 1C7FA 2YV3A 1CR4A 5JVDB 2EJUA 1D6NA 2LYSA 1E2UA 3RSCA 2JDID 1HQKA 1G8PA 2P27A 4CM3A 1ODKA 3MWEA 4EQ6A 2BDEA 2XSDC 1GWNA 1L7AA 3C45A 3G2OA 4CEJA 3OHSX 5TIIA 3SQXA 4HDRB 5J2UA 1HE4A 4WZBA 4FLFA 3ROZA 4DV7B 3LX8A 4K3UA 3TNJA 3N7AA 5ADHA 4CNBA 2RHCA 3V32A 2NSLA 3WGQA 1KKLA 1X9IA 3DBLB 4G8DA 4S12A 2GZHA 1JTEA 2Q0HA 3ZDQA 3MJRA 1FJHA 1Z2NX 2FPRA 1VBMA 2ACEA 2V74B 4ZVUA 3RJZA 2IS6A 2V98A 4PPFA 4G9BA 3O2QB 3EUFA 5T3YA 1BKYA 3WOVA 1QDEA 1YNSA 2R00A 3AEQB 3PGXA 1UBNA 1EI9A 1KC1A 4LSZA 4MDYA 6AT1A 1VIVA 1KO4A 2C95A 3BGVA 5JAOA 3X2FA 1LC3A 1ZZEA 3LSYA 4EB8A 4EYEA 3IDSA 1XVUA 2C7BA 1MAHA 3VTKA 2DQYA 4KFRA 4FEYA 1DCKA 2VDWB 2DHEA 3HP4A 3SEAA 4FDVA 2PWPA 2AR0A 4CLDA 4R8SA 2XWPA 3VI4B 4ZHQB 4RIIA 1GTG1 2PL5A 3R5HA 2IYSA 1NMQA 1EFHA 3NC4A 2V4ZA 1G7TA 4KGDA 2PS3A 5B1DA 3BD6A 1P5JA 5KVVA 4ZVKA 1B93A 1BGWA 4PAOA 3RM3A 3ISVA 1OI7A 3EPPA 4R0NA 2I6QA 1IY2A 4YRZA 4MUEA 1BX0A 1OX5A 5G4KA 3R0ZA 2GK4A 5JO9A 5BR8B 2HK7A 1VE7A 2DPHA 2XUQA 3IILA 5SZIA 4XZ3A 5JZOA 3CE9A 1F9EA 5KC8A 1OLSB 1Y5MA 3W5BA 4X92A 3WIBA 4U9HS 2C5GA 4WQMA 1BEZA 4Z1MA 3NBFA 1CJVC 1NF3A 4QUIA 3ADBA 1SVNA 1S6YA 1LS6A 2ENUA 2DC1A 4NSNA 2PE5A 1XMIA 5MN4A 2QD5A 5E3IA 3H5TA 2OUKA 2WQZA 3IUPA 3F6YA 5KDOA 1P39A 1XMXA 4IUCS 2ZTHA 3ESXA 2BN4A 2HXYA 3FYSA 4HAOA 4Y2SA 3AEZA 4BNNA 3U6BA 3VV2A 3B9BA 2FSVC 1WHSB 5IT4A 3I61A 2X3FA 1L7VC 4KE9A 2FV8A 1BCSA 1WF6A 3NS7A 4PU8A 3HDQA 1ABBA 4NFHA 4BY9E 2IF0A 4H1VA 1UDXA 1W5TA 3OP4A 1D8AA 1AIPA 4M7OA 2ZQZA 1KYWA 4OQQA 1QZUA 4QLOA 3O9MA 3UMBA 4KXMA 4D3ZA 1JKJB 3CZ4A 3QLUA 1CRQA 4YRJA 5SICE 5MN6A 1AO3A 2ZWOA 4OP3A 5CFNA 1O6CA 1M74A 3PQCA 1ZISA 4CKBA 3P71T 1LPOA 2HYDA 1RMTA 5KNBH 3IEMA 3GVHA 2RCYA 3NZEA 2BGJA 4E5MA 4Q9HA 2IXFA 3QIVA 1ODFA 4A92A 3D2AA 3LPCA 3BICA 2LE0A 3NC0C 2AX4A 3RIEA 1PWXA 6CHYA 4MULA 3AUSA 4KFTA 3BCHA 4RJ2A 4RVNA 2I4NA 1CERA 5KB3A 4BQQA 4ZDWA 3GPLA 1EAMA 4WZBE 1U7PA 1U28A 4WKOA 1CJKC 1RWPA 1ISHA 3OKCA 4XD2A 3VPAA 4AKTA 5I4IA 1KVTA 1OLXA 1RJ9B 2J5QA 1CIVA 2O7VA 3HKCA 1WU8A 3HBLA 3MWKA 4F6RB 1T4CA 3QBVA 3E9DA 4INZA 1Q16A 5J2TF 1IZ8A 1UMKA 2E55A 3JARA 3JQCA 1KE1A 1ZI6A 2VXBA 4MVJP 3ZEIA 5BN4A 5HUHA 4ZOCA 1K86A 1T5TA 2W43A 1KSGA 1C1DB 4ZC8A 4X63A 5IAJA 4NBVA 5B57C 2OLKA 1N5JA 3C16C 2QVGA 4Y1FA 4QM6A 1ZOLA 4AP9A 2EKBA 4JP2A 1XUOA 1UDAA 1JT9A 2C9CA 3HFGA 3CGWA 3AQ4A 5JTUA 1KYZA 1U1EA 4RVSA 5A9SA 1VHDA 2OVBA 3TZQA 4IHAA 5KNDD 4D3XA 2HCNA 1OYYA 4J9UE 4ZHQF 3DLTA 3EEOA 1RRPA 2JJ2A 3PEWA 1SJ9A 1K7XB 4G8BA 3PPWA 221PA 2MU1A 1XD9A 1CQXA 2PV7A 1QWOA 4Y2YA 4Y6QA 1E3DA 4L15A 2WUSR 1UC8A 4NU0A 4DCGA 1G18A 4GX5A 1NBEA 1VLQA 2OC4A 4IIJB 4V0MA 3S0JA 3VVMA 4C0HA 1HX7A 2V03A 2APJA 1UK9A 1R15A 2P5UA 2VYNA 3AYZB 1ZUNB 2Z09A 4OI2A 1WPXA 1VCMA 4L5JA 4UFPA 5CB4F 1ZSVA 2WMOB 3TZLA 4JX9A 1MIHA 3N8IA 1N6OA 5LVAA 1B0UA 1QG0A 2OSVA 2BP7A 4KYIB 4YBZA 4BFXA 4Q4DA 5L3QA 2XAAA 2R66A 4IDAA 4C1BA 1DAHA 4YCBA 1V95A 3SCFA 2OQIA 1WIZA 1H6DA 1XVVA 2YW9A 3N8NA 4LMPA 4QO8A 1E3WB 3T5PA 1GGNA 3KZ3A 1Z7BA 3A7DA 4U6NA 5KDLA 3X1YA 1ZR4A 1R00A 4FW9A 1MH9A 2NO4A 1R9NA 3UMCA 2F6RA 3CSSA 1F06A 3KLMX 4H08A 1O9HA 5DFAA 3ESYA 2ILTA 3UAWA 1LCIA 3B9RA 3H13A 1OLUA 1XZMA 1DAGA 1RXVA 3CUVA 3LK7A 5LQSA 2J48A 1LW6E 2O0JA 4B4WA 3F2IA 1ZZBA 1HYGA 4K9NA 1L8AA 5CFRA 5KCZA 1ZL2A 1RZVA 3EG9B 4PV7A 2WE8A 2XQJA 3V4ZA 5MGNA 1BGXT 1EG2A 4HNRA 2PXEA 1VMEA 3N0XA 4O4LA 2ZG6A 3TRBA 2HV9A 4I50B 3BAFA 2VSXA 3DLPX 3RC1A 4C08A 1S9HA 5EKXA 4F45A 3AEXA 5B53A 1P8AA 4PLVA 4NG5A 1DQRA 4FR5A 4D2IA 1AVTA 4G0YA 4M0DA 3EZXA 4X0EA 1NQAO 1SKQA 2J3JA 1QH1B 3C41J 3GA7A 3JD0A 5DBGA 3EVDA 2RSLA 2MYNA 3PX2A 2OZLA 2VATA 4E11A 1KJJA 2BGTA 3IKTA 1M76A 1B42A 1VPTA 1N5LA 1KVRA 2V4MA 4MA0A 4CWAA 4FZJA 3I0NA 4X71A 3FI0A 3HSYA 2IZZA 2I3DA 3NTUA 2D8AA 2X2FA 2OVFA 2K2QB 3AEYA 