4EKIA

Crystal structure of dot1l in complex with epz004777
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
327
structure length
319
Chain Sequence
KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Conformational adaptation drives potent, selective and durable inhibition of the human protein methyltransferase DOT1L.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 319
sequence length 327
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4ekiA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ekiA02
1OR8A 4FR0A 1KPGA 4HH4A 4FT2A 4E2XA 3P9IA 5GINE 3VC1A 4DM3A 2HTEA 1V39A 3I5UA 3GRRA 1NW5A 1NBHA 3C3PA 5EHIA 2ZTHA 3THRA 3M6XA 3TM4A 1R18A 5EMLA 3V8VA 5D1HA 1YFJA 1AQIA 5EQJB 2ZCJA 3PTAA 5CVEA 3KPYA 4UOEA 2YXDA 2XYRA 4P7JA 5E9JA 3S68A 3E05A 4EK9A 1WG8A 5DX1A 4OA5A 3OU7A 4FZVA 2I6GA 2BM9A 4PWYA 3HVHA 3LGAA 4CKBA 3FRHA 5CVUA 1PRYA 1VP9A 4FT4A 4KWCA 1X19A 4DKJA 1M0EA 1DUSA 1Z3CA 3F4KA 4PONA 4C07A 4YUWA 3ELDA 1YZHA 1NV8A 1SVUA 3G8BA 3FTDA 2VZ9A 3MHTA 4OA8A 1RI2A 2GB4A 2O0LA 4RSRA 5EOVA 1I4WA 4PCLA 5E8JA 2H11A 1H1DA 1KR5A 4Z2YA 4FGZA 4C04A 4PYQA 3DR5A 3KPVA 2IBSA 3MAGA 4L7VA 2JH9A 3KQQA 3HVJA 2NXEA 1DL5A 1JSXA 3KQVA 3R24A 5DLYA 4E2WA 4PYNA 2VDVE 3UJ9A 5JR3A 2EG5A 1O9GA 1XVAA 3R0QA 3EGVA 5CIYA 3Q87B 5BXYA 3G2OA 3NW9A 4ER0A 5LQAA 2CMGA 3I9FA 3RIEA 3T0IA 4DCGA 5HIKA 2ZZNA 3P8ZA 2HV9A 5FCDA 1NW8A 3UA4A 2IBTA 4M36A 2PXXA 2ZIEA 3A7DA 1NW6A 1I1NA 1NT2A 2R6ZA 2ZFUA 4GEKA 2FHPA 3UFBA 4E2ZA 4FSXA 3HVKA 4K6MA 4P7FA 1XDUA 3FPEA 3C3YA 1INLA 5EGSA 1SUIA 1XTPA 3KQMA 2JJQA 2AOTB 4OBWA 3OFKA 2G70A 3KPWA 4C4AA 4HTFA 5B1SA 4BLVA 2AN4A 4AX8A 4CXMA 1RJFA 4DMGA 4QVGA 3EVFA 2GA9A 3ER9A 1N7IA 2C7QA 1VQ1A 3DMFA 2XBMA 2LD4A 4HGYA 3UJAA 3TPZA 2VP3A 4YUVA 4E33A 3O7WA 4QDKA 4YUZA 4RTSA 1L3IA 4FS8A 3DXYA 4A6DA 4POOA 5KQRA 5LR6A 2OO3A 1G55A 2PGXA 2WK1A 1BHJA 2PKWA 3GWZA 4P7KA 4GOOD 3ER8A 3CCFA 4AZVA 3NMUF 3CJRA 2PXCA 3IEIA 3B7PA 1UIRA 1O9HA 2H1RA 2HMYB 2A14A 2DPMA 1P1CA 2QYOA 4IV8A 3UJCA 2IH4A 1VL5A 4EVIA 4FSDA 4LWOA 1KPIA 4FP9A 2OYRA 2ZW9A 5BW5A 4HG2A 5E1MA 3OCJA 3M70A 2WA1A 1AV6A 3SSOA 2B2CA 3TMAA 3BWMA 3FTEA 4HC4A 2ZZMA 3P97A 4KDCA 5T64A 3C0KA 4CKEA 3G8AA 3GJYA 5DX0A 1G8SA 3SSMA 1YFLA 4MIKA 5GIPE 3LDGA 3EVZA 4JXJA 3LDUA 3PFHA 3VYWA 2OBFA 5GWXA 2NXJA 3P9KA 2PX8A 2OY0A 4QTUB 3GNLA 3RODA 3DP7A 5C0OE 3FTCA 3AWIA 2AOUB 1U2ZA 3C6MA 2PSSA 2BH2A 1FJXA 5K0GA 5FHRA 2YVLA 2UZ4A 3HVIA 4ATNA 3MCZA 2GPYA 2AOVA 3CGGA 2BR3A 4M37A 4GF5A 3EMDA 5EC8A 3GXOA 4ER5A 4QPNA 3ORHA 3GRZA 3KR2A 3I53A 2OPBA 4PIPA 2P7HA 4HRAA 5G02A 4PNEA 4DF3A 2I9KA 4EKGA 4HGZA 4RTOA 9MHTA 1NW3A 2Y1XA 3U81A 4R8SA 2AN3A 3UZUA 2FRXA 4OBXA 5EEHA 2OZVA 3ANXA 3MB5A 4E2YA 1JG4A 5E9WA 1IY9A 3TM5A 3M6UA 2R3SA 3H2BA 3SGLA 1NE2A 1YB2A 2NXCA 2Z6AA 3HA7A 5IKMA 1XCJA 2YX1A 3PVCA 1F38A 3LPMA 2CMHA 4PGHA 2YTZA 2HR1A 1SG9A 3AXTA 5M5BA 2QRVB 1XCLA 1FBNA 1M6YA 4XUCA 5DT2A 1XXLA 5ICFA 3OE4A 4IKPA 5ICEA 2PX2A 5FADA 3MGGA 5DTMA 2G1PA 1D2CA 2ZVJA 5CCBA 4BLUA 2NYUA 4X1OA 1XDSA 1VLMA 4E70A 5CM2Z 5E1BA 3BWYA 4C03A 4R8RA 5FA8A 2FPOA 3BUSA 3UJ7A 2F8LA 2IGTA 3KQOA 3L8DA 5CCXA 3KPUA 4CTKA 1RI4A 2P1DA 2ZWVA 3M33A 1QANA 4V0RA 3EGEA 4RTLA 2JHPA 2AS0A 1P91A 3G7UA 2N47A 2FK7A 4C08A 2YUIA 2EFJA 4GQBA 4IV0A 2PXAA 2P3QA 2UYOA 2JH8A 1XDZA 2G71A 3T7TA 3PX2A 3HA5A 2QY6A 2Q41A 5DXAA 3NVMB 4C05A 2XVMA 4C06A 1FP1D 4RTRA 2EX4A 5E8RA 2DULA 5DX8A 3E7PA 5EHGA 5HIMA 1WXWA 5F2NA 5K0BA 2IP2A 2C7PA 2ZBPA 4RV9A 1YF3A 5DM2A 1WZNA 3EMBA 2GLUA 5EG5A 3CC8A 3ERCA 1VIDA 1NW7A 3NWEA 3M6VA 4HSGA 7MHTA 3G5LA 2G72A 3OU6A 3PS9A 5EVJA 3G2MA 4RTMA 1L9KA 2CKDA 2OB1A 3AXSA 2ZWAA 2XYVA 1RI5A 3G2PA 3MTIA 4P7GA 3VC2A 1HMYA 3PFGA 4P58A 5LSAA 5C1IA 4PYIA 2Z6QA 4YMGA 1BKYA 4PYMA 5GM2A 3UA3A 4PYKA 5EMKA 1JTFA 2JHAA 1N2XA 1TW3A 1T43A 5HIIA 1EIZA 5DM1A 1EQAA 3GRUA 2B9EA 3JWGA 3PLAE 3GIWA 3V97A 1MJFA 5BP7A 1P1BA 5K03A 1BOOA 4PCAA 5DWQA 3LHDA 5KVAA 4GOMD 3A7EA 4U7PB 1ZGJA 2O57A 3JWHA 3M6WA 3P71T 3DH0A 3KKZA 4CKCA 3D2LA 3LECA 3HEMA 5T67A 1X1CA 1JG3A 4KIGA 5JUWA 3OZTA 4MTLA 3DULA 4XUDA 5EPEA 3RW9A 1ZGAA 4ER7A 5E1DA 3ID6C 2OKCA 2CL5A 2PT6A 3KHKA 3HCBA 3CJTA 2AOWA 4QPPA 2PWPA 4RWZA 4MHTA 4EMSA 3KQWA 1AF7A 2PJDA 4PGGA 3LBFA 1SQGA 2HNKA 3LCCA 3NWBA 2IDKA 2K4MA 1IM8A 4PYOA 4YUYA 2IDJA 5K05A 3EVCA 3LX6A 4X60A 1VBFA 4PYLA 2NNWB 3M4XA 3TFWA 4ER6A 5HOQA 10MHA 1EAMA 3KQSA 3A27A 1RJDA 3KR1A 3FUUA 1KP9A 2PBFA 2O07A 2H00A 3LDFA 3G2QA 3OFJA 2OXTA 3AJDA 2YR0A 3BWCA 1D2HA 4OX9Y 3DTNA 3HCCA 1R74A 2ESRA 2O05A 3BWBA 3KQTA 2EJUA 3NJRA 5E2BA 2ONZA 1RJGA 3TRKA 3OPNA 3SSNA 2JHCA 2Z6UA 3HCEA 4M7RA 3FUWA 2B25A 2EJTA 3GU3A 5FA5A 5K09A 3TKAA 1G8AA 3NDIA 4GBED 1XJ5A 4H0NA 4X63A 4ISCA 5GM1A 5K0LA 3EVGA 4B17A 3FUVA 2P3OA 1WY7A 4Y2HA 3EVBA 5CD1A 3SX0A 4KIFA 1MHTA 1D2GA 1JR4A 3LBYA 5IH3A 3B5IA 4QQKA 4BP1A 5DTRA 2AOXA 1JTEA 3B89A 3KR0A 2I62A 3HCAA 4WXHA 4YV0A 5KYGA 1R6AA 2IIPA 2ZBQA 3TQSA 4R05A 3BKXA 2ERCA 1VE3A 3T7RA 3EVDA 2P40A 2ORED 5DRTA 1ORIA 3P2IA 3UJBA 2IH5A 1QAOA 2FYTA 4XCXA 4GC5A 5DPMA 3LL7A 1ORHA 4RVFA 3FPHA 3HCFA 3SR4A 3HCDA 1TW2A 3P2EA 3Q7EA 4AZTA 2PX4A 5LQRA 4AUKA 2ZLBA 3NTVA 1YZ3A 3O4FA 