2BNNA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords EPOXIDASE
total genus 52
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnnA02
1X2LA 3U3WA 5I0RA 4X4EA 1RL3A 4HN1A 4LUKA 5BPXA 1UD1A 4IEUA 2GU9A 1GT0C 1ZZ9A 5EFUA 2CAUA 3LZZA 1PMIA 2PHLA 1ZZ6A 4IVZA 2UY8A 2VQAA 3H1MA 1FT9A 4D7SA 4FAHA 2Q30A 5JSRA 1OD5A 4Z5CA 1SQ4A 5F1RA 3BD1A 1UXDA 3IVPA 4Q0VA 2H6CA 5CVRA 1HF0A 2PIJA 2XKPA 1J3QA 1SFNA 3HT2A 2ATFA 2VPVA 3MYXA 4HVQA 4YSFA 4Y42A 4FBFA 2ICTA 2EWTA 3JXBC 1Y9QA 2E9QA 3CLPA 2LYRA 1EYBA 1SEFA 2PUFA 3WW3A 5I91A 3RPQA 2IV1A 4PU4C 3KMHA 4Z58A 4F8DA 3LFPA 3DL3A 3O14A 2XLAA 4UBHA 3S0MA 2LYKA 4XETA 5J3UA 4AVCA 1YHFA 1JFSA 3BCWA 2A6CA 4I2OA 4BHPA 3DKWA 3M3IA 2XI8A 1ZAYA 2GH2A 3E97A 3SXWA 2GC2A 4D7TA 2OA2A 3H7JA 3EO6A 1PRUA 1YFYA 3SMHA 2XJ3A 1WA4A 3LA2A 4Q0SA 4KWKA 4AQ2A 3ELNA 1NXMA 3GN5B 1ZVVA 5JAXA 1X7NA 2IU7A 4DINB 2HKXA 5FLJA 1WH8A 2D93A 1Q43A 2R1JL 4IEWA 3E6DA 1FI2A 1CAWB 3FZ3A 4L11A 3D82A 4O8BA 5CADA 3RYPA 3FYAA 3SCFA 2FJRA 5T3NA 2ETEA 4XFIA 3DNVB 3RNSA 3IIAA 3S7IA 4P9GA 1DZTA 3G7DA 2FMYA 4PIZA 3QOPA 4HMZA 3TNPB 2MPFA 5I8YA 1VR3A 4K8FA 1UXCA 1VJ2A 3KGLA 1OMIA 4OFGA 1LCDA 1RC6A 3ZDSA 3JZVA 3HQXA 4MGZE 1DGRA 4KWJA 2AW6A 4AXOA 3EQEA 2PE5A 2Q4SA 1H1MA 4IEZA 1NYWA 1RUOA 3RYRA 3L2HA 1OCTC 3S8QA 3U11A 4YBAA 2GZUA 1O3QA 1YWKA 3LA7A 1JFTA 4IEQA 4I09A 4I6TA 4YARA 2KEJA 1X82A 4Q29A 4HN0A 3QWGA 2IVBA 4PU3C 1X8EA 2ICPA 4O9EA 5I0SA 2Z2SB 2DCTA 2IC1A 1LRHA 4YG1A 4MV2A 1CAWA 2CAVA 3MPBA 4QXKA 4XF9A 4ZU7A 4IEVA 4JV4A 3RDIA 3CL1A 3PVBB 1PRAA 4J1WA 5JSOA 3BDNA 4FAGA 3E5UA 4WBBA 2OYZA 4IEYA 2BNOA 3I7DA 1PNRA 3D0SA 4OB4A 3FX3A 2OR1L 1HW5A 1LCCA 3SCHA 3CROL 2BEOA 3PXPA 3RZZA 3I59B 4I0AA 4KU7A 2C0ZA 4XFFA 4QGLA 1X57A 3I59A 5E1RA 2K0GA 1YSEA 2BJCA 4KWLA 1S7EA 3L1PA 1UCXA 4ZU5A 3BU7A 2BYVE 3NW4A 4ZU4A 3B7HA 2EBYA 1QP4A 1X8MA 1LB2A 3F6WA 5A7LA 4NDWA 1YFXA 4HVRA 4I02A 4Q0QA 2XSDC 3LWCA 1EY2A 1ZZ7A 3E5QA 3O9XA 3H7YA 4PIYA 2IUOA 1LKNA 2IXKA 1ZRFA 3VK0A 1QXRA 2LYSA 1LQCA 3F52A 1CGPA 1QP7A 1J58A 1NE6A 3C3VA 1DW9A 5JSPA 3N4MA 3R1FA 3U10A 4AVBA 2B5AA 1NERA 3IWZA 4EV0A 2LCVA 2WFPA 5KHKA 4Q0PA 5AVPA 4KU8A 4FN3A 4EWDA 3CECA 2D40A 3OGJA 2ET7A 2GC1A 3ES1A 3LA3A 5FLHA 5BUVA 1ZS4A 3OQOA 4YNIA 1ZZBA 1UTXA 3DV8A 2QCSB 2BNMA 3LISA 3S7EA 1NE4A 2KZ8A 2KPJA 2PQQA 1J3RA 2LYQA 4ONUA 2GRMA 3H8UA 3E5XA 3NJZA 4QGNA 1XWRA 5KBFA 2HSGA 2PUDA 2B5HA 4I3PA 2O38A 2XLFA 2IXJA 4JTNA 1QP0A 2EVXA 4X6QB 3CEWA 3U0ZA 4F8AA 1TQ5A 4BYYA 4HBNA 4I01A 3B02A 5FQ0B 2BNNA 2GZWA 4LA2A 3NSTA 2BGCA 3H9AA 4XFHA 3EBRA 4JCYA 3OF1A 1O4XA 3UFDA 4MH0E 2FQPA 2PYTA 1NZCA 3IDBB 4WZCA 3LAGA 4XF1A 5LRRA 2PAEA 3FJSA 4EWAA 2AXZA 3OMTA 2PUGA 2XKOA 2XL9A 2AXVA 3VHRA 2H0VA 4I6UA 1RUNA 4Q0UA 1VPWA 4IA8A 3KCCA 5E16A 3WW4A 4IESA 3SHRA 1ZZ8A 3UKVA 5LEJA 2QDRA 2QNKA 3OQNA 4MUVA 3LOIA 3MLFA 3IDCB 1QXJA 4XFAA 2OFYA 5JCTA 1DWKA 2AXUA 2GC3A 3NKTA 3OTFA 3MDPA 3FE5A 4FT8A 1EP0A 2O1QA 3ETQA 5FPZA 4JQDA 4I8TA 4CYDA 4KL1A 2IXLA 3F51A 1I5ZA 3KZ3A 2UYAA 2PUAA 3NL1A 2XL7A 3BALA 3R6SA 1RPEL 4HVOA 4HSJA 1JWLA 2Q1ZB 2PUCA 2MEZA 4IEXA 5FPXA 2EAAA 3ZKCA 5I8SA 1WH6A 1ZREA 1GQHA 4R8HA 4O9GA 4N9IA 3OCPA 2Q0AA 1OSLA 5I0TA 4YG4A 1IPKA 3M70A 4UBGA 4XFCA 4LULA 2GRLA 4FBIA 1XE7A 3EJKA 4B29A 4E2GA 5FQ0A 3H3ZA 3I54A 5K98B 2PAMA 2XGXA 2HINA 5BXXA 4BH9A 5HI0A 4IEOA 1B0NA 3UKNA 2B8MA 4QMAA 2F4PA 4Z07A 2B9UA 3D1NI 5LRSA 5I93A 2P17A 2AWIA 5D1IA 4YYOA 3FMYA 2KEIA 1UW8A 4X4DA 1UPIA 2PFWA 4YRDA 4BIFA 2IXHA 3GBFA 1QQAA 1CAVA 5FLIA 5C8WA 4YG7B 3H3UA 4QM9A 5EZWA 1J59A 2MNGA 1UIJA 1DGWA 4X4HA 1O5UA 4IETA 4XF4A 1O5LA 1RTVA 1ZUGA 3WW2A 4X4IA 3PNAA 3ES4A 2JCGA 2PUBA 1LMB3 3CLCA 5KHHA 4LLOA 2V09A 1OFNA 2Y0OA 2PAKA 1O4TA 4LTAA 2HJIA 1ZRRA 2IXCA 4NVPA 4JVAA 1Y7YA 1O3TA 1CAXA 2GC0A 5J48A 3ST7A 4Z82A 3SCGA 4R52A 4PIXA 4LEJA 3QACA 3USSA 3JXCL 4E2SA 3JXDL 4Z5DA 2LYJA 3BB6A 3PLQA 2CSFA 2I45A 2OZ6A 3CJXA 1RZRA 1RZRD 1POUA 1ZZCA 1PRVA 1FXZA 4N9HA 1O3RA 4Z5HA 4LA3A 2EF8A 2H8RA 2L49A 2XIUA 1U12A 4GHJA 3HT1A 1ZRDA 1Y3TA 4IEPA 1BDHA 2H6BA 4HLTA 4MX3A 3UKTA 4A2UA 4UXAA 1I6XA 3G5GA 4HZFA 3H1YA 3OQMA 3KGZA 4PU8A 3QYXA 1QQBA 1G6NA 2N7GA 3TRBA 4JCXA 4MCXA 1Q3EA 5CU1A 4GQMA 1L3JA 2O4AA 1GQGA 2EA7A 1J3PA 4AQ6A 1BDIA 3CF6E 1WLTA 1ZPQA 1LLIA 3DN7A 3KXAA 5FDBA 1RGSA 1WIZA 3H5TA 1PERL 4HSLA 4MGIE 4X6RB 4XFGA 2O49A 1CX4A 2IVGA 2LYPA 3OD0A 5FCCA 5J7MA 5KHGA 2R63A 1YFUA 3IBMA 1YUDA 1ZRCA 4EROA 1WGPA 1JUHA 5BY5A 1CQTA 4I6RA 2UYBA 4XEZA 3HIFA 2ET1A 2PUEA 4Z59A 1VP6A 1XRUA 3KJXA 3E6BA 1ZNPA 2D5HA 3FYMA 1R69A 2XCJA 2CGPA 1IC8A 2OZJA 1CAUA 2VECA 1DZRA 3H1WA 4E2QA 1AU7A 5KHJA 1SQ8A 2QVSB 2JVLA 2CV6A 2XHKA 4META 1WETA 2XLGA 1L1MA 4ORFA 1QPZA 1E3OC 3D0JA 1RIOA 1QY4A 2IXIA 4X4BA 4QM8A 2WUSR 1R63A 2MQKA 3EUSA 1UIKA 4IERA 1ZVFA 4TLFA 2KEKA 4MZUA 2CROA 3TNQA 4X4FA 1QWRA 5JR7B 1Q5OA 4F7ZA 3GN5A 2O8QA 2ZKLA 4MGKE 3RYKA 5LEKA 2LYLA 2PA7A 5K8SA 2IVQA 1EFAA 3QQ6A 3MZHA 1V70A 3E6CC 4X4GA 2WIUB 1LR5A 5I8TA 3HZIB 3ACLA 2MHFA 4MCTA 4X4CA 1CAXB 3FWEA 2Z69A 2OPKA 4XF0A 3BS3A 3QF3A 2AUWA 3GYDA 4AVAA 1EPZA 4MGYE 3OP9A 3H50A 2UY9A 1XE8A 4OLLA 4RD7A 1J1LA 2D5VA 3ZHIA 4LUMA 2WC2A 5I0UA 1ZX5A 4WVZA 3KSCA 4PJYA 4QGMA 4JTOA 4J1XA 3CO2A 1PM7A 2K9ZA 4IWRA 1ADRA 2KXLA 4PU7A 1CAVB 1YFWA 1O3SA 1NEQA 3NVCA 4EWEA 2PPXA 3WW1A 4H7LA 1OI6A 3FHIB 1CAUB 5KHIA 2L8NA 4I0BA 4XF3A 1O7FA 2ZCWA 5BV6A 5C6CA 3EHKA 2PTMA 3FFQA 3ROUA 4L2NA 1YLLA 1CJGA 1H1IA 3BPZA 1IPJA 2PHDA 4XFBA 4QX5A 1JH9A 2D5FA 2GAUA 4GULA 1RZSA 3ZHMA 2QJVA