3N5KA 3RJ9A 2HWKA 2B4YA 3UK1A 4EYQA 4MAMA 3ENZA 1U9IA 4IJ5A 4OEHA 3HJHA 1YFZA 2WP0A 1AU9A 5DHSA 3LDFA 3D7KA 2ODEA 4BMXA 3WDKA 4NCBA 4P0TA 2V0GA 3W5IA 4LJ7A 3GLHA 3OT4A 1ZS9A 3CLRC 1RAGA 1P2GA 2BUAA 2R7AA 2ZTLA 3WB1A 1KK0A 4DIFA 2AOUB 5A4IS 1XF9A 1ZX1A 1DLJA 1L4HA 3L7MA 1W76A 4Z5XA 3AVWA 1GG9A 2PVCA 2BEWA 3NAGA 1JDBB 3HWSA 3KPJA 1YZUA 3SJUA 3FGZA 3FYTA 3LUJA 3OAAD 3WYGA 3SVLA 4JLNA 3TNLA 1CS4C 5AI9A 5EP3A 4YREA 4Z4FA 1X19A 1Z4NA 1F7VA 4FFLA 4M9SA 2I62A 1HXHA 2EJCA 4U9IS 1HR0B 2LDXA 3LP8A 1F17A 4C87A 1JILA 1C5KA 3ZZ0A 1F51E 4KRXA 4OCZA 5ICSA 5IT0A 2YWEA 3NHWA 3OKPA 2F1OA 4XVRA 1KI2A 1ENPA 4HK4A 2DGDA 1SVMA 1JFLA 1WZIA 1Q0RA 2CW5A 4HXGA 4K05A 5ESRA 1KFKB 2DQZA 3ETDA 5DF1A 2DSTA 3M5DA 1JBKA 3SJCA 3UGTA 3DNMA 1MPTA 1TQDA 2O8NA 3K9HA 1F6WA 5EQJB 4D3FA 1GM5A 5ETJA 1KSJA 2R6HA 2O49A 1J21A 1G5FA 1QV7A 1T9AA 3C5CA 4HH3C 4J1TC 2O2JA 2G9NA 4PU4C 3DMFA 4IIJF 2W6OA 4QDXA 2UZ3A 1E66A 1QANA 4W1RA 3WYDA 4C4AA 3EXEA 3QNMA 2IYRA 3LBHA 2XCOA 3EIHA 4LYFA 7AT1A 5BNFA 2XNDA 5KNBD 3LCJA 3V97A 1K08A 4EHNA 4Q3LA 4Q4HB 3W8DA 3H5VA 1HFWA 5NULA 4PSCA 4J7XA 2HCTA 3A6KA 3G8YA 1NLFA 1T3GA 1EHYA 4H7PA 1WV1A 2F1KA 2Q5OA 5SZJA 3RYHA 1SVKA 2FU5C 5KTNA 2GF0A 3DOCA 4PQYA 4RV5A 4MYCA 4CKEA 4EVQA 2NUAB 4JBYA 1G8MA 1KPGA 4AT1A 3O2NA 4GI3A 1ISJA 1CB7A 2YHBA 2Q3FA 1RZ3A 4WFQA 3MTEA 5K0FA 5CT8A 5KYKA 4JMLA 1JTFA 2PN1A 4KWEA 4O4HF 4UBKA 1R69A 1OXVA 2NU8A 1Z0ZA 3DBOB 3UFXB 1WQ1R 1Z45A 2PXAA 1P2BA 5I9SA 4C3UA 3U3WA 1FDUA 3VJKA 1IM5A 1VBKA 1K92A 4OHVA 3WYBA 2NSHA 1TT7A 4K6MA 3CWZA 2FQQA 1B3RA 1DO2A 1HLDA 1MAUA 4CT4B 4AD8A 3T5DA 4I50F 1P29A 1P91A 1XRNA 2YNMA 3CNNA 2F64A 4UCWA 4FZ5A 4FGSA 1TW2A 1SUCA 4FYPA 4AW9A 4ONEA 1IULA 3NGXA 1ZP6A 4UDNA 1A0OA 4KPUB 4CMCA 3MGAA 2RGDA 3SEFA 4NBWA 1SXPA 3DE5X 2IS1A 1I4LD 1O94D 4BEWA 5KVCA 1NUUA 3FMYA 1MA3A 3G6WA 3UKOA 3RHFA 2X3YA 1FYFA 4ZA2A 1S5PA 2WMYA 4X95A 1JFTA 3R7WA 1L8XA 3TW8A 4KL8S 1Y6JA 2VHCA 1AKEA 1VA5A 3QNWA 2IK8A 3JXDL 2VHJA 3IIIA 3BF7A 1AKMA 1H0RA 2QAJA 1V41E 2JI7A 3EASA 1GQYA 3V1YA 1II0A 1TO2E 3QVWA 3PV0A 2A3RA 3GLHE 4RWZA 1S9DA 2IE0A 3HEAA 1GPLA 1PR2A 2D2VA 3ZNOA 1CDDA 1XOIA 4PWZA 4XX1A 4ETMA 1UK8A 1P6QA 4UBJA 2YH2A 1GKYA 1FZQA 4J75A 3NT4A 1TZMA 3VR6H 2WP8J 4C4PA 4EITA 4WWHA 2DG2A 3AHIA 3P7MA 1Q0QA 3A7EA 4Q3OA 4MIEA 2BH9A 5F7XA 4L4SA 3SZOA 1RKBA 1PFUA 1GPUA 2QUAA 3P9XA 1ZJ4A 3S1LA 1TDJA 4KAFA 3G9XA 4ND5A 2X4DA 1FDWA 1GILA 3LC7O 4LGMA 4I36A 4QU8A 3UIEA 4AWXA 4EGSA 2V45A 2XSZA 5K0LA 1IBCA 4DE9A 4KHZA 1CQIA 1RABA 4KQIA 2XRZA 2JD1A 3C6BA 4UNIA 4R40A 3ZJYA 4RGYA 1T35A 2IY8A 2X5XA 3QBJA 1MJ5A 2AR7A 1JSXA 4LHZA 3OJXA 3QGMA 2FGKA 5D87A 5FDFA 3IPLA 4YDHB 2YQZA 1W5SA 1IN1A 1E5LA 1XZPA 2PZAA 2ZE8A 2ZIAA 4LYDA 5AK5A 3R41A 1G3RA 4CHTA 2XKAA 3NYIA 4ER5A 3T7EA 5B7GA 3BULA 1SB8A 1Y5LA 3LUGA 1R18A 2QRQA 3GVCA 2GZ2A 1K6IA 1KAEA 3N6XA 4LZZA 2RGNC 4MPRA 4Y3UA 7YASA 5F23A 4R9SA 1H6CA 1Z4PX 3WBKA 1FP6A 2YYYA 4IIBA 4ZEOA 5FOQA 2E5FA 3K6SB 3C8MA 1FLNA 1G9XA 1HE5A 1MABB 1Y42X 3PPVA 1CNEA 4TUYF 3V3KA 3WLNA 5FADA 1CUGA 4PIVA 2DT8A 3D6TB 4D43A 1ZU4A 1FX1A 1H22A 1CZKA 4EHHA 5HKBA 1LSJA 1IJBA 1BXRB 2GWHA 1QK4A 3AUKA 2CT8A 3Q2IA 2JI9A 1UMBB 2GB4A 1U31A 3D4PA 1V37A 1YVDA 2I4IA 1KVSA 3JQ6A 4FX5A 1LTHR 4OXNA 3TZBA 4A5SA 4E88A 1OXMA 1P1KA 5CX4A 4EUKA 5IDXA 3P4XA 1G1MA 2NXWA 2O5RA 2EF1A 3GBFA 1R8QA 3MPUA 4NJOA 4W7IA 1X1RA 4C0BA 3W7AA 2Y76A 1LQCA 5HS6A 1G4UR 1D3AA 4OQLA 5JW6A 1PJ8A 4ESHA 2X15A 5C5DA 5CEJA 4RUKA 1E5VA 1RKVA 3G8AA 1E3MA 2E18A 3MFYA 4RLQA 1M2OA 4H18A 2H11A 2W4QA 1UBHS 3ZBPA 2QLBA 4DLRA 3T1TA 2ZI7A 3OECA 4L6IA 1L5GB 3LT0A 1RQPA 1TXGA 1V7CA 3TQFA 3BGWA 1RQXA 3EMBA 3GAMA 3VC3A 1IUPA 1EU1A 3SBOA 5BSFA 2V6GA 2PZJA 5EEHA 4EG5A 1L7QA 1U3WA 2EIHA 4URZR 4KEAA 5DGXA 2YIMA 4YDRA 2ZBEA 4CU2A 1BH2A 