2PUBA

Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLEANTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
publication title Crystal structure of LacI member, PurR, bound to DNA: minor groove binding by alpha helices.
pubmed rcsb
source organism Escherichia coli
total genus 116
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1997-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2pubA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pubA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pubA02
2P4UA 2CROA 4HNSA 5D2CA 1JDNA 2WIUB 2BGGA 5I4CA 2NZVG 2L49A 2FMIA 3R1FA 2QZJA 3JXCL 3MIZA 3LISA 4MR7B 2NZUG 1URPA 2PUAA 3DBIA 3NNDA 3FMVA 5FWYA 2NT4A 4EY3A 3BREA 3NBMA 5CHYA 1JDPA 1NXPA 3S99A 1RZRA 2JBAB 4RXMA 2KEIA 1DC8A 8ABPA 3Q9SA 2FW0A 1BVHA 1QKKA 3VNBA 3G85A 3OLWA 1EWKA 1RPJA 1DBQA 2GBPA 5HQJA 3JXDL 1LK0A 4GHJA 3EULA 3H6GA 3K9CA 4JOQA 4EUKA 1PRAA 5BRJA 3C3KA 2XDYA 5IC5A 1NY5A 3O2JA 1NERA 3RVLA 3F6WA 3URMA 4YG4A 4J1XA 3KTOA 3T38A 4ZMSA 4MS3A 1IC8A 2CHEA 5JNWA 5JNTA 1APBA 2AWIA 1ZY2A 4Z4CA 2KEKA 2OFYA 1DRJA 2FQWA 2LYRA 1F51E 2L18A 4Q7EA 3G1WA 3EAFA 4L4UA 3TO5A 1TLFA 1EFAA 1AB5A 4F8DA 3QWGA 2CWDA 1IIBA 2FN8A 1TVMA 1C0EA 2CHFA 2PLNA 3DLBA 4RXUA 1JFVA 4W5OA 4N03A 4G97A 1M5TA 4KV7A 3E3MA 4KK4A 5KQLA 1MIHA 1BDHA 1D2AA 3MM4A 4Z0NA 1NTRA 1PERL 3BRSA 2WWVD 3B7HA 4MR9B 1TJYA 1LMB3 4X4CA 1QO0D 4XLTA 5FBKA 4MYRA 4KPYA 2OENG 4G86A 4MRMA 1H9CA 1YSEA 4W5NA 1Z12A 2O49A 1HEYA 1QP4A 2YHAA 4WWHA 2H8RA 4IWRA 1K66A 2AUWA 1ZITA 4MQFA 2XI8A 2PPXA 4GQMA 4X4DA 3BRQA 3O1JC 1ISSA 4OG2A 4IGAA 1R69A 4RY8A 4NICA 3SG0A 2V0NA 1BA2A 2MYPA 2F8SA 3G5GA 1RZSA 2R4QA 4KMRA 5IBQA 3I45A 3ZHIA 5JNSA 1W9HA 5KQMA 4F06A 3GBFA 3U3WA 2B4AA 1ZZ6A 5T3YA 3CFYA 2PUDA 3HUUA 1YK1A 2L17A 2GKGA 5B3JA 1XHFA 3CKMA 3BDNA 2LYQA 1QMPA 2EBYA 3JVIA 3DGEC 3JTEA 2A9PA 5HSGA 4RK6A 1D5WA 2I6FA 3F73A 3OO1A 3FDFA 4RXTA 2R48A 4Z5DA 1P6UA 3H1FA 4MPTA 