2BNNA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
b'KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPOXIDASE
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 52
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnnA02
4UBGA 3G7DA 1ZZ6A 1X8MA 4BH9A 1ZS4A 1EFAA 2XL9A 1XRUA 4IEOA 3WW2A 2B8MA 1QPZA 4QM8A 5FQ0A 2D40A 3PVBB 1NZCA 3MYXA 3E5UA 3WW1A 2H6BA 1WH6A 2R1JL 3GYDA 4IEQA 5LEJA 4YNIA 2BNMA 5I8SA 3OGJA 4PU4C 2GRMA 2CGPA 2IXHA 3UFDA 4X4EA 1QP7A 1WGPA 2D5FA 1VPWA 1YSEA 2XHKA 2EA7A 3RYRA 1X8EA 3D82A 5KHGA 1CAWA 1VR3A 5FLHA 5I0RA 2HINA 5LRRA 4FAHA 3KGLA 4P9GA 4ONUA 4PU7A 1VJ2A 2IXKA 2XLFA 4I6TA 3KXAA 3VK0A 4I01A 1ZRCA 4FAGA 2R63A 4O9EA 4LA3A 2XKOA 5K98B 1YFUA 3BU7A 4QM9A 4IEYA 4X4DA 1Y7YA 4E2GA 3HQXA 3OP9A 3E5XA 1O5LA 4WVZA 3ES4A 4EV0A 4X6QB 4ZU5A 2ATFA 2PFWA 4HSLA 3UKVA 1RGSA 4X4GA 4NDWA 3IDBB 4IEXA 4HSJA 1Q3EA 2L49A 2OYZA 3G5GA 5BV6A 2E9QA 3I59B 2Q30A 4IERA 1UXCA 4WZCA 4LUMA 3TNPB 1O4XA 1UIKA 1DZTA 4I0BA 3RPQA 2XCJA 3ZHIA 3CL1A 2PUDA 2GC0A 1ZNPA 4JVAA 3S7IA 5KHKA 3ROUA 3LWCA 1NE6A 3OQOA 2BYVE 4KU7A 2PAKA 2VPVA 4AVCA 2UY8A 5FCCA 5I8YA 3ES1A 3GBFA 2KEKA 2AW6A 4I8TA 1LCDA 1XE8A 2GC1A 4OLLA 1WIZA 2B5HA 5F1RA 1ZZCA 5I93A 4HN0A 5FDBA 4UXAA 3H1MA 3E6CC 2QNKA 3QYXA 5C8WA 2FJRA 3S0MA 1NE4A 1J3RA 4Q0SA 2OZJA 1PM7A 2Z2SB 4PIYA 4E2SA 3LISA 3OMTA 3EJKA 1ZREA 2IUOA 5LEKA 2EVXA 3L1PA 2PYTA 3C3VA 4E2QA 4HBNA 2WFPA 1Y9QA 1LLIA 1X2LA 2XL7A 2Z69A 4L11A 4YRDA 3DV8A 4JTNA 2EF8A 1DZRA 3OTFA 1JUHA 2ICTA 2V09A 1JH9A 2PA7A 5JAXA 4Q0UA 1UXDA 3NJZA 4ZU4A 1HW5A 4IEWA 4X4CA 4BIFA 3HIFA 1ZZ9A 3D0JA 5EZWA 3KZ3A 4PU3C 2PHDA 3CLPA 1DGWA 2LYQA 1I5ZA 3TRBA 4MUVA 3KJXA 1RTVA 3JXCL 1ZZ7A 5I0UA 4X4BA 3LFPA 1LMB3 4N9HA 4QGMA 3H1WA 3QWGA 3BS3A 2BJCA 3E6DA 1ZPQA 3DKWA 3IIAA 3H7YA 4MGKE 2XLAA 1O4TA 4LEJA 5HI0A 1CGPA 3PXPA 4JQDA 4HVOA 4XFGA 2PQQA 2B9UA 4EWAA 2F4PA 5KHIA 3LA2A 1QXRA 2UY9A 2GH2A 4HMZA 3KSCA 3BDNA 1E3OC 1RUNA 2ET7A 4FBFA 2CAVA 2GZUA 3ELNA 4AVAA 3HT2A 2IXIA 1S7EA 3F6WA 4WBBA 3U11A 2UYBA 4Q0PA 1LCCA 2GRLA 1IPJA 1PRUA 4XF3A 1L3JA 4KWKA 2WIUB 4I3PA 4I09A 4Z58A 1YWKA 4K8FA 2PUFA 5FLIA 2EBYA 2PHLA 3B02A 4IEVA 1HF0A 4FBIA 1QWRA 3LOIA 1AU7A 2ET1A 1GQGA 3H3UA 4R52A 1NEQA 3FE5A 3FJSA 4IVZA 3S7EA 2ETEA 2XGXA 2GZWA 1BDHA 1PRVA 5KHJA 4OFGA 5KBFA 1QQAA 2FQPA 3MPBA 3D0SA 3IDCB 1OCTC 4EWEA 2AWIA 4F7ZA 2IXCA 1ZZ8A 3NL1A 3LAGA 2IVBA 2D5VA 1O7FA 3HT1A 5BXXA 4RD7A 4MGIE 1DW9A 1FI2A 1SQ4A 3LA7A 1ZUGA 4PU8A 2PUCA 1SFNA 5T3NA 5JR7B 3FWEA 2MNGA 1CAUB 3F51A 2KPJA 1OSLA 3S8QA 4YG1A 3WW4A 1ZRRA 4I0AA 4IEZA 4I6UA 3NW4A 1WH8A 2O38A 3SXWA 2KEIA 3KCCA 1CX4A 3SHRA 2HKXA 3EO6A 5A7LA 1FXZA 3CECA 5EFUA 1J58A 3RDIA 1LQCA 1U12A 3ST7A 1Y3TA 4BYYA 1OMIA 4HVQA 4EROA 4X6RB 4N9IA 2GC3A 1Q43A 2WUSR 5FLJA 4J1XA 3SMHA 2Q0AA 4IESA 2IC1A 1PNRA 2P17A 2IXJA 1RIOA 4META 3CO2A 3ZDSA 3OQNA 1PMIA 1QXJA 4XFHA 4CYDA 1J3QA 5CVRA 4XFBA 1RUOA 3BB6A 3PNAA 2ICPA 1OI6A 1X57A 4AVBA 4LUKA 4I02A 1I6XA 1V70A 5I0SA 4NVPA 2Q4SA 1RZSA 3O14A 3QACA 1EP0A 1CAVA 4JV4A 1VP6A 2GAUA 4AQ2A 3BPZA 5FQ0B 3N4MA 4Q0VA 5FPZA 2AXZA 3BD1A 4XF9A 4LA2A 3USSA 1O3SA 3NSTA 3NVCA 3H3ZA 1R63A 1X7NA 4Z5DA 3QOPA 2VQAA 2AXUA 3H1YA 5CU1A 5BPXA 4QX5A 2O4AA 4UBHA 2AXVA 3CLCA 2MPFA 1DWKA 2PPXA 1O3QA 4Z59A 4GULA 2MHFA 4X4HA 4KWJA 3H8UA 2XJ3A 4D7TA 4F8AA 4Z5CA 1CAWB 2N7GA 4IEUA 4YYOA 1JFTA 4MGZE 3RNSA 3FX3A 4IA8A 2FMYA 1RZRA 3UKTA 3RYPA 1G6NA 1LRHA 4KWLA 5BUVA 1TQ5A 2Y0OA 1POUA 2IVQA 2PUEA 4XF1A 2PTMA 3IBMA 2OR1L 3IVPA 3M70A 4LULA 3E97A 1DGRA 4XFIA 1WLTA 4I2OA 1PERL 4A2UA 1NERA 2PUAA 3MLFA 5C6CA 5E16A 3JXBC 2O8QA 2CSFA 3CEWA 4H7LA 4YG4A 1JFSA 4Y42A 2L8NA 4DINB 4FN3A 2WC2A 1L1MA 2IXLA 2PUGA 3R6SA 4MZUA 3EQEA 2ZKLA 2PIJA 4XF4A 1H1MA 3UKNA 4YBAA 2JCGA 2O49A 2EAAA 4LLOA 4MGYE 4AQ6A 1EYBA 1ZZBA 3FYAA 3ZHMA 1ZAYA 1CAXA 4L2NA 4Z82A 3TNQA 5FPXA 3SCFA 3E5QA 2PAEA 4X4IA 3VHRA 1CQTA 3FMYA 1RPEL 3MDPA 1SEFA 2BGCA 1NYWA 3M3IA 2BNNA 1YLLA 3I54A 4Z5HA 5JSRA 2OPKA 2H8RA 1Q5OA 4XEZA 5KHHA 3SCGA 2AUWA 3EUSA 1LR5A 4YARA 1J1LA 1ZVFA 2GU9A 3BALA 1QP4A 4GQMA 2A6CA 2I45A 4HN1A 4GHJA 3EBRA 2QDRA 3F52A 3DL3A 4F8DA 4IWRA 2XIUA 2XLGA 4O8BA 4HVRA 3U10A 3FZ3A 2OFYA 2H6CA 1YFWA 2K9ZA 4IETA 1J59A 1NXMA 4O9GA 1CJGA 3FHIB 5J3UA 1J3PA 4KU8A 2MEZA 1GT0C 1EPZA 1CAVB 3RZZA 2CAUA 4FT8A 4ORFA 4TLFA 2LYLA 1ZRDA 1JWLA 3GN5A 1XE7A 2XI8A 2QVSB 2LYPA 1ZVVA 4EWDA 3IWZA 2H0VA 3E6BA 1LB2A 3ZKCA 2IU7A 4QGLA 4MX3A 4MCTA 1YHFA 2KZ8A 2LYSA 5JSOA 4J1WA 3L2HA 2BEOA 1EY2A 4QGNA 1QP0A 4X4FA 1GQHA 1R69A 1IC8A 1B0NA 4D7SA 2CV6A 3FYMA 1QQBA 4OB4A 5I0TA 3DN7A 1YFYA 2LYRA 3SCHA 1ZRFA 1UD1A 1PRAA 2CROA 2PE5A 1X82A 2LCVA 2QCSB 1O3TA 4XF0A 2O1QA 3ETQA 3MZHA 3QQ6A 1OFNA 4LTAA 4MH0E 4Z07A 2IV1A 4XFCA 3NKTA 2C0ZA 4XFAA 1QY4A 4I6RA 1ZX5A 4HZFA 1UCXA 3I7DA 5J7MA 2XKPA 3JXDL 3OD0A 2D5HA 3OQMA 4JCYA 1UPIA 2HSGA 2PUBA 5D1IA 3PLQA 1XWRA 2BNOA 2HJIA 1WETA 1FT9A 1UTXA 3ACLA 3KMHA 4ZU7A 1SQ8A 2DCTA 3B7HA 1CAXB 3BCWA 3CF6E 1IPKA 2ZCWA 4JTOA 4XETA 1OD5A 1RC6A 3LZZA 3QF3A 5BY5A 1RL3A 1CAUA 3RYKA 3HZIB 3KGZA 4JCXA 4KL1A 3H7JA 4R8HA 3CJXA 4YSFA 4PIZA 2B5AA 1LKNA 2K0GA 1BDIA 4AXOA 5LRSA 2VECA 4Q29A 4IEPA 3U3WA 2LYKA 1UIJA 2OA2A 3JZVA 3LA3A 3CROL 4Q0QA 1UW8A 3EHKA 1YUDA 2GC2A 3OCPA 5J48A 3U0ZA 3I59A 5I8TA 4PIXA 1O5UA 1RZRD 1H1IA 5JSPA 3DNVB 5JCTA 5K8SA 2KXLA 4QMAA 4PJYA 4MCXA 4QXKA 1WA4A 3H50A 3H9AA 2OZ6A 1O3RA 1ADRA 2QJVA 4YG7B 3H5TA 5I91A 3GN5B 3O9XA 2Q1ZB 4B29A 2PAMA 3D1NI 5AVPA 3WW3A 2MQKA 3R1FA 2XSDC 1YFXA 2UYAA 4XFFA 4MV2A 2LYJA 3OF1A 2JVLA 2D93A 2IVGA 4BHPA 4HLTA 2KEJA 3FFQA 2EWTA 5E1RA 5CADA