3D8TA 3WISA 3GGOA 3TB4A 2ACKA 1YFKA 3LT1A 3QKSB 4XVQA 3RUIA 3I9FA 4P4LA 5TE9A 4JI4B 2AZMA 5EIEA 5DRTA 1HGXA 1RR6A 2N0SA 4D9HA 2ZT5A 4ARIA 4O6VA 1C7ZA 4FNOA 3ZWKA 2OHJA 4XWTA 2QTHA 1PGPA 3H2GA 1JL3A 1SG9A 5BW6B 1U81A 2W93A 3QEAZ 3VYRB 4ZMSA 1VMAA 3ZE9A 4S1OA 4BVLA 3RTGA 5JQGB 1KI8A 3E3OA 1QYDA 3IT1A 2BEVB 3LT2A 4FT4A 4BN5A 1OXTA 2F17A 4L3WA 3KXKA 5IKXA 1ELOA 3GDOA 2F4NA 4BNKA 1II9A 1OX4B 2V7VA 1SHLA 3LUPA 2ZU0C 4CM4B 4CG2A 3O8QA 1UQTA 2E85A 3CTPA 3OH8A 4IKOA 4U3JA 5ALMA 5E6RA 4EFMA 1Z35A 4FWIB 1IATA 4FC6A 1WG8A 2GZMA 5EJ7A 5BPFA 4ZI7B 4KWCA 3EVCA 1Y1LA 3GCZA 4B3XA 4DV6B 1M8GA 1OE0A 2HSEA 3GC6A 2Z8ZA 1NNSA 1Y8CA 4WK6A 3K0SA 1HFEL 1FTSA 1C80A 2RHWA 1ZNZA 2YICA 2GCPA 1ADRA 3KBBA 3OSUA 2FSVA 2DAPA 2OV4A 2HSGA 1FMTA 2WILA 5DCUA 3KZMA 1WBJB 3W5UA 4F7DA 1LPSA 1TUBB 2OM2A 4Q4JB 4P22A 1BVHA 2WJYA 5LLSA 1Z88A 1XZDA 4MJ7A 4NNJA 1AHHA 2IP1A 5CD1A 2WD8A 2VPTA 1CIJA 2D1SA 4A0SA 2QVCA 2ZT6A 1S2GA 2QQ5A 5EMNA 1NZDA 2AI3A 2X7HA 3S44A 2VI5A 3MINA 2FPUA 3FG9A 3EIQA 4XQEA 1NF9A 4ABTA 1EFPB 3ZGYA 4QG3A 1BSVA 2HF8A 3ZDCA 2FMFA 3A1VA 4FXOA 3ZCXA 4DR3B 2B5WA 1IY9A 1MG0A 4GP6A 1COZA 1GL3A 1D2GA 3S28A 4BCCA 4Q21A 5EA2A 4JBWA 3AVTA 1H8HA 4BJ1A 3AM3A 4F11A 3QUQA 4QFDA 2JK0A 5K4HA 1TVKA 4TL8A 3ZS8A 1B0AA 4LY9A 3RODA 4M22A 2OP0A 1CUVA 1UXKA 4PPYA 1UBEA 2VDMB 3FPLA 3IS3A 2WJAA 3ZY2A 3RFVA 2W6CX 3E53A 4K9MA 2PEYA 2CLFB 2GK7A 1PT7A 3SX0A 2YWJA 3VR6D 3WWCA 3B3GA 4BO6A 3DBRA 3INYA 4EABA 3C1UA 3MB5A 3I28A 3DULA 2QMZA 3I6MA 3R3XA 3NWOA 3L6UA 1CQTA 4TYPA 4WK4B 3U3JA 2HQRA 1I6MA 5K20A 3UJ9A 3UH0A 4AP5A 3ICCA 5BN5A 1MAAA 5ALQA 1BS9A 1JI0A 2J7PA 3FUCA 3LDGA 4YWJA 3INGA 5A5EA 3DTVD 4HGQA 4ZT4A 4CM1A 3AVPA 3DLIA 2GILA 1YB6A 4AMVA 4QGAA 2HDNB 3R09A 4J4BA 3TGWA 5BUSA 2IYOA 1K7CA 4BQSA 2PQ0A 4HRVA 3FSGD 4KITB 4PZCA 2QMOA 3AZQA 1ADCA 1ZVJA 4TT3A 3UMVA 4QTXA 3D3WB 1NVDA 3N8DA 2OD2A 3R6GA 3X3HA 5KYYA 4FEGA 1IJKA 1SO8A 4B4KA 3IV9A 3VPSA 3ONNA 4GDFA 1ZNWA 5JWHA 2QS9A 1DULA 5J1TB 1FJ2A 3B2NA 1PWEA 3QY9A 4BAGA 3C3XA 3KSBC 4YRQA 3AR6A 4HXEB 1RAHA 1USIA 3U0BA 3IQXA 3K6RA 4CM5A 3LFPA 2AVNA 2ZW9A 1Y9DA 2I8AA 2WAYA 1YVUA 3V8BA 1L8QA 2I87A 1ZJ6A 5BOSB 5JQGF 4MUYA 4LJ5A 3C43A 4CMIB 3Q72A 4PR0A 1QQ6A 2M1XA 4I9FA 3S2UA 3GG9A 3Q7QA 2Q6LA 4E14A 3THWB 3PDJA 2CLIB 5F98A 4EZIA 3SZRA 5A0TA 4UOZA 4QNRA 4RLFA 4UHJA 5HOQA 2ZM6B 1KIFA 3G8DA 1LDMA 3K0EA 3L7DA 4FPXA 4P54A 4BMCA 1KY2A 4YMSA 3QPWA 3KQPA 5C3UA 3IUQA 4RQAA 1NI3A 2VP4A 2WYUA 3OLXA 4FHZA 4UC0A 4ZI7F 7REQA 5M34A 3U3DA 5A9TA 1SBNE 3TEJA 4ZXFA 2JHAA 3CURA 1ZIXA 2YW2A 2SHKA 3QA9A 5BQXA 3PT9A 4B9EA 3OQBA 2P8SA 1EM6A 4OQEA 1K9SA 1N2BA 2F43A 2QRVA 4LF9B 3LPLA 5DRYA 1T8YA 4G4GA 1FSGA 4A2QA 7MDHA 1FVHA 2G63A 4PGHA 2OR1L 5DYTA 1R2QA 5EZYA 1SCNE 3R7LA 4Q3EA 1QIIA 2ODWA 1TL7C 2X0NA 3HY6A 3PC4A 3K0AA 5DBIA 4C5BA 1SQFA 2DWQA 2CHGA 3C1AA 1R6UA 5EFZA 2UYQA 1XZQA 3CH6A 3NOXA 4IGIA 1M8FA 4XX0B 3OKZA 1B8UA 4IEEA 2WUFA 3HNRA 1YI0A 3Q98A 4GUDA 2FRDC 3WHLA 1J39A 2OK8A 2WUGA 4QT4A 2J3IA 4GYJA 1Z0AA 4XJXA 1OIVA 2PQMA 3EBPA 3F5FA 4LRWA 1JFFA 1SEVA 2ON6A 2R8BA 3FTDA 2MWMA 4NPCA 3ZTYA 1R6XA 4FOLA 3GA0A 1I94B 2O38A 3JQAB 2X13A 2XCRB 5JALA 1M33A 1ZPDA 2FLVA 3SS7X 1BHSA 1FTQA 2EYQA 3FB1A 3R5XA 4U4AA 3E7PA 3RUPA 1MIOA 2JA1A 1ADBA 2X9QA 1PAUA 1UEJA 2JS7A 4NNPA 2OFFA 2ASEA 2ZULA 3M8KA 1WE2A 4KU4A 3DMDA 3MEJA 3LBNA 2YVQA 4R2XA 5FL7A 4JZKA 1XRSB 2PX6A 3INTA 1NTOA 1QSGA 2JGKA 4R1MA 5C8YA 5JHHB 3L1HA 4QWMA 3PXUA 3U4QB 4M6WA 1AN0A 1RC0A 1UF9A 1SUWA 1DEKA 2R62A 3EISA 1JLHA 3L7LA 4MKIA 5B7NA 2JGJA 4BMPB 3VTFA 5F2NA 1IBRA 3B13B 3PGA1 1Q77A 4JI5B 1TGVA 1KEEA 3OA0A 5LQDA 1JKMA 3KLOA 1RE1A 5E8RA 2IOYA 2N75A 3IQIX 4A8PA 2ZYTX 1N2HA 2PT6A 2ZWVA 3HLKA 4Y1EA 4Y6OA 2BJCA 1H1LB 1LDEA 4C78A 4RIFA 5AJUA 3NTQA 1R8YA 4OB6A 