2PJUA 3TMYA 2RJOA 1MAVA 2FQYA 3LUGA 1OCTC 3ZHMA 3HEBA 3CNBA 1E6LA 4G0QA 2IOYA 1EWTA 4LDAA 4LX8A 4WZZA 2PUCA 4H3KB 1WH6A 1YIOA 3QX8A 3DGFC 1ZUGA 3Q7RA 1UTXA 3FYMA 1TMYA 2FMFA 4MS3B 3TX6A 4FE7A 3DNVB 2WY2D 3T6KA 4MR8A 4X4EA 2BNOA 1Z18A 2IPAB 4PZ0A 3A0RB 4X4IA 5JNRA 3O1HB 4P1ZA 4RK7A 4ZMRA 5K98B 2FEPA 3CG4A 3LUAA 2E4ZA 2AXUA 3HSYA 4F11A 3RH0A 5JNUA 2LYJA 4O8BA 4YG7B 4KVFA 1KRXA 2LYPA 1P8AA 3ILYA 1R63A 5TQJA 4FB4A 2W42A 2FSPA 4IILA 3OLYA 1NXWA 3QLTA 4MGEA 4MRMB 3SAJA 4YRZA 4IA8A 4Z4FA 2BNMA 5EWLA 5KQPA 1DCFA 3TRBA 4DN6A 3R0JA 4MQFB 1M2EA 4OTZA 2JVLA 1ISRA 2A9RA 1A04A 1RIOA 1VLZA 2R25B 3QLVA 3W9SA 3RVQA 3SM9A 3F6CA 4Z4HA 1KRWA 2CSFA 3SCHA 3BBLA 3H5IA 5KC8A 3C3MA 4Z4GA 4FBIA 1ZZCA 4Z4IA 4Z4EA 4MS4A 4G0MA 2WB4A 3O1IC 1CJGA 1JHZA 2E4XA 2VYCA 3LKBA 4RY0A 2LYSA 1FFWA 5EWMA 1ZZ9A 4PE5B 1D4ZA 5IEJA 3CECA 1RPEL 3UK0A 5TQ0B 3ROFA 4F8JA 2FJRA 3ILHA 1JFTA 4OLAA 3OO0A 2XCJA 1ZZ7A 3Q41A 1AU7A 1WH8A 3BD1A 2QVCA 1VKRA 1Z13A 1GUBA 1PEAA 4OBBA 4RDCA 2L8NA 2GRLA 3NNNA 1FFGA 1JF8A 5TPZA 3KXAA 5GOTA 1SXIA 4G0ZA 4ETNA 1ZPQA 1ZDMA 3DLHA 3N8IA 1PHRA 4NDWA 4EYGA 4Q6BA 3GN5A 1PEYA 2MSWA 3H5VA 1YVUA 4RSMA 4NV3A 1SXHA 2LP4Y 3LFPA 3LUCA 2IVQA 3OM0A 1Y1LA 1ZH2A 4KZKA 4TLLB 5F64A 3KLNA 5KWSA 4RS3A 1TM2A 4MLCA 3HZIB 3RVPA 4MR8B 3JY6A 5FBHA 2E4UA 2FKAA 4X4GA 5JS1A 1NXOA 2HSGA 4QICA 1M5UA 3FFXA 1J56A 2HINA 1DBWA 3RVKA 3HS3A 3TB6A 5FWXA 2QR3A 5TQ2B 4F12A 4HYEA 3KJXA 3LUHA 1NATA 1QP0A 3IP7A 4Y42A 2QW1A 1YK0A 2IVBA 3H5LA 3MF4A 2EWTA 3ROTA 5A7LA 4MQEA 4X4BA 1NXXA 3N0XA 1SQ8A 1JBEA 1POUA 1X2LA 4ZYLA 4IMJB 4YBAA 1BDJA 5T7BA 1KGSA 4QPJC 4RZSA 3JPWA 2O20A 4O5AA 5DGCA 3RQIA 3IPCA 2IPLA 3GWGA 1YMVA 4JCYA 2GWRA 3KLOA 3JVDA 2BJCA 2JRLA 4EYQA 4MS4B 4Z9AA 1Z2EA 4ETIA 2WJWA 4NCBA 1BAPA 3QK7A 3RVRA 2D5VA 3H1GA 3E61A 5EWJB 3IVPA 2HQRA 2LYKA 3FFWA 2AXVA 1DZ3A 4H3HB 4Z99A 3EUSA 2QXYA 2IU7A 5HKOA 4KFCA 1GUDA 4Y9TA 2F8TA 3OQMA 4WXEA 3QELA 4RY9A 1PRUA 4X4FA 