chains in the Genus database with same CATH superfamily
2VMCA 5TSWA 4K1YA 3ALQA 2P3JA 3USUA 4IUGA 4D7YA 3JB8A 1MEC2 2YBPA 5C9AB 2Y38A 1S1AA 4XC9A 3VGIA 3RI9A 5CFCC 1BK0A 2WAAA 3BN6A 3ZXKA 3TEYA 1E5RA 2OX0A 3ZYGA 1OQDA 1GZWB 1LHUA 1JZ2A 3AMQA 2X29A 4Y24A 5F5IA 3ZPXA 5FQ0A 4M3CA 1WCKA 2O8OA 1LEDA 4F3JA 4D6RA 1VB2A 4CDUB 3KVAA 4NN0A 3F95A 3SEEA 4IEQA 3ZFEB 4BM8A 3S5AA 1SBEA 1OH4A 5I8SA 4Y1VA 4YPJA 3RFRA 4PU4C 2GRMA 5L7OA 4UT5A 3M3EA 3UFDA 1S0DA 1AL22 2D5FA 1VPWA 2JENA 4QX8A 4NPLA 2JECA 1H8VA 5J09A 1QOSA 2VXRA 1H2NA 4OHXA 1TME3 3FUOA 1LECA 1OVSA 1SLBA 2Q8OA 4XJWA 1D2SA 3AP5A 3MLLA 1IG3A 5FZOA 4FAHA 1EAH2 3KGLA 3RVHA 4NIGA 1RHI3 1FYUA 3CU7A 5DABA 4Q4Y1 4BMEA 3CHXA 1VJ2A 2D43A 2WS93 3IIIA 3AZXA 2WSVA 4GWMA 3UL2A 4E8CA 1QQP1 2XLFA 1RIRA 2ZMKA 1H8TB 3B01A 4DS0A 1AL0G 4LIUA 5LCWL 2R63A 5J96B 3IT8A 1W28A 3PDQA 3SEPA 1YFUA 5ACA1 4QM9A 2VUJA 5IUQA 3AZWA 3U4SA 2ZAAA 1UMZA 2D6PA 1RUD2 4TN7A 3NO8A 4YZ3A 4DUVA 3OGGA 3A9XA 4E27A 4UI9L 4WVZA 4KQ7A 1V6JA 4LORA 5L7OC 1JTZX 1ZYBA 5A3PA 2AGSA 2E33A 3O1TA 1TEIA 1IS5A 2HWC2 4Y20B 4RR3A 3UKVA 1WMDA 5FZAA 4X4GA 3VDDA 4IEXA 3LF7A 3MPPG 5T54A 2EXKA 4HANA 1KXGA 1NY71 4A4AA 5JOYA 3G5GA 2WZPP 1S2KA 2PHXA 3I59B 4F83A 4XUOA 2PXDA 4CEYA 2Q30A 3KHCA 2RS13 3VBRB 5GZGA 1O4XA 3WP5A 1DZTA 3RPQA 2XMLA 5BNPC 2FDGA 2LROA 1DQ4A 2HWF3 3D8CA 3SX0A 1ND2A 2GC0A 2VMEA 1ZNPA 5KHKA 1BEV1 5A3OA 3LWCA 3ROUA 3A0NA 2XXPA 2VPVA 2DF7A 2WR9A 2D6MA 2V72A 1R081 2P1BA 2W52A 2AW6A 3OBRA 3WUDA 3IZOA 2VZSA 4QHOA 2Z42A 2JDKA 4UAPA 4UW4A 4ER7A 1RUJ2 2X09A 3ASIA 2R16A 5C71A 5FZ0A 2EXJA 2XQXA 2ZZJA 3VZMA 4QXBA 2QNKA 5LWBA 2AH2A 5ISLA 2VOWA 3ZYIB 1S0FA 1J3RA 4Q8KA 2QQPA 1VPHA 1PVC2 2XVLA 2WT2A 1PM7A 4PIYA 4RR3C 3WF4A 4CXYA 3MO4A 3VDDC 1YRZA 2ERFA 1G9AA 1U5YA 5IK5A 3JXSA 3OMTA 2A75A 4Q2JA 3RZJA 1DQ2A 4AWDA 2EVXA 3L1PA 4UF0A 3AM2A 4CEYC 2XJVA 1AYM2 3O1RA 1Y9QA 4FP2A 4L11A 3WNXA 4OBMA 1XSRA 3D6EA 4Q1PA 2RG4A 4XXAA 1JU4A 3V56A 4AHXA 5EQUA 1ND2C 2ICTA 1W2TA 2D7FA 1JYWA 2PXVA 2GALA 2YPJA 3CIHA 4OUEA 4WM7B 4INDA 4NOTA 4HK8A 4SBVA 3MV11 2TUNA 1MS5A 5FBZA 2VTFA 3HIFA 1LGCA 1K5JA 1VMJA 4QKFA 5GLVA 4CCLA 2BPA2 4I3GA 3KZ3A 3HWJA 5A6YA 1PGL1 4XURA 4PU3C 3CLPA 3P6BA 1DGWA 1TVGA 5FZ4A 3V0AA 1UF2C 2GMPA 3GNEA 5DAPA 5I0UA 3AB0A 4W65A 3LFPA 1AR62 4QGMA 5GAHi 2JE9A 1H6YA 5CKNA 3BS3A 3E6DA 4OHWA 1ZPQA 1PIV2 2HBTA 3NNGA 4PQ9A 4MGKE 1S55A 1HQWA 3T3YA 3SNMA 4K7JA 5FZHA 3KL4A 4O61A 4XTPA 2BTVC 5A33A 3VZJA 2WFF3 3Q9OA 4EWAA 2JG8B 3LEMA 4W8JA 2CU5A 3LA2A 3POIA 3BDNA 1YI7A 2RM21 2UURA 2NP0A 4LO5B 3T09A 4BA6A 4QU1A 1FATA 1UNBA 4OI0A 3T2PA 4MXVA 1OURA 1RUC1 2GNDA 1C1LA 2FBEA 1XQNA 2IUWA 1PVXA 2OXBA 3ZYPA 2GRLA 2CNAA 1IPJA 3MLKA 4DY3A 2WZR1 1L3JA 4KGGA 4XF3A 3RWNA 3TN91 1YQ8A 2VBDA 1D4M2 2W0XA 4B8EA 3K4DA 4XJAA 3OG2A 4OMDA 1NCRA 1TMF2 3MV01 5FZ1A 2EBYA 2VMGA 2NMNA 4CCDA 5IATA 1C3HA 1W8TA 3FFZA 4FBIA 3WDUA 5AFEA 1G7YA 2ET1A 2XJPA 5FJHA 5GZEA 4TYSA 4R52A 1US2A 2WNUA 2PXQA 3VBOA 3FJSA 4J25A 2QTWB 4B1LA 2ETEA 2P37A 1FV2A 4JGYB 3SISA 3W20A 1R1A1 4EN0A 2GZWA 1BDHA 1PRVA 4ITCA 3TEWA 5KBFA 3I3BA 1QQAA 3VBUC 4JDMA 1PO12 3IDCB 4EWEA 1W3VA 1W6NB 2IXCA 1YIFA 3A7QA 3GZAA 1HQ1A 3NL1A 4JRLA 2OQ7A 5AC91 1UU6A 2D5VA 2BZDA 4IL7A 3O5SA 4XE9A 1A6CA 2DVFA 2GN7A 4FCAA 3QCWA 5E89A 4FPEA 3ZR5A 2Q1MA 4FPCA 3ZSMA 2PHRA 3POEA 1XC6A 3FWEA 4MGTA 1CAUB 2KPJA 5K7PA 5LA1A 3ZFFB 4NRQA 3NV3A 5FPBA 1JUIA 2W5FA 4FFGA 4DRRA 1NCRC 3BIWE 1WH8A 1UZVA 1S0CA 3HVDA 1CX4A 3VD7A 3O0VA 4TTGA 5JIAA 1FXZA 3VBOC 4KG0A 1W6QB 1GZCA 2PELA 1J58A 4JHTA 5CB7A 5FY9A 1LQCA 1AR92 2JDHA 4HVQA 1OMIA 2R49A 3KS7A 4EROA 1V6KA 1E57A 1BHGA 1ZBA1 5ACA3 4Y5Z0 3LIHA 3LPFA 1OLRA 4ATEA 3X29B 5FLJA 2ODRD 4UFLA 3I3QA 5DZFA 4IESA 4K6BA 1SDWA 2VE1A 4NROA 2IXJA 4IE7A 4ZPIA 4COZA 2DTWA 1F5JA 3CO2A 4FXKB 1XNDA 4RHV2 2R042 4AFCA 1QXJA 4BIOA 2XVKA 3KLSA 4LO8A 5EYXA 3WOGA 2A5ZA 5D8AA 3UGFA 1N3OA 2ICPA 1I3HA 2J1AA 1AR81 1Z7S2 4YW5A 4AVBA 3RZMA 2AACA 4HFSA 1ULDA 1GFF2 3ZXAC 3USUB 2FHRA 1JZ7A 2VZQA 2VNOA 1XNBA 2YZ4A 2P34A 1DQ6A 2W39A 2ZMLA 3OYWA 4NVPA 5DUVA 3O14A 2PXJA 3QACA 4XACA 1VBB1 1S0BA 2VBBA 4JV4A 5FZGA 3L9JT 4COUA 4V2WA 1BEV3 5FQ0B 2VMFA 2QQOA 2AXZA 3I8TA 4N7UA 1R083 2VL4A 4MHUA 3BVCA 5FBJA 5F5CA 4CTEA 4Z5DA 2WA3A 3OPZA 1NA1B 4YM1A 3EXUA 1MVQA 5DRTA 2VH9A 2C9AA 1OKOA 2VW0A 1OLQA 4Z59A 4GULA 1COV1 3V0BB 4D7TA 3ORJA 4Z5CA 5D8AC 1JFTA 2JKXA 3J26N 2BBVA 2YXSA 1R092 1R1ZA 1LHVA 5FZOB 4CCMA 4DEQA 4DUXA 1G6NA 2OW4A 1LRHA 1FOD3 5BUVA 5BNPB 1FNZA 2PUEA 2RS31 2ZXQA 4XJ9A 3VZLA 1RXGA 1KFXL 5AFBA 5J36A 2JIJA 2H0BA 5C5TA 1WLTA 2J7MA 5JPMB 5IK7A 3KF3A 2FDFA 4PHZA 5E16A 2O8QA 4H7LA 2VC9A 5KWRA 3R6SA 1CJPA 