4GOND 1BC5A 3OZRA 2IPXA 1QAMA 5EKXA 2QE6A 2AZTA 1RI3A 1L1EA 5K01A 3ELWA 4HTFB 3QOWA 1M6EX 3UWPA 2ZULA 1KYZA 3BZBA 1VPTA 1Q0SA 3DUWA 3FPJA 4RTKA 3THSA 2PWYA 1YUBA 3DMHA 3DLIA 4RVGA 2PLWA 2WA2A 3FPFA 5HEKA 4RTPA 1JSZA 4PIMA 2AOTA 1G38A 2P7IA 3E23A 3MCTA 5K0CA 3QOXA 2P3LA 3LSTA 3CKKA 3SM3A 3MERA 4RX1A 1F3LA 1JG1A 3KPJA 1L3CA 3A26A 3A4TA 4DA4A 1JQ3A 4MWZA 3CJQA 4YV2A 5H02A 5FUBA 4YUXA 8MHTA 5DSTA 4OQDA 2ZZKA 4KW7A 4AZSA 2UYCA 4BY9E 5CVDA 5EZSA 5FWDA 3LKZA 5EIFA 4DQ0A 1WXXA 5LQCA 5GIOE 3LCVB 3BGDA 5DTQA 1N7JA 1UFKA 1X1AA 3ELYA 1R00A 3MQ2A 2P35A 4ZTBA 3UJDA 5P8WA 5FQOA 3UJ8A 2C7OA 1RI1A 3O31A 2PY6A 2QM3A 4YV1A 2PX5A 4BP3A 3SXJA 3OU2A 1B42A 3OZSA 3FYCA 3X0DA 2YXEA 5HIJA 3SVZA 3HA3A 5KQSA 3GGDA 1AQJA 3EGIA 3DOUA 3FRIA 1Q0TA 5DM0A 3KU1A 2I7CA 3GRYA 3ELUA 3B3FA 2OB2A 4KRGA 3B3GA 4KVZA 5E1OA 1X1BA 1QAQA 3QV2A 3TLJA 1WS6A 4Y30A 1ZG3A 4R6WA 3C6KA 2E5WA 2PVCA 1G6Q1 1NV9A 2BR4A 2JG3A 3NDJA 1JG2A 1IXKA 3G5TA 4EKIA 2ZSUA 4O29A 1EG2A 5T6BA 5U4XA 3K0BA 5FWAA 1SKMA 5EZQA 4QDJA 1R8YA 3HTXA 5K0EA 2P41A 4E30A 4A6EA 5LQNA 1ZKDA 2AOUA 3EEOA 2V74B 4RVHA 5DRYA 1KYWA 5K0FA 5FQNA 2PV0A 1X1DA 4R6XA 4MQ4A 2ZBRA 2VDUE 3JWJA 1L3BA 4RYLA 4LG1A 4QTTB 4AZWA 3GRVA 5GP1A 4OQEA 3HP7A 4RTQA 2BR5A 3JWIA 3TOSA 3FTFA 1EJ6A 3DXXA 3PT9A 2NP7A 5LQKA 3I64A 5E9QA 3DXZA 3HM2A 4YMHA 1KIAA 3FPGA 3VSEA 4ER3A 2FK8A 3FUTA 2FCAA 3GCZA 4WVLA 2ADMA 2C7RA 3I58A 4LWPA 3LKDA 1G60A 4X41A 3AY0A 5HILA 4M38A 3SMQA 2GH1A 5LQJA 3CVOA 5MHTA 1R8XA 3GO4A 1QYRA 5EMMA 2UYHA 3REOA 3HNRA 3BXOA 3PB3A 3TR6A 3P9NA 2NP6A 3BGIA 4QVKA 5CVJA 3A25A 3P9CA 2QRVA 4E32A 1O54A 2UYQA 3R6TA 4GOLD 5CUQA 3GDHA 5HFJA 3R9XB 3R3HA 5D1NA 1KPHA 5GOZA 3EPPA 2B78A 2G8NA 2YXLA 3IYLW 1ZHFA 3LCUA 1RJEA 3OE5A 4PINA 2AN5A 4F84A 3B3JA 5K8VA 2Y1WA 5BW4A 3KQYA 1NBIA 5DXJA 5K0JA 1SUSA 5F2KA 4RTNA 1JQDA 5FULA 1EJ0A 4LECA 1JQEA 3KR9A 3ME5A 1KHHA 2IFTA 3FUXA 5F2OA 3FZGA 2GAFA 2VDWA 2VS1A 1QZZA 3G89A 3IHTA 4RVDA 5ERGB 4BLWA 4CWAA 1NKVA 3WSTA 5C9ZA 5ICGA 5EEGA 5EKUA 4G56A 5LQUA 4DCMA 1KXZA 2P8JA 2KW5A 1P39A 5HZMA 1I9GA 4IWNA 1FP2A 3PX3A 2YQZA 3UJ6A 2BM8A 4PYJA 4NECA 5EMJA 4E31A 1UWVA 3G88A 4QQNA 4U7TB 2BZGA 5KS2A 2IH2A 5FTWA 1DCTA 1FPQA 3KQPA 3P2KA 3EVEA 1HNNA 2B3TA 2ZIFA 3MTEA 5EIWA 4F86A 5DM4A 5DSXA 5ICCA 3NVKI 2CWWA 3BGVA 3DLCA 2ONYA 1SQFA 1ZQ9A 2GS9A 4KDRA 2V7EA 4GUAA 2AVDA 3K6RA 2AVNA 2PT9A 3BT7A 3EEYA 3IV6A 3DMGA 5K0NA 3BKWA 4CTJA 1Y8CA 4F85A 2AR0A 2NXNA 5E2AA 2O06A 3TKYA 2XYQA 3E8SA 4DZRA 2HWKA 4GC9A 5FHQA 3FYDA 3EVAA 1PJZA 2ZIGA 5CVVA 3CBGA 4V0QA 4EQZA 3T7SA 4XUEA 1VP3A 1TPYA 4X61A 3UBTA 4RTJA 2XVAA
chains in the Genus database with same CATH superfamily
3AYXB 4HH4A 3INNA 3O2SB 1OI3A 3QVVA 3FH0A 1RM5A 2C1EA 4KI0A 5EE0A 1G3IA 5GINE 4YPFA 4DDTA 1W73A 2O3RA 1JJFA 2B6NA 3P9XA 1CETA 3DLAA 3THRA 2A5GA 1XQXA 2OFPA 1R18A 1KI3A 4K6OA 2GF0A 3G1WA 1IRIA 4NK4A 3PXGA 4XGKA 4HNHA 3GZNB 5KYUB 4QG7A 1TEZA 1D0VA 3V4ZA 3GAFA 4PG4A 2FRDA 2H1SA 2GQ0A 1SRQA 1CQWA 2YXDA 3LY8A 4MS4A 5ULLA 3UV3A 4EG3A 1XPJA 2AKAB 1FZTA 1QFYA 2DY1A 3IHKA 1I7DA 3LQXA 1BFDA 3PYMA 1OB2A 1A2BA 1HKUA 2VUHB 4KWCA 1G4AE 1DUSA 2BE7A 2EF1A 2ZAOA 4AJPA 2PR7A 4C30A 1LDYA 3VNVA 1V3UA 4M6WA 1HV8A 2VZ9A 1SVUA 1TUBB 1GT91 4J9UE 4O4IB 4REOA 5I9LA 1TF7A 3EWIA 4J03A 4D4HA 2ODAA 2Z3ZA 4I8DA 2H1CA 5GOTA 4QZVA 1N9GB 4KQ9A 1HFWA 1J4AA 2GCOB 3P0HA 4HNTA 3C5HA 4W8HA 3ZDFA 1LI4A 1X57A 4TS3A 2VYFA 1CIPA 2JCYA 3HVJA 4INPA 2CY0A 1GSOA 2YDYA 2CJWA 4YDSA 5F5LA 1G7CA 3FA2A 1M2VB 3GA0A 4YIKA 4YCDA 3RLIA 2BGGA 5C8YF 1O9GA 1LD3A 2GJAA 2V4MA 3JS5A 1IUKA 4C2AA 5J3JA 2BMAA 5J2UF 1LVUA 4YRCA 3JQDA 1L7BA 4U02A 2ZZNA 2JDID 3IP5A 1IHXA 2F2TA 2J0UB 3CKYA 3D6JA 3LISA 2WC1A 2QP9X 3EZYA 3EDYA 5B6JA 1Z8NA 4RQTA 3QH4A 1BDMA 4Q39A 1TQHA 1XDUA 4MVJH 5A06A 5HZKA 2HK8A 3NHWA 1G8FA 4CF5A 2PS1A 4DCVA 2ZYDA 4RD1A 4Z9FA 2JJQA 1RWXA 2ZB3A 4LYEA 1UAYA 4LF4B 1C4KA 1AH2A 2G70A 2LW7A 3WHKA 3WQSB 2OCXA 3P4XA 3IJRA 5DBIA 4LN1A 5B2ZA 5BUCA 1BRMA 1IEWA 3OY7A 5DN6D 4CN8A 3BREA 3PF8A 4DUGD 2XXQA 3NKVA 4IINA 3WLNA 2LD4A 1K2VN 2DBVO 2X3FA 3B9RA 1VHDA 2R7AA 3AP2A 3EHDA 4UUNA 3PGA1 4KITB 1ITZA 1JPVA 5JWRA 2P0AA 3GMDA 4A6DA 1XMIA 4POOA 2PAAA 3D3EA 3P96A 4FW9A 5C1PA 4IS3A 3BEDA 4OU5A 5T4BA 3H2YA 4MIYA 4X9XA 3U7QA 3W8RA 3GR6A 4K9KA 1S2IA 3K05A 1UDBA 3NX4A 3EFOA 5U1PA 3LHSA 1UBEA 5F76A 4GLBA 2JRLA 3B78A 1AMNA 3ER8A 2BFFB 3P9QA 1XD2A 1OXSC 5JSZA 1JN0A 1L5YA 5ECWA 1NQTA 3ZWWA 5H9WA 3PEWA 2ZSAA 2Y67A 1T35A 4ABTA 4B81A 1LBIA 4K9QA 3DL0A 3KZKA 1CY4A 2D0PB 3NS7A 5BW5A 4UHKA 2B83A 5FDFA 4XQ9A 1GLGA 4OI4A 4DUZB 2VHJA 3QKIA 3RGGA 4FWTA 4D57A 5BSTA 1KH2A 3K1YA 4IH1A 3I72A 2IIVA 4GI5A 2YJ3A 3VRHA 1KO5A 4W1RA 1PG2A 3ZHYA 2XUHA 5K98B 3QBDA 1Y9AA 3WGJA 4AJOA 3FFAA 2OQRA 3RODA 1ECLA 1JLHA 1MRNA 2Q6VA 4UOZA 5SICE 1W36C 3PEVA 4LBVA 3FCAA 2X86A 2AOUB 5KBYA 1U2ZA 3CINA 1L8XA 2PSSA 1NJFA 3IBGA 3TL6A 3WB1A 1QPBA 2FEMA 2JJ8A 2OD7A 1Z18A 1ZEJA 2YNMC 4JOBA 2CLFB 4L6CA 1Y7HA 3HSKA 3PXDA 4L2IA 1OJLA 4Q12A 4W7IA 2WJVA 5AVKA 3VGPA 5EJ7A 3AVVA 1QYDA 2WYVA 5A4DA 2H9YA 1E1NA 2LKDA 4KQWA 4L8YA 1RPNA 1Z6XA 4PIPA 2YWEA 1A5AB 2XQJA 4Q47A 4F5WA 1OU4A 4JJ4A 3UTDA 4EHDA 1GUBA 