2PUBA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pubA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pubA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pubA02
3TMYA 1M2FA 2FSPA 5D2CA 2GBPA 3H6GA 4WXEA 2FVYA 4RSMA 3KTOA 5CNKA 2WY2D 3DLBA 2AWIA 2FMIA 3RVLA 1KMIY 2AYZA 4I6TA 4J1WA 4MCTA 1JBEA 1JDNA 1VRVA 2Q5CA 5FWYB 2A6CA 3CECA 3HCWA 5CHYA 3HSYA 2M98A 1RZSA 4G0QA 4KQCA 3SCHA 5T3YA 4IWRA 2ICPA 3OQOA 2CHFA 4NCAA 3FFXA 4X4HA 2YHAA 1K68A 2VUHB 2R48A 2IKSA 3GL9A 2IVGA 3OLXA 2N9UA 4JB0A 2FQXA 2PAFA 4ZMRA 2MYPA 8ABPA 1EWVA 3JXBC 1P6QA 1B00A 1JYFA 4XARA 3S99A 3I42A 1E2BA 3QEMB 1UXDA 4KK4A 1YS7A 2KZ8A 1QP7A 3H5LA 4UHJA 2WRZA 3CU5A 3HXMA 5K98B 1BAPA 4Z5DA 3TB6A 1E6MA 4W5NA 3URMA 1LCDA 1ZN2A 1BDJA 3C3WA 4PU4C 3HDGA 4Y42A 3H5VA 4DQDA 3H75A 3QEKA 5EWLA 1PEYA 5KQPA 1USGA 4XLTA 5TQJA 3QQ6A 4QICA 1W9HA 4W5QA 2NZVG 3HUUA 1L5ZA 2CSFA 1QNLA 2L18A 3OM0A 1JLKA 1RNLA 3W9SA 3HEBA 2E4YA 1RPJA 2J48A 4LE1A 4I6RA 3NNDA 4XXHA 3QLUC 1Z26A 4RU1A 4ETNA 3GV0A 2LYQA 5JNVA 2QZJA 3QLUA 3C6QA 5F64A 1APBA 3MLFA 2FEKA 4MLCA 3LUFA 2JCGA 2GZUA 4Z9BA 5E3JA 5JS2A 4YG1A 2FMKA 2LUOA 2MQKA 3JY6A 3KS9A 4KZKA 3HK2A 2JVLA 3L49A 3H1EA 1R63A 4LE0A 2IU7A 2CROA 1A0OA 2IDMA 2P4UA 4HYEA 2F8TA 3BDNA 3JS5A 3N0RA 1M5UA 4OATA 3TO5A 1WETA 3RVJA 2R1JL 2IV1A 3JPWA 1KRXA 1LMB3 1R8JA 3G1WA 2DRIA 4CBVA 3CRNA 3LISA 2H3HA 4RKRA 2JVIA 1PHRA 3O2SB 4G86A 3MYYA 3FFWA 1XWWA 1EWKA 3QX8A 4FE4A 2PUBA 1SQ8A 1I3CA 1SXIA 1JWLA 1QP0A 4S05A 1NEQA 1YIOA 3QF3A 4J1XA 4Z5CA 2LYPA 1POUA 4MS1A 4ETMA 5KC9A 5TPWA 3KYJB 1YMVA 3G7DA 1A04A 1C0EA 1ZZ7A 4RK7A 2NZUG 2OENG 3JXDL 2RDMA 1MB3A 4IGAA 3B2NA 2IVQA 3QELA 1RXIA 2E4XA 3L6UA 5DGCA 3NHMA 1Z17A 4Z9AA 4ZYLA 2MSWA 1Z16A 4O1HA 3OMWA 5FWXA 2L2QA 1Z15A 1MAVA 4RZSA 5TPWB 2A9OA 3CZCA 4EYGA 1S7EA 1NY5A 3DLHA 3K9CA 4EGSA 1LQCA 4IVZA 3KSMA 1NXOA 4JOQA 2FXIA 3IP5A 5ABPA 1UDRA 4ML3A 5EWJA 6CHYA 3KCNA 3F6CA 2LCVA 1B0NA 3N53A 3KJXA 4RK1A 1NXPA 2GKGA 3E3MA 4D6XA 5FWXB 1EWTA 3KG2A 3H5OA 5KQLA 4Z4FA 4I8TA 3RH0A 1W25A 1JDPA 3KHTA 3O75A 3HZHA 1OXBB 5B3JC 2WJAA 1EFAA 2AXZA 5EWJB 4S04A 3IDOA 1DZ3A 3OMTA 4F3TA 4NCBA 3M9WA 1SXGA 2PL1A 4JASB 5B3JA 3LUAA 4B09A 2RJNA 1QMPA 5IC5A 5IX8A 3SCGA 2EF8A 4Z59A 3C97A 4RK0A 3N0XA 1CYEA 1E3OC 3LOPA 3RVSA 3LFTA 3GBPA 4Z0NA 3RVQA 1ZGGA 1TVMA 2LPMA 4Q6BA 3UK0A 5JNRA 1O4XA 2LYRA 2V0NA 1ZUGA 4Z58A 4YCSA 4N0QA 2E4ZA 3B7HA 3HJFA 2O38A 1QKKA 1ZY2A 3IPAA 4JB2A 4Z4GA 5FBHA 3CNBA 4KRFA 1BDHA 4P98A 2KEJA 4OB4A 1ZITA 3SNKA 4F06A 1QO0A 3FYMA 3OP9A 4Z99A 3T6KA 4XASA 3U3WA 3HV2A 3LUKA 1S8NA 2JBAA 4N0PA 1DBWA 3HS3A 5TQ0A 2XCJA 4YR7A 5BQ3A 9ABPA 3VNBA 1MB0A 2FLWA 3Q7TA 1E6LA 1JL3A 1GUDA 4MS3A 1OCTC 3SM9A 1MIHA 1A2OA 5HQJA 2JK1A 1AB6A 3F51A 2PLNA 1FFGA 3MM4A 4G0XA 1TMYA 1DW9A 1LK0A 5IUJC 5JS1A 3RQIA 4IF4A 5KQGA 2NT3A 2VK2A 1ABEA 4MS3B 3D8UA 4IRXA 3VK0A 4OTZA 4WT7A 1NTRA 5TQ2A 1RPEL 3C3MA 1AU7A 1CQTA 4YS6A 4XAQA 2BGGA 4MAAA 1NXSA 1NERA 1GLGA 1JX6A 2CHEA 1FFWA 3K4HA 2FN9A 4FE7A 1U0SY 2E4WA 3E61A 5TPZA 3RVMA 4EYOA 4F12A 3OQNA 2O20A 5KQMA 4PZ0A 4N03A 4KVFA 4MR8A 4P1ZA 2ID9A 5HM6A 1Z13A 1WH6A 1JH9A 3MQ4A 1OSLA 4Z4EA 1ISRA 3LFPA 4MS4A 4O1IA 3GRCA 4RK4A 4EYQA 5A7LA 1UTXA 1DCMA 4KFCA 1ZVVA 4F11A 1NXWA 4I6UA 4Z5HA 2O4AA 2QR3A 4MR8B 4TN5A 4WUTA 5CNJA 5IBQA 3SY8A 4Z4HA 4OLAA 4KREA 5EWLB 3N75A 4FN3A 3H6HA 4QYMA 4YBAA 4RWEA 2JVKA 3EDCA 3Q15C 4GHJA 2QW1A 3UKJA 4JCYA 3KYIB 1RZRA 2PUAA 4IMIB 4RY9A 4EVSA 3MIZA 3O21A 3MMNA 4HNQA 4RK5A 5KC8A 4IA8A 3PXPA 2KEIA 3QLTA 4TLLB 5C5CA 2IVBA 2IYNA 1PUXA 4NQRA 2BNMA 1JHZA 4YV7A 3LUGA 1JYEA 2WUSR 2H8RA 2CWDA 1URPA 3ILYA 1DRJA 1Z2EA 1JFSA 2L17A 3DGEC 2ZAYA 3CKMA 2R47A 4HNSA 4MQFA 4MQEA 4ZMSA 1FFSA 3SQNA 2RGYA 3CG0A 1AB5A 1TLFA 3R0JA 4RY8A 4EYKA 4PU3C 3HO1A 2HQBA 5DTEA 1PEAA 2FLKA 3FDFA 3KLNA 1UXCA 3IVPA 4RS3A 5HSGA 4JP1A 4NICA 1QQAA 4RV5A 4XFKA 3T95A 3GA5A 3F7NA 3RZZA 3TRBA 4X4DA 2E4VA 3CG4A 1E6KA 3GN5A 4MQFB 2CD7A 3SCFA 1PERL 4G0PA 4NV3A 4MLDA 1ABFA 3LUCA 4F8JA 4RKQA 4W5RA 3C3KA 1MVOA 2GI4A 2A9PA 2IOYA 2QVGA 1PRUA 4H60A 4MYRA 3EULA 4WZZA 3IP9A 2HJ9A 3QLVC 2MYUA 3ROFA 3G5GA 2P9HA 3GN5B 3O2JA 3QLVA 4H3HB 4LDZA 5IEBA 5DCLA 2L8NA 2R63A 4RXTA 1R69A 4MS1B 2PUFA 1LBIA 1NATA 2A9RA 2FJRA 4YARA 1L5YA 1ZZCA 2LYJA 1DP4A 3BREA 1X57A 2IPAB 3EUSA 1YTUA 3QELB 4PU7A 2IPLA 3CZ5A 3KLOA 1VLZA 3H1GA 5BR1A 2B5AA 5BRJA 3CROL 1EHCA 1JF8A 3I09A 1VKRA 3EAFA 4KPYA 4KK3A 1QP4A 3F73A 1YS6A 2JVJA 4WXMA 4MRMA 2LP4Y 3Q41A 2L49A 3LKBA 2X7XA 1RIOA 1LJUA 1QQBA 3F52A 3FMVA 2QXYA 2PPXA 1NXTA 2AXVA 2XJ3A 2PE5A 1DWKA 3BS3A 2VUIB 2BNNA 4LRQA 3UFDA 5DLEA 2PL9A 1LLIA 1RXEA 3ILHA 3DNVB 5HKOA 4YGXB 2FQWA 3T8YA 1EAYA 1PNTA 2AYXA 2FW0A 4MRMB 4OLBA 1L1MA 4G0MA 4LDAA 1D1PA 4TMYA 2M1ZA 3M6MD 4D6YA 1Y1LA 4MR7A 2KEKA 1D5WA 4N47A 2EBYA 2BJCA 3HDVA 3ROTA 1CEYA 3ZHIA 1QPZA 2TMYA 3F6WA 5KI6A 3VNAA 4OBBA 3GBFA 4Z4IA 3CLKA 3BRSA 1JFTA 4M88A 2B1JA 4X4BA 2FEPA 2R25B 3MF4A 4G0OA 2I6FA 2QVCA 4EVQA 1JFVA 1QO0D 4MR7B 2O49A 4WWHA 3O9XA 1U04A 4PU8A 4Z4CA 4GPAA 2HQOA 1Z12A 5JNUA 2RJOA 7ABPA 1ZZ8A 2ZWMA 3ZHMA 1XHEA 1SD5A 5I4CA 3OQMA 1ZS4A 3EJWA 5KWSA 