1TVEA 4XDYA 1XTSA 2A0YA 5FUXA 4ZVMA 3R9WA 4DHWA 3HP1A 4ID9A 4RK0A 4ZPJA 5THXA 5F64A 1ETUA 3H19A 4J1TA 5GAHi 2ET6A 4Q16A 5E9JA 5SV2A 4F4JA 1XC7A 3ZIUA 2EKZA 4J90A 1QGZA 3DCIA 3H9EO 3OZWA 3I34X 2WIBA 3FIJA 2FAXA 4Q1FA 1NR7A 4B7ZA 3CLUC 4OMFG 1P0IA 1OI2A 3U7IA 4Z5HA 4KPFC 1VSQA 3GFQA 5I8ZA 1Z7EA 2PRKA 3GL9A 1UBRS 3KR2A 5CM8B 3ZQ6A 5BUQA 3AF5A 1XJCA 1OLOA 3TECE 2ECOA 4BHTA 2IEDA 2PAAA 4OYHA 4BQIA 4LJAA 1TI7A 4N7BA 4WKCA 1CJSA 2C2MA 2GEUA 2P5YA 4UE6A 3BQ9A 3AGPA 1LPPA 4OI0A 4LHXA 4MW6A 1KARA 1XMOB 1A8UA 1J24A 1XKTA 2MCFA 2CDRA 5JPIA 4COKA 2ICTA 3M4ZA 3L6RA 5TARA 2WPDD 1NMXA 2WWRA 3OICA 1VYTA 4MLCA 2IV3A 4PG4A 4D42A 1TUGA 3VDNB 5JS6A 2EBWA 3P52A 4W5OA 2A86A 1GRCA 1E1QA 2CL6X 1KPIA 3GGDA 3JVEA 3NWEA 3OF3A 1D2EA 4HZIA 3DAGA 2H29A 4P86A 4HNVA 4MUFA 1QF6A 2NU9B 1R5BA 3KXAA 1FFXB 3H84A 1QDLB 4EW3A 2VNJA 4ZOLB 4KAXA 4Q9AA 5JC1A 4LXHA 2G76A 4GQMA 2IF2A 4Y9TA 4NS1A 5K8TA 3RJ5A 1NUAA 5BV2P 2RAFA 1SUFA 2QWXA 2QZSA 4OBEA 2PA0A 1A4UA 4Q2JA 2I71A 3BMNA 2A0KA 1MNAA 3JWJA 5B36A 2V4UA 1O08A 4LJ4A 2FEMA 3A1CA 4AKSA 2C98A 4JLAA 3ZWAA 4EPYA 1QK5A 3I2FA 1PFVA 3RRZA 4AJ2A 4D5GA 5CVTA 2G9VA 3ZXUB 3PYMA 1ECJA 2YUTA 1DG3A 1WB6A 3BZBA 3I2YX 3OJOA 1G8HA 1U8ZA 4OFXA 5TMEA 2OPHA 4BU1A 3ORRA 5BW8A 4YRSA 4YRLA 3N2KA 2P91A 4DYVA 1JU3A 1KWKA 1GNSA 2Q4BA 2X0FA 3H1AA 4D9NA 4JEMA 3UWSA 2REBA 4PYRA 5ALLA 5JR3A 4CGYA 5TPWB 1R4MB 2A1UA 2A9OA 2ZR0A 3I4CA 4NZ9A 2FW0A 2M9MA 1GCOA 1IZZA 4RA9B 3RTAA 1X15A 3W4JA 1QOZA 4HQNA 3OO1A 4UTVA 2N9UA 2HMYB 2OAQ1 4ACBA 2QG6A 3P2KA 3CBGA 4HWRA 3G82C 2KS6A 5FI0B 1V3TA 3ZG6A 1LY1A 2QG9A 5CNKA 5IUKC 2CK3D 2HD4A 1UKEA 3LFUA 5DHAA 3P9SA 3IPYA 3BYZA 4KO1S 5GV7A 1WKCA 4XYEA 5IKMA 3P0JA 1UWKA 4AY2A 2ZIEA 3G0OA 1EHCA 4GBJA 5EP1A 5CDFA 3HKDA 4I1OA 3ZIAA 4H9GA 4FMCB 1ZM3A 4HNSA 2JGNA 4PHFA 4OQYA 5I7FA 2XKBA 3D4LA 2DHCA 1JDPA 1MQ9A 3TLCA 3BIWA 3IAAA 2WAAA 4Y0AA 3PE6A 1X7YB 2IXGA 4OJQA 2H7CA 3CRNA 4MUXA 3G85A 2YVKA 1ONNA 3CUSA 5C35A 1F12A 4JBXA 1K5GA 1FDTA 3TMKA 2XXAB 1CEXA 2OWDA 2ZI6A 3FY4A 1PF7E 1LLCA 1RJEA 4JUCA 1MQ8B 4G84A 4XGKA 5A7HA 4M1EA 2VFAA 2ZCVA 2P6MA 2RGNA 1WULS 2P65A 5JARA 4TYWA 3RWBA 5EC8A 4QUEA 2KQUA 1Z5ZA 2IBSA 4EB6B 2Q1XA 4KXLA 1DIBA 5EGNA 3GLIA 2PL1A 1XA0A 4CTJA 5D3MA 4I6UA 1JVSA 3IUJA 4WN3A 1YR6A 3MC1A 1FTYA 1EFUA 4JU9A 4E07A 4B76A 3NBYC 4DTCA 4TYYA 3GUUA 3WWEA 2ORED 4AYXA 2XGSA 1X74A 1JR2A 4FDUA 4UMVA 3ZXXA 4UUPA 4X6UA 2JJYA 3PQ4A 4MS1B 4CPDA 1MB3A 1B2RA 2G9QA 3F4LA 3QX9A 3R3UA 4HWKA 1XKLA 4KMOA 4R1OA 3VH4A 4ZOLF 1QHSA 1Z4OA 4QSHA 3DVRX 4REMA 2KB0A 1EPUA 1NXVA 4PG7A 3ZY6A 3C8UA 5LOVF 1GAJA 4MPJA 3KQLA 3COVA 1I2AA 4L0QA 4C6TB 3AVXA 4JCYA 1OFGA 2L0XA 4RC9A 5EJIA 2QXYA 1GL7A 4DCUA 4RMNA 4Q1EA 1OAOC 4Q15A 1GSOA 2OUIA 1DB3A 2C99A 2KBEA 4NQZA 5AM1A 3VVCA 3GT3A 5AJYA 1XVTA 3PEYA 3U7EB 1MLDA 1VE9A 4AJHA 4Z1MD 4F4HA 1JFSA 2MIIA 1OA0A 4N18A 5TS2A 5JSHA 4JZYA 1GZHB 1LF0A 3LKVA 4DCJA 1Y3AA 3DLCA 3CZQA 3H11A 4OU5A 4GL2A 1GGFA 2AQIA 3EXHC 4PRKA 2GPBA 2JZOA 4KQWA 4DUGD 1WOYA 1UFQA 1Y63A 4MYTA 4F85A 3U4MA 5U9CA 2P2CA 5HQ3A 4Y2VA 3Q0IA 5GV8A 4JQZA 4BBAA 1EVJA 3ZHYA 4V1CB 3OLYA 3I9NA 4FBMA 2AKYA 4DEXA 2NZVG 1EG7A 1BXGA 2VEDA 2VTEA 3KV1A 2P9GA 1TC2A 3EEBA 4AZSA 1ZCJA 1U3DA 1PFQA 2W6JD 2IYZA 2MMCA 1MOQA 1INLA 2E21A 1ZJZA 4B7XA 3E22A 3COYA 1T1RA 2VXYA 3B51X 2DE0X 4MOWA 4RD0A 3ZCRA 4MP8A 1G6HA 4ZRMA 3G9UA 2AL7A 5AOBA 3VWSA 1V1JA 3D3NA 2XDAA 4FMCF 2RBGA 5JATA 5AHWA 4D4HA 5D7NA 3L7NA 5GGYA 1TFUA 2YOHA 4EK9A 3SKYA 1MC4A 4L8LA 4QOJA 2JA2A 3TUJC 3QEKA 5KQPA 5AJXA 3OQMA 1PKXA 2NZ2A 3WGZA 1GV1A 2GEVA 1S0UA 3CTMA 3FXAA 3UMSA 2GTIA 4NESA 4D3SA 3H5RA 1S89A 3FZQA 4E12A 4Y0VA 1AGPA 1JPJA 1P75A 1QU3A 1PZHA 2QLTA 2WTAA 2L2QA 5J23A 3HJAA 2H2HA 1BJTA 2PSSA 2Q9BA 4H7FA 3KQHA 1Z37A 3QG5A 4E5NA 3AT1A 5LQRA 