2BNNA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords EPOXIDASE
total genus 52
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnnA02
1L3JA 4IEWA 1UIJA 4LULA 3S8QA 2PE5A 1QQAA 2VECA 1ZZ7A 3LAGA 4BHPA 1EY2A 3GN5B 1SFNA 4AXOA 1VP6A 5LRRA 2AXUA 2GZUA 1BDHA 2PUBA 4XF0A 2D5FA 4HVOA 4N9IA 4N9HA 2O8QA 4F8DA 1HF0A 4O9EA 4Q0UA 3KGZA 5JR7B 1UCXA 3OQMA 2PHDA 3DL3A 2QVSB 3SCGA 3PXPA 2MQKA 4BYYA 2BNOA 3KSCA 3ST7A 4QX5A 4YNIA 1QPZA 3DN7A 3IDBB 3NSTA 5FQ0B 4MV2A 3RYRA 4X4CA 4EWDA 2XL7A 2BJCA 1WIZA 2IC1A 3E5QA 2OYZA 5I0SA 4CYDA 5JSPA 1EYBA 1J59A 2BNMA 1QXJA 3H7JA 3BU7A 4KU8A 2IVGA 4JTNA 4YYOA 4HN1A 4I01A 4Q0VA 2XCJA 4HBNA 5KHJA 1NYWA 5KHIA 4QXKA 3OTFA 3BD1A 1CAUA 1R69A 3H9AA 2KEJA 4AQ6A 1JFSA 2B5HA 3D1NI 2LYSA 1NERA 2CV6A 5J3UA 2OA2A 4HVRA 4META 1NEQA 1OCTC 1V70A 1YFXA 1J1LA 1Q43A 4IEVA 5EFUA 5FQ0A 4PJYA 2D5VA 1UD1A 2PPXA 1YLLA 3MDPA 1I6XA 4PIXA 2L8NA 3L1PA 4FAHA 4Z5CA 2O4AA 2ETEA 2WIUB 3QF3A 2IV1A 4Z5DA 3E6BA 4XF9A 1RZRD 3S7IA 3HIFA 2PUAA 1ZAYA 2R1JL 1GQHA 3JXDL 1CAUB 3U11A 4MGYE 4I2OA 3S0MA 2XLAA 3NL1A 2XHKA 4O9GA 4FT8A 4LA3A 2HKXA 2MPFA 2PUDA 4ZU7A 3HT2A 4X6RB 1JFTA 1CX4A 5J48A 4KWJA 4WZCA 4JCXA 1YHFA 1YWKA 2BGCA 1CAWA 3ELNA 4ORFA 5E1RA 3CECA 1IPKA 4IESA 1JWLA 5BXXA 2OPKA 1WETA 3OGJA 4GQMA 3O14A 3G5GA 2OR1L 3CLPA 2GZWA 4YBAA 1HW5A 4EROA 1X2LA 1ZZ8A 1ZZBA 4X4BA 4QGLA 4YSFA 2QJVA 1CAVB 2LYPA 2LYKA 2IVBA 1POUA 1ZX5A 2F4PA 1SEFA 1VJ2A 3UKNA 4IERA 2OFYA 3KCCA 1ZZ6A 2KPJA 3UKTA 5JAXA 4ONUA 3BS3A 5CU1A 4XFHA 1GQGA 4JCYA 2QDRA 3H1YA 1G6NA 1I5ZA 3KZ3A 2XKPA 3M70A 1QP4A 2PUFA 2PAKA 1VR3A 4Y42A 4LUKA 2OZ6A 5FLJA 3USSA 1IPJA 1EFAA 2D5HA 2XSDC 4KL1A 3FMYA 3EQEA 4Q29A 3ZHIA 2UYAA 1YFWA 4H7LA 4I0BA 2PTMA 1ZUGA 4Z58A 2LYRA 3CF6E 5BV6A 1X7NA 1CQTA 2V09A 1ZRRA 2PA7A 2PUEA 5I0RA 2PHLA 4HZFA 5JCTA 2XL9A 4Q0QA 1FT9A 3LA2A 1RUNA 5KBFA 2AXZA 3H1MA 4WBBA 1UW8A 3LA7A 3MZHA 3GN5A 5JSRA 3FYAA 1J3RA 1YFUA 4R8HA 5AVPA 1O7FA 4YRDA 1Y9QA 4Q0SA 2Q4SA 3FE5A 1H1IA 3SCFA 1QY4A 1ZREA 3FFQA 1ZZCA 5I0TA 3CL1A 3NKTA 4XFAA 1B0NA 2H8RA 2FQPA 4R52A 3F6WA 3JXBC 1E3OC 2R63A 1YUDA 3N4MA 1OFNA 4XFGA 5LRSA 1O3SA 4QM8A 1J3PA 3OCPA 3MYXA 2CSFA 4Z5HA 1LKNA 4HSJA 1WH8A 4Z82A 3OMTA 2EBYA 4XETA 1J3QA 2WFPA 4X4FA 5FDBA 1FXZA 3BPZA 4XFBA 4I6RA 2IU7A 3R6SA 2L49A 3EUSA 3FZ3A 3QACA 2VQAA 3SMHA 3B7HA 4F7ZA 4JTOA 1LRHA 1VPWA 2CAVA 1RZSA 3EHKA 4KU7A 5KHGA 3EJKA 3RZZA 3D0SA 3LA3A 2PAMA 1ZNPA 2PQQA 2O38A 2B5AA 2ZKLA 3BCWA 1LMB3 3IWZA 2IVQA 1X8EA 1RL3A 2ICTA 2Y0OA 4XF3A 4J1XA 4MGKE 4D7TA 1PNRA 4FBFA 2KZ8A 4HVQA 4MH0E 4QM9A 2IXCA 1WA4A 2PUCA 4AVAA 2Q1ZB 4UXAA 1UIKA 3I59A 3MPBA 1UXDA 4HSLA 4AVCA 2Q30A 4PIYA 2GU9A 1NXMA 1X57A 1O4XA 1QP7A 2LYLA 3IBMA 1QQBA 2GC2A 3VK0A 1QXRA 4E2QA 2LYQA 1UTXA 3ACLA 3JXCL 5KHKA 3PNAA 4GHJA 3CEWA 2PIJA 3WW1A 2O49A 4AVBA 2IXJA 2ATFA 3E6DA 3CLCA 3UKVA 1Y7YA 4L2NA 5I93A 4MX3A 1X8MA 5I0UA 2H6CA 1U12A 2VPVA 4I6TA 2H6BA 4JQDA 3NVCA 3LWCA 4X4IA 2A6CA 3LZZA 1PM7A 5I91A 3H8UA 3IIAA 1XE7A 3LISA 3DKWA 4F8AA 3WW3A 2UYBA 4OFGA 1OMIA 1Q3EA 2GAUA 1CGPA 1RUOA 2K0GA 4TLFA 5KHHA 2EWTA 2IXHA 5FPXA 1O3QA 3OF1A 1GT0C 3LOIA 2EVXA 4PU3C 1AU7A 4YG1A 1ZZ9A 1O5LA 1R63A 3KJXA 5I8YA 2GC0A 3SXWA 1LCCA 3S7EA 2DCTA 4EWAA 1DGRA 4QMAA 4I0AA 4LUMA 2ZCWA 4EV0A 5A7LA 1LB2A 5FLHA 4J1WA 4XF4A 3OP9A 1NE4A 2GRLA 4PU8A 3H1WA 1J58A 2UY9A 4LA2A 5FLIA 3LFPA 1DZTA 3I54A 3I7DA 2PAEA 4IEPA 2B9UA 3QOPA 2IXIA 2KEKA 3OQOA 4PIZA 4OLLA 3OD0A 3MLFA 2I45A 3PLQA 2EF8A 4FAGA 3FHIB 5BY5A 1UXCA 5C6CA 3RNSA 1RPEL 1FI2A 3ETQA 3TNQA 5BUVA 2XJ3A 4L11A 4XFIA 3TRBA 1DW9A 3FX3A 3R1FA 4PU7A 4A2UA 1WH6A 2FMYA 3FYMA 2CROA 4IVZA 3I59B 1SQ4A 2B8MA 4IEQA 2PUGA 3IDCB 4QGNA 3CROL 4ZU4A 3F52A 2Q0AA 3H5TA 1X82A 2XLFA 3H3UA 4KWLA 4X4DA 3M3IA 1WLTA 2AW6A 3FJSA 4X4EA 1EP0A 4IEUA 5J7MA 1RIOA 2EA7A 4MGZE 1ADRA 2E9QA 3U10A 1DGWA 3FWEA 3E5XA 4Z59A 4FN3A 5K98B 4HMZA 4IETA 4BIFA 1OSLA 3H3ZA 4Z07A 3RYPA 3HQXA 4X4GA 4IEZA 1XWRA 3HT1A 4I3PA 4WVZA 3BB6A 2QCSB 3BDNA 1TQ5A 2CAUA 5CVRA 5JSOA 1Y3TA 1LCDA 2AUWA 2D93A 2GRMA 2Z2SB 1ZRDA 3OQNA 3GYDA 3QWGA 4X4HA 5HI0A 4MCXA 2XI8A 1JUHA 4UBHA 3RYKA 3E6CC 3E5UA 4P9GA 4E2GA 4DINB 4I8TA 1LQCA 1QWRA 2XKOA 1ZS4A 5F1RA 1LR5A 2N7GA 4HN0A 4LTAA 2XIUA 3RPQA 4JV4A 3G7DA 1ZPQA 4MUVA 3D82A 1YFYA 2GC1A 4IA8A 4UBGA 2GC3A 4XFFA 2JVLA 1PRAA 3ROUA 2PYTA 2HJIA 3NW4A 2MHFA 4LEJA 4XEZA 4YARA 3E97A 1PMIA 4IWRA 1CAXB 4IEYA 2BNNA 1CAWB 3SCHA 2LCVA 5I8SA 5LEKA 2XLGA 4I6UA 3PVBB 2ET7A 4YG7B 4MGIE 1WGPA 3VHRA 1QP0A 4I02A 1JH9A 3DV8A 5LEJA 3QYXA 5CADA 1CAXA 2AXVA 3L2HA 4Q0PA 1CAVA 3SHRA 4O8BA 4KWKA 1ZVVA 3QQ6A 3ZKCA 2WC2A 4IEOA 4RD7A 2D40A 2IXKA 3KGLA 1IC8A 1PERL 3ES4A 5I8TA 5T3NA 3GBFA 2Z69A 4MCTA 1O4TA 1OI6A 2KEIA 1XRUA 2GH2A 2H0VA 4XF1A 1O3TA 3HZIB 1EPZA 4OB4A 1XE8A 2WUSR 5K8SA 5FPZA 1DWKA 1LLIA 2BEOA 1SQ8A 1PRUA 2IUOA 1O3RA 2EAAA 3EO6A 4AQ2A 3ZDSA 3EBRA 2PFWA 1RC6A 1H1MA 4K8FA 2HINA 3CO2A 5EZWA 4JVAA 1ZVFA 3U0ZA 3JZVA 5BPXA 1NZCA 2MEZA 1NE6A 1UPIA 2ICPA 3B02A 2IXLA 3CJXA 3IVPA 3WW4A 2QNKA 1O5UA 4BH9A 2C0ZA 2O1QA 4B29A 2HSGA 3UFDA 1RZRA 3KXAA 4GULA 2JCGA 1YSEA 4E2SA 5C8WA 3DNVB 1Q5OA 1CJGA 1PRVA 1RGSA 3RDIA 4QGMA 5E16A 2FJRA 2KXLA 2P17A 4YG4A 4D7SA 4I09A 2XGXA 3TNPB 2ET1A 4HLTA 2MNGA 3C3VA 3O9XA 1OD5A 4MZUA 3ES1A 1L1MA 3F51A 1BDIA 2BYVE 2UY8A 4XFCA 4EWEA 4X6QB 3WW2A 4ZU5A 4FBIA 4LLOA 3BALA 1RTVA 1S7EA 5FCCA 2K9ZA 2LYJA 4PU4C 1DZRA 2OZJA 3D0JA 3U3WA 4NVPA 3H7YA 1ZRCA 2CGPA 3ZHMA 3KMHA 4IEXA 3H50A 4NDWA 1ZRFA 2AWIA 5D1IA 3NJZA
