2BNNA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords EPOXIDASE
total genus 52
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnnA02
1CAXA 3H7JA 1I6XA 1H1MA 1XE8A 1HF0A 1CAVA 3FYMA 3SCFA 1ZVFA 4B29A 4O9GA 2WUSR 3TRBA 2H6CA 1ZNPA 2D5FA 2IXJA 2MPFA 4ZU7A 1OMIA 2GC0A 4QXKA 1IC8A 3SXWA 1YFUA 5E16A 4XF4A 5KHJA 3CO2A 2UY9A 3E97A 1RUOA 1UXCA 4Z5CA 3BB6A 3IIAA 1YWKA 3KCCA 2HJIA 2PTMA 3JXDL 2GU9A 2CV6A 2H0VA 3D82A 1O5LA 3RPQA 1HW5A 4F7ZA 2LYQA 3ELNA 3DNVB 1GQGA 1IPJA 4XF9A 4Y42A 3GN5A 3H50A 3HIFA 5J3UA 3PNAA 1ZRRA 3SCHA 4WZCA 2A6CA 3CLCA 5J48A 2OZ6A 1O7FA 1LCDA 1X2LA 4QMAA 2K0GA 2PIJA 1NE4A 1ZVVA 3OQOA 1CAWB 3E6DA 4IESA 4HVQA 1O3SA 2IXHA 3U10A 1ZRDA 4Z5HA 4IEOA 4LUKA 4JCYA 2CSFA 1YFWA 2B5HA 1ZRCA 2PQQA 5FLHA 2KEJA 5J7MA 5LRRA 2BYVE 4X4GA 5I0UA 4DINB 1QQBA 4LA3A 3TNPB 4IEQA 2EAAA 1RZRD 2XJ3A 1YLLA 3DL3A 1IPKA 3OGJA 3QOPA 1O3RA 5JCTA 3OTFA 3OCPA 1ZZ8A 4YG4A 2QJVA 3TNQA 5LEKA 4LA2A 1TQ5A 5CADA 1ZX5A 3EQEA 3ZHMA 3OQNA 4HSLA 1JUHA 1JH9A 4MGKE 4RD7A 4BIFA 2XGXA 5JSRA 1RPEL 4MCXA 1VJ2A 2PYTA 1QP0A 4XFHA 4GHJA 1J58A 3MZHA 2B9UA 2D5VA 2PUAA 3S8QA 2ZCWA 4IEVA 2GRMA 1EYBA 1GQHA 4WVZA 4D7TA 1SEFA 2P17A 2IVBA 4QM8A 2BEOA 2CGPA 4FT8A 4XFAA 4PIYA 2EBYA 1PMIA 4Z58A 4YSFA 5C6CA 1LLIA 3PVBB 1J1LA 3MLFA 3LA2A 2GC1A 3LISA 3ES4A 2XI8A 1NYWA 3BALA 2BJCA 1XE7A 1CGPA 5D1IA 3PXPA 1O4XA 1BDHA 3WW2A 2BNMA 4Q0QA 4YG7B 4JV4A 4JTOA 5C8WA 2O38A 2O8QA 3WW4A 3NW4A 2B5AA 1UIJA 4MGYE 2PUDA 4R8HA 2QVSB 5BV6A 4I6UA 1LRHA 2ICPA 2KXLA 1VP6A 3O14A 4EWAA 5I8SA 1PRVA 2HSGA 1AU7A 3LA7A 2O49A 4EROA 2XCJA 1U12A 3KGLA 3S7EA 3C3VA 4HN0A 1O4TA 3U3WA 4PJYA 3KJXA 3OQMA 2LYKA 3F6WA 3L2HA 4X4CA 4PIXA 4FAGA 2BGCA 2PHDA 4QGNA 2GC3A 4QGLA 1I5ZA 3JZVA 4XETA 3LAGA 3OP9A 3D0JA 1WH6A 4XF3A 2ETEA 4X4HA 2EA7A 5CVRA 4L11A 1ADRA 4Q29A 2GRLA 4TLFA 1WLTA 3RYKA 2O4AA 4HBNA 5I0TA 1ZPQA 1YFYA 2D93A 3UKTA 2C0ZA 1CX4A 2GZUA 3E6BA 1QP7A 3FWEA 3D0SA 4PU4C 2GZWA 2WFPA 1YSEA 4YARA 5JAXA 3FFQA 2Q30A 2XLAA 5FQ0B 1L1MA 3B02A 4Q0SA 3ZDSA 4BYYA 1RTVA 4IEPA 4ZU5A 2XHKA 2BNNA 1EY2A 3BCWA 1UW8A 2EF8A 2PAKA 3USSA 3E6CC 2XLGA 3UKVA 1DWKA 3BDNA 3JXCL 3I54A 1X57A 1CQTA 3E5QA 4CYDA 3O9XA 4KU7A 3KMHA 1RZRA 4ONUA 4Z5DA 2OZJA 4FBFA 1WGPA 5BXXA 1SQ8A 1LQCA 3U11A 4X6QB 4F8DA 3VHRA 1QXRA 2I45A 1XWRA 4LULA 3NKTA 3PLQA 5I8YA 3BD1A 3QWGA 1X8MA 1VPWA 3FZ3A 1UCXA 2PAMA 1YFXA 3LOIA 4A2UA 3F51A 1NERA 5FCCA 3E5UA 3H7YA 4Q0UA 2AXVA 4I01A 4FBIA 1FI2A 4FAHA 5FDBA 2PUCA 4JVAA 4EV0A 3WW3A 1UPIA 2WIUB 2IXKA 5KHKA 3MPBA 3D1NI 3M3IA 3NVCA 5I0SA 4HSJA 2R1JL 1LR5A 3FHIB 2UY8A 5JR7B 4X4EA 2KZ8A 5LRSA 1OD5A 4MGZE 3UKNA 1X82A 2FQPA 5BUVA 1S7EA 4PU3C 1X7NA 2QDRA 3H1YA 5LEJA 3ZHIA 1ZS4A 3LA3A 4UXAA 4GULA 2XKPA 4E2QA 5I93A 1G6NA 3RYPA 4EWDA 4MUVA 2O1QA 1YUDA 2AW6A 4IEWA 3KSCA 2MQKA 2PPXA 1NXMA 3EJKA 1YHFA 1QWRA 3B7HA 1JWLA 4IERA 3CROL 1Y3TA 2XLFA 2XIUA 1JFSA 4PIZA 3BPZA 5KHHA 4XFCA 3BU7A 4IVZA 1ZZ6A 3ZKCA 3QQ6A 3GYDA 3QF3A 2GH2A 5AVPA 3S0MA 1LCCA 4F8AA 2Q0AA 4ORFA 2WC2A 3H1WA 4Z07A 2FJRA 4O9EA 1ZZ9A 4META 3N4MA 4XFGA 3NL1A 4AVCA 1ZZBA 4HZFA 2MNGA 5JSPA 4N9IA 1GT0C 1O5UA 4MGIE 1RIOA 2F4PA 2B8MA 1X8EA 1LB2A 4AQ6A 3IWZA 2AXUA 2R63A 4JQDA 2IC1A 4EWEA 2Q1ZB 2AWIA 4IWRA 4XEZA 3G5GA 4YRDA 3E5XA 3U0ZA 2CROA 4FN3A 1XRUA 2AXZA 2PA7A 2XL7A 4I6TA 3HZIB 2XL9A 3R6SA 3GN5B 2AUWA 1VR3A 3IBMA 2UYBA 1WA4A 2Z69A 3H8UA 4OB4A 4YBAA 1ZAYA 1DGRA 2VQAA 4QM9A 4I0AA 2KEIA 1CAUB 3KZ3A 4IA8A 4JTNA 3CJXA 4IETA 4YNIA 2CAVA 4Q0VA 4L2NA 1Y7YA 2OR1L 1NZCA 3KGZA 2VPVA 2Z2SB 4UBHA 3KXAA 2HINA 2L49A 3EHKA 3QACA 3CF6E 3LZZA 2OYZA 3VK0A 2QCSB 3EUSA 4OLLA 4XF1A 3SMHA 3H3UA 5FLJA 1O3QA 2KEKA 5K98B 1ZZCA 4NDWA 1DW9A 5FLIA 4HN1A 3L1PA 5FPXA 4Z59A 1SFNA 3DKWA 1QQAA 2N7GA 4I02A 4HVRA 3IDCB 4R52A 4XFFA 3H5TA 5I0RA 5KBFA 4ZU4A 1OI6A 4I6RA 4WBBA 2D40A 2PFWA 1UIKA 2ET7A 2ZKLA 1RZSA 3BS3A 5FPZA 2BNOA 4YYOA 2OA2A 4I8TA 2IXCA 2KPJA 4XFBA 3FX3A 4X6RB 2K9ZA 4JCXA 1R63A 3FMYA 1LKNA 1Q5OA 3H1MA 3RYRA 1ZZ7A 4AVBA 1L3JA 3DV8A 2IU7A 1Q3EA 4HMZA 4K8FA 1CAWA 1CAXB 1EPZA 1RL3A 1CJGA 2PUBA 5I8TA 2H6BA 3ETQA 2VECA 2LYSA 1UXDA 2XKOA 3ES1A 2IXIA 5KHGA 5T3NA 4I2OA 4HLTA 3ROUA 4X4IA 4BH9A 2PE5A 3H9AA 5JSOA 3F52A 1QY4A 2Y0OA 3JXBC 1V70A 3HQXA 4IEUA 4I09A 3QYXA 2PUEA 2L8NA 3SHRA 4LEJA 1ZRFA 2CAUA 4OFGA 1J3PA 1J3RA 3HT2A 3EO6A 4Q0PA 4PU8A 2IV1A 5KHIA 4YG1A 4QX5A 4KU8A 1PRUA 2V09A 5I91A 2DCTA 1PERL 2JVLA 1R69A 1E3OC 1NEQA 2PUFA 1QP4A 2GC2A 1DZTA 3NSTA 3CL1A 3HT1A 2LYPA 3RDIA 2E9QA 1OCTC 2HKXA 1Y9QA 2OFYA 4LTAA 3I59B 1H1IA 5K8SA 1B0NA 3IVPA 4N9HA 3ST7A 4HVOA 2ATFA 1CAVB 4KWKA 2EWTA 4BHPA 1SQ4A 3S7IA 4XFIA 3FYAA 3FE5A 2MEZA 4J1WA 1QXJA 5F1RA 2OPKA 3R1FA 5A7LA 4MCTA 4E2GA 2QNKA 2Q4SA 2JCGA 1ZUGA 2UYAA 1NE6A 4MV2A 2MHFA 4I0BA 5BPXA 1PM7A 1J59A 5EFUA 5BY5A 3LFPA 2LYLA 5E1RA 3CEWA 4J1XA 2D5HA 3IDBB 2LYRA 3M70A 4NVPA 4IEZA 4AXOA 1RC6A 1DZRA 4UBGA 4XF0A 4D7SA 4X4DA 2IXLA 3WW1A 4Z82A 1PNRA 2PAEA 3MDPA 3H3ZA 1JFTA 1BDIA 1UD1A 3FJSA 3I59A 1DGWA 2EVXA 4IEYA 3ACLA 2ICTA 1QPZA 2IVGA 4LUMA 1WETA 4X4BA 1J3QA 3OF1A 2XSDC 4LLOA 2LCVA 2H8RA 1FXZA 3EBRA 1UTXA 2PUGA 3CECA 1FT9A 4QGMA 5CU1A 5HI0A 2IUOA 1PRAA 3I7DA 3UFDA 1WIZA 2FMYA 4X4FA 4GQMA 4MZUA 4KL1A 3OD0A 4P9GA 1WH8A 3DN7A 3SCGA 1O3TA 2PHLA 3MYXA 4KWLA 1OSLA 1Q43A 3CLPA 3NJZA 4MH0E 2GAUA 1LMB3 3G7DA 4IEXA 1ZREA 4O8BA 3LWCA 1EFAA 4MX3A 2IVQA 4KWJA 4E2SA 4AQ2A 3OMTA 1EP0A 1RUNA 1CAUA 1POUA 3RNSA 5FQ0A 1RGSA 4I3PA 5EZWA 2LYJA 3GBFA 2ET1A 4AVAA 4H7LA 4PU7A 1OFNA 3RZZA