chains in the Genus database with same CATH superfamily
3VBSB 2WNUB 2Y38A 2D6NA 1UD1A 1WMEA 4YW5A 1V6NA 3MEJA 2CAUA 2VM9A 3PL0A 4YM2A 5EFUA 5FYBA 3VBRA 3JD71 2RHPA 2VQAA 2UY8A 4HK9A 3GNEA 3HNYM 4C1XA 1ULFA 3NJYA 5F1RA 1QHDA 2VZRA 1UXDA 2BWCA 4QPGA 4V1PA 2PIJA 4N53B 1J3QA 4XTPA 1SLBA 3PMSA 4AAXA 4CVUA 5FUNA 5K4LA 4Q4V3 5LK5A 5FYZA 1BJQA 1QJY3 4CEYB 5F9TA 2E9QA 2LYRA 2B7YA 2Y33A 4MXWB 5DDJ3 5AVAA 3SEEA 2PUFA 3WW3A 1S0EA 3VBHA 1CD3G 4K1YA 3WUDA 2DUPA 3W5NA 1DHKB 3IPVA 4AFAA 4CCEA 2D44A 1T6BX 3S0MA 2LYKA 4NUBA 3DYPA 5J3UA 5CFDB 3K4ZA 2BW8A 4UW4A 3BCWA 2A6CA 1F35A 4M4RA 3O12A 1E5IA 4CU9A 4AFBA 2F17A 4NJ4A 5GLZA 1ZAYA 4FPCA 5FZGA 4FFGA 4D7TA 1W6MA 4PCRA 2WIIB 4WVMB 2WFF2 3SMHA 4Q0SA 1RJ7A 4A3XA 4KWKA 3RWNA 1ZVVA 3A7QA 2I74A 4WM7C 3PU3A 4DXTA 1QOSA 1ASJ2 3AXEA 1XXNA 5F5CA 2HKXA 4UFKA 2ZEXA 2PMWB 1TE1B 4AWDA 4MGSA 3VUOA 4YPJA 4CEYA 4HANA 2ZEYA 1FI2A 1CAWB 3D82A 5LZ6A 4O8BA 1OLME 5E89A 2JX9A 2OW4A 1OVSA 3ACFA 2CHHA 3WQ1A 5C5UA 5A33A 3NNJA 3I2GA 1MS1A 3UJQA 1OOPB 2OT7A 3RVHA 3S7IA 1H8VA 1HJFA 2W92A 5DQ0A 3WG1A 4AG4A 3G7DA 5ISLA 3B94A 4HXCA 4D6SA 3ENRA 4W4ZA 4XUNA 4JGZA 5JXJA 4FP3A 5FKCA 2QQJA 4UF0A 1SFYA 3VZJA 3NJXA 5I8YA 1UXCA 1VJ2A 3KGLA 4OFGA 2UU8A 1QJX1 1U5ZA 1H9WA 1KFXL 4CZSA 1AYN3 3JZVA 4P00B 3C7GA 4OUSA 2VU9A 3WDUA 1DYKA 4OBMA 3RG0A 4FPEA 4U36A 1GKBA 3NO8A 3OBAA 2XVLA 1W3XA 4Q4Y3 1H1MA 1K12A 1NYWA 3SEPA 3TOJA 3V64A 3VLBB 3GDBA 5L7OA 1PVXA 2CTVA 1NQJA 4IV1C 3U11A 4XILA 4YBAA 1NCQC 1RUH2 2NMOA 4CCKA 4DO0A 1RHI3 1JFTA 4IEQA 2K2SA 4QPIA 5FY5A 2KEJA 1NLSA 3F95A 4CUGA 1OOPA 3VWSA 4HN0A 1LGBA 4QPYA 5BNPB 5JIUA 1O4YA 1X33A 3S5QA 3RWKX 1O91A 2ZOEB 3EYPA 3ZMNA 2E63A 3MPBA 5F32A 1OKQA 3RJRA 4JAAA 4LR4A 3AKPA 1HJGA 1UKRA 3AMNA 1HRV2 3PVBB 2VJXA 5JSOA 3AL6A 1AL23 4Q8LA 4CEWC 4MO3M 1AHSA 3KF5A 4Q4V1 4AEDC 4XUPA 1R1A1 5ERLA 5FWJA 4CDWC 1PNRA 1PO21 4ATFA 4RQPB 4IE7A 1Y4WA 2OR1L 1LCCA 1DQ6A 4MGTA 3CROL 5E8AA 4IDZA 2BTVC 3AVRA 4I0AA 2C0ZA 3AYCA 3NZLA 3UV9A 4QGLA 3FHQA 4BA6A 1X57A 3KCXA 4HETA 3I59A 4P5YA 5E1RA 2K0GA 3AZXA 4BQWA 1MPXA 1JZ7A 1X9TA 3DYOA 2GNMA 4E9KA 2K46A 1H4HA 2YBKA 2EBYA 4MOAA 2HWC2 1ZM1A 4FPYA 1X8MA 3WVJA 5FPVA 5A7LA 4NDWA 1MS3A 3G6JB 1DZQA 4NN0A 3A9XA 3FL7A 5A1AA 1EY2A 1ZZ7A 1SLTA 2D6OX 1UOGA 4N43C 5EJ1B 3AP7A 3O9XA 2AENA 4N7IA 3GCWA 3VBOC 2IUOA 1GP5A 1IGOA 1OURA 1W8FA 4RGKA 4OZOA 2G9ZA 3J7NA 1KS5A 4ZONA 3VDDB 3T09A 5LA0A 3DXTA 3WG2A 3F52A 1SCSA 2P1BA 3PHMA 1UMZA 5AFEA 1NE6A 4K9SA 2ZGTA 4HRAA 1HV0A 4QXHA 1F5FA 1NERA 2HH9A 5LY1A 1US3A 4NWWA 4Q0PA 3ZDVA 3WHTA 1QU0A 4DE9A 1S4CA 3VDCA 2O0OA 4EWDA 4DOUA 1GOFA 3OGJA 4AEMA 4XDPA 2DBIA 2GC1A 5HCAA 3ES1A 3CHXA 2C26A 1KDMA 3LFIA 3MFCA 3LA3A 5BUVA 3KB5A 1AR73 2W95A 5F8PA 1SBFA 2HBTA 3U75A 1UTXA 2FDJA 3DV8A 2BNMA 1TZOA 1C1LA 1NE4A 1H8TC 4NWVA 5T5JA 3H8UA 1R1ZA 5IFPA 1GZCA 2GP3A 4I30A 3T0DA 3VBFB 2PUDA 2VTXA 3UWPA 3BGAA 1VALA 2O38A 4I3PA 4DY3A 2IFWA 5DUUA 2XLFA 2P3IA 3NWKA 4XE9A 1OKOA 1WD4A 3VBFC 1VMHA 3W5MA 4AR2A 5J48A 5FQ0B 1ENRA 1RVF3 4L97A 3INAA 5EIYB 1VAKA 4CDUB 2L1PA 1XNBA 4GA9A 1Z7S2 4AYUA 2DCZA 2YHJA 3VZKA 3OF1A 3AZWA 1O4XA 2Y0IA 4DZGA 4JQTA 3QH6A 4WM8C 4DNYA 1QJY1 5IVFA 1QIQA 2FQPA 3IDBB 4XF1A 3LDRA 3LAGA 3VBHB 5BNOC 5CKQA 4EWAA 2ID4A 1F4HA 3O0VA 2WSUA 4XJ8A 2AXVA 3DEMA 2VZTA 3ZKYA 3U4XA 2VG9A 1HV1A 4Q4X1 5FIXA 3THTA 3I2IA 3WNNA 4IGPA 4BCUA 3D5OA 3TEYA 1RUNA 3DPRC 3WW4A 3WOGA 3WDWA 2ZAHA 4FQ4A 1AVBA 1AR61 1YI9A 1VBE3 5JIAA 3UKVA 2QDRA 4MUVA 3OQNA 4CEYC 3LOIA 4Z8BA 1YQ2A 3UT0A 2VVEA 1IS5A 5ACA2 1A78A 1AJOA 3AKRA 4XFAA 3WNLA 3J7HA 4LJHA 3ZYRA 5DUWA 5LWBA 3LKJA 1DWKA 1GOGA 2E32A 3NNMA 3OTFA 5L19A 5BNNA 2WA3A 2WT2A 4FT8A 1QQP2 3U37A 3VKFC 1FOD1 2O1QA 1QNWA 1C57A 2P37A 2IXLA 2VQUA 1BEV2 3F51A 1I5ZA 2VULA 2A6XA 4XPVA 5FMBA 1S1AA 3NL1A 4XABA 2XXQA 4DE8A 1AL21 3R6SA 3A0KA 2AR6A 4HVOA 4QB1A 2LTNA 1JXNA 2PUCA 3VBUC 3N9QA 2Q5TA 4IEXA 4N53A 4W65A 1U2ZA 2J1SA 5CKNA 2W94A 1GANA 3B01A 3ZYJB 1VBC2 3WG3A 1F9KA 4RGGA 1VMJA 4R8HA 2LNMA 2Q0AA 1QOTA 3ZN5A 5HCHA 2QZ3A 4YG4A 4UBGA 2RMU3 3W9AA 4LULA 4XQWA 1WLCA 3U07A 3EJKA 3LQCA 4LBLA 3LE0A 3P3NA 1LOAA 1H0BA 2Q8CA 1D0GA 2XGXA 2B45X 2X8KA 4BH9A 2PHUA 4IEOA 1B0NA 3AMQA 1VRH2 1ZBA2 2O8OA 4I3GA 4QMAA 4Y5Z0 5C7GA 3FUOA 4HPKA 2B9UA 2V72A 1DQ2A 2J42A 2JDUA 3C2UA 4BJ0A 5IK7A 4RR3C 5LRSA 3RZGA 1POQA 5JZGB 3POBA 5D1IA 2BUKA 4NIHA 3FMYA 4Y24A 1PO22 5JOXA 4YFWA 1QB2A 2IUWA 1AR91 1UPIA 3HNMA 4G3YC 1V9U2 4OHVA 2IXHA 3GBFA 4BIFA 4Y22B 2W0XA 2BFUL 2WQ8A 2XJVA 2R071 4CDWA 5C8WA 1KRIA 4OI1A 3LD8A 4OZXA 1DGWA 4Q2FA 4X4HA 1K5MC 5FY1A 1O5LA 1RTVA 1LESA 1ZUGA 2TNFA 3IM0A 4RHV3 4XQDA 5DTMA 3IAQA 3JB8A 4QHOA 4X4IA 1OHFA 1YYNA 1F15A 4MHRA 4QDRA 4CXWA 3DM5A 4Z92B 2JCGA 2QE3A 3CLCA 1LMB3 4IXLA 1REFA 