chains in the Genus database with same CATH superfamily
1ZBA2 4QHZA 1UMZA 5GZGA 2BV4A 5JOZA 2NM1A 3VDBA 3WF0A 2VECA 1QQAA 2XG3A 4PQ9A 2P3KA 5GLWA 2VVFA 4CZSA 2DUQA 4L92A 3GN5B 1CZSA 1AVBA 2YC0A 4FPLA 2W1UA 2ARBA 4N8MA 1BJQA 3W5NA 3KHCA 3K48A 3VZJA 4HVOA 5FXZA 2TNFA 3CIHA 1W39A 1NT0A 2LRPA 1JI6A 1UCXA 3LQXA 2CHHA 3OQMA 5FZAA 4AI1A 3PXPA 2MQKA 1RUH3 2GN3A 5FP8A 4ES8A 4RQPC 3CKHA 3ST7A 5B2GB 3AXDA 1QPZA 4W65A 4WVWA 5JMCA 3JD72 3NSTA 5FQ0B 2HWF3 2QZ3A 2R49A 3BTYA 5C5UA 5CKQA 1WIZA 2RDSA 2OYZA 4N7UA 4CYDA 4YM0A 2IZWA 1ASJ3 4HG6B 1ODNA 1J59A 1W6QB 2HYXA 2ZGOA 3D3AA 1ZA4A 1OHFA 2XCJA 3M8LA 2YPDA 3ACFA 4JGZC 5FZBA 5F3IA 1NYWA 2UWCA 4AI3A 4CCEA 2CTVA 3T09A 2R041 4QXKA 2FZ1A 3OTFA 4LHKA 2E7QA 4OMCA 1CAUA 1R69A 3HAGA 4FO9A 1JFSA 1QOTA 1UKRA 2B5HA 2LYSA 2VO5A 4NRQA 3OBAA 3WDVA 3ZYGA 2AENA 1NA1A 2BP6A 5CFDC 2ZACA 3DPRB 1ZM1A 2QQLA 1YFXA 4EN6B 5IVJA 4JHTA 1Q43A 4IEVA 1LNSA 4PJYA 2JB4A 1GWKA 1WW5A 4BU2A 2BVVA 1ULGA 4GWMA 3WNPA 2D5VA 1YLLA 3TELA 3BYWA 2JICA 1I6XA 1U0AA 3L1PA 2R1BA 3MO4A 4AG4A 1GQPA 1OQDA 3O0WA 1ULEA 1D0GA 2LALA 3VBUA 5LBEA 1GP4A 3BOPA 4N53A 2DU1A 2R30A 4Y5Z0 3PJYA 1RZRD 4IE4A 4LIUA 4CEWC 1SLBA 2PUAA 3VBOC 5L19A 2R1JL 1XSQA 1XC6A 3JXDL 3DXUA 4RQPB 4DEQA 1GNHA 2ZGKA 4XUPA 4CCJA 2R16A 5F9TA 3AZYA 4O9GA 1YI7A 1RUC1 3GBGA 3VBRA 1UU6A 4K6BA 2HKXA 2VMIA 2PUDA 2JG8C 4QKDA 4Y1ZA 4YPJA 1LENA 1JHNA 1XQNA 3GALA 2X5IC 5FTTC 2DCYA 3HR9A 3AMPA 3VDAA 5KR7A 2CGNA 4BA6A 5FZ1A 1VBB2 3IN9A 4IESA 4Y22A 4ER6A 1W2TA 3ABZA 3OGJA 5C3OA 1MS1A 2OQ6A 1LOFC 5C4WA 4XDQA 5LBFA 3P3PA 3CLPA 2X05A 3VD3A 3WZ1A 5KXBA 4QU2A 4YBAA 1HW5A 4MXWB 4ER7A 1ZZBA 4P08A 4YSFA 4NHXA 4Q4Y3 4QPWA 1C8NA 3VZOA 4NWWA 3ME5A 2SBAA 2YYOA 1RB8G 1JYIA 3T2PA 3QCWA 1KQRA 4RN5A 4XQWA 3MUY1 3AXEA 4CPBA 3S30A 3AC0A 2OFYA 1FYUA 4C90A 5KC6A 1YEWA 4IV3C 1ND2C 2KPJA 4FFGA 1YJLA 3BS3A 1QJU3 1X50A 4HK8A 4XILA 1EAH1 5IATA 4XFHA 5FZCA 1VRH2 4WVVA 4JCYA 3QH7A 3RQ0A 4AF9A 5F32A 1G6NA 2OKXA 2FD8A 2PXTA 3HNYM 4MHRA 4NPMA 3V0BB 5T5JA 1IPJA 3A9ZA 4AQSA 2D5HA 4IE6A 1VMFA 4KL1A 1HRI1 3FMYA 4H2AA 4URTA 3EQEA 3MIEA 3RWNA 5C7GA 3ZHIA 1W06A 3LEKA 1RUG3 2LYRA 2CWMA 3CF6E 2PHFA 2V09A 3TBDA 3T0DA 1G9FA 1WD3A 1ZRRA 3ZKYA 1XB9A 5I0RA 2Y6HA 4HZFA 5GAHi 3J7MA 5JCTA 4G3YC 1RUF2 2YBKA 3OWQA 3AP6A 2BDRA 1W8NA 3KHBA 3U14A 1RUNA 5KBFA 2ORZA 3H1MA 1SLLA 1UW8A 4BM8A 3MZHA 1CPMA 1OLRA 3UETA 4DFSA 1OF3A 4OVEA 5G04L 1YFUA 1K5JA 1FNYA 1N3QA 4L0PA 2B4KA 1U5ZA 1H8TB 4YRDA 3OD4A 4DMIA 1F8VA 1Y9QA 4GWIA 3VL9A 3K46A 4AI2A 1OUXA 2RDNA 4Q1RA 5IAVA 4AVTA 3ZR6A 5CFDB 2Q1FA 3FFQA 2HWE1 2HYKA 2EICA 4IUGA 1FAYA 3NNLA 5A6YA 5FPUA 2VMDA 1W8FA 1H1AA 4UFKA 3WR0A 5FY8A 4IL7A 3PJQA 2R63A 1YUDA 1VMJA 2YY1A 1O3SA 5LRSA 4EQVA 3LFMA 1BEV2 2J7UA 1Q8PA 3ZPYA 4KGQA 4N43C 2XXPA 2VNRA 2WNUC 3RS6A 1NXD1 1FXZA 3BPZA 4I6RA 2XXAA 3VHNA 1JZ3A 3WOGA 1R083 1LGBA 2OS2A 3M4FA 3T2OA 3KV9A 3T0AA 3WNMA 4V1PA 1XNAA 1VPWA 1GOGA 1JTZX 3HJRA 4KU7A 5KHGA 1TVGA 1BZWA 3FHQA 3GUUA 1ZNPA 2O38A 3OGGA 3FFZA 2HWB3 2ZKLA 4XC9A 1LMB3 2IVQA 2ZAHA 3ON7A 1RL3A 2CSGA 3POBA 4A45A 2Y0OA 1UYZA 2ES3A 1KJLA 4XZUG 4D7TA 1ASJ2 1AYN3 5A32A 3N9PA 4O7XA 4Q4X3 2ZEZA 5LA9A 3DKQA 5FAXA 3SC7X 4AHZA 4TZDA 1W8OA 1HB4A 3ILRA 1J84A 1WA4A 1AJOA 1DULA 2CNAA 4UW4A 5F39A 5FREA 2ZGMA 5GLVA 4HSLA 2BWAA 3A4UA 3W5MA 2Q30A 2HWC3 1XNCA 1TZOA 1FATA 2V5YA 5FO7B 1RUD3 1AZDA 3ZYHA 4H3WA 3WG3A 5JXJA 1AR71 2F17A 3VK0A 1C3HA 1HB1A 1QXRA 1YXWA 1H8TC 2ZGSA 1UTXA 2CYFA 2NLRA 2C24A 3GNEA 1PIV1 2IXJA 1BCXA 3E6DA 2XVKA 3AJZA 4L2NA 2BW8A 1TNRA 1UOBA 2DVBA 5I0UA 5LATA 2DFBA 4QKBA 3SKVA 4YFZA 3O1RA 4I6TA 2P3IA 4HFSA 2PHWA 2BFUS 3OYWA 4XJZA 4X4IA 5A7NA 2F6BA 2YXSA 3LZZA 1PM7A 1Q56A 4YW5A 3ZFFC 3H8UA 4Y4RA 4QQLA 4DUXA 3AMQA 3DKWA 4OFGA 1OMIA 1Q3EA 3TB0A 3BIEA 1CGPA 2K0GA 5CFCA 2EWTA 4LBQB 5A6XA 1MZFA 2WFF2 3OF1A 1GT0C 2RMU3 4L8QA 1VBE1 1YIFA 3WCRA 3JBG1 2E31A 2O0OA 2VZVA 2W3JA 2W94A 4I0WB 4B7KA 1G9BA 2GC0A 1ND3A 1POV0 2XVLA 4HKOA 1VMHA 1DGRA 2QQNA 4QMAA 5FOJB 4LUMA 5IUQA 1LB2A 1GZWA 1REFA 5FLHA 2BGOA 2BERA 1QZXA 3N7LA 1AR63 1F35A 1NE4A 2YBSA 3H1WA 5B4XA 1REDA 1IG3A 1US3A 4LA2A 3LFPA 2ARCA 3I54A 3I7DA 1RMU3 2B9UA 4P9LA 4R4XA 1N1YA 3OEAA 5FY4A 1C5IA 3OD0A 4NE9A 1RUG2 2C1FA 3KD4A 3NJYA 5F3CA 3NV3A 1S0FA 4DRVA 3RGBA 2Y64A 2VW0A 4LK7A 2EF8A 5EV7A 5GLZA 5BY5A 1EUTA 1K45A 4RFRB 3FC0A 4QAWA 4AVSA 4CP9A 4KG0A 4BQ3A 2XJ3A 1A8DA 2FDKA 1Z0HA 4MHUA 2GH8A 2RJ2A 4RR3C 5K7PA 3FX3A 1KS4A 4A2UA 3POJA 5FPBA 4IVZA 5AC91 5LA0A 1VBC3 1PX4A 4K8RB 4AYUA 3TYJA 1R092 2VQ0A 4QXCA 3WF2A 2QBXA 3WY6A 4Y1VA 3H3UA 3H5TA 1VAMA 4M0HA 3G0TA 5FXWA 3VN4A 4YZ5A 5FBZA 2J1EA 1WLTA 3FJSA 4X4EA 1W2OA 4JZRA 1XNKA 1RIOA 4WM7B 4K20A 5DRYA 1PO22 2E9QA 3U10A 5FKBA 1AR83 5JVVA 3OGVA 3GZAA 