chains in the Genus database with same CATH superfamily
3NV1A 1CAXA 1KS4A 5A32B 1I6XA 1H1MA 4DPNA 5A3TA 4HK9A 3O1SA 1GANA 4C1WA 3SCFA 3A22A 5GALA 3WNMA 4GIQA 2W94A 4B29A 1RUJ2 1GNHA 1UU4A 1VAKA 3IAQA 4AFCA 2IXJA 3TN93 2D5FA 2YPJA 2IFRA 2W95A 4YVSA 1QF3A 4Q4X2 4FSJA 4RA0A 3TN92 1CIYA 2MPFA 1AL23 1OMIA 4QXKA 2C5DA 2LUWA 2R0FA 5E16A 1SFPA 4URAA 1JOJA 5KHJA 3E97A 1VAVA 1A3KA 2P6HA 1GNYA 3FHQA 1HQLA 4QX0A 3F2ZA 4TSVA 1QKQA 1XNAA 4CCJA 1RUJ1 2VXJA 3BTAA 4FP3A 4XTPA 5ANNA 5FPAA 2BPA2 4F7ZA 3FLRA 1ZA7A 2GMPA 4HKWA 4M0HA 5ERLA 3KV6A 2G9ZA 3WG1A 1F8VA 4LBQD 5F9TA 3IN9A 1ENXA 3VWSA 3NV2A 3WDWA 1HRV2 5J3UA 3Q9OA 1E5IA 5J48A 3WV6A 4JHZA 4UT5A 3NV4A 4P14A 4W4ZA 4CDWC 1R081 4COWA 2UWAA 5FYSA 1ODNA 3TFLA 1LCDA 2RS33 2VZQA 3VKLA 1H2NA 3Q8BA 1R092 3DEMA 2VTFA 1TZOA 2JG9C 1Y43B 1D4M3 1W90A 3ORJA 1NE4A 3CIHA 1CAWB 3PMSA 1O3SA 1DQ4A 1ULCA 1LULA 4J25A 4K21A 3JUUA 4XBQA 2HYXA 1YFWA 2B5HA 4BM8A 2VCCA 5FLHA 2KEJA 2W1WA 4M3CB 1VE0A 1OA3A 2YFZA 3ACFA 2ZGKA 5FP3A 2D7FA 4CDQB 5GM0A 4AE2A 3O7OA 4AWDA 3T30A 4JDNA 1RZRD 1P8JA 4LK7A 4QPWA 2UWBA 1H30A 1FPN2 1XYOA 4RGKA 1UZ0A 3SITA 4EQVA 5A1FA 3POJA 1LCLA 3NJVA 1US2A 3OCPA 3OTFA 3VBOB 5C71A 5IFTA 3HNYM 3MLJA 3PIGA 4Q26A 3UGHA 1QOTA 4GAZA 2C24A 1C4RA 3POIA 4NWWA 1JH5A 1XSRA 2XBO2 5F7UA 1PVC1 3OQNA 2E7TA 4HSLA 3J8F3 4MVTA 3QOXA 1C8M1 4BIFA 3VKMA 5JSRA 5EP9A 5K0UA 1VJ2A 2PYTA 4RS5C 1C28A 5FXXA 3LOBA 3N35A 2QQUA 3DYPA 3H0OA 1HRV3 4XACA 4E8CA 2X29A 4AOCA 3NNGA 1QU0A 3S8QA 2BV4A 1GQHA 4WVZA 1W8FA 3AK0A 3VZOA 4D7TA 3AKQA 2JKXA 4RHV2 2X05A 2YBPA 4C91A 5EQUA 4FFIA 4XFAA 5J1XA 2EBYA 2VOKA 2XJVA 4HXCA 1NW3A 5FUNA 2FBEA 4CCDA 1LLIA 2RG4A 3P6BA 1R082 3PVBB 3RZHA 3MLFA 2LM3A 2XXPA 3LA2A 3VKNA 2XI8A 4QB1A 4JGYA 4QHBA 1V9U1 5DABA 4QHOA 5HCHA 3PXPA 1OKOA 1BDHA 1BKZA 3NAPC 4H55A 5C8WA 3Q8AA 2ZPXA 4A4AA 3P5BA 3W9AA 1HRI1 3A7QA 3INAA 4FVVA 5HXVA 3HEIA 4AL9A 3J4UH 5DN2A 4R8HA 2VL4A 1MEC1 3M9LA 4Q5OA 5ISLA 2ZABA 1AHSA 4YG6A 4XVHA 3KCYA 4NAMA 1PX3A 5I8SA 1QDCA 2DCJA 2VULA 4IL7A 3OUIA 4NRMA 1DGRN 1FOD1 4FOVA 3TYJA 1PZ9A 3KGLA 1BQPA 2LW8A 2CL2A 1OVPA 3AZVA 3C3VA 3GZTB 1O4TA 4UF0B 5FZOA 5JR2A 3SQOA 3D5OA 4BA6A 3KJXA 3OQMA 2LYKA 4YGDA 5T50A 1XOYA 3UV9A 5JDBA 2MEV1 2PHDA 2GC3A 4ZXKA 1I5ZA 2PXKA 2WNVC 3LDKA 4W50A 1LHOA 2HWF3 5F5AA 3X29B 2RJ2A 4XETA 4Q4V1 2HWB3 2PLV2 3NXHA 1VRBA 2WT0A 5CVRA 4R9AA 4XW3A 4L11A 2WNUB 4CDUB 2GRLA 4JRAA 4WM8A 5CAZA 1UY1A 2J1RA 4UFLA 5FK7A 1LAJA 4HBNA 4AEKA 2YMZA 1YFYA 2WLPA 4UYBA 1W9FA 1UYXA 4UW5A 2WFPA 1BXHA 1SMVA 3FUOA 2HWD1 2NYYA 3V64A 4M0NA 5FQ0B 1L1MA 3R4SA 4LPLA 4UW6A 2NMNA 2PHUA 3ZFEB 2B39A 4LE4A 1YQ2A 5JLVA 1NY71 4IEPA 2CDPA 2XHKA 3V0BB 5IAVA 2QKDA 1UW8A 1FV3A 4AHXA 2XLGA 1TE1B 3BDNA 1H2MA 1WBFA 3W21A 1GQPA 3I54A 1X57A 2A1XA 1CQTA 2V5YA 3E5QA 4QX7A 4XYXA 4KU7A 3KMHA 1RZRA 1EV13 4GWIA 3L9JT 4XTMA 5FP9A 1PIV2 5JSOA 4Y26A 1O59A 4CE8A 3VBOC 4E8DA 1LQCA 2D3PA 1VBE2 2JDAA 2HWF2 3IDAA 5DPNA 5SV8A 4MGSA 4BQYA 5C3PA 1VPWA 2R7EB 3L2YA 1UX6A 4A2UA 2E31A 1SG3A 3GZUC 3LPFA 4XDOA 5FWJA 5FCCA 3E5UA 1F9KA 4NRQA 4YW5A 3H7YA 1RVF1 4Q0UA 4EYUA 3RJ2X 2A73B 2VZTA 2FMDA 4KGGA 2JICA 4JVAA 1IKQA 4EV0A 3OBRA 3J7HA 1KQRA 3WLUA 1PX4A 2HWE2 4PF1A 3LEKA 1DQ1A 1ZBE1 5FUIA 5KHKA 3H8RA 5A1AA 5GZCA 3H8OA 4YLZA 3J8F2 3D1NI 1VBB3 4XCBA 2GNBA 1TME2 4RQPA 4HSJA 3NZLA 4LO4B 5DTMA 4JGZC 1XNCA 3KWVA 5L9VA 5DG1A 1G8WA 3AKTA 3LEIA 4D6SA 4Y24A 2IFWA 4MGZE 1R1A2 1X82A 2G19A 3I8TA 2FQPA 3NNMA 5BUVA 4H2AA 2YZ4A 1X7NA 2M4HA 1W05A 4QWNA 1WCUA 3ZHIA 4HETA 5TSWA 5LEJA 3SR4A 3H8XA 4LIUA 2TNFA 2XKPA 3O0XA 4KG8A 2WJSA 4JC1A 4E2QA 1G6NA 4QQLA 3RYPA 3W59A 4EWDA 3Q8CA 1LECA 1IGOA 2JECA 2YGLA 1SLCA 3OEAA 4GWNA 3KSCA 4IEWA 2MQKA 1ONAA 1REFA 2K46A 4S2FA 3WNNA 4AVVA 2P4EA 4UI9L 2HCNA 2PPXA 1NXMA 3WP4A 1AYN2 3AC0A 4Z8BA 2RS11 3DYOA 4HT1T 4XABA 3WNKA 3BTYA 4KMQA 4GALA 1X9TA 3WSOA 4DUVA 2LRPA 3B01A 1W6PB 1BJQA 2Y0IA 1SCSA 2DVFA 1RIRA 1FV2A 5JZGC 1XXNA 2YG0A 2YV8A 1RUD2 2XJSA 5IK8A 3QF3A 3KV5A 4Z92B 2SLIA 1PO23 2FHRA 4XQ4A 4F8AA 5A80A 4UWDA 4CVUA 3WF4A 2I2SA 4BMEA 5C70A 3W58A 1JODA 1ZZ9A 5CKMA 5GLWA 1PK6C 1WMEA 3NDBB 4CU8A 4WVWA 2HEYF 4FPGA 3J9SA 2MNGA 3MV11 4S2GA 4LBKA 2F4PA 4CDQA 1HV1A 4QD2A 1FATA 1X8EA 2R63A 1QJX2 2IC1A 2JDNA 1NLRA 4XURA 2QQWA 1KFXL 4AK3A 4BPZA 4XEZA 2VAUA 1PO22 2ARXA 4YVSC 5A6QA 4XHXA 5FJHA 5FZAA 1XRUA 1W03A 2LTNA 2R32A 3N9QA 2AXZA 4W6WA 4XC9A 5F37A 2R49A 3ASIA 5IK7A 2XL9A 1JZ6A 1NXD1 1L7LA 1QDOA 1V00A 3VHOA 1ACCA 4DRRA 3K4DA 1NAEA 1S2EA 1GP5A 2Z69A 3O12A 1KDKA 3JB8A 4Q4X1 5AC93 2E7AA 1MACA 1DGRA 2P3IA 2V73A 1V6IA 4A7ZA 3UYJA 2X53S 4IA8A 4NJ4A 3LSDA 1HB1A 4IETA 4L2NA 3RSJA 3KGZA 2VPVA 2OUJA 3JB4C 3J7MA 5FY9A 3EHKA 3RMYA 3QACA 4CDWB 3OYWB 4F3JA 2OYZA 3VK0A 1QNWA 