1BKZA 4S2GA 2Y0OA 1LU1A 1QJX2 1RVF2 1ZRRA 2JG8C 3KV5A 4XUTA 3H8RA 4NVPA 3JQWA 3SH3A 4KMQA 2HWD2 1PIV3 4FP2A 1UXZA 3KHBA 2EAKA 4Q4X3 4KI5M 1SLAA 1W0OA 2XUEA 5F5IA 3PLQA 3BB6A 5SV8A 4R4ZA 2X09A 2J7WA 1RZRD 1FXZA 1Z78A 1PRVA 2R16A 3BIWE 3M7AA 4Z5HA 4MYEA 3J8F2 4N9HA 1JOPA 2FDHA 3HT1A 2VZPA 1QXPA 5F6LB 1EV11 4IEPA 5A80A 1BDHA 1LHVA 3Q8CA 3ILRA 3T3YA 3UKTA 3ZFFB 3K4DA 1I6XA 1RMU1 2VZ3A 4XUOA 2EF6A 2R6QA 5A3UA 2LLVA 2KR2A 3SLIA 1NOVA 1MZEA 5JOZA 4PU8A 2JQEA 2G9FA 2VNGA 2OQ7A 3UL2A 2XONA 2QUOA 5CU1A 4MCXA 1Q3EA 1N47A 5K0UB 2BGOA 4ER3A 1UXXX 2XPJA 1J3PA 1BDIA 1UZ0A 3AX4A 3J26N 1JU4A 3PUSA 1UOJA 4CDWB 1ND3B 4AHWA 2DVAA 5A3PA 3I49A 1NA1B 5FJHA 3DN7A 5GLVA 4D6QA 1RUD2 3RZKA 4MGIE 1FPN1 4AVSA 4N43B 4Y26A 3OD0A 3AZYA 2YG0A 1B35B 2R63A 1YFUA 2YPDA 1W8UA 2ZHNA 2A70A 3CJIC 2RM21 4BM8A 1XNTA 4CDQB 1ND3A 4K40A 1CPNA 1YUDA 1UU6A 5FPLA 4DQAA 3QD6A 5EYYA 1LHWA 4EROA 1WGPA 1H2LA 2QQKA 2ILMA 1JHJA 2KD7A 4I6RA 3H42B 3MHZA 3OYWA 2BERA 1B35C 2WZR2 4UWDA 3T1MA 1JZ5A 1YQ8A 2FDIA 1W9FA 2WLPA 5DZFA 1HB1A 3KT4A 1KQRA 3KJXA 2WS93 4LIVA 4FTEA 3FLTA 3WCRA 3N9PA 3FYMA 1R69A 3OPTA 2GNDA 4GWNA 5DTRA 3F2ZA 2A73B 3WG4A 3POGA 2VECA 4AEJA 5GM0A 1D4VB 1ZRIA 1AU7A 3T4HB 1GSLA 5CFCA 1JZ3A 4CRQA 3EXUA 2EIDA 4META 4NIIA 1UAIA 2JDZA 3T1LA 1Q8VA 3ASIA 4ASKA 3ZYIB 1QY4A 3V56A 3ZSEA 2JB8A 3VDAA 3EMRA 4BMBA 1HQ1A 3EUSA 5FYHA 1G7YA 1GWMA 1PVC2 4MLOA 5IK5A 4GXLA 3GJBA 4LBMA 1RUI3 2MEV1 2CROA 3VZOA 5A70A 4A42A 1BHGA 4OULA 1I1EA 4FXGB 4QDQA 1UYYA 2C24A 2CGNA 1REEA 3GN5A 4P14A 4WZFA 3BYWA 4F7ZA 2OIIA 5A6QA 2RS51 2FZ2A 1OF4A 2BZDA 2G9GA 4A41A 2LYLA 5BNNC 2NMNA 3PIGA 5CKMA 5JLVA 2RJ2A 3AMHA 1XSRA 1V70A 1E5HA 3E6CC 3AK0A 2OPWA 5GZGA 5HPOA 1RHI2 4JGYB 1MS5A 4MCTA 1R081 2WLQA 5FWEA 4BQ2A 1DF0A 3SISA 1VBE1 5FP4A 5LATA 3GZEA 2Z69A 2OPKA 3BS3A 3JBG3 3O0XA 3QCWA 3ZYHA 3GYDA 1C1FA 1B09A 2DCKA 4AVAA 1H6YA 2PXFA 3P6BA 1XC6A 1W2AX 4E4HA 4Y33A 1OBNA 1YQCA 1XSQA 1GP6A 5FMDA 4XYXA 4LUMA 2W87A 2F6BA 4QKNA 4ET7A 2QZ2A 4QGMA 2WNOA 4JTOA 4YW4A 5FYUA 3CO2A 4P9YA 2VW1A 3WF4A 4COZA 4HOOA 4BDVB 4IWRA 1ADRA 4Q2JA 2ES3A 1HXS3 4YVWA 4CCLA 1WCUA 1YFWA 2VQ0A 3ZO0B 5FZIA 1C5HA 4FVVA 2VZUA 1PK6C 3CZJA 5KHIA 3AB0A 5HV0A 1RHI1 3SKVA 5ABJA 2XBO1 4LO4B 4XF3A 2XJSA 5F3GA 3ZYPA 5C70A 5C6CA 5BV6A 2J1UA 5IK8A 2QFEA 3FFQA 4WV8A 4Y1YA 1JYWA 3T30A 3Q8EA 5C5TA 5JI9A 3O1VA 2PHDA 2ZX3A 1W9WA 1RUD3 2D5FA 5C71A 1Q8SA 2B4KA 4JGZB 1VBD3 3ZHMA 4LBQD 4PBOA 2BPA2 2ZAAA 4K7JA 1X2LA 4AEDB 5A1FA 1RL3A 3LEMA 4UFMA 3P5BA 2YMZA 1GT0C 1HQNA 3NXHA 2YB7A 2XJQA 2PELA 4ZHNA 2PHLA 1G9DA 5F3IA 1RUI2 1RXGA 1JUIA 4AEKA 3BVCA 4LMFA 5JSRA 2ZGPA 2BBAA 3BD1A 5FUIA 4Q0VA 2Y26A 2A6ZA 1K5JA 1ULDA 1SFNA 3HT2A 2ATFA 4HVQA 3BN6A 1MZFA 5F5QA 5E88A 3PTYA 5T55A 3KT1A 1SDDB 4LBNA 4K6BA 4NR1A 4N43A 2BV4A 2J1TA 1JYTA 1CR7A 3LSDA 5DUVA 4E8CA 1JZ6A 2IV1A 3TN92 5IW0A 3O0WA 3VBOA 4K20A 4QXBA 3KMHA 2ZGUA 3OGVA 4FTSA 2DYCA 3FUQA 2XR4A 4UBHA 1UU5A 2R30A 2VQTA 4XETA 2WS91 5A3LA 1YHFA 3DYMA 3ACIA 5FMOS 1JFSA 3URFA 1R1A2 1LTEA 3K51A 5IT6A 5CNAA 3VV1A 2GH2A 1DLLA 1YJLA 2RDNA 3R05A 5FYSA 2OA2A 1N1YA 2ZEWA 1PRUA 4K1ZA 4LBOA 1AJKA 1O8PA 1Y43B 2XWBB 2D6PA 1D4M3 4DUWA 3ELNA 1NXMA 3GN5B 1W06A 4R9DA 3USUA 3ZKUA 4AGVA 2FHRA 4Q8KA 3D6EA 1KDKA 2FBEA 1UYPA 5FP3A 4QB2A 4JDMA 1APNA 2D93A 1Q43A 4NIGA 2R1JL 1RUF1 2JDAA 1DBNA 3FZ3A 5CG8A 1W6QA 2VOKA 3RRDA 5CADA 2Z79A 4DXRA 4CP2A 2OS2A 1JZ2A 4N7UA 3ZXJA 3SCFA 4OQ8A 1NQDA 2YXSA 3VZLA 1R64A 2ETEA 4TYSA 2EXKA 4FPFA 4XFIA 4CCJA 2JD9A 3IIAA 2BQPA 4LBKA 3RZLA 3LEGA 2LLWA 2FMYA 3TN91 1ENXA 1W6OB 5FZ6A 1OLQA 2ENRA 3HN1A 5SV5A 3RGBA 4QQLA 3TNPB 2GP5A 1S0GA 1VR3A 4K8FA 5L7OB 1XNDA 1LCDA 1TNFA 3ZXFA 3N7LA 4CDUC 2D6KA 1ZA7A 3HQXA 5FXZA 5D8AC 1UKGA 4PBPA 1DGRA 3ZR5A 2ZGNA 3WQ0A 4AXOA 2AACA 2PE5A 4B3NA 3OGGA 3N9OA 5C3OA 4JDNA 1BBT2 1XB9A 3RYRA 4RYDA 3L2HA 3AM2A 1RUF2 1YWKA 2R32A 3LSEA 3N9MA 3LA7A 4LNVA 2Y8KA 5ABJB 4I6TA 4YARA 2OXBA 3DPRA 4GWMA 4Q29A 4O65A 5FZ8A 5FO9B 1UZYA 1OA2A 1VBC3 1S0BA 3WF0A 3THPA 5JR2A 5I0SA 2C9KA 3IN9A 5DDJ2 2IC1A 5T5PA 1LRHA 4YG1A 2PHFA 3LFMA 4MV2A 5F3EA 2HWE1 1CAWA 5FZ4A 5A32A 3RZHA 4IEVA 5AC93 1CVNA 4WM8B 4NHLA 4YZ3A 3CL1A 4Q4X2 3BDNA 1AX1A 4GKYA 4UYBA 4XJUA 4ARXA 3UGHA 5FY0A 3WF3A 5LA9A 2B46X 4IEYA 4PI2A 3V0AB 3J8F1 4NROA 2VNRA 4XZUG 2QQIA 2JXAA 4AVVA 3FX3A 5LB6A 2DCJA 1RJ8A 3SCHA 4IE5A 4QU2A 4Q1PA 2ZTNA 3AJZA 5D2AA 4XJZA 3NMBA 2R1BA 4N53C 2MXDA 3OEAA 5IFTA 3PUIA 4Z2AA 1WBLA 3AYAA 3NDBB 1QEXA 3KQ4B 5CFDA 2CL2A 3VBUB 4AOCA 4BIOA 1LOBA 1CZSA 2CDPA 1E5RA 3L1PA 3QOXA 4EZIA 1UCXA 2W5FA 3I4IA 4QAWA 4ZZ5A 4FPJA 2RDQA 2E7QA 2V73A 4ZU4A 4CDXA 3B7HA 1BZWA 1OLRA 1RUJ1 2A3WA 2AGSA 4BQ1A 3DUIA 3ZXKA 2HWF3 1XYOA 2YPJA 4NRQA 3F6WA 1YFXA 4HVRA 4XAAA 5DXDA 1D4M1 4A44A 1M06G 2XSDC 1I3HA 1KXGA 4EYUA 4A4AA 4GJZA 4NPRA 1OFSA 3U1XA 1RUE2 4PIYA 1TME2 4YGEA 1LGNA 2WQ4A 3HVDA 4Y4RA 4YW7A 1H8TB 1BCXA 2IXKA 2R072 4HKOA 3T08A 1QXRA 3ZFGA 2DURA 4CCDA 4XTMA 4BZ4A 3POYA 4YZ4A 3K75B 3K2OA 4JRLA 5FZKA 1K3IA 2WUHA 5JSPA 3N4MA 5TSWA 2DWRA 3LB9A 5C3RA 4MG2A 3IWZA 2CDOA 4EV0A 2LCVA 1PX3A 4P08A 5C4WB 1V6LA 1Q8OA 