1NCQB 4GJZA 1W3VA 3R4DB 3B5LB 4HMZA 4OI0A 4YLZA 4CDQB 3E1F1 4Z07A 5C4WB 1QEXA 3U4SA 2PXUA 4LHLA 1O59A 3HQXA 3UT0A 4X4GA 2DCKA 4PLOA 4GD4A 3MPPG 2VULA 5FUIA 4C8DA 3V0AB 4I3PA 1WCDJ 1NZIA 4Q4Y1 5CVRA 1ENXA 3PL0A 2ZGQA 4CDWC 2DF7A 2EALA 4COUA 4EJRA 2YGMA 1KRIA 2V72A 2LM3A 1MVEA 4CDUA 4Y20A 5FY1A 2EIDA 2GRMA 1PZ9A 4J25A 1AX2A 5A1LA 5HI0A 5KWRA 3P6BA 1ND3B 1SFYA 2ZEWA 4ZZ8A 2GNMA 3I2DA 3M3CA 1EAH2 3RYKA 3E6CC 4P9GA 2BRTA 4I8TA 1ZS4A 4KQ7A 1LR5A 3ZXDA 3PVEA 4M3CA 4HPKA 3OKZA 1MZ5A 1TE1B 3DXTA 2VAUA 3O5SA 4HANA 4OI2A 4RHV2 3RI8A 3WX5A 2W39A 1ENQA 4DQAA 3CJIA 4RGGA 2WYSA 3R4SA 4IA8A 4UBGA 4WVMA 5FUPA 3WP4A 5A3TA 2XBO3 5EXOA 2XUMA 3BKZA 1PRAA 5LK5A 1QJY3 2PYTA 1ZYBA 3FMGA 4V2WA 1T2XA 4XEZA 2XOMA 4SLIA 1DCSA 2Y33A 1LAJA 2BNNA 1CAWB 4YFWA 3LDRA 2WS91 2JD9A 2ZGRA 4U36A 4I6UA 3GXUA 2QDNA 4YZ2A 1OFSA 2E7TA 3N3HA 3PVBB 4M00A 5E8AA 3USUA 1QH7A 1QP0A 1CR7A 1JH9A 1UY4A 2A70A 1DGRN 1JN2P 3QYXA 3PVOA 4JDOA 4Y4YA 3WUCA 1UMIA 4IGOA 3VBOB 1MPXA 1NA1C 5FYIA 3F95A 5IK8A 2WC2A 3OOXA 4CDQC 2BFUL 3KVBA 2B42B 1NKGA 2PHXA 2P3JA 2XJVA 3FBYA 3VBRC 2WQ8A 1IC8A 4DB5A 1DGLA 1VBD2 3ES4A 5FZGA 3ZSJA 4CEWB 4ZY9A 2Z69A 3HNMA 4BPZA 3H42B 3VKMA 4Q4W2 1F5FA 5FMOL 4OHVA 1PK6C 4Q8KA 1RJ8A 5DAXA 2WT0A 3POIA 3HZIB 1EPZA 1QQP1 4GALA 3AYDA 4TTGA 2BU9A 2GNBA 3UJQA 4XCBA 5E6HA 2WKKA 2AREA 1Y9GA 1DBNA 1GU3A 4XPVA 2EAAA 3CJIC 3EO6A 3ZDSA 2VMCA 5EHDA 1RC6A 1K3IA 4CDXB 3OGRA 1H1MA 1AJKA 1W8TA 2RMU2 3DPRC 4EZ4A 1AR61 4JVAA 2WNVA 3PIGA 4LKDA 1TNFA 2R061 1B09A 3JZVA 5ERLA 3S5QA 2PXKA 3T1MA 2ZPXA 3W59A 1UPIA 2NMNA 1XNDA 3P3NA 1WW6A 2QNKA 1O5UA 1W8WA 2QE3A 4CXYA 4Q4V1 5LBBA 1W6PB 3ZSLA 3TEZA 4DE8A 2EIEA 3AM2A 1RZRA 4XUOA 1GFF2 1W04A 1Z78A 5C3QA 4LT5A 1XYOA 3WEZA 3CNAA 4F83A 4B7EA 4B8EA 5EP9A 2LUWA 1V9U2 3CZJA 1Q5OA 4N43A 3ZSMA 2MEV1 4UI9L 4UOJA 3RDIA 2C4XA 4QGMA 1WBFA 5HV0A 3BODA 1OQ1A 2KXLA 3QH6A 5F6LB 4S2GA 1XYNA 4KGGA 1AYM3 2VUDA 3GM8A 1ZBE2 4BJ0A 2VUAA 1MEC3 2R1DA 4UFLA 3GCXA 3MI8A 3MIGA 4AI0A 1PX3A 3ES1A 4MZUA 2RS12 1BDIA 3JXSA 1LOEA 3WNOA 2AH2A 3Q8AA 5FZ4A 4L9BA 2D3PA 1W3XA 4FBIA 4XUNA 2RS32 4HONA 2WA3A 1W0OA 5AFEA 4OULA 1NLSA 2Y60A 5FMBA 3FLRA 3WF1A 3ZKUA 1NQDA 4PU4C 3PU3A 5FR3A 1ZRCA 2NQYA 3VBHC 3U3WA 2F4LA 4CU6A 5J09A 1CJDA 3GHNA 2XH6A 4QU1A 1AYM2 1RUH2 4Y1XA 5D1IA 1AHSA 2YFZA 4IEWA 1A6CA 3TN92 5CFCB 1OH3A 2EXHA 1U5XA 1UIJA 2PE5A 3TEWA 4GKXA 4H14A 4N53C 1V9U3 3AP7A 3TEXA 2VZUA 2ADEA 4QB2A 3W21A 4BHPA 2ZABA 1XJAA 2QKDA 4COZA 5BNNB 3VBHB 1I1EA 4Q8LA 2J7MA 3AYCA 5FYZA 3OEBA 1E57A 1FMD2 4DO0A 4IQPA 4WVLA 2GZUA 2NZ9A 2E51A 2HLEA 5FKCA 3KF5A 3UESA 2D5FA 1JYVA 2RV9A 1YQCA 2O8QA 1HF0A 3F2ZA 5GZEA 4QB1A 5IYYA 1WMEA 3KGZA 3NAPA 4PHZA 5JR7B 3WT3A 2JENA 3AMMA 3DL3A 4OHWA 2QVSB 1VLNA 2X09A 3GGLA 4DIQA 2TBVA 5FZHA 4BYYA 4C0BA 3NV1A 1SLIA 3I3MA 2JDMA 1A78A 4QX5A 3P5BA 3DN7A 4GAZA 4LOSA 4MGSA 4UF0A 1QJFA 4X4CA 3J8F3 4EWDA 1PZ8A 2BJCA 4G9SB 1EV13 3I2FA 2FFHA 1IQDC 5JSPA 1IS4A 1RUG1 4RL7A 5FP4A 1AR92 1QXJA 4R9CA 5FZDA 3BU7A 3SKJE 4HN1A 1ZBE3 3CDZB 5H9RA 3SLIA 1PGL2 4YVSB 1UN1A 5KHIA 1S55A 1UQXA 2WL1A 3POGA 3NNJA 3NWKA 4UW3A 4HXCA 4C1WA 4NPRA 1OLMA 2VOWA 2CV6A 3VD9A 3JB4C 3NO8A 1O91A 1WMFA 1UO9A 4FXKB 4HVRA 3UL2A 3VBSA 1LOBA 4NOTA 5AFBA 2QQPA 1D4M3 2HWB2 1J1LA 5EFUA 2LLWA 1F31A 4JKLA 1DYPA 1S0GA 4ZXKA 2WBKA 2WZ8A 1PO11 4DE9A 2RHPA 2L8NA 1OOPC 4M01A 5L7OC 4Z5CA 5BNPC 1TME2 2D3RA 4CP2A 2JE8A 2VTXJ 1GP5A 3MEPA 2IV1A 5JOWA 1VBE3 2RE9A 1DFQA 2JD4A 1W6QA 2ZEYA 1GQHA 4BZ4A 4M4RA 2QQIA 1NX9A 3K3OA 2PXBA 4BMEA 4I2OA 3S0MA 2JDAA 2XLAA 1UAIA 3J7HA 1D4M2 2RS51 4JRAA 3V64A 4AI8A 2XXQA 1CX4A 4YVWC 5DDJ1 3ZYPA 1DP0A 2GP3A 3ELNA 4ORFA 4YW3A 4KMQA 1CAWA 4UWDA 4LO7A 3K4DA 1IPKA 5BXXA 1JWLA 1AXKA 4Q4V3 1WUVA 3WHTA 4GQMA 1HN0A 1W05A 5FO9B 5HV4A 5F5IA 5T50A 3LSEA 2OR1L 3I3BA 4RS5C 3RJRA 4M3CF 2B9VA 4FPFA 5JPNB 4FTSA 1YNAA 3ZXGA 3U07A 4E4HA 5DZFA 3RWKX 1W28A 4XJUA 1ZZ8A 1GNZA 4QGLA 4NO4A 2QJVA 3I4IA 4LIVA 1POV3 2LYKA 2EXJA 2ID4A 2WNUA 1DG6A 2XONA 2J1SA 2IVBA 1F2NA 1POV1 4D6RA 1YQ6A 1V6NA 5D8AB 4N53B 4HK9A 2WINB 3ZN6B 3ALQA 1CN1A 1O6UA 3D8CA 5A33A 2RR11 3KB5A 3N7MA 5CU1A 4BQ1A 3IDAA 5L7OA 4K7JA 3IPVB 4L97A 4IV1A 5FZ9A 3H1YA 4KWUA 2XKPA 3M70A 4NAOA 2PUFA 2PAKA 5CIRA 4Y42A 4LHSA 1PIV3 5DAVA 1A8MA 3C7EA 4LUKA 3USSA 5F7UA 5FY9A 4DXZA 5FBJA 2JEMA 1B35B 2HBUA 3THPA 1PGW2 3VBOA 2XSDC 4AEMA 1XOYA 5CA6A 5I0DA 4OUEA 4Q29A 5C3RA 4H7LA 3QBQA 4I0BA 4JAAA 1ZUGA 2A73B 2OQ7A 3DCQA 4Z58A 4CCNA 1UOJA 2PA7A 2PUEA 2Y8KA 1J83A 1UXXX 5IVCA 1DGWX 2J1UA 3MW4A 1GWMA 2ZZJA 1CESA 1QJEA 2ZGLA 1UPSA 1C8M1 4NIDA 1RUD2 1Y43B 2GMMA 4WBBA 2WN2A 3LA7A 3KVAA 4RS5A 4CP9B 4MOAA 4QB6A 4BQYA 2BUKA 4CRQA 1LOCA 1YI9A 1J3RA 2E6VA 1W2AX 2WT2A 1RINA 3LE0A 3T4HB 5AVPA 5DT2A 3WV6A 1BMV1 1W6PA 4MSVA 3AP5A 1H0BA 4Q0SA 1FOD2 1RUI3 1JODA 2Q4SA 4Q4X2 2JDHA 1SLAA 1AYN2 1T6BX 4O65A 1AX1A 1QY4A 2X5IA 3ZFGB 3ZMOA 5D8AC 4AFAA 2PQSA 4NHYA 3CL1A 2ZEXA 1W2NA 1AR62 4XFAA 4CDUC 2ZX4A 3ZXJA 4FCAA 4Q4W1 4HL0A 1B0NA 5SV8A 1RUJ1 2FQPA 1CIYA 3N35A 2RM22 4BWOA 1HRI3 1QOSA 2WSUA 4QXHA 1G7YA 1QNYA 3LGRA 2G1MA 1ULDA 4CCLA 1OFNA 1FPN1 