1R1ZA 1UU5A 1RVF2 3D4KA 3NO8A 4XF1A 2D6KA 5FLJA 1IOAA 1O3QA 2PQSA 1PK6A 3DPRC 3ZSEA 2PXTA 4DB5A 1TMF1 1PVC3 4NDWA 1GLHA 4N53B 5K7PA 3IKWA 4YM2A 4GH4C 3QLQA 4Y4RA 4EN6B 4K7JA 2ZGUA 3GXUA 2RM21 3IDCB 4BMBA 2XMLA 1VRH1 3VBOA 2VZ3A 4YZ2A 1PGSA 1OI6A 5L36A 2D40A 1VBB1 1UIKA 4K1ZA 2ET7A 5FPZA 4JRLA 4YYOA 2BNOA 1UZWA 5FZ6A 1OHFA 2C6SA 1K12A 3MW3A 4A6SA 4AG4A 4CEYB 2R0HA 2PLV1 4H3WA 5JZGB 3VZLA 3FMYA 1V6KA 2ZGQA 1LKNA 1PIV3 5FV3A 3SKJE 2Q1FA 3RYRA 5E88A 1ZZ7A 2ZEYA 3D6EA 3DV8A 1O6UA 4NPLA 1Q3EA 4YW6A 1XU1A 5ACA2 3HVDA 1NX9A 3CJIC 1AXYA 2P34A 3AYDA 2BU9A 3G6JB 4GJZA 2LYSA 3B93A 4P9WA 1H8TC 2KR2A 5K0UC 1CZVA 3K75B 2ILMA 3ROUA 1QJZA 1H1AA 1UMIA 1U2ZA 3F52A 1QY4A 1WZXA 3ECQA 4IEUA 4NHMA 3WUCA 4DY3A 1MEC2 4NMIA 2DYCA 3FMGA 5SV5A 2PUEA 5F3EA 3WEZA 4OFGA 4E9KA 3GDBA 4AHZA 5LK7B 1SLIA 2W9XA 1UY4A 1J3RA 1UZZA 2YY1A 4CEWA 1QQP3 4P02B 4RGGA 5BNPA 4MOAA 4PU8A 5CFDB 2IV1A 3CJIA 5KHIA 1EUUA 4PBPA 5BNNC 2A6ZA 4KU8A 4Q4V3 5FZOB 2DCTA 2PELA 5LWBA 1W8UA 4WM7B 1WWYA 5FPVA 1CPMA 4XMAA 5LBFA 4QT6A 5FR3A 2VJXA 5FZBA 4FPKA 3RDIA 1OCTC 3DXUA 2OFYA 1C8M3 2GH8A 5FXVA 3LQCA 5JXHA 5LK5A 3THPA 2WUHA 4ZONA 3GALA 4MLOA 1W8OA 3ST7A 4HVOA 2VC9A 3KF5A 4XUOA 3PTYA 5C8CA 3VBFC 4ARYA 4OUSA 4K8RB 3B9CA 4AEJA 4CPBD 1K5MA 3DXTA 3FYAA 2KD7A 4PDWB 3ACGA 5FZKA 4RL7A 4MADA 1OOPC 4QPGA 2VUJA 3KT4A 2OKXA 5L9BA 2PXFA 4FPLA 1GWMA 2A6WA 5IK4A 1UOJA 4MV2A 1WD4A 1Y9GA 4KBBA 5DZEA 1QGLA 5BPXA 4IE4A 5KXDA 2WNEA 5BNOC 2JWPA 3ABZA 5A3WA 3LFPA 4Y20B 5E1RA 4J1XA 2D5HA 4AI3A 3TEWA 1C1FA 4AHYA 5DDJ2 1X36A 2CSGA 5BNNA 3OBTA 1W06A 4X4DA 2IXLA 1PZ8A 1EV11 2Y26A 3FFZA 2OS2A 2Z79A 1WD3A 3I59A 1WKYA 1RUI3 3ZOIA 5EJ1B 1Z78A 4GMP0 1GUIA 4FTBA 3VBUA 1UZYA 2VCAA 3VD4A 3AMMA 2W68A 4LHLA 5FYIA 2PMWB 5GZEA 2AACA 3ON7A 4Q4Y2 4C0BA 1DQ5A 1N1TA 5CZKA 5A6XA 2QBXA 1UTXA 3BIWE 1Y7BA 2PUGA 2PXJA 4BXSV 2DDUA 3LFMA 3RI9A 2ZGTA 1PRAA 1XE0A 3KV4A 3MIFA 2QQOA 2VEOA 3RJRA 5C9AC 4GQMA 5FO7B 5A33B 3VDAA 1HKDA 1VRH3 5FUPA 3HBZA 1LEDA 1LESA 1OFSA 1Q8QA 1OLME 3WR0A 2HWB1 1CZTA 2IZWA 1VRH2 1XPWA 2DU1A 1AJOA 5CFDC 2PHLA 3VDDC 5GAGi 4YW4A 4RR3C 3I3BA 4IEXA 1LMB3 3BYWA 1URXA 4O8BA 3AKSA 3LWCA 1EFAA 4YW2A 2JDHA 3AFKA 2IVQA 4ARXA 2BVBA 4IE7A 4CP9B 2ZEWA 3JXSA 4E4DX 1AYM1 2R043 4AF9A 1EP0A 1MQTA 4AI8A 2C9KA 1YXWA 1VMHA 1RUH1 3RNSA 4I3PA 4OI2A 2RVAA 2ET1A 3GBFA 3AX4A 5EYXA 4L0PA 1N3QA 4LBMA 4H7LA 3AMHA 4IEQA 4MHRA 5A7QA 1B35C 2BW8A 4GH4A 4P9LA 5B2GB 1HF0A 1YIPA 3BOPA 5BNQA 1CAVA 1WCQA 5FRAA 1JYWA 1VLNA 5JUWA 4G9SB 1UNBA 1MS0A 4V2WA 4O9GA 2BJSA 4Q4Y3 4YZ5A 4MO3M 2LS6A 3WNLA 3IT8A 3U37A 1JYXA 3OUHA 1DU3D 5ABJC 2XPJA 3GUUA 3SEEA 1F5JA 3IZOA 4Q2JA 4CRQA 1JHJA 1A6CA 2DTYA 4ZU7A 2BBAA 4IGQA 3I2FA 3SXWA 1YFUA 2E33A 1VBE3 3CO2A 4LK6A 1RUOA 4BQ5A 1FPN3 4N43C 4CU6A 4Z5CA 3BB6A 3IIAA 1YWKA 2AC1A 3KCCA 2JG9A 2HJIA 1WW5A 2PTMA 3ZXKA 4CCOA 2GU9A 3ZXGA 2DFCA 2VG9A 2DU0A 2D3SA 5K4LA 2NN8A 3ELNA 4AFDA 1NCQC 4Y22B 1JN2P 3HNBM 2P5BA 1IPJA 1PVC2 2BWAA 3KQ4B 1OH3A 4Y42A 4Q1RA 3H50A 1O8PA 5JIUA 3TEZA 2QQMA 3PNAA 3ZXJA 4JGYC 3POWA 4NPRA 1ZRRA 4WZCA 1WMXA 5JZGA 3CLCA 1GSLA 3C2UA 1TNRA 2DUOA 1RUC1 2E6VA 5FMOL 3M3EA 3TEXA 5KXCA 1X2LA 1PZ7A 2WNOA 1HQ1A 2P6CA 1F5FA 4YG0A 2OPWA 3ZXAC 1JOBA 2IXHA 3U10A 2FDFA 3WHTA 1ZBA2 1B35A 1ZRDA 4CEYA 1OQDA 1H8VA 2AUYA 3PL0A 3DPRB 3WOGA 4X8NA 2PQQA 5KXBA 1XNKA 4EZHA 5J7MA 1DFQA 1Q8PA 2Y64A 5I0UA 3RS6A 4BISA 1QQBA 1HN1A 4DINB 1PGW2 2YHJA 3OB8A 4XQWA 2XJUA 5CFCA 4QQOA 1WW7A 2XJ3A 4NIDA 4QU2A 3OYWA 4Q4Y1 2NPIA 4AQSA 5LEKA 3KD4A 3N3HA 4LA2A 1TQ5A 2YC0A 5CA6A 1NA1B 2DTWA 4RQPC 3JD72 4M3CE 4QPIB 4DXRA 3EQEA 1W6MA 2XJPA 3CZJA 3USUB 1YJKA 1XYPA 1JUHA 2OXBA 4B4QA 1RPEL 4MCXA 1W3VA 1ZM1A 4QKNA 4Y4YA 2ZGLA 3D8CA 2RR13 4XFHA 4GHJA 1D2SA 3KT1A 2BWCA 2GMMA 3NQHA 5DAWA 5FTTC 1LODA 4BQ3A 5IJRA 1NKGA 2B9UA 2PUAA 3AP4A 3PVEA 4IEVA 1DLCA 1JU3A 1EYBA 1JHNA 2P17A 4FXGB 1CX1A 2IVBA 4QM8A 5CFDA 2VQUA 3MICA 4YG3A 4YW3A 2VBBA 2IVJA 4Z58A 1EUTA 1FAYA 1NQDA 5C6CA 5D8AA 3VZKA 1JZ8A 4FFGA 1MS3A 5FYTA 1QHDA 1RUH3 1VBC2 2GC1A 1NYWA 3BALA 1H8TA 1BLZA 3AKPA 1CGPA 5D1IA 1C3HA 1O4XA 3WW2A 4YG7B 2A6YA 3IM0A 3O0VA 4RHV1 1RUC3 2XHNA 3WW4A 3NW4A 1UIJA 2JDKA 4IE5A 2ZMKA 1LTEA 2DCZA 2Y38A 1DP0A 2QVSB 3LEMA 4I6UA 2G9GA 3POSA 5BV6A 1LRHA 4IV3C 2PXDA 4CPBA 1PRVA 1SFYA 2XWBB 1AX1A 5IVCA 1AU7A 3LA7A 4X8PA 4EROA 5A32A 2XCJA 1DIWA 1U12A 3MW4A 2JB4A 2ERFA 4A44A 2OIIA 1LOCA 3F6WA 1FPN1 4X4CA 1GYKA 4QXBA 2HWC2 2WN3A 1CJPA 1IZ3A 2XUMA 3DKQA 5FY4A 4B8EA 1QQP1 1YRZA 4YW1A 4BK4A 4FAGA 2Y6FA 1N1VA 4QGNA 3VL9A 4IXLA 4QGLA 4Y20A 3JZVA 5IVJA 4ZY9A 1YJLA 5CKQA 5LASA 1VBE1 4NIIA 3OP9A 4XF3A 2ETEA 3QD6A 1JYNA 1AJKA 3UGFA 3DUIA 3VBRC 3MLKA 4NRPA 4PI2A 4Q29A 4LKEA 2F17A 4TLFA 4RYDA 1SLAA 3GF6A 3T2QA 1Q8SA 2O14A 1U5YA 1ZPQA 2D93A 3UGGA 3A9ZA 1R083 2HCSA 2AR6A 1CX4A 3JD71 1ASJ1 4GZ9A 3UKTA 1OLQA 4LKFA 5FO8B 4PU4C 1ULDA 4LBNA 1MS1A 4YARA 1NLQA 5JAXA 2WZR3 1UYPA 4RFRB 3PU3A 1D4M1 3KZ4C 4DFSA 4JQTA 4AAPA 4P00B 5K0UB 2UWCA 4QB6A 4G4FA 1GZCA 5DDJ3 4ZU5A 1RUE2 2BNNA 4IGPA 4W6XA 2ZX0A 2W2IA 2PAKA 3BCWA 4LHSA 3S5QA 5D2AA 5T52A 1DWKA 1LHNA 2VUCA 