1QOOA 1PGL2 1PMJX 2D3PA 1VBD2 2JICA 2P3KA 3CECA 5J37A 1V0AA 4UAPA 3WP5A 4M3CE 1VRH3 2ET7A 2JG9B 2ZGOA 1GLHA 4MHUA 3VD7A 2PHTA 1S2KA 5IWFA 1PHMA 3POSA 3NJVA 1ZS4A 1RUH3 5FLHA 2JKBA 5CZKA 3MIBA 2RR12 1GFF2 1YQ6A 3ZPYA 3LISA 1GYKA 4CE8A 4COWA 3R4UA 2JG9A 2KZ8A 2VZ1A 4D8MA 2XXPA 2KPJA 3OY8B 2GRMA 2ZHLA 1UX7A 1F8VA 1XWRA 4W8JA 2HSGA 2EXIA 2B5HA 2JE9A 2WL1A 4PF1A 1A6CA 2HBUA 1OA3A 1GZWA 1IPSA 2IXJA 2XMLA 4M4PA 2EVXA 4RHV2 1LAJA 4IUGA 4ZS3A 1TQ5A 1AL22 1WWYA 4EN7B 4I01A 2YYOA 1W6QB 4DXSA 3O1UA 2WNEA 3OPWA 1VBC1 3NSTA 2BGCA 4XZPA 5GZFA 3PMEA 3I2OA 2WO7A 2W39A 3EBRA 4AGRA 1NCRB 3ZOIA 3LIHA 1MEC2 3Q9OA 2YGLA 3T2QA 5A7SA 1KJLA 2YDEA 5G04L 1K45A 4M0HA 3UFDA 2VR4A 4MH0E 4RGAA 3GUUA 1MZ6A 1W6OA 2CY6A 2VMFA 2J1RA 4AF9A 4AHYA 2XQRA 2PAEA 3FJSA 4MXVA 5JVVA 3ZVXA 3H8OA 2AXZA 1XU1A 1NCRA 4LKSA 4ER0A 2VL4A 2GDFA 3VHRA 4Y20A 2ZXQA 4V2VA 1NCQA 1Y9GA 3B9IA 3K77A 2GN7A 1HB4A 1V6OA 2PQSA 3KCYA 4QPIC 4IA8A 3NNGA 2VBBA 4EQZA 3PJQA 4IESA 2NP0A 3FBYA 3VZNA 1OT5A 5LBCA 3UYJA 3ZXGA 1MQTC 2YFUA 3MLFA 1FAYA 1HB2A 4DB5A 4JX0A 4KH9A 3WNOA 2FFHA 4PF5A 4PT6A 3FMGA 5JCTA 1LHOA 5C3QA 2AXUA 1VBB2 2GC3A 3GGLA 3NKTA 1QJZA 1ZBE3 4JCKA 1PO11 5I0DA 3AKTA 3WF2A 4ARYA 1YQ5A 4UFHA 2NQYA 2VGDA 3ETQA 3L2YA 5FPZA 1ALYA 1JZ8A 4I8TA 3MBWA 3O1TA 2WT1A 3KZ3A 4LO6B 2VBPA 1CWPA 1LCLA 1JYNA 3ZR6A 2DCYA 4LKEA 4CDUA 3JB4C 3ZFEB 2PXLA 3KQRA 1JWLA 2Q1ZB 5DAQA 3PE5A 4R9CA 3IPVB 4KWUA 5FPXA 2JDYA 1AX2A 3ZKCA 1NG0A 2GH8A 5I8SA 2VZQA 3V0AA 5JMOA 2YBPA 3N7MA 4Q4W2 4O9GA 2JDMA 4AQTA 4N9IA 1S2EA 2WFF3 2ARCA 1OD3A 5FQ0A 4B4QA 4ER6A 1R091 3H3ZA 1NA1A 3N9LA 1QJX3 5K98B 4AI9A 3B69A 4TLGA 2M4HA 2BP6A 2JE7A 2WSVA 3FN9A 2RS33 3MIHA 3VKMA 5HI0A 3VDBA 1DGLA 5FZBA 2EXHA 2F4PA 3TAYA 1IS6A 3AP4A 1W6PB 3I3EA 2P17A 4CDXB 2BVBA 2NLRA 3DGTA 1UYZA 5B2GB 1AYM1 2KEIA 3AJYA 4FTBA 2RR11 3WINE 2ARBA 1NUKA 2PFWA 2LM3A 1Z7S3 2OX0A 4YRDA 5A7WB 1CAVA 1N1SA 3ZFEA 4CA9A 1C8M2 2BOIA 1WCQA 2AC1A 1J59A 1UIJA 2J7MA 1EV12 1A8DA 2VOXA 5FK8A 1VRH1 1UQXA 5GKAC 2Y6KA 1W6NB 2V5YA 5FZDA 5J09A 3WW2A 2X10A 1REDA 2XXZA 4A45A 2WWSA 2WYSA 3GZTB 5JXGA 3ES4A 1OUSA 2PUBA 1JODA 2VTXJ 5FZFA 2HWD1 1PVC1 4CU7A 5FY8A 3ME5A 5A7QA 4NIAA 1ENSA 3CKHA 3B9CA 2VY0A 4LTAA 1GV9A 5D8AB 5EPAA 2YROA 2XVGA 5B4XA 4JVAA 1Y7YA 1SBEA 4ZKTB 1QJU2 3VBSA 2QQUA 4QPGC 2GC0A 1AR81 4KGGA 3AMPA 2BVVA 4LE4A 4Q27A 5A32B 3ST7A 4L99A 4D6RA 1YJKA 3QACA 4HKLA 3JXCL 1N3QA 3USSA 4EJRA 2RS53 1TMF2 3MUY1 5JOWA 2CSFA 1H2NA 3Q8BA 3RSJA 4GB32 3NNLA 1ZZCA 2B39A 3JU9A 5GJ6A 1JYVA 1G9BA 4IV3A 4LA3A 3SC7X 3VBHC 2L49A 4KBZA 1Y7BA 4GHJA 2RVAA 1FMD3 2D7FA 2WWUA 1Y3TA 4BU2A 4GWIA 2D97A 5ANNA 2R041 1W6MB 2JKXA 1IKPA 3CDZB 4COYA 5FZOB 1PGW1 2DBNA 4GQ7A 4QKFA 3OQMA 3KGZA 4GIQA 1JW6A 4Q4V2 1XOYA 4DMIA 3TRBA 2ZS6B 4GQMA 2J1VA 1QGLA 3IKWA 2EA7A 3NV2A 3V65A 1FPN2 4L0PA 4AQ6A 4BQ4A 2EIBA 4XIKA 1QF3A 4ER5A 3HNBM 1VRBA 3O7OA 1WLTA 1ZPQA 4QU1A 3OOXA 1PERL 1H6XA 4XFGA 2O49A 1CX4A 5J7MA 2GNBA 5KHGA 2C9AA 4GD4A 3SH4A 1XPWA 5A33B 1JU3A 3BPSA 1UY2A 3R4SA 4XCBA 3TRSB 3KZ4C 3MICA 4LITA 2JDNA 1V6MA 1JUHA 3ZYGA 1CQTA 4YG3A 4CCMA 2JWPA 1ND2B 3AKSA 1GMMA 3HIFA 4NMIA 5DMYA 2AEZA 3T2TA 2NYYA 5GAHi 1ZBE1 3O1SA 4Z59A 1VP6A 1BVP1 2WT0A 1VAVA 3MLJA 3KL4A 2JE8A 3IB3A 2XCJA 2CGPA 3M3OA 1QDCA 1NW3A 5F7UA 3WXPA 4Q4W1 4E2QA 2VXRA 3V0BB 1CJDA 3ORJA 3S5AA 4LK6A 3AC0A 5AFBA 1QQP1 2OUJA 5KHJA 1BMV1 2QVSB 2XHKA 1WETA 3MF6A 4ORFA 2VD7A 1XNCA 3D0JA 2YC2A 4X4BA 3OD4A 2V4VA 2W1QA 2XH6A 2Z42A 3ZN6B 4IERA 1ZVFA 2WZEA 3M2MA 2KEKA 1W90A 1MQTA 4B1MA 4MXWA 3TNQA 2XDVA 2W1WA 1LHNA 1N1TA 1Q5OA 1H4GA 1C5IA 4WVWA 2ZKLA 4GB33 2RG4A 1AXZA 2W1UA 4Q4Y2 5BNQA 1DU3D 3GZAA 4YVSC 1GICA 1UY4A 1W9TA 1WD3A 2PA7A 5DUXA 4K3UA 2IVQA 5F39A 1MR5A 3QQ6A 1WW4A 3MZHA 2GMPA 4DXZA 4GH4B 1CQ9A 2PHRA 4X4GA 1OH3A 2WIUB 4H3WA 4AFCA 4SBVA 3HZIB 1LHUA 4UFJA 4AHXA 2FDGA 3GHNA 3M3QA 4LBJA 3FWEA 1ACCA 4PQQA 5G05L 4JZRA 4DPNA 3TEPA 1VB2A 2R042 1BMV2 1V6KA 4XMAA 1XQNA 4NHYA 5FZHA 1UY3A 1O6UA 2PXTA 3H50A 2UY9A 4JKMA 4O7XA 5L9RA 4UW5A 4RD7A 3K46A 3ZN6A 2D5VA 5D8AA 2WC2A 1ZX5A 4WVZA 1WW7A 3KSCA 2QQNA 4HK8A 4PJYA 1WMXA 1CESA 3KM5A 1X9PA 2J1AA 5CA6A 5A3WA 1BEV1 5A7PA 2I2SA 1D7PM 2ARAA 3IMMA 3VD5A 4PU7A 4RFRB 2ZMKA 1O3SA 1NEQA 3NVCA 2DFBA 3N36A 2W9XA 3FHIB 3AL5A 1W8ZA 2QQMA 4FPHA 5EP9A 4EK9A 4BB3A 3DECA 1LODA 4FO9A 1AR63 1NY72 2KM2A 4OI0A 1W2OA 2HYXA 2JEMA 2PTMA 3ZFEC 5T54A 4EN9B 3AYEA 4L2NA 4LHKA 1CJGA 4XAEA 1FYUA 1H1IA 2JDHA 4R4XA 1IPJA 2P2KA 1JH9A 3ZSKA 4H7MA 4YLZA 5FZAA 1DFQA 1RZSA 4GULA 5H9PA 3TB0A 5C3PA 4BWOA 3U3WA 5I0RA 4HN1A 4Z2WA 1V6IA 4IEUA 2WRAA 5H9SA 5JUWA 2RMU1 2ZJCA 1PMIA 1WKYA 1LECA 2RR13 2XB6C 1A3KA 2PXBA 1PNGA 4IVZA 2XHNA 4D7SA 4EN8B 1FT9A 3OBTA 5FRAA 4FAHA 5JXIA 1HXS2 2Q30A 1PK6B 1VIWB 1OD5A 4Z5CA 1S0JA 4AGGA 3IVPA 5LY2A 5CVRA 5K0UA 1HF0A 1ND2A 3CJIA 3PVOA 4CDXC 4GMP1 4UFLA 2O14A 3MYXA 4BPZA 4YSFA 5FO8B 4R9BA 1RUE1 4Y1XA 5C8CA 2HEYF 1Y9QA 1DQ5A 1EYBA 1UY0A 4FPGA 1EAH2 3ZSLA 3ILFA 3L9JT 1PIV2 4IV3C 3ZFFA 1O59A 1KEXA 1WCKA 4H55A 2WO3A 2R063 3AVSA 4A7YA 3CBNA 4PU4C 2WWJA 4E8DA 5GZDA 4F8DA 3QBQA 4PDWC 3DL3A 2XLAA 1QMJA 