2YFZA 4OHZA 3ZYBA 3NAPC 5DN2A 2VNRA 2WAOA 4RR3B 4LKFA 2ZKLA 2PIJA 1M4WA 4IGQA 3VDDB 5FP7A 2YMZA 3UKNA 3BU0A 2D6LX 2IFRA 4YBAA 4OULA 1JYTA 2RS53 4LLOA 4MGYE 4B3NA 4IV1A 4Z82A 1RB8G 1CAXA 1ZAYA 4XHBA 3LCPA 4CEYB 1TE1B 5DTMA 1QNWA 1KDMA 1XNCA 2QQUA 2JD4A 1WLWA 2BGCA 4LHKA 3POWA 4QDQA 5JSRA 1ND2B 1W8OA 3ZMOA 1QH7A 1KGYA 1CWPA 1VBA1 4OQ8A 2AUWA 4QX0A 4LXLA 2MEV2 1IQAA 3ILRA 2BQPA 3IB3A 4PLNA 1RUC3 1W2NA 3IMNA 3PTYA 2I45A 4GH4A 4K1ZA 4GHJA 5FP9A 3WQBA 2QDRA 3VBRA 3F52A 1HQNA 2PQSA 3DL3A 3MLJA 4Z92B 5BXXA 1SACA 2XLGA 4O8BA 1U2ZA 1MQTA 3VBHA 2WZR3 2EAKA 2E32A 3Q8AA 3TN93 5DUWA 3U10A 4XUTA 2RJKA 1ODNA 2YBKA 2K9ZA 4FQ4A 1W9WA 3R05A 4O9GA 4UW6A 2VZPA 3WG4A 4X8PA 3T0DA 4AVSA 1GNZA 5J3UA 5HV4A 5K9YA 4IV1C 5CG8A 3RZZA 4ORFA 3WDXA 2LYLA 4EN6B 3ATGA 1GZTA 5DTQA 1JS9A 1C5IA 4PBOA 2QVSB 5T50A 2LYPA 4MADA 2GP5A 1R1A3 1H1AA 3IWZA 2H0VA 3POJA 4P5YA 3ZKCA 4U2AA 3HNBM 4AXOA 4MX3A 5LBFA 1LAJA 1NAEA 4EZIA 1WA6X 1NG0A 5JSOA 5AC93 2XWBB 4E4ZA 2E53A 2ZX0A 3WG1A 4GH4C 3IAPA 1PO21 4CCKA 1B0NA 2CDPA 2VBPA 3VBRC 2C26A 3OBTA 1FPN2 5F3GA 4OB4A 4ZXEA 1QIQA 2P3KA 1YFYA 1X9TA 1CZTA 4XZUG 3VBHC 1PRAA 4S2DA 1ZBE1 2Y60A 1XPWA 2PHTA 1X82A 4K21A 3ZFEA 1GOHA 1V9U2 3VZOA 1JOJA 3WQ0A 1SFYA 4YM0A 2O1QA 1QJY2 3MZHA 5DT2A 4Y1UA 2BU9A 3W58A 2PXLA 4LTAA 3LOBA 4XFCA 3VBUB 3J8F2 2TNFA 3DUIA 4CCCA 1KEXA 1VLNA 3UK9A 3J7HA 3ZSLA 4PI0A 3EB7A 1ZBA3 1GV9A 3B00A 3OD0A 1MR5A 3ZXFA 5IJRA 4JCYA 1UPIA 2KR2A 3MIGA 2PLV1 2BP6A 2Q5TA 2R071 5GM0A 1O3QA 5EYYA 1QDCA 3K77A 2RR11 2D44A 2GP3A 2HJIA 2JG9B 2VMHA 1CX1A 2OUJA 1W6MB 3GHNA 4PF5A 3TB0A 1UU4A 3B7HA 4A42A 5BNOC 3CF6E 3C7OA 4HT1T 1OD5A 4Q4W2 3LPGA 5FY8A 1AR83 3LZZA 1UYPA 4P9WA 3QF3A 3I3MA 4YFZA 4YZ1A 4NO4A 1X33A 3VBOB 4AFDA 1FNYA 3N35A 2Z79A 4D94A 2RVAA 2XR4A 1AYN3 1VBB3 4Y20A 1UO9A 2WINB 4Q29A 2J1UA 2XJTA 1UIJA 1ENRA 1GKBA 3GM8A 1ONAA 3CROL 1OXCA 3U14A 1VBD3 2E31A 3OCPA 1K12A 3I59A 2QQKA 4CZSA 1YQ6A 1O5UA 1SBDA 4CP1A 4AGRA 5JCTA 5F6LB 4COWA 1WLCA 5FYIA 3T2OA 5DAQA 2G9FA 3AYCA 3O0XA 1FMD2 3C7EA 1WW7A 1JMUB 3H9AA 2EIGA 5F37A 1YXWA 1COV3 4TZDA 4GMP1 4AQTA 4D0QA 3ZSKA 3H5TA 1DHKB 5I91A 5FKBA 2RDNA 4GWJA 4HKWA 4QX7A 5A3WA 5A7OA 2VGDA 3MFCA 2PAMA 3OD4A 2OKXA 3VBFA 4D69A 1QJU1 4EN9B 1YFXA 2AZ5A 2RE9A 2UYAA 2VU9A 1RVF2 2RS33 2Y26A 3GJBA 2JDZA 2VOTA 1UPSA 3IAQA 3POGA 1QJX2 4CDWA 3FFQA 4YW1A 1W8ZA 2OQ6A 1REDA 3N9LA 3TAYA 1RHI2 4BQ5A 2WS92 1ZS4A 2AR6A 1OQEA 1EFAA 2XL9A 5FP4A 2A6VA 2JDYA 4IXLA 5L9BA 1Q8QA 2YV8A 4IEOA 2B8MA 4XPVA 4J6GA 5FY7A 2D40A 4RGAA 4YG6A 1ENXA 1HJGA 5FREA 3MYXA 2H6BA 1U5XA 4YNIA 4R9BA 1AXYA 3AYDA 3SKVA 2CGPA 1SMVA 1QP7A 1WGPA 1YIPA 2YHJA 3PVNA 1DQ0A 3VD4A 1LEMA 4XQDA 3VBFC 4XBLA 2XHKA 1ULFA 2DUQA 2EA7A 2Z4FA 3OYWB 3RYRA 4ASMB 3D82A 1JZ5A 1G9BA 1CAWA 2AYHA 3KZ4C 4XW3A 3V64A 2WA4A 4CDWC 1VRH2 1W6PA 2HCNA 1VBA3 3MEPA 2ZMNA 4ONUA 1W0NA 3VLBB 2Q1FA 4M01A 4FPYA 4XJUA 2FD8A 4P02B 3WF2A 4UYBA 2ORXA 3ZN6B 4LO6B 1ULCA 3VK0A 2VOVA 2JG8A 1ZRCA 2PXFA 3WXPA 3NAPB 4W6WA 2HWF1 3N9MA 3CZJA 1IQDC 2ZEXA 1Y7YA 4BCUA 3HQXA 4M4RA 4XABA 4E2GA 5JXIA 3DXUA 1O5LA 2ZACA 3ES4A 4D8MA 1UY0A 3PMEA 2PFWA 4WVWA 1X36A 2ZGTA 1Y9MA 4NJ4A 3WD5A 1LU2A 3PIJA 3SLIA 3VWSA 1JYXA 3RSJA 2HCSA 1LHOA 1Q3EA 3M3OA 2UWBA 4GB31 4N7IA 2BWAA 3R4DB 1QU0A 2K2SA 4IW3A 1RUH2 3MGUA 3THCA 2QZ3A 4IERA 3KV9A 1UXCA 5GKAC 3I3EA 2P3YA 4LUMA 1TG7A 4QXCA 4WZCA 5DDJ2 3WG3A 4FSJA 2ZHKA 3FHQA 2AC1A 3H8RA 4N8MA 3BTYA 2QQLA 2A6XA 4AFMA 4DOUA 1EV12 1PO23 2X05A 1NE6A 3LGRA 1T2XA 2PAKA 4AAXA 2DTYA 2UY8A 5FCCA 3LSEA 3S57A 2LUWA 5I8YA 3OY8A 3GBFA 2KEKA 1XE8A 3APBA 3FUQA 2M4HA 2GC1A 4JGYA 2DBIA 1WIZA 1NLRA 1OOPB 2ZPXA 3H1MA 5FZ7A 4IV1B 5C8WA 2FJRA 3S0MA 4AQSA 2NQYA 4CUBA 3J7LA 2R061 3RZKA 1NW3A 3WNPA 2OZJA 2Z2SB 4B1MA 3AJZA 3U75A 3OBAA 4HONA 1BK1A 5J98B 1ZREA 2IUOA 3MW3A 3C3VA 4A41A 3H3LA 3ZFFA 4BMBA 2VEOA 3ACHA 3UJQA 2WFPA 1LLIA 1NUKA 2Z69A 3NNLA 3PU3A 4YRDA 3ZSEA 3DV8A 5FJKA 4AFBA 1XSQA 2LRPA 2PN5A 2WFF1 2EF8A 4GH4B 4JKLA 3OTFA 5FZ6A 5IAVA 5GAGi 1JHJA 1JUHA 2ARCA 2PLV3 1YJKA 2CL2A 2R073 1HRV2 2VAUA 2RR13 3ABZA 4HKOA 4Q0UA 4XXPA 5D21A 5CFDA 5JAXA 2WQ8A 3MF9A 2XWJB 4W6YA 3VBHB 1SLCA 2RMU2 5EZWA 4PBPA 3WNLA 3UJOA 3BYWA 2PHDA 1WCQA 4H14A 3BOWA 3DEMA 4MUVA 4QX1A 2W9XA 1ZZ7A 1O4YA 3MW2A 3QWGA 1D2QA 2DCZA 5IW0A 3H7YA 1RITA 4PF1A 5IVCA 1O4TA 3JD71 4LEJA 3A9YA 4Y5SA 5HI0A 5IHRA 4WVLA 4DO0A 3VUOA 1LOCA 3PXPA 2XBO3 4XFGA 2PQQA 5EXOA 2B9UA 5E6HA 1W39A 2DCYA 4ISQA 1UX7A 3KV5A 4KH9A 1W9TA 3O1PA 1QXRA 2UY9A 2GH2A 2UWAA 4HMZA 3AZZA 3KSCA 5FP3A 2VXJA 1E3OC 1H0BA 1RUNA 5CIRA 5FY4A 3QOWA 4XCBA 5CFDC 1SLIA 1W04A 4NMIA 2JDPA 2CAVA 4XOGA 1IPSA 2ADEA 4B7KA 4R9CA 5BNOB 5FUPA 4BU2A 4MLOA 3WQ1A 3TELA 1PGW1 3N9NA 5L73A 2UYBA 4GMP3 2Y6GA 4Q0PA 1EPWA 3WNKA 1PRUA 4YGDA 3AX4A 2F6BA 5KC6A 4DMIA 5JXJA 2VZUA 5HCBA 4Z1VA 1F35A 3Q8CA 3ILFA 4AHZA 5B4NA 1JZ4A 1QJU3 1NA1A 4I09A 3DGTA 4Z2AA 1S0IA 4QB1A 3S6PA 2LS6A 2Q8CA 5FLIA 5GALA 5FOJB 4URAA 2G9ZA 4HL0A 4M0HA 3LOIA 3V0BA 4NIHA 1ZA4A 4A7YA 4QHZA 4YM3A 1GQGA 4NRMA 2IVIB 1Q8PA 4Q4Y2 5DUXA 4GWNA 2ENRA 3B9CA 1A3KA 2XGXA 1JH5A 1SPPA 3HOBA 1QQP2 1BBT2 2A1XA 2BWCA 