3K1YA 3B1XA 2D8MA 4FZRA 1QPBA 3GRYA 4JI7B 3NTOA 1SUSA 2I3AA 2Q7DA 1D2CA 3GLIE 5JAMA 1AV6A 3MGCA 3RREA 5IF3A 4MRMA 4CT5A 1XZHA 1PGJA 3I4FA 3N0WA 4WXMA 5H0IA 5A5VA 1E9SA 1WNFA 1Y33E 3I3SR 3M81A 3OMXA 4FGUA 4N5IX 4Q9KA 2YXEA 3WADA 1Y8RA 5LQJA 2H9YA 4WOJA 1A2OA 4BPRA 1S01A 2EC5A 3S55A 1G98A 2PCLA 3E2IA 2FUG1 3HA5A 3R5FA 5HHTA 2HZBA 4Z6KA 1YRYE 1HF3A 5ECWA 1C1YA 3KT0A 2BM9A 1WJGA 3K4QA 4JROA 4ZU6X 4B5LA 4WTOA 1E4EA 4K5QA 4PY2A 2WU8A 3EFOB 5B37A 3WLSA 3HI4A 1V1RA 3B5EA 3I04M 4ND8B 3TQOA 3ZLUA 4AJLA 4NZMA 2BFNA 1MC1A 2H2IA 1Z4IA 3CX6A 2BL4A 3L49A 3ACDA 1W5EA 3ZZ1A 1DJOA 2VHTA 3RVBA 3N3BC 5KJEA 3WIVA 4DIEA 1XIVA 1RZSA 3MJEA 5FOUA 3C8HA 3FTPA 4ERNA 1J00A 3LVFO 2OV2A 2ODAA 2VYND 3C5HA 1UR5A 3LX4A 3OEYA 4IV5A 4OYYA 2A9PA 1TPYA 5A4DA 2VP5A 3GUZA 4MH0R 4GKVA 1ZH8A 4LWQA 4OHMA 5KWJA 5F33A 3CZRA 3EVTA 4DLBA 1NV8A 2B7CA 4L4ZA 1K8QA 3EWAA 1TCVA 5BMOA 1UK7A 5BVGB 2AFHB 4IW3B 1FFHA 2F55A 1JR3A 2MT9A 1DHRA 5TT0A 4B3CA 4K1XA 4L4YA 1XAHA 1NDQA 1CUWA 1D4FA 1M1UA 3T52A 1OU4A 1MORA 3JYOA 5JBNA 2YRWA 3O47A 2ACWA 2G3YA 2Q2VA 3OC6A 3O8OA 3L04A 3D6MA 4RVFA 3UOGA 3DV0B 4UMDA 3AUTA 1I32A 3L8EA 2FWJA 3RBVA 2QR3A 4REQB 3T3IA 2RJ3A 3KHKA 3NHZA 5IH7A 5IK2A 5AVQA 3LAWA 1U02A 3GLRA 4PW0A 3KLBA 1C8KA 1T1EA 4II7A 1HFJA 1XZLA 3CPHA 3E15A 5AUNB 5EIXA 2FUKA 3FHJA 1FW6A 1L5FA 1LA2A 3TWOA 3HYCA 1XA4A 3L8CA 3QQ5A 4LTNA 1CQJA 5A1JA 1Q0SA 1XB2A 1ZRNA 3LP6A 5K3AA 5BSTA 2PT7A 1L4KA 3CB4A 4ER6A 3DT8A 4UBMA 2KE5A 4GMHA 1NOIA 4BVEA 2O07A 1AGRA 1LI5A 2VDRB 2ZI9A 4B8YA 5HPYB 3H0CA 1NJSA 3EIUA 4P7JA 1KO1A 3ZGLA 1VRVA 4RAOA 4OA5A 4DJTA 2IU4A 1MO6A 1K3UB 1WHTA 4G97A 1UBFA 4BPBA 5EIBC 5J2TB 1Z2CA 4P38A 1XDUA 2XBMA 5JYEA 3DXZA 1OUMA 3UFDA 3IPAA 1NXXA 4YJHA 1NDHA 4UBIA 1J7JA 2O3UA 3EZ6A 1BDJA 2R8ZA 3ASVA 1IY0A 3LUKA 4QRHA 2FPSA 2G8NA 4F2DA 5AJHA 1E89A 5EZSA 1G3UA 1JA0A 4Y2JA 2CWDA 4XVCA 4DVJA 4RMGA 4GLJA 2FRDA 5KOIA 3V1TC 4MYHA 4BO0A 3U17A 3QFIA 4UUBA 3DZBA 3RKUA 1TQ2A 5FWYA 3T7RA 1SURA 3FWKA 1KS9A 3ENQA 4NE9A 1ZDMA 4L50A 4PN7A 5C80A 2Z8YM 4N76A 4B8WA 1K6XA 5DM0A 1ZY2A 3SC3A 5D6NA 4G9EA 1TFRA 3Q8MA 2H8KA 2Y1KA 2FF5A 4HAXA 4BQRA 1ZCAA 4GXTA 4BU0A 4ZYXA 2JAXA 2Q5QA 4C29A 4KQFA 2WHXA 4AZ3B 1AUQA 1ITZA 1JSRA 2A0XA 2DSNA 2XHEA 3AETB 3NPAA 4RFSA 3RNLA 4QG7A 3SJBA 3UTDA 4F5YA 1USGA 4XASA 2J9FB 2QT1A 1ISMA 3FF1A 4MUMA 1A8HA 2DX7A 1QTRA 1CZRA 2FG5A 2UYGA 4I46A 2QD4A 2EQBA 1K8ZB 4HATA 3DEYX 4IVNA 3KYDA 2WM9B 2BFMA 1U9ZA 2ZR9A 2RAPA 4O33A 3KJGA 3RS4A 3U4GA 4C0WA 2OHOA 3HXMA 2XNDD 1PE0A 4Z3OA 3G2KA 1CX9B 3K70B 5CXXA 3UJNA 1XGKA 2CCKA 3LRPA 3GRVA 4HRXA 2J4FA 4ML3A 1WXXA 3DMRA 2O23A 3I39X 3KB2A 3NHPA 4R1LA 2X8WA 1EFVA 1EKXA 4O8BA 2JVIA 3GHHA 2H0QA 3JPYA 3ONWA 4OQNA 2ZRQA 3GROA 4Z7JA 5KZMB 3U1VA 4HYYA 3IDFA 3KSMA 3NDIA 5DX1A 4EI7A 4EUNA 3KBOA 4W4TA 4MI9A 4DNXA 4F2GA 1OWNA 5CVDA 1RTTA 1Y6ZA 2PGOA 2FW7A 4LDRA 4IDFA 2PH7A 4YROA 4I55A 1NYTA 1ZA1A 1Z36A 4BEVA 2WNIA 3CRZA 3NHFA 1UODA 2GFQA 4QTZA 4WACA 5ANRB 3O75A 1DNPA 2NIPA 3TJRA 1NHWA 2C2ZA 2FW6A 2ZPTX 3L0ZA 1IHOA 1PJRA 5GJCA 2GEDA 1TU4A 1LVUA 1TYCA 1TIBA 3NHUA 3ND9A 3S5JA 3ZJVA 2P6PA 5ICFA 5IMSA 3P9KA 4F4IA 3EF1A 1JI3A 1YCHA 1OXKB 1SUDA 3N2ZB 2X0RA 3D5TA 4GICA 1V16A 4OKNA 4NMXB 5JSKA 1EE1A 2EYUA 3BTVA 3H5NA 4IGEA 3KSRA 1K2WA 1NC3A 1ZMXA 3OTIA 4ZV9A 1RT9A 4OO3A 5AM3A 4KNYA 3ENKA 1PYDA 3ZTWA 4I19A 3LUDA 3WP1B 1JKXA 2ZB2A 3GF4A 1G8AA 3MMSA 4CIXA 4UTPA 4QPCA 2A6PA 1O2DA 3GGCA 3C5VA 4JK3A 4RU1A 1R6BX 3AW9A 4TLDA 1P60A 2MEZA 1NY6A 1VHLA 2WSYB 2WNSA 1ZRMA 3ADPA 3DL7A 3D8NA 1E3TA 3NBKA 1JPNA 4MQEA 4Q24A 4CI0B 4GW3A 1KAQA 1YBMA 2IH2A 4PF1A 1XTJA 3QE4A 3HADA 3LBFA 1PR5A 3GVIA 1AOXA 1Z2PX 2E48A 4PPGA 4R7GA 4QELA 1GUZA 4IRXA 4G1UC 4GYWA 5ALEA 5CDGA 1NMZA 3AV3A 3F6EX 3WGMA 5DM1A 1Y8QA 3OZRA 3R2JA 