2Y64A 3WR0A 2ZMLA 3LGRA 2H0BA 3THCA 3WCSA 4AFMA 5C33A 2WYFA 5CFCC 3UNPA 3RZMA 4BHPA 3OKZA 3DKWA 4PDWB 3M3IA 2DF7A 2XI8A 3P1IA 1CX1A 4OMDA 3E97A 3D4KA 2IVIB 2GC2A 3IAPA 4Q4W3 2D6LX 3SXWA 4AI8A 3EO6A 4CP1A 1YFYA 5LA2A 1WA4A 3LA2A 5CG9A 4W50A 1SMVA 4AQ2A 3AP5A 3BTXA 1WW5A 2LALA 2VMIA 3HBZA 1ULEA 1S0FA 2UWCA 1FPN3 1HN1A 2XXAA 3KT7A 4Y3OA 5FLJA 5J98B 4B7KA 2D3RA 4JKLA 2BDRA 2EIEA 4IEWA 2CNAA 4P9IA 2YFZA 2I07B 2JG9C 3TWIA 3W20A 1ODNA 2RDRA 5FZEA 3RYPA 1W99A 4JC1A 4FOYA 3H0OA 3M3EA 1FNZA 2X5IB 1W9SA 4PLMA 3JUUA 2R49A 3DNVB 4FFIA 4EZ4A 4P9GA 2VH9A 3WHUA 4PIZA 1TME1 3GBWA 4XBQA 4NIDA 4YGBA 4CP9A 4GMP0 3BTAA 2ZMNA 4ES8A 1CPMA 3WY6A 4ZZ8A 3AP9A 3HD8B 5DABA 1AR93 3TYJA 2PXPA 4LXLA 2UWAA 4YW6A 4AHZA 5ANQA 1RC6A 1UY1A 1DGRN 2VW0A 1EUTA 5T52A 4MGZE 2XJPA 3KV4A 1K42A 1CIWA 5F37A 3A9ZA 4E4ZA 4YZ5A 4UW6A 4PHZA 2HWC1 2Q4SA 2ZX4A 4RHV1 4IEZA 3USUB 4CTEA 4YZ1A 2GALA 1SPPB 2A1XA 1NCRC 1W9YA 1AYN1 1QH7A 5CEHA 1OCTC 1MS8A 2ZX2A 4LE3A 3MIGA 3O1PA 2XQXA 1O3QA 3BKZA 5J36A 4FCAA 1GBGA 2DU1A 4I09A 4XXPA 3VB9A 4BMEA 5FXVA 4UOJA 5LCWL 1D2SA 4HPKB 3QWGA 3WNKA 2IVBA 3ITQA 4PU3C 3ZFGB 2ICPA 5AC92 4TZDA 4UFIA 2Z2SB 2ZGSA 2DCTA 4QX1A 2NPIA 3T2OA 2YGMA 1ONAA 3PUAA 2CAVA 4CPBD 3CIHA 2V3CC 3UJOA 4BOWA 3RI8A 4O61A 3RDIA 3NV3A 2WJSA 4RS5A 1PGL1 5KXBA 4AFDA 4FAGA 5IUQA 5A7OA 1OH4A 4LQRA 5DPNA 3J7MA 4URAA 1NZIA 4WBBA 2DU0A 2OYZA 2V5DA 1G9FA 2IFRA 1W03A 3I7DA 3D0SA 1LEDA 4GB31 3KF3A 3ACHA 3QOWA 1HW5A 1VBB3 4NO4A 1U5YA 4IE0A 4XVHA 5E6HA 4DRVA 2BEOA 3PXPA 3I59B 4KU7A 5FYMA 1RMU2 4GKXA 1FV2A 1NAEA 3BTZA 4IL7A 1ZA4A 2Q1FA 4OHWA 2KA3A 3IDAA 4Y1ZA 1MVQA 4ZU5A 2WNVA 3WLUA 2BYVE 3NW4A 2JG8A 4XQ4A 1RUJ2 3OG2A 1QP4A 3WSOA 2WZR3 4LHNA 1NA1C 1LB2A 1J83A 3QFIA 1I9RA 2VVDA 1SPPA 4Y5SA 5IJRA 2FDKA 2J7UA 1GNZA 3E5QA 1AXKA 3NROA 3SX0A 3H7YA 4XDQA 1R093 2DDUA 2WNUA 3BUCA 3M9LA 3CJIB 1LKNA 2ZGRA 2IVJA 3GBGA 2BGPA 4OCTA 1L7RA 4TWTA 2BFUS 3NAPA 3AZVA 2CSGA 3N35A 2RJLA 2DTYA 3ZPXA 5LK7B 4A7ZA 1W0PA 3C3VA 1VMFA 5FPUA 3R1FA 1BLZA 3U10A 3ALQA 3VDDC 1ODMA 2B5AA 2QQLA 3HBKA 5FYYA 3VD3A 4YGCA 2GMMA 2Q1MA 1N3OA 2WFPA 1C4RA 5AVPA 5KHKA 4KU8A 1GWLA 4A3ZA 4FN3A 2PXUA 5A6XA 4CUAA 1XNKA 4DEVA 3UETA 1RUG1 3W21A 3MI8A 3PVNA 5CYYA 2HWB2 5ACA1 1W28A 2VVFA 2RS12 1ASJ1 1OF3A 3MW3A 1HB3A 4YNIA 3ZIWA 5FYVA 4EKGA 1AUYA 4CDQA 4QX3A 2HEVF 1RYYA 3FFZA 3S7EA 3THDA 2HYKA 4WVVA 1J3RA 2LYQA 3MO4A 3NJZA 4ONUA 4C8DA 1O8SA 3VBSC 1XYPA 1R092 4ATEA 3LDBA 4AL9A 5C8CC 2DVGA 4CUCA 1W8TA 4JTNA 4OUEA 4XJWA 5A6YA 3ZFFC 2YV8A 1YXWA 5DG2A 4LO5B 3WF1A 5IAVA 5FP9A 4QD2A 4HBNA 5FZ0A 2BNNA 1DIWA 4ISRA 2GZWA 4LOTA 4NHKA 4RA0A 1W8WA 2W08A 4BK4A 3H9AA 4CUBA 5HCFA 5KR7A 1KFUL 5FFOC 4C91A 4DUVA 1R083 4JCYA 3FC0A 2VC9A 2XJRA 5JDBA 1RVF1 4DUXA 1FMD1 1UNBA 2JD4A 5LRRA 2PYTA 1NZCA 4WZCA 1R082 5JAXA 2NZ9A 2VUAA 3DF0A 4QT6A 5FUPA 4CP0A 1LNSA 2R043 1G9CA 3OMTA 2PUGA 1N1VA 1GOHA 2XKOA 1NKGA 2XL9A 2Z4FA 5FO7B 1MZ5A 2R061 4LLFA 1IHMA 2ZKNA 3VN4A 1ULGA 2H0VA 4U2AA 3AYDA 1AYM3 1Q8QA 2W3JA 2W1SA 4Q0UA 5IK4A 4WVMA 1BBT3 2P3YA 1VBB1 1WLDA 3KCCA 5E16A 2C6SA 2TUNA 3SHRA 1ZZ8A 3MIFA 1GR3A 1D0HA 5LEJA 3MPPG 2A6WA 4SLIA 4HT1T 5CAZA 3PU8A 3WNPA 1BVVA 2SLIA 1H30A 1PGW2 1QXJA 2J1EA 2OFYA 2E7TA 4A6OA 5JXHA 4ZXKA 3MDPA 1S0IA 1KS4A 5FYIA 4YZ2A 4JQDA 4OI2A 4KL1A 1E5SA 2AZ5A 3BI3A 1TVGA 1COV3 2PLV3 3GALA 4Q5OA 4DIQA 1PM4A 3O5SA 2W46A 1JZ4A 4RFT0 4CU6A 3SNMA 3UESA 5A3NA 3FHAA 2GSYA 1RPEL 1ULOA 3LQXA 4HSJA 4CCCA 1AF9A 4X8NA 3KLSA 4YW2A 2MEZA 1JOBA 2VBDA 1HIXA 2EAAA 2FMDA 2LUWA 5A7NA 1VBA1 5BNPA 5FY7A 4UI9L 2UWBA 1WH6A 2JIJA 4XBLA 1Z7S1 5FOBB 1GQHA 5F5AA 1ZREA 1PZ8A 4BQ5A 1UOFA 5LBBA 1OSLA 4WVLA 1DQ1A 1OSGA 3PVEA 1IPKA 2W47A 3M70A 2R1DA 4P9JA 4XFCA 3EB7A 4YVWB 5F3CA 1CZVA 3VZMA 2A7AA 2YY1A 2VMGA 2OQ6A 1OQ1A 2D6MA 2HINA 2PAMA 2ZGQA 2X05A 3S30A 3VHPA 4YVWC 3S6PA 1MACA 1V6JA 2FCUA 4HONA 2B8MA 4BISA 2HWC3 3MV11 4Z07A 5HXVA 3TN93 2HWE3 2HWD3 4OQ9A 2R0HA 2DVBA 4XC9A 4CP9B 5FZOA 5C4WA 4DFSA 3MLKA 3KV9A 1MEC3 3TFLA 4W6WA 4XMIA 1JH5A 4YG7B 3UK9A 5EZWA 3I2KA 4LT5A 2MNGA 2OKXA 4C0BA 4YM1A 2CWMA 1RUG3 2DTWA 4FOVA 2PXQA 2D98A 4FFHA 1G8WA 1W3VA 1ZYBA 4XURA 1RUC1 3HPNA 5LA1A 4LBQA 4XW3A 3PNAA 5F2WA 3OWQA 4ASMB 2XUMA 1W2NA 5KHHA 3WP4A 1SHWB 1DGWX 3A4UA 1AR82 4K8RB 5CIRA 2DV9A 1OPMA 2HJIA 2JECA 3ZM8A 2YUEA 2L9LA 2GNTA 5H9RA 3C7EA 1NT0A 5GAGi 4Z82A 3A23A 3I3BA 3SITA 4PIXA 4LEJA 5FBJA 4JGYA 5CBLA 4IV1B 5L9VA 1CIYA 3RZJA 3JXDL 1EUUA 2LYJA 1JYXA 5DSXA 2I45A 4A7KA 4IW3A 2OZ6A 3CJXA 3FBMA 1S0DA 1POUA 1POV1 5KWRA 5JPNB 3GZDC 2EF8A 1UZVA 3JCIA 2WINB 1PNFA 1RXFA 4MX3A 2LROA 2Q8OA 1QZXA 1AR72 2PXKA 1PO12 3I2JA 4A6SA 1C8M1 5A7WA 4AK3A 1QJFA 2HWF1 2CYFA 2OUHA 3NRUA 3QLQA 4URTA 4M3CF 1EAH3 3CQOA 4XXAA 1QQBA 1AR92 3NKGA 3M8LA 4QHZA 4ZXEA 2G4IA 3U14A 2N7GA 3ZYBA 4QPGB 3LPGA 3MLLA 1L3JA 2O4AA 2W2IA 2P34A 5HXMA 5GZCA 5FK7A 5LBFA 1IS3A 4CDQC 1LLIA 4RQPC 1FV3A 1UO9A 2XBO2 1RGSA 3H5TA 4RS5B 4HSLA 4X6RB 1RIRA 4MADA 5CB7A 4P9XA 3OUIA 2IVGA 4S2HA 5HCBA 5FCCA 3R09A 4TTGA 4PI0A 4KQ7A 3BTYA 4JHTA 4NRMA 3MW2A 1ZRCA 1SLIA 1R1A3 1PIV1 2QTWB 2VE1A 3ABZA 3OSDA 5DTQA 4XEZA 