3UKVA 3WG3A 3JXCL 4DMIA 1E57A 4EJRA 1ULPA 1BEV2 3O9XA 2Z4FA 3NKGA 2EIDA 3E1F1 5EPAA 2NM1A 4BZ4A 3OSDA 3TAYA 1UMHA 3MGUA 5BXXA 4AEDB 4ES9A 2Q8DA 1S0EA 3VLBB 3ILFA 4PLMA 3WP5A 4Q4W2 2VVFA 1IS5A 4X6QB 4F8DA 1STMA 5LBCA 2PXPA 1QXRA 2A71A 3VHRA 3VD7A 2R072 4CCKA 1XWRA 2ODRD 2RS13 5T55A 4H14A 2XB6C 4D8MA 3KF3A 5A3NA 3HAGA 1UCXA 4PQQA 2PAMA 3VN4A 3LOIA 3TN91 2R063 5BNOB 2PHXA 1OOPA 4LORA 4QPGC 1RXFA 1NERA 2JDMA 2RS52 3WX5A 3P3PA 1TMF2 1W6OA 4INDA 1MS8A 2GNDA 4I01A 3OUJA 4D69A 1XC6A 3EB7A 4GD4A 4QKDA 4OHVA 2D3RA 3HPNA 3VBUB 2PUCA 4CTEA 4FAHA 1VBD1 2LROA 1AR71 2AEYA 3WW3A 4OHZA 1JZ3A 2MXDA 5JOXA 2IXKA 2RDQA 5FYYA 3AYEA 2WDBA 3MPBA 2XDVA 3WCRA 4NR1A 1V0AA 3LKJA 3M3IA 3WF0A 2A3YA 1D2QA 4QU1A 2RS51 4CDUC 4M4PA 3VBRB 4WVMA 5LW9A 2WQ8A 2XXZA 3WDTA 4Y1UA 5FAXA 1JZ7A 5LRSA 2HBUA 4IGOA 2O8OA 4KG0A 3UKNA 4FTSA 5LBBA 5L7OA 5G04L 1U5ZA 2QDRA 3H1YA 4N7UA 5FXWA 5CG8A 4LBJA 5I93A 4MUVA 2O1QA 1YUDA 4MSVA 3N9LA 4BWOA 5F6KA 4FPCA 4KI5M 3SLIA 3A23A 1IQDC 2W47A 1L7RA 1YHFA 2VUDA 3KVAA 3AZWA 5C4WC 1DDLA 1MEC3 2CGOA 3I2IA 1ZBA1 3NV3A 1Y3TA 4R4ZA 2ZXQA 5IAXA 1TMF3 3T0AA 3CBNA 4LXLA 2ORZA 2BRTA 3ZSMA 1ULOA 4JAAA 1ZZ6A 3ZKCA 1E5RA 3ZFEA 3QQ6A 2YB7A 3R4DB 1QJU2 3GYDA 4C8DA 5FXZA 2WS91 3A9YA 4DY5A 5AVPA 4EN9B 2JIGA 1LCCA 3S0MA 4XE9A 4XILA 4CXYA 1AR73 1VBA2 1B35B 5FIXA 4O9EA 1AUYA 3N4MA 4RN5A 3JBG2 3KLSA 1EV12 4HZFA 4IW3A 2JG8A 5LA2A 1O5UA 4MGIE 1JU4A 3ZLIA 1GNZA 5FYUA 2F6BA 2V5DA 3W20A 5CEHA 3FC0A 3UNPA 1LB2A 4MXWA 2NP0A 4JQDA 1TNFA 4ISQA 2Q1ZB 2WL1A 4D7YA 3UWPA 5C4WB 3VBSB 3G5GA 4YRDA 1TG7A 3R0RA 4FN3A 3SX0A 2YBSA 3B00A 4JCKA 2Y6HA 1TVGA 3ZN6A 5IVVA 3THDA 3WQBA 3A9XA 2EALA 2F4LA 2PXLA 4CCMA 1RXGA 3IBMA 4FCAA 4UF0A 5FWEA 3ZYBA 3HQRA 3H8UA 3MIDA 4A7KA 3RG0A 2A3XA 1MZFA 2KA3A 2VQAA 4YFZA 3ZXEA 3M3CA 1XSQA 2TUNA 5DDJ1 3BIEA 1YEWA 3NMBA 5A1LA 4Q0VA 3V0BA 1Y7YA 2OR1L 1G9DA 5FZ8A 2Z2SB 4FOWA 4CA9A 1DYOA 5IVBA 1NCQA 1IKPA 1ENQA 4BQ1A 4CEWC 2I07B 3CKHA 5HCAA 3BVCA 1ZRIA 3VDCA 4XUQA 2KEKA 5K98B 3M4FA 1AR83 4GJYA 2XVGA 4P5HA 3ZR5A 3WDUA 1SBEA 1D4M2 5F5IA 2VY0A 3KVBA 4E4HA 2N7GA 3VBHA 4A41A 3RGBA 4IE0A 5KBFA 3POEA 4XDQA 2OX0A 3OBAA 4FOQA 4ZU4A 1GZWA 5FO9B 1Z7S1 4UFHA 3RFRA 1W6OB 1J1TA 3U75A 2XQXA 4ER5A 3ME2A 2ZKLA 3BS3A 1OUXA 4OZOA 4MG2A 4I8TA 4P9JA 2W1QA 1COV2 4AI0A 5F3CA 4D6QA 4Z2AA 4XFBA 5FZEA 2BVVA 5D8AC 4X6RB 4JCXA 2QFEA 4CZSA 4OI0A 4YVWC 5DT2A 1UX7A 2NQYA 1Q5OA 1S0IA 3T3YA 5C7GA 3GGLA 4AVBA 3THTA 2DVGA 3WCSA 1JW6A 3SH3A 2D6OX 3RZLA 2Y6LA 1WCDJ 4K8FA 2XJTA 1ASJ2 5DAXA 2DVDA 1EPZA 1RL3A 5APAA 4XBLA 5FFOC 1UXDA 2VOVA 2IXIA 4TTGA 2JX9A 3APBA 3VKOA 4HLTA 1RUG1 3MIGA 3W5NA 1HQNA 4X4IA 3O0WA 2W1UA 1W6NA 4BH9A 2VBDA 1RMU1 2PXVA 2Y0OA 2LALA 2XONA 5HXMA 3QYXA 3SHRA 4LEJA 2CAUA 1J3PA 2W52A 1WCSA 5F3IA 1ST8A 4EK9A 2D6PA 3WF2A 1LGNA 2HWC1 2VZPA 3ZKUA 3FBYA 1UWWA 4TYSA 1CPNA 1TME3 4FQZA 1W2TA 5JOZA 2VOXA 1GICA 1QOSA 1PRUA 1F15A 5FZ4A 4I3GA 5C3QA 5I91A 2WRAA 3RQ0A 2PUFA 3WP3A 2A7AA 3ZX7A 3CL1A 2ORXA 3H3LA 2RMU1 1Q8VA 3HT1A 3LB9A 3POFA 1H6XA 1PNGA 1R64A 2E9QA 2HKXA 3T2PA 4ER3A 1LHWA 4P9YA 2Q8EA 1YC61 2JJ6A 2GMEA 5AFBA 1S4CA 1NT0A 5K8SA 2BP6A 2P3YA 3IVPA 5FZ9A 2FCUA 4N9HA 3ZFFC 5J98B 1AR93 3VKFC 1HRI2 1OT5A 4LMFA 4BHPA 2CGNA 4EKGA 4XFIA 4XZPA 3T4VA 3T0DA 2PXBA 1XBFA 2JD4A 4J1WA 1V9U2 3WNOA 5F1RA 1W2AX 1DHKB 4OULA 3VD9A 2VZRA 4MCTA 5FY7A 2WZPP 2QNKA 5B4NA 1QIQA 3NAPB 3ZR6A 2QQPA 2JCGA 1LGCA 2Y6JA 2VTXA 3HN1A 3HWJA 1AYM3 2R041 4I0BA 4I30A 4SBVA 1PM7A 1H2LA 5JXIA 2ZBJA 2H0BA 3M70A 3OY8B 4QDSA 5DUVA 1NA1C 1RC6A 4RQPB 3ZYFA 1MQTC 3OD4A 2XQRA 1XNDA 4YZ3A 2BGOA 2VMDA 1DYKA 3GHMA 4XF0A 1T6GC 3PIJA 3WW1A 5C3RA 3K4AA 4Z82A 3ZMNA 2QQJA 2YPDA 1WCKA 3MDPA 4QKFA 4BQWA 5ABJA 1UD1A 4XJUA 4RR3A 1DGWA 3T08A 4LHNA 2J7UA 3MEJA 2PXEA 2EVXA 1QJY1 1UKRA 1QPZA 3ACLA 5F2SA 5JOWA 2ZMLA 2X5IA 5KXEA 4QDQA 1J3QA 4X4BA 2QZ2A 5F2WA 1C1LA 1SBFA 1UU6A 1BBT3 1POV0 1Z7S3 1HX6A 3F95A 4FPEA 4JKMA 5KWRA 3VZMA 3CECA 1FT9A 2A6XA 3AJZA 1N1YA 4P9IA 1QH7A 4COZA 4LO6B 1OOPB 1AXKA 3I7DA 5CYYA 3KB5A 3LF7A 4MGTA 4GB33 4KL1A 2VD7A 3DN7A 2WSUA 3WDYA 3LEGA 1G9FA 4XHBA 3ZPOA 4CEWB 4FPYA 2VOTA 2JDZA 3MFCA 4RFT0 2BOIA 4KWLA 1OSLA 1QQP2 1Q43A 3WDVA 1HJFA 1SLBA 4FPHA 1VAMA 3NJZA 4M3CA 2LLVA 1CR7A 2ZX2A 3G7DA 4DS0A 2PLV3 2WINB 4ER0A 4PCRA 2VMEA 3HQUA 3RMXA 1JS9A 4KWJA 4E2SA 2YROA 1AX0A 3B3QE 4AQ2A 3CZUA 4AGGA 1GWKA 1R093 5GJ6A 4OZXA 2Y34A 3SNMA 1RMU3 4XAEA 1IS3A 2PN5A 3ZN4A 5CKNA 1PM4A 1XE8A 1N47A 4LQRA 1AZDA 2PXQA 3PMEA 1K5JA 5B4XA 3ILRA 4O7XA 4NPMA 2ZZQA 3GBWA 4UFKA 1SPPA 2VMGA 4TXWA 1LENA 2VQ0A 4Y5TA 4KH9A 4YW7A 4FPOB 2DCKA 2WO1A 5IFPA 4HL0A 5CFCC 4RGAA 4PT6A 5EXOA 3MPPG 3LIHA 5D21A 2QQKA 3FL7A 2VXRA 1W28A 1GP6A 4XF4A 3URFA 2UY9A 3AM2A 3VDBA 2YU1A 1UXCA 4LE3A 2TEPA 3GNEA 3LE0A 1NCRC 1DQ2A 3I2KA 4KQ7A 3JXDL 3KCXA 4LKDA 4BCUA 5J96B 2VMFA 4OHYA 2ARCA 2CV6A 1AR91 2B4KA 2H0VA 1O5LA 1BMV1 3RPQA 1HW5A 3JBG1 4ET7A 2W39A 2LYQA 5HV4A 1RHI2 3BKZA 4W6YA 3WXPA 2WKKA 3DNVB 1GQGA 5DTRA 5JI7A 5C8CC 2ZGOA 1IS6A 1S0JA 2RS31 3MHZA 4B1MA 1RUD3 1XB9A 3ACIA 3SCHA 3KHBA 2A6CA 5LA9A 4WVVA 4D94A 4L9BA 2BTVC 5JXJA 