1OF4A 3C7GA 5BNPA 4ES8A 5HXMA 1RUG1 3MPBA 5FMCA 4Q4X2 4XMIA 4WVMA 1ZZ8A 2YB7A 4SLIA 4YZ5A 4IE0A 2ZX1A 1W03A 2I74A 4RD7A 1VMFA 3DKQA 1DW9A 5FZIA 3VD5A 4C0HA 1ZUGA 2WN2A 2AEZA 5JR7B 3LD8A 1GP6A 2XXAA 1ZRIA 3F51A 1OSLA 5DAXA 1WCSA 1W8NA 4MG2A 1VAMA 1NA1C 5AVAA 3S8QA 2F17A 1B09A 1ZRRA 2X5IA 3LIGA 1NY72 4H3WA 1G9FA 2ZEZA 4XMAA 1M06G 1C8M2 5LATA 4OUMA 2TEPA 3AKRA 2QFEA 3KCCA 3RI8A 1EAH1 3QH7A 5KC5A 5EFUA 3GALA 4NHMA 5C3QA 1U12A 1ULGA 2OPWA 1RXFA 2W1UA 1SLTA 4DRVA 1X50A 2BJSA 2IWGB 1CESA 2TBVA 5FYZA 3SH3A 1MFQC 4CXWA 1QJZA 4J1XA 2XOMA 3SMHA 1RUD1 2Q0AA 2IC1A 2AUYA 4ER5A 1RIOA 5EJZB 3HBKA 3K48A 3MI8A 4AG4A 3K3NA 3K75B 1BXHA 2VCAA 2VZRA 3AMNA 4TWTA 3VBFB 3OQNA 2W68A 4HG6B 3I2OA 4CYDA 2HWC1 1J3QA 2PXUA 3I2GA 1W9SA 4XFBA 4LO4B 2BDRA 1XOYA 1DYPA 2X5IC 1X57A 4CDWB 1NLSA 4GB33 2XH6A 4QDRA 4LUKA 5FYHA 3A22A 4I02A 1LOBA 2VNGA 1JI6A 4K40A 4MGQA 3SKJE 1IS3A 4EQZA 4AEKA 1ZM1A 3B69A 5I0SA 2Q4SA 1RZSA 1WD3A 2HLEA 5FTTC 5F7UA 2EXIA 1EP0A 2VCCA 1C5HA 1FOD1 1UOJA 4JDNA 3ZDVA 2HWE2 3BPZA 4RS5B 4C90A 2DV9A 2JDUA 2R6QA 3NJXA 4XF9A 4H2AA 5FPZA 4LA2A 5A3NA 5C33A 4R4XA 1W8HA 1O3SA 3WZ1A 1OA2A 1F5FA 4EK9A 1PGL2 1RUE1 4RQPB 1REFA 4GXLA 2VQAA 1WMXA 3HEIA 4PQQA 5CU1A 3ZXJA 2O4AA 2XQRA 4UBHA 3V65A 3VKNA 3QLQA 2ILMA 2R1BA 1QZXA 1HXS2 4M3CF 4YGCA 3EMRA 2R063 2PPXA 3WF1A 4AGVA 3W21A 4LPLA 4KWJA 5LA9A 1SFPA 4CCOA 2XJ3A 4QB6A 4QB2A 4F8AA 1MZEA 1CAWB 4IEUA 4P9JA 4AEJA 4MGZE 1GWKA 2HYXA 3FX3A 2JIGA 4KG8A 2FMYA 3TEPA 1RZRA 1W6PB 4LITA 5IVJA 1LOEA 4N90A 3RMXA 4AYUA 1DZQA 3BIEA 2RS51 2IVQA 4PI2A 1E5SA 5FOBB 1N1SA 2PMWB 2W94A 2AEYA 4UW3A 1UZYA 1POV1 1WBLA 5KXEA 4GALA 2RM22 5A6QA 4DUWA 4BZ4A 1GMMA 1CR7A 3JBG2 1PERL 1RJ8A 1WMEA 2PUAA 2HEVF 2V4VA 2WWJA 3LKJA 3MIFA 4NHXA 4A2UA 2DWRA 3VBUA 2W1SA 1OKQA 2LTNA 1LULA 2CSFA 4OQ9A 4JQTA 1JFSA 4Y42A 5DG2A 5A3MA 4DINB 4FN3A 1X9PA 3WP3A 1L1MA 1ENQA 5CYYA 3O7OA 2WZR2 3VB9A 3TN92 3EQEA 3UGHA 1LNSA 3GZUC 5HCAA 4R9AA 5DAVA 1H1MA 1UY2A 2JG9A 5DQ0A 3UYJA 1PIV1 2PXBA 2VUDA 5FAXA 1QB2A 1W6MA 3JD73 4AQ6A 3TOJA 3C7HA 2DFBA 1EYBA 4L2NA 3FYAA 3ZHMA 1LGBA 2WLPA 2Y6KA 4OMCA 4PDWB 3SITA 2GN3A 4ZXKA 3Q8FA 1CQTA 3FMYA 1PZ9A 2ID4A 2VUAA 3AP4A 4YVSC 1SEFA 2QQJA 1JZ8A 1CPMA 1YLLA 4Z5HA 2NMOA 3GBGA 4RL7A 1AX1A 2H8RA 4YW4A 2WT1A 4AI3A 2E26A 2A71A 2EIBA 3SCGA 4YARA 1N47A 2BUKA 2HYKA 3OY8B 3HN1A 4RSUA 1UZZA 1QP4A 1BVVA 4Y33A 4ET7A 4GQMA 2X10A 3K46A 4CEWA 5KR7A 3R0RA 2EALA 1UWWA 3RZHA 5ERLA 4QHBA 5EPAA 4FOQA 2XIUA 2LLVA 3SC7X 5JMCA 4LLFA 3A4UA 3FZ3A 2VVEA 3CNAA 3N9OA 3QH6A 2HH9A 2E6VA 3NROA 1YFWA 1D4M1 1I9RA 2YBSA 3J9SA 3THPA 1DLLA 2JG9C 3PU8A 2ADDA 3HD8B 3THDA 1TMF1 4KU8A 4FFIA 1ASJ1 1EPZA 2CAUA 3RZLA 1ZRDA 4URTA 4BDVB 5JWPA 3UV9A 4AAPA 4C1XA 1MEC3 4BK4A 1B35A 4EWDA 4KNCA 4LE3A 5CFDB 5FY1A 4Q4V2 5FUIA 5EJ3A 1XYOA 1RUG3 1XJAA 1ZBA2 5IFPA 1JU3A 2KZ8A 2W46A 3DPRB 3K51A 3WP6A 4CEWC 1IC8A 4CCJA 1VBC2 4D7SA 2CV6A 5APAA 5ABJC 1XNAA 2HWB1 4NE9A 5DTRA 4QWNA 1EUTA 2B42B 1AL23 1NQDA 5FZEA 2KA3A 1HKDA 4M00A 2PE5A 1N1VA 3MBWA 3ZSJA 1OQ1A 5FWJA 3VD3A 5JPNB 3UESA 2HFZA 3RZGA 1EAH3 1UOBA 3IDEA 1WBFA 4LBQA 3D5OA 4ZS3A 4Z07A 2PHFA 3KD4A 1B35C 2C0ZA 2QE3A 1E5HA 4WM8A 1OLMA 2VNVA 4P9YA 1AYN1 1ZX5A 4HZFA 1ACCA 1GLHA 1UCXA 3I7DA 3WX5A 4C0BA 1HB4A 1STMA 2JDMA 4DXRA 2FDIA 4Y1XA 2HSGA 4XAAA 2ZHMA 1RUD3 2QQNA 2PUBA 1BVP1 1VBD1 4YW7A 1XWRA 2BNOA 5FZMA 5A7QA 3W5MA 4XBNA 3ZN6A 5JIUA 2YROA 4Y22B 2DCTA 5HCHA 2HWC3 4RHV1 3NAPA 1S0GA 1XXNA 2BGPA 2VO5A 3BCWA 4CU8A 1CJDA 2HWD1 3ZKUA 2J22A 4XETA 4EQVA 4LHLA 1RC6A 5LBEA 4GJZA 3HBZA 1DYOA 4Q27A 4GD4A 3O1UA 1H9PA 2ZGQA 1Z7S1 2BV4A 1ENSA 2O0OA 2L9LA 4ARYA 4ASKA 3HN3A 5BY5A 2ZBJA 3POBA 3QBQA 4JCXA 4KL1A 5LB6A 3O1SA 1H6XA 1UOGA 4O65A 4R8HA 1QNYA 4GZ9A 2B5AA 1LKNA 1W8WA 2K0GA 1SPPB 2GNBA 4G9SB 2VJXA 4JAAA 1JOPA 5FXZA 3TEXA 4R4ZA 2G9GA 2VQ0A 3U3WA 2LYKA 5T5OA 3OUHA 2NM1A 3GZTB 4WM8C 1UW8A 3M7AA 3EHKA 1YUDA 2GC2A 3G0TA 4WVMB 3J7MA 4AW7A 2IVJA 3GDBA 3PIGA 5F3IA 5L36A 3U0ZA 3PUQA 1RZRD 1PMJX 3ZIXA 1RUE3 5JSPA 1RUJ3 4NIIA 4P9IA 3WV6A 2CY6A 3SQOA 5FMOL 4QMAA 1BKZA 4PJYA 3INAA 4LNVA 4NAMA 4BQXA 3VL9A 3GBWA 1T6GC 2XPJA 2X5IB 1PVC3 3AP9A 4UFIA 4XUNA 3GN5B 3O9XA 2FDHA 2WZEA 5F8PA 2J1TA 1OOPA 2P5BA 4JRAA 4B29A 2OVUA 4LT5A 4MVTA 5DXDA 3IN9A 5AVPA 4AK3A 1R091 3WW3A 2A73B 5A80A 5DPNA 4CU6A 1UKGA 2LYJA 2J7UA 2JVLA 1QOTA 2LM3A 1CZVA 2KEJA 1POV3 2XXZA 5E1RA 2P4EA 1UYXA 1NX9A 4UBGA 1H4GA 1DG6A 2ZGLA 3M4FA 1ZZ6A 4X8NA 3ZX7A 4E4HA 1RINA 1X8MA 5E88A 4BH9A 5FR3A 3U4XA 1VAVA 1GNYA 1ALYA 4GA9A 2DBNA 1MS3A 3ETPA 4DE9A 5FXVA 3FBMA 1QPZA 1GP5A 4QM8A 1RMU2 1JODA 1W0OA 4CE8A 2WO2A 3MIDA 3OUJA 3PVBB 2LALA 2ZEWA 2JE8A 3GYDA 2R1JL 2BNMA 3M3QA 3KF5A 4Y4RA 4YGEA 3FN9A 3OGJA 4GIQA 4EJRA 1PIV3 3I2KA 1TNFA 1W3XA 1YSEA 4NWVA 4BXSV 1OOPC 2A6YA 2QDNA 4QQHA 2YPDA 4OUSA 1IS6A 4K9SA 4P9LA 5GLWA 2VG9A 5FPAA 5JUWA 3LDRA 5DG1A 3THTA 4DXTA 5JZGA 3U07A 5I0RA 1J1TA 1Q8SA 2W2IA 2W1QA 4XJ8A 4QPIB 4BE3A 2YC4A 1VMHA 1JYNA 4PU7A 1SCRA 1VBE2 3ZOIA 1MZ6A 4PLMA 1O6UA 2MEV1 1HQLA 4Y5TA 5IFTA 5JLVA 3KXAA 2C9KA 4I01A 3VL8A 3ZXGA 5JOZA 1PO22 4LA3A 5K98B 1W2AX 3BU7A 4IEYA 