3GYBA 1DJMA 3QX9A 3O1JC 2FTKE 2JBAB 5TQ0B 1D1QA 2PUCA 2LYLA 4JAVC 1ZZ6A 4RK6A 1ZH4A 2PKXA 2KPJA 1M2EA 1X2LA 1DC8A 2FQYA 5FWYA 3I5AA 2HINA 1TM2A 4Q7EA 1U2QA 2PIJA 1VPWA 1D4ZA 3OLZA 4G97A 1YK1A 3EODA 1F51E 2R4QA 1U8TA 4LE2A 1NXXA 1ZZ9A 3RVNA 4E7PA 2FMHA 5DKFA 3LMKA 3NNSA 3FMYA 5TPZD 5TQ2B 1PRVA 2FEWB 1Y9QA 2LYKA 1P6UA 4X4IA 4O8BA 3OLVA 4L4UA 3HVRA 3RVRA 2IPNA 3BBLA 3EQZA 4YO7A 5EWMA 3QEMA 2QU7A 5IUKC 2GX6A 4JCXA 4QPJC 1ADRA 4IILA 2JB9A 3N8IA 1BVHA 1YMUA 2GWRA 1YSEA 3HUTA 4EVRA 3CLCA 1LBHA 4X4FA 5EWMB 5T7BA 3Q7SA 4YG4A 3KXAA 2MSLA 3EQ2A 1GT0C 4KNYA 2XDYA 4MS4B 3D1NI 2QV0A 3LTEA 3MA0A 4YRZA 5CNIA 4G0ZA 4N41A 2D5VA 3CFYA 1RZRD 2PMCA 3D02A 3FFTA 3KKEA 4EUKA 1FSPA 2FN8A 3OM1A 1XHFA 3IP6A 2WIUB 1Z25A 1DC7A 1KRWA 2PUEA 1Y7YA 1ZPQA 3A3KA 4MPTA 4DN6A 3OLWA 3QWGA 3OO1A 3F6PA 3HZIB 5JNSA 3O2QB 4HNRA 3NNNA 1TJYA 5IULC 1DG9A 3CS3A 1HEYA 2JRLA 3HM9A 3R1FA 2FMFA 3GBVA 1C4WA 4MGEA 2GRMA 4PYRA 2BNOA 1GUBA 2L19A 2LBPA 3H5IA 3G85A 4PEVA 2WJWA 1YVUA 1BA2A 1SRRA 4MQEB 4RXMA 2PUDA 1WIZA 1K66A 1OXKB 4RDCA 4DADA 2PJUA 5TE9A 2F8SA 3JXCL 3IPCA 1M5TA 3JVDA 3O74A 3SG0A 3JPYA 1ZESA 2FKAA 2LYSA 4X4CA 3TD9A 1ZDMA 4YP9A 4EY3A 1LJLA 1NXVA 5C5EA 2WB4A 1PRAA 1DBPA 3OMXA 1H9CA 4QYWA 3EGCA 5CNMA 1PNRA 3FGZA 5PNTA 1IIBA 3M9XA 3QYXA 4RY0A 4E7OA 1DCKA 1USIA 3NHZA 3JVIA 2ID7A 2AW6A 2ICTA 1T34A 2MYTA 4GQMA 3BRQA 3N0WA 4MR9A 3O1HB 3RVKA 3T38A 2OFYA 1WH8A 1U2PA 1DRKA 3A0UA 2NUBA 3A0RB 3H5WA 5ED4A 3BD1A 2XSDC 2B4AA 3S8QA 4PE5B 5GQSA 4D74A 3QK7A 2MEZA 1DCFA 2YHBA 2LIVA 3CTPA 3GWGA 3I45A 3N6VA 3UUGA 3H5TA 4MR9B 1ISSA 2WWVD 3H1FA 3FYAA 1YK0A 3ZKCA 3A10A 2GRLA 2AUWA 1FQWA 4X4EA 1P8AA 4YG7B 3L1PA 1ZH2A 3DGFC 3GT7A 3OLYA 3KZ3A 4N76A 2HPHA 5BRAA 2KYRA 5JNTA 3CHYA 3LUJA 1F4VA 1ZGZA 1HF0A 2EWTA 2MSKA 1BDIA 3DZDA 4O5AA 4RXUA 4Y9TA 4W5TA 3O1IC 2W42A 3DBIA 6ABPA 3BILA 4FBIA 3JTEA 4W5OA 4PICA 3IP7A 3OO0A 4H3KB 1CJGA 1D2AA 4KMRA 3Q7RA 4KV7A 2MYNA 1ZAYA 4NDWA 1DBQA 2OQRA 3TX6A 4JA2A 3LKVA 2IPMA 2QSJA 4JQDA 2VYCA 1ZZBA 1CHNA 1USKA 4KQ9A 5IEJA 3NBMA 4LX8A 4LZLA 2WMYA 1Z18A 1P2FA 4ETIA 3RVPA 4YLEA 4L85A 1SXHA 1Z2DA 3LUHA 3RVOA 4ZJPA 1KGSA 4ZPJA 2OR1L 5JNWA 2HSGA 4X4GA 4IMJB 4Q6WA 1ZHHA 2XI8A 4G0YA 2PUGA 2XIUA 4F8DA 2A9QA 2HQRA 2IUOA 4TLMB 3P9YA 1XWRA 5FBKA 5IUNC 1J56A 1GCAA 4UHKA 4GNRA 4FB4A 3SAJA 1LCCA 1IC8A 2NT4A 2E4UA 3LUDA 1GCGA 2AXUA 4YWHA 3Q9SA 5GOTA 2H0AA 4OG2A 4MCXA
chains in the Genus database with same CATH superfamily
3MTJA 3QQPA 3A9VA 2NU8A 2AMLA 2WY2D 1EZ1A 3RVLA 5BR8B 1T5HX 1GO2A 2NO4A 3VR4H 4BLPA 4EL0A 1CZNA 3BZUA 2P27A 1L4NA 3ONEA 4RAQA 1O03A 5ERYA 3RRJA 4QJBA 4D25A 3D5EA 3SCHA 5JHGB 3K5IA 3HZOA 4OHWA 4QQKA 2J41A 3K8QA 4RY2A 5JCOC 3H2BA 5B3KA 1YT5A 4R9RA 4O2AB 4OQYA 1E9CA 4OHFA 1CY1A 1Q7GA 4DC0A 5LQJA 3O6VA 3CVOA 1QH8A 3UTDA 4EI7A 4JI7B 3QEMB 4LC1A 5CXXA 1JJ7A 2ZS8A 5FOVA 4OJNA 4BX8A 2Q1SA 2RC5A 1TUIA 1ESZA 3QKUA 2XTNA 4Z5DA 4NJMB 1Y34E 1QVRA 5GJCA 2UYHA 1SUSA 3N05A 3HE3A 3OQHA 4BXOB 2GZSA 1N2JA 2O8DB 3C1AA 4INAA 3H75A 3SOPA 1EFVB 1FX0B 2PXHA 3RF6A 3ZWBA 3G9QA 1C3EA 4CMHA 4QICA 1W9HA 1K5GA 3FTDA 4GMGA 4Z53A 2QAGA 3OJLA 2JEOA 3NWOA 4PX5A 1JHYA 3RV3A 4F5ZA 1XSEA 2Q4DA 1WHTA 3A3OA 4I6RA 2JJQA 1B6SA 1M6NA 1WHSA 2MHCA 4XXHA 2HUPA 2IIPA 1IQ0A 3OFNA 1VM6A 5JXHA 1I0ZA 2VH5R 4FMBB 3TBHA 1NLFA 2HYIC 3EF3A 2RAVA 4UUOA 1Y81A 1JE0A 3DL4A 4I4LA 4TTJA 2FMKA 2WWTA 3INRA 3RT7A 3YASA 5C8VA 1W581 1K92A 2F8TA 1A0OA 4HYEA 1H2ZA 4H18A 3LOUA 4Q0MA 5I51A 3N0RA 4JX9A 3AGPA 1TIKA 1JN0A 1O8BA 1OFVA 3CZQA 3VZRA 2RHMA 1P1FA 5FO1A 4F2HA 2B20A 2HYDA 3FPCA 3GJRA 1H66A 2JHPA 3RPEA 4ENVA 5BSKA 3KSBC 4MAFA 1ZJ6A 1MIOA 3IV9A 3E2IA 3KYCB 3UF0A 4DG5A 5HUQA 3HVUA 5ER6A 2NMVA 2QGNA 4P3YA 3LYLA 3NAZA 1GHTA 3EQ6A 3GJQA 1PHRA 3NTUA 6NULA 4ARUA 2DR0A 3D1JA 3W8DA 5EP1A 3TF5A 2Y4NA 4EABA 4HGRA 1C8VB 4RD6A 4FT2A 2DFPA 4ZALA 4L57A 4ZANA 3QF3A 4N18A 4RD1A 3DFZA 3OPYI 5KBYA 1YE5A 3ABQB 1KVSA 3E9NA 2FW9A 1NJ5A 2XCIA 5LWQA 1TE2A 2A5GA 1QUEA 2PKEA 4DQ0A 1VJGA 1WDMA 2A3NA 2Z5GA 1TAHA 1XAGA 3FSJX 3IQHX 3IO3A 5IC6A 2XXAB 2R6FA 2HI0A 2P35A 3TL6A 4UMEA 4AIIA 4O4HB 3W2GA 4PQFA 3C7AA 2FZKA 2VO1A 2G70A 5BSUA 2OKGA 1GR1A 1JFRA 1W4RA 1CUUA 3VNSA 4YEDA 5CFQA 2OZVA 2YV3A 1OBCA 2OORA 1OT3A 4YAKA 3L0SA 2AWOA 3FFBA 3REQA 2LCVA 2WU0A 4N8SA 3SX4A 3M1YA 2DT8A 5BMVF 1SKAA 1VL5A 2AH5A 2O6LA 3B1FA 4Q3BA 1HRDA 2FI1A 3W6OA 5CEFA 3TFLA 2I4LA 3GG9A 1ZFNA 2VJDA 4FHEA 5B3AA 1O0CA 3NXSA 1YQUA 4MV7A 2W8BB 4H7KA 5D3ZA 5JS7A 3MFQA 2VJNA 2I29A 4HLNA 3NRCA 2GZAA 1WLSA 2WIKA 2OAQ1 1GRRA 5K3AA 4M8SA 1MAAA 5HCIA 3KT8A 1Z63A 2X0DA 5D3QA 2IXBA 1H2FA 1VC2A 1VCIA 1NWCA 4R1TA 5B1DA 1AXEA 2EWVA 1N5JA 3EVEA 4C4XA 5TLSA 4MI6A 2VIIA 1M1NA 5L3ZA 3RJ5A 3H83A 4D4LA 2HAEA 5ISMA 1IM2A 1T25A 2ON6A 1EB8A 4NCKA 1YI0A 1ULBA 2B4QA 2QZ4A 3DHYA 4KDRA 3A9UA 5KYGA 4XFDA 3LDHA 4C3ZA 4ZT6A 3EZLA 2EZUA 1PQPA 5K01A 1IY0A 2PLAA 4GP6A 1QF9A 1Z45A 2FSFA 5C80A 5TQ0A 1Q6ZA 1N9KA 4OH7A 1QE5A 1N1MA 2Q6OA 1WUKS 1BW9A 1GUDA 3QJ5A 3L2OB 1WRBA 2ZCUA 3NAGA 1T8UA 2I7CA 3DR5A 5BQFA 4LBYA 5HQJA 1JR2A 5DISB 5EE5B 3PFWO 1A9PA 1B74A 1N2GA 1B93A 3CRZA 1K27A 