2X10A 5GLVA 3ZYRA 4QMAA 2K0GA 3C7FA 3HNMA 1GZ9A 1KD7A 1UQXA 1S0DA 2PIJA 3GCXA 3IPVA 2B9VA 1ZVVA 3OQOA 5F8PA 3E6DA 2BDRA 5JIAA 1L7QA 2GP3A 4IV3A 5GLUA 3S30A 1SLTA 1SZBA 4IEOA 4QX8A 4Z1VA 2VMCA 4B7KA 4JCYA 1AYN1 1GFF2 4LBOA 1CIWA 1DQ6A 2WYSA 1OQ1A 4N7IA 4E4ZA 5DXDA 2BYVE 4DE9A 4X4GA 4NWVA 3RZKA 3TWIA 4YM0A 5T5PA 3AP7A 4MGQA 2EAAA 1LOAA 3CNAA 3P3NA 1YO8A 1YLLA 1O3RA 1IPKA 1BBT1 1S0CA 2BGPA 3W5MA 3O1UA 1NCQB 1W2OA 2WZ8A 2MEV2 1ZZ8A 1HB4A 1PO11 1GZTA 2QJVA 5JVVA 1W9TA 2P3KA 3TBDA 2EAKA 5CADA 1I9RA 1YI7A 1QJY3 1X50A 1QJU1 3GM8A 3ZHMA 2V72A 4MGKE 4RD7A 1NZIA 1HRV1 3AXDA 3ZYIB 3LSEA 4HPKB 2JEMA 4W65A 3BODA 4QPGB 2P3JA 2XXQA 5FZ1A 1CONA 1J58A 3GCWA 4BQ2A 5L73A 3J8F1 3HR9A 1AR72 1RB8G 1F4AA 1NOVA 3N7JA 2GRMA 3VBSC 4HK8A 5FKCA 3K77A 4OUEA 2ZKNA 1SEFA 4UW4A 4W8JA 1GR3A 3AYAA 4QXHA 1ND2A 2DUQA 1A34A 3IDEA 5LZ6A 1S2BA 4AFAA 2CGPA 1GP4A 1ALYA 4HFSA 4PIYA 4GKYA 4YSFA 3O1OA 1V6MA 4UFIA 1PGL2 3FUQA 5M0TA 2B45X 1Y9MA 3PHMA 1BVP1 1HB3A 3ES4A 5EJZB 4EN0A 2OT7A 1QJEA 2R071 4E4SA 5EHDA 4Q0QA 1E5SA 4JV4A 2YC4A 2D44A 1POV1 1GWLA 1RHI1 2AH2A 2B5AA 2DWRA 4L92A 5FZDA 3VZNA 2YBKA 4MGYE 2YYOA 3D3AA 4CP2A 4EKIA 3BU0A 1W9SA 4OQ9A 5C5TA 5ABJB 1F4HA 1HRI3 2HEVF 2W46A 1VP6A 3C7OA 3O14A 4KBZA 1VIWB 1GOFA 2D43A 2HSGA 2RE9A 5A3PA 3OY8A 4GB32 3KS7A 2E26A 2O49A 2BFUS 2ZX4A 2VH9A 4CUGA 3S7EA 2IVIB 3BOWA 3ZSLA 3U3WA 3IB3A 3VUOA 3B5LB 3U14A 1SPPB 4RS5A 4OUMA 3UETA 3L2HA 4PIXA 3U07A 4XUTA 5DRYA 1OC1A 1YNAA 2VNGA 1S2KA 1OPMA 2WNVB 4URTA 4DOUA 1N3OA 3PVOA 4CUCA 2R061 2ZAHA 3I4IA 3OGRA 4N8MA 3C7HA 5F6LB 2JE8A 4LJHA 4LT5A 1AL0G 3HD8B 3LAGA 5FJKA 2VNRA 1GMMA 3VBHB 4AW7A 4TLGA 1KJRA 1E5HA 3PUIA 1UAIA 1JZ4A 3K46A 5FZ3A 4OI1A 1VBD3 1GZWB 1F2NA 1YIFA 2R16A 3N7MA 2VMHA 3VHPA 5AVAA 3RYKA 1VBB2 2ZAAA 4UFMA 3I2DA 4OBMA 1RUG2 2AYHA 2WYFA 4N53A 5GZFA 2C0ZA 4QKBA 2VCMA 4AI9A 1CWPA 5JXGA 3N7KA 3FFQA 2RHPA 3RWKX 1W2UA 1DG6A 4Q0SA 4QQPA 4BYYA 1BCXA 3I97A 5A6ZA 1EY2A 5FY0A 3USSA 5EJ3A 3E6CC 1K5MC 3V0AB 3WNXA 1IG3A 3R09A 1HXS2 3K3NA 4ONUA 3DGTA 4Z5DA 1C8NA 1G9AA 4O65A 3OGVA 2OZJA 4FBFA 2X09A 5JOYA 4YFWA 1VMFA 2C1FA 5BYNA 1SBDA 1SQ8A 3EYPA 2X5IB 4OHWA 5D8AB 4LO5B 1W0NA 2ZJCA 2YFUA 2I45A 1H9PA 4CP9A 2VBPA 2VNOA 3NKTA 3PLQA 5I8YA 1VB2A 4CP0A 3QWGA 1VBC3 3MIHA 3LDBA 3IMNA 1S0FA 3I3DA 4Y22A 1YFXA 2WFF3 3F51A 2OUHA 2HWC3 4CXWA 4NIGA 4Q8LA 4EE2A 3POYA 2RR11 3WQ1A 5FPUA 2AXVA 1RUJ3 1TME1 4CCLA 3O1VA 4FBIA 1DF0A 5EIYB 3ZFEC 4N53C 2C9AA 3ENRA 4WM7C 1XNBA 3PUSA 5FMCA 4NO4A 4UW3A 3MBWA 1QJX1 4QPIA 4XMIA 1W6MB 1UPIA 4NIAA 1GV9A 3U4SA 3EMRA 3USUA 1JBCA 5FZ7A 3I2HA 3ZYGA 3WQ7A 5I0SA 2R1BA 3HMYA 4M00A 4AFBA 2R1JL 1LR5A 3FHIB 1C8M2 1AR61 1MS9A 1OXCA 2UY8A 2W1SA 4X4EA 2WSVA 3S57A 4GXLA 2EXKA 5F39A 5A6YA 1OPOA 2WBKA 1W99A 2VCBA 3U78A 3WD5A 4PU3C 1RUNA 2XUEA 4IV3B 1QB2A 2BOJA 1CD3G 3WY6A 2QTWB 3PVNA 2UURA 1LOEA 2OVUA 3ZN5A 1SCRA 4Q27A 4XXAA 2AZ5A 1H8TB 2ZHLA 4Q4W1 2GNTA 5IT6A 2AW6A 4RHV3 4QDRA 3JQWA 5A7WB 4JX0A 1DQ0A 4ITCA 1COV3 3CMGA 5FYZA 2FDKA 3EJKA 3T1MA 1CESA 1QNYA 4BK5A 1U5IA 1W8ZA 3DPRA 4IERA 2ZZJA 4PIZA 5KHHA 1GBGA 3BI3A 4LHKA 4IVZA 4BE3A 3KV9A 2R062 5CB7A 2VZUA 4BQ4A 3LQXA 2HWD2 1C57A 4PF5A 2GH2A 3POGA 2XJQA 4P9XA 4J6GA 2L1PA 1WMFA 2D98A 1RUI1 1F31A 2EICA 4IV1C 1WA6X 2VNVA 4ORFA 2B7YA 2WC2A 3H1WA 4Z07A 1MS4A 3AZYA 1HLCA 2J1SA 4RS5B 4META 3WNPA 2Y6GA 1NUKA 2JXAA 3NL1A 1O91A 1HJGA 4LOSA 1POQA 5JSPA 4N9IA 3C7GA 1M06G 4NN0A 2L9LA 2HFZA 2B8MA 5CFCB 1F35A 2AXUA 3MI8A 4GMP3 2WZR1 2AWIA 4IWRA 2GP5A 2ZMNA 4CUAA 1GOGA 4QAWA 1V9U3 3E5XA 3IAPA 3OGGA 3ZVXA 5AC92 3K51A 3R4UA 1QOOA 3K48A 4PBOA 2WAOA 2JB8A 4I6TA 1W8WA 2BERA 3JQXA 1UKGA 3GN5B 1LOBA 1W8NA 1KXGA 2AUWA 2RS32 1VR3A 3A0KA 3NJXA 1RUG3 3VL8A 5EV7A 3ETPA 2UYBA 4XDPA 1H9WA 1WA4A 5JMCA 3O1TA 4OB4A 1EPWA 2DBNA 1W8HA 1JYVA 4QXCA 1ZAYA 2FZ2A 4QM9A 4AYUA 2KEIA 3JCIA 1OF4A 1W6QB 2LNMA 2ZS6B 1BMV2 2HWE1 1PMHX 1NZCA 2VMIA 4HANA 4JGZB 4YWAA 3KXAA 3PUAA 1ZA4A 4ZXEA 3CF6E 3GBGA 1ULGA 1GU3A 2RMU2 4M4RA 2QCSB 3GHNA 2WIIB 4BLIA 3SMHA 3H3UA 1APNA 1O4YA 5F3GA 5IUQA 2AGSA 1UY0A 4H7MA 3TB0A 5JUVA 2ADEA 5F5CA 2EIBA 1YI9A 3L1PA 2HWF1 5FPXA 4Z59A 1SFNA 4NAOA 4IV1A 4IE6A 5EYYA 1UPSA 2J1TA 1QQAA 2HLEA 4I02A 3FLPA 4HVRA 4XFFA 4O61A 4XXPA 3ZYJB 3H5TA 3DCQA 5EWSA 2GN3A 5I0RA 1HB2A 4CDXB 1ND3A 2W08A 4WBBA 3S6PA 1KEXA 3ZFGB 2J7MA 5IWFA 1HXS1 5FMOS 2XXAA 4XBNA 3PE5A 1ULEA 2J22A 3A0NA 3MF6A 2ZHKA 1LHUA 1W9WA 2IXCA 4XPVA 1QJX3 5FZFA 5GKAC 5JPNB 4ZHNA 1EAH3 2VW1A 3FX3A 3WG2A 1R63A 4XIKA 2VO5A 4ASMB 2J42A 5ANQA 2DCYA 2VTXJ 3H1MA 4DXSA 3K3OA 3PUQA 1L3JA 4NOTA 4GMP1 4UOJA 3JD73 3J7LA 4HMZA 4XJ8A 1JYIA 2YDEA 5LB6A 1CAXB 3WHUA 2CDOA 4S2HA 5I8TA 2E51A 3ETQA 2VECA 5KHGA 2A75A 2QZ3A 5T3NA 4I2OA 1RMU2 1MVQA 3MEPA 5H9RA 4ER6A 4GWJA 1K45A 1WUVA 2PE5A 1QH6A 2PHTA 3H9AA 2J1AA 1NQJA 2V3CC 3HQXA 1LOFA 4Q4V2 3JXBC 1V70A 3VBFB 4PDWA 5FMBA 5FYHA 4I09A 4WV8A 1IS4A 3ZYPA 2LLWA 4D6RA 2L8NA 5A70A 1RJ7A 1W3XA 5A7WA 5FREA 3OG2A 5JWPA 5H9QA 4LLFA 1DCSA 3HT2A 3FLTA 4Q0PA 1AR82 2QE3A 5LA1A 5DG2A 2ARAA 4QX5A 1W39A 1I1EA 1H4HA 1T2XA 3SEPA 1YYNA 3VBRA 4AHWA 2J1EA 3RWNA 3TRSB 