3OBIA 2AN3A 1PGQA 2DX7A 4C4RA 3S81A 1U2QA 3C8HA 1UEIA 1VKRA 3AO0B 5B1DA 4JYMA 3SI7A 5E9AA 3X1XA 5KNBD 2V7XA 1XZEA 1XA4A 3NDPA 1Z0JA 1V48A 3SGLA 4ND6A 5BSWA 1I2AA 1PNTA 3DYIA 3I04M 2B34A 3RKSA 2Z0MA 4JBLA 1QDEA 4KLCA 1R16A 4MR7A 1SG9A 4DLWA 1KYXA 2F3QA 3AXTA 3Q7RA 4KMRA 4CIXA 2DXIA 1E2QA 3KOXA 2KWIA 1NI3A 4OLFA 5HS6A 3AUKA 2EWMA 4JR2A 5A2QA 3GYBA 3MZ0A 4IGIA 2UYGA 2XI8A 1GNQA 1SIUA 3BDAA 3MS7A 1P6XA 2GYWA 3GGGA 4DV7B 1XDDA 3TSWA 2IUYA 2CVPA 4LOIA 1TL7C 4C03A 3DMNA 4MGHA 1DMSA 1NC1A 4R7GA 2QVGA 3IX7A 2YVQA 2IGTA 4MH0R 5C52B 2O38A 3ADPA 3WJ2A 2WB4A 3E1SA 1Q74A 1JAZA 1XL0A 2OQ2A 2XLCA 3LQKA 3JQGA 4NHEA 5EWLA 3WMWA 3ZVKA 1OX4A 3I09A 1MXHA 1CLEA 2EFJA 4J7CA 3R7BA 3WGVA 3OQHA 2C4MA 3GH3A 4DDKA 1RM0A 2WAMA 4QUBA 5G40A 1DOZA 3DAGA 3HA5A 3NBUA 3GFBA 3CZQA 4EW3A 3DD1A 1QRDA 2EX4A 3C3BA 2PMDA 4JDUA 5EHGA 5J1TB 3QKUA 4G8BA 4ZVVA 1ZOIA 3T95A 1L8QA 1RRFA 3NHUA 1Y48E 2JJ1A 3FZYA 4J4TA 2VNIA 4GPEA 4IHJB 4I4NA 4BGUA 1BWSA 2VH1A 1SCKA 5BMOA 1V3TA 2GZSA 3L6OO 3ETHA 1C30A 4F60A 4P81A 5AXAA 3SDZA 4H1WA 1C1XB 1WHSA 2H3EA 4RTMA 4HPWA 8LDHA 3T5PA 2HSWA 4HF7A 1HRKA 2WJ3A 2A0KA 2JLAA 2Q7OE 5TQ0B 1JFTA 1HMYA 1CY6A 1KORA 4WASA 1AA9A 3LMKA 4O4LB 3PQ4A 2PWAA 2Z9DA 1UEJA 1W2WB 1RWMA 1EFLA 1F60A 4QYXA 1KU6A 1XQWA 3MRSA 1KO4A 1G7TA 3HRIA 3O4IA 2FSGA 5C7IO 3UAVA 4QXMA 1YDGA 2LTAA 3F96A 2CFRA 2CLOB 1P3JA 4OKIA 5JSQA 1D7OA 3FLEA 2CYCA 3P19A 3LLVA 4BLQA 2BWJA 4ZJZA 4UUBA 1E9BA 1TUIA 2QR2A 4LJLA 5LNK6 3JWPA 3N0TA 3M6WA 3HSSA 1SBHA 1SVNA 4IZ6A 4WLUA 2BHSA 3SLKA 4CKCA 1T6XA 2XUFA 5CFLA 3VH3A 1TYBE 1MOQA 2BI4A 1K7YA 2X0DA 3HKBA 2FX3A 4S2UA 4I6RA 4U2KA 4E21A 4YRIA 1NVAA 2DT8A 2RHHA 3ID6C 5DO9A 2VPZA 3GLGB 2CFIA 1G2IA 2RHMA 2H1FA 3ZDDA 1NJ8A 1T5BA 2HRCA 2X3UA 4HDNB 1WXHA 1J7KA 1TGVA 3JTEA 3LTEA 3LY9A 1F0NA 4TTJA 2GXUA 3MJFA 3WQRA 3VX4A 4E4RA 4CMCA 1L5GB 2XMZA 2R5NA 3SQNA 3T7IA 4ZZ1A 5ER9A 4BP9A 4GOXA 4EMUA 4Z8XA 4QYWA 1YH3A 1DAOA 5JXJA 4PGFA 3NIBA 1RJDA 3FUUA 2IEDA 3EA4A 3FFXA 3UJ3X 1X14A 1Z83A 3O1JC 1LDGA 1TZBA 1SVSA 3NAMA 2QLTA 3EGWA 2HZ7A 3D3KA 1CG6A 1R5BA 3N2EA 1JWAB 4JGIA 4YJ3A 4OX9Y 3HFJA 3CLRC 4HS4A 2JI7A 1M1UA 1XMXA 1MCZA 4TV8A 1Y0BA 2GKGA 3PUHA 2R8BA 4US0R 4BKMA 3NAGA 3TH5A 5HKAA 1VSVA 1XE3A 5DHRA 5F9MA 5G1NA 5K0SA 5EZYA 4B17A 4EELA 3KSBC 4EJSC 1FRQA 4D80A 3TEMA 4RKRA 2HJGA 3EW7A 4JQCA 2PWZA 1L6IA 1YZYA 3I2GA 4U5QA 3VNQA 2XXAB 4YMUA 1EWVA 5IJ9A 2GPJA 3ZXUB 3H13A 4G9BA 5IU6A 4JCCA 1EVJA 2F1KA 1TJ4A 2YHIA 5DHQA 3M81A 5DEIA 2PKQP 3BKXA 4XD7D 4L4RA 1RSZA 1ESZA 1I2ZA 1PTJA 2E82A 3ZWPA 1WETA 3SOZA 4DEVA 3GMTA 3KVOA 5FT9A 4CKWA 3CRRA 1XNJA 3KRTA 2PN1A 3IVXA 3MUEA 2CKMA 2YJ4A 3IMFA 1IUOA 3WYFA 2PGAA 2B8TA 3H1TA 3JQBA 5LLSA 4I14A 4IIEA 4IP0A 1OXVA 1H2RS 3CLKA 3O38A 4MA4A 3QEMB 4PICA 2JJ1D 1T3SA 3MTJA 5HDQA 1M6EX 5A05A 4D8XA 3SYMA 1KYZA 2W48A 3FPJA 5JYEA 2ASEA 3FW1A 4RTKA 3THSA 5LIRA 3MTBA 1FE8A 4G89A 2J9GA 3FPFA 4FNAA 2ZB8A 4P38A 1B74A 4K6FA 4YS6A 5ALJA 4P4SB 4RTPA 2QQ0A 3FNGA 1KIFA 2WNHA 1J7JA 3DO6A 1VLHA 1M34A 3LSTA 4BBZA 3LUHA 1X7WA 4BCBA 1QFSA 3A1VA 5FIUA 3V8MA 1E9FA 1BYUA 3SY8A 3AIOA 2W22A 9LDBA 2ZJ2A 8MHTA 1K7EB 4Z3OA 1T0HB 2CE2X 1U8FO 1RAHA 4TXJA 4E5SA 5IMSA 3ESXA 4AZSA 1UH5A 5IZCA 5KNCA 2G3YA 3F2VA 2H7XA 4MW5A 3IAM6 821PA 2C3OA 3B85A 1YONA 3ICVA 4QYSA 3G0OA 2AMLA 4PU0A 3RZZA 1N7JA 5BSRA 1VE9A 4JSTA 3SEZA 2CXHA 4LKRA 2D00A 3UJ8A 5B3KA 5BMVB 1AOXA 1M1YE 1I3NA 1Y6QA 5F23A 3WHIA 5HS4A 1Z13A 2X13A 3H7AA 3WSWA 4BVBA 3GGDA 4NYIR 4GQMA 3MGBA 4BIMA 3J81k 4G0NA 1QBKC 2P9YA 3EGDB 5JSYA 2AG1A 3BB4A 2P1ZA 3EXIA 3QLJA 1GA6A 5JLAA 2WTUA 1T24A 2VI5A 2Y9PB 2YZ2A 1DUVG 2NU7B 3OESA 3P5SA 1KDYA 3T7KA 3TB6A 1NM5A 3IT3A 3N86A 1NVTA 1T0PA 4YWHA 4CBVA 4DHWA 1FRZA 1G6KA 4EG4A 3OE7A 3Q3JB 4NCNA 1JAHA 2CV1A 2WINI 5FWAA 2GR9A 4F4FA 3OFVA 1A9OA 3HJBA 3NRJA 3SYNA 4E30A 1TYDE 3OT1A 4HWPA 3O4RA 1TMOA 1X1RA 1L8OA 5K3AA 4Z9AA 2QAIA 2GM5A 5J23A 5K0FA 3UMMA 3ETDA 1ESDA 3WL7A 1LSJA 3CWZA 1U9IA 2OGZA 1L3BA 3JYOA 4AWXA 4L27A 3DZDA 3S4YA 2YJTD 4QTTB 4NJEA 1WP9A 1E3DA 2CNDA 4NFHA 1ABEA 3GOQA 1GITA 1AO3A 4FC6A 4MWCA 1ZN2A 2F1RA 3DXZA 1QE5A 3DZJA 3UXHA 4NPCA 2NNLD 4G67A 2W98A 2QTLA 1IIBA 3RSLA 4KPGA 2A9FA 5ICSA 4ZHQB 3LKDA 4I8XA 4ILKA 4RXTA 4FU0A 4M38A 4LC1A 4JBXA 4EHLA 2X42A 3IP1A 1R8XA 1ZW6A 2FJ0A 1QYRA 2IPNA 4AIRA 5IJXA 4CZ2A 5KYYA 5IT9A 1T36A 5AW5A 4FLEA 4G97A 1X7YA 3WHLA 2NP6A 1L1MA 1KZ4A 5KAMA 4BRZA 4JEHA 2NZJA 2QT9A 2QRVA 4LNUB 4B0OA 1RQLA 2AW3A 4N5HX 3FPAA 1W5BA 4TV8F 3KVYA 5DNUA 3HE3A 6NULA 2H5IA 5D1NA 2ICAA 2XXBA 1XD9A 3IURA 1U8ZA 4Z99A 2AN5A 1XJCA 3H75A 4K26A 4JX9A 3JZIA 5K8VA 4PG6A 2AG6A 3CZ9A 4KH0A 3GCWA 4NU6A 5EE5B 3RYHA 2PMWB 2W6QA 1YOBA 1QFZA 2DFPA 1TPZA 3FE2A 4M88A 5E6UB 4DTIA 2Q45A 2ISQA 4RIGA 1RHRA 3NNNA 2G28A 3W2IA 3Q8KA 1WULS 4DC9A 4EI7A 1C2TA 4XD2A 3GW8A 4XGNA 3R0ZA 1NKVA 1TKRA 2IPLA 4WCVA 4X6XA 1E9EA 4Q4JA 1OYWA 5EEGA 1KE1A 3RNLA 3SC6A 5KNCD 3QFSA 3CVJA 5ELMA 2Y4OA 3X1DA 1WDWB 2ZSHA 3PX3A 4MV6A 5TARA 1VHTA 2FA9A 4JLPA 1Z5VA 4I6JA 1BEUB 5KDDA 3GLHB 3KUCA 2PLNA 1BJKA 4IMRA 4L6AA 5DV9A 5H7XA 5KS2A 3P2KA 4RJTA 1HNNA 4UCWA 4KGDA 2I54A 1MOSA 5IAAA 2F3TA 1JQKA 2SNIE 3E03A 3ESYA 3ND7A 