1OSLA 1Z16A 4PICA 4NQRA 1U8TA 2QVGA 4MS1A 3QEMA 2AYXA 5FWYB 3RVMA 1LQCA 3I09A 2NUBA 3K4HA 3N75A 1PUXA 4HNRA 3SNKA 3GYBA 2OR1L 1D1PA 4P98A 5DLEA 1UXDA 1FSPA 5IX8A 1MB3A 3RVJA 3VNAA 3O75A 4RK5A 3A0UA 4Z59A 3I42A 3F7NA 4Z5HA 3CU5A 1UXCA 1PRVA 4LRQA 3OLVA 4O1IA 5TPZD 1MB0A 5CNIA 3RVOA 3VK0A 3QYXA 2IVGA 2GI4A 3IP6A 4CBVA 3M9XA 1YTUA 3NHZA 2XSDC 2FEWB 3RVNA 1QQAA 4OLBA 2LPMA 4F3TA 1Z25A 1LJUA 4PEVA 2M98A 3IDOA 3OQNA 2ICPA 4XARA 1L1MA 2FMKA 2Q5CA 3FYAA 3C3WA 2JVKA 3SY8A 4I6TA 1LCDA 1I3CA 3EQ2A 2MYTA 1U2QA 4N0QA 4E7OA 2O38A 1A0OA 4I8TA 2FN9A 3A10A 4H60A 5TPWA 3KKEA 4KQCA 3L49A 4S05A 3QEKA 2LUOA 1O4XA 3P9YA 2J48A 4MCTA 3L1PA 1NXTA 2X7XA 3FMYA 2L2QA 2VUHB 5BQ3A 3TD9A 2JK1A 2PAFA 4W5QA 1DW9A 2JBAA 1BDIA 2ZWMA 4ZPJA 1NEQA 3HV2A 4KQ9A 3T95A 3FGZA 3HDGA 4EVSA 3UUGA 4ML3A 1YS7A 1UDRA 4MLDA 2NT3A 4Q6WA 1C4WA 4W5TA 3O21A 1USKA 3RVSA 2M1ZA 1DJMA 2QSJA 3LMKA 5ED4A 1YMUA 3GL9A 4PYRA 4KNYA 5IUKC 3NNSA 5PNTA 4RWEA 4G0OA 2RDMA 4JB0A 3H5OA 4PU7A 4EVQA 3KS9A 1Z15A 2FEKA 4YS6A 2KYRA 1ZGGA 3SCFA 4UHJA 2JVIA 1DG9A 1LJLA 5CNKA 5CNJA 1E2BA 1X57A 2LBPA 1ZVVA 5BRAA 2WUSR 4KRFA 3GT7A 2PUBA 2YHBA 3IPAA 1K68A 2N9UA 3CROL 1F4VA 5KQGA 2IKSA 3HDVA 1RXEA 3CLCA 1ZHHA 1DRKA 2PUEA 2IDMA 2P9HA 3F6PA 2R63A 5IUJC 3HK2A 1E6KA 2R47A 3CLKA 2KEJA 1USGA 1B00A 3EODA 3KYJB 2B5AA 3UKJA 4EVRA 4NCAA 2MYNA 2H3HA 3A3KA 1JFSA 4WT7A 1ABFA 3F52A 1QP7A 1OXBB 3O2SB 4HNQA 3KZ3A 4MAAA 5IEBA 3GBPA 1JL3A 4EYKA 3N53A 3DZDA 1Z17A 3EQZA 3LOPA 5TPWB 1DCKA 1USIA 2FTKE 2OQRA 3HO1A 3H6HA 2B1JA 1CEYA 3F51A 1HF0A 4YLEA 1YS6A 4YR7A 3KCNA 1ZH4A 3GRCA 2ID9A 2A9OA 4PU4C 1CHNA 3Q7TA 1WIZA 4G0PA 4GNRA 2A9QA 2IPNA 5GQSA 3KHTA 3G7DA 1D1QA 1P2FA 4J1WA 2PE5A 1QQBA 1JX6A 3QF3A 4IVZA 1U04A 3M9WA 2TMYA 4G0YA 5EWLB 1LCCA 3LFTA 3GV0A 4ETMA 4YCSA 3HUTA 2KPJA 3SCGA 1ABEA 4FE4A 2AYZA 2CD7A 2PMCA 3SQNA 1FFSA 1ZS4A 1Z26A 3LUDA 3NHMA 2FLWA 3GA5A 4LE0A 1DBPA 1P6QA 3JS5A 4IMIB 1L5YA 4XASA 4YP9A 