3A21A 1AL21 3OPWA 1NEQA 1OA4A 1LJ7A 5J36A 2RDSA 3N9PA 3K4ZA 5IHRA 1PNFA 2LYPA 4CDWA 1VPHA 1Y9QA 1FNZA 4HPKA 4LNVA 3THCA 4LTAA 1Z7S2 2R1DA 2WN2A 3I59B 4G3YC 5A3UA 4XUPA 2JDYA 1ZYBA 2W92A 3GJBA 1KDMA 1ZBE3 4IUGA 4A3ZA 2EWTA 1QJFA 4LBLA 3S7IA 5H9PA 5BNPC 3PURA 3WUDA 3FE5A 3CHXA 4HG6B 3SH4A 4AEDC 3KL4A 2OPKA 1PGL1 2I74A 3R1FA 5A7LA 4EN7B 2CHHA 3M1HA 5T5LA 1GKBA 2Q4SA 3CJIB 3LGRA 1ZUGA 2UYAA 3AKRA 2MHFA 2YU2A 3OJBA 4XIOA 1IG0A 1Y4WA 3BTZA 5EFUA 5BY5A 1J59A 2LYLA 1CQ9A 2VVEA 3ZXFA 2ID4A 4AXOA 4NVPA 2LYRA 3WZ1A 1S0BA 1FOD3 4CUBA 4DUWA 3LCPA 5T54A 1LEMA 2D6MA 1CN1A 2PAEA 5FY8A 1SHWB 2WNUA 2JG8B 3H3ZA 4N90A 5IYYA 5DTQA 4ER7A 1PMJX 2DVBA 4K20A 1MQTB 2EF6A 3WF1A 4JGZA 2QQIA 5FP8A 2ZTNA 3ZM8A 2ICTA 1RUE1 3CQOA 5DAVA 3ZFFB 4LUMA 2ENRA 5HBAA 1UYZA 2JE7A 3IIIA 4Y5SA 4N43A 4LLOA 4Y1XA 2H8RA 1R1A3 1FXZA 3SC7X 5FZMA 3C8XA 3ZIXA 1NLSA 3EBRA 4K1YA 1S55A 4QQHA 1FMD3 4FQ4A 4QPIC 4TWTA 3LPGA 5FY5A 3SKVA 3M3OA 5CU1A 3ZO0B 3CU7A 4FOYA 5HI0A 3UFDA 1WIZA 2ZGNA 3PDQA 1XQNA 3ZMOA 4X4FA 1I5PA 1OF3A 3OD0A 4P9GA 1X33A 4ISRA 1AR92 1DYPA 3HJRA 2ZGSA 1RUF1 1OUSA 3NJYA 2RDNA 3I49A 1FYUA 4JDMA 1OD3A 3MYXA 4JGYB 4LIVA 3ZFGA 3CLPA 4R9CA 4MH0E 2GAUA 4Y1YA 4A7YA 4M01A 1SACA 1ZREA 3OWQA 4P5YA 1ENRA 1UO9A 5F32A 5LY2A 4MX3A 1UOBA 3WDXA 4YGBA 2ZA9A 4AAXA 3T2TA 5A3OA 4CU9A 1AR62 2JDPA 4C90A 4FP2A 3I2GA 4C0HA 4BB3A 3AVSA 5IATA 5EZWA 2LYJA 2E32A 1J83A 3M2MA 3GZDC 1TEIA 3AVRA 4Q8KA 5J09A 2D6LX 3RZZA 4QHZA 4YZ4A 3I2OA 4DEVA 2WWSA 3H7JA 2Y60A 3V0AA 4YZ1A 3FYMA 1OQEA 4DEQA 5J37A 3OBZA 5C8CB 1ZVFA 3MUZ1 1A8MA 4CCEA 4WZFA 2WUSR 3TRBA 2H6CA 1ZNPA 2Y6KA 1NG0A 4HKLA 4RSUA 1OH4A 3T2OA 1REEA 1UXZA 2YGMA 4EZ4A 1N3PA 5T5JA 1K42A 3P1IA 4CEYC 2RM23 3AZZA 2GC0A 2JKBA 1IC8A 1W04A 1VBC1 4CDXA 5GLZA 1BK0A 2WZR2 1WW6A 2ZEXA 3I3EA 2SBAA 3H42B 1XJAA 4FXKB 4IV1B 4CSWA 4AQTA 3VDDA 4LKSA 1H2KA 4B4RA 5DZFA 3D82A 4EN8B 1OLRA 4K9SA 4YM3A 3RZGA 1OKQA 1VBD2 4NHYA 1V6LA 2FZ1A 4FO9A 3BTXA 3J26N 3AP5A 4XF9A 3GN5A 5GZDA 1NY72 1W6NB 1JUIA 2PHRA 3HIFA 1IHMA 2RV9A 4XJAA 5LATA 5KC5A 4CDQC 1CJDA 1VBA1 4K6BA 5LBEA 2OZ6A 4COYA 2EXIA 2HEWF 4ATEA 1O7FA 2Z5WA 5FPBA 4AEMA 4GA9A 3NROA 4OMDA 5A7SA 3ZXLA 4DZGA 3OEBA 4GQ7A 2HWE3 3B94A 4BU2A 1LGBA 4HVQA 4IESA 5C3SA 2BQPA 2Y33A 4MYEA 3WT3A 5FOBB 4BIOA 4XZUG 2CNAA 3VBFA 1JZ2A 4Z5HA 4BOWA 3RZJA 4LUKA 1W2NA 2CSFA 2B42B 2HWB2 3NAPA 1ZRCA 2WLQA 5CIRA 2CY6A 4L8QA 5LRRA 2WZEA 2WO7A 2AREA 3UL2A 1DULA 1G86A 2WQ4A 4OHXA 4LA3A 3TNPB 5FOJB 2A5ZA 4R9BA 2WS93 4EQZA 2WO3A 3MO4A 4LBQA 3DL3A 3OGJA 3POBA 1R1A1 1UMZA 3QOPA 1ZBA3 5JCTA 1QXPA 3NRUA 5G05L 1FX5A 2X5IC 1NCRA 5A3LA 4JDOA 4YG4A 1MZ6A 2BUKA 2D97A 1ND3B 4IQPA 3TNQA 1K3IA 4V1PA 4DE8A 4BJ0A 4HONA 3MIEA 1ZX5A 3B9IA 1RINA 4GB31 1JH9A 1DZQA 1GOHA 1W9YA 2WO2A 2XGXA 3PUHA 1HXS3 4QX1A 5FP4A 5CG9A 2J7WA 3OOXA 1QP0A 3Q8FA 2VU9A 4N43B 5FZLA 5GZGA 2CYFA 4LO7A 4SLIA 4LOTA 1CZSA 3MZHA 5A3MA 2O0OA 2D5VA 1W6PA 2ZCWA 3HOBA 3MLLA 2NMOA 4QPYA 5FZIA 4OI4A 2WR9A 1FMD2 2IUWA 1O8SA 3VV1A 2BEOA 2RR12 4OYUA 3M7AA 2A3WA 4XJ9A 1BHGA 4FT8A 3N36A 4OCTA 5IK5A 1PMIA 1MFQC 1HIXA 1MR5A 4ZKTB 2FDIA 1JYCA 1J1LA 1DBNA 5DUXA 4UFJA 5C9AA 3LISA 5FYCA 4BDVB 1JZ5A 3SH5A 3ZDVA 2BJCA 1PK6B 1XE7A 5FZGA 2WNUC 3V56A 2XOMA 4ZS2A 2BNMA 2VM9A 3RI8A 4JTOA 3VBHC 2O38A 3AP6A 1OVSA 2ZX1A 2O8QA 4XOGA 5FZCA 4FI9A 4COUA 3UJOA 3AJYA 4L99A 1D0GA 1G9CA 2PUDA 4PDWC 4DQAA 1D7PM 2W3JA 2ICPA 2KXLA 2VUAA 4EWAA 1W6QA 1ZBE2 2EXHA 3FN9A 3UK9A 1BEV1 1YCIA 2WT1A 3GZDA 1Q56A 2UU8A 3T09A 4HN0A 1D0HA 2QQLA 2C4XA 2VQTA 4PJYA 1LOGA 3WINE 3ALQA 4OQ8A 4Q1PA 5FKBA 4JZRA 2XR4A 3MW2A 4OVEA 3LFIA 1ENSA 2EIGA 4ASLA 4ZZ8A 2HYKA 1UXXX 1YQ5A 1AR81 2BGCA 2JDUA 3FHAA 2R30A 1H6YA 2WFF1 2ZEZA 5FYMA 4BQXA 4K40A 3HBKA 4PQ9A 2P2KA 2DVAA 2Q1MA 1WH6A 3D0JA 3IMMA 4DIQA 4X4HA 1UF2C 3N9NA 5H9SA 2EA7A 3AFGA 5DAQA 5FY1A 4YPJA 1ADRA 4LITA 1PIV1 4NROA 1ASJ3 1ODMA 1O4ZA 4AVSA 5IW0A 1WLTA 2WQZC 3FBMA 3VDDB 2O4AA 3ZKYA 5I0TA 4UAPA 4CCCA 4CP1A 3BN6A 2GZUA 3E6BA 1QP7A 2VW0A 3D0SA 3FWEA 4YVWB 2GZWA 5IVYA 1YSEA 1IPSA 1QZXA 5DUUA 5DSXA 2Q30A 2G1MA 1WMDA 2XLAA 3WQ0A 4A42A 4L97A 3B02A 3ME5A 3N9OA 4GKXA 4U36A 3ZDSA 5K9YA 3TEYA 1Q8OA 1RUD1 1S1AA 1RTVA 1FOD2 3UJQA 2DUPA 2EF8A 4FPJA 4R4XA 5DZGA 2VOWA 1COV1 1OLMA 1UY3A 4CDXC 3S5AA 2FDGA 2WABA 3VHNA 1C5HA 1WW4A 2XWJB 4S2DA 4CYDA 4OMCA 2BZDA 2RS12 1UZVA 2PHFA 1WGPA 2FDHA 1MS5A 1WLDA 5AFEA 2GALA 5L7OC 3LD8A 1KFUL 3ZFFA 2W0XA 3U11A 1HQWA 4MHUA 4DXTA 5FMDA 5BNPB 4C1XA 3N7LA 4AR2A 5L7OB 4LULA 2QQNA 4CDUA 3O1PA 2X8KA 3BD1A 2RJLA 2OQ7A 2RM22 1QEXA 2KM2A 2NLRA 1BEV3 1X8MA 2HBTA 1QJU3 3FZ3A 3PJQA 1YQ6A 1H0BA 2Q5TA 5C4WA 3O1RA 3VGIA 2OQ6A 1K5MB 2Y8KA 1JYTA 1WLCA 1ULFA 2XBO3 3LIGA 4LBQB 1UY2A 4ZPIA 3ZIWA 5C3OA 1FI2A 4IDZA 4DRVA 1KGYA 2ARBA 3AL6A 4NHLA 5DUWA 4ZS3A 4BLJA 5FDBA 2MEV3 5JMOA 1PVXA 1V6OA 2YXSA 1RYYA 3SISA 4NUBA 2QUOA 4BXFA 1FMD1 2WIUB 4Q2FA 3IPVB 1AF9A 2CTVA 1S0GA 2RMU3 3JU9A 3NVCA 1OSGA 2TBVA 1ND2C 3M8LA 1MZ5A 3VZJA 3QFIA 1QMJA 3AMPA 2ADDA 1US3A 5JR7B 4AI1A 2D6NA 5FZHA 2KZ8A 3NWKA 1I3HA 3GZCA 1OD5A 1POV3 1BBT2 2RDRA 2VZOA 3VD5A 4XJZA 2WS92 1A8DA 