4Q7JB 4U2CA 2MSWA 4ZOAA 1RJ9A 3UJPA 1KMHA 4R8LA 4A1OA 4AKTA 1ZQ9A 3U3KA 2A9KA 3R0JA 1DC4A 1VGQA 3ONVA 3ADDA 1X80B 2AVNA 4LHSA 1NYTA 5EA2A 4DL9A 1QB8A 2ATVA 2QZPA 2FEAA 2ZPAA 1Y8CA 1XV5A 4BQPA 2V7UA 4Z54A 1Z68A 3KM0A 4YJGB 3VZQA 2G63A 2ZYUX 3DCNA 4BIIA 3OQMA 4W5NA 1UQRA 1DCKA 1PJZA 4BX0A 2B3DA 4V0QA 1ECFA 4RL6A 2BFCB 3D3JA 3SZLA 4MQFB 1U7TA 3AG5A 2J3EA 1N5JA 2QYSA 2PKQO 3DNPA 3UBTA 1FTSA 2HY7A 1DBPA 3WLIA 1XFAA 4N3GA 3AQ4A 4P32A 1I7NA 1TCAA 1U0HC 2XAUA 3AOEA 3NROA 1I6MA 3BJEA 3P20A 2IYZA 4BTEA 4Z0HO 5KOIA 1FMTA 4HNGA 3JALA 3X44A 2ZI6A 1LLFA 3L7IA 3CT6A 1VFPA 3QWHA 3INTA 4CDGA 2VJMB 1PSDA 3JVVA 3LFTA 3N2NA 4F1KA 2VQFB 3CV3A 1Z6QA 2XD9A 3MJSA 4S1PA 3DHNA 3M6MD 3C14C 4CMAA 3NETA 5EQFA 1K3TA 2N42A 1PNVA 1W29A 2ACWA 2ZUFA 1ZAKA 1ULZA 3KPYA 3OOHA 5IUNC 5KOJB 4XVRA 5LN1A 4J1TC 4TTSA 1MC8A 5KJ6A 1WG8A 2J32A 3DSRA 1IJBA 3NQ41 1M1NB 2H9AA 1JA1A 1ZOOA 3D7RA 4RK0A 4TSFA 3IAAA 1MF7A 1LPMA 1Z3CA 4IIVA 5AQEA 3GRFA 3TZKA 3O4JA 3G8BA 4OL0A 1IAQA 2BP7A 3AKEA 1NC3A 3Q40A 4JYAB 3WA7A 1ODLA 2QUHA 4NDWA 4J3NA 3WVNA 4QBHA 5FOTA 1EXVA 1R37A 1MQ8B 5GPBA 3VVBA 3CF6R 3LS2A 1HSZA 4WGFA 5JOQA 4L7VA 2ZYVX 1CJSA 4RH1A 1ZZ6A 1W48A 1E3WA 3U44B 4XVQA 3SBEA 2X3YA 2AYZA 1SEVA 4PQRA 4DA0A 5LJLA 2KQUA 1MV5A 4KXXA 2IRWA 5TQVA 5AKHA 5JR3A 1O1YA 4YP7A 3G2KA 4L8WB 4A5SA 3PHIA 2IXAA 3PPVA 4FW8A 2XA2A 4R1NA 4X8OA 5J4HA 3VKGA 1JFVA 5DDIP 4NE7A 2YXNA 1TJYA 2OV6A 3CWCA 3ZY5A 3FDZA 3SDBA 1M8JA 3RAJA 4CDNA 2PXXA 1HE1C 1KH1A 3ITDA 4F9TA 4PQFA 4JYPA 4RA6B 2R1JL 1NYLA 3PRJA 4HDRB 2FHPA 2YMLA 5BV7A 4HEJA 1A9XA 1TTTA 2HCRA 1YKSA 1N5LA 4IFTA 3W1EA 4B4WA 5CG2A 1F5SA 3DF7A 2FPLA 1L4YA 3VHXA 2Q3DA 3KZVA 1X9GA 2WHPA 3EIXA 5LOVB 4RQUA 1Z6YA 2IV2X 3EEBA 3L7AA 5KWVA 2P11A 1CP2A 6YASA 1E9SA 2I6SA 1J2RA 1Q1BA 4ZC8A 3SN6A 1GG9A 2W6PA 3DE3X 3P52A 3CH4B 3ZWQA 2G77B 2HWXA 3AJAA 3GPDG 3M2PA 5CBKA 1BW9B 1K8YB 1P4RA 4JGBA 3G9UA 3NPMA 1KFKB 2C95A 5EI5A 4DFDA 2BEWA 4NY1A 3D7LA 4KE6A 4NE2A 3WO0A 4KPUA 2HRQA 1FFXB 3I2FA 1ONSA 5LR6A 2GN4A 4LJKA 5AI8A 3O1LA 5GV8A 1O87A 5DM70 4O4IF 4FUTA 4OCZA 1UBCA 2DQSA 3I5MA 3UIEA 1OFUA 1JU3A 2GKSA 3EJWA 4FDAA 3PXXA 4M0CA 3RM3A 1TA9A 3RYCA 3VTAA 5ITVA 1XKXA 5TMDA 1TDJA 3COPA 4AJKA 3H1PA 2WB2A 1YB4A 3FOEC 5ITSA 2HMYB 2QRQA 4KNYA 5T57A 1CUYA 3IBSA 2N1BA 3OQBA 3PNYA 4LYGA 4MVJA 5PGMA 5AJWA 3B5JA 4FP9A 2WU8A 4B33A 3LW8A 1U3CA 2P6PA 2ADOA 3I3SR 3Q5GA 4FJ0A 4HG2A 4BLRA 2H7YA 4HQOA 1YMQA 2CSFA 2FR1A 1Z5NA 3KJIA 2CUTA 2B2CA 3MBOA 4QRDA 3Q2KA 4ZEVA 3SYRA 3QYXA 3HYSA 3GZJA 5BRJA 1V71A 1GTJ1 1RR6A 3C0KA 4CF6A 4CKEA 1BS9A 2CBZA 1S2MA 2J5RA 1YFLA 1ND5A 2C7VA 2JCVA 2VXOA 3BD9A 3UKOA 2VDKB 3VKWA 3QLTA 4PHHA 3K94A 4D4KA 3OKCA 5I7SA 3S8YA 3HJFA 2L42A 5LIPA 2GAOA 3UKDA 3QP9A 3DP7A 4JVMA 3LHFA 4CM7A 2HREA 2RG7A 1QORA 4YCMA 4EHHA 1V9CA 3DOIA 3EQ6A 1XKQA 3CH6A 5F7JA 1ZFNA 1J1IA 4MRSA 3PJGA 2I34A 3G5UA 4HH1A 2QQGA 4LHZA 1A72A 1E9RA 2VTKA 3FCSB 1TKCA 1HY3A 4AECA 5KEIA 2GPYA 3OI7A 2AOVA 4CMGA 2JQEA 5DH9A 4GF5A 1E4VA 1U3FA 4KUEA 2OCAA 1XZAA 1I5RA 2HA7A 2VCEA 2Q1TA 1FX0B 2MINB 2YIMA 3I53A 1N92A 2OFYA 3ZHXA 5JAPA 1UM9B 3NBXX 4L85A 5LP6B 4FHZA 4F71A 4UEKA 4OG2A 2Z1DA 3ZG6A 1JA0A 2W2VA 3COZA 4LJ9A 3ZI4A 2X4GA 3ZLUA 5G0TA 3I8OA 3J80A 1YCFA 2FRXA 2VNAA 1PW7A 4E2YA 1MEOA 4DB4A 4UXIA 3U7HB 1IY9A 1REQA 5KSWB 4R41A 4EFLA 2IYXA 1AURA 1T0IA 1Z25A 3UMVA 1L1FA 3GDGA 4LYHA 5DMXA 5ALSA 1A4XA 2JD2A 4X95A 4JD5A 3HEAA 4WKNA 3W5AA 3HP4A 4JL6A 5LQMA 4I9HA 5ICFA 1RPTA 4JLNA 5JC8A 3I05A 1J56A 5HKLA 4RNCA 3ZXXA 4YRBA 1BZYA 3OP1A 4JI3B 4LPSA 4AG3A 2X2OA 3T9FA 2JCXA 1VLMA 3OURA 2AXQA 2W2MA 2QL9A 1LPBB 1Q7BA 3BMCB 3BWYA 3DDWA 1S3SA 4TTRA 4V24A 1Q5PA 3DHYA 4MI3A 3AI3A 4Q4LA 2ZWVA 4M53A 4B40A 4IBOA 4ZCTA 3JQ8B 3KKQA 3U6KA 1L4HA 4M1SA 1CE8A 3LLCA 1XMQB 1U3GA 2AWIA 1KEEB 1BQ3A 4A8JA 1JJIA 2NIPA 2WFAA 2ZSIA 5EIHA 1QNLA 2G71A 3DT9A 4XX1A 4Y2JA 4EPVA 5SZKB 5FEMA 3GQVA 2JEYA 2YYSA 2IKQA 2IXTA 3O1IC 1ZGBA 5GMOA 3PTLA 1HQCA 4GGMX 4YMLA 1CUWA 2A3RA 3EWSA 3E9ZA 2BF4A 2HIGA 1TUEA 1TAQA 3HC7A 4G01B 5E6SA 4JBHA 1S2NA 2ID8A 3PWSA 4HZUB 5ED4A 3ERCA 1U5BA 1QH8A 2EIHA 5ERYA 3A2LA 4HYQA 4EUSA 5EVJA 1GL6A 1NMXA 1YD7A 4HCJA 2PX3A 2MR6A 4HN9A 1PX2A 1TLTA 2KZ8A 1W85A 4LMAA 4UU8A 3KQUA 4MVJD 5HCUA 2WU3A 1Z5PA 3UHAA 2OO5A 4JLUA 3DEYX 4PYIA 3OOWA 4X1IA 3UHFA 4MQEA 3T34A 2AG0A 1GRVA 4G4IA 16PKA 1N2XA 3O2QB 4CV3A 2Z2KA 2R97A 4MS3A 5BVGA 1EQAA 3L0ZA 1F5NA 3IOBA 3QELB 1C9MA 2V7QD 4QVIA 1BOOA 2MSEB 1UOPA 1J6UA 1IBRA 3B9QA 3H9CA 2VYCA 3C45A 2XB9A 3JWHA 2Y76A 3OPYA 4DREA 4F3NA 5IT4A 1SKBA 3W6PA 3DOOA 4X54A 4OUDB 1F6WA 1I4OA 3IQFA 2PL9A 2A0WA 1QTIA 1VL8A 3F0TA 5GAHi 2OK8A 3FPSA 4OXQA 3GEHA 4D6XA 1MC1A 2ZUBA 3AVWA 1K8RA 2AXZA 2VQEB 1T8UA 2XUJA 4DIMA 1XNRB 2PZLA 4H08A 1O58A 2I1QA 2ZRNA 4GX5A 2XBUA 3M6IA 2FQXA 2E1PA 1U6IA 3U37A 4FQ7A 2GETA 5AJYA 4E5KA 4D0SA 1XVUA 4ERXA 1ARZA 3KEOA 5DP2A 3RJ5A 1NLFA 1PGNA 3VPSA 5J9FA 3AUYA 2RFLA 1I0LA 1M2KA 2VAXA 4HFRA 4IHJF 4TRNA 5LYJA 4FXOA 3DEIA 5A7FA 1ZVQA 4EPRA 1JFSA 2GHTA 3E3MA 3NLLA 4FS3A 3E9RA 4LVNA 5A3VA 1JPNA 1ST2A 3HNOA 1TQDA 3TRKA 2HINA 2X0NA 4HGNA 4WFJA 1BVRA 2HQSA 2JKYA 3EGDA 1LLIA 3OD5A 4M0PA 4KYUA 5K0LA 