1TFUA 3ABOB 3WAKA 1NG9A 1Z5ZA 2EKLA 4GGOA 1WR8A 2GTHA 5FFFA 3K9BA 4DIEA 4L5CA 2AZMA 2LKDA 5EE1A 4WT7A 1VHDA 4TX1A 5EJ2A 1L7OA 5K8LA 1KORA 2ZJ0A 2LVBA 5JSKA 2BTQB 1Q77A 3IX7A 4V3BA 4XB2A 3ZV4A 1HO3A 3E61A 3KTDA 2FQ1A 4RMNA 2PMEA 4C03A 3AI7A 1HOTA 1M2HA 1XCMA 3IUPA 3K05A 4KACA 2YJ6A 4TLBA 2ZDGA 5CFMA 2RAUA 5AUNB 3RC8A 3B7GA 5ALPA 5DNUA 1CZHA 3OTGA 5CCEA 1D6SA 2X76A 3QX3A 2DM6A 2IQ5A 2VJYA 2BOVA 3I6ZA 3UK2A 1U0GA 3TW4A 5K0BA 2R7LA 1GILA 2ZETA 1XD2A 2QORA 3D7MA 2PUVA 3GRCA 4MYTA 1CJCA 4UCXA 2Q9CA 2OESA 4YCBA 3RQSA 4CWAA 4F11A 1HUQA 1I6WA 1Z0FA 1V7CA 2QR3A 3FVRA 1KSHA 4MR8B 3AFIA 2Q0HA 1MNAA 2ACVA 2G5GX 4TVOA 2GNOA 2C4KA 2PVPA 2X5OA 4GFDA 4RJ2A 4YUVA 4OV6B 4FN3A 2NXWA 3WLTA 1ZCBA 1DAMA 2VZ0A 5JSFA 2NYRA 2QW1A 4JCYA 1FU8A 1NQ5A 3EW7A 4QBTA 4BEJA 3AVYA 1SKUA 3AU8A 4A8PA 1Y7TA 3HC7A 3HVKA 3N2NA 2DKNA 2GN1A 3K1ZA 4L0QA 2VHJA 2JFFA 3UMJA 3VNVA 1C9KA 2BMWA 1DJLA 2HFKA 4EL5A 1DRJA 4GBED 2ZAYA 4FXOA 2JFOA 3LK6A 4ZMSA 2RGYA 3CG0A 2GJ9A 3KPVA 4CF5A 3X2FA 2P9YA 4F9GA 1K0FA 1IOWA 1C4KA 1MC1A 3PNQA 1GN8A 4F4HA 4F86A 1RP1A 1PEKE 1Z4JA 2A0WA 2AVDA 1A8QA 5CK4A 3SCFA 3LT0A 1PNQA 2XJ9A 1SHLA 4BKOA 2JGEA 3NBKA 2DPHA 2H4HA 3GUYA 1NFRA 1VE9A 2QVGA 3PC6A 4KGZA 4Q9NA 2QUAA 3EULA 3O94A 2YTZA 3T1VA 4BL5A 1NYQA 1Q5PA 1UFQA 4KH0A 4NJEA 4NNOA 5TEVA 3WHPA 3DBRB 3CVWA 1J39A 4L3OA 5ALKA 3H2KA 1HE1C 1DKNA 1OXUA 2A9FA 3GJSA 3FNQA 3E4DA 3HDTA 4D8UA 3U4CA 3HZRA 5HKBA 2C4MA 2PUFA 4OGKA 2PXKA 1Y0BA 1SCIA 3UC9A 2Q1WA 3TOXA 2J5XA 3BREA 3UMYA 1AD2A 2H4JA 3G88A 4ITUA 3PC4A 3D59A 4F2DA 2EW8A 4QNMA 1EK0A 2ZKLA 4IGFA 1VRWA 2CLFB 2Q62A 4MLPA 3RWBA 2VJMB 3AP3A 3M82A 3H1GA 3GUVA 1P19A 5ILQA 2FR1A 2FZ4A 1ZUIA 3QBVA 5EP4A 2Z6AA 4AULA 1FP2A 3DBVO 3PFCA 1YS6A 2C5SA 5ALNA 5ECWA 3SZOA 1DKOA 3V97A 4XEHA 4WBNB 3WA7A 3IE1A 4O3MA 2ZKIA 3KQYA 2ZJYA 3DMTC 4JLDA 4QGFA 5AVSA 2ZBUA 4ZV7A 1MEEA 2Z2JA 3GEDA 1ZGCA 2O8CB 4DM3A 2IQIA 2XZLA 4RA9A 4AW9A 3Q6IA 1NUTA 2BNNA 3KVVA 5G2OA 1QCYA 3T54A 2CV0A 5JAUA 1NE2A 4TV9A 3I61A 1OH7A 1CHDA 4YGXB 3WGZA 1X8KA 3C41J 4I8IA 1T29A 3S44A 1XQYA 1UPUA 1A9XA 4RNCA 3QHPA 5AKZA 4HDNA 2CLOB 1UR5A 1GKLA 4GM0A 4JQOA 1SKMA 2A2ZA 4HC4A 1SBHA 3OLCX 3IQIX 4Y0VA 1AMNA 3HDVA 4WGGA 3ZHIA 2NM0A 2XXPA 5KYYB 4PHHA 4OBBA 4YGYA 1NMSA 1NNEA 1XMVA 2ZSHA 1A8IA 3DHEA 1XLTC 3WSWA 1JFTA 2ZRMA 3UY4A 5BQXA 5C8ZA 2FEPA 1OWPA 1DHRA 4FJ1A 3ZCQA 2HBZA 4DJ5X 1UBRS 1O87A 4YJFB 4NG5A 3WB2A 4CG3A 1IBLB 2DG2A 4RFLA 2HIHA 2G6BA 2RGDA 2CKDA 4Q9KA 4D02A 5CB4A 3PKZA 3Q4GA 3EA5A 2X1MA 4XR9A 4QFMA 1U0RA 2VPQA 1YZHA 4CUKA 2FRXA 4MWZA 5IMBA 3T5TA 4QU0A 4R16A 2PUCA 1E2GA 1QGUB 3GRAA 1T6BY 3I6BA 2Q9BA 3LGSA 4S3MA 5D3MA 2C9MA 1FRFS 1M2EA 4FFBB 2Z98A 3WK6A 4GLLA 3ZGVA 1VZ2A 2A1UB 1J2EA 5AK0A 1NI3A 2QN9A 3KUDA 1PLLA 1YZGA 2B99A 1UJ5A 2BWJA 4A1OA 2C4UA 4YMSA 2Y93A 1BFKA 2R4QA 3EHEA 3IBGA 1FFCA 4PAWA 5BYKA 1X1EA 1OE0A 4PG5A 4R3WA 1P4SA 4Y6SA 4BWFB 3O4VA 5E2AA 2IOQA 3QWFA 3D4PA 4FEEA 5BT8A 4DYDA 4C01A 4HLDA 1PRVA 4IQ8A 2CEKA 4FTWA 1M1XB 2NUAB 3S29A 2DGDA 2OO5C 1J25A 4AVYA 3HN6A 3K5WA 4Q3DA 3PHBE 1H1TA 2Y9MB 2PMDA 3PQ2A 2GX6A 2PL5A 3WKBA 3QU7A 1JR3A 5IFLA 2WG1A 2RI1A 4R1NA 3R6TA 4UKDA 4KXVA 4EVRA 1HBJA 4C7XA 4LXUA 4XW2A 3CLCA 5K3BA 5JANA 1CRPA 5AW9A 3GEPA 1UXOA 3JYPA 4B3CA 1NJGA 5AFSA 4JX8A 2CVPA 2ECOA 1MH9A 1UODA 3D1NI 1E20A 4JROA 5EZ5A 1YTLA 4X20B 2Q3BA 1QTQA 5ITSA 3KKEA 5EJ6A 4D3SA 3OM1A 3QVGB 2TYSB 2VA9A 4P4NA 1Y3FE 5H9WA 1VYVA 2AKYA 2OCPA 3FUCA 2PUEA 2UXCB 3S8EA 4AO8A 4YLGA 3VR5A 3N87A 3NORA 2V4UA 3KFLA 3OLWA 1E89A 1PS8A 2YMMA 3UXYA 4FUQA 4Y2PA 5IULC 5D3KA 2PWBA 2TSYB 3OFSA 2SECE 2ZB4A 5TDHA 3DXYA 4FEAA 4E30A 1KSJA 4BVFA 5LQUA 3W6UA 3QBTA 2R8PA 4MGEA 1IUKA 3EAQA 5TQVA 4K0RA 1X1RA 1IG3A 5H3CA 2ZT7A 3QF4A 3ZQ6A 5C7IO 5C9ZA 2YDYA 2BFBA 2ZZKA 3FBGA 3GGSA 1J7JA 2CHGA 4RFVA 1TW2A 4AYXA 4ZEVA 4CEJB 2A3RA 3JW8A 2JEYA 1ZESA 4N39A 2LYSA 3FE2A 4ZOEA 2E55A 2DUUA 3R5JA 3IE2A 3LZCA 4UU1A 3SICE 1ZI8A 3VZSA 3SOZA 3U7FB 3PYLA 2HMTA 1ILWA 3PWZA 1IIBA 4MHOA 5GGXA 3SKXA 4EIWA 1T2NA 4GZLA 5KDOA 1MD9A 1IHYA 3BRQA 1V0JA 3PPVA 1Z5OA 4TVBA 1FP4A 3WLQA 5JOQA 4NFSA 2KBEA 4N7BA 4TUYB 3AU9A 1ST2A 3WR5A 3NC1C 3E7DA 1SXJB 1R9NA 1I7QB 1KMQA 1LXCA 1Z5NA 2QJOA 4PYMA 3WVNA 4D5GA 3SHTA 4II2A 5JYBA 3GP8A 3GUCA 4PY2A 4DBVO 3S5UA 4KP7A 4D98A 1ISSA 1SN7A 1Z29A 3O4JA 4FSHA 5LPNA 4QM6A 2GBGA 3OJFA 1JRLA 1TYZA 1ZH2A 3OBBA 3NDJA 4DDHA 1EP9A 2P6RA 2HJVA 2PX2A 5T8KC 1FSSA 5GONF 2IUFA 1IONA 2A8YA 3FOCA 1TKAA 3P9IA 4HR7A 4IQFA 4IWXA 5E2IA 1GYRA 3ZV6A 1JXOA 4HX2A 3O1IC 1GSHA 2B2NA 1MAHA 2C3UA 4RLSA 2IYTA 2OBMA 3V48A 1YQEA 1CF4A 3TLYA 1J24A 3ONVA 3OZTA 5EC8A 2PS0A 5SV2A 1M2VB 3FHLA 2QM3A 2X0KA 4KMRA 4NBSA 2Q7OE 1SKBA 1ZAYA 1DBQA 1W75A 2PSFA 2ZPTX 4R5MA 3AIKA 2HMWA 5T4BA 4AXXA 4OK5A 4RW0A 1Y5LA 4JKOA 3E58A 3I2YX 3VVLA 3FMPB 4XDHA 3GRUA 1LRLA 2NOAA 4PXAA 3N58A 3HV0A 2NPFA 3RIMA 4CM3A 2K7ZA 2A92A 3OFJA 5C46F 1CUWA 1CXZA 3LHKA 4Q1DA 1AS3A 4R7ZA 4PSUA 1S4MA 2IHYA 3F96A 2Q6VA 3LUHA 4M55A 4B31A 4TOIA 4LJ4A 2QP9X 1EEXB 4YRFA 3CJRA 2MXDA 2CJXA 1SQ0A 2CXNA 3DAPA 3EYAA 4ZT5A 3FRHA 4JGGA 2QTHA 3WZ2A 1QXSA 5KYNA 4EZIA 1R5BA 