4X4DA 5T5LA 2DU1A 3VKFC 1BYHA 4HOOA 5JDBA 2NZ9A 1D4M3 1KJRA 3E5XA 5A32B 1K3IA 1ZBE2 2R0FA 1YC61 4TXWA 3VKMA 4X6QB 2QUOA 5BNOA 2ATFA 1H4HA 1TMF3 3H8OA 1RUI2 4FFHA 1ASJ3 2V73A 4MYEA 3T2QA 1V6OA 3AZYA 4Z2WA 4YVSB 1N3QA 3C8XA 2JEMA 2XVGA 4HSJA 5IVVA 3PTRB 2R7EB 1NLQA 3H8XA 4FFFA 5HV0A 2L49A 1JBCA 2OYZA 1NT0A 5JZGC 1RUF2 5EP9A 2YU1A 1SBFA 1UMHA 2BOJA 1QEXA 1UIKA 2NPIA 2WYFA 2ZX4A 3JUUA 4DPNA 3QOXA 2XCJA 2CHHA 4JX0A 3MIBA 1PO13 3ZHIA 3CL1A 3VV1A 3VZNA 5KXDA 4UWDA 4PT6A 2PUDA 2PLV2 2Y34A 4JVAA 3S7IA 3O0WA 1GQPA 2BYVE 4KU7A 3ECQA 5IVBA 1G9CA 2HWB3 2DYCA 1CIYA 1FPN1 4I8TA 1LCDA 2JWPA 4LBQD 1AR72 1HRI2 2B5HA 4GKXA 1DFQA 4CP0A 1ZZCA 4KI5M 5FP8A 5C3SA 5I93A 4BXFA 4HN0A 5FDBA 4MXWB 5H9QA 3E6CC 3NJYA 3QYXA 2Q8EA 4EN7B 5J1XA 5HCFA 2WO7A 4CP9A 3WVJA 1JYCA 1UZ0A 2D6OX 3MHZA 4FPHA 1V9U1 2ZGNA 1MACA 3ZPOA 1PZ8A 4LKSA 3SH5A 1QOOA 4LQRA 4XDQA 3EJKA 4BPZA 3GJAA 4S2GA 1OF3A 5LEKA 4L8QA 2PYTA 4E2QA 1NOVA 3J8F1 1FV3A 5GZFA 4HBNA 5LA2A 4DNYA 1X2LA 3ME5A 4MO3M 1GP4A 3WNOA 1DU3D 2XBO1 3N3HA 5CKMA 4CEWB 1ULPA 2V09A 1HV0A 4YWAA 5ABJB 2J42A 1UXDA 4CA9A 4YW2A 1MS1A 1OSGA 1W2UA 1HW5A 3AK0A 1DULA 1V6LA 4IEWA 4YZ4A 2ZAHA 4Y3OA 1ZZ9A 4BIFA 4XBQA 3D0JA 5L9VA 4W50A 2G19A 3JCIA 3ME2A 3PL0A 4RHV3 2B46X 2LYQA 3B93A 5FZ9A 1I5ZA 4ZZ8A 2HWD3 4JHZA 5FZKA 3KJXA 4YSFA 3JXCL 1Q8OA 2QQMA 5IAXA 2ARAA 1UY3A 1Z7S3 4AZZA 3H1WA 5FZLA 2BJCA 4QX3A 1UU5A 3DKWA 3VKLA 4QX2A 5C5UA 2Y33A 3HJRA 1A8MA 1GZ9A 1K5MA 2WUHA 4M0NA 4UFKA 3T4VA 1B35B 2WKKA 2L1PA 4JQDA 4HVOA 3ZFGA 5D2AA 2ZX2A 2Q8DA 1OUXA 2PHWA 2VTXA 1TME2 2F4PA 5KHIA 1AJKA 4JKMA 2B9VA 5BYNA 3PE5A 1LTEA 1L7RA 3OBZA 3C2UA 5C4WB 5EJ1B 4ZHNA 1JXNA 4D6SA 4FPJA 4EN8B 1PNGA 4BQ1A 3C7FA 1QMJA 3U37A 4IGOA 5JOXA 2GZUA 1SHWB 3ELNA 4KBZA 3T2TA 1CQ9A 4AVAA 4RS5A 1FMD1 5A7NA 1S7EA 3F6WA 1LHWA 3U11A 3DYPA 2YC2A 1LCCA 1AJOA 4LBLA 1WUVA 2C6SA 4CSWA 1GR3A 2FMDA 1BLZA 4RQPA 2WO1A 4IE6A 3TYJA 1R093 4I3PA 2HEYF 5CNAA 2WLQA 5FIXA 1HN1A 1YYNA 4U36A 4M4PA 4Z58A 4K8FA 4LBQB 2PHLA 1RVF1 1GYKA 1K5MC 1KS4A 4L97A 3B02A 1QJX1 3I2FA 4QKDA 1AU7A 1WD4A 4WM8B 1TNRA 3ZFGC 2CWSA 5A1FA 3H3UA 2R1DA 1KRIA 1NEQA 3FE5A 4QPGA 3CDZB 3N36A 5A1AA 4AE2A 3FBYA 3BGAA 4Z8BA 1N3PA 3B5LB 5C7GA 2RS12 3SH4A 4NPRA 4QPYA 2BVVA 5FXWA 1O4ZA 2FQPA 1DQ5A 3RS6A 1GWMA 2HWF2 3D0SA 1UOFA 3T4HB 4F7ZA 1W2OA 4EKGA 3ENRA 3LAGA 1O7FA 1F4HA 4RS5C 4HETA 4MGIE 2EICA 1SQ4A 1Z78A 2XG3A 3LA7A 2GMEA 2WNEA 4OHVA 2D3RA 1WWYA 4QXHA 5GLZA 5FZFA 2C24A 4RQPC 2A3WA 2A6WA 2RHPA 5L9RA 3WW4A 4YG1A 4NPMA 4I6UA 1KQRA 3NW4A 4GB32 4CVUA 3D3AA 2O38A 2Y6LA 4NHKA 3KT1A 3SXWA 3ZPYA 1MVEA 1VRH1 1XNKA 2DUPA 2HKXA 1WZXA 4QPGC 5K0UA 1BMV1 2MEV3 4GMP0 1VRBA 3G6JB 4PDWA 3RDIA 3ZM8A 4XJZA 4AI9A 4BYYA 3I49A 2B39A 2I07B 2A7AA 3OEBA 3AKTA 5A7WA 3ZXLA 5FO9B 4N9IA 3WR0A 2XHNA 2GC3A 1Q43A 3CJIB 4BK5A 1H30A 2ZGSA 1ST8A 3KT4A 2DU0A 3PUHA 1PX4A 5DZGA 1RYYA 1WCDJ 3F2ZA 1OPMA 2P17A 2ZGUA 4AVVA 1AHSA 3MIHA 4EE2A 3ZDSA 4JKKA 4K8RB 1UYYA 4QQ2A 4XFHA 2EXHA 4K20A 4Q5OA 1YI9A 3DCQA 4BWOA 4CU7A 4YW3A 2UWCA 4Y1ZA 1OI6A 5BNNA 5JXGA 4JC1A 3JQWA 2W1WA 2VZ3A 4DXZA 2DVAA 2WYSA 5F3EA 5HPOA 4OI1A 4WVVA 5DDJ1 5A6ZA 1APNA 4XZPA 5K0UC 1UQXA 2WFF2 1XU1A 1C8NA 1CVNA 4PDWC 1VP6A 5EIYB 4Q26A 4AEDA 3N4MA 4Q0VA 1EV11 2JX9A 1DYKA 2WABA 1FPN3 3NSTA 3PUAA 4Y4YA 3VDCA 3AVSA 3H3ZA 3ZO0B 1R63A 1X7NA 3N9PA 4LJHA 4ZY9A 4K3UA 2VM9A 3W9AA 1A34A 2AXUA 3H1YA 3ZR6A 1H2KA 4QX5A 4R9DA 3DPRA 5FPVA 2AXVA 4N53A 4NAOA 4NR1A 5FKCA 4S2HA 1DWKA 3P1IA 5DAWA 1V9U3 2MHFA 3S5QA 3AVRA 3ZXEA 4YYOA 1URXA 5JZGB 3RMYA 2ZTNA 4QPWA 2X8KA 3NDBB 3UKTA 5BNNC 3RYPA 2D6KA 4ATFA 4KBBA 4KWLA 1TQ5A 3J8F3 1DBNA 2Y0OA 3PUSA 4IQPA 4NHLA 4XF1A 2PTMA 5F2SA 4ARXA 5C8CB 2ZJCA 3IBMA 4ZONA 2VVDA 3DYOA 3NNJA 4LULA 4AI8A 3E97A 4QD2A 4LO7A 4XHXA 3B9IA 4FPFA 5F32A 2QQVA 4PCRA 1NERA 1DGWX 1HRV1 5H9RA 4AEDC 4CUAA 5A3UA 3MLFA 5C6CA 3ZYHA 2FZ2A 3JXBC 2O14A 5KXCA 4L0PA 3CEWA 2Y8KA 2VCBA 2RMU1 1OHFA 4YFWA 4A7KA 5LZ6A 3O1MA 2WBKA 2WC2A 2DDUA 2PUGA 1T6BX 3M9LA 4FOWA 2D98A 2ARBA 3DPRC 5ANNA 5HXVA 3NNMA 2DCJA 4N53C 2J1SA 5FFOC 1F31A 2JCGA 1UXXX 2EAAA 4A7ZA 4B4PA 4Y22A 1WW6A 1OFSA 1ZZBA 5FPXA 3TNQA 1JYVA 1WLDA 2JE7A 2DFCA 5K0UB 1PX3A 5GZCA 1D7PM 1Y43B 1RPEL 1ODMA 3JQXA 3ZYFA 3IKWA 1NYWA 1NZIA 2BNNA 3MW4A 3WCRA 4H55A 2OPKA 2VMDA 3ACIA 1Q5OA 3OEAA 4XEZA 3ZVXA 5M0TA 2CGOA 4G4FA 3ZMNA 1MEC1 3EUSA 3AXDA 1RUG2 1ZVFA 2GU9A 5FMOS 3LFMA 4ES9A 4H7MA 2A6CA 4NRPA 4YW6A 3MIEA 1FMD3 3EBRA 4QDSA 5ACA2 2G1MA 3AL6A 2NLRA 3WDYA 2EIEA 3FMGA 2D97A 4B4RA 5FZBA 1AXZA 2YFUA 4BQWA 4CP9B 2OFYA 2E51A 4BOWA 1J59A 4LK7A 4BISA 1QHDA 1S4CA 2B4KA 5A3LA 1AL21 3N7JA 1ULOA 4NHYA 3FHIB 1RVF3 3E1F1 1J3PA 2J1EA 3VN4A 2MEZA 1CIWA 1Q56A 1QJX3 3FC0A 1CAVB 4FT8A 3ZYJB 4ER6A 4YG3A 2PXEA 3GN5A 4ZZ5A 4L9BA 1UN1A 1XE7A 1F8VA 2XI8A 2VULA 3WINE 2XJRA 1IGOA 1K45A 2VW2A 1Q8VA 4QQLA 1UAIA 1UMIA 1BBT1 1Y9GA 1LB2A 4XYXA 2IU7A 4QGLA 4XUQA 4MCTA 1YHFA 2VR4A 5FYTA 3T08A 3AYEA 4P5HA 4Q4X1 3L2HA 2BEOA 4HXCA 3ZN5A 1BEV2 4X4FA 1GQHA 4QKNA 2KD7A 5DMYA 1LGNA 3Q8BA 5LA0A 1R082 3NV4A 1JN2P 3ON7A 5I0TA 1US3A 4AFAA 3PMSA 3DN7A 4YZ2A 3BUCA 3SCHA 1AX0A 5A3TA 