3I3MA 5ACA3 3ILNA 2ET1A 2PUEA 4BXFA 2VO5A 3ME2A 5EXOA 4GMP3 2FDFA 1RUH1 1STMA 1XRUA 2IWGB 4IQPA 1YRZA 3E6BA 3HAGA 4P5HA 3M4FA 1IC8A 2PLV1 5JUVA 1CAUA 1ZBA3 1DZRA 3H1WA 2WBKA 5FYTA 1DLCA 1RMU3 3POJA 1JTZX 3IZOA 4GH4C 4YG6A 1HQWA 1W04A 2VCCA 1SQ8A 2JDKA 4AI0A 2JVLA 2CV6A 2Y6JA 4M01A 3ZIXA 3POIA 1L1MA 1W0NA 3WP3A 3BOPA 3O1MA 4GZ9A 2IXIA 2FCVA 1BQPA 1DG6A 2EIGA 4LO8A 1F31A 2MQKA 1UIKA 3AFGA 5DRTA 1IQAA 5DAXA 4J6GA 4TLFA 2JIGA 4IE4A 4MZUA 4WM7A 3ZYFA 3E1F1 1HXS1 1A8MA 5JR7B 3FLPA 5BYNA 2O8QA 4YW3A 1NY71 3A9YA 1TMF3 2ZABA 4LO7A 1URXA 1A34A 1P8JA 4DS0A 3IDEA 1YC61 2HCSA 4WM7B 2PHWA 2AUYA 4CU8A 3AMMA 4DY5A 2WS92 1SACA 3PURA 4NOTA 1G9AA 3H8XA 2JJ6A 1LR5A 1SBDA 4Y1UA 5I8TA 2MHFA 1XU2A 2X5IC 3U4SA 4BLJA 1AZDA 1CAXB 3NV4A 2VMEA 5BNOB 1RUC3 1AR71 1EPZA 2P4EA 3APBA 3R0RA 4OHYA 2VOTA 3LIGA 2WZPP 2ZGMA 1LULA 2WQZC 4OLLA 3KWVA 5A3MA 4FQZA 3ZHIA 4YW1A 5I0UA 5K7PA 2QDNA 5FY9A 3WUCA 4H14A 4FPKA 4J1XA 4LIUA 1W6NA 2K9ZA 4IV1A 4N8MA 5IATA 1FNYA 5FP7A 4EE2A 2RDSA 4LBQB 2VOVA 2X53S 3I3QA 3OEBA 4CSWA 4DRRA 2KXLA 1PO13 1RB8G 1LOCA 3O1OA 2P3JA 5EHDA 3ETPA 3WZ1A 4H7LA 3MGUA 5FOJB 3WEZA 1GZ9A 2DFCA 2QBXA 2ZX0A 4I0BA 5EJ3A 3VHOA 3I2FA 1RUD1 3W58A 1O7FA 3MFAA 1DQ0A 3JBG2 3OY8A 5JMCA 3C7FA 5EV7A 4AE2A 1GZTA 2VW2A 1RUC2 3N3HA 5FZ1A 3ROUA 1S0CA 1POV3 3ZFGC 4C90A 4CEWA 2E7AA 3BPZA 3CZUA 1F2NA 3SQOA 2E51A 2XBO3 2YC0A 4XIOA 5FZCA 2GAUA 3T0AA 5FMCA 3B7MA 3BODA 2QJVA 3D8CA 4X4EA 3HJRA 3PTRB 4LUKA 5BPXA 3RFRA 2BJSA 2GU9A 5FZMA 5FKBA 1ZZ9A 2WN3A 2WFF1 5FPBA 1J84A 1JYCA 3LZZA 4QQOA 2VZSA 4B4PA 1MEC1 2ERFA 3WD5A 1ZZ6A 4F3JA 1PVC3 1W6PA 1UL9A 1ZBA1 3H1MA 1AX0A 4KNCA 4YGDA 1SQ4A 1T6GC 2CU5A 2A5ZA 3ZXAC 3ZXLA 5IVVA 5GZEA 1RUF3 2H6CA 1FOD3 4D69A 2PXDA 2XKPA 3Q8AA 4RR3B 5FYCA 5JZGC 2VPVA 4XHBA 4JDOA 1ZBE2 3KVBA 4QDSA 4Y42A 2ZHMA 3HMYA 3R4DB 5DAPA 5IVYA 4FBFA 2ICTA 1EPWA 1AXYA 2EWTA 3JXBC 3J9SA 2E31A 4XJ9A 3CLPA 4D7YA 4GJYA 1MQTB 1SEFA 1SCRA 1MFQC 1EAH1 2VXJA 4QQHA 5GLUA 3B3QE 3GZDA 4BE3A 4C0HA 5I91A 3RPQA 5A1LA 3TEWA 2WZR1 2WNUC 3LPFA 4ZPIA 1ZRDA 4Z58A 3T2PA 2RS31 3RMXA 3LFPA 1YCIA 3NAPC 1YEWA 3O14A 3K3OA 3LEIA 1NLQA 3AP6A 5FZ3A 3DKQA 3M1HA 3RJ2X 2AREA 4AVCA 3SH5A 1ST8A 4I2OA 4LHSA 1DQ4A 4M0NA 3ZSJA 1YI7A 3NNFA 1F4AA 4Y20B 4Q26A 4AI3A 3H7JA 3IIIA 2ZHKA 2RMU2 2XJ3A 5FV3A 2G1MA 3MUZ1 3LCPA 3NQHA 2W68A 2F4LA 3JXSA 1X7NA 2IU7A 3LOBA 4GALA 4DINB 3PUQA 2AEYA 1LJ7A 1WH8A 3HOBA 3GZUC 5LBEA 1IS4A 3E6DA 1LOEA 2XJTA 4L11A 4CXYA 4XHXA 4YVSA 3SKJE 1VPHA 5F6KA 5M0TA 3FYAA 1HKDA 2FJRA 1B35A 5T3NA 3MF9A 4QPWA 1NCQB 3IMNA 3HEIA 3CU7A 5CFCB 3RNSA 2RS32 4B4RA 3M3CA 4CCNA 2PLV2 5DAWA 4D0QA 4R9AA 4J25A 2ZZJA 5IAXA 1DZTA 2Y60A 4JHZA 3BIEA 1XBFA 3B00A 3VBFA 1Q56A 2D3SA 3QOPA 1N3PA 5EJZB 4FSJA 1NXD1 1LOFC 1OQEA 1XJAA 3J8F3 4HMZA 4LKFA 3O1RA 2ADEA 2MPFA 2PN5A 4L92A 1L7LA 4QB6A 1HRI2 1OMIA 5FR3A 5FAXA 1W8HA 4L9BA 3ZDSA 4LORA 3WNMA 2B42B 5FY4A 4Z1VA 5KXEA 4KWJA 1GU3A 4WM8A 2AW6A 5GLTA 4FPOB 1UZZA 3EQEA 3JD73 2DVFA 1RUOA 1IKQA 4Q1RA 2VCMA 4NHXA 3U78A 4GAZA 1NLRA 3VL9A 3S8QA 1QNYA 3LF7A 3VGIA 2GZUA 3WX5A 1JMUB 2QQVA 4XUQA 4ZS2A 4XOGA 1X82A 4P9LA 4AI1A 5FBZA 1BXHA 4ASLA 2W91A 1JYIA 1X8EA 3DXUA 4O9EA 1WW6A 5JI7A 3WDYA 3WNXA 1VLNA 3KD4A 1QQP3 4XACA 2EXJA 2TEPA 5DDJ1 1QJU3 3GHMA 4QXKA 4XF9A 5FPAA 3T0BA 4ZU7A 1HQLA 1OXCA 1U5XA 5JOYA 2BBVA 1PZ9A 1QDOA 1C3HA 1S2BA 2YBSA 4JV4A 1BK1A 1NX9A 3GF6A 4I0WB 5A3TA 1PRAA 4J1WA 1JHNA 2V4AA 3E5UA 3ZXDA 1Z0HA 2VUDA 2GN3A 2R073 2BNOA 1UPSA 2WKKA 5FMOL 5AC91 4XDOA 4OB4A 1FMD2 3VBOB 4BXSV 4EKIA 4IV3B 2ZZQA 2E53A 4XFFA 3RZZA 3VBUA 3VBRC 4HFSA 4PQ9A 2J22A 4PLNA 2OVUA 4AQSA 5BNPC 2RJKA 3RS6A 2XVKA 1W2TA 1YSEA 2BJCA 2VCAA 3K48A 4KWLA 1S7EA 4G9SB 1W39A 2HWB3 3BU7A 2YBDA 1ND2C 5DG1A 4FXKB 1LOGA 3KS7A 1BBT1 3HQUA 4YG0A 5BNNB 2FCTA 3B5LB 2QQOA 1H2MA 2ZBJA 4I02A 3T4VA 2A3YA 2AH2A 4Q0QA 5EWSA 3LWCA 1SFPA 3MIEA 2NN8A 1JBCA 1H1AA 1V00A 4ER7A 4IGQA 1C28A 4E4DX 1E57A 5IVEA 3POWA 4PDWA 3VK0A 2LW8A 3A0NA 5FJKA 5FZ7A 2LYSA 1LQCA 4FOWA 1EV13 4UT5A 4OVEA 3MIDA 4K21A 2LS6A 1QP7A 1J58A 1BEV3 1VAMA 1CGPA 1DW9A 4OMCA 3CNAA 3Q8FA 1YIFA 3IT8A 3GCXA 4TN7A 1CZTA 5EYXA 1XNAA 4AVBA 4NE9A 5FTTC 1OA4A 5K9YA 2RM23 3JD72 3HQRA 4N90A 3MV01 3ZLIA 1K5MA 2FD8A 1ENQA 1KJRA 1WCDJ 4D94A 2D40A 5A3OA 1VBA3 3WDTA 1TNRA 2VMDA 1CONA 2HFZA 3OQOA 1ZZBA 4G4FA 1K5MB 3AKQA 1DDLA 4W6YA 1UX6A 1XYNA 2QCSB 2WR9A 4OHZA 1AYM2 4S2DA 2EALA 2PQQA 3I2DA 5JZGA 3E5XA 5KBFA 4QGNA 4YWAA 5T5LA 1RUE3 1OUXA 1AYN2 4LOSA 2QQPA 4Y1VA 4QQPA 4QKDA 3B93A 1QP0A 2VMHA 1GNYA 5DN2A 4X6QB 3CEWA 1DP0A 1RINA 3U0ZA 4YM0A 4F8AA 1UMIA 4BYYA 3B02A 2WN2A 4JGZC 4XBNA 4YVSB 2ORXA 4L8QA 4LA2A 2WAAA 1LGCA 4XFHA 4B8EA 2VCBA 1UMHA 5HV4A 1V9U3 1PO23 1COV2 2DUQA 1QJU1 3WQBA 2XG3A 2ZACA 3VKNA 1T2XA 3OB8A 4UF0B 5C3SA 4H2AA 1Q8PA 2XOMA 3H3LA 4KGQA 2A75A 2PXJA 2AYHA 2WNVB 5EQUA 3VKOA 1O4ZA 1WUVA 5L7OC 2FZ1A 2Y6HA 3KV6A 3POEA 1U0AA 1DYPA 2VOWA 1W8NA 4I6UA 1HRV1 2NM1A 4NRPA 3W59A 4BQ3A 4BQXA 1S55A 2ADDA 4NAMA 5C9AC 1VPWA 3A22A 1YO8A 4RQPA 2QNKA 4MSVA 5APAA 5KXCA 3IDCB 3WDVA 4HG6B 1AR62 1ND3C 4CXXA 4AVTA 5L36A 3VD9A 3FE5A 