1YH3A 1H3FA 3IPRA 4DDVA 1CUVA 2CD9A 3E48A 4TWZA 1XWRA 1K7SN 1V4BA 1J56A 2Q99A 3DTVD 2XIQA 4KAAA 4N4AA 2J9FB 1LSJA 4OQ4A 1RE0A 1X1SA 3FLMA 2AC4A 3I1FA 3NHFA 1HTBA 5DP1A 4E5NA 2GGSA 4XOIA 5TGTA 3TS1A 2AXUA 3WDLA 1IY9A 4HAIA 2DFLA 4G0NA 4M38A 1LFDB 3ISTA 3Q9SA 4BBZA 1D07A 3GLIB 4MCXA 1Y9ZA 2AJ8A 5A4JA 4YQZA 4A8TA 2AOXA 4FDUA 2GBPA 1RLMA 4B3HA 4WAUA 1Y7LA 5EGNA 1CR2A 4MYCA 3KJQA 3IP3A 2MSCB 1FMTA 1YZLA 1KQPA 3GEBA 3ITKA 2W11A 4IW3B 2IDJA 3TZEA 4MCTA 1S4QA 1SBCA 3OY7A 3Q85A 4IJWA 4M2LA 5CX1A 3W6PA 5B3LA 4CKWA 4B3IA 3DVQX 1LS1A 5T3YA 3WNQA 2NU8B 3GAZA 1CY7A 2IGTA 4C4RA 5KZMB 4PX3A 4FMPA 4ZOLF 2YV1A 3GL9A 2WJ3A 3L93A 2WP8J 3MOSA 4RJJA 3ICQB 1U8CB 4E21A 4LNHA 2GEJA 3LH5A 4EA6A 3MAAC 2FNAA 4GMFA 3Q9NA 1EB9A 1YDWA 2GXUA 3K9QO 2A1IA 2VSXA 4FVTA 4TT8A 4DA7A 1F17A 1E2BA 2M32A 1O54A 2JA2A 1E32A 4GQAA 3WHLA 3AKZA 1T4CB 4BJ6A 2LLVA 3WAGA 2WRZA 3V4OA 5AVVA 4WECA 1IVSA 2H08A 5JZ9A 2OGWA 2XVMA 3URMA 1YU6A 3OD5A 2M6KA 2GVDC 5DEIA 2H51A 5J2TA 2P1ZA 4NESA 2O2ZA 2JL1A 3PUJA 1USGA 4OYHA 4UNIA 1SBTA 4DR7B 2IUYA 2QAIA 3H5NA 2O2EA 4RZQA 2XD4A 4FEGA 5BSMA 1VHWA 2CYAA 2DVMA 5BRNA 3VDNB 4FX2A 1TZMA 2X3FA 5DGXA 3UMMA 3W5AA 1AC5A 3C24A 1PZEA 4HAVA 1Y8AA 1RLOA 5EHNA 3KOWA 3FUWA 5A5GA 5C3MA 5LA6A 3VZPA 2QX4A 3C16C 1IMJA 3KAKA 3LIPA 1GWNA 1A4UA 1W52X 4KVZA 5F78A 5I5GA 5KSPA 1KMCA 1GKYA 2PBFA 2QSUA 3RS4A 1CQPA 1Q7EA 1NPDA 2DH5A 5G4KA 3SHWA 2JCGA 1G98A 3O92A 1F2VA 4YG1A 1KVRA 4JLVA 5BMOA 3PGMA 1WHTB 4GXRA 4HPXB 2MSDB 4LE0A 4O4LB 2OE2A 5JO9A 4OQDA 1WHSB 1JG6A 1WB4A 2IUTA 3AH8A 1GR0A 4AWAA 4BLUA 1BKYA 1KO4A 1AKYA 2OBYA 1E3TA 1S3IA 3A04A 3RJ9A 3JPWA 1Q0PA 2YVQA 4MRNA 5AIBA 2RONA 1EUYA 1P81A 2JAUA 4C4AA 2ZK7A 1DBSA 1U0HC 5CM8B 3C70A 5DN6D 1GTZA 1TYDE 3FPBA 3G8DA 3GJ5A 1XCBA 3NTRA 4HLUA 4RIHA 3VKWA 3Q8WA 1ZKDA 3OPYB 2GASA 3FWHA 4PVCA 3WQQA 4P0QB 1JEDA 1QP0A 2HU2A 3KB2A 2HREA 1KU6A 3TW6A 1SFRA 2VDOB 3NHSA 2EW2A 4FGSA 3WL3A 1FUIA 1JLRA 3LC7O 5L3SB 1ZW1A 1RRPA 2AQIA 2NZUG 2OENG 3OMLA 3QMWA 3RC3A 4AZSA 4L0DA 2WV9A 4CUZA 2RCNA 5BYJA 1Q22A 3MTGA 4ESVA 1NJ8A 1QAMA 3KSZO 4PSVA 4Z9AA 5JO0A 5G3YA 4MQBA 3RRZA 4XTRA 5FWXA 3WOVA 4I4IA 2DFNA 1YA4A 2C2MA 4FNGA 3HU2A 4YAUA 4J0QA 1IULA 3TPZA 4PZCA 4RELA 1ULZA 1RCUA 1UIMA 1X7XB 2IYSA 4B40A 1NVEA 4ZZ1A 5H81A 1KS9A 4I8XA 3WZLA 4EA8A 3JQAA 1RABA 4Y2XA 1RRCA 3GRPA 2YV4A 1RQXA 3JQAD 3WFZA 3S5JA 1NA5A 3PXCX 2GARA 4NKRA 4BFXA 1LW7A 1XPRA 2WJAA 3CSDA 4GPTA 1HQYE 3KQWA 5AWFC 1RXUA 5HS4A 2HX1A 4NU8X 2Q8QA 2N75A 4QYIB 1N75A 3M33A 1GCUA 4DWVA 1CZKA 4PC1A 2RGNA 3LK7A 4WL0A 2C03A 1FP1D 1TJ4A 2P11A 4CIWA 1KVQA 1TVMA 4L8FA 1O4XA 1OBFO 3AMVA 3RLIA 2X1HA 4A82A 4HP8A 3AVWA 1NR5A 1SHTX 2I5PO 3B7HA 2YXLA 5K8CA 4G5RA 4AX8A 3ED5A 5BW5A 1FC0A 2C42A 3DZKA 3ZU5A 4BMDA 4ZYYA 1BDHA 1XQ6A 4ZDIA 3FCAA 2C2YA 3H19A 3PA8A 2XITA 2C96A 3JD1A 3TE6A 3QG5A 4LJ7A 4TMXA 4LMAA 4UTXA 4F06A 5CXQA 1XKLA 2V7WA 4NHOA 4BC0A 2X4GA 2VCYA 3LUKA 4WZAA 3R0QA 1HQ1A 3WX0A 4WLFA 3VOSA 3THWB 3Q7TA 3QE4A 4I55A 3SJ7A 1BYUA 3NHPA 3P4XA 3SM9A 5TVKA 4CFYA 5AKHA 1MIHA 3B38A 3Q10A 1V45E 4BN5A 1FVFA 1QKIA 1P0IA 3OM8A 1GPYA 1AM4D 1FFGA 2E0IA 2PBLA 1COWA 4G0XA 4WKNA 5I9SA 1LK0A 2G06A 4IO0A 3K1TA 4M86A 1B2LA 4XX0B 4C4TA 5LP1A 3KJHA 5JS1A 4JGBA 1GSAA 4KMOA 3L1VA 5AM2A 3UJBA 1NP7A 2H1VA 3PS9A 2V5VA 1F38A 3R0IA 4QHSA 3ZWXA 3VJLA 4L22A 1Z8FA 4EFNA 2BF7A 3ASZA 1P80A 2CHEA 1FFWA 1KGDA 3GNQA 1DAOA 5T6BA 3K4HA 1UAYA 4A2QA 5B5SA 1ZMOA 3JARB 5DFAA 3T7DA 1I7SB 1NMYA 2PSEA 1U65A 2XZDA 4IZHA 3P97A 1MHTA 3RVBA 2AMFA 5JHHB 5DWDA 3GA7A 4N03A 3TEFA 4AMBA 1QH1B 4DC9A 3RSLA 3BXPA 1NRXA 4XB1A 5BNIA 5GJVC 2JGLA 1NNI1 2ODQA 3GYGA 3QMPA 4L4SA 3WQRA 1ISRA 3BQMB 4MDYA 1KMNA 4RK4A 1M1UA 1ECPA 3NROA 1QFJA 2B1RA 4IZ6A 1NM5A 1WMBA 1FRQA 2QVXX 3I39X 3QFSA 3CJQA 3SF8A 5L53A 3RARA 1IB6A 3IQEA 5CLFA 1JQJC 4EW6A 2G09A 3N5CA 2BEWA 3B6ZA 1QIFA 3H1AA 1U8FO 2JIPA 3N75A 4OHBA 4PLHA 4RWEA 4S1PA 2B61A 4YRBA 4YUXA 2VYVD 3DMHA 2GCGA 1HYHA 3U81A 3W7AA 1XR3A 1XD2B 1UEIA 5DYYA 5FWDA 4P2GA 2VHZA 4D4IA 1QYWA 1V6CA 3RWMB 2WUSR 1BE6A 1IL0A 1TM5E 1TM4E 4HEHA 4PX2A 4NH0A 1NQVA 4NARA 4RMGA 4KE8A 2BKXA 1BSVA 3T9EA 3CGGA 3IALA 1JVSA 1FSGA 3U13A 1X42A 1NOKA 3RFVA 4AJHA 1AH2A 1E1CA 1RM0A 1T9ZA 3JSAA 4KIJA 1EUDB 2AE1A 4EKNB 1ZNXA 1FJHA 4MV4A 4EQ6A 2IYRA 4YROA 1JQAA 3KQNA 4P80A 1LVGA 1T2CA 1NKTA 1YACA 2Q45A 3LOQA 1W0JA 4L95C 4RV5A 3O8RA 4RF5A 4NOJA 2CD7A 2QVYX 1XNQB 4A6DA 4MLDA 3HJTA 1CERA 3V4RA 1YJ8A 3PHHA 4TVKA 2HDNB 3NHWA 4MMYB 1JDSA 5KMGA 4J1TA 4R1OA 3V4LA 1PT5A 4M9XA 3L8CA 2CL0X 3TSWA 5JJKA 3L8HA 1EU1A 4P3XA 1RJ9A 3R3VA 3KQLA 2XB2A 4MS1B 3ZDYB 3KAPA 2ZJ4A 3ZX4A 2OORC 4FDAA 1AS0A 1JMKC 1X80A 2O6HA 3C3AA 5E8JA 1QMGA 1DP4A 2O5EA 1Y8ZA 5DGIA 2O57A 1G7SA 2VYND 1Q2UA 1XIVA 3D54D 1EXNA 3HVIA 2AOUB 4I1RA 1GQOA 3E3AA 5CT9A 3VZQA 2O59A 4KPYA 3MTBA 3OZGA 2FMUA 3EDYA 3NEJA 1TK2A 2TECE 4ATNA 5F4BA 1HE5A 3FUXA 3RRMA 1TFRA 1L2TA 1TYCA 4HDRA 2R7NA 4S1TA 1P2VA 4JB8A 5A7HA 1KP3A 1G21E 3H3JA 2FSHA 2Z95A 3ESRA 5AM4A 1Z0SA 1P1JA 4XTCS 3RKUA 1DTEA 2NYUA 1CDOA 2Z0MA 2A5YB 3BGIA 1GPBA 2KQUA 3X2SA 3RC7A 4AM8A 5DI3A 2Z9BA 2D74A 