1UD1A 3B94A 1KS5A 3U1XA 1KFUL 2A3XA 1K5MB 2CROA 5GJ6A 1ND3A 3WSOA 4P14A 5FZ3A 3ZFGB 2LCVA 4YLZA 1O3TA 1C8M1 1VRH3 1GSLA 1QJEA 4XF0A 5FK7A 3ETQA 2W87A 4WV8A 3NZLA 1HDKA 4G3YC 1JW6A 1FOD2 1YNAA 2D3PA 3AC0A 3NKTA 4XFAA 5FYMA 1QY4A 1VAKA 1MZFA 3ACFA 4I6RA 3KM5A 3VZKA 5F3CA 3ITQA 2BBAA 3JXDL 2Y64A 3OQMA 4A6SA 2PHUA 4LHSA 4YVWB 5FYUA 4QPIA 1RUE2 1DLCA 5D1IA 2C1FA 5A70A 1FT9A 3T30A 3DM5A 2FDJA 1MS4A 1UTXA 5F39A 4QU2A 1VE0A 5DRYA 1YQ5A 3ACLA 1BQPA 4CDQA 4IE5A 4EZ4A 4DY5A 5FZCA 1RUJ1 1P8JA 2XJUA 3ZN4A 5G04L 1PK6B 4JTOA 1LOAA 4C91A 1ND3C 4AHYA 1HB1A 4COYA 1H2MA 1LU1A 1CD3G 1CPNA 3HZIB 3RYKA 1PVC1 5A32A 3BTXA 1RUH3 1DDLA 1QKQA 2RS52 3IDAA 3OB8A 4QPGB 3H7JA 3FLPA 5DDJ3 1BDIA 4TSVA 5LRSA 2VECA 3P3PA 3GHMA 2YDEA 4LBMA 4YVSA 2B7YA 3HMYA 4ASLA 5FPUA 3JZVA 2XJQA 3LA3A 1YQCA 1EV13 1AYM1 2HWE1 4XVHA 1I5PA 3W5NA 2A6ZA 2JICA 3AJYA 5I8TA 2WWSA 4OHYA 3DNVB 1Y4WA 4QPIC 1GBGA 1OC1A 4Q1RA 1UY1A 3LEKA 3O12A 2ARXA 2KXLA 1DF0A 1RUC2 4KMQA 4IV3A 4MCXA 3BKZA 5CEHA 1WA4A 1CZSA 4CDQC 4CPBD 1OVPA 2BW8A 1ADRA 1HXS1 3BTAA 4L99A 1V6IA 3OGVA 2PXPA 1KDKA 4KGQA 3RRDA 5FWEA 4OYUA 2ZGOA 2Q1ZB 1AR61 3D1NI 1WCUA 1IZ3A 2WDBA 4JGZA 5IK8A 2MQKA 3R1FA 4MXWA 2XSDC 2W3JA 3KV6A 4LIVA 4XFFA 4MV2A 3OF1A 2D93A 4V2VA 4COVA 3RJRA 1SDDB 1D4VB 3WNMA 4MSVA 1H9WA 3G7DA 4NIAA 4CUCA 5FPLA 2DVDA 2W92A 1OLME 5A7WB 1RJ7A 5LY2A 5JXHA 1HRV3 3JBG1 1KJLA 2J7WA 1R1A2 4LMFA 2ZABA 4FQZA 5IVFA 3LEIA 2RJLA 3T1LA 1XRUA 3NMBA 3WW2A 2RMU3 1XB9A 2IFWA 4OVEA 3BI3A 2P6CA 5LK7B 5T55A 5AC92 2WSUA 3WCSA 1ULEA 3PHMA 1NZCA 3EYPA 5LBCA 3MF6A 3E5UA 3M3CA 4IV3C 5LBBA 1WH6A 1YEWA 4FPGA 3WW1A 2VUCA 5ABJA 5LEJA 5IYYA 2A3YA 3AXEA 5FV3A 2IXHA 2ES3A 4X4EA 4BQ4A 1AUYA 5BNNB 3M2MA 5FYVA 5JI7A 1ASJ2 4D6QA 2VW1A 2J1VA 2V4AA 5FMDA 1XYNA 4JGZC 5T52A 3WDTA 4AL9A 1C28A 3AMMA 4E4DX 1NQJA 1X8EA 5KHGA 1AXKA 1VR3A 3P5BA 5FLHA 4Y26A 4OZXA 3TBDA 2HINA 4FTSA 5LRRA 3CZUA 2ZX3A 3AL5A 3KVBA 5IVEA 1VB4A 2LLWA 2XJSA 2BGOA 4P9GA 1W9YA 5ANQA 3AP6A 3NV2A 3ZIWA 4AEDB 3M1HA 3VHOA 3UT0A 3KCYA 5FYCA 2IXKA 3OPWA 4AEMA 3N7KA 1HIXA 4I6TA 4LR4A 4FAGA 5E8AA 4O9EA 2XKOA 3M8LA 1PO11 3OGRA 2HWB2 1W6OA 3GF6A 3VHNA 3WY6A 5A7PA 1UZWA 4N53B 5C4WA 3VBSA 3OP9A 3URFA 4CP2A 1JZ3A 5A6XA 1POV0 3JU9A 5SV8A 3LQXA 3GZEA 2JB4A 4AF9A 2WQZC 4EV0A 4ZU5A 2RDRA 1NCQA 2LW8A 5FZDA 2E7QA 4HSLA 3TEZA 1RGSA 4NDWA 3IDBB 2CSGA 1AR82 1A78A 1SG3A 4Q4Y3 3AKQA 1XBFA 3FHAA 2DVGA 4AVTA 5CFCB 2WNUC 1W0PA 3J7NA 2E9QA 2V5DA 4I30A 4Y1YA 2CDOA 3WNNA 5BV6A 1QQP3 1BBT3 3HPNA 3TNPB 1AYN2 1PM4A 1VBB2 4I0BA 4Q4V1 2XDVA 4Q4X3 2JD9A 5F9TA 3DYMA 1QXPA 3AYAA 1AR91 4RGKA 2EF6A 3KT7A 5JVVA 1VBD2 3OQOA 2QBXA 3GXUA 4A44A 4AVCA 2Z5WA 4LK6A 2Y6FA 1VBC1 3PUIA 1OD3A 3ES1A 5GLUA 4CDXA 4OLLA 4FPLA 3RG0A 1QF3A 3R4SA 5C3RA 5C4WC 5F1RA 3VBSC 2OIIA 4UXAA 2HWD2 2RV9A 1MZ5A 2CWMA 1NCQC 1WW4A 2AREA 1NE4A 3KQRA 3OJBA 4FXGB 2R041 1PNFA 2BRTA 4Q0SA 1COV2 5IWFA 3RGBA 1C8M3 5LK5A 1O59A 4CXXA 4UOJA 4E2SA 3I3DA 3LISA 3DF0A 1S0EA 2DVBA 4BB3A 4E9KA 5FO8B 3NRUA 5B2GB 1W8UA 4FI9A 4FOYA 3WF0A 4N43A 2VOKA 2WN3A 2RS32 4QQPA 4RN5A 1LCLA 2BFUS 4M3CB 2XL7A 1YJLA 2SBAA 4JTNA 1DZRA 1FAYA 1K42A 1JH9A 2PA7A 1LOGA 3NJZA 2PXTA 1NKGA 5EHDA 1O8SA 4XDOA 4ZU4A 4X4CA 4BQYA 5L7OB 2VTXJ 4HPKA 4LE4A 4CDXC 3FLTA 3B7MA 3UNPA 4DIQA 1V0AA 5LW9A 3TRBA 3CJIA 4LBKA 1RTVA 1GICA 4X4BA 1VIWB 3GZDA 1LMB3 2YGMA 4N9HA 5EWSA 3RJ2X 4EZHA 1GANA 4DZGA 3IIAA 1UXZA 2Y6JA 4O7XA 2VZOA 5C3OA 2XLAA 3WF3A 1IKPA 1WMFA 4CCNA 1GNHA 3BPSA 4BLJA 4XCAA 1YCIA 1CGPA 1UY4A 1SZBA 4BQ3A 1V6NA 5JOWA 1V6MA 1YQ2A 1F4AA 2W47A 3OOXA 1PZ7A 4ER0A 2CGNA 2E63A 2WNVA 3TRSB 3RWKX 4N43C 3SR4A 1AYM3 2HWE3 2YUEA 1MPXA 5IT6A 1GWLA 4FTEA 2JJ6A 3Q8EA 1GOFA 4IGPA 1VBA2 4HRAA 3K4ZA 2ET7A 4FBFA 4RFRB 2WQ4A 2ZKNA 5T5PA 2HBUA 5T5JA 2OT7A 1POQA 3HT2A 4B4QA 2IXIA 1FX5A 4WBBA 1HXS3 2RDSA 3HNMA 5F5QA 1ND3B 2VD7A 3IPVA 4XQ4A 1SLLA 3VKOA 4XTMA 3CJIC 4I0WB 5BNQA 1AR63 2VOXA 1IOAA 4KWKA 1HX6A 4YM2A 3N9QA 2WIUB 3GZDC 1OA4A 2FZ1A 4CUGA 4UW5A 3LB9A 3RQ0A 1OH3A 1YWKA 1S2EA 2PUFA 1MS8A 1U0AA 4IEVA 1HF0A 1QWRA 3POSA 2RM23 2FCVA 3K3OA 2WNVC 4YG0A 3JBG3 5CBLA 4IVZA 3S7EA 5HBAA 3LDKA 2JDNA 2ZGRA 4YGBA 1V00A 2IZWA 1UX6A 5KHJA 4OFGA 4QT6A 3WHTA 5C8CA 4XUPA 3LE0A 4AI0A 1OCTC 1RMU1 1PHMA 2AWIA 4MOAA 4CDQB 5IK4A 4JZRA 4OCTA 2IVBA 3HT1A 4AGGA 4GKYA 5G05L 5SV5A 4XQWA 2W95A 1FI2A 1SCSA 1BZWA 4BQ2A 5FYYA 2PUCA 4PU8A 1GU3A 1SFNA 5T3NA 3ACGA 4E4SA 2MNGA 3QFIA 3K4AA 4UF0B 2C4XA 3KV4A 4I0AA 4IEZA 4NWWA 4WZFA 5J37A 2DCKA 2BOIA 1R64A 3JB4C 3PVEA 4GQ7A 2KEIA 1F9KA 4JCKA 3SHRA 3OUIA 5A1LA 3EO6A 2D3SA 5A7LA 3ZYRA 4AHWA 3CECA 3ILNA 1J83A 1OBNA 3LQCA 1VBE1 3AKSA 1HLCA 2C5DA 3ST7A 5L19A 1Y3TA 3FLRA 2QQWA 5CZKA 4X6RB 5C9AA 5C8CC 1F2NA 3HR9A 4IV3B 3V0AB 1JOBA 4ER3A 4PLOA 3DXTA 2WUSR 5F5AA 2R072 1UL9A 2WWUA 2RR12 2VCMA 1GZWA 1MQTC 3MEJA 1C57A 1L7LA 1LENA 1SLAA 1PNRA 1IKQA 2VZ1A 2W91A 5CKQA 4AI2A 5DSXA 4LOSA 2P3IA 3KHBA 4META 4XAEA 5FO7B 5LASA 3POYA 4JGZB 4TLGA 4CDUA 5C3PA 1PMIA 1RUI1 5JI9A 1N1TA 3J4UH 3NWKA 5A33B 3MUZ1 5CVRA 3NV1A 1RUOA 2NN8A 1HB2A 3BB6A 3PNAA 3I4IA 1CONA 4E8DA 1JZ6A 1PMHX 5GZDA 2VZVA 