5CB4A 1R0ZA 4L8VA 3WFJA 3A58B 5C8VA 3AJAA 3K1AA 1DJQA 3EEYA 5DNUA 3IELA 2AWIA 1SBYA 1FDVA 2FMIA 2QYSA 1KKMA 1K7SN 1U8TA 4V38A 5B6IA 1AMUA 1GTJ1 2V7QD 3HCEA 5DGDA 1IEXA 4WNYA 1LI7A 2HDOA 1XZNA 2RHBA 4KGXA 1E3EA 2R47A 2PQ6A 1ULHA 2EX4A 4PXYA 1JNYA 4R71A 1YZNA 4PHHA 1NOKA 4MEJA 2ZSFA 1E2MA 3EGIA 4EHDA 4AG3A 4H4CA 5G1OA 2MYPA 4UVIA 1GUDA 4TKUA 3CISA 1M5UA 1PN3A 2O05A 3Q7PA 4KIFA 5LB4A 4YI5A 2ZBDA 1ZYUA 2JRLA 4I6TA 3MAAC 4DLNA 5JTTA 1GQRA 1YOBA 4OD0A 1Z2EA 9MHTA 1LPAB 1RXYA 2Z2XA 3DAPA 1FNDA 3Q3HA 1RYMA 1LU9A 5B58C 2IH5A 1YQGA 3R44A 4RH0A 2GA9A 1U6JA 4XWGA 1OREA 2WKSA 5EMLA 2SCUB 5LZ5A 4ZHSA 3IMFA 4O59O 3B82A 1GAWA 5D01A 3TEPA 3G88A 2O54A 1QG2A 3M5WA 4HQOA 2Q46A 2EP5A 4NHEA 2VDVE 4I3FA 4UUAA 4BRSA 6Q21A 4ZZ3A 1VECA 4YRPA 3ER8A 1L4FA 2BDTA 5CHEA 2YUIA 2CDNA 1F8YA 1Q1ZA 5DVZA 2WK1A 4G5QA 4YUAA 4R68A 2D0DA 5L8VA 2I99A 2QSZA 2ZJFA 1JBQA 1T15A 4LHYA 4AJ4A 4K87A 4QHYA 2EBYA 4PNHA 4DA8A 1HBJA 3CUWA 1ST2A 5AUPB 1TQ4A 2V7GA 4RTMA 1X1EA 2PKRA 2IGTA 2J0EA 2NXNA 2YJNA 4ISBA 4HZUA 1T6ZA 3EQZA 1L4YA 3T0FA 2QBYA 1E5TA 1QTQA 3HJGA 5H8WA 3DM5A 4MKFA 2JLQA 1IQRA 2C0PA 1I2ZA 3LWDA 1TZKA 3QFCA 4YC7A 1YV9A 4MV7A 4K9LA 2AG5A 5I51A 4JEHA 5FJJA 2HGSA 3N7TA 4HP8A 4M1TA 1P81A 1RAIA 1WP9A 2B92A 4GLFA 3A9YA 1QQAA 1PJBA 3PJEA 1JWBB 2PRJA 5BSRA 4KDCA 3KQMA 4NJEA 4RJLA 1RM5A 1ZI9A 1OBFO 1H2XA 5L53A 2NP7A 3RRNA 4Z9XA 1Q0HA 4DANA 5AK6A 2R86A 4AURA 3G6KA 4B6EA 4MCXA 3L6BA 3DZCA 3BHIA 4N3BA 4PQFA 5IARA 3UENA 1OAOA 1CEEA 3GOQA 2E4XA 3LKDA 4IXTA 4M37A 2QA5A 4Q9NA 4F91B 2OQRA 4D79A 4MUGA 2X9NA 5KJ1A 1C9MA 4CMAA 5JD4A 3R9XB 2PMCA 3SDZA 4LX8A 2O5VA 3ETEA 3FWHA 2O19A 2IUTA 3WLLA 1G6KA 3JQAD 4RA6B 2C2YA 4OHOA 1GCAA 4CEIA 2Z6VA 2H7XA 2WYVA 3TLYA 3EXHA 1U7TA 3W6ZA 3EXAA 3QFFA 4D6PA 2B8EA 2C7VA 2D62A 2J3MA 2PZGA 3B52X 4JUDX 2QQGA 1RMQA 1SHZA 2FMXA 4I6RA 4OAQA 4EGFA 4CCAA 5IVDA 1ZH0A 3W2EA 4AZTA 5JZ9A 4TX1A 3E9YA 4O4HA 1AF4A 3LL4A 3TLXA 2BFCB 4BQFA 1SXIA 2B20A 5JANA 2UAGA 2IPOA 3DE0X 3ILSA 4C20A 1KS2A 3I9LA 3PE3A 1U5BA 1J49A 2B98A 3U3OA 2GBPA 3EEQA 4LE2A 1IOWA 2DR2A 4INJA 4QPNA 4OHYA 1X7HA 4R3NA 5BSUA 1T0JB 1UTXA 1F48A 2FE1A 1I0IA 3R0JA 3WHPA 4NBUA 2ONJA 1GLVA 2WYIA 1FJXA 2Q5LA 1EXVA 4FFOA 4HEJA 6PFKA 1WLYA 2H31A 4K9RA 2BT4A 2RHJA 2J6HA 3PWSA 4FDLA 4P2BA 1TM3E 2HIMA 4LCJA 1A7UA 5CX1B 3S1AB 4KYVA 2D0OB 2HRBA 5FWAA 4IHJA 3GRUA 1PZGA 3RRMA 2HU8A 2V7WA 3DDHA 3ZWNA 4C76A 1I4EB 1POUA 5EKUA 1YFLA 3TD6A 3JQRA 3FOWA 4IIVA 3TH5A 5CDTA 3I62A 4RHYA 3DL4A 4XM2A 5MFZA 2AOVA 5JWRA 1LVHA 2TMKA 4HMOA 4YP9A 2BM8A 3JZDA 4OLBA 3KTAA 2AE2A 2QRLA 4LG1A 1PK9A 2IS2A 1P7CA 2WWTA 3OLQA 1Q7CA 3EEFA 2PXBA 3HZRA 1RHJA 4WXRA 2XUHA 3ZE0B 5EXSA 5A3SA 4PZUA 3RGGA 1P7YA 2J7PD 2XLCA 3IR7A 1A4XA 4ZI2A 2W8BB 5CJ2A 1FP4B 2BFPA 2GD6A 1EJ6A 4M55A 4RADA 3PVSA 4HTFA 3W5CA 4R4JA 5ALDA 4AZWA 4GRDA 2PZFA 2YKGA 2LVBA 5EYPA 4YUZA 3F47A 3FCXA 4MVJA 2K7ZA 4RZUA 3WL3A 3ZD9A 3T0GA 1CQPA 1FP7A 1MRNA 3KRTA 4L5AA 5CLJA 5AVRA 1XTIA 1NVTA 3B1ZA 5A05A 1RAFA 2F8SA 2GJSA 2RHRA 5FD8A 2ZGVA 1G19A 4CL8A 3VU8A 2O8VA 3TYXA 5G2OA 3HO8A 4IOMA 2W2PA 1AXEA 3U6KA 4PS1A 4INPA 2CZGA 5A3JA 1DAPA 3U80A 4PFSA 4P35A 4QGFA 4H3SA 3B53X 1PTJC 1NI4B 3EDMA 1RHKA 4BDTA 5HQTA 3PGVA 5HP4A 4PSUA 2DM6A 3BJZA 4XLZA 4RVOA 5ECGC 3TSYA 1TU3A 5ILOA 3HCDA 2G09A 3V4VB 4YPOA 1QAOA 2GM3A 5C5IA 2AW6A 1KAHA 5ALNA 4EW1A 1J56A 5AI8A 3JVUA 3EFBA 1QZTA 1G21A 3SLGA 4TUYA 1L7PA 1UWCA 1KFEB 2XVXA 2GF9A 2H51A 1KDTA 2IC5A 4DF3A 4UTNA 5EKDA 1ZJ5A 5EE1A 2W6ZA 1J8VA 4YG7B 4K46A 4PG8A 2YZKA 4ZQCB 4EUEA 3AHEA 5EGSA 4HO1X 1P6UA 1E6MA 2OO5C 5A5DA 1YDFA 5L6LB 1HQ1A 1E6WA 2IHBA 1W1IA 2OFPA 3JAMA 4R2KA 1Y4SA 2VKTA 1GTSA 4GGOA 2X1MA 1BQEA 4DQKA 1X7DA 3P94A 4MLZA 2AYYA 4GEKA 3BK7A 3DHWC 1SVIA 4TWZA 4ALKA 1FMLA 1TRKA 3NOQA 1KO7A 