1S7EA 3UT0A 1ZS4A 3LA3A 4UXAA 4GULA 3OPZA 4QX3A 3BUCA 4V2VA 1HV0A 3B7MA 1YQCA 4AGRA 5BNNB 1YQ8A 1V6JA 1EAH2 2YUEA 3ZXDA 4YVSB 1G9BA 3ZSJA 4QX2A 1QWRA 3B7HA 1JWLA 3AB0A 3CROL 2XLFA 1RUH2 2XIUA 1JFSA 3BPZA 1LU1A 4XFCA 3BU7A 4DXZA 3KQRA 1AYM2 2WFF2 2R6QA 3BPSA 4K3UA 2JENA 2FDJA 1C5IA 1LHVA 2XBO1 2Q8OA 4P08A 4WM7A 4Y3OA 4AZZA 1JI6A 3AMQA 1LNSA 1VMJA 1PO12 2ZOEB 3GZAA 5FZ0A 2Q0AA 3DM5A 4XCAA 1DGWX 1PO13 3KHCA 2FJRA 5A33A 1BK1A 2Q8CA 3C7EA 2XH6A 4XFGA 2CU5A 4Y5Z0 2HH9A 4R9DA 4AVCA 1ZZBA 4AEDA 4B3NA 1XU2A 1GT0C 1RIOA 1H4GA 2E53A 3MF9A 5A7PA 1KJLA 2W87A 3ITQA 1U5XA 4Y1VA 4AQ6A 3IWZA 1UYYA 4B4PA 1XYNA 3KM5A 1VBA3 5FBJA 4EWEA 3TOJA 3N9MA 5BNOA 1RUF3 4LR4A 5F5QA 1OURA 2CROA 5ACA1 3U0ZA 1MZEA 1ND2B 1VALA 1R091 2VR4A 3RVHA 2ES3A 2PA7A 2XL7A 2ZACA 1LU2A 3OKZA 3HZIB 3R6SA 2G4IA 2ZGRA 1CVNA 3PTRB 3OPTA 4PI0A 4KWUA 2XG3A 4NHXA 2DURA 2VZVA 4YVWA 2VW2A 3VB9A 5C9AB 2EXJA 4YBAA 4HRAA 2V4VA 1KS5A 2WWJA 3R05A 1U0AA 4GH4B 2C26A 4EZIA 3QH6A 4A45A 4I0AA 4ES8A 2XVKA 4NHKA 4XQDA 1CAUB 3KZ3A 1AVBA 2B46X 1KITA 3CJXA 4JTNA 4YNIA 1WBLA 2CAVA 3OGSA 3I3MA 1RHI3 4UBHA 4AI2A 3TEPA 2HINA 2DFBA 2L49A 1JOPA 1V6NA 1W8TA 2IWGB 4NE9A 5L9RA 3RZMA 4WVMB 3U4XA 2WWUA 3LZZA 4OLLA 3EUSA 2K2SA 3I2JA 2G9FA 1REDA 2PHWA 3T0BA 1MVEA 2YC2A 2JG8C 4ATFA 1ZZCA 4CCNA 2CWSA 1DW9A 3HN3A 2JQEA 4HN1A 5FBZA 5FLIA 1OA2A 3DKWA 2ZHMA 1M4WA 2JG9B 4R52A 4JKLA 2W5FA 1NCRB 1PO21 2OW4A 3JBG3 4I6RA 5FYBA 1N1SA 2PFWA 2VE1A 1RUF2 2JIJA 1RZSA 2QQVA 2JD9A 2OA2A 2VZSA 2ZHNA 3WP6A 1LOFC 4AGVA 1T6BX 5LA0A 2KPJA 5DRTA 4F83A 2FFHA 1AL22 2K9ZA 3MUY1 4GWMA 4JHTA 2BFUL 1IQAA 3ZPXA 3PJYA 3ZPYA 3ZYHA 1JMUB 1BZWA 2WA4A 3BGAA 2IU7A 5KC6A 3NNLA 1KRIA 3V65A 1RUI2 3MFAA 1QJY2 1UOFA 1BYHA 4QB2A 5AC91 5IVFA 1DLLA 3AYCA 1AR63 1CAWA 1HN0A 4NIHA 4FFHA 1CJGA 1Z0HA 2PUBA 2DV9A 3ACHA 4Q4W3 2H6BA 4YGEA 2XKOA 3ES1A 3PU8A 5HPOA 2XVLA 3MV01 4QQ2A 5C5UA 1W0PA 5LY1A 2XJRA 4B7EA 4MXWB 2ZX3A 4Q4X3 2J1UA 4CXXA 3T4HB 2GNMA 2J1VA 3VBSA 2R042 1RUE3 4A3XA 1AYN3 1ZRFA 5DAPA 3WVJA 5CNAA 3MIBA 3DF0A 3EO6A 1BVVA 1NA1A 4PLNA 5GLTA 1J84A 1DGLA 3CDZB 4YG1A 4FTEA 1AXZA 4DO0A 2V09A 5E89A 2VGDA 1PERL 3AZXA 2JVLA 1R69A 1RJ8A 2WAAA 1E3OC 4ZZ5A 1PHMA 5E8AA 4A6OA 4FPFA 1QP4A 2GC2A 3DECA 1DZTA 4YGCA 4DUXA 1JXNA 3NNJA 3NSTA 2P1BA 4M3CF 3VBUC 1MPXA 2RJKA 1WLWA 1VB4A 1UOGA 4LO8A 4RR3B 1H1IA 4YM1A 3WG4A 5JPMB 2RS53 3ILNA 1B0NA 5ACA3 1SDWA 2QDNA 2ATFA 2W91A 1CAVB 2WT2A 3AL5A 4KWKA 4MXVA 3J7NA 5DQ0A 5HCFA 5L19A 4WM8C 2PXUA 1D4VB 1SQ4A 5FP7A 5HV0A 3K2OA 3O1MA 2R073 4CU7A 2GDFA 2YBDA 4KGQA 2MEZA 5T5OA 5C33A 1QXJA 3U1XA 1AX2A 4AFMA 4E2GA 2HWD3 1G7YA 2E63A 1OBNA 4Y33A 4I0WB 5KR7A 1NE6A 1A78A 4Y1ZA 4HOOA 3O5SA 1PGW1 2FD8A 3ZN6B 3M3QA 1UN1A 2FCVA 2EIEA 3B69A 1X9PA 3CEWA 3IDBB 4IEZA 2E7QA 4D7SA 1DZRA 3ATGA 5CISA 4UBGA 4D3WA 3LDRA 1PNRA 4DNYA 2VZ1A 1JFTA 1BDIA 4FFFA 5DMYA 3FJSA 2NZ9A 4WM8B 2ZGMA 2A70A 4JKKA 3ZSKA 1FNYA 4IEYA 3UESA 2DF7A 1RVF3 3AP9A 3ZFGC 5CBLA 2IVGA 5HCBA 1WETA 3DYMA 1SLLA 4XUNA 3GJAA 2DBIA 4Z2WA 3OF1A 4PLOA 2XSDC 3A4UA 2LCVA 1HDKA 1RITA 2FCTA 3QOWA 1W0OA 5JI9A 4WVLA 4QGMA 3GZEA 4B1LA 1ND3C 2IUOA 4HKOA 5FPLA 2FMYA 2CWMA 2WA3A 5E6HA 4JQRA 1EAH1 3QH7A 4MZUA 5GAHi 4XAAA 1WH8A 1UL9A 2ZGPA 3G0TA 1B09A 3SCGA 4PHZA 5FK8A 5A7OA 3WF3A 5FYVA 4AVTA 5IVEA 1O3TA 2Z42A 3QBQA 4U2AA 3RRDA 4E27A 4COVA 4ASKA 4TZDA 2VVDA 3EXUA 2BBVA 2AENA 2WNVA 3AXEA 4XJWA 1RUC2 3Q8EA 3T1LA 2GN7A 4TN7A 4KNCA 3VD3A 1XNTA 1JTZX 3NNFA 2V4AA 3QCWA 3OMTA 2JE9A 3KT7A 1CAUA 3AMNA 1POUA 4D0QA 5FQ0A 1RGSA 5I0DA 2GSYA 2AEZA 5A7NA 2A6VA 4AVAA 3TELA 1SDDB 2P37A 5LCWL 4PU7A 1OFNA 3I3QA
chains in the Genus database with same CATH topology
3NV1A 1CAXA 1KS4A 5A32B 1I6XA 1H1MA 4DPNA 4HK9A 1GANA 4C1WA 3SCFA 5GALA 4GIQA 4B29A 1RUJ2 1GNHA 1UU4A 1VAKA 4AFCA 2IXJA 3TN93 2D5FA 2YPJA 2IFRA 4YVSA 1QF3A 4Q4X2 4FSJA 4RA0A 3TN92 2MPFA 1AL23 1OMIA 4QXKA 2C5DA 2LUWA 2R0FA 5E16A 5KHJA 1JOJA 3E97A 1VAVA 1A3KA 1HQLA 4TSVA 1QKQA 1RUJ1 3BTAA 4FP3A 4XTPA 2BPA2 4F7ZA 3FLRA 2GMPA 4HKWA 4M0HA 3WG1A 1F8VA 4LBQD 3IN9A 1ENXA 3WDWA 3NV2A 5J3UA 1HRV2 3Q9OA 5J48A 3WV6A 3NV4A 4P14A 4CDWC 1R081 4COWA 2UWAA 1LCDA 2RS33 3VKLA 1H2NA 1R092 2JG9C 1Y43B 1D4M3 1NE4A 1CAWB 3PMSA 1O3SA 1DQ4A 1ULCA 1LULA 4K21A 3JUUA 4XBQA 1YFWA 2B5HA 4BM8A 5FLHA 2KEJA 4M3CB 1OA3A 2ZGKA 2D7FA 4CDQB 5GM0A 4AE2A 3O7OA 4AWDA 4JDNA 1RZRD 2UWBA 1H30A 1FPN2 1XYOA 3SITA 1LCLA 3OTFA 3OCPA 3VBOB 3MLJA 4Q26A 1QOTA 1C4RA 4NWWA 1JH5A 2XBO2 1PVC1 3OQNA 2E7TA 4HSLA 3J8F3 4MVTA 1C8M1 4BIFA 3VKMA 5JSRA 5K0UA 1VJ2A 2PYTA 4RS5C 1C28A 3LOBA 3N35A 3H0OA 1HRV3 2X29A 1QU0A 3S8QA 3VZOA 1GQHA 4WVZA 4D7TA 3AK0A 3AKQA 4RHV2 4C91A 4XFAA 2EBYA 2VOKA 2XJVA 2FBEA 1LLIA 1R082 3PVBB 3MLFA 2LM3A 3LA2A 3VKNA 2XI8A 4JGYA 4QHBA 1V9U1 3PXPA 1BDHA 1BKZA 3NAPC 4H55A 5C8WA 2ZPXA 3W9AA 1HRI1 4FVVA 3INAA 5HXVA 3J4UH 4R8HA 1MEC1 2ZABA 1AHSA 4YG6A 3KCYA 5I8SA 1QDCA 2DCJA 2VULA 4IL7A 1DGRN 1FOD1 4FOVA 3TYJA 1PZ9A 3KGLA 1BQPA 3AZVA 2CL2A 3C3VA 3GZTB 1O4TA 3D5OA 4BA6A 3KJXA 3OQMA 2LYKA 4YGDA 5T50A 3UV9A 5JDBA 2MEV1 2PHDA 2GC3A 4ZXKA 1I5ZA 2WNVC 3X29B 1LHOA 