3KV6A 4XFGA 3GCWA 3NRUA 5FZ6A 1RUD1 5T55A 4Y5TA 1LKNA 4HSJA 4QQ2A 4Z82A 1ZBE1 2EBYA 2R042 3URFA 4XETA 1J3QA 1DDLA 2VMHA 4BIOA 4XFBA 1LU2A 2YU2A 4FFFA 4FPCA 3ZXFA 3EUSA 3QACA 5KXDA 4F7ZA 5DXDA 2HH9A 1LRHA 4JTOA 5DAWA 4EN8B 1LESA 3T30A 1VALA 2BJSA 3JBG2 1Q8SA 3WNLA 1W8ZA 5A3PA 1L7QA 1LHOA 1PVC2 2PQQA 3HBKA 5FY7A 1POQA 1WCKA 4GH4B 2RVAA 1OA2A 2QQOA 1FOD3 1VBD3 4XCAA 3ZFEA 3ZXEA 1PO13 3BU0A 1PHMA 1PNRA 2GNTA 4FBFA 2KZ8A 2VNVA 4MH0E 4HVQA 4QM9A 1ULFA 4ATEA 3NNFA 5ACA3 4LKFA 1AL21 1AR81 3L9JT 4LKSA 3WP5A 1GSLA 2PXQA 1B35A 1KFXL 1MS5A 3ZFFB 4MGQA 4AVCA 5ISLA 5JZGA 1R64A 2YZ4A 4PIYA 4EN7B 1UWWA 1RVF3 3IDEA 4X8NA 3ZFGC 5DAPA 1QDCA 2ZMKA 5D2AA 3MV11 4IDZA 4UW5A 5DZGA 2DURA 4ASMB 1QQBA 1C5HA 1YRZA 2GC2A 1APNA 4LBMA 4Z2WA 1PMHX 2C26A 2W47A 3BN6A 3LEIA 1CJPA 3ACLA 4FFIA 3VD5A 3PNAA 2WZEA 3NNMA 4QDSA 2XJUA 2PIJA 3VZLA 1JYNA 3MGUA 4AVBA 2R072 4OQ8A 2ATFA 4XQDA 3CLCA 3RMYA 2I2SA 3H8OA 3OPTA 5CFCC 4MX3A 5I93A 2VNOA 4MVTA 3C8XA 4XJ9A 4NIIA 2VPVA 3KF3A 4UT5A 5FP9A 4JQDA 5F37A 3NVCA 4CU8A 1UYXA 5J1XA 3LD8A 2L9LA 1ND3C 1XE7A 1LODA 4K3UA 4F8AA 1IS6A 2ZGTA 1SLTA 2GAUA 3DPRA 1UYYA 1ODMA 4TLFA 5KHHA 3KS7A 2IXHA 3VKFC 3ZYIB 3LOIA 2EVXA 3J8F1 3ZO0B 3TN93 3ORJA 3N9MA 2R6QA 5CG9A 1R63A 5FZ3A 5A3OA 5I8YA 4P9XA 4XMIA 3TN91 1MS9A 1U2ZA 4EN9B 2BOIA 1CIWA 2VE1A 3D6EA 2X8KA 4LBQA 4EV0A 5FYTA 4J1WA 3NV4A 1FX5A 4ZKTB 4YZ3A 4PU8A 2GMPA 5L73A 3QFIA 1J58A 5GAGi 3V56A 3VDDA 1NCQC 4AEDC 1F5JA 4K1ZA 1UOFA 4I3GA 5DSXA 4B1LA 3RJ2X 3ZYBA 2QQJA 4XBLA 4AQTA 2FDIA 4XDPA 2VC9A 1A3KA 4LO6B 1QB2A 3OQOA 3LF7A 3ZLIA 3WSOA 1OKQA 2BBVA 1SZBA 4QXBA 4BQ4A 2VY0A 2I45A 4ISQA 2YROA 3PLQA 4FAGA 5F2WA 1J1TA 2I74A 4M0NA 1XXNA 1M06G 5C6CA 4XJWA 1FI2A 2VXRA 3RZKA 3MIFA 4XIOA 5BUVA 2LTNA 5C8CB 4JKMA 5EJ3A 1DZQA 1FMD3 5GZCA 1R081 1JUIA 1W9SA 3PUSA 5L9BA 5JWPA 1E5IA 4PF5A 3PU8A 1WH6A 1HLCA 2FMYA 2JKBA 3FYMA 2QQMA 1R1ZA 3RFRA 2A7AA 1PNFA 1WLDA 3D5OA 3WD5A 3ZFFA 4D8MA 1W6NB 4JHZA 3IDCB 4FPGA 4A3XA 4ASLA 5A3NA 3CROL 2VMEA 3HEIA 5FK7A 1X82A 2HWB1 3NMBA 1JZ5A 4KG8A 3LDKA 4QQPA 4BQXA 5B4NA 4IGQA 4KWLA 3ZSKA 4X4DA 3M3IA 3DYPA 4JGYC 1WCQA 5IFTA 4IEUA 1NW3A 2YDEA 1S0DA 4HT1T 4UW6A 4GH4C 4XTPA 5DDJ3 2EA7A 1JZ2A 4XHBA 4AL9A 1DGWA 4C91A 2QTWB 3E5XA 4P9JA 1S4CA 5K98B 4QDRA 4IETA 5HBAA 2Q5TA 4CTEA 1DU3D 5H9PA 1E5RA 2YMZA 3WDYA 5F5CA 4NMIA 1MQTA 5FYUA 4AE2A 3LQCA 4IEZA 5FMOS 2ZAAA 3HT1A 3PDQA 3AKTA 1AUYA 3JCIA 1PK6A 4S2HA 2VOXA 3BB6A 2DFCA 1Y9MA 1JBCA 1TQ5A 1ENSA 2WNUB 3PUHA 4LE3A 5JSOA 1JHJA 3WLUA 1Y3TA 5EPAA 1JZ7A 4E9KA 1E5HA 1RHI3 2V5DA 3PUAA 2AUWA 4ZS2A 4LBKA 1WD4A 4CUBA 3GZDA 4J6GA 5A3WA 2AACA 3NJXA 4P14A 5BNNA 4JQRA 1ZA7A 5EIYB 4Z92B 1XBFA 5AVAA 4YG0A 4PDWB 1W6NA 3E5UA 5FO8B 4AZZA 4BISA 2D43A 1LQCA 1QWRA 3RZLA 5FK8A 3D4KA 2Z4FA 4LTAA 3ZPOA 2XIUA 4JV4A 3D82A 5LY1A 2VM9A 1C1FA 3KWVA 2GC1A 5A70A 2FMDA 5FXVA 3ROUA 3RZJA 2HJIA 4N90A 4A7YA 2MHFA 4LEJA 4UF0B 1G9CA 1PMJX 4YARA 3E97A 2PELA 4FQ4A 2WZPP 4IWRA 4CXWA 4HPKB 1PIV2 4LO8A 3SCHA 2DTYA 4QD2A 2LCVA 2Y6KA 5FY5A 2R32A 3T1LA 5LEKA 2AEYA 3O1SA 2XLGA 3FLTA 2P1BA 1OOPA 1R1A2 3SISA 4YG7B 1C8M2 4BK4A 2XB6C 3OGSA 1WGPA 3VHRA 4I02A 2ENRA 4OYUA 4AEJA 5LEJA 1TMF1 3I8TA 4PBOA 1PZ7A 3APBA 2LW8A 4U2AA 2A75A 4KWKA 3DM5A 2FCTA 1RJ7A 5M0TA 1LOFA 5C4WC 4IEOA 2RS11 2Q8CA 3ENRA 4Y26A 3JQWA 4B4PA 2WN3A 4YM3A 2BZDA 2R0HA 3K4AA 3KGLA 5EWSA 5J37A 1PERL 1VB4A 4D0QA 2WLPA 2OXBA 3GBFA 4Q4W3 2A6VA 4MCTA 4QX7A 2X10A 2JG8A 1XRUA 2AYHA 3OUHA 3W20A 2ZS6B 1F15A 1O3TA 1SBEA 2RG4A 4OB4A 1XE8A 1FPN3 1WLCA 2XJTA 3AL6A 4Y33A 1RUF3 1GV9A 1R1A1 1UXZA 2BQPA 1VBE2 3I3EA 4JKKA 4K40A 1DWKA 2VR4A 3I3QA 4DZGA 4YGEA 2BEOA 3FUQA 1IPSA 2IUOA 2ZA9A 3TEPA 1TMF2 1JU3A 3ZMNA 2WFF3 2VEOA 4BK5A 1W99A 1PVC1 1N1TA 1X33A 4NROA 1N3OA 3JU9A 5GLTA 4GWJA 2MEZA 1NE6A 2P34A 3FLPA 4MXVA 3NXHA 2ICPA 4QQOA 4OQ9A 5IK7A 3AL5A 2D6PA 3AYEA 1ZBA1 4BH9A 2C0ZA 4Y1YA 5C9AB 1CPNA 3DYOA 3BTXA 3MIHA 4IV3A 1GICA 2HSGA 2ZKNA 3PVNA 3KXAA 2NP0A 1YSEA 1N1VA 3OUJA 4A6SA 4E2SA 4S2FA 4FP3A 1HRI2 1BLZA 4BOWA 2Y34A 2JG9C 2A1XA 5E16A 5A3LA 2FJRA 5C71A 5IK5A 2P17A 4TN7A 4YG4A 2HFZA 2R7EB 4LMFA 3WQ1A 4D7SA 2FDFA 1JZ4A 1S2BA 1JH5A 3EB7A 1HQWA 1EAH3 3O0XA 3POSA 3TNPB 4OZXA 2MNGA 1DQ0A 1LHNA 1I3HA 2WRAA 2O14A 3MLJA 2ZX1A 4FQZA 3B94A 4OI1A 1JOJA 3R05A 4X6QB 4ZU5A 1MS8A 4P02B 5KXEA 4ES9A 3BALA 2HWF2 3KZ4C 2VBDA 1QDOA 3WNXA 3ZFEC 4IV1B 5F3EA 4CXXA 2G19A 1AR82 1CX1A 5GKAC 3ZN5A 2LYJA 2BGPA 3D0JA 2VTXA 2XQXA 3K77A 3H7YA 1HRV1 4JDMA 3WCSA 3ZHMA 2B46X 3KMHA 1BBT3 3H50A 4IEXA 4YG3A 3AVRA 4QT6A 1K5MC 4CA9A 3NJZA 2IWGB 4Q26A 3VBFA 1L3JA 1GNYA 3L2YA 2ZX2A 3OBRA 2UWAA 3ZXKA 4PCRA 4ET7A 1LULA 1HXS1 3S8QA 5FZOA 4YZ1A 1H6YA 3LSDA 1BK1A 3BI3A 2Y6FA 3J4UH 1QJY2 3LAGA 4BCUA 1EY2A 2J42A 3ATGA 3T4VA 3M3QA 4AXOA 5IVFA 2AXUA 4XF0A 3AZVA 3HN3A 2I07B 4ZHNA 2W92A 2WIIB 3LPGA 3PIJA 4N9IA 2FZ2A 2AR6A 3C7FA 2XJSA 4Q0UA 1QKQA 1R093 5T52A 2O8OA 2HWE2 1JOPA 5CFDA 3SCGA 4AFDA 4E4ZA 5EJ1B 4XHXA 2DVFA 2V73A 4QHOA 1RUH1 2HWF1 5FZKA 4YNIA 1DF0A 2VCMA 1MZ6A 1KXGA 4Y1UA 1VE0A 2XL7A 1JU4A 1KS5A 3ME2A 3E5QA 3MW2A 2B39A 3PTRB 5I0SA 5EYYA 4EN0A 