1CYEA 5DKFA 4L85A 3QX9A 4ZJPA 1Z2DA 3FFTA 5C5EA 3Q7SA 3D8UA 1ZESA 3O2QB 5EWMB 2E4WA 5JNVA 1XHEA 2HQOA 4TMYA 3L6UA 1GLGA 3LUFA 4OATA 1VPWA 1SXGA 4YGXB 3JXBC 4JP1A 3UFDA 5DCLA 4LZLA 4FN3A 1ZZBA 4EGSA 2L19A 3HCWA 2VK2A 2VUIB 3H1EA 4W5RA 3MQ4A 1JYEA 3H5TA 5KI6A 4Z5CA 2FVYA 3LUKA 4D6YA 3HZHA 1LBHA 2FXIA 3IP5A 3D02A 3OMXA 3GN5B 2JVJA 2AXZA 3OLZA 1FQWA 3ZKCA 4RV5A 3PXPA 4YG1A 3O9XA 3EGCA 2HJ9A 2PIJA 2FQXA 2MSLA 3JPYA 3N0RA 4N76A 4TLMB 2DRIA 1EAYA 3IP9A 5KC9A 3CRNA 1M2FA 1Y7YA 4X4HA 3LKVA 4JAVC 2PUGA 2IYNA 2RJNA 4DADA 1QPZA 3Q15C 2RGYA 2H0AA 4Z58A 3HVRA 4YV7A 1NXVA 3RZZA 2IUOA 1A2OA 1DWKA 4RK0A 5BR1A 4I6RA 2HQBA 4MCXA 1RNLA 2EF8A 1ADRA 1JYFA 2A6CA 1CQTA 2HPHA 5DTEA 2MSKA 1RXIA 3T8YA 7ABPA 5FWXB 2IV1A 3MA0A 4IRXA 4RKRA 5TQ0A 2GZUA 2LYLA 4G0XA 1ZGZA 3MMNA 1DCMA 2PKXA 3CZCA 1SRRA 4KK3A 4QYWA 4D6XA 5HM6A 4TN5A 1PNTA 3BILA 3B2NA 5ABPA 1LLIA 2XJ3A 3OLXA 2FMHA 3QLUA 3LTEA 5E3JA 2PL9A 4MQEB 4UHKA 4WUTA 1JWLA 4PU8A 1KMIY 3EDCA 4MR7A 1XWWA 1EWVA 3KSMA 9ABPA 3D1NI 3O74A 4N41A 3HJFA 3N0WA 2ICTA 4O1HA 2MYUA 1DP4A 1MVOA 2FLKA 3LUJA 4OB4A 4N47A 1OXKB 1ZAYA 1LBIA 1W25A 5B3JC 2JB9A 3CTPA 4IF4A 4E7PA 1EHCA 5JS2A 1RZRD 1GCAA 3CG0A 5C5CA 4Z9BA 1GCGA 1NXSA 3OMWA 4WXMA 3H75A 4PU3C 4GPAA 2WRZA 2E4YA 3EJWA 4QYMA 3HXMA 3C97A 4YARA 1ZN2A 1JLKA 3OM1A 4LDZA 1ZZ8A 1R8JA 3HM9A 2MEZA 1VRVA 3QLUC 4D74A 3CHYA 5TE9A 4LE1A 4N0PA 4YO7A 4XXHA 4KREA 4XFKA 3OP9A 1T34A 6CHYA 2KZ8A 4I6UA 1QO0A 4JB2A 3N6VA 5CNMA 3QELB 5TQ2A 3QQ6A 4RK4A 4EYOA 2QV0A 3MLFA 1E3OC 2IPMA 5IULC 2R1JL 1S7EA 4MS1B 1SD5A 3QEMB 6ABPA 3C6QA 3BS3A 4JCXA 2WMYA 2LIVA 4DQDA 2GRMA 4RKQA 4LE2A 3OMTA 3H5WA 1Y9QA 4B09A 2PUFA 4MR9A 1DC7A 4RU1A 4JQDA 1XWRA 2PL1A 2WJAA 4JASB 1AB6A 4XAQA 4YWHA 5IUNC 2AW6A 2E4VA 3I5AA 2ZAYA 3KG2A 4M88A 3CZ5A 3S8QA 1U2PA 1WETA 1S8NA 3CS3A 3M6MD 2GX6A 1U0SY 2ID7A 3KYIB 3OQOA 1L5ZA 1PNRA 2O4AA 2MQKA 1GT0C 2QU7A 3MYYA 2LCVA 5EWJA 3GBVA 1JH9A 1B0NA 4RK1A 4JA2A 4S04