2HWF3 4XETA 4Q4V1 2HWB3 2PLV2 2WT0A 5CVRA 4R9AA 4XW3A 4L11A 2WNUB 4CDUB 2GRLA 4JRAA 4WM8A 5CAZA 4HBNA 4AEKA 2YMZA 1YFYA 2WLPA 4UW5A 2WFPA 1BXHA 1SMVA 3FUOA 2HWD1 2NYYA 3V64A 4M0NA 5FQ0B 1L1MA 3R4SA 4UW6A 2NMNA 2PHUA 3ZFEB 2B39A 4LE4A 5JLVA 1NY71 4IEPA 3V0BB 2XHKA 2QKDA 1UW8A 1FV3A 4AHXA 2XLGA 1TE1B 3BDNA 1H2MA 1WBFA 3I54A 1X57A 2V5YA 1CQTA 3E5QA 4XYXA 4KU7A 3KMHA 1RZRA 1EV13 4XTMA 3L9JT 1PIV2 4Y26A 3VBOC 1LQCA 2D3PA 1VBE2 2HWF2 5SV8A 1VPWA 3L2YA 1UX6A 4A2UA 3GZUC 5FCCA 3E5UA 1F9KA 4YW5A 3H7YA 1RVF1 4Q0UA 3RJ2X 2A73B 2FMDA 4KGGA 2JICA 4JVAA 1IKQA 4EV0A 3OBRA 1KQRA 3WLUA 2HWE2 1DQ1A 1ZBE1 5KHKA 5GZCA 4YLZA 3J8F2 3D1NI 1VBB3 2GNBA 1TME2 4RQPA 4HSJA 4LO4B 4JGZC 1XNCA 5DG1A 1G8WA 3AKTA 4Y24A 2IFWA 4MGZE 1R1A2 1X82A 3I8TA 2FQPA 5BUVA 2YZ4A 1X7NA 5LEJA 3ZHIA 4HETA 5TSWA 2TNFA 2XKPA 3O0XA 4KG8A 2WJSA 4JC1A 4E2QA 1G6NA 4QQLA 3RYPA 3W59A 4EWDA 1LECA 1IGOA 2JECA 2YGLA 1SLCA 4GWNA 4IEWA 3KSCA 2MQKA 1ONAA 1REFA 4S2FA 4Z92B 4AVVA 2PPXA 1NXMA 3WP4A 1AYN2 4Z8BA 2RS11 4HT1T 4GALA 3B01A 1W6PB 1BJQA 2Y0IA 1SCSA 2DVFA 1RIRA 1FV2A 5JZGC 1XXNA 2YV8A 1RUD2 2XJSA 5IK8A 3QF3A 2SLIA 1PO23 2FHRA 4XQ4A 4F8AA 2I2SA 4BMEA 3W58A 1ZZ9A 5GLWA 1PK6C 1WMEA 4WVWA 2HEYF 4FPGA 3J9SA 2MNGA 4S2GA 4LBKA 2F4PA 4CDQA 1HV1A 4QD2A 1FATA 1X8EA 2R63A 1QJX2 2IC1A 1NLRA 1KFXL 4AK3A 4BPZA 4XEZA 1PO22 2ARXA 4YVSC 4XHXA 1XRUA 2LTNA 2R32A 4W6WA 2AXZA 2R49A 3ASIA 5IK7A 2XL9A 1NXD1 1QDOA 1V00A 3VHOA 4DRRA 2Z69A 3O12A 1KDKA 3JB8A 4Q4X1 5AC93 2E7AA 1MACA 1DGRA 2P3IA 2V73A 1V6IA 4A7ZA 2X53S 4IA8A 3LSDA 4IETA 4L2NA 3RSJA 3KGZA 2VPVA 2OUJA 3JB4C 3RMYA 3EHKA 4CDWB 3QACA 3OYWB 4F3JA 2OYZA 3VK0A 1QNWA 1R1ZA 1UU5A 1RVF2 3D4KA 3NO8A 4XF1A 2D6KA 5FLJA 1IOAA 1O3QA 1PK6A 3DPRC 3ZSEA 4DB5A 1TMF1 1PVC3 4NDWA 1GLHA 4N53B 5K7PA 3IKWA 4YM2A 4GH4C 3QLQA 4EN6B 4K7JA 2ZGUA 3IDCB 2RM21 4BMBA 1VRH1 3VBOA 4YZ2A 1PGSA 1OI6A 5L36A 2D40A 1VBB1 1UIKA 4K1ZA 2ET7A 5FPZA 4JRLA 4YYOA 2BNOA 1OHFA 3MW3A 4AG4A 4CEYB 2R0HA 2PLV1 4H3WA 5JZGB 3VZLA 3FMYA 1V6KA 2ZGQA 1LKNA 1PIV3 3RYRA 5E88A 1ZZ7A 3D6EA 3DV8A 1Q3EA 1XU1A 5ACA2 3CJIC 1AXYA 2P34A 3AYDA 3G6JB 2LYSA 3B93A 4P9WA 1H8TC 5K0UC 2ILMA 3ROUA 1QJZA 1H1AA 3F52A 1QY4A 3ECQA 4IEUA 4NHMA 3WUCA 4DY3A 1MEC2 2DYCA 3FMGA 5SV5A 2PUEA 4OFGA 4E9KA 5LK7B 4AHZA 1SLIA 1J3RA 1UZZA 2YY1A 4CEWA 1QQP3 4RGGA 5BNPA 5CFDB 4PU8A 2IV1A 3CJIA 5KHIA 4PBPA 5BNNC 2A6ZA 4KU8A 4Q4V3 2DCTA 2PELA 4WM7B 1CPMA 4XMAA 4QT6A 3RDIA 4FPKA 1OCTC 2OFYA 1C8M3 2GH8A 5LK5A 3THPA 3GALA 4MLOA 3ST7A 4HVOA 3PTYA 5C8CA 3VBFC 4OUSA 3B9CA 4AEJA 1K5MA 3FYAA 4PDWB 4RL7A 1OOPC 4QPGA 2VUJA 3KT4A 4FPLA 2A6WA 5IK4A 4MV2A 1WD4A 4KBBA 5DZEA 5BPXA 1QGLA 5KXDA 2WNEA 5BNOC 3LFPA 4Y20B 5E1RA 4J1XA 2D5HA 4AI3A 1C1FA 4AHYA 5DDJ2 1X36A 5BNNA 3OBTA 4X4DA 2IXLA 1PZ8A 1EV11 2Y26A 3FFZA 2Z79A 3I59A 1WD3A 1RUI3 1Z78A 4GMP0 4FTBA 3VBUA 1UZYA 3AMMA 2W68A 4LHLA 5GZEA 4C0BA 4Q4Y2 1DQ5A 1N1TA 3BIWE 1UTXA 1Y7BA 2PUGA 3RI9A 2ZGTA 1PRAA 3MIFA 3RJRA 5C9AC 4GQMA 5FO7B 5A33B 1HKDA 1VRH3 3HBZA 1LEDA 1LESA 1OFSA 1Q8QA 3WR0A 2HWB1 2IZWA 1VRH2 2DU1A 1AJOA 5CFDC 2PHLA 3VDDC 4YW4A 4RR3C 4IEXA 1LMB3 1URXA 4O8BA 3AKSA 3LWCA 1EFAA 4YW2A 3AFKA 1G9BA 2IVQA 2BVBA 4E4DX 1AYM1 2R043 4AF9A 1EP0A 1MQTA 4AI8A 1YXWA 1RUH1 3RNSA 4I3PA 4OI2A 3AX4A 2ET1A 3GBFA 5EYXA 1N3QA 4LBMA 4H7LA 3AMHA 4IEQA 1B35C 2BW8A 4GH4A 4P9LA 5B2GB 1HF0A 1YIPA 3BOPA 5BNQA 1CAVA 5FRAA 1VLNA 4G9SB 1MS0A 4O9GA 4Q4Y3 4YZ5A 3IT8A 1DU3D 5ABJC 2XPJA 1F5JA 4CRQA 1A6CA 2DTYA 4ZU7A 3SXWA 1YFUA 1VBE3 3CO2A 1RUOA 1FPN3 4N43C 4Z5CA 3BB6A 3IIAA 1YWKA 3KCCA 2JG9A 2HJIA 1WW5A 2PTMA 3ZXKA 2GU9A 3ZXGA 2DFCA 2VG9A 2DU0A 2D3SA 2NN8A 3ELNA 4AFDA 1NCQC 4Y22B 1JN2P 1IPJA 1PVC2 2BWAA 4Y42A 4Q1RA 3H50A 5JIUA 3PNAA 3ZXJA 4JGYC 3POWA 4NPRA 1ZRRA 4WZCA 5JZGA 3CLCA 1GSLA 3C2UA 1TNRA 2DUOA 1RUC1 2E6VA 5FMOL 3M3EA 5KXCA 1X2LA 1PZ7A 1F5FA 4YG0A 3ZXAC 2IXHA 3U10A 3WHTA 1ZBA2 1B35A 1ZRDA 4CEYA 1OQDA 1H8VA 2AUYA 3DPRB 3WOGA 4X8NA 2PQQA 5KXBA 1XNKA 5J7MA 1DFQA 1Q8PA 5I0UA 3RS6A 4DINB 1QQBA 1PGW2 2YHJA 4XQWA 2XJUA 5CFCA 4QQOA 1WW7A 2XJ3A 4QU2A 3OYWA 4Q4Y1 2NPIA 4AQSA 5LEKA 3KD4A 3N3HA 4LA2A 1TQ5A 2YC0A 5CA6A 1NA1B 2DTWA 4RQPC 3JD72 4M3CE 4QPIB 3EQEA 1W6MA 2XJPA 3USUB 1XYPA 1YJKA 1JUHA 4B4QA 1RPEL 4MCXA 4Y4YA 1ZM1A 5F9TA 2ZGLA 3D8CA 2RR13 4XFHA 4GHJA 1D2SA 3KT1A 2BWCA 2GMMA 5FTTC 1LODA 2B9UA 2PUAA 3AP4A 3PVEA 4IEVA 1EYBA 1JHNA 2P17A 4FXGB 2IVBA 4QM8A 5CFDA 3MICA 4YG3A 4YW3A 4Z58A 1FAYA 5C6CA 1NQDA 5D8AA 3VZKA 1MS3A 1QHDA 1RUH3 1VBC2 2GC1A 1NYWA 3BALA 1H8TA 3AKPA 1CGPA 5D1IA 1C3HA 1O4XA 3WW2A 4YG7B 2A6YA 3IM0A 3O0VA 4RHV1 1RUC3 3WW4A 3NW4A 1UIJA 2ZMKA 1LTEA 2DCZA 2Y38A 2QVSB 5BV6A 4I6UA 2G9GA 3POSA 1LRHA 4IV3C 1PRVA 1SFYA 2XWBB 1AX1A 1AU7A 3LA7A 4X8PA 4EROA 5A32A 2XCJA 1DIWA 1U12A 3MW4A 2ERFA 2OIIA 1LOCA 3F6WA 1FPN1 4X4CA 1GYKA 2HWC2 2XUMA 1CJPA 1IZ3A 4FAGA 4B8EA 1QQP1 1YRZA 4YW1A 1N1VA 4QGNA 3VL9A 4IXLA 4QGLA 4Y20A 3JZVA 1YJLA 1VBE1 3OP9A 4XF3A 2ETEA 3QD6A 1AJKA 3DUIA 3VBRC 3MLKA 4Q29A 4TLFA 1SLAA 3GF6A 1Q8SA 1U5YA 1ZPQA 2D93A 1R083 3UKTA 2AR6A 1CX4A 3JD71 1ASJ1 1OLQA 5FO8B 4PU4C