1GUIA 3HQRA 4QQOA 1N1YA 2WO3A 4HKLA 3PVOA 1OT5A 2RDQA 4LKDA 1I6XA 1V70A 1QJY1 1RUF1 3ZLIA 2Y6HA 4A3XA 4Q4V3 4FTBA 2XBO2 1CAVA 3CMGA 1EUUA 4FPOB 4XIOA 3WEZA 2OS2A 5CG9A 2MXDA 2VMIA 1AR93 2GAUA 4AQ2A 1YO8A 3P3NA 2ZHNA 3KQ4B 5K4LA 3BD1A 2E7AA 3IM0A 3WDVA 1VBC3 3USSA 4FPKA 5C9AC 3NVCA 3KB5A 3NQHA 1XE0A 1H8TA 1AR71 1HRI1 2XUMA 1VALA 2P6HA 5FK8A 5H9PA 3QOPA 4RA0A 5BPXA 3POFA 3VD9A 1NCRB 1W06A 2EIDA 4NIDA 1MS0A 3CBNA 3I2DA 1W90A 3CLCA 2R043 4FOVA 4OZOA 1G8WA 2MPFA 4IDZA 4CDUC 4X4HA 3ZFEC 1Z0HA 3H8UA 4DEVA 4CU9A 2I2SA 2N7GA 1OPOA 2WNUB 1HV1A 1LOFA 4Q4W1 3RNSA 2FDKA 4IA8A 1W05A 3T1MA 3WG2A 1QJU2 3MICA 1G9DA 4Q2FA 4XDPA 1JHNA 1POUA 2GDFA 4P9XA 4UFJA 2XUEA 2BVBA 1J84A 3D4KA 2OR1L 3OWQA 2DURA 5FRAA 2WL1A 3IVPA 3M70A 4GJYA 3GUUA 3N7LA 1DGRA 3ZXDA 4XFIA 1XNTA 5C70A 2YU2A 5JMOA 3MUY1 1S0JA 2P2KA 4I2OA 2ZA9A 1OA3A 2ZHLA 1W6OB 1HJFA 3BODA 3CKHA 3A9ZA 1O8PA 2FFHA 2QKDA 2X53S 2YY1A 3VBSB 3A23A 3NXHA 3MFAA 4XILA 4HK9A 4YG4A 2JB8A 4BLIA 2L8NA 1H8TC 4FO9A 3IMMA 5FMBA 1NCQB 1GOGA 2IXLA 5F6KA 4MZUA 2J1RA 2WJSA 5FZ8A 3KWVA 5H9SA 4YVWA 3AMHA 2ZGPA 1UKRA 1ZA7A 4A6OA 3A0KA 3NKGA 1AZDA 2JQEA 2YGLA 4XF4A 4C1WA 1DIWA 4DFSA 2O49A 2ZS6B 5FYSA 1LOFC 4DB5A 3TWIA 4S2FA 3SCFA 3E5QA 4UFMA 2PAEA 4X4IA 1PK6A 4V1PA 3LSDA 3MDPA 3UWPA 2WIIB 3VHRA 1TME1 4ZKTB 3M3IA 1DCSA 3I54A 4MHRA 4LHNA 2XONA 5KHHA 1RHI1 4W4ZA 1LR5A 2W08A 1J1LA 3BALA 2WS91 1PGSA 3HQUA 4ZS2A 2VVFA 5B4XA 4CCEA 4CDXB 3HAGA 4D3WA 4HN1A 4AOCA 4Q8LA 3TFLA 3NJVA 3I2JA 1E5IA 1WKYA 2D6NA 4W6XA 4F8DA 4IWRA 2DUOA 2E7TA 1LJ7A 3AP7A 3PJQA 4HVRA 4WM7A 5D8AB 3U78A 5IVYA 2XB6C 1O91A 4OI2A 1D0GA 1KD7A 4UFHA 3I2IA 3AMPA 2H6CA 4YVWC 2R0HA 3WDWA 4DE8A 4IETA 1QH6A 4C8DA 1NXMA 1W99A 2XXQA 3BOPA 2YBDA 5JUVA 1OUSA 4OI4A 1CJGA 5FY5A 1AX2A 2YG0A 1KITA 1U5IA 2R30A 3OPTA 5KXBA 3LFIA 1GT0C 3L2YA 4N43B 4TLFA 1JWLA 2ZOEB 3K2OA 3QD6A 1C4RA 3WP4A 3LDBA 3AFGA 1PK6C 1DGLA 2GH8A 3LEGA 5JR2A 1BMV2 1DQ1A 3WLUA 3VDBA 1ZVVA 3GGLA 3PURA 3R09A 1AVBA 5CISA 5I0DA 3E6BA 2RS11 2V3CC 5LY1A 2BERA 2B45X 1DGRN 1Y7BA 3WT3A 3OGSA 4HPKB 4EKIA 1RMU3 2LYSA 2OUHA 4LBNA 4J1WA 4QGNA 2ZZQA 1EY2A 1QP0A 2JDAA 2GNMA 5A7SA 1F15A 2BFUL 1R69A 4LOTA 4A3ZA 2HEWF 5F2WA 3FYMA 1QQBA 4QKBA 4NUBA 2FCUA 4WM7C 2LYRA 3AFKA 1ZRFA 2ORZA 1CN1A 3BTZA 5DUUA 2RJ2A 4A45A 2R32A 4GWIA 2KM2A 3CQOA 4JDOA 1D0HA 1NXD1 2R062 2ZEYA 3I97A 2K46A 2QCSB 2SLIA 2Y0IA 4P08A 5GLTA 1U5ZA 2WNVB 3UGGA 3N7MA 5DZEA 1C1FA 3QQ6A 1TZOA 2WZ8A 1OFNA 3AZVA 1QJFA 1VBE3 4MH0E 2IV1A 3H42B 1RUH1 1H2LA 1W9FA 1IS4A 4EYUA 4RGGA 2QQIA 1HB3A 2ZGMA 2JG8C 5J7MA 2XKPA 3DECA 2FCTA 4M3CE 2WNOA 2D5HA 4MGSA 1JYIA 3NNFA 3WHUA 3WUCA 2YC0A 1BCXA 2UU8A 3GCWA 1XYPA 3PLQA 2VQUA 1AF9A 3IPVB 3OSDA 2ZGKA 1WW5A 1WETA 4B7EA 1ZBE3 2VY0A 3KMHA 4L92A 1QGLA 1W6NA 4ZU7A 1SQ8A 1IHMA 1RUI3 4DQAA 1CAXB 4CRQA 3R4UA 1IPKA 1MS9A 2VZTA 2ZCWA 4AI1A 1REEA 1W8FA 4BJ0A 3GCXA 5CA6A 4IE4A 1RL3A 1IG0A 5FYBA 1CAUA 1HN0A 2GSYA 4AR2A 4KWUA 3KGZA 1QJY3 1RUF3 2CYFA 2YYOA 3JD72 3VHPA 1BJQA 3CJXA 4PIZA 4ISRA 3W59A 3ZKYA 3B3QE 4LKEA 3FL7A 5EV7A 3A21A 3HNYM 4IEPA 5FXXA 2OA2A 3T0AA 4Q0QA 2JKBA 2QZ2A 5CFCA 4GAZA 1L7QA 2G4IA 4CPBA 5J48A 1LODA 3O1VA 3S30A 1MQTB 1W6QA 4PIXA 1A8DA 3VDAA 1G86A 1UYZA 1H1IA 1AR73 1HRI3 3AKPA 4JGYC 1LHNA 2GMMA 1S2BA 3UETA 2F4LA 2WT0A 4FP3A 1LESA 4RFT0 3T0BA 3WQ7A 2GNTA 5K8SA 4JQRA 4QXKA 3KCXA 5CAZA 3H50A 4DXSA 1PGW2 2OZ6A 3GZCA 3H0OA 3PJYA 4LBOA 2NYYA 2PXKA 2CTVA 1XU2A 2QJVA 4LBJA 4XIKA 3O1OA 1O3RA 4YG7B 2AENA 4QAWA 5FUNA 4Q4W3 3I2HA 5FY0A 2JXAA 1I1EA 2LNMA 4P00B 2A70A 2V5YA 2WRAA 4RYDA 1DP0A 4FVVA 2VQTA 3ZFFC 3OKZA 2IVGA 4BHPA 4HLTA 1QDOA 2EWTA 5CADA
chains in the Genus database with same CATH topology
5TSWA 4K1YA 3ALQA 2P3JA 3USUA 4D7YA 3JB8A 1MEC2 5C9AB 2Y38A 1S1AA 3VGIA 3RI9A 5CFCC 3ZXKA 3ZYGA 1OQDA 1GZWB 1LHUA 3AMQA 2X29A 4Y24A 5FQ0A 4M3CA 1WCKA 2O8OA 1LEDA 4F3JA 1VB2A 4CDUB 4NN0A 4IEQA 3ZFEB 4BM8A 1SBEA 5I8SA 4Y1VA 5L7OA 4PU4C 2GRMA 3M3EA 3UFDA 1S0DA 1AL22 2D5FA 1VPWA 2JENA 2JECA 1H8VA 5J09A 1QOSA 2VXRA 1H2NA 4OHXA 1TME3 3FUOA 1LECA 1SLBA 2Q8OA 4XJWA 1D2SA 3AP5A 3MLLA 4FAHA 1EAH2 3KGLA 1RHI3 1FYUA 3CU7A 4Q4Y1 4BMEA 1VJ2A 2D43A 2WS93 4GWMA 3AZXA 2WSVA 3UL2A 1QQP1 2XLFA 1RIRA 2ZMKA 1H8TB 3B01A 4DS0A 1AL0G 2R63A 5J96B 3IT8A 1YFUA 5ACA1 4QM9A 2VUJA 5IUQA 3AZWA 2ZAAA 1UMZA 2D6PA 1RUD2 3NO8A 4YZ3A 3OGGA 4E27A 4WVZA 4KQ7A 1V6JA 5L7OC 1JTZX 1ZYBA 2AGSA 1TEIA 1IS5A 2HWC2 4Y20B 4RR3A 3UKVA 1WMDA 4X4GA 3VDDA 4IEXA 3MPPG 5T54A 2EXKA 4HANA 1KXGA 1NY71 5JOYA 3G5GA 2WZPP 1S2KA 2PHXA 3I59B 4F83A 4CEYA 2Q30A 2RS13 5GZGA 1O4XA 3WP5A 1DZTA 3RPQA 5BNPC 1DQ4A 2HWF3 3D8CA 1ND2A 2GC0A 1ZNPA 5KHKA 1BEV1 3ROUA 3LWCA 3A0NA 2VPVA 2DF7A 2D6MA 1R081 2W52A 3OBRA 2AW6A 3WUDA 4UW4A 2Z42A 1RUJ2 3ASIA 2R16A 2EXJA 2ZZJA 3VZMA 2QNKA 2AH2A 2VOWA 3ZYIB 1S0FA 1J3RA 4Q8KA 2QQPA 1PVC2 2XVLA 2WT2A 1PM7A 4PIYA 4RR3C 3VDDC 1YRZA 2ERFA 1G9AA 1U5YA 5IK5A 3OMTA 2A75A 1DQ2A 4AWDA 2EVXA 3L1PA 3AM2A 4CEYC 2XJVA 1AYM2 1Y9QA 4FP2A 4L11A 3WNXA 3D6EA 4Q1PA 4XXAA 3V56A 4AHXA 2ICTA 1ND2C 2D7FA 2YPJA 2GALA 4WM7B 4INDA 4NOTA 4HK8A 4SBVA 2TUNA 1MS5A 5FBZA 