3S57A 4RS5C 1EP0A 1KD7A 4CYDA 2JENA 4AEDA 1LOFA 5JPMB 2UYAA 2Y6GA 1PX4A 1MS9A 2PUAA 2XL7A 3BALA 3JBG1 3JQXA 1H9PA 3VHNA 4AZZA 1FATA 2ARXA 3P3PA 3ZPOA 1C8M3 2ODRD 5DZGA 2YC4A 4LKDA 1JN2P 1PMHX 4TXWA 4GH4A 3TELA 1IOAA 2RS13 2A3XA 5HBAA 1OLMA 5FXXA 1VE0A 3AZZA 1UZWA 3FLRA 2B9VA 1OPOA 2ZGLA 3BOWA 4LK7A 4V2WA 2Q8DA 2VAUA 1M4WA 4EQVA 5IYYA 2WO2A 3CMGA 3OCPA 5IVCA 2ZGKA 5I0TA 1VBE2 1KITA 1GQPA 3VBRB 5D21A 4E4SA 2GRLA 4FBIA 1XE7A 4B29A 4E2GA 1SZBA 2PHXA 2VZVA 4CCOA 1AR83 3VD4A 3A21A 2HWB1 3I54A 3ECQA 2RV9A 1HDKA 2P5BA 5BXXA 1POV0 2A71A 4GWJA 4OUMA 3UKNA 2PXEA 3N7KA 4B7EA 3D1NI 2GMEA 1J1TA 2C1FA 3I97A 3OBZA 3UGFA 2AWIA 5I93A 1OVPA 3PUHA 4QKBA 4YYOA 2XJUA 2Z5WA 3C7OA 2E6VA 2MEV2 1UW8A 4X4DA 1BYHA 5KC6A 4S2FA 1RUG2 1WA6X 4OI4A 1G86A 1QQAA 5FLIA 2Q8EA 2QKDA 4EN6B 2X5IA 3H3UA 4QM9A 5FZ9A 1GP4A 2HLEA 1W05A 2JB4A 4IETA 1O5UA 4QX8A 4XF4A 1DCSA 3OBRA 1VBD1 1HX6A 2TBVA 3N9NA 4FPLA 2XWJB 1TME3 2ZA9A 1JOJA 4RN5A 3GM8A 3AXDA 5T5OA 5CFDC 2LRPA 4Y4YA 2VNVA 3X29B 1IZ3A 3G0TA 2C4XA 1OQDA 4LLOA 2V09A 1OFNA 3ACGA 3OGRA 1WZXA 2PAKA 4FI9A 1O4TA 2YU2A 3C7HA 3ON7A 3POFA 2IXCA 2ORZA 1H8TA 1LEMA 5C8CB 1O3TA 2SBAA 4NAOA 1KGYA 5K0UC 1CAXA 1MS0A 1OC1A 4NPMA 3SCGA 3N7JA 4R52A 3VKLA 1YIPA 2HEWF 3OPZA 1HRV3 3HWJA 4E2SA 1TMF1 3BU0A 4Z5DA 3DPRB 1IQDC 1ZRFA 1RZRA 1PK6A 1O3RA 5L9BA 3TBDA 4B1LA 2P6HA 5ABJC 1UOBA 5KC5A 1U12A 2H8RA 2XIUA 2ZX1A 3C8XA 3RI9A 1FOD2 4KG8A 4HLTA 2H6BA 3VL8A 1X50A 4A2UA 4CPBA 4EZHA 5LW9A 1U5IA 4UXAA 3J7LA 1TG7A 1W8OA 5DRYA 3OGSA 1H2KA 3G5GA 4IE6A 5BNOA 4DEQA 4HZFA 5CISA 3H1YA 2VUJA 2WZ8A 3QYXA 1LENA 2RM22 2X29A 1HRI3 1G6NA 2VTFA 4FOQA 3WP6A 2YZ4A 3RMYA 2VEOA 4JCXA 5IHRA 1GQGA 2R7EB 1GZWB 4M00A 4YFZA 3CF6E 1UN1A 2BWAA 1ASJ3 1GUIA 3HR9A 4XJAA 5FREA 2E33A 4E27A 4M3CB 3KXAA 1SG3A 1C8NA 3I3DA 1WIZA 1CN1A 4QX0A 2PXVA 5GLWA 5FDBA 1RITA 1WMDA 3HN3A 3J4UH 2LYPA 4JQRA 5L73A 2JDPA 2R0FA 4IGOA 4BQYA 3ZN4A 2DUOA 2HWE2 3NV1A 3IBMA 4CEWB 4ITCA 1QH6A 1GWKA 1WBFA 3SR4A 2HWF2 5BY5A 5FXWA 1LU2A 2UYBA 5A6ZA 2W52A 4UW3A 3PJYA 1UYXA 4YM3A 2A6VA 2D43A 3UGGA 3KHCA 1PGSA 2WA4A 1D4M2 1HN0A 4RL7A 3WDXA 1ZNPA 2D5HA 3TEZA 1BK0A 3OYWB 3V0BA 3PDQA 2CWSA 2OZJA 1XE0A 2Y34A 3KVAA 5F2SA 4AAPA 5IVJA 3RQ0A 4MGQA 3NAPB 1TEIA 4NHMA 4XCAA 2RE9A 3OJBA 5H9QA 5C4WC 5IVBA 4HKWA 4QHBA 2XLGA 1QPZA 2BOJA 1E3OC 3MW4A 1US2A 4M3CA 3LEKA 4QQ2A 5J1XA 5B4NA 1RIOA 4JRAA 1JS9A 4QM8A 4C1WA 4INDA 5C9AA 2WUSR 1WMFA 1R63A 2EICA 2WABA 3ATGA 3ZX7A 2WAOA 1V9U1 3ZSMA 4F83A 1DYOA 5JWPA 3TEXA 1W2UA 4X4FA 2HCNA 1QWRA 1IG3A 1OOPC 2QQWA 1DULA 2CGOA 2ZPXA 1AL0G 1UU4A 2VNOA 3LDKA 4MGKE 4RR3A 3RYKA 1HLCA 1RUJ3 1SLCA 4RSUA 4W6XA 5K8SA 4QX7A 5LEKA 3I8TA 1EFAA 2JG8B 3DCQA 4AW7A 1YNAA 2YU1A 4KBBA 4LHLA 5LASA 4ZY9A 1QJY2 1UWWA 2WO1A 1WCSA 3ACLA 4PLOA 4X4CA 5DAVA 1I5PA 3K4AA 4XF0A 4NPLA 5FZLA 4ES9A 3K3NA 5J96B 2C5DA 3QF3A 2AUWA 1X36A 4TSVA 4X8PA 2WDBA 3GJAA 1WLWA 4Y22A 3I2HA 4MGYE 1SDWA 4EN0A 2VMCA 1GNHA 2VUCA 4Y5TA 4BLIA 5FP8A 1VBA2 3OP9A 5T50A 2BU9A 1MS4A 2VZOA 1FX5A 1XE8A 2Y6LA 5C9AB 1J1LA 4BK5A 2A6YA 4QX2A 1QJEA 1ULCA 3ZMOA 1VB4A 1CJPA 4AI2A 4HL0A 3OUJA 3GZCA 4JKKA 1PM7A 4QWNA 1COV1 3GXUA 5DT2A 1JI6A 2Y6FA 2WNVC 3PIJA 2DVDA 4ISQA 1HRI1 3WT3A 5DZEA 3OUHA 1CAVB 4JGYC 4P02B 2P6CA 4EWEA 2PPXA 2RS11 3WW1A 4D3WA 5KXDA 1OI6A 3QH7A 1CAUB 5GALA 4OYUA 3WQ7A 3D3AA 3MEPA 2L8NA 4QPIB 3WV6A 4LPLA 4P9WA 2E26A 2IZWA 1SLLA 2ZCWA 2RS52 2BRTA 1PZ7A 3EHKA 4FFFA 4MVTA 4KG0A 1QKQA 2UURA 1RUI1 1ULPA 1L7QA 1YLLA 2MEV3 1IG0A 2ZEZA 4OHXA 4Q4Y1 1Y9MA 4QXCA 4COUA 3AFKA 4XFBA 4QX5A 3ZXEA 1F5JA 2R062 4COVA 1D2QA 1MVEA 3VDDA 1UF2C 2G19A
chains in the Genus database with same CATH topology
3VBSB 2WNUB 2Y38A 2D6NA 1UD1A 1WMEA 4YW5A 1V6NA 5EFUA 2CAUA 4YM2A 3VBRA 3JD71 2RHPA 2VQAA 2UY8A 4HK9A 3GNEA 4C1XA 1ULFA 5F1RA 1QHDA 1UXDA 2BWCA 4QPGA 4V1PA 2PIJA 4N53B 1J3QA 4XTPA 1SLBA 3PMSA 4Q4V3 5LK5A 1BJQA 1QJY3 4CEYB 5F9TA 2E9QA 2LYRA 2B7YA 4MXWB 5DDJ3 5AVAA 2PUFA 3WW3A 1S0EA 3VBHA 1CD3G 4K1YA 3WUDA 2DUPA 1DHKB 3IPVA 4AFAA 2D44A 3S0MA 2LYKA 5J3UA 5CFDB 2BW8A 4UW4A 3BCWA 2A6CA 3O12A 4AFBA 5GLZA 1ZAYA 4FPCA 4D7TA 1W6MA 4PCRA 2WIIB 4WVMB 2WFF2 3SMHA 4Q0SA 1RJ7A 4A3XA 4KWKA 3RWNA 1ZVVA 2I74A 4WM7C 1QOSA 1ASJ2 3AXEA 1XXNA 2HKXA 4AWDA 1TE1B 3VUOA 4CEYA 4HANA 1FI2A 1CAWB 3D82A 4O8BA 5E89A 2JX9A 2OW4A 3WQ1A 5A33A 1MS1A 3UJQA 1OOPB 3S7IA 1H8VA 3WG1A 4AG4A 3G7DA 3B94A 3ENRA 4JGZA 4FP3A 3VZJA 1SFYA 5I8YA 1UXCA 1VJ2A 3KGLA 4OFGA 2UU8A 1QJX1 1U5ZA 1H9WA 1KFXL 4CZSA 1AYN3 3JZVA 4OUSA 3WDUA 2VU9A 1DYKA 3RG0A 4FPEA 4U36A 1GKBA 3NO8A 3TOJA 2XVLA 4Q4Y3 1H1MA 1NYWA 3VLBB 5L7OA 3V64A 1PVXA 2CTVA 1NQJA 4IV1C 3U11A 4XILA 4YBAA 1NCQC 1RUH2 2NMOA 1RHI3 1JFTA 4IEQA 2K2SA 4QPIA 2KEJA 1NLSA 1OOPA 4HN0A 1LGBA 4QPYA 5BNPB 5JIUA 1O4YA 1X33A 1O91A 2ZOEB 3ZMNA 2E63A 3MPBA 1OKQA 3RJRA 4JAAA 4LR4A 3AKPA 1UKRA 3AMNA 1HRV2 3PVBB 5JSOA 1AL23 4Q8LA 4CEWC 1AHSA 4Q4V1 4AEDC 1R1A1 4CDWC 1PNRA 1PO21 4ATFA 4RQPB 2OR1L 1LCCA 1DQ6A 3CROL 5E8AA 2BTVC 4I0AA 2C0ZA 3AYCA 3UV9A 4QGLA 4BA6A 1X57A 3KCXA 4HETA 3I59A 5E1RA 2K0GA 3AZXA 4E9KA 2GNMA 1H4HA 2EBYA 2HWC2 