4WV8A 1EYBA 3PUIA 4IXLA 2BNMA 1UZ0A 3H7JA 2Y6LA 1QGLA 4KU8A 2IVGA 4JTNA 2A6WA 4I01A 5C5TA 4HBNA 1RMU2 3TRSB 5J36A 2OW4A 4H7MA 3VHOA 3KQRA 2ODRD 2ZOEB 3BD1A 4YM1A 1KFUL 5IK4A 2KEJA 4AQ6A 3AVSA 4NHMA 5J3UA 4CDUB 3Q9OA 2Q8DA 2W1QA 1HDKA 4META 1DQ5A 1V70A 4GB31 4ARXA 2HCSA 3I2IA 2Z5WA 5JR2A 5FQ0A 5JUVA 2JWPA 1PK6B 4A7ZA 1LCLA 2R0FA 4XVHA 1UOGA 5H9SA 2FHRA 3BVCA 1UD1A 2PPXA 4W4ZA 2CGOA 3MDPA 1VBC2 2W1WA 2XHNA 1RUJ3 4QQHA 4FPEA 1MZEA 1IKQA 3M3EA 2Y26A 2WIUB 1AYM1 3QF3A 1H2NA 1W2UA 2W68A 2ZGPA 4OI4A 4QPIA 2RM23 4XF9A 4XE9A 2P6CA 2J1VA 3S7IA 3W58A 2WJSA 3TAYA 1ZAYA 1M4WA 1E5SA 1US2A 2WFF1 3T3YA 1CAUB 4BQWA 2KD7A 3MICA 1V6IA 3ITQA 3ZVXA 3A9XA 1LTEA 2Q8EA 2D3SA 3AP4A 1UZYA 4FT8A 4LA3A 2MPFA 4LNVA 2UWBA 5FZOB 5L9VA 1JFTA 1F4HA 4XQ4A 4ZU7A 3I2HA 3EYPA 3VZKA 5J48A 4KWJA 4Y24A 4AW7A 2PXPA 4JCXA 1YHFA 1YWKA 2BGCA 2Y6JA 1AL22 1K12A 1VRBA 1QF3A 3CECA 4CUAA 3IZOA 5JIUA 2WAOA 3O14A 1OC1A 1OLME 4YW2A 4YG6A 2CU5A 4HETA 4WM8A 4OZOA 1XU1A 4GMP0 1XNTA 4QPGB 1GKBA 2C5DA 4X4BA 1X2LA 4EROA 4F3JA 1I9RA 1AR72 1OBNA 5IT6A 1PO12 3I2KA 2LYPA 2E33A 2W52A 2AZ5A 3C7OA 1QHDA 4Q5OA 4CCDA 3PMSA 1JYTA 3IM0A 2RMU1 4CEWA 2HWD2 4HOOA 4GH4A 2DVGA 3UKNA 2RS52 3IT8A 1GOFA 3U1XA 4AGVA 1HQ1A 2OUJA 4NHKA 4AEDB 3KCCA 2XR4A 3UKTA 4QPGC 2XBO2 4EYUA 1OVPA 3RZMA 4ER0A 2M4HA 1GQGA 1XNBA 1ONAA 3A7QA 1ENRA 2DCJA 4QKNA 4AR2A 1ULOA 2QDRA 5IAXA 1I5ZA 3KZ3A 4CCKA 2J1RA 3WF4A 1VR3A 5C3SA 2OZ6A 5DUUA 4KH9A 1ULPA 3ZXAC 3J26N 3VBSC 3WXPA 1EUUA 1GANA 2C9AA 5LASA 2UYAA 2E53A 4A3ZA 1LECA 1BBT2 2VXJA 1WWYA 1KITA 2VOKA 4RGAA 5BV6A 1NQJA 1X7NA 1CQTA 3MV01 3POFA 2JE9A 4AAPA 1OKOA 1HXS3 3BTZA 1UNBA 1RITA 1SCRA 1L7RA 1HB3A 4QX8A 2ORXA 4WM8B 2HWC2 1REEA 3ILFA 2E7AA 5FPAA 1Z7S1 1W9FA 2A3XA 4L99A 2AXZA 2VZ1A 4RGKA 1H2KA 2BWCA 4IV3B 1MS3A 2H0BA 3CMGA 2EXKA 3GN5A 1JOBA 5GALA 5JSRA 1V6LA 2QZ2A 1HJFA 4FTEA 1RHI1 2BBAA 3BPSA 5A33B 4XDOA 3S57A 3ZIWA 1ALYA 3B01A 2PXEA 3T08A 4LK6A 5C8CA 1D4M1 4YGBA 2VD7A 5EYXA 2WNOA 3FE5A 1C57A 1AXYA 1DYKA 1H1IA 2VZOA 1R091 2ZZQA 3AZXA 4YVWA 4JGYA 2E26A 1ZREA 1ZZCA 1VRH1 3NKTA 4KNCA 4FPYA 3OSDA 3UV9A 3WG2A 2G4IA 3NAPB 2YUEA 5A7WB 5EJZB 5JXHA 2FDGA 1OPMA 4XW3A 4R52A 5LCWL 3F6WA 3JXBC 1E3OC 5DUVA 2ZMNA 4XJ8A 2JDZA 2WQZC 4Y5SA 2FCVA 3N4MA 2XUEA 4IV1C 5HXMA 2J1TA 1J3PA 5T5PA 3B69A 2X5IB 3NZLA 3IMNA 3OCPA 5FP7A 4A44A 3V0AA 4Z5HA 4C0HA 2XQRA 3OMTA 2XDVA 4D6QA 5FZLA 3T2QA 4X4FA 4ASKA 4ARYA 3R6SA 2IU7A 4FPHA 2L49A 2DBNA 2JDKA 5K0UA 3AB0A 3WP6A 3WQ0A 2VQAA 3B7HA 5A80A 4I30A 1TMF3 2OT7A 1W8UA 3MEJA 4Q4Y2 2IFRA 3WF3A 5A7SA 1F9KA 3D0SA 3A23A 2PAMA 2CDPA 2VCAA 3LA3A 5DN2A 3VDCA 5J96B 4AEDA 4XUQA 1KEXA 3BCWA 4BQ2A 3O1OA 1NAEA 1X8EA 1S0EA 2W08A 4GB33 1HIXA 4XF3A 4J1XA 3ZFGA 5DTMA 2WR9A 3H3LA 2RS13 5SV5A 2XJQA 3SNMA 2IXCA 1AYN1 1CQ9A 3ACIA 2YBDA 1UIKA 1DQ6A 4CCMA 3I59A 2DYCA 2RM21 5DABA 3WG4A 4NRMA 4BMBA 1NXMA 2B45X 1X57A 1C28A 1O4XA 1DQ4A 1QP7A 3U75A 2IFWA 2LYLA 2YC2A 5FYMA 4DXTA 1PVC3 2YHJA 3HOBA 3ACHA 2LYQA 3JXCL 5ANQA 5APAA 5KHKA 1GR3A 4GHJA 2K46A 4LO4B 5IVYA 3VBRB 3FUOA 3UKVA 1GUIA 4RFT0 3KCYA 3OPZA 1MS4A 1UZVA 4Q27A 4XJAA 4DXSA 1U12A 1BQPA 2E63A 4NJ4A 3C7HA 3BGAA 4PQQA 2KR2A 2WABA 3LWCA 1AXZA 2ZX0A 5TSWA 5I91A 3PURA 4MG2A 2Z42A 3LISA 3EMRA 2VQUA 2YGLA 3WW3A 5IFPA 2LLVA 2P37A 2WZR3 4TWTA 4DEVA 5IVVA 4K1YA 2ARXA 4B1MA 5K9YA 4QX3A 4AFMA 5ABJC 2VZPA 1SBFA 5A7PA 1VBA3 3VBUC 2RR12 1O5LA 1S2KA 3WP3A 3GDBA 3SXWA 3WNKA 5IHRA 1LCCA 1MS0A 2DCTA 4D6SA 3WDXA 2ZBJA 1HN1A 3SEPA 1QH6A 3QOXA 2WWJA 5E88A 4CP1A 2J22A 4XF4A 3OP9A 1OQEA 5JMOA 1V0AA 2GRLA 1GLHA 2JG9B 2P3YA 3GZEA 2VW1A 4H55A 2ILMA 3AFKA 2VBBA 3OYWB 5L7OB 4QKFA 2V4AA 3OY8A 3K4ZA 4IEPA 4DXRA 1O4YA 1VIWB 2ARAA 3QOPA 1GWLA 2EAKA 2IXIA 3VUOA 4OLLA 1EV11 2YB7A 1YQ5A 3MLFA 1QQP2 5DQ0A 4YM2A 4EQZA 3Q8FA 5H9QA 3M3OA 2MEV3 4NRPA 1UXCA 4N43B 3Q8EA 5FOBB 4MADA 3LKJA 1RUE2 1ZRIA 1WMDA 3ETQA 3TNQA 4Q2JA 1AF9A 2AUYA 2KM2A 4LQRA 3TRBA 1DW9A 1VBC1 1QU0A 3R1FA 5FYSA 4BDVB 1MEC1 5JOXA 2YFUA 2RR13 3I59B 1VAVA 1XE0A 2B8MA 3HBZA 4IEQA 1O8PA 4FI9A 3U78A 2XWBB 5DRTA 3MBWA 3F52A 1H9WA 4LLFA 4LO5B 1R082 3A22A 4Z1VA 3BIWE 2DDUA 5LZ6A 3H8RA 1RUJ2 1VRH3 2V4VA 1KGYA 3QOWA 4JGZB 1EP0A 4MGTA 5J7MA 1TEIA 2CY6A 2VZQA 3ASIA 1WCSA 5BNPB 4Q1PA 3MLKA 1IQAA 3POYA 3SH3A 4KBBA 4E4SA 2PHRA 2WYFA 2B7YA 1OSLA 3H3ZA 3PMEA 5F5AA 2JX9A 2DBIA 3N7JA 2DTWA 2PXVA 1N47A 3RYPA 1WKYA 1DQ1A 2FBEA 1RVF1 3AZWA 4LBQD 3WDTA 3O7OA 1OURA 3O1UA 1RXGA 5C9AC 4YZ4A 3OB8A 2J1AA 2QCSB 3BDNA 5JUWA 1CZTA 3J8F2 1UY3A 2CAUA 4CEYC 1GZTA 5F3GA 3JQXA 3ZOIA 1H9PA 3DYMA 5JI9A 4R9DA 3UWPA 5FYBA 1GOHA 4AGRA 2Z2SB 1ZRDA 5DTRA 4GIQA 5BNOC 1SFPA 2C6SA 2J7WA 2VGDA 1SPPB 2XI8A 4QWNA 1KJRA 4TSVA 4BB3A 4FPJA 3VDDC 4OBMA 4INDA 5JI7A 1OLQA 4CE8A 4DINB 4DNYA 2W95A 2XKOA 2K2SA 2N7GA 3POWA 4XURA 2TEPA 5FZ7A 2A5ZA 3HWJA 4AFBA 1ZPQA 3WDWA 4MUVA 5A32B 4R9BA 4CCOA 3S5AA 1UYPA 3ZFEB 2GC3A 1EPWA 1QJY1 4XFFA 4AAXA 4BLIA 2JXAA 5BNPA 2HWC1 4JCKA 3WHUA 4CVUA 5D21A 2JG9A 3NW4A 3THCA 3VD4A 3ILNA 3R4UA 1PGL1 1OPOA 1PMIA 2JQEA 1X9PA 1CAXB 1CONA 2PLV1 1JMUB 4FFHA 4P00B 2R071 4A41A 1IG0A 2WDBA 5HXVA 