3HIFA 1LGCA 2BPA2 5GLVA 4I3GA 3KZ3A 3HWJA 1PGL1 4PU3C 3CLPA 1DGWA 3V0AA 1UF2C 2GMPA 3GNEA 5I0UA 3AB0A 4W65A 3LFPA 1AR62 4QGMA 2JE9A 3BS3A 3E6DA 4OHWA 1ZPQA 1PIV2 4PQ9A 4MGKE 1S55A 1HQWA 3SNMA 4K7JA 4XTPA 2BTVC 5A33A 3VZJA 2WFF3 3Q9OA 4EWAA 2JG8B 3LA2A 3BDNA 1YI7A 2RM21 2UURA 2NP0A 4LO5B 4BA6A 1FATA 4OI0A 4MXVA 1RUC1 2GNDA 1C1LA 2FBEA 1XQNA 3ZYPA 1PVXA 4DY3A 2GRLA 2CNAA 1IPJA 3MLKA 2WZR1 1L3JA 4KGGA 4XF3A 3RWNA 3TN91 1D4M2 2W0XA 4B8EA 4XJAA 1NCRA 1TMF2 2EBYA 2VMGA 2NMNA 1C3HA 3FFZA 3WDUA 4FBIA 5AFEA 1G7YA 2ET1A 2XJPA 5GZEA 4TYSA 4R52A 2WNUA 3VBOA 3FJSA 2ETEA 2P37A 1FV2A 4JGYB 3SISA 4EN0A 1R1A1 2GZWA 1BDHA 1PRVA 4ITCA 5KBFA 1QQAA 3VBUC 4JDMA 1PO12 3IDCB 4EWEA 1W6NB 2IXCA 1YIFA 3GZAA 4JRLA 5AC91 3NL1A 1UU6A 2D5VA 4XE9A 4IL7A 3O5SA 5BXXA 1A6CA 2DVFA 2GN7A 4FCAA 3QCWA 5E89A 4FPEA 2Q1MA 4FPCA 3ZSMA 2PHRA 3FWEA 1CAUB 2KPJA 5K7PA 3ZFFB 3NV3A 4DRRA 1JUIA 1NCRC 3BIWE 1WH8A 1S0CA 1CX4A 3O0VA 5JIAA 1FXZA 3VBOC 4KG0A 1W6QB 1GZCA 2PELA 1J58A 5CB7A 1LQCA 1AR92 4HVQA 1OMIA 2R49A 3KS7A 4EROA 1V6KA 1E57A 1ZBA1 5ACA3 4Y5Z0 1OLRA 4ATEA 3X29B 5FLJA 5DZFA 4IESA 4K6BA 1SDWA 2IXJA 4COZA 2DTWA 1F5JA 3CO2A 4FXKB 1XNDA 4RHV2 2R042 4AFCA 1QXJA 4BIOA 2XVKA 3KLSA 4LO8A 5EYXA 3WOGA 2A5ZA 5D8AA 1N3OA 2ICPA 1I3HA 4YW5A 1AR81 1Z7S2 4AVBA 4HFSA 1ULDA 1GFF2 3ZXAC 3USUB 2FHRA 2VNOA 1XNBA 2YZ4A 2P34A 1DQ6A 2W39A 2ZMLA 3OYWA 4NVPA 5DUVA 3O14A 3QACA 1VBB1 1S0BA 4JV4A 4COUA 3L9JT 5FQ0B 1BEV3 2AXZA 3I8TA 4N7UA 1R083 4CTEA 4Z5DA 2WA3A 3OPZA 1NA1B 4YM1A 3EXUA 1MVQA 2VW0A 2VH9A 2C9AA 1OLQA 4Z59A 4GULA 1COV1 3V0BB 4D7TA 4Z5CA 5D8AC 1JFTA 3J26N 2BBVA 2YXSA 1R092 1R1ZA 1LHVA 1G6NA 2OW4A 1LRHA 1FOD3 5BUVA 5BNPB 1FNZA 2PUEA 2RS31 4XJ9A 3VZLA 1KFXL 5AFBA 5J36A 2H0BA 1WLTA 5JPMB 5IK7A 5E16A 2O8QA 4H7LA 5KWRA 3R6SA 1CJPA 4OHZA 3NAPC 2VNRA 4RR3B 2ZKLA 2PIJA 1M4WA 3VDDB 2YMZA 3UKNA 2D6LX 2IFRA 4YBAA 4OULA 2RS53 4LLOA 4MGYE 4B3NA 4IV1A 4Z82A 1RB8G 1CAXA 1ZAYA 4XHBA 3LCPA 4CEYB 1TE1B 1QNWA 1KDMA 1XNCA 2JD4A 1WLWA 2BGCA 4LHKA 3POWA 5JSRA 1ND2B 3ZMOA 1QH7A 1VBA1 2AUWA 2MEV2 1IQAA 3ILRA 2BQPA 4PLNA 1RUC3 3IMNA 3PTYA 2I45A 4GH4A 4K1ZA 4GHJA 2QDRA 3VBRA 3F52A 1HQNA 3DL3A 3MLJA 4Z92B 1SACA 2XLGA 4O8BA 1MQTA 3VBHA 2WZR3 2EAKA 3TN93 5DUWA 3U10A 2RJKA 4FQ4A 2K9ZA 4UW6A 3R05A 4O9GA 3WG4A 4X8PA 4AVSA 1GNZA 5J3UA 5K9YA 5CG8A 4IV1C 3RZZA 4ORFA 3WDXA 2LYLA 4EN6B 3ATGA 1C5IA 4PBOA 2QVSB 5T50A 2LYPA 1R1A3 1H1AA 3IWZA 2H0VA 3ZKCA 4U2AA 4MX3A 1NG0A 5JSOA 5AC93 2XWBB 4E4ZA 2E53A 2ZX0A 3WG1A 4GH4C 1PO21 1B0NA 3VBRC 3OBTA 1FPN2 4OB4A 2P3KA 1YFYA 3VBHC 1PRAA 4S2DA 1ZBE1 2PHTA 1X82A 3ZFEA 1V9U2 3VZOA 1JOJA 3WQ0A 1SFYA 4YM0A 2O1QA 1QJY2 3MZHA 4Y1UA 3W58A 4LTAA 3LOBA 4XFCA 3VBUB 3J8F2 2TNFA 3DUIA 1VLNA 3UK9A 3ZSLA 1ZBA3 1GV9A 3B00A 3OD0A 1MR5A 3ZXFA 4JCYA 1UPIA 3MIGA 2PLV1 2Q5TA 2R071 5GM0A 5EYYA 1QDCA 2RR11 2D44A 2HJIA 2JG9B 2VMHA 2OUJA 1W6MB 3GHNA 4PF5A 3TB0A 1UU4A 3B7HA 5BNOC 3CF6E 4HT1T 1OD5A 4Q4W2 1AR83 3LZZA 4P9WA 3QF3A 4YFZA 4YZ1A 4NO4A 1X33A 3VBOB 4AFDA 1FNYA 3N35A 2Z79A 4D94A 1AYN3 1VBB3 4Y20A 2WINB 4Q29A 2XJTA 1UIJA 1ENRA 1GKBA 1ONAA 3CROL 1VBD3 3OCPA 3I59A 4CZSA 4CP1A 1O5UA 1SBDA 4AGRA 5JCTA 5F6LB 4COWA 1WLCA 2G9FA 3AYCA 3O0XA 1FMD2 1WW7A 3H9AA 2EIGA 1YXWA 1COV3 4TZDA 4GMP1 4AQTA 3ZSKA 3H5TA 1DHKB 5I91A 4HKWA 2VGDA 3MFCA 2PAMA 3VBFA 4D69A 1QJU1 4EN9B 1YFXA 2AZ5A 2RE9A 2UYAA 2VU9A 1RVF2 2RS33 2Y26A 3OD4A 2JDZA 1UPSA 1QJX2 4CDWA 3FFQA 4YW1A 1REDA 3TAYA 1RHI2 2WS92 1ZS4A 2AR6A 1OQEA 1EFAA 2XL9A 2A6VA 4IXLA 1Q8QA 2YV8A 4IEOA 2B8MA 4XPVA 4J6GA 2D40A 4RGAA 4YG6A 1ENXA 5FREA 3MYXA 2H6BA 1U5XA 4YNIA 4R9BA 1AXYA 3AYDA 2CGPA 1SMVA 1QP7A 1WGPA 1YIPA 2YHJA 3PVNA 1DQ0A 1LEMA 4XQDA 3VBFC 4XBLA 2XHKA 1ULFA 2DUQA 2EA7A 3OYWB 3RYRA 4ASMB 3D82A 1G9BA 1CAWA 2AYHA 3KZ4C 4XW3A 3V64A 2WA4A 4CDWC 1VRH2 1W6PA 1VBA3 3MEPA 2ZMNA 4ONUA 3VLBB 4M01A 4FPYA 4XJUA 3ZN6B 4LO6B 1ULCA 3VK0A 2VOVA 2JG8A 1ZRCA 3WXPA 3NAPB 4W6WA 2HWF1 4BCUA 1Y7YA 4E2GA 3HQXA 1O5LA 2ZACA 3ES4A 3PMEA 2PFWA 4WVWA 1X36A 2ZGTA 3WD5A 1LU2A 3SLIA 3RSJA 1LHOA 1Q3EA 3M3OA 2UWBA 4GB31 4N7IA 2BWAA 3R4DB 1QU0A 2K2SA 1RUH2 3MGUA 2QZ3A 4IERA 1UXCA 5GKAC 4WZCA 4LUMA 5DDJ2 3WG3A 4FSJA 2ZHKA 2A6XA 4AFMA 4DOUA 1EV12 1PO23 1NE6A 3LGRA 2PAKA 2DTYA 2UY8A 5FCCA 3LSEA 2LUWA 5I8YA 3OY8A 3GBFA 2KEKA 1XE8A 3APBA 3FUQA 4JGYA 2GC1A 1WIZA 1NLRA 1OOPB 2ZPXA 3H1MA 4IV1B 5C8WA 2FJRA 3S0MA 4AQSA 2NQYA 2R061 2OZJA 2Z2SB 3AJZA 1BK1A 5J98B 1ZREA 2IUOA 3MW3A 3C3VA 4BMBA 3ZFFA 3UJQA 2WFPA 1LLIA 2Z69A 4YRDA 3ZSEA 4AFBA 3DV8A 2PN5A 4GH4B 2WFF1 2EF8A 3OTFA 1JUHA 2PLV3 2R073 3I4IA 3VBRB 1YJKA 2CL2A 5CFDA 1HRV2 4Q0UA 2RR13 4HKOA 4XXPA 5JAXA 3MF9A 2XWJB 4W6YA 3VBHB 1SLCA 2RMU2 5EZWA 4PBPA 3UJOA 2PHDA 4H14A 3BOWA 4MUVA 1ZZ7A 1O4YA 3MW2A 3QWGA 1D2QA 2DCZA 3H7YA 1RITA 1O4TA 3JD71 4LEJA 5HI0A 3VUOA 1LOCA 3PXPA 2XBO3 4XFGA 2PQQA 5EXOA 2B9UA 1W39A 2DCYA 4ISQA 4KH9A 1QXRA 2UY9A 2GH2A 2UWAA 4HMZA 3AZZA 3KSCA 1E3OC 1H0BA 1RUNA 5CIRA 5CFDC 1SLIA 4XOGA 4B7KA 2CAVA 4R9CA 5BNOB 4MLOA 3WQ1A 1PGW1 5L73A 2UYBA 4GMP3 4Q0PA 1EPWA 1PRUA 4YGDA 3AX4A 2F6BA 5KC6A 4DMIA 4Z1VA 5HCBA