1ZM1A 4FPYA 1X8MA 3WVJA 5A7LA 4NDWA 1MS3A 3G6JB 1DZQA 4NN0A 1EY2A 1ZZ7A 1SLTA 2D6OX 4N43C 3AP7A 3O9XA 2AENA 4N7IA 3VBOC 2IUOA 1IGOA 3VDDB 1KS5A 3WG2A 5AFEA 3F52A 1SCSA 3PHMA 1UMZA 1NE6A 4K9SA 2ZGTA 1HV0A 1F5FA 1NERA 4NWWA 4Q0PA 3WHTA 1QU0A 2O0OA 4EWDA 4DOUA 3OGJA 4AEMA 2GC1A 5HCAA 3ES1A 1KDMA 3MFCA 3LA3A 5BUVA 3KB5A 1AR73 1SBFA 1UTXA 3DV8A 2BNMA 1C1LA 1NE4A 1H8TC 4NWVA 5T5JA 3H8UA 1R1ZA 1GZCA 4I30A 3VBFB 2PUDA 4I3PA 1VALA 2O38A 4DY3A 2IFWA 5DUUA 2XLFA 2P3IA 3NWKA 4XE9A 1WD4A 3VBFC 5J48A 5FQ0B 1ENRA 1RVF3 4L97A 3INAA 1VAKA 4CDUB 1XNBA 4GA9A 1Z7S2 4AYUA 2DCZA 2YHJA 3VZKA 3OF1A 3AZWA 1O4XA 2Y0IA 4DZGA 3QH6A 4WM8C 4DNYA 1QJY1 2FQPA 3IDBB 5BNOC 4XF1A 3VBHB 3LAGA 4EWAA 3O0VA 2WSUA 4XJ8A 2AXVA 3U4XA 2VG9A 1HV1A 4Q4X1 3THTA 1RUNA 4BCUA 3D5OA 3DPRC 3WW4A 3WOGA 3WDWA 2ZAHA 4FQ4A 1AVBA 1AR61 1YI9A 1VBE3 5JIAA 3UKVA 2QDRA 4MUVA 3OQNA 4CEYC 3LOIA 4Z8BA 2VVEA 1IS5A 5ACA2 1A78A 1AJOA 3AKRA 4XFAA 3ZYRA 5DUWA 3LKJA 1DWKA 3OTFA 5L19A 5BNNA 2WA3A 2WT2A 4FT8A 1QQP2 3VKFC 1FOD1 2O1QA 1QNWA 1C57A 2P37A 2IXLA 1BEV2 3F51A 1I5ZA 2VULA 2A6XA 4XPVA 1S1AA 3NL1A 1AL21 3R6SA 3A0KA 2AR6A 4HVOA 2LTNA 1JXNA 2PUCA 3VBUC 2Q5TA 4IEXA 4N53A 4W65A 1GANA 3B01A 3ZYJB 1VBC2 3WG3A 1F9KA 4RGGA 4R8HA 2Q0AA 1QOTA 3ZN5A 2QZ3A 4YG4A 4UBGA 2RMU3 3W9AA 4LULA 4XQWA 1WLCA 3U07A 3EJKA 4LBLA 3P3NA 1LOAA 1H0BA 1D0GA 2XGXA 2B45X 2X8KA 4BH9A 2PHUA 4IEOA 1B0NA 3AMQA 1VRH2 1ZBA2 2O8OA 4I3GA 4QMAA 4Y5Z0 3FUOA 4HPKA 2B9UA 1DQ2A 3C2UA 5LRSA 5IK7A 4RR3C 5JZGB 5D1IA 2BUKA 3FMYA 4Y24A 1PO22 5JOXA 4YFWA 1AR91 1UPIA 4G3YC 1V9U2 4OHVA 2IXHA 3GBFA 4BIFA 4Y22B 2W0XA 2BFUL 2XJVA 5C8WA 2R071 4CDWA 4OI1A 4OZXA 1DGWA 4Q2FA 4X4HA 1K5MC 1O5LA 1RTVA 1LESA 1ZUGA 2TNFA 3IM0A 4RHV3 4XQDA 3JB8A 4X4IA 1OHFA 1YYNA 4Z92B 2JCGA 2QE3A 3CLCA 1LMB3 4IXLA 1REFA 1BKZA 4S2GA 2Y0OA 1LU1A 1QJX2 1RVF2 1ZRRA 2JG8C 4NVPA 3JQWA 3SH3A 2HWD2 1PIV3 4FP2A 2EAKA 4Q4X3 1SLAA 1W0OA 3PLQA 3BB6A 5SV8A 4R4ZA 1RZRD 2R16A 1FXZA 1PRVA 1Z78A 3BIWE 3M7AA 4Z5HA 4MYEA 3J8F2 4N9HA 3HT1A 1QXPA 5F6LB 1EV11 4IEPA 1BDHA 1LHVA 3UKTA 3ILRA 3ZFFB 1I6XA 1RMU1 2EF6A 2R6QA 3SLIA 1NOVA 1MZEA 5JOZA 4PU8A 2G9FA 2VNGA 3UL2A 2QUOA 5CU1A 4MCXA 1Q3EA 1N47A 5K0UB 2XPJA 1J3PA 1BDIA 3AX4A 3J26N 4CDWB 1ND3B 4AHWA 2DVAA 1NA1B 3DN7A 5GLVA 1RUD2 4MGIE 1FPN1 4AVSA 4N43B 4Y26A 3OD0A 3AZYA 1B35B 2R63A 1YFUA 4CDQB 2ZHNA 2A70A 3CJIC 2RM21 4BM8A 1ND3A 4K40A 1CPNA 1YUDA 1UU6A 4DQAA 3QD6A 5EYYA 1LHWA 4EROA 1WGPA 1H2LA 2ILMA 3OYWA 4I6RA 3T1MA 1B35C 2WZR2 2WLPA 5DZFA 3KT4A 1KQRA 3KJXA 2WS93 4FTEA 3FLTA 3WCRA 3FYMA 1R69A 2GNDA 4GWNA 3WG4A 2A73B 2VECA 4AEJA 5GM0A 1D4VB 1AU7A 1GSLA 5CFCA 4CRQA 3EXUA 4META 1UAIA 2JDZA 3T1LA 1Q8VA 3ASIA 3ZYIB 1QY4A 3V56A 3ZSEA 4BMBA 3EUSA 1G7YA 1PVC2 4MLOA 5IK5A 4GXLA 4LBMA 1RUI3 2MEV1 2CROA 3VZOA 1I1EA 4OULA 4FXGB 2CGNA 1REEA 3GN5A 4P14A 4WZFA 4F7ZA 2OIIA 2RS51 2FZ2A 2G9GA 5BNNC 5JLVA 2LYLA 2NMNA 3AMHA 1V70A 3E6CC 3AK0A 5GZGA 1RHI2 4JGYB 1MS5A 4MCTA 1R081 2WLQA 1DF0A 3SISA 1VBE1 2Z69A 2OPKA 3BS3A 3JBG3 3O0XA 3QCWA 3GYDA 1C1FA 1B09A 2DCKA 4AVAA 4XYXA 4LUMA 2F6BA 2QZ2A 4QGMA 4JTOA 4YW4A 3CO2A 4P9YA 2VW1A 4COZA 4IWRA 1ADRA 2ES3A 1HXS3 4YVWA 1YFWA 3ZO0B 2VQ0A 1C5HA 4FVVA 1PK6C 5KHIA 3AB0A 1RHI1 5ABJA 2XBO1 4LO4B 4XF3A 2XJSA 3ZYPA 5C6CA 5BV6A 5IK8A 2QFEA 3FFQA 4WV8A 4Y1YA 5JI9A 2PHDA 2ZX3A 1RUD3 2D5FA 1Q8SA 4JGZB 1VBD3 3ZHMA 4LBQD 4PBOA 2BPA2 2ZAAA 4K7JA 1X2LA 4AEDB 1RL3A 2YMZA 1GT0C 1HQNA 2XJQA 2PELA 2PHLA 1G9DA 1RUI2 1JUIA 4AEKA 5JSRA 2ZGPA 3BD1A 4Q0VA 2Y26A 2A6ZA 1ULDA 1SFNA 3HT2A 2ATFA 4HVQA 1MZFA 5F5QA 5E88A 3PTYA 5T55A 3KT1A 4LBNA 4K6BA 4NR1A 4N43A 1CR7A 3LSDA 5DUVA 2IV1A 3TN92 3O0WA 3VBOA 4K20A 3KMHA 2ZGUA 4FTSA 2DYCA 3FUQA 4UBHA 1UU5A 2R30A 4XETA 2WS91 5A3LA 1YHFA 5FMOS 3URFA 1JFSA 1R1A2 1LTEA 3K51A 5IT6A 5CNAA 3VV1A 2GH2A 1DLLA 1YJLA 3R05A 2OA2A 1N1YA 1PRUA 4K1ZA 4LBOA 1AJKA 1Y43B 2XWBB 2D6PA 1D4M3 3ELNA 1NXMA 3GN5B 4R9DA 3USUA 4AGVA 2FHRA 3D6EA 1KDKA 2FBEA 4JDMA 1APNA 2D93A 1Q43A 2R1JL 1RUF1 1DBNA 3FZ3A 5CG8A 1W6QA 2VOKA 3RRDA 5CADA 2Z79A 4CP2A 4N7UA 3ZXJA 3SCFA 1NQDA 2YXSA 3VZLA 2ETEA 4TYSA 2EXKA 4FPFA 4XFIA 3IIAA 2BQPA 4LBKA 2FMYA 3TN91 1ENXA 1W6OB 1OLQA 2ENRA 3HN1A 5SV5A 3TNPB 4QQLA 1S0GA 1VR3A 4K8FA 5L7OB 1XNDA 1LCDA 1TNFA 3ZXFA 3N7LA 4CDUC 2D6KA 3HQXA 5D8AC 1UKGA 4PBPA 1DGRA 2ZGNA 3WQ0A 4AXOA 2PE5A 4B3NA 3OGGA 4JDNA 1BBT2 3RYRA 3L2HA 3AM2A 1RUF2 1YWKA 2R32A 3LSEA 3LA7A 4LNVA 5ABJB 4I6TA 4YARA 3DPRA 4GWMA 4Q29A 5FO9B 1UZYA 1OA2A 1VBC3 1S0BA 3THPA 5I0SA 3IN9A 5DDJ2 2IC1A 5T5PA 1LRHA 4YG1A 2PHFA 4MV2A 5A32A 2HWE1 1CAWA 4IEVA 5AC93 1CVNA 4WM8B 4NHLA 4YZ3A 3CL1A 4Q4X2 3BDNA 1AX1A 4GKYA 4XJUA 2B46X 4IEYA 3V0AB 3J8F1 2VNRA 2JXAA 4AVVA 3FX3A 2DCJA 1RJ8A 3SCHA 4QU2A 4Q1PA 2ZTNA 3AJZA 4XJZA 2R1BA 4N53C 1WBLA 3AYAA 5CFDA 4BIOA 3VBUB 2CL2A 1LOBA 3L1PA 1UCXA 3I4IA 4FPJA 2E7QA 2V73A 4ZU4A 4CDXA 3B7HA 1BZWA 1OLRA 1RUJ1 2A3WA 2AGSA 4BQ1A 3DUIA 3ZXKA 2HWF3 1XYOA 2YPJA 3F6WA 1YFXA 4HVRA 5DXDA 1D4M1 1M06G 2XSDC 1I3HA 1KXGA 4NPRA 1OFSA 1RUE2 4PIYA 1TME2 4YGEA 1LGNA 2WQ4A 1H8TB 1BCXA 2IXKA 2R072 4HKOA 1QXRA