5EJ9A 3VU9B 5LFAA 4JJKA 2P3OA 4JCOA 3LBYA 2WFLA 1U90A 1R6TA 3B82A 3PKZA 1Z6AA 1MC4A 4WOJA 3O74A 1YSEA 2LDBA 4DYHA 2OFFA 3W90A 4H3VA 3WBBA 3FZEA 1BE8A 4HR7A 3TE6A 1VKZA 3E5RA 3C5VA 1S2DA 4HAOA 5J59A 1A9QA 4QU9A 2YFHA 4M7OA 1EVKA 2ORED 2VL7A 3L82B 1N9ZA 3BMQB 4FKZA 4RSHA 2QMQA 3I5YA 5DPMA 1V95A 4UCXA 2D5IA 5LQRA 4WY8A 4YCCA 1MA3A 4R0MA 3PD1A 3PC3A 1LPAB 1U7PA 3VAYA 2GZMA 2ZKLA 1Q57A 1BC5A 1XLUA 1UJBA 5EKXA 3Q8LA 5G3YA 1RI3A 2I2AA 1U0TA 2WWGA 5JG7A 1H6DA 5CT6A 2FUNB 4HTFB 3UWPA 2DWUA 4ZJYA 2ZUVA 1UXGA 3PENA 2PWYA 1GLNA 2EKBA 1NUTA 4Q7MB 5EGNA 3ADOA 3PGVA 3NUZA 4ZHQA 1QIGA 4PLGA 1JG7A 2HDWA 2QMZA 3HY3A 3HZRA 5JDIC 2K6GA 3QUCA 1ZUGA 2IZ1A 2WHQA 3Q2OA 4H1UA 2Q5HA 4WOKA 5FOWA 1NRWA 3MJCA 1M73E 3RF7A 3EDQA 4X3OA 1X7XB 4HGQA 1UKBA 4P86A 1EVZA 2AJLI 4XEUA 3HUDA 4LRWA 4DEYA 3COVA 2AEEA 1LMB3 5SY4A 5CB8A 5ADWA 4JH0A 4TM8A 2BT4A 1U8AA 4IRMA 2V4ZA 4BMYA 4BQRA 3PT5A 4DEXA 4QOIA 4HQFA 1WWKA 4WZBE 3TDMA 5GIOE 2QORA 4MV3A 1OLSA 3E82A 3NR2A 2XA9A 3BM5A 4KSYA 3HUEA 2HFZA 2C2OA 2RI1A 2XUKA 5HHTA 4LV5B 3RSGA 2X8JA 3R6GA 2FQYA 2VPPA 2X14A 1U2EA 1TZJA 3N39C 1EINA 1GFZA 3OU2A 1VJCA 1RRMA 4LHEA 1RVDA 3MLAA 4FR2A 5GONB 1T3HA 2GSWA 1ZN8A 4IHKA 2YOFA 4JFAA 4G23A 3WLTA 1HLPA 3N2GA 3KU1A 8OHMA 5JPCA 3GRYA 1Q0TA 2PFSA 1WCIA 3IXLA 4XJTA 4PZPA 2QSZA 4ZREA 3FCXA 1C0IA 3O9ZA 3QBTA 1E79A 2GVNA 2O2XA 1BCSB 2RJOA 4N8EA 4WAUA 2D3TA 4YROA 5KOHA 3ZCUA 3EDRA 3UGTA 4A2QA 3VC3A 2H2WA 3UYKA 5AM0A 5FUWA 1KVSA 4D25A 2UXCB 2ZSUA 4F45A 1R64A 4DTCA 3ZV7A 1TXGA 1Q3TA 4D96A 4Y2RA 1DO2A 4YMSA 2IYYA 3HUUA 4F8DA 1E77A 2V7BA 4BO6A 4L5YA 4G4JA 2C4TA 4L95C 3KXKA 4I5EA 3MGCA 1PERL 1KYTA 1VJTA 4L73A 4U6QA 5D3QA 5K8LA 1KJQA 1LUAA 1OVGA 1YO6A 4OD0A 4RK5A 1OFHA 4PHCA 3UKJA 2XNHA 3IR6A 3WKDA 4OHXA 1IXZA 3O84A 3N2KB 1EJ6A 3ZX4A 1VZ2A 2Z2IA 2TSYB 4F06A 3TSAA 3W3AH 4EGCB 2C59A 4RS3A 2I8CA 3FPGA 2WUVA 5FO1A 3TDKA 4BNYA 4J2TA 5JZBA 4M55A 4ONEA 5I45A 3WBJA 4E7PA 1DU4A 1P8AA 3IVCA 1NZDA 2WMNB 2W70A 3EUEA 3TMKA 3TG8A 5BMVF 1OWOA 2PZMA 3K0FA 3NJ8A 3R8FA 5B36A 3ROZA 2CMFA 2FSUA 3AUJB 3REOA 3FF1A 3PB3A 2A88A 3BXOA 3NGMA 4YJ2B 5B7PA 3T5BA 4QVKA 2NV0A 2C92A 2WM3A 4UUPA 1EESA 2BFEB 3HGTA 2I71A 1THTA 1Z63A 2DRIA 3ZQJA 5HFJA 1SXPA 1UBGA 4IXNA 2YW9A 3F97A 2YKGA 5L8VA 4ALJA 5MGNA 3RC2A 3TLGA 3B1JA 5HM8A 1I7PA 3NHRA 3IEXA 2FJRA 4OH7A 5TF0A 2YOGA 3RH0A 2QY9A 3PFIA 5I3CA 4OLBA 4LJ6A 2NU8B 3ME5A 1PL0A 4TXLA 1LTKA 5EPUA 2FR8C 3FWNA 4AFNA 5ALRA 3GMIA 1WMEA 2H4JA 5HBRA 5A4FS 5ERGB 4V0KA 4MKZA 5ICGA 4ZXFA 2QDXA 2P2NA 2WOJA 2IU7A 3HLKA 4MV5A 1UK7A 3SQXA 1C4XA 4WLFA 3USCS 4AB1A 1FP2A 3WSVA 1KDPA 3KE9A 1ZCFA 2ETVA 2O3TA 3K92A 3OE1A 2ORIA 1OGIA 3WI7A 1QJCA 3MSCA 4GPIB 2LNDA 2PRIA 2VDPB 4OREX 1QQ5A 3V1KA 4NH4A 4RZXA 1N8TA 2V58A 2V3WA 3WIUA 3IVMA 2FV8A 4FXPA 5EXXA 3TQFA 5DM4A 1YZLA 2OP0A 1E1YA 2R4TA 4ZHQF 5ETJA 3EAGA 1EA7A 3IT2A 3KEQA 3TIIA 4DVJA 2F8TA 4Q05A 1I1OA 4C0BA 4J0JA 2Z8YA 1X77A 3PQ8A 2G82A 3EPRA 3DF9A 1CZHA 1KP3A 4R3NA 1SQ8A 5K0NA 4G37A 1E79D 4V0ME 2VYNA 3GBFA 4D92A 4HVAA 1LBTA 3EIHA 3T3EA 5CURA 5FLEX 5IJAA 3KVRA 3SJ7A 2LGJA 4BNNA 5BWLA 3TGLA 3JR3A 1IYZA 2WG2A 4L50A 5KINB 2CLCX 1AE1A 2H29A 4LSMA 5CVVA 1XB2A 2SCUB 4WMLA 4D0GA 1AHIA 1IULA 2P62A 3TEPA 3OC6A 4KO1S 5JBQA 2BHTA 4ESEA 2H51A 1IHPA 2D2VA 4FR0A 1NU6A 4GXTA 1P45A 2C97A 5BV0A 1S9DA 1V5GA 4NPHA 3IA2A 1KZYC 1ZD1A 5LDGA 4ENSA 1FLDA 4M0DA 3RUDA 3HG7A 1DWOA 2LV8A 2AFIB 2V6IA 6GPBA 1MX9A 2OCIA 3OBBA 1NW5A 2BD0A 1E3EA 1TKAA 2C77A 1W4BA 1DPFA 4IVQA 1TNDA 4K9LA 5CFMA 2IELA 4B84A 2HK9A 5BURA 2Y77A 4QE3A 1ZDMA 2WIKA 4HB2A 2FW6A 2OZLA 1PWHA 1SCIA 4UHDA 1GSHA 1CRLA 5AJXA 3S68A 3OUTA 1VE1A 2FW1A 4GVXA 3JYHA 1DRWA 2YFYA 4MUFA 3Q41A 1MBZA 3JD2A 4CKBA 1YAHA 1A9TA 2E48A 1AGNA 1N6IA 4BLPA 4YUWA 1Z29A 2GBPA 2JLWA 4F21A 1YZHA 5AI0A 1CZKA 1DAFA 5IDYA 2I4RA 3JARA 2QEQA 4G1VA 1PGJA 2IC5A 2TMYA 4KN9S 4RSRA 4U6SA 2EIXA 4E08A 1VI2A 3KZOA 3V4FA 4LXQA 3D81A 1NTOA 2GEKA 1C8LA 1GEGA 1H69A 3V8BA 4MO9A 2ODBA 1GV1A 4LXXA 3KBOA 4KU4A 4OB7A 3TKLA 4E13A 2HSJA 4U2FA 2PXEA 3SQLA 1SC4A 4E2WA 3TK1A 1NI5A 4U0JA 4LUCA 2VDVE 2EEPA 4DQVA 1H42A 4GVPA 4QRIA 1FZQA 1H4SA 5BXYA 1L2TA 4ER0A 4F4HA 4UATA 2O49A 5HIKA 3OQ6A 5B64A 4P3OA 2RHDA 2CHEA 1MP0A 1O6ZA 3ROGA 5LP6A 4MUEA 1B8VA 1T9BA 4II3A 2HCNA 1G21A 2XB6A 4M0KA 4F3TA 1YI8A 2I6TA 1XTPA 3TRJA 1DX4A 1SZJG 5CFQA 1RT9A 4AY6A 2QX4A 1EFCA 5IUKC 5TMEA 5NULA 3CLTC 1ZZGA 4Q3EA 4F2HA 1J0EA 3ORYA 2UVPB 1RJFA 2CEAA 3JYPA 4KK3A 4DNFA 2VQ6A 1YB7A 1HC7A 3AFNA 3K8QA 3LOQA 4RKYA 2PV7A 4XIGS 4RLHA 1Q1ZA 4Q3AA 2WW8A 4RH3A 5EUQB 5HRAA 2E7ZA 3NIGB 3O7WA 1GL7A 4BGDA 5LJIA 1E8NA 5KQPA 1GTG1 3GHYA 3ZKWB 3KLPX 2IY9A 6REQB 2CJFA 1ORWA 2PGNA 4FJ1A 2PQ2A 3R44A 5JRDS 5CLHA 3F7MA 4GOOD 2BF7A 1VYVA 3OQNA 1WRBA 2VYND 3SJUA 5B53A 1V2GA 5D5QA 1OIXA 3NNDA 4J1XA 4JLMA 1V8DA 1K7SN 2HA6A 3IEIA 1PWEA 4HMOA 1NX9A 2H1RA 3MD0A 4NDZA 4XM1A 2QXTA 2ZRGA 4JT9A 2A9QA 1EFKA 2JJMA 4DBVO 5AIBA 2PPVA 2W4IA 4KAXA 1E0DA 1E60A 2G9UA 3PGKA 4WIAA 5C31A 1GL3A 3G0BA 1JAIA 3U4IA 3FTEA 4AYWA 3QE3A 3SC2B 2KEIA 4NZZA 3ZU4A 3G8AA 4BWYA 1H23A 3DPIA 1JIUA 3LIPA 3OQ1A 5SYAA 4AMYA 3LDGA 3KHTA 4EKDA 4YPVA 4JY7A 2OCGA 