5JZGB 1W0PA 5G05L 3NKGA 3WQBA 3ZYRA 3SH4A 4YVSA 1B35C 3GJBA 2ET7A 1RUI2 1BVP1 2JDUA 3I3DA 5T5OA 2W1SA 1H2MA 3GBWA 4QX0A 4CDXA 2AXVA 3L2HA 4JDNA 3W9AA 1CAVA 1OT5A 5DAQA 3NQHA 4R4ZA 3QQ6A 5L9RA 1LGCA 2JIJA 3IMMA 4CU7A 3B9IA 3I2GA 2IXKA 4OUSA 1W6OB 1FOD1 3SQOA 3OBZA 2EF6A 3AP9A 5I8TA 2OPWA 5T3NA 3WINE 1S0IA 3TWIA 1O4TA 5HCHA 2KEIA 1AL23 2H0VA 1ND2B 2W9XA 4XF1A 4XABA 5DPNA 2XJPA 4KI5M 4LOTA 4E8DA 5K8SA 3VV1A 2WUHA 3HQUA 4A6OA 3MF6A 1H2LA 2AEZA 2VH9A 5FPZA 1LLIA 1COV1 5FZEA 5J98B 3M7AA 1NOVA 5T54A 1H6XA 1SQ8A 3CBNA 4DY3A 1O3RA 1GZWB 3I2JA 3I49A 3EBRA 4W6WA 2RJLA 3LIHA 4AEKA 5CAZA 4K8FA 5K0UB 2HINA 2OVUA 4HKWA 3PE5A 1ZVFA 4XBNA 3RZHA 5BPXA 3MHZA 1NZCA 1SHWB 2LS6A 2VJXA 2WZR2 3K75B 3LFIA 1HX6A 4LR4A 2R063 5DUWA 3THTA 5CB7A 3MW3A 3VGIA 3CZUA 1QJU2 4V2VA 1Q8OA 2O1QA 4YW7A 4YVSC 1F4AA 5IW0A 5LBCA 5LY2A 4B29A 4CUCA 5C70A 4GULA 5K4LA 2JCGA 2D44A 5BYNA 1D7PM 3VKOA 1HQLA 4XXAA 3MF9A 4FOYA 4JQTA 4NN0A 5C8WA 3I97A 4D7YA 1PRVA 1RGSA 2PHUA 3VLBB 5JXGA 1OD3A 2JIGA 3PUQA 2HWD3 1BXHA 5C3PA 4XUTA 4DRRA 2ZGUA 5EQUA 4PBPA 2ET1A 2MEV2 4HLTA 4COWA 3O9XA 1HJGA 1OD5A 1YCIA 2ZX3A 4LJHA 2JECA 1Q8QA 2BYVE 3GHMA 5FYVA 4B4QA 4DUWA 5CYYA 1GYKA 2VBPA 4XFCA 4EWEA 3GZUC 4KBZA 3KV5A 3WW2A 4LLOA 4R9AA 4FTBA 4UFMA 2EIGA 3AMHA 1G9AA 1BHGA 5F8PA 4LITA 3DECA 4EKGA 3BTAA 4P5YA 5DTQA 2WLQA 2WSVA 3IKWA 4NHLA 3RSJA 1RXFA 1IS3A 1DZRA 1PO21 2PXJA 3AX4A 2Y0IA 4NVPA 2SLIA 3SH5A 1SDDB 3UYJA 1S1AA 4NDWA 1ZRFA 3VZNA 1UF2C 1JXNA 3C2UA 2C9KA 3FBMA 1H8VA 4UFIA 1U5IA 4EZIA 4LULA 2XMLA 1HKDA 1C8M3 2VVEA 5HCFA 4QPIC 2DUOA 1ZZ7A 2HEVF 4NIAA 2JDPA 5A3MA 4D69A 3JBG3 3A9YA 4OCTA 3I2OA 4PDWC 3DEMA 5FPLA 1SFNA 5FUNA 5A6ZA 1VP6A 3O0VA 1BDHA 2XWJB 4ZXEA 2PUBA 1BK0A 1YC61 5LRRA 3Q8BA 4XYXA 3ZDVA 1G8WA 4N9HA 4O9EA 4F8DA 3O1MA 2VZSA 1WZXA 1D4VB 2PHDA 4QPYA 1IS5A 2YU1A 4YW1A 5BNQA 3KT7A 2XJRA 2IVJA 1WA6X 4Q4X1 3ZM8A 2BNOA 1PGSA 3KSCA 2V3CC 4P9IA 3GZDC 1RYYA 1FV3A 5BNNC 1AX0A 3IDBB 3OG2A 4MV2A 3RYRA 4JC1A 2VMFA 4WVMB 2WO2A 2IC1A 3HPNA 4CU9A 5A7WA 2PXFA 1HRV3 1Y4WA 2AC1A 3ZN4A 4RHV1 3SEEA 4RSUA 1W9WA 2WS92 5GLUA 5ANNA 1G86A 2BTVC 2WS93 4YYOA 2QUOA 4Q0VA 2D6NA 5FZFA 4GMP3 2D98A 5KHJA 3U0ZA 3U37A 1NG0A 1DLCA 2A6YA 1VBB1 5BNOB 5C33A 5FJKA 4Z8BA 2VG9A 1SG3A 3ACGA 5CISA 3H9AA 2ZXQA 1RIRA 3D1NI 1NERA 2IUWA 1OVSA 3NAPC 2OA2A 3GZCA 1GP6A 3VB9A 5CZKA 2W0XA 4UFJA 1NEQA 1OCTC 1VBD1 3J9SA 3NV2A 2RDQA 4GKYA 2G9FA 3N36A 1BKZA 4A7KA 3VL8A 5C8CC 4PF1A 2WNEA 4IW3A 3X29B 2R062 2HWE3 4PIXA 2WT1A 3DGTA 4UYBA 3P1IA 4FAHA 1XSRA 1Y7BA 5ACA1 4COVA 2ZHKA 1NUKA 2O4AA 3J7LA 1MVQA 1BVVA 2ETEA 2VW2A 2NPIA 1LHWA 3AK0A 2BOJA 4CSWA 3R09A 3E6BA 4Z5DA 3VBFC 5FY0A 4NAMA 3UK9A 3HIFA 1HB2A 1NCRB 5FPVA 3DUIA 2A3YA 5A1AA 2VMGA 2D7FA 2PHTA 3MIBA 4Y22B 3U11A 4MGYE 5A6QA 2RS33 3NL1A 2XHKA 2D6OX 3FN9A 5LK7B 3U4XA 1YYNA 4NR1A 3HT2A 4WM8C 4X6RB 4W6YA 1QJX3 1GMMA 2YBPA 2FCUA 5CNAA 1JZ8A 1SLCA 4WZCA 4RR3B 1OXCA 5E1RA 1VAKA 5E89A 1XYPA 2P4EA 4QX1A 2OPKA 5KXCA 5FYCA 1WETA 1DIWA 3B3QE 5GM0A 3G5GA 2QQUA 4X8PA 1IOAA 2PN5A 2DUPA 2VUCA 3ZSEA 3VD7A 4NPLA 5IJRA 2GZWA 3GJAA 4UAPA 1P8JA 2ZMLA 2Z79A 3JUUA 5C9AA 2L1PA 1CAVB 4EK9A 1NLRA 2W91A 4IE7A 1UU5A 1POUA 1ZX5A 2DV9A 4PI0A 2F4PA 1SEFA 1S2EA 4QPIB 1QXPA 1GZCA 1QJZA 1VB2A 1VJ2A 1X36A 2HEYF 2HBTA 3HMYA 2JDNA 3MLLA 4HKLA 4IERA 4XMAA 5FWEA 1R1A3 3VHPA 1ZZ6A 3ZX7A 5JAXA 4ONUA 5AC93 5L36A 2P6HA 4WM7A 4RS5B 3VDDB 3KL4A 1W6OA 4AWDA 4OUMA 1ACCA 2CDOA 2JJ6A 1QP4A 2FDHA 4CDWB 2OX0A 2VUJA 1BYHA 2WNVC 1S0BA 2WO7A 3OPWA 4MLOA 5FLJA 5A7OA 4BE3A 1EFAA 3AKPA 4P9YA 1ND2A 2D6KA 2WO1A 3G6JB 1N1SA 3WNNA 1DYOA 1KDKA 1YFWA 4RR3A 1T6GC 2EIBA 1H30A 2PTMA 2W46A 5DG2A 4Z2AA 1JYWA 4D94A 2E32A 3VWSA 3KCXA 1YQ2A 4QX2A 5FWJA 5CKMA 4LORA 5CEHA 2QQKA 1QIQA 4XZPA 2PHLA 4ATFA 2PMWB 1FMD1 1RUC2 2XL9A 1RUE3 4Q0QA 4E8CA 1XU2A 1FT9A 3LA2A 4GJYA 2QQWA 1CVNA 3R0RA 4CCCA 1LOGA 4XAEA 4RA0A 3AFGA 3VBHA 1DQ2A 2YC4A 4B3NA 1K5MA 4MYEA 4GZ9A 4W6XA 3FYAA 2EXIA 4LBLA 2QFEA 4R8HA 1O7FA 3LEGA 2ZTNA 1MFQC 3THDA 2LROA 3O1TA 4M3CB 1COV2 5FP3A 4M4PA 1H4HA 3SCFA 4MO3M 3ZXLA 3BOWA 5FRAA 1QMJA 2ZHNA 3PHMA 5I0TA 1CWPA 4RQPA 2PXLA 3K2OA 2NN8A 2XVGA 1TME3 3IB3A 4BXSV 2H8RA 4AOCA 4CDWA 4E4DX 5K0UC 2YG0A 3NNGA 1OA4A 1JZ6A 4QM8A 5ABJA 1BBT1 4YVWB 4FOQA 2VL4A 3MYXA 5GJ6A 2CSFA 1BEV3 4EKIA 3K3NA 1WH8A 3ZPXA 2WA4A 4RHV3 3WG1A 4CPBD 4CUGA 2WFPA 2GDFA 4Y3OA 4DY5A 5FDBA 4W8JA 4NIHA 2VCBA 2R073 3N9QA 4GMP1 3FZ3A 3LOBA 3SMHA 4IE5A 5IVEA 1NA1B 2CAVA 2WWSA 1RZSA 3EHKA 1K42A 3EJKA 4PI2A 3RZZA 2X29A 2Y38A 3DF0A 1WMXA 4ITCA 3RZGA 5F5QA 4UFHA 2B5AA 4AHWA 1NCRC 3KT4A 3T0BA 3IWZA 4XOGA 2ICTA 1WW4A 4JGYB 1LHUA 4LPLA 4MGKE 2WZR1 1AR93 4OMDA 2VOTA 2GMEA 2VQTA 2GSYA 2VZ3A 5FZMA 3AZZA 3N9NA 4AVVA 2PUCA 4AVAA 2Q1ZB 2WQ4A 4UXAA 1QOOA 5DZEA 3MPBA 1UXDA 4PT6A 1X9TA 4ER3A 2ADDA 2Y6GA 2GU9A 1RHI2 5IVBA 4ZZ5A 1HRV2 1GZ9A 1WCUA 3IBMA 1CZVA 2VCCA 3PTYA 5GZFA 4OHXA 3USUB 4E2QA 3UNPA 1G9DA 4G4FA 1VBA2 2W5FA 1HXS2 1PVXA 3CEWA 4TXWA 3WW1A 4LHNA 2O49A 1QNWA 1V6KA 3ETPA 3N9OA 2OUHA 2D6LX 1Y7YA 2P5BA 1LEDA 1X8MA 3WDUA 3ZR5A 2H6CA 4AHXA 4P9WA 1K5MB 2H6BA 