4PBTA 1XUOA 5LMUB 4RA9B 2EJWA 1KA9H 4LQ4A 1J90A 4N6GA 4K9MA 3ROTA 1RYDA 2TMYA 4TV9B 2CLLB 1YOVB 3QPAA 4GH5A 1V3UA 1E64A 1M67A 4P3NA 1ABBA 3PP8A 4WZBA 4M88A 3IOMA 5BUCA 1F7VA 1K4KA 1AF4A 3GWZA 2NZ8A 2I6FA 2H85A 2CMHA 2VF4X 5EN4A 5A4MS 4GI5A 4NABA 1H23A 4KYIB 4MGHA 1U04A 1U1CA 1W96A 3PPIA 4FGLA 1JDUA 2KS6A 4CM8B 4DCUA 4YAFA 4J94A 2NQ2C 1ZZ8A 2ZWMA 5JD5A 3H1PA 5IBRA 1SD5A 1QFZA 3KVOA 4DABA 4U3JA 3LJKA 4EY5A 1NP6A 4FR2A 1QRUA 4LOJA 3GLRA 2V0CA 3TTVA 4QPCA 2DLNA 2CUKA 2FTKE 2YYAA 2ZXFA 3AOGA 3HA2A 4YJGA 1GSOA 3T9CA 5CAEA 1ZH4A 1YVDA 1AKQA 3OI7A 3PD0A 3GU3A 5CB4B 1L5LA 2IOFA 4DR1B 3LXXA 1QRSA 3SZLA 2VF8A 2ZI3A 3UA3A 1K6MA 1U2QA 2QT9A 3U2QA 3DA8A 1VLVA 3VOTA 1D2EA 3DE4X 2GA9A 3A6JA 4LE2A 4HV4A 4GZ6A 4YUWA 3TVDA 1DINA 3RVNA 5D3MB 2YWEA 1A69A 2R7AA 3O8CA 4HUJA 4D57A 1AKUA 1T13A 2CLIB 3KE9A 3TRDA 2LYKA 1RXCA 4O8BA 1FS4A 2G4VA 2IPNA 4EDFA 2IHBA 3DDUA 5JFOA 1NGSA 3M0EA 2GLXA 1XRJA 5BNTA 4CNQA 4XQGA 1ADRA 4G5SA 5DVZA 2JB9A 4D45A 1KZGB 4MUYA 1G5QA 4Q3EA 2D2XA 5AYVA 3BIXA 1LSSA 2D8AA 3B51X 3IGFA 1HX7A 3SBDA 4MLZA 2JGMA 1XZFA 1E9VA 3RCBA 3RFUA 4TROA 1KDPA 3KJNA 1ODIA 4YP5A 4P93A 1TZJA 3MA0A 1ULHA 1T24A 1WXEA 2XKBA 3FETA 5CNIA 4N41A 3JD2A 2O1SA 2FW8A 2GPNA 1DB3A 1JZQA 3JATB 4J3JA 5HIIA 2N1BA 1Z25A 3LCRA 2F8MA 3D2LA 3OWHA 4QUJA 4X84A 1IAVA 1T3LA 1Z9BA 3K1AA 1GD1O 2PQ2A 3CUKA 1Y7YA 3HG7A 1L4YA 1XU9A 3A3KA 2GR9A 4Q4JA 5K3FB 4K9NA 3VISA 1E0DA 1HR0B 2X0FA 1G20A 2PZAA 4FZRA 3KD2A 5J1SB 1TM1E 2JJYA 3CIFA 1UJ6A 1O6ZA 3NNNA 4JU9A 5G0SA 4J9VA 4B6QA 3R1FA 2D7CA 4B3MB 2AFIA 4I4NA 4LHYA 4RHXA 3ZS8A 1DTSA 5DYIA 2HXYA 2J3LA 4B85A 1ONBA 2RSLA 3Q7QA 4OMDA 3KSUA 3RASA 3PPYA 3VYRB 3TRKA 5AW8A 3NAQA 2HIAA 2YFQA 3FPLA 4K2AA 3O74A 3DE6X 4NNPA 4NZZA 3X1XA 2C99A 4B8ZA 1VFNA 4US0R 3MRVA 1BE0A 3I5XA 4IJMA 3FYCA 4XRGA 2FSVA 1G9XA 1GCOA 2VQEB 1PRYA 3QF4B 1EDDA 5AUQA 3K9GA 3SX2A 4A8JA 3LPNA 3MT7A 5A4IS 3UT6A 2DUMA 3NHZA 2XT0A 1N2HA 1AXRA 1T34A 1XDGA 1ZH6A 2I55A 2ORED 3EASA 5HMMA 4TS1A 3TEJA 1PG2A 1UINA 1PYDA 2ZRCA 3HJBA 4OH1A 5FA6A 3HNOA 2I22A 2P67A 4EY4A 4G1EB 4UULA 3UB4A 2AC7A 3DE3X 3UO8B 3VC3A 4ENPA 2WDZA 5ED4A 1M75A 1UP4A 2PLRA 3MELA 1DCFA 3TECE 1PR2A 4MVJM 3ECCA 1QF6A 3BK2A 3QXGA 2CXTA 4NDNE 1FP4B 2ODEA 4V0KA 5JY6A 5LQRA 2UZ4A 4DHEA 1R0YA 2J3KA 3MCAA 1D6NA 3C8ZA 4R3NA 3AILA 1MQAA 5I7EA 1DAHA 2OV1A 4MDEA 2QPTA 1E9AA 1XVAA 4MKGA 3VPBA 5CH3A 3R7WA 5A3JA 1QH9A 3M70A 3R7AA 3K4QA 5FO0A 2X9LA 3D0KA 4RXUA 4O5AA 4AY3A 3TQTA 4M0PA 3AKYA 4EPRA 4MARA 2WJ6A 2WP0A 1Q3KA 4E32A 4PFSA 1VLLA 4MUXA 2G0NA 3V7NA 2P2ZA 4KV7A 3L6RA 4YT2A 3Q7RA 3QBEA 2OQRA 4QFCA 5DK6A 4YPVA 1J2YA 2GESA 3LKVA 4CTMA 3UXMA 4BB5A 3D7KA 4RLHA 4LYJA 1NF8A 1HETA 4WEQA 2DBQA 2QG4A 1ZZBA 3GLFB 3ZOZA 1DL5A 3LRXA 4LZLA 1Z18A 4C0AC 3FTCA 3H3FA 1T35A 3IKLA 4RTJA 1C4OA 2WJHA 3B1JA 3WB9A 3HBNA 3GC6A 1KYXA 2ZWIA 3FI0A 1DRWA 2WKRA 1RIIA 2C57A 3G0IA 4OLJA 1Z4MA 6Q21A 3A6PC 2PWZA 3PBKA 2I4TA 1DWUA 1F9EA 4AMYA 1P2UA 4TKVA 2XIUA 1Y7IA 1W59A 3QW4B 4G1VA 5H68A 2GCIA 4D4KA 5B4UA 4UHKA 1M8PA 1H5NA 1GUYA 3DKPA 5FDFA 2IU3A 1JU4A 1KJQA 2ATCA 3CUWA 4XWTA 3RW9A 1LGYA 2VEDA 5A5EA 1I2BA 2HF7A 2NZXA 3Q2KA 4H3VA 4YNBA 2GSDA 2H16A 1VKRA 4MQLA 5HK8A 3RSSA 4DXDA 3VPGA 1X7WA 2E87A 3A32A 2D6FA 3H6GA 1K9VF 1LF0A 4RSMA 5FNVF 3MWJA 3T0GA 3DLBA 1N9GA 4XB6B 2ZIVB 3U9LA 1D9ZA 5FI5A 2GD6A 3ZI4A 2DAPA 4CG0A 1U7ZA 3BC1A 5AVWA 1E6EA 1RZSA 4HQOA 3FJOA 3V1UA 4BWYA 2QLNA 3HP1A 4J49A 2IPXA 1K6IA 1U3WA 3AF5A 3DQQA 3HM2A 2O8FB 7MHTA 1A71A 2CXRA 1G3QA 4WLNA 4MVJF 1YDMA 3OLXA 2ZUFA 1L1RA 1YQXA 1E2KA 2PAFA 4IH4A 5FOQA 5CX1B 4FBLA 3D3QA 1L5FA 2Y1WA 3MSCA 4Y30A 2VUSA 4XDGA 4HYYA 1AGYA 5EPUA 4A36A 3OOJA 3H5LA 2W6JA 1XTQA 3KQKA 4EKDA 5K98B 5AMXA 1BGVA 1P7VA 2QXUA 2L0XA 2W6JD 4QXMA 1ZX1A 2W0SA 3TPCA 1Y3CE 4R7TA 4PU4C 1QQ6A 3COWA 2VNJA 5MN5A 1KARA 1I5RA 3DEJA 3X1KA 2HRZA 1F1JA 4JR2A 4B33A 1P29A 3KWJA 2EERA 3N6RA 1C1YA 5GP1A 3L7LA 3PIDA 4XVUA 5CFPA 1T36A 4QL3A 2QRZA 4PQRA 2C29D 5HFNA 1QVAA 5J2TB 3IVMA 1XGKA 3GV0A 1H2RS 3CEJA 5U4QA 3KE8A 4MZDA 2J4CA 1APBA 2FEKA 2BFAA 3Q1LA 4MWGA 4UARA 5I8WA 1XWFA 3DE7X 1D0SA 2A94A 5HJ2A 5SZHB 2NTJA 1AU9A 1XE3A 2ZE7A 4E51A 3TR5A 3TXYA 4RJTA 3PUKA 1UANA 1SCUA 5JFGA 3GRRA 1NY6A 4GPZA 3SN6A 3AEQB 4HVTA 1NMXA 4P82A 5AOAA 2GYYA 2P3LA 2Q8NA 1V9LA 2CXXA 2YC4C 3EZFA 3K9HA 4J90A 3S2FA 4B7CA 1FTQA 4XRRA 5G4KB 4GZMA 4QO7A 3NBYC 2DBRA 1PTJA 1KI2A 1OAAA 2ZB7A 4PG6A 2XB4A 3RHTA 3FYUC 1KIFA 1F8FA 4JNCA 4QBGB 5TARA 3ZXYA 4Z7JA 7MDHA 3RUFA 3E27A 5DYTA 1TTPB 1XD8A 1XMIA 4PCVA 5BXQC 4I6JA 5IK2A 3CF4A 3C6XA 4IZIA 1R0LA 3AZOA 1SXIA 1TKRA 5CG1A 1MEJA 1NEQA 3W8RA 3O9ZA 4JI8B 1TMGE 1V1RB 4M1KA 4ZOAA 1HYGA 3T3HA 5HWSA 2W2OA 1CPYA 3PE4A 5CIQA 1UPBA 2IP4A 1PAUA 3ZCXA 2OCLA 2B4KA 3BZWA 2LIPA 4OKSA 1QX3A 2P2LA 4IHJF 3T7TA 1A9TA 3I8XA 2KPOA 3FG9A 3NLLA 1SWWA 4PINA 13PKA 5IF3A 4ZYLA 3NJRA 4N0MA 1U3TA 4BVKA 3ZCRA 2IZ6A 5HRCA 1G4HA 3TLBA 5GAGi 1QHIA 3EF1A 3HXTA 4V2IA 5F35A 3VR1A 2BTEA 1NUAA 4UVHA 1I2AA 2QZ9A 4L02A 4ES6A 3UWMA 3KCNA 3NTOA 2QLTA 3JQ7B 4JMPA 5LB4A 5IDQA 3ODPA 4LJ5A 1I8TA 1ODFA 2Q46A 5C18A 1NLYA 4E07A 3RUPA 5FWXB 