1ZK4A 6YASA 4TV8B 1YAJA 3LNTA 1BQ3A 1MOZA 1T13A 2BNNA 1ULBA 4QBFA 4R6WA 4ZQHA 2MMGA 4PPQA 3DC2A 5FPPA 1U0FA 3DWEX 3Q6MA 4U7PB 1YH3A 1C2TA 2GMWA 5I7EA 3SI7A 2Y4OA 4F8YA 4WLOA 5CR9A 5KU7A 2QD3A 5IT9A 5IYZF 1YGYA 3H5IA 2QY9A 3FAKA 3FDZA 4AYWA 4ZCRA 3HA2A 3EVNA 3KVOA 1KYYA 1RWQA 3O8LA 3TAUA 2ZPAA 5ENVA 1T2FA 2O8BA 3DVQX 1FS6A 1VJCA 2QRMA 3EZ2A 4IF6A 1K06A 3B3JA 2BF4A 3NHJA 1IWBB 5BN3A 2FHSA 2I2FA 4I4LA 4PU3C 1N7HA 4RSRA 2D5CA 4DDUA 4CMEC 2Q0SA 3H2IA 3BD1A 4X1YB 5KX5A 3ABSB 1ZINA 1LWNA 1P0MA 3CLRD 3EG5A 3QPDA 3RQIA 5JNWA 5LMNB 4E32A 3F9CA 3FAZA 2IEGA 2Q5HA 4ESVA 2BGNA 2NQ2C 4DR6B 3AM1A 3F2VA 3GNQA 2IOFA 2PCJA 4G56A 4OAPA 3SFVA 3WLFA 1OWOA 2AJBA 2P9YA 4TL9A 5E1DA 5KYWB 1GSIA 4HSGA 4MAFA 5CLHA 3RS5A 2OOKA 3V9PA 4E1BA 1T9KA 5EFOA 1W47A 1XKQA 2QJFA 4JI1B 3WICA 4CKXA 1WDWB 4HDSB 5C1BA 5JCXA 4B80A 1MW9X 5AP9A 5FBWB 3M2PA 4JGBA 4K6FA 5LFAA 4KUGA 3OP9A 4QPDA 4BGUA 3ZZTA 3DBHA 1F5SA 3OY2A 2XTNA 5JAHA 1O0SA 4II3A 1M1NA 2NPOA 2I2AA 4BXOA 3TD2A 3O94A 2BFEA 2R9VA 3R3YA 4WJKB 5CNJA 1DC8A 2BFFB 4FJ1A 4TLLB 4UM8B 1MF7A 1RIIA 3IURA 3B9PA 3PXAA 1V2GA 4MGZR 1H2AS 2FEOA 3WO1A 1IG0A 2EFCB 2YDXA 2A1TR 1YVRA 4RHFA 5DX8A 3RFXA 1WCWA 3PP8A 3ZV6A 1AM4D 3ITEA 1BRTA 2X19A 3ANLA 2HN9A 2VBIA 4CTOA 3KM0A 2H4ZA 3FNQA 1BGVA 2Q8QA 3I9JA 4EG0A 2C5LA 1VHQA 4E2WA 2JBAA 2AS0A 3ID6C 3QKRB 2ZSEA 2H65A 1G4HA 3OA2A 4LRUA 4WLUA 3UBTA 4UUMA 3L1KA 1KAOA 4US0R 2AZ4A 5G40A 2GUWA 2LDBA 2YTZA 4OBWA 1BX1A 1NURA 3WKBA 5CP8A 1NBIA 2D1FA 3HCPA 4Z86A 2IIPA 2CFSA 2KI5A 3KLNA 4OQ4A 3ZX4A 2FZ4A 1P62B 3A3OA 3OU7A 2ISQA 3T7CA 1MO5A 2HLHA 5A2GA 5JFOA 1PSDA 3YASA 5U4XA 3BE6A 2QLLA 3L6CA 2GARA 3NBAA 3T5CA 5FTJA 4W5JA 4J49A 1HI9A 4HLNA 5HGXA 3PDCA 3ISJA 1S2OA 1YR7A 4UAJA 2VRBA 1TPZA 2OFXA 5BQ5A 3F90A 1YR1A 4EZBA 3G8BA 2COUA 4MQUA 4GECA 1VCHA 5F1OA 4P81A 3TJZA 1L7OA 3QF4B 1KOGA 1G5IA 1QPGA 1SXJE 1U5AA 4HLQB 4TV8F 5FYDA 2H2GA 1U0BB 4NLLA 2H7VA 4DPMA 2XUAA 4TMZA 4ZAGA 1XCGB 1JZQA 2FE4A 2EHDA 2Q28A 2Z57A 3EDOA 3WSTA 1D0SA 5FWNA 3KFXA 4ZWNA 1FDIA 3K0FB 3I5UA 3Q1LA 1XP5A 4DWVA 1O0CA 1ETHA 1UJMA 2FN7A 1XAGA 4C4ZA 1M8PA 1EM8B 4A7PA 2X5OA 4LS3A 3FX2A 3LJKA 5KAMA 1C1XA 3LUFA 4KSBA 4UPVA 2O1EA 3M9WA 4FFBB 1H94A 1MX3A 1P7PA 1Y6FA 5E2AA 3RK0A 3RG8A 3UOAB 3WGLA 4PNEA 3RRYA 3DMGA 3QVGA 2XQGA 3T3NA 1LQUA 1N6PA 4MDHA 3PXEA 4W5QA 2Y68A 3A2LA 2O3TA 1X9HA 2H18A 2QIOA 3I01M 1E4VA 4X41A 5LZ9A 2EHJA 2FWRA 3GJZA 1RFLA 4L5IA 3SCZA 4F12A 2C2KA 5JXWA 2ZREA 3WMRA 3HK2A 2JFBA 1W9HA 2QVXX 2KEIA 3D9QX 4ZCIA 3QELA 4AM8A 1IOVA 3STHA 5TF0A 1Q22A 1YC2A 1ZCFA 3NUQA 1XBTA 2WFMA 4WKGA 2SNIE 1JGTA 3U4CA 1G5TA 3LBAA 2JGAA 1IOLA 2E1RA 1DSSG 2RB4A 1VG8A 3DTNA 5BYKA 521PA 1CIPA 2XQVA 2PZ8A 3SDSA 1SXJB 3FDJA 1XWIA 2VPQA 1ZH4A 1SVSA 3KUDA 2O8DA 3EGDB 2ZETA 3M6XA 1M2NA 5H7XA 2V6FA 5EJ2A 2HLDD 1OZHA 1BE0A 1J07A 3PGLA 1N2XA 4MKZA 1H2EA 4R8KA 1YZYA 3DEZA 1OGYA 2W71A 4WIAA 3R75A 3DGEC 2OYSA 1MT3A 3TNYA 1J5PA 1K0UA 5JIBA 3HB1A 1TUIA 4MV1A 4BO1A 3EGVA 2JGIA 5ILGA 3MVEA 4BE9A 3VA7A 3S2YA 1YTUA 3ZHRA 1U8AA 3R0QA 3LY5A 1USKA 4FFVA 3H65A 3WYFA 2RHOA 2ZIVB 1YRAA 4JUIA 2GYWA 3RVPA 4NENB 3GEBA 2EFEB 4JP1A 1Z5PA 4N12A 3QMMA 4BWVA 5L3VA 1I0LA 4WZZA 5JWOA 3WOHA 4YMUA 3BCSA 2GHIA 4FILA 1A1SA 4O2RA 4BATA 1EMDA 2I6SA 2EFHB 3BE4A 2X76A 5E38A 3C6ZA 3UB2A 3EZLA 4OLAA 1ODLA 1HRDA 1JIIA 2OG2A 4BCBA 2P9QA 4HFNA 1T5HX 2FJUA 1NJ5A 2E5WA 1G8YA 2XNJA 1F2UB 5J40A 1PGNA 1PV4A 4ZIRA 3ILVA 3BMQB 2XXJA 4K0KB 3HMKA 3OE1A 2QTVA 4W9MC 3JWGA 4DSZA 1RKQA 5A3VA 1VZ2A 4JX8A 2ADOA 1YQDA 4RY2A 1H05A 3WZLA 5HKKD 3G2NA 1FL9A 2WFLA 2OKCA 2XE8A 1BXZA 1M34E 1PUIA 2YIJA 4QGBA 1E2GA 1SU4A 3AC0A 2OECA 4QECA 3L9WA 4CT0A 3LT5A 3V7WA 1PJTA 2HSZA 3KDAA 1ENZA 1X94A 3QU5A 1SCUA 4W63A 3C4VA 3KO8A 3U81A 3ZY4A 1MV5A 2DERA 2IHVA 