4L3VA 4PO9A 2RAVA 1IY0A 3MGKA 1QV7A 2X9VA 3MRTA 1GZ6A 4NCAA 1KEPA 3Q3IA 1H05A 1UP7A 3ZZNA 3SCFA 3AWIA 3RJ9A 5LOVF 3ZGVA 5A0TA 1HLGA 5JRJA 4UDXX 4FFOA 1E89A 3CX7A 1WMDA 3FSEA 4NXNB 1RHUA 2F8MA 2Q4RA 2CL0X 1RZRA 1EFAA 1KQPA 3TWOA 4D9NA 4WLOA 3VNAA 4EAQA 3MQFA 3IAS1 1E3QA 2PUAA 2PXHA 3LC2O 3TXAA 1LRKA 1BX3A 2Q9UA 2PSDA 3PQEA 1UFVA 3WGMA 4BMPB 4DY4A 4EKGA 4S1OA 1JDJA 2O2IA 5JWHA 2V4UA 4KQGA 3SLGA 1SQSA 2AWNA 4HO1X 1K0FA 3M6UA 5JVDB 2OENG 3H9BA 1WKCA 1TMGE 1TMYA 4WRRA 3RBXA 1QP0A 3H1BA 5DTJA 3UQZA 2DUUA 2CMHA 1SHZA 2VQDA 4DMUB 1EU1A 4NI5A 2FMKA 2YV5A 3PUJA 5KKCA 3BFXA 2D06A 2CMKA 3H8VA 3EXHC 1SB8A 3KT3A 2G9QA 4RXMA 4IKPA 4EKNB 5ICEA 2PX2A 3Q7SA 2EV9A 4UBKA 3CLSD 3OCCA 3A6ZA 3NASA 4MV8A 5CNMA 4ZTUB 1G19A 1FFDA 1YHYA 2A78A 1AQYA 1XDSA 1M7GA 2DPYA 2DUNA 2DBZA 3PL1A 1QHIA 1U8EA 2FPRA 4LYDA 1XTVA 3AJ8A 4LZJA 1AUOA 2F67A 2PU5A 3LG2A 4Z86A 4EI2A 2ZXEA 1QH1B 2C31A 1HFEL 1JX6A 1T2FA 2ETXA 2GN9A 3DV0B 1FVOA 2IHJA 1GQSA 2C8KA 3EGEA 4MUKA 1SHJA 1QHSA 5J5AA 1ZGCA 3PEUA 5AVQA 4C08A 1HO3A 3N75A 5DLEA 5SYNA 4PZ0A 2P3QA 3OM0A 1XAHA 2XVYA 4ZVPA 4Q21A 1GYRA 1KAQA 2XUDA 1KZ9A 4C05A 3FGZA 5K3OA 2IU0A 4OQYA 4KGXA 1SCUA 4MMYB 1FVHA 4K9DA 4XGRA 4BVKA 1M5UA 4CLOB 4GNRA 2SBTA 2FW0A 1NW9B 4MUYA 1EFRD 1MNAA 3ENQA 4Z4FA 5LP6F 4EP1A 1LLQA 2WHEA 2B4YA 4RIFA 4XEHA 1CUUA 3PUKA 4UW9A 3UK2A 3V3KA 1SOMA 2WTBA 4KP7A 3GBPA 1YCDA 4JJFA 3U3DA 1UBJS 2GPSA 3F7TA 3WOVA 3ZZUA 1WW8A 1CQIB 1WEKA 2Z2JA 4F91B 2WM9B 3GNQA 3E9EA 4R51A 1H9BA 2JGFA 3AUXA 5CW2A 2RJ3A 2Q5EA 2JFNA 2FQWA 5EMKA 1CFJA 2GZDA 3BHNA 4DCNA 3S8EA 4C7VA 1QR2A 1VHQA 2ZAIA 3KXDA 1EFVB 3IUBA 2GAAA 1MJFA 5I5EA 3FBTA 3GLIE 2P0YA 4LZZA 3CG4A 1NF9A 4D74A 5C5CA 2GBLA 4KSCA 4Y1GA 4UCFA 3ILHA 4ALKA 1XZJA 3KJXA 2Y0DA 2XYPA 3RW9A 4UZSA 3EEQA 4UD6A 4J3FA 1GCOA 4D3DA 4BFVA 2WYUA 4LRSB 3AI2A 3F6YA 4RGQA 3KB1A 1LBHA 3I9V6 2DHDA 4MHTA 3A1UA 2PUJA 5BVHA 5ALUA 2C07A 1RZRD 2IYFA 3G9ZA 2VP6A 2HNKA 3LBFA 5AI4A 1IN6A 2Y68A 3P9ZA 4P0QB 4UVGA 4LDPA 3EF1A 2DCMA 4NZNA 4D9FA 3LP5A 1GNSA 2IZOA 4LRQA 1AMUA 1L5KA 2BFAA 1W93A 1T3GA 2GOYA 1S0UA 2XWJI 4Q1AA 3VQTA 1U9CA 1IHYA 1Z75A 2E55A 3EK2A 4GPZA 5ESDA 1K8QA 2GK3A 2RGDA 4YJHA 3SE7A 1YL5A 4CNBA 3AI1A 1M33A 4HLUC 3G2QA 3OFJA 4L5IA 4OHWA 5CRIA 3CUEF 1BWPA 2EHJA 4QEDA 3ZV5A 1CRPA 3DTNA 2IZ0A 3HCCA 4BRUA 2GWHA 4FFNA 1I2BA 2X77A 2XXJA 3LQQA 5C1BA 4IFIA 4UJ3A 4J1SA 1YDHA 2QDKA 4Z0PA 4LSWA 5TS2A 1B0AA 4C7XA 5LWQA 2VDNB 1R0SA 4WXEA 5BR1A 1ENPA 1Q1EA 2BW0A 3OIUA 1OASA 1AKYA 1HRDA 2QN2A 4AY5A 3CMMA 1Y7LA 5IKXA 1XRMA 1I32A 1XZFA 4QYIA 3ZQKA 2G4VA 4KIFA 2Q9BA 3RYTC 4JSRA 3TPCA 2NVUB 1GD1O 3B89A 2BDTA 1TCVA 5C1DA 4L5AA 1OF1A 1MUUA 2BEUA 3AEKA 1YVRA 1XR3A 5ESRA 1NXSA 4WHMA 1U0FA 3B13B 4MUAA 3WB9A 1XOIA 1ESEA 2QPAA 2ZYTX 2AUTA 3B53X 1KJ9A 4EHAA 3LL7A 4MSUA 4Q3LA 1GRRA 3TR0A 5DJ5A 4G1CA 4L4SA 4BB5A 1ZAYA 5FEUA 2D5CA 4UNIA 3CIOA 3DD5A 3T1HB 2B36A 4LSZA 3OZRA 3WWYA 1RP1A 4ZVOA 2QE6A 2YC4C 3PNKA 1Y3HA 4WKCA 4RFSB 1Z36A 3ELWA 1CX9B 3RVPA 4QECA 2QVCA 3SOPA 4DBLC 4N0MA 1AO0A 1TCCA 2HX1A 2O2ZA 3G0IA 3T41A 4EB6B 3R7AA 2BSQA 4ZI5A 2X0KA 2E49A 3BGOS 5HEKA 1JSZA 5KJFA 2V03A 1BVYF 3W34A 1PRVA 3E23A 4YAFA 1ZMRA 3WLRA 1H94A 1QFJA 1XWIA 2P5TB 2GZ1A 3MERA 4D43A 3THXA 2W6MA 4GKJB 1BFKA 2F9FA 3M49A 4FYMA 1WV1A 1W25A 1OU0A 3HZIB 1QIDA 2E4ZA 2EERA 2ZZKA 5ADVA 1FUKA 1EUCB 3IDOA 4LZAA 1EK0A 2F17A 2FDRA 2V8OA 3N70A 5AOBA 5E3IA 5BOSB 5CNJA 4OHPA 2EXXA 2P35A 3PEEA 4UBIA 8GPBA 3K71B 4LNHA 3AESA 4E22A 1RI1A 4QDUA 4F2WA 2PX5A 3DFIA 4UM7A 3TLBA 1ZA1A 1V1RA 3HCPA 3DV9A 5H9VA 2O1WA 4Y7DA 1FB5A 1KI8A 3WAJA 3TSOA 3DOUA 3IRVA 5IANA 5L3SA 5MF6A 3EQ2A 4I1PA 1KQOA 3TFOA 1B1CA 1PN3A 3LQRA 4WLVA 1T0BA 3E4CA 4CCYA 2OB2A 3BG5A 4HEA6 3G0CA 2FPIA 4INAA 3N74A 4P4LA 4MWGA 2PVCA 2QD5A 1YZQA 4KVAA 1KJJA 1P9RA 5CDTA 2DERA 1QIHA 2WYWA 2BE9A 2EBWA 4O29A 5BV2P 1EG2A 1FA9A 4JX8A 5FP0A 3CW9A 3HY6A 2IPMA 3T3PB 1UBSB 1FDVA 4YRTA 2XCLA 3OF3A 4XAQA 4Q37A 5B2EA 1SBZA 3I39X 3UICA 1K8XB 5F1OA 1WDKA 5DOZA 1M2NA 4B9EA 3UC5A 3NBYC 4CVNA 4D0NA 3NUQA 4ZT7A 4I66A 4R6XA 3RU3A 2D2IA 3WWDA 3KALA 3S29A 1QKJA 3L3BA 1XTUA 4DADA 5JMOA 2IHTA 4ZAVA 1S6YA 2Q1UA 4TUYA 1M7HA 4DQXA 4EUKA 4EATA 1CDOA 5EP1A 4D5EA 2I2DA 1SUDA 2JCSA 4C43A 2GD2A 4PSUA 1U65A 1P9WA 3OO1A 1ZINA 2FCAA 3PDHA 3U4GA 3IPRA 2NM0A 3I58A 4GSYA 4HDSB 4N0DA 3D6TB 5HQJA 1QYCA 1K7XB 4PVDA 4JLKA 1RZVA 3WRVA 1PYDA 3MT9A 1RC8A 2GH1A 1I3CA 2J7UA 2P6UA 5MHTA 4QOJA 5A4AA 3FBGA 4QM7A 4V03A 5KO2A 1E59A 1NFRA 2O20A 2CWDA 1DIGA 2NTNA 1OAOC 3QVGB 4CG1A 2HI0A 4WJZA 1WXGA 1JHVA 3DO8A 1VJ1A 5GONF 1CULC 1QYWA 4MPDA 3LCMA 3AYZB 2HK6A 4DJJA 1FW6A 5K3BA 2XI4A 4FEEA 2QZ9A 1B93A 3E2MA 1PHRA 3VKFA 2A7XA 5JO0A 1TVMA 2EFDB 3RIYA 3O8OB 5REQA 4DCCA 4DDMA 4ZAWA 2O0JA 4CU5A 4IIHA 3L7DA 2X9LA 3QWBA 3CX3A 2WZDA 2A5FA 4URUR 3QW2A 4AWAA 1ZOLA 1OFTA 3GB9A 1OBFO 2WILA 1IG0A 3F8WA 4S24A 1J5EB 4CM8A 3GGCA 2O2JA 4MVJI 4ALIA 1AB6A 3ICQB 1Z7YA 4E5VA 4I6UA 1NF2A 3EGCA 3IERA 1MT0A 3KVNA 4FNGA 4ZICA 1D9XA 2BMVA 3MTAA 3GLFB 4DCMA 3G49A 3A1DA 4AS2A 4ZYLA 5HZMA 1I9GA 1RWBA 4OPMA 5C3MA 2CNBA 4PYJA 1T8PA 1A97A 3H4TA 3K9HA 3UMBA 1E7MA 2POQX 4JP1A 1W9MA 4G0XA 4EGQA 