2XLBA 5ENVA 4EW3A 2GDZA 5TMPA 3U4DA 1XL1A 2FUG1 3UW1A 3WFJA 1JQKA 2VPZA 1BJKA 1P9WA 1RHMA 3KHTA 4I3HA 4BZXA 1BG6A 2AW3A 3EZ6A 4J0FA 4Q66C 4MV0A 1PD0A 2I7XA 2JIRA 3CYFA 2ZRFA 3D1VA 2AG8A 3HKEB 2BUBA 2CNBA 5CT8A 5FD8A 1D0IA 1GL3A 1OWNA 2X1VA 3F2VA 3M6VA 3HBFA 1PVOA 1JLSA 2JEZA 3DVSX 3JQAB 3V7YA 1FUKA 4IXTA 5SY4A 4CDNA 4BX2A 2BE7A 4PVDA 1PEDA 1S89A 4NYJR 1UUFA 3VUFA 4ZU1X 2ACKA 5HCUA 1GDDA 3WISA 2D1RA 4YDSA 5KUTA 4Y9RA 2H5EA 2V0NA 1KQOA 3TE7A 3L05A 3O3OB 3DDHA 4R84A 1HY3A 3S8MA 5G0VA 3HRKA 1MGPA 4IL5A 4QBKA 4BQSA 1E2IA 4C7VA 4LKOA 2O3JA 4GOKA 4Q1AA 1NVFA 5CT4A 4C3UA 3LZDA 1SUWA 4X1KA 3GARA 3HCFA 1QDEA 1VL0A 4MUFA 4MRSA 3ZWKA 2WWRA 5IBCA 3R5KA 3KQUA 3HV2A 4UD6A 1HG1A 3K72B 1X9HA 3BK1A 3JQFA 3QIAA 3KIPA 2I91A 1ULUA 2W48A 4K81B 1P3DA 3AZQA 1HLGA 2J3IA 3AVVA 1HFKA 1JVNA 2JLBA 2H4FA 3AJEA 1NVVQ 2FUEA 2JK1A 2YFYA 3F67A 3U3KA 4X7BA 3EGDA 4WZAB 2WWGA 1L4MA 2GETA 4HBZA 2R85A 1YR6A 1IU9A 4IF4A 3SC6A 4V38A 2QZZA 3PL1A 4IDQA 4KIWA 3DFKA 2PFGA 3OEEA 1QWOA 4J0IA 1N34B 3PUYA 1MC5A 4MAAA 1KSGA 3WMRA 4WVLA 2JJ2D 2BMJA 4BWVA 4NU0A 4CMKA 1OT5A 1Z5UA 2GYUA 2D54A 2Y68A 3UVEA 1HM5A 3UJ6A 1IB0A 1MJGM 2J0EA 1Z47A 2NU6A 3OQNA 3AOEC 3HFRA 1KY2A 3K2EA 4U7JA 4ZP1A 2R1VA 4C3VA 3JWHA 3FNRA 3OPQA 3PEVA 3VHRA 3VKGA 3NOVA 2GK4A 2EBFX 3NP9A 1Q14A 2CDNA 3R5TA 3VC1A 5DWQA 2G3YA 1NVUQ 5FADA 4ERNA 4OQQA 4YX9A 2IT1A 2LCQA 3I64A 3L02A 4PYOA 1NXWA 4X85A 1P0PA 1UJMA 2XOEA 4PZYA 1ZIPA 4TN5A 4FYKA 1UXHA 4BZPA 1IUPA 1QP8A 1YZKA 2WICA 3SJZA 5EGSA 5HIKA 4YONB 2J3QA 2JVKA 3CRMA 4GHJA 1OASA 2ZRJA 3PEUA 1KETA 4AY4A 3TL3A 3PXPA 1KRHA 1DOZA 3SF8B 3UHOA 1PVVA 2IYNA 1RRVA 5JJBA 1KYQA 2QR2A 2HHJA 1FNBA 2BLNA 2EX0A 2F59A 3BB3A 4C0SA 5K03A 3HABA 1AUPA 3I9OA 1LTKA 3FMFA 3DAGA 4G3XA 5IJXA 4F46A 3JAMA 4R51A 4RGYA 1W47A 3NUGA 1JAYA 4QYTA 3I5UA 2PS3A 2WTUA 4JLSA 2HQBA 5IZCA 2FLKA 1I7LA 3CT6A 3ZQKA 4N0EA 1E7YA 4BS9A 2L42A 3JVEA 5EJ5A 2Z43A 4BU0A 4OEHA 1Y6GA 3G8CA 2H4YA 3DC2A 1NJSA 1E1CB 1RHQA 1SK9A 1UBTS 2SKDA 3TLZA 2XB6A 3BTUA 4EFMA 4EQ6B 2I6SA 2HWUA 5EUCA 1RYEA 4OXKA 2GEBA 1NVXQ 2MWMA 5CPBA 5A02A 3RYCB 2PXTA 2UZIR 5EIBC 3MJDA 4XIIA 4K6HA 5L7WA 3JRXA 1S7GA 4GUAA 1RYNA 2AS0A 1B16A 3P9NA 4R2KA 5FQNA 4DLZA 3G49A 4HD8A 1YIAA 4DXAA 5CA1B 4CKEB 3R3HA 2VHTA 2WJZB 1T3HA 1MTZA 3CM0A 2ZG6A 3O8QA 5KDDA 5KNBD 2X8JA 5J5VA 1Y7PA 4NWIA 3G2IA 4PWYA 5CVJA 4YMUA 2IUSA 2V3VA 1G1MA 2PWAA 1RJ9B 1VL6A 2C4HA 3BN3A 2Q4EA 1XCLA 1EHCA 2X42A 4L78A 4AZTA 1NR7A 2AG1A 2JJ1A 1HEIA 2OK7A 4HQNA 5E9QA 1X80B 1Y82A 3VYWA 4LDNA 4LXYA 2VSOA 3MXTA 4LXXA 4MRMA 1G17A 3ADPA 2O8NA 4GC5A 2VSQA 1G0NA 2ZR9A 1M72A 3G17A 3I12A 1G42A 2RGNC 4DCGA 1CF9A 2XE7A 2KB0A 3BSFA 1L7PA 1AO3A 2YXBA 2ZTVA 4NS1A 4V0OA 4OX9B 3WDMA 4AJEA 4OI1A 2YMQA 4L8LA 5E4TA 2QM7A 4YXFA 3GZDC 1Q3TA 2EJTA 4NE2A 5JCPA 2IYFA 1ZJZA 4D6YA 3R0VA 1I51A 3IJRA 1T9GR 1R0RE 2A0UA 3SX0A 2EBYA 1CUCA 4OI4A 4E2XA 4Z5XA 1BTOA 1ULSA 1WUIS 2WSSD 3ODGA 2IX9A 3H84A 1YV9A 3R4VA 2I1LA 4MPPA 3C5VA 4A0GA 2BN4A 2RHRA 5B4VA 3MF4A 2ASEA 2FSGA 2QVCA 4EPXA 3MJCA 4B8YA 3C43A 3NATA 4L28A 3HKDB 2I4NA 4FSDA 1L1EA 2WWYA 3WGTA 3DMNA 1VLHA 2IHVA 3UUFA 1VG9B 4KQEA 1Q1BA 3BRCA 4WZBB 5I4CA 1GUAA 3IAHA 4RIEA 3B60A 4W7SA 3SI7A 4BCBA 4MTCA 2UYOA 3UV6A 4OGFA 5EMJA 2V7BA 2CNLA 4PWZA 4MVJD 4FD3A 4LY0A 1WKVA 1OFGA 3SBOA 4NXMB 4IINA 1B73A 3PCTA 4IIXA 4ZI7B 1XPOA 1O57A 3I5AA 1QS0B 4FFDA 4Q7EA 4U3JB 3UOGA 1MQSA 4HX5A 1OFTA 4FBMA 1QLHA 1NRIA 1MJ5A 1Y4SA 3E8MA 3FBTA 5K3SA 5CAEB 3R8FA 3HR7A 2Q4RA 2I1VB 3PTLA 5DHPA 3E82A 3LMKA 4U6QA 1QQ7A 2YZKA 4MVJI 5LJIA 3E7PA 3OOYA 3F78A 1NZDA 1HDOA 1NNUA 2DWUA 4RAOA 5FBWB 1U0LA 3DJYA 3R76A 5CGQB 3IJ5A 3DE5X 2B4YA 1A5SB 1SVMA 3V6LA 4G1CA 2XOKA 5M04A 3MTQA 1UQUA 4BN4A 1YSEA 3HUTA 3O4FA 5EJ7A 4A0HA 3CNNA 1LBHA 2EX1A 4IPTA 1QGZA 4BMYA 1EXWA 3X1DA 1II9A 1WUJS 1GZ7A 1KAHA 2DTEA 4PLCA 2XDYA 5T4EA 4I2NA 3NTVA 1V4NA 3VHQA 1LK5A 4IUCS 4X90A 3D02A 2UVQA 4JJIA 5IKEA 2OUIA 4QGBA 3C6KA 4MGYR 4U9UA 2Q27A 1RRFA 2I78A 5FTKA 3KQHA 3MSXA 1AE1A 1YS9A 4P4GA 3A9SA 3HLTA 5EIFA 3NTLA 1KDVA 3L4BC 4ZAVA 5I6DA 3N2GA 4UUPA 1YFKA 4MWTA 1CZRA 1KO7A 1WUHS 1ZVKA 1H4VB 3T34A 1BU8A 3BHMA 3EDOA 3CS3A 3EH2A 3FCSB 1DBIA 5T41A 4URVR 1JZTA 1CRLA 1RYBA 2FMFA 1VCHA 2LE0A 1EJBA 3L7NA 2QMHA 2A0YA 2OCGA 3KDSE 2BNOA 2HC9A 1GUBA 3PG5A 3ME5A 4Q4JB 2WF9A 5JLAA 1B41A 1P73A 1L6IA 3P7MA 2NV0A 3GLUA 2V97A 2KW5A 3F7TA 1GPH1 5E8RA 1G8JA 2EWMA 2HLDA 2QRGA 2OLJA 3AJ8A 4LECA 2PJDA 3I04A 4Q9DA 1GP2A 5HGJA 3RK0A 3V7WA 4B8WA 4CMCA 3Q3JB 2PLWA 1FJGB 3KKQA 3KP1A 4U7GA 2PZJA 1TZKA 1PNRA 1QK4A 3WLAA 3KYBA 1L7AA 4ZFNA 4V03A 2VDJA 4UUBA 4CQJA 2ICTA 1CNMA 2WVHA 3QI7A 5JMPA 1X0VA 4CQMA 1O94A 1R6VA 3O1HB 2YWDA 3LGAA 4DNQA 3P4UA 3LPMA 2VQFB 1DRKA 1E63A 2JPDA 2NUBA 4QRDA 1F48A 1NXQA 2GBFA 3DF7A 5L6MB 3EUEA 4A8JB 3JWIA 3EEQA 1GL9B 3PD1A 5CEEA 1Q91A 5JI3E 1N5MA 4EFKA 1TKBA 1GAEO 1JB1A 1L7RA 4H4EA 4IY1A 1KE2A 1DDIA 1FVHA 1N7GA 1YK0A 4O2BB 3V7FA 5AVZA 4DLUA 1A9SA 1CCWA 4HNAA 2WLTA 4ZV4A 4AROA 1JHMA 1H5UA 3JR7A 4MJXA 3RTCA 3TZCA 1NFFA 1J0DA 1RHRA 4R40A 4X6XA 5BN4B 3VZDA 4IVNA 3DCYA 2O5CA 2GD1O 6ABPA 1V6SA 5KX5A 