3TLKA 4G0UA 1XZKA 5BURA 1WXGA 2ZJ1A 1V11B 4YR7A 3BSFA 3ND7A 2BEKA 3PXXA 1BD3A 4PCLA 1XQVA 4CF7A 1WAMA 3DKPA 4H3VA 1XWRA 1V1MA 1J9GA 1V3QE 2G9RA 2IYFA 2Y93A 3R7DA 3CKYA 5DNDA 4PX3A 4O2LA 5AKXA 3S3TA 4RH3A 3V7NA 1VL8A 1A27A 1V6CA 4O4IB 4U0KA 4KOEC 5JMOA 1PL0A 4RPLA 5KYNA 4UVHA 5LIPA 1BCRA 1UKZA 2AMYA 1L5VA 2Z98A 4HYQA 2WY2D 4IR7A 5KSPA 1WD7A 2GKGA 3HUUA 5FHQA 4ETNA 5F3WB 4EGJA 1LDBA 4KMMA 3RH0A 4YFVA 4D99A 1DDOA 3NROA 3ENWA 3L0OA 2R1ZA 3UVEA 5ICCA 3KL2A 5IXJA 4RPHA 4RZHA 3TGPA 1YS2X 1DVRA 1LH0A 4LBZA 3VZQA 1MRSA 1Y1PA 2FPWA 1I4TD 3B36A 3I12A 2DFPA 3X2SA 1ZKDA 5TV2A 2PD4A 1ZD3A 3ZQKA 1M34B 3DFZA 4IPTA 4GR4A 4RACA 3WI7A 1FUEA 4G1FA 1Z39A 2VF4X 3DD1A 2V7UA 2FX3A 1D1PA 4TYQA 3INRA 5E7MA 4CLEA 2P67A 3RS3A 3KZOA 1QUEA 1ZM4A 1OGIA 3OD5A 2VSFA 3ZGXA 3KFVA 2FWNA 4DS3A 4MK4A 3DE3X 3H8VA 4CG1A 3IAXA 1JAZA 2PGJA 4MUHA 5AW9A 1CUHA 3ZBUA 1R50A 1RPNA 1T34A 1CXZA 3BFKA 5CM2Z 3SIXA 1Z5UA 1G0OA 3JWPA 4RVUA 2FP4B 2RHDA 4X4IA 2VYFA 3PTAA 1G5HA 1NA5A 1I1QB 4CTKA 3SC2B 4Q47A 2WJGA 3CZ9A 3JZAA 1YWGO 4OYRA 5IEBA 2VWHA 3H9JA 1IHDA 4E08A 2GCIA 2PT9A 5JADA 3W5JA 1LBEA 1OGJA 5DHPA 1DC4A 1UFVA 3AGQA 4CDMA 2UZ4A 2XUFA 1B3BA 3HY4A 4RPKA 2AFIB 1FFSA 3I1YA 3U39A 4CN9A 4ENTA 2PMDA 4YMWA 3NZLA 5DT2A 3K0BA 1QVWA 3O1HB 4G3XA 3ZDYB 3K70D 3VR0A 2VBFA 5HJ7A 1KPHA 3OCWA 3VZDA 5LYJF 1IDOA 2IYPA 5LNK1 1NW9B 3JATA 3CMCO 3QE0A 4P82A 3ESQA 2ORIA 4NI5A 4UJ5A 1KORA 3UT5A 4AJOA 4ZDJA 3IDOA 1TAQA 1JWAB 1K5PA 4FOSA 4DLWA 1BFUA 1QFXA 4Y9UA 3PYXA 3OTGA 2PGNA 2V8OA 1TKCA 3P0FA 4P3PA 4IXDA 1Y4ZA 4BWGA 5FBLB 1JF8A 6ABPA 2VYQA 3JXEA 3TTYA 5KYGA 4X1OA 3D81A 2O2GA 4R8MA 2XHZA 4KAJA 2VJYA 3R0XA 1ST3A 3P2EA 1Q21A 1IQ0A 1QH0A 4RX1A 3TIGA 1HNWB 3D0RA 2CN1A 2JJMA 2BKXA 2EKQA 1J33A 3BWMA 4Y42A 3E2MA 3ED1A 3U9SA 5KTPA 3Q4GA 1UM8A 3DS8A 2Y0BA 4IQ0A 1Z82A 2IYLD 2WA2A 5FBVB 3HXOA 5DI3B 1E63A 1N78A 2WSSA 2DFKB 1U98A 4OJTA 4GPD1 5ABPA 5BP7A 4MTCA 4B4DA 1UUFA 1B8PA 3K1TA 3PNOA 1YCFA 1JHYA 2VF5X 4KN8A 5EWJA 2XT9A 3IT3A 2HRRA 2FFJA 4WOKA 4ZYTA 1H9BA 2REQA 4U8HA 2EX0A 2EZTA 3PB3A 3TOVA 2UYCA 1G42A 1K63A 1ZWKA 1OD6A 2QY6A 4H6XA 1JHAA 1EGQA 1W87A 3LRXA 4NE7A 5FPYA 4N1AA 4G4SO 1KBZA 1SHJA 3QZUA 4HNAA 5EIAA 1JIJA 5FTKA 2C2OA 3WX0A 2PIJA 1H0HA 2E87A 2GPTA 5HDQA 1QGUA 5A4AA 3M6WA 5LQCA 2XUKA 1T4DA 4G25A 1IN6A 1FFGA 2KEJA 2EJTA 2I0FA 5GAJA 3WC4A 5I01A 3OEED 1BDBA 2JZNA 3PFCA 4CUJA 3JQ8B 3NBXX 4HAUA 5FH9A 1ODCA 2AZDA 1HTBA 4PU7A 1PTJA 5EZQA 1RC8A 3AF2A 5TMDA 2EP7A 3RG2A 1DINA 3S2FA 5A9RA 2OL4A 4DMHA 3GJ5A 2IHNA 3GPIA 5G4LA 3M82A 4W8HA 3ZCUA 4DDWA 5HIKA 3C2QA 1Z75A 3ONEA 2OR3A 3SIWA 4XQCA 4QQKA 4DEVA 2GS9A 3EDQA 1UZMA 4QL3A 1Z0IA 5J59A 3WG9A 1IVNA 4BB9A 4RE6A 5J3JA 3A0RB 1ZHOA 4B3MB 2O14A 1SUPA 3ZU4A 3L01A 5K0JA 4C2BA 4CLRB 5DM2A 1UXDA 2ZSAA 3E9EA 3TIIA 1C3LA 4IQ8A 5CBKA 4G07A 5CAEB 4M76B 2QAGB 2DTXA 3OT5A 4IS2A 5CFMA 2OO5A 1QYCA 1L4LA 1ZZGA 3RC2A 1GTRA 1I24A 1ZCZA 2KLHA 4IRMA 3TMYA 1HNXB 2PS9A 4KPGA 2XCUA 4M54A 1TU0A 3D6UA 3HFRA 5JAQA 4LYHA 1NV9A 1DC5A 4QYIA 4YFYA 2NUTB 2CVOA 4QKQA 2AN9A 4H17A 4E0BA 1ICIA 3L07A 5T7BA 4J0DA 1QKKA 3BHJA 4FWTA 4DLTA 5LOVA 3H9UA 1Q12A 3EW9A 2DBZA 4YK7A 3QLVC 1X39A 4JBLA 3R8CA 4BFVA 4C2TA 3I2JA 4WRRA 1QOPB 1NNUA 3C8DA 5JAIA 3GJ6A 1HDRA 4NPAA 3GLVA 2UVPB 4Q5IA 1EIWA 1X8JA 1EK6A 1E79A 1T6YA 3PKZA 4TM7A 1VOTA 4CDGA 4CMGA 1YS9A 4YH1A 2GFIA 1XG5A 1LCCA 1XTZA 2RIPA 2C59A 3Q1KA 4G5OA 3NBUA 2PR2A 4I6GA 4G37A 3ZU3A 4DCOA 1UKBA 4PSVA 2BEUB 4A27A 4Z51A 1JDZA 1PG5A 3NAQA 3STUA 1FU4A 3H6HA 4LI0A 4UTRA 4ZDKA 2HHCA 4CMEA 5ED4A 3KOYA 3CA8A 2HPVA 4S1TA 4O3MA 3F78A 3NTXA 5JYBA 2CLEB 3N8HA 1ZM2A 2C5FA 1P5HA 4OQZA 3UG6A 5ITWA 4GYKA 2PXDA 2I6XA 4NC9A 2I1QA 2GCOB 4WCFC 4L75A 4WESA 2QVLA 4K6KA 4PAGA 3KDSE 3OI7A 4EB3A 1PGQA 3L84A 1ZG3A 5BR4A