5DDJ2 2A6CA 3M1HA 1UX6A 3IIAA 2VOVA 1D0HA 2UYBA 2FDJA 1FNZA 3C7GA 4TYSA 1RUOA 1C1LA 5FPXA 5KC5A 4NWVA 1O3QA 1OSGA 2NMOA 4PU3C 2GP5A 1AU7A 2JG8B 4YG1A 1ZZ9A 1CD3G 1LEMA 2GNDA 5JZGC 2BPA2 2XBO1 1JYXA 3KJXA 4CEYA 2VVDA 1SACA 4FPKA 5LW9A 3JB8A 5D8AA 3MFAA 1JYCA 1ULCA 3MFCA 5FV3A 3S7EA 4QHBA 2HWD1 4EWAA 5ABJB 1WW7A 4I0AA 1UKGA 2ZCWA 5A7LA 1AR73 5JIAA 5LA1A 2W87A 1V6JA 2QQVA 3AKSA 1I5PA 5F6KA 4M3CE 5FZ8A 3KLSA 5BNOA 2AGSA 2UY9A 3B9CA 1IHMA 1UZZA 5FLIA 1DZTA 1NY71 4EZHA 2PAEA 4C1XA 3O1PA 1IKPA 1UY2A 3V65A 2CL2A 2KEKA 4PIZA 5ACA2 5CKNA 2VU9A 1PM4A 2LNMA 1W90A 4D3WA 4YGCA 3RI9A 2D6MA 1Q8VA 3HVDA 3JD73 2VTFA 3FHIB 1MQTC 3IAPA 5FYHA 3T2TA 5LWBA 4DPNA 3RNSA 2JKXA 3JD71 3OY8B 5LB6A 1RPEL 2BVBA 2CWSA 3NJVA 4QDQA 2YV8A 3FHAA 1V00A 4L11A 4XFIA 1YJKA 1W6MA 1HV1A 4LBOA 4Y20B 1V9U1 4PU7A 1V6MA 4ZONA 4COYA 3M9LA 2UU8A 5DMYA 2CROA 5LA2A 1W9YA 1SQ4A 2PUGA 3CQOA 2VZTA 2UURA 3KT1A 5FZIA 3O12A 4CEYB 2A6ZA 1PGW1 4QGNA 1OF4A 4XAAA 4ZU4A 5FJHA 4DUVA 5A3UA 2Q0AA 2TUNA 2XLFA 4W50A 1QJU1 2HCNA 2RS31 3A0NA 4PLMA 3VKLA 3H8XA 1BMV2 1DLLA 2AW6A 1WLWA 3J7NA 3S6PA 1D2SA 1QJX1 2RDRA 4YGDA 1KDMA 3N9LA 1ADRA 4MGZE 4PDWA 5GZDA 3SITA 2JDYA 2JE7A 3FWEA 4Z59A 2ZHLA 4FN3A 4ZS3A 2A71A 2A6XA 4BIFA 3TOJA 4O61A 3Q8CA 3LB9A 3VBUB 1W9TA 2IVIB 3RMXA 4P5HA 3UGHA 1A34A 5HCBA 3VBFB 2W2IA 1LU1A 2PLV3 2VZRA 4EE2A 2DWRA 4NIGA 1XWRA 2DVAA 1IGOA 4S2DA 4WVZA 2XPJA 1XPWA 3ECQA 1FPN2 5FIXA 2A3WA 1VBB3 1RUC3 1MR5A 1STMA 1LCDA 1L7LA 1RVF2 1Z7S3 4WZFA 4LXLA 2Q8OA 2ZJCA 3VBSB 1SCSA 1NY72 2D93A 2G9ZA 3M2MA 5IWFA 3OQNA 2P2KA 3GYDA 4YWAA 3QWGA 4X4HA 1W0NA 4MCXA 1FV2A 1LOAA 3CJIB 1O4ZA 1JUHA 1PNGA 4URAA 3KM5A 1EV12 1AL0G 3IIIA 1KD7A 4UBHA 4FP2A 4E2GA 4JX0A 4CP0A 1ST8A 1UY0A 3RG0A 5JXIA 4K21A 5F1RA 4HN0A 1SBDA 2YPJA 3RPQA 1LHVA 3G7DA 1JS9A 3HNBM 1MACA 4IE0A 3AJYA 1YFYA 4MXWA 4FSJA 1SPPA 1SDWA 1PO23 2JVLA 5AC92 1ASJ1 3UJOA 4GXLA 4LKEA 5DG1A 2RJKA 4YW4A 1JW6A 3HN1A 4SBVA 4ZPIA 2GN7A 3BUCA 4BXFA 2ERFA 3NROA 4IEYA 1GBGA 1LJ7A 5I8SA 2RS53 4A42A 2R043 2NYYA 2HEWF 3A0KA 4AFCA 1UY1A 4E27A 1UZWA 4JRLA 1YIPA 4TLGA 3CHXA 4MGIE 2WNVB 4GWNA 4K9SA 1HQNA 3WVJA 3DV8A 1RMU1 3NDBB 1W6MB 4GQ7A 1C4RA 4FXGB 1CAXA 3UGGA 4DS0A 4LE4A 5CADA 3UGFA 5HCAA 1OA3A 5HPOA 4Q0PA 3SHRA 3QLQA 4O8BA 3VZMA 1W8HA 1ZVVA 1OUSA 3ZKCA 2PXDA 3FL7A 1RUI1 4RD7A 2G9GA 3ZYFA 4OHZA 2D40A 3HD8B 1VPHA 4LBNA 1QJX2 4NUBA 2DU0A 3SR4A 3LIGA 4GB32 4FVVA 1O8SA 3B93A 3HQRA 1TME1 4Q4V2 2PLV2 3INAA 3VKNA 4N7IA 1OI6A 4B4RA 4FOWA 5FZ0A 1HV0A 1OH4A 2GH2A 4YW6A 3ZN6A 5F2SA 3KQ4B 3MIDA 1S0JA 2WUSR 4XACA 3B7MA 4IGPA 5FXXA 2GALA 1H4GA 1OOPB 5JDBA 3V0BA 2ZGNA 1BEV1 3B00A 4DOUA 1RUF1 1PRUA 1YO8A 1D2QA 2MXDA 1UU4A 4AQ2A 1W03A 5FYYA 4Q2FA 1UX7A 1V6OA 2PFWA 4AK3A 3TEYA 3EXUA 3N7KA 1S0CA 2VNGA 3CO2A 3OJBA 5EZWA 1YQ8A 5DUXA 3A21A 2ZHMA 3GF6A 4FOVA 3ZYJB 5CG8A 2XXZA 4FPOB 3LCPA 2OIIA 1UL9A 5FMDA 4RYDA 2KA3A 3B02A 3KV4A 3LDBA 2IXLA 3CJXA 3IVPA 2DVDA 3WW4A 3POEA 1IZ3A 1H8TA 4PLNA 3RVHA 1ZBA3 3UFDA 4WM7C 5JLVA 5FFOC 1N3PA 4QPGA 5T5LA 1AR91 4XBQA 3IAQA 3LPFA 3OUIA 3TFLA 1SMVA 3DNVB 2DCZA 3H0OA 3AKRA 1CJGA 4OHYA 3AYAA 2JB8A 3CU7A 3LEMA 3RRDA 3SX0A 1RUE1 3GZTB 1VBA1 3IPVA 4HRAA 1QQP3 4GA9A 4I09A 2XGXA 1NLQA 3K51A 3ZIXA 2WO3A 3C3VA 1COV3 2D97A 1MEC2 4XXPA 3O1VA 5FMCA 1L1MA 4BQ5A 3QD6A 3F51A 2UY8A 4AI9A 5JOYA 1Z7S2 4A4AA 1TG7A 3OBTA 1NCRA 1DHKB 2X53S 4LBJA 3AMNA 4XTMA 3WQ7A 1U5YA 4BLJA 3MUZ1 5A1FA 1NCQA 5JPMB 4ISRA 1RTVA 4AGGA 4CDQA 2Q1MA 4CDXC 1S7EA 5FCCA 1LGNA 2K9ZA 2WAAA 1WBLA 4JGZA 2WWUA 5A7QA 4AHYA 2OZJA 2CGPA 3AKQA 3WUDA 4ER5A 4XIKA 1MQTB 1URXA 5CBLA 2AWIA 1UMHA
chains in the Genus database with same CATH topology
1ZBA2 1UMZA 5GZGA 5JOZA 2NM1A 2VECA 1QQAA 2XG3A 4PQ9A 2P3KA 5GLWA 2VVFA 4CZSA 2DUQA 4L92A 3GN5B 1AVBA 2YC0A 4FPLA 2ARBA 1BJQA 3K48A 3VZJA 4HVOA 2TNFA 1W39A 4AI1A 1UCXA 3OQMA 3PXPA 2MQKA 1RUH3 2GN3A 4ES8A 4RQPC 3ST7A 5B2GB 3AXDA 1QPZA 4W65A 4WVWA 5JMCA 3JD72 3NSTA 5FQ0B 2HWF3 2QZ3A 2R49A 1WIZA 2OYZA 4N7UA 4CYDA 4YM0A 2IZWA 1ASJ3 1J59A 1W6QB 2ZGOA 1ZA4A 1OHFA 2XCJA 3M8LA 4JGZC 4AI3A 1NYWA 2UWCA 2CTVA 2R041 4QXKA 2FZ1A 3OTFA 4LHKA 2E7QA 1CAUA 1R69A 3HAGA 4FO9A 1JFSA 1QOTA 1UKRA 2B5HA 2LYSA 3WDVA 3ZYGA 2AENA 1NA1A 5CFDC 2ZACA 3DPRB 1ZM1A 4EN6B 1YFXA 1Q43A 4IEVA 4PJYA 1WW5A 2BVVA 1ULGA 4GWMA 2D5VA 1YLLA 2JICA 1I6XA 1U0AA 3L1PA 2R1BA 4AG4A 1OQDA 3O0WA 1ULEA 2LALA 1D0GA 3VBUA 3BOPA 4N53A 2DU1A 2R30A 4Y5Z0 3PJYA 1RZRD 4CEWC 1SLBA 2PUAA 3VBOC 5L19A 2R1JL 3JXDL 4RQPB 1GNHA 2ZGKA 5F9TA 2R16A 3AZYA 4O9GA 1YI7A 1RUC1 3GBGA 3VBRA 1UU6A 4K6BA 2HKXA 2VMIA 2PUDA 2JG8C 4Y1ZA 4CP1A 4ZU7A 1LENA 1JHNA 1XQNA 3GALA 2X5IC 5FTTC 2DCYA 3HR9A 3AMPA 2CGNA 4BA6A 1VBB2 3IN9A 4IESA 4Y22A 3OGJA 1MS1A 1LOFC 5C4WA 4XDQA 3P3PA 3CLPA 3WZ1A 5KXBA 4QU2A 4YBAA 1HW5A 4MXWB 1ZZBA 4YSFA 4Q4Y3 1C8NA 3VZOA 4NWWA 2YYOA 2SBAA 1RB8G 1JYIA 3QCWA 1KQRA 4XQWA 3AXEA 3S30A 2OFYA 1FYUA 4C90A 5KC6A 4IV3C 1ND2C 2KPJA 1YJLA 3BS3A 1QJU3 1X50A 4HK8A 4XILA 1EAH1 4XFHA 1VRH2 4WVVA 4JCYA 3QH7A 3RQ0A 4AF9A 1G6NA 3V0BB 5T5JA 1IPJA 4AQSA 2D5HA 4KL1A 1HRI1 3FMYA 4URTA 3RWNA 3EQEA 