1XZLA 4W5OA 4PICA 3ROGA 3GLGB 4H3KB 1QC5A 4M99A 1SUCA 4E08A 4R69A 3BSWA 1IOLA 3ZWCA 3QPDA 3RRNA 1UZMA 4MRRA 5TPZA 3RG8A 1KEVA 4B2IA 1BHJA 1H4SA 3UGJA 3D2CA 2EATA 2FXVA 1F4LA 1P7PA 3NBMA 3UV3A 4W8GA 5AW2A 3EGEA 4QUEA 4QXAA 3TLXA 5DNYB 1DEKA 3JCZA 1Z2DA 2NO6A 4P3KA 1H94A 1UFKA 1X86B 2I3DA 4ZJPA 1AMUA 1FDIA 3KAQA 1CLEA 5KWEA 4J29A 4ZGBA 1KXJA 1CS0B 1ES9A 1VYHA 3OJEA 1BRMA 3H18A 1QVVA 3AP1A 4IOMA 2TRSB 1K8QA 1PGQA 3SSAA 2OILA 3W9BA 3GZJA 4H7FA 4QVKA 3ORQA 4ZXFA 3JAKA 1PJ2A 4H59A 1O9BA 2ODNA 2E4UA 1NI4A 3LUDA 4EBBA 4FLMA 3MGKA 4WCDA 4QGGA 4TKVB 3OX1A 5T67A 1WBBA 3CB2A 1Z36A 5IT9A 3OQIA 2VPIA 3STYA 1QU2A 1UCFA 5AKLA 3H9CA 3NDRA 1MW9X 1THTA 2WWWA 2EFHB 2IW3A 2ZP1A 3F6EX 4WOBA 3B1VA 3U4HA 2HL6A 2ZIEA 1DUVG 3JASA 5KNBH 1JJFA 1GAJA 1VRVA 3I4CA 2E1RA 1HURA 4LTDA 3C6MA 4Q03A 1IWOA 1QF7A 2V6GA 1L5RA 5CXSA 4ZZ2A 4G0QA 1RTKA 1VG0B 1X7WB 1EJ2A 1VSVA 2JH3A 2JW5A 1JJVA 2PH1A 3B20A 1N9GB 4UDOA 4ARAA 4MA4A 2I33A 5KOJA 2IVGA 4IICA 1XTPA 1R8XA 4NONA 4YCNA 3MPOA 1FFAA 3R6DA 3JXBC 2N47A 3R44A 1D7OA 2D1YA 1P5RA 4HQLA 4UCWA 3KOOA 2ZE6A 4HTAA 2JCBA 1ZUWA 1AK9A 2O3SA 1CVIA 1O5OA 3OCWA 3HVHA 5AKJA 3VUEA 4D92A 1E6MA 4K6KA 3B82A 3ADDA 2W2TA 2XVZA 3RV4A 3ZIAA 1I6KA 3L8EA 5GTDA 1MRZA 3BDAA 3IULA 1TAQA 2HDOA 2O0HA 3QEKA 4HGQA 4Q7JB 5DT2A 3MWEA 3JQRA 4UEOA 4V0QA 4F2WA 3TWOA 1JSCA 4NV0A 4R8KA 3V80A 5LQMA 2WIAA 4D3XA 2BIFA 3H9JA 4BE7B 1B42A 1F14A 5CH5A 1H0SA 3ILVA 4BU1A 2VNSA 5GADl 1PZXA 4ALNA 4RQAA 3A06A 3SEFA 1KFBB 5BO5A 3IAM6 2NXCA 1G7TA 1M1YE 1POWA 4ZAWA 5JYDA 1H2YA 1SCBA 5LA6F 2W4MA 3LHIA 5TV2A 1L7QA 2Z04A 3DLHA 1EBBA 3GZ4A 3RS9A 3B13B 1E3SA 1E7RA 3LAWA 1M8JA 2IDMA 2OXEA 3AFHA 3LDFA 3LP5A 2O4UX 2W2NA 4GR5A 4QQRA 5EIAA 1U6KA 3DO5A 2YN4A 3ZZMA 3PXAA 3UJPA 3ADBA 3P4YA 3L1UA 3FMGA 2FJPA 4J0GA 5IAJA 2WU3A 3CX8A 1ZN8A 2Z3VA 1TPZA 2GHQA 2I3BA 3JALB 4MKXA 1XVTA 4OFXA 1B0ZA 3RF7A 4KBGA 3EOZA 3PFNA 2O1WA 1JZSA 4PLWA 4DY6A 2QUJA 1SCUB 2P6UA 3KEQA 1U5AA 3E6AA 4AKIA 1UK8A 2J07A 3K7EA 2QN1A 5B58T 1ESNA 3ETGA 3AKCA 3ENWA 3I1JA 4HDKA 2HA2A 4KFUA 4RABA 4ZEXA 4UQLA 2Q2VA 3WLPA 2Z2IA 5F7XA 3GVHA 3CXRA 3FYSA 5G1OA 1U3CA 1J09A 4DNFA 4F3CA 2JLQA 5BR4A 4CQNA 1XTBA 1JNXX 3NG1A 1GU0A 3GT4A 1SVWA 2JLCA 3K31A 2DHQA 4KO4S 2OHFA 1N5RA 3MWGA 4NZMA 3OKPA 2RDMA 4UVEA 5JVDA 3DDZX 5A0FA 5TJHA 2CV1A 3B5EA 4HNVA 4AIRA 2QYTA 4REQA 4LWPA 3PE3A 1HWYA 3TLEA 2DZDA 4E88A 3F4KA 5CJPA 1WXHA 2A9OA 2G63A 1UC9A 3CZCA 3DBLA 3LU1A 3Q7PA 2C78A 3KSMA 4S0ZA 3HCRA 1I3OA 4MNTA 2BYTA 1GZDA 1L5MA 1OAKA 3GAFA 1REQA 3JRWA 1SC6A 3PE5A 3PJDA 3F6CA 1ADGA 1MHPA 1XJCA 5EHIA 2BR3A 3IV7A 4M8NE 2J0SA 1IEXA 1NXPA 1XMJA 1JT2A 2QTVB 2X40A 3KG2A 3MOIA 3H5OA 3ADCA 3GK3A 3AVXA 4PQGA 4UOEA 1Q7BA 2NZ2A 5ECYA 4YJ2A 3TSOA 4B17A 1EFAA 3ZDEA 2DWPA 1M7BA 2XRYA 1A5ZA 2TMKA 3C4VA 3OMTA 2AUNA 3OIYA 3QNUA 4JT8A 3EVGA 4B32A 4EPVA 1XAIA 2Z6QA 2XUOA 4MUNA 1OJ7A 3DONA 1QMPA 4RL4A 5DCWA 2IUEA 2PS1A 3CKKA 4DCOA 4WESA 3PQ6A 4CM5A 3B9BA 1GQSA 3WK5A 4E13A 3BUSA 2B37A 5M29A 4TMTA 3AL0C 3AK4A 2JK0A 3WNDA 2LPMA 1KK2A 4IXDA 5CM9C 2FSIA 5B58C 5AW6A 3TI7A 2GD0A 5LL6P 1X70A 3E05A 1NJFA 2I03A 2FEXA 3BFVA 1V11B 1ZY2A 4P83A 4RV9A 1CYDA 1YWGO 5BW6B 5KU7A 5F23A 2OSVA 3ECSA 5JAMA 2RD2A 1OQAA 2HT6A 4REMA 4WY2A 5LYJA 3CLSC 1J42A 2OV2A 4OHOA 4AJ1A 4KQWA 1QIGA 2HCBA 1UEJA 4XASA 1IJKA 1IHOA 4K9SA 1S8NA 4MVXA 4YR7A 4IDAA 1AO0A 4JODA 2JF0A 2P68A 3GFSA 9ABPA 3VNBA 4E5KA 2XMSA 1NU8A 1U11A 2IK8A 1E6LA 3FLEA 3NW9A 1SCNE 3K9NA 4UBNA 4TSKA 5TR9A 3U60B 1UAAA 1H0RA 4JSYA 5B2ZA 1NP3A 5CW1A 4I55F 4AL4A 2X9GA 4KR9A 4MHTA 4NIMA 5L3QA 3GT0A 3ZBUA 8ADHA 4HN2A 4YWJA 3A14A 4L4ZA 3UOAB 5JD6A 2BGKA 1QORA 4D7AA 2I99A 1J20A 1J8DA 3OZFA 1KFEB 1AU7A 1JAHA 1I5OA 3WGQA 1NXSA 1NERA 3VTAA 3UXHA 3C15C 1SR8A 1RZUA 1CTQA 3CRW1 4FBGA 1OVGA 3AIMA 1E60A 4HWPA 3UG6A 4A23A 4CR8A 2H9YA 1T9BA 4MA0A 2AEMA 1NAHA 4KWHA 4B82A 2JARA 1T9KA 1A2QA 1WMEA 4LC0A 1FE8A 2UUCB 2ZJ3A 3N7UA 1I0LA 5BSRA 5HRUA 1L9KA 1ZKMA 2YV2A 4R1LA 3IBSA 4D4HA 1YF3A 1M73E 3UKDA 2B0CA 1OSLA 3AI2A 4CW7A 1SQFA 5CM2Z 3W0LB 4CM7A 1ORTA 3THXA 3ETLA 1CSEE 3AEUB 3KLMX 1QNFA 3N70A 2Z09A 2R6ZA 2JFHA 4JUCA 4X97A 5IBQA 4B71A 1FDVA 2PT6A 3O8BA 3ELDA 4LK3A 4BQQA 3UK1A 3EC1A 3H6HA 4KO3S 2IZZA 2VT7A 3TDMA 4AS2A 3Q15C 3EMVA 5BORA 4DQVA 3MJ4A 1YZUA 5JAHA 4IMIB 2ZUSA 2PUAA 4JVOA 1U9YA 3MMNA 4KKVA 2C5FA 4RLFA 1G0OA 1S8FA 4K40A 3PA6A 1JW9B 4FYVA 3IAEA 5HBRA 1OTHA 4D8WA 4LJLA 1IHXA 4BHTA 4OYYA 4HMQA 3CKMA 3AWDA 4Q4DA 1D03A 2X4DA 3HBAA 3SQNA 3WGGA 3AC0A 1UBLS 3UG7A 3FDFA 1PK7A 3A9RA 4FQ7A 4MB2A 3AB3A 2OD9A 3QVWA 3NYQA 4LYFA 4RS3A 3VR2A 2J3JA 2QD3A 3T95A 1T3TA 3P0RA 3MOGA 3CF0A 3PHLA 3U0BA 1EXMA 3LUCA 4PLVA 3TD6A 4B6JA 5REQB 2JGIA 3M6XA 3TOSA 3HCOA 3OY2A 3P32A 2XYGA 1T0HB 1E2MA 1RT9A 2RHCA 3QLVC 4EF5A 2XYHA 4BRZA 2HPAA 1NRJB 1OJLA 3ROFA 4D9JA 4MCJA 3GJ4A 4RD4A 4L6CA 1TJPB 4XCQA 4RZUA 1XPJA 1TL7C 4M89A 2IF0A 1SELA 3HP4A 3NB0A 1ZMBA 3GFPA 5L7TA 4DE5A 3AVUA 5CLLA 4OP2A 4XIGS 4YRGA 2Z5FA 1N6LA 2QTLA 4GBJA 4H4CA 1SURA 4QUDA 4WN3A 4K88A 4U6SA 3KTAB 4X94A 1ZS9A 2ZFUA 4D9EA 4MDFA 5JWOA 4X1YB 3KLOA 3AVOA 1KDYA 4BNXA 