2GK7A 2ZJ0A 4GMKA 2GASA 3GT3A 3L7JA 2JAOA 2DGDA 3FXAA 1BDHA 5DSXA 1ZR2A 4NTZA 3O8QB 2HJHA 1XP5A 4MJLA 4QUKA 1OXKB 4RE5A 4IH9A 4P83A 1JSLA 2XNSA 1JB9A 1GCAA 2H3HA 3QJGA 3ACDA 3INGA 2HFJA 3VZPA 3WIBA 4V1CA 2H4HA 4YJ2F 3D02A 5T8KC 3EEYA 1ATIA 1LSSA 2BISA 2GCPA 2R1VA 3O8DA 3PCXA 1UXKA 3VR6H 1RHMA 1XK7A 2PUDA 3PG5A 1XZHA 3CU5A 3UTCA 4RZHA 3ZNNA 3FWHA 2YV2A 2O59A 4LXIA 3QLEA 4IQ4A 4MDYA 4DJFC 3JQAA 1DOAA 2XKAA 4XPZA 1S2GA 1S5PA 3EQ8A 4QQRA 4RUKA 1UP6A 3IA7A 4N0QA 1Q2XA 3OKZA 5K6AA 5D7BA 1QQAA 3UCFA 2F00A 5A6SA 2XQIA 4J43A 4UE3S 5SZHB 2I4MA 3DA8A 4U2GA 1VG9B 2P3SA 2IUOA 1KDTA 2GEVA 3RTEA 1ICEA 1DWPA 3DBOB 2R7LA 1ZXXA 4FQ8A 4FYYA 5TNXA 2UZ1A 3FDJA 1YR3A 2QRGA 1CRQA 2A35A 2PA0A 3K0AA 9LDTA 3T52A 2RHGB 3EYWA 3LVBA 1PK7A 2VQSA 4B8ZA 3N8IA 5B30A 3QXGA 1EX9A 1Y3DE 2I6GA 2PFKA 3DBRA 3B1ZA 3IGFA 3JD3A 3S2UA 2WJZB 1GAWA 4FT4A 4TZTA 2NV2B 5EINA 1WL8A 3HI6A 1F3OA 4PONA 2JS7A 2OEPA 1PO7A 4KFTA 4Y9DA 4EVQA 4LVOA 3CRW1 4I3GA 3AHJA 2FETA 4LNAA 1DCFA 3W2TA 3FTDA 3GUZA 5C34B 4RMIA 4PS0A 4W9NA 1QO9A 2IS2A 1MIOB 4RVNA 4RY2A 3M4ZA 1XQ6A 4HX5A 3CNNA 1DO0A 4QREA 4X8HA 4JC4A 2V59A 3R1FA 3V34A 4QKQA 3IB3A 3PPIA 4B73A 1LDNA 4GL2A 1J23A 1JH8A 1SBIA 4DVGA 1E1KA 4L5CA 5D01A 1CU1A 5C1OA 1G6HA 3D4LA 3SIWA 5LLDA 5FPHA 4UTNA 3O95A 5L3QB 1DS6A 2CT8A 5M7EA 4U2DA 1KEWA 3QYAA 1ZPQA 2LCVA 3B3QA 1C81A 1TK2A 2IYSA 4PHFA 2HB6A 2HHAA 3G1UA 1U9YA 3TCXB 4ZOBA 2XVXA 3ZS8A 3ACBA 2ZSJA 3FETA 5FNZA 4KFRA 2AQ8A 1CBUA 1Y3IA 4G1FA 4GP6A 4E6PA 2ZIEA 3A7DA 5H68A 1NW6A 5IF9A 2EKQA 3GJ0A 1R9JA 4GEKA 4O8BA 1SO8A 2H8RA 3BL8A 2B9VA 1V8OA 3WB0A 4P80A 1TTHA 5EHQA 3RE1A 4BXOB 2CJXA 3ZTYA 2PXVA 1XU4A 3SHTA 1JPJA 3GLGE 2QKYA 3FFTA 4P34A 4R2LA 1G7RA 4P3YA 5ALWA 3PQ5A 2KEKA 4EJ6A 4EQ6A 3I30X 1Q12A 4NBLA 2XXAA 4XH9B 1T9HA 1N6HA 4DMGA 4CXMA 3DMYA 3GUHA 3OPYI 1RTTA 3HLTA 4L74A 1KY2A 4TYMA 3R1IA 3QFRA 4D4MA 4NU0A 4TT8A 1BS2A 3NOOA 5FBQB 1EE1A 2GUWA 2PSFA 3MWLA 5I7FA 3Q0TA 4TLEA 1QVZA 3WNVA 3NHAA 3WDMA 4OSOA 3CPHA 2V3VA 3QU9A 4EZEA 4LXUA 4YR9A 3CISA 2XWPA 1P18A 3KBBA 5ICMA 1A7KA 3ORRA 1F8XA 3HJGA 5DLDA 3HKEB 1C7ZA 3ZUPA 4LBWA 2BGIA 2PSEA 2QK4A 1JNXX 3HL0A 3OQIA 1R5OA 3NMUF 5FF9A 3K8ZA 4ZRNA 1YHZA 4Y9UA 4CJXA 5H3CA 4HWGA 5DGTA 1RKVA 2FUCA 3S5JA 3L40A 4JELA 4WZAA 3JQAD 4RDIA 2JGEA 4LHWA 4EJ0A 2VZ0A 4J2HA 4COOA 2I6XA 3K0CA 4M99A 1CZNA 2DLNA 3LWNA 1MB2A 1GKYA 2C7BA 3DE0X 3P97A 4PG5A 1HT0A 3ZY4A 2RSLA 2ZJYA 1EM8A 2E85A 2FFJA 2CDRA 2J9RA 3C8MA 3I1YA 4NBUA 3RSCA 2Z9CA 3TTYA 3PFHA 4BGIA 4QT4A 2YHAA 2WM8A 2QOEA 3G82C 4WNCA 1WCXA 2FX2A 1WHTB 1L4UA 3EMVA 3DDSA 3GNLA 2G7ZA 3KOUA 2OK7A 2ONCA 4GZ5A 1PQYA 3GRPA 2YVUA 1IBMB 3CLUD 5FPYA 3NP9A 4J07A 4TXNA 2ZDGA 4RHCA 1S2OA 5KSOA 1RACA 2RK6A 1G5TA 5MN6A 3H19A 1M10A 5JPDA 2LIVA 5H16A 3ZDQA 2Q2QA 1FTYA 2ACKA 5A5VA 4UFPA 4BEWA 3QYFA 4PXAA 3TSYA 2DJIA 4M21A 1EA5A 3BTUA 1EFVA 4TTIA 1V9SA 3DBLB 4Q19A 1UQUA 4PE5B 3S70A 1DUIA 2G88A 4L8VA 1TD1A 4KR2A 1L5HB 4RTOA 3L84A 2Q2WA 1VRVA 2PUTA 1O4VA 3DDUA 3AY7A 1KI6A 3MB5A 1ZD9A 4J0FA 5CA1A 3CF4A 4MYTA 4B3GA 1OC4A 4MYRA 5FWYA 4RS4A 4HFMA 4UTZA 3MCVA 5AO9A 1F38A 1A1SA 3ESBA 4YXFA 4Q7LA 4EGSA 5G4KA 3W5DA 2RGYA 2HR1A 3NHBA 5IXJA 1QH0A 5I7HA 4BRWA 2NMVA 3L6BA 4NS1A 4KXWA 4NJMB 3BWXA 4JJIA 3ICPA 4PC2A 4ED9A 1VCIA 4ZGWA 2BEKA 2V6BA 1IXRC 2DBYA 5BR8B 2AMJA 3PHJA 5JFOA 1PLLA 1JV2B 3F6SA 1DQZA 4JC5A 3VV2A 3GHHA 5BW6B 4B7CA 3AF6A 1FU8A 4XB1A 1OBHA 4Q9LA 3UUEA 5B37A 2VZEA 5ALOA 5KSZA 4K3UA 1R27A 4TKMA 1UFQA 3F3KA 3PHGA 3SFTA 4A1FA 3T5AA 2HK7A 1CJTC 2PXAA 3U1TA 1K7CA 3PC8C 5LM3A 2ZR9A 1Q0QA 2WE7A 4N5MA 3H5IA 3PVSA 4PCVA 3EMKA 1PVOA 2R65A 4K5QA 4V2UA 2WKRA 1ZEMA 1FNCA 1ZJJA 1BNCA 1QSGA 2KE5A 3GCGA 1VKNA 1J24A 1NDUA 2FP4B 3QRWA 3DCYA 5EZ6B 4IVPA 1XTTA 4RZSA 3SK0A 3ZCRA 1PJTA 1TJ5A 1YR6A 2BI8A 2X2EA 4FMPA 1GHTA 4GOJA 4TYNA 2GLUA 2B0JA 5CDYA 1NW7A 3BH6A 3B1XA 3UMSA 2PZGA 2RONA 4KWEA 2ZJ7A 3W7BA 3ABZA 3LL4A 3OEEA 4A0GA 1NUSA 1OLUA 3GJ7A 2WWVD 3REGA 3VDRA 2GEJA 1NWCA 3H2SA 3UWKA 4EB3A 4EB8A 1WD7A 4JU8A 1CVLA 1Q14A 5EHXA 1IRXA 2P9HA 1E2GA 1AHHA 4TXHA 4DSUA 4AMVA 1LNZA 1PK9A 2VAMA 3A9ZA 2IE0A 1SUFA 1E7YA 2HUPA 3O92A 1T1SA 1YZGA 3MIZA 4LJAA 2B9EA 2OORC 1SBCA 4JIGA 3CVXA 3F5QA 4NC9A 1OI2A 1Y1QA 4NZPA 4Y2VA 4S1NA 4D79A 1FP4B 2GRLA 1GDDA 2XWBF 3DDHA 3A9CA 1EX6A 3IDQA 1M2EA 2EQBA 2ZRDA 4HAYA 1ZC4A 2D1YA 3ZLTA 1V4NA 2IZ5A 3AILA 3U3WA 4KIGA 2CE7A 4WBSA 5CTJA 2BGNA 3DULA 5JANA 4LVCA 1QTQA 2R11A 4KQ6A 1LC3A 1SCAA 4PG7A 3CTMA 2WD8A 1DRUA 1TAHA 1N2HA 2EP7A 2J46A 2KS6A 2IUEA 2OV1A 2B8JA 2PANA 3D6HA 4L28A 4CLHA 4KLZA 4NYMR 3QU2A 2A0FA 2QTMA 4KQEA 4A03A 4X20A 3QE2A 2C1XA 3MJEA 4YUYA 1QG4A 3MINB 5F3WB 2V5AA 2DHQA 3IJPA 1EAMA 5IWAB 1KARA 3L4KA 4JP2A 4CLEA 2VLIA 1WB6A 1OZFA 3DW1X 3EH2A 1BWQA 1TM2A 1W5AA 2YZMA 2Z98A 2YR0A 3BWCA 1E58A 4WJLA 3IVAA 4ZKDA 3D3WA 3HADA 2X0IA 4QLOA 4EJ2A 5I4CA 1LFAA 3F5MA 1IDN1 4QU5A 3BE6A 3AR2A 4MLDA 1UOEA 1OFVA 3EXEB 3AIMA 2HBQA 3WWEA 1Z4QA 4BVJA 4QHTA 1LK7A 4LRTB 2EJTA 2D5VA 1DEXA 4GX0A 1RDFA 1YB1A 2DSTA 5DVZA 1OB5A 3CO5A 3GLHE 1TEHA 5AVXA 3ZCVA 5EAIA 1CQJB 2WD7B 2B4KA 2H2FA 2I4OA 3ZBUA 3ZX5A 1OCTC 3EXFB 1D2GA 3EIOA 4DCOA 5K5EA 1EUQA 4OIMA 