3MIEA 3ZHIA 1RUG3 2LYRA 2CWMA 3CF6E 2PHFA 2V09A 3TBDA 1G9FA 1WD3A 1ZRRA 5I0RA 4HZFA 5JCTA 4G3YC 1RUF2 3AP6A 1RUNA 5KBFA 3H1MA 1SLLA 1UW8A 4BM8A 3MZHA 1CPMA 1OLRA 4DFSA 4OVEA 1YFUA 1FNYA 1N3QA 1U5ZA 1H8TB 4YRDA 3OD4A 4DMIA 1F8VA 1Y9QA 3VL9A 4AI2A 4Q1RA 4AVTA 5CFDB 3FFQA 2HWE1 2HYKA 1FAYA 1H1AA 3WR0A 4IL7A 3PJQA 2R63A 1YUDA 2YY1A 1O3SA 5LRSA 1BEV2 1Q8PA 3ZPYA 4KGQA 4N43C 2VNRA 3RS6A 2WNUC 1NXD1 1FXZA 3BPZA 4I6RA 3VHNA 3WOGA 1R083 1LGBA 3M4FA 4V1PA 1VPWA 1JTZX 4KU7A 5KHGA 1BZWA 1ZNPA 2O38A 3OGGA 3FFZA 2HWB3 2ZKLA 1LMB3 2IVQA 2ZAHA 1RL3A 2Y0OA 2ES3A 1KJLA 4D7TA 1ASJ2 1AYN3 5A32A 4Q4X3 5FAXA 4AHZA 4TZDA 3ILRA 1WA4A 4UW4A 1AJOA 2CNAA 5FREA 2ZGMA 5GLVA 4HSLA 2BWAA 3A4UA 2Q30A 2HWC3 1XNCA 1FATA 2V5YA 5FO7B 1RUD3 1AZDA 4H3WA 3WG3A 1AR71 3VK0A 1C3HA 1QXRA 1YXWA 1H8TC 2ZGSA 1UTXA 2CYFA 2NLRA 3GNEA 1PIV1 2IXJA 1BCXA 3E6DA 2XVKA 3AJZA 4L2NA 2BW8A 1TNRA 2DVBA 5I0UA 2DFBA 4YFZA 4I6TA 2P3IA 4HFSA 2PHWA 2BFUS 3OYWA 4XJZA 4X4IA 2F6BA 2YXSA 3LZZA 1PM7A 1Q56A 4YW5A 3ZFFC 3H8UA 4QQLA 3AMQA 3DKWA 4OFGA 1OMIA 1Q3EA 3TB0A 1CGPA 2K0GA 5CFCA 2EWTA 4LBQB 1MZFA 2WFF2 3OF1A 1GT0C 2RMU3 4L8QA 1VBE1 1YIFA 3WCRA 3JBG1 2O0OA 4I0WB 4B7KA 1G9BA 2GC0A 1ND3A 1POV0 2XVLA 4HKOA 1DGRA 4QMAA 5FOJB 4LUMA 5IUQA 1LB2A 1GZWA 1REFA 5FLHA 3N7LA 1AR63 1NE4A 3H1WA 1REDA 4LA2A 3LFPA 3I54A 3I7DA 1RMU3 2B9UA 4P9LA 4R4XA 1N1YA 1C5IA 3OD0A 1RUG2 2C1FA 3KD4A 3NV3A 1S0FA 4DRVA 2VW0A 2EF8A 5EV7A 5GLZA 5BY5A 3FC0A 4AVSA 4KG0A 2XJ3A 1A8DA 1Z0HA 5K7PA 2GH8A 4RR3C 3FX3A 1KS4A 4A2UA 4IVZA 5AC91 1VBC3 4AYUA 3TYJA 1R092 2VQ0A 3WY6A 4Y1VA 3H3UA 3H5TA 1VAMA 4M0HA 4YZ5A 3VN4A 5FBZA 1WLTA 3FJSA 4X4EA 1XNKA 1RIOA 4WM7B 4K20A 1PO22 2E9QA 3U10A 1AR83 5JVVA 3GZAA 1NCQB 3R4DB 3B5LB 4HMZA 4OI0A 4YLZA 4CDQB 5C4WB 4Z07A 4LHLA 3HQXA 4X4GA 2DCKA 4PLOA 3MPPG 2VULA 3V0AB 4I3PA 1WCDJ 4Q4Y1 5CVRA 1ENXA 4CDWC 2ZGQA 4COUA 2DF7A 2EALA 4EJRA 1KRIA 2YGMA 2LM3A 1MVEA 4CDUA 4Y20A 2GRMA 1PZ9A 1AX2A 5HI0A 5KWRA 1ND3B 1SFYA 2GNMA 3I2DA 3M3CA 1EAH2 3RYKA 3E6CC 4P9GA 4I8TA 1ZS4A 4KQ7A 1LR5A 3ZXDA 3PVEA 4M3CA 4HPKA 4HANA 1MZ5A 1TE1B 4OI2A 3RI8A 3O5SA 4RHV2 3WX5A 2W39A 1ENQA 4DQAA 3CJIA 4RGGA 3R4SA 4WVMA 4IA8A 4UBGA 3WP4A 2XBO3 5EXOA 2XUMA 1PRAA 5LK5A 1QJY3 2PYTA 1ZYBA 3FMGA 4XEZA 4SLIA 2BNNA 1CAWB 4YFWA 2WS91 2ZGRA 4U36A 4I6UA 4YZ2A 2QDNA 1OFSA 2E7TA 3N3HA 3PVBB 4M00A 5E8AA 3USUA 1QH7A 1QP0A 1CR7A 1JH9A 1DGRN 1JN2P 2A70A 3QYXA 3PVOA 4JDOA 4Y4YA 3WUCA 3VBOB 1NA1C 5IK8A 2WC2A 4CDQC 2BFUL 2B42B 2PHXA 2P3JA 2XJVA 3FBYA 3VBRC 4DB5A 1IC8A 1DGLA 1VBD2 3ES4A 3ZSJA 4CEWB 2Z69A 4BPZA 3VKMA 4Q4W2 1F5FA 5FMOL 4OHVA 1PK6C 4Q8KA 1RJ8A 2WT0A 3HZIB 1EPZA 1QQP1 4GALA 3AYDA 2GNBA 3UJQA 2WKKA 2AREA 1DBNA 4XPVA 2EAAA 3CJIC 3EO6A 3ZDSA 1RC6A 4CDXB 1H1MA 1AJKA 2RMU2 3DPRC 1AR61 4JVAA 2WNVA 3U0ZA 1TNFA 2R061 1B09A 3JZVA 3T1MA 3W59A 2ZPXA 1UPIA 2NMNA 1XNDA 3P3NA 2QNKA 1WW6A 1O5UA 2QE3A 4Q4V1 1W6PB 3ZSLA 3AM2A 1RZRA 1GFF2 1Z78A 4LT5A 1XYOA 3CNAA 4F83A 4B7EA 4B8EA 2LUWA 1V9U2 1Q5OA 4N43A 3ZSMA 2MEV1 3RDIA 4QGMA 1WBFA 3BODA 1OQ1A 2KXLA 3QH6A 5F6LB 4S2GA 1XYNA 4KGGA 1AYM3 1ZBE2 2VUAA 2R1DA 1MEC3 3MI8A 3MIGA 4AI0A 4MZUA 3ES1A 2RS12 1BDIA 1LOEA 2AH2A 4L9BA 2D3PA 4FBIA 2RS32 2WA3A 1W0OA 5AFEA 4OULA 1NLSA 3FLRA 1NQDA 4PU4C 1ZRCA 2NQYA 3VBHC 3U3WA 5J09A 1CJDA 3GHNA 2XH6A 1AYM2 1RUH2 4Y1XA 5D1IA 1AHSA 4IEWA 1A6CA 3TN92 5CFCB 2EXHA 1U5XA 1UIJA 2PE5A 4GKXA 4H14A 4N53C 1V9U3 3AP7A 4BHPA 2ZABA 5BNNB 2QKDA 4COZA 3VBHB 1I1EA 4Q8LA 3AYCA 1E57A 1FMD2 4IQPA 2GZUA 2NZ9A 2E51A 2D5FA 2O8QA 1HF0A 5GZEA 1WMEA 3KGZA 3NAPA 5JR7B 3WT3A 2JENA 3AMMA 3DL3A 4OHWA 2QVSB 1VLNA 2TBVA 4BYYA 4C0BA 3NV1A 1SLIA 1A78A 4QX5A 3DN7A 4X4CA 3J8F3 4EWDA 1PZ8A 2BJCA 4G9SB 1EV13 5JSPA 1IS4A 1RUG1 4RL7A 1AR92 1QXJA 4R9CA 3BU7A 4HN1A 1ZBE3 5H9RA 3SLIA 1PGL2 4YVSB 1UN1A 5KHIA 1S55A 2WL1A 3NWKA 4UW3A 4C1WA 4NPRA 2VOWA 2CV6A 3JB4C 3NO8A 1O91A 1WMFA 4FXKB 4HVRA 3VBSA 3UL2A 5AFBA 1LOBA 4NOTA 2QQPA 1D4M3 2HWB2 1J1LA 5EFUA 1F31A 1DYPA 1S0GA 4ZXKA 1PO11 2RHPA 2L8NA 1OOPC 4M01A 5L7OC 4Z5CA 5BNPC 1TME2 2D3RA 4CP2A 3MEPA 2IV1A 5JOWA 1VBE3 2RE9A 1DFQA 2JD4A 1W6QA 1GQHA 4BZ4A 4BMEA 4I2OA 3S0MA 2XLAA 1UAIA 1D4M2 2RS51 4JRAA 3V64A 4AI8A 1CX4A 4YVWC 5DDJ1 3ZYPA 3ELNA 4ORFA 4YW3A 1CAWA 4LO7A 1IPKA 5BXXA 1JWLA 1AXKA 4Q4V3 1WUVA 3WHTA 4GQMA 5FO9B 5T50A 3LSEA 2OR1L 4RS5C 3RJRA 5JPNB 4M3CF 4FPFA 4FTSA 1YNAA 3ZXGA 3U07A 5DZFA 4XJUA 1ZZ8A 1GNZA 4QGLA 4NO4A 2QJVA 3I4IA 1POV3 2LYKA 2EXJA 2WNUA 1DG6A 2IVBA 1F2NA 1POV1 1V6NA 5D8AB 4N53B 4HK9A 2WINB 3ZN6B 3ALQA 1CN1A 5A33A 3D8CA 2RR11 3KB5A 3N7MA 5CU1A 4BQ1A 5L7OA 4K7JA 3IPVB 4L97A 4IV1A 3H1YA 2XKPA 3M70A 2PUFA 2PAKA 5CIRA 4Y42A 1PIV3 1A8MA 4LUKA 3USSA 4DXZA 2JEMA 1B35B 3THPA 1PGW2 3VBOA 2XSDC 4AEMA 5CA6A 4Q29A 4H7LA 3QBQA 4I0BA 4JAAA 1ZUGA 2A73B 4Z58A 2PA7A 2PUEA 1DGWX 3MW4A 2ZZJA 1CESA 2ZGLA 1UPSA 1C8M1 1RUD2 1Y43B 2GMMA 4WBBA 3LA7A 4RS5A 4CRQA 2BUKA 1LOCA 1YI9A 1J3RA 2E6VA 2WT2A 1RINA 3WV6A 1BMV1 5AVPA 1W6PA 4MSVA 3AP5A 1H0BA 4Q0SA 1FOD2 1RUI3 2Q4SA 4Q4X2 1SLAA 1AYN2 1AX1A 1QY4A 2X5IA 3ZFGB 3ZMOA 5D8AC 4AFAA 3CL1A 1AR62