3LBNA 4CRWB 2C88A 3RABA 3NVKI 1SEPA 4DMMA 1P72A 1RZ3A 3I9JA 3OTHA 3FNEA 2UYQA 4MEJA 5AM3A 1RYFA 1PJLA 4WDRA 2L49A 4NBWA 2X7XA 3H1TA 4I5IA 1E8NA 2X8JB 4ZO4A 5HQ3B 3E9YA 1YVEI 4JEHA 4G4SO 1YBVA 5CHEA 1RCTE 2GN9A 2FN3A 4MEAA 1FF9A 2WFMA 5LJLA 2QVBA 1UFRA 1LPAB 2L82A 1E2UA 3MD9A 3GDWA 1VIMA 3L0PA 1D2NA 3NDBB 4MRMB 4OHRA 3WGUA 3ESXA 3R24A 3MW8A 5B1EA 1W5EA 3EXEB 4AZWA 2CXOA 1QPZA 1ZA2A 2QPOA 5LZ7A 3GBFA 4ENSA 4LOIA 4DB4A 2AZ4A 2OV6A 4ZXPA 4RM3A 1C7JA 1D2MA 1LPOA 1YKFA 2D8MA 2YUIA 3W9UA 3AY6A 3CV3A 2PD3A 3EIOA 4FFOA 1JFVA 5CMLA 5AHOA 4IMPA 3W1WA 2VRNA 1NQTA 3JQDA 2ODWA 1N0WA 2W2KA 3BD7A 3CURA 3HWRA 4P81A 3VI4B 5JBIA 5J3JA 4I99A 3WIEA 4Z4CA 3Q8LA 1QZZA 4RKYA 1DBVO 4L7QA 2FP4B 1VBFA 3E22A 3BF8A 1QVWA 1WZCA 2HZ7A 3ZHZA 2GM4A 4C7MA 2WD7B 3ZJ5A 1KAMA 4OQMA 5H7XA 2AJBA 4M9ZA 4HAUA 2F2TA 1M8FA 2XMDA 4UXJA 4EG8A 2PXXA 1JEEA 3IERA 5D86A 2KPJA 3QHQA 4DJEC 1G41A 3UJ3X 2CFCA 3R09A 2Q07A 3CW8X 2FQYA 3DFUA 4MWSA 5M7EA 1LQ2A 2RB5A 1TM2A 2C7VA 3D5TA 4ZARA 1D4FA 4B4DA 2PIJA 2O05A 1D4ZA 4G97A 4W5JA 1YK1A 2IPOA 2PUTA 4Q21A 1BXRB 2FX2A 5GAHi 1EM8B 3G9ZA 3H3XA 1NXXA 4O2RA 5A3VA 4RTOA 2B78A 5B7GA 1LSUA 4BIIA 3H04A 5JJ5A 3LSYA 5CCDA 3C85A 1P6UA 1Z06A 1Z4OA 2W37A 2XJ4A 3C3DA 4IG9A 1DDOA 2V96A 3EQZA 3L8YA 2FN4A 1IQRA 4QE3A 2ZR7A 4EG3A 4QT4A 4QVGA 1O08A 3AR3A 2JHAA 2PYDA 3ANSA 4HGZA 2HD4A 2JD1A 3N8IA 3SFZA 5HR5A 3KZMA 5AK5A 1GYQA 4XSHA 3WGOA 3QH4A 4IHKA 1U2RA 3MUOA 3S4YA 4DLPA 2JFPA 4MAMA 2I54A 2AUMA 2YASA 1EM6A 3BSYA 3EZ9A 3WWEA 1SU7A 3RSGA 5J58A 4KWTA 4AJ2A 2HCFA 1PKEA 2YS6A 2QL7A 3ZJUA 3ISJA 4B80A 1DT3A 1LWOA 2QROA 1ORIA 2VH1A 3OSZA 4M76B 3RD5A 1RZRD 2FK7A 3HJNA 4DMUB 1OZHA 3PVCA 3GHHA 1E6WA 1G8YA 4KVGA 3E5MA 5BVHA 1G7CA 2CMFA 5JH7A 5L8VA 2J46A 2Q1YA 1DC7A 4GLBA 1MB2A 3AFGA 9GPBA 4RULA 1G3MA 3AEKA 3LVBA 2ZJOA 5DXFA 3RUDA 1ZH0A 4CR6A 3DWGA 4TQUS 4DTCA 3BH0A 4BEWA 3D6UA 3C3PA 4N3BA 1T26A 3PFHA 2Y76A 5GY7A 4DRXA 4ZEMA 3KR2A 2GCOA 1RD4A 1KK0A 3FAZA 4A15A 1LZLA 1OFHA 4DR3B 1ARZA 1I2MA 4G4IA 1G2OA 2BR5A 2PO7A 3GZCA 4RXMA 4UHCA 3VKFA 4LFBB 1OXKB 2R62A 2WHEA 4ZYZA 1G3RA 1RLJA 3I0ZA 1JJAA 3EC7A 2YRFA 3IPCA 2X9VA 3ZHUA 1Y3IA 1W19A 2ERYA 4AG6A 2VT6A 3BFKA 3DS8A 2OBNA 3O82A 4UVGA 1HE4A 1C50A 4QOHA 4MUMA 1U8YA 1L6RA 3LC0A 4GI2A 2BZ0A 3ZV3A 3STHA 1LNQA 2BFWA 6YASA 3SKYA 2QJFA 1UC8A 1R4NB 5MGBA 1G5FA 4IHJB 1DXOA 5EIBD 4BP9A 4DPLA 5BVGA 4R2HA 2OFXA 4ZTUB 3EZXA 3E4CA 1JFFB 3KHUA 3P2OA 5I4KA 2A0FA 3B85A 4M0FA 4F92B 3OZUA 2K6GA 1C7FA 4YCAA 1NC1A 1XF9A 3AHDA 4HB3A 1MKYA 2ECFA 2WFZA 3GWGA 1YBFA 3SJCA 3N6VA 4FOOA 1QHEA 4AG5A 3ZW7A 3TD2A 1N6RA 1X74A 3NI2A 2FW1A 3WLLA 4JHLA 4QASA 3UMVA 3ZE8A 4QFDA 1Y4UA 4A5SA 2BBOA 3VU0A 4N76A 3Q3EA 3RIYA 3DWEX 5JNTA 4IXNA 4QGAA 4INOA 1UDWA 1G21A 1ZGZA 2RAFA 4TWAA 1AG9A 5FV7A 4B48A 2GPAA 3H16A 2GPWA 3HP7A 5CLHA 2YIMA 5AKKA 3DO8A 3FDIA 3GUHA 3OO0A 3DKIA 4B4UA 3DL0A 5EE3A 3VSEA 2PU5A 1ZUNA 3TVTA 4C76A 4RADA 5LWHA 1WU8A 3U61B 2WSLA 3ANNA 5F2EA 1USKA 5FL7D 3TFWA 5IEJA 5EJMA 4XUCA 2A1TS 3NXHA 5AOCA 4PLZA 2ZEJA 1GUZA 4JY7A 4CKYA 1K7FB 1ZM2A 2G9NA 1YZYA 1PDWA 3ZNOA 1QC5B 2ZCVA 2KSQA 3CKYA 1NOJA 3EX7C 1KDTA 2B7CA 2AQ8A 2OCYC 5DNAA 3UJHA 3QX7A 4R9UC 3K73O 2I7VA 4C0JA 2LV8A 1H5QA 2R96A 3MB5A 2HQRA 4R9SA 1U2TA 2O23A 3KELA 4Y6PA 5DX0A 3BZBA 3C3YA 4BFYA 5BP7A 1AV6A 2I2FA 4QD3A 2JAHA 4D42A 3CSSA 1QPBA 2P40A 3IAS6 5ES4B 2OZPA 1G6Q1 2ZVPX 5DM2A 2PU7A 2R8YA 3HB4X 2ZQYA 4ECEA 3EXIB 3Q5DA 2W6ZA 3E9QA 5I7RA 3DVRX 3COZA 3JAKB 2ZREA 3D6VA 3KTOA 1ZR4A 1S96A 4IV8A 4MINA 2D3TA 1XI2A 1WDWB 3T3DA 1TT7A 4BO1A 3EEBA 1EDOA 5CIWA 1JUDA 3C5HA 5IAAA 3SMVA 3UK6A 1J2UA 2M98A 4KQCA 3UMGA 2XVXA 2QTWB 1ZMXA 2HFJA 3OQIB 1FFHA 4JYBA 1PBNA 2Q2QA 2X6RA 1SBQA 4J8PA 5JSYA 4J4TA 1E2EA 3NKVA 3W9YA 3VVCA 2Z1DA 3JASB 1OHHA 1ZGBA 5KPJA 1OHHD 3C4JA 1ECBA 1CNFA 3IYLW 4OM8A 4QTUB 3THOA 3RI3A 1B4DA 1T2FA 2PUJA 1QKJA 5LC1A 3A1SA 3NM5A 3HXMA 1IM8A 4ZVKA 1VKNA 1F5SA 4FNMA 2GJKA 4KHPB 1N5KA 1NI5A 3KZOA 1T9DA 5EWLA 3ICEA 2ZAIA 3SEZA 1NBOA 5DBEX 7YASA 1KEKA 4MV9A 3IQDB 2WFAA 1OMOA 3PFIA 3AZPA 3PXUA 3B1KA 3JQGA 5CYPA 2ERXA 2ATIA 2VHUA 3G9XA 5DBIA 4RPIA 3E8XA 2E4YA 3F6RA 2WC1A 3HYLA 3AM5A 1UZNA 5EJAA 1Q16A 2H31A 2RGGA 1ACJA 4K5QA 4R2IA 5HUHA 3E15A 4ZQBA 1VKJA 2HDWA 4EGQA 3K71B 3VO8A 4R9NA 1YCDA 2R7KA 3K8ZA 4PLGA 5JS2A 4KZKA 3CCCA 1QR2A 1I36A 1N2IA 4FS8A 4U7DA 1EWRA 3WAJA 4OJYA 2UZ0A 4H7IA 1WETA 1CQIB 1R6UA 2ZIXA 4ME6A 4HS4A 4KSCA 3ROEA 4N0DA 3D6TB 4R81A 1PBTA 1CDEA 3SR3A 3S2IA 1FYDA 3OFVA 3G0HA 4EB0A 1E1YA 5DM0A 1UXJA 3M6LA 2VATA 1KFJB 4JNKA 2JVIA 3RHZA 3UAYA 1C8BA 3VHXA 5BYAA 1L5GB 1GGEA 1ZWKA 1GTL1 1JSZA 1OYVA 4YDRA 3W8FA 4ZCMA 1DU4A 3DMPA 2VTBA 1VPEA 3GHYA 1HF3A 3WO0A 2LYPA 1U3UA 1UBJS 1OGJA 2Z83A 3F9CA 4HVAA 3WE7A 2FQQA 4BN0A 3SMQA 1YDEA 5AJZA 2UZ1B 3USES 3WYFA 4F4CA 3R40A 1VI2A 4UATA 2JBWA 1PI3A 3AI3A 2O7SA 4H77A 4HH4A 3TRFA 3V8VA 2WHQA 2IW1A 1VBNA 4PGAA 5IBPA 2OFFA 2R6CA 1CULC 5JRDS 5LDHA 3CRQA 3EOBI 3NEAA 5KTSA 1EFKA 4RTMA 1NY5A 4X62B 3C45A 2VDUE 4HEJA 5D01A 5T57A 1GRNA 1CT9A 2F3QA 2FXIA 1WCIA 4KFSA 4C2UA 5BV7A 1UWVA 1BKSB 1H6AA 3OEWA 4RMIA 3DV0B 1YBHA