5CX1A 3B5IA 3KAJA 2JVIA 3GEDA 1TEXA 2Q3BA 4HAUA 2ECPA 4ZU1X 1Z2AA 3Q0IA 3NBKA 1MW9X 4Y18A 1H2FA 4KJXA 5CM8B 2P40A 4RDCA 1ORIA 5IN4A 1HBJA 1W5EA 2GZUA 4MB0A 2FYTA 5HX7A 2PUFA 4I3FA 1NQVA 3U5TA 3ZH2A 1LRJA 3Q12A 2FE1A 4ZTZB 2FWAA 1YDMA 4JP5A 2C9CA 5DGDA 3PQ3A 5C7LO 4UFOA 4K03A 3NH9A 1Y8AA 4NF2A 1K86A 5C53B 5JNUA 1GPLA 2ZSKA 4Q6BA 1JEOA 3WQQA 2I87A 5DHUA 1XGKA 1LJ8A 3K0KA 1TM7E 5JS1A 4AP9A 2Z2ZA 4PIMA 2EWTA 3OEED 2GCGA 2Q27A 1SXIA 2JGKA 4WN9B 3ZGNA 2RBGA 4LTNA 4R1SA 5IFKA 2WJIA 1K1EA 2F1IA 1O0SA 3CKKA 1BWRA 2I4IA 4ZP1A 3PTZA 2AQIA 4G07A 4C0KA 4KO4S 4HS9A 5FUBA 5KHAA 4C78A 1Y9ZA 3AR8A 2J5KA 3W4IA 2HJWA 4I4TA 1O8BA 1YZVA 3E5MA 1CC1S 3D7NA 4JITA 4BAUA 4C9BA 1OGJA 4R5HA 3W5BA 2ZRCA 1TYAE 3IDFA 5K3DA 4G0VA 4D4JA 1D04A 1G8PA 1MGOA 4DLUA 2GVDC 3RS8A 3BD6A 4XFJA 2E3JA 3R7LA 2A1UB 4ZDIA 1CYDA 1VJ0A 3R5JA 4I50B 3BAFA 3L4SO 1ZLXA 2XD4A 4PX2A 1WPXA 1RXCA 3CLHA 4YAUA 4L9AA 5CB0A 1Q7RA 4HB4A 4PXSA 1GGKA 5BWOA 1WW3A 1G20B 4OMUA 4X92A 2IWRA 1O3YA 2XQVA 3V55A 3RK1A 1WZUA 2AD5A 4HHEA 1AHPA 1HE4A 4Y2GA 1ONNA 3CX8A 4AJEA 4P5DA 1U2GC 1T6ZA 1DAEA 1CR6A 3DQPA 1H2ZA 3FKJA 3HZHA 1Q6ZA 2FXVA 3QHAA 5HIAA 2FQ1A 3U31A 1EXWA 2OA0A 1HYHA 4IGEA 4OK3A 3VVCA 1MN6A 3WLMA 1A2QA 4DSZA 4KH1A 2QIOA 1F4LA 3VO1A 1VG1A 2JG3A 1B0NA 1GIAA 2D3WA 2Q62A 4EHFA 4TLLB 5JNSA 3KLMX 1J8QA 3NU1A 5EZQA 2ZETA 5LMCA 3JPYA 3SJZA 2C58A 1T8TA 5ALMA 4WFKA 1QGYA 4WDRA 5JD3A 1PDVA 1ZKDA 3R09A 1THMA 4J9VA 1BOFA 3M1AA 4M9UA 2XCOA 4UC0A 1BCRB 1KL7A 2DTDA 4QASA 2ZUEA 4P53A 1IEVA 1HMPA 4YDHB 2M98A 4A0SA 2NPIA 1OXMA 3V4VB 3I92A 4FFBB 1EP1B 2A4MA 4IDAA 5LU9A 2BR5A 3GJ3A 1Y8QB 1HZZC 5FJIA 3TOSA 4CCAA 1W49A 2WWRA 1Z6GA 4C3UA 4DPMA 1WE2A 2REQA 3AM1A 1KVUA 4UAGA 4WY2A 2P5SA 1GQOA 3C74A 4F1WA 3QEJA 2XNDA 1VPWA 1TU3A 1AF4A 3ZOZA 4X41A 1CY2A 3SMQA 4WINA 3V2HA 3BA1A 3JASA 2RARA 1ZNZA 3QEBZ 4QUAA 1XDWA 2QAGB 1XZ8A 1TF2A 1JB1A 4LF8B 2WJ6A 2XKJE 2ORYA 2BOVA 3RRYA 3N8HA 3ZW7A 1BDJA 4ZJPA 3JD0A 2R1TA 1WMSA 3TX6A 5JQGB 1P2BA 4LI3X 3R9XB 1SHKA 4WA7A 5JYDA 1AGYA 1DQSA 1JQLB 3QE9Y 1G18A 4FGKA 1GU0A 1FTQA 4HFJA 2BMJA 3EDCA 1POWA 1SGWA 3UH0A 1KIMA 1QHHA 2Q5OA 2OR3A 4RJJA 2IOFK 4I46A 5L45A 4PO8A 5CHEA 1SUSA 4ND8A 5DBHX 2VSNA 4FFSA 1EJ0A 4I4LA 3AIKA 4LECA 2FHSA 2BSXA 2CHVA 3ISJA 1WXFA 1J0XO 1NJSA 4JI2B 4UVEA 1KF0A 3FUXA 3RWOA 1U8YA 1XRRA 4OFBA 3DL4A 2V7GA 3TX2A 1AGRA 2GAFA 2QUZA 2RB5A 4BZQA 3UCXA 1R66A 4WERA 3ZCSA 5JNLA 4BFWA 1JHAA 3QZUA 3PEYA 4RPLA 5EXEA 1OKKA 3KCQA 4KTVE 2OHHA 5KB3A 3HYCA 4AYXA 3V4SA 1JAYA 4FQ5A 1EHIA 4DV2B 3MYRA 2Q3MA 1NQWA 4BNUA 1DEOA 1KS9A 2O7NA 4U7TB 4YACA 5C3UA 3DVSX 5L3QA 4O2LA 4MR9B 4AUNA 2WWTA 2F3RA 6ABPA 1CUGA 4CETA 3DLCA 3OLVA 3B52X 5H0IA 1J20A 4CUZA 3WMGA 3IVPA 1K6IA 1NIJA 1U4SA 2EW2A 5TVKA 4QJ3A 3K9FC 2ZB4A 3IS3A 4JLAA 4DB2A 1Z4IA 4F5YA 5J47A 1XQ1A 5FPSA 3ABSB 2BDEA 2J3IA 2DPHA 3IP7A 3JPWA 4CMIA 2GHRA 1Z0KA 3EH1A 4IZHA 5FWNA 4I4TF 7YASA 3GXBA 3V7YA 2XYQA 1XLTC 1RQXA 1EEXB 1I1HA 1EFPA 1F4VA 3T8YA 2VAVA 4OB6A 3B8HA 3U7GA 1O4XA 1I9CA 1AM4D 2HADA 4H7KA 3T7SA 5D3MA 2ZRKA 2JF0A 2XVAA 2BFWA 1YZFA 1KDRA 3GYGA 4R0NA 4LJRA 4A36A 3ZK7A 3W6OA 1RPEL 2XMQA 4OFZA 5LU8A 4KZPA 4RK6A 2Q5IA 5FPTA 3VC1A 4BN0A 1V39A 1X15A 4Q3CA 3CWQA 4YP0A 4BLOA 2O2GA 3ONFA 4HPJB 2FWPA 4MRPA 1K8ZB 1E0SA 2EWVA 3L4BA 3MMZA 5HM6A 2V9CA 2X22A 4YNBA 1TRHA 2BFDB 1NVVQ 4NFYA 4KE9A 5JARA 5M04A 4TWIA 3BCSA 1ISJA 3VXKA 1KFEB 4JYZA 2CVOA 3DB1A 2XNDD 1AUVA 3OM9A 1RE1A 3PFBA 4LDAA 1OV6A 1KERA 2O3QA 4PWYA 2QTHA 3VR6A 5B57C 1SCQA 2AF3C 4XSGA 2XDYA 1W88B 3HYLA 3ELDA 4ZQIA 3D4IA 5JBIA 4JI0B 4NG4A 1GPAA 4EKEA 1V16A 3GLRA 4IX1A 5D6NA 5JAZA 4ARCA 1H1DA 2DU8A 1NSTA 3C3MA 3ZZTA 1EHCA 5HRCA 3EA5A 3AWDA 2WIUB 4P54A 5A5FA 1WHTA 3AB7A 2GN2A 3HSYA 2Z4SA 4PYRA 2VHWA 2HL6A 2PRYA 3FYUA 4YH1A 1T5TA 4K28A 1T2AA 4YP1A 3T9BA 4X85A 4FCTA 3ZE6A 1MJHA 3AL2A 2BNMA 4S1TA 1MH9A 2PCLA 1PF7E 2ZI5A 3PHLA 4HTAA 4I55A 3I9FA 5K3FA 3D64A 1NXTA 1H0HA 3I73A 3H5LA 1XROA 4QBFA 3DZKA 3R3ZA 1AC5A 4LOKA 4NYJR 3V1YA 3KKLA 2PPXA 2WP8J 3OJEA 2NZXA 4TL6A 3F52A 4TKLA 1NP3A 1RWWA 4XX0B 1AK1A 2FPGA 3CSDA 3BRQA 3K72B 1OKKD 1YBHA 2X8AA 2V6GA 3KX2A 3LYAA 1A4IA 3FYHA 3HH8A 3HGQA 3C3DA 5DGIA 3P9SA 5JJIA 3CUYA 1G9TA 1UT6A 3EF3A 4UZFA 4IDNA 4OJNA 5FTJA 2WJGA 3UAOA 1QKKA 1YT5A 4OMCA 4BU1A 2QMUA 4D7AA 2OGSA 4TMXA 2XUPA 2VQ3A 2E37A 5EJ2A 1HLFA 3H11B 4F72A 4Y2XA 3T15A 1N6KA 4V38A 3E9CA 5GY7A 4F4CA 1YS1X 3NH6A 2PGXA 2JJYA 3DAHA 3KB6A 2PKWA 3QVMA 5HKBA 4BFSA 1OBOA 3EX7C 3MELA 4GE3A 3GQBA 3NPAA 1VJGA 4G5OA 5LBTA 5IT0A 3WKAA 3N0VA 2JGAA 3WYAA 1I2DA 4IM7A 4DV6B 2DBRA 1OQAA 2M32A 2PQ6A 2VYVA 1UMKA 2EZUA 2PGOA 2EARA 4IDDA 5MN5A 1HM5A 1YS6A 3OY2A 4FZ5A 4TKUB 4OLJA 4WK6A 2D0IA 3NTQA 3RKUA 4IQ0A 1GAQA 1K63A 4ZIRA 3UAXA 4GD3Q 3NXHA 3JVEA 3RTCA 1MA0A 2QP4A 3D6MA 4IQGA 1G8GA 2DWQA 4C3VA 5BW8A 3FOWA 4OJQA 2UUBB 3QENA 3QOFA 2YHBA 3GUYA 1OZ0A 2J4CA 1XU7A 2HC9A 2OD2A 3PBKA 5LDHA 4CEHB 2D54A 3IEUA 2C5GA 2CD9A 3EXG2 4JJZA 3B3AA 2GN6A 4O1HA 2PUCA 1UJCA 3DWEX 1FMLA 1ZZ9A 4ZT6A 1SA0B 5HOEA 5HF8A 2HCSA 2UZ0A 1O94C 3AUUA 4C21A 3F1LA 1RFLA 4ZO6A 5KSYA 1C9YA 3OPQA 4TS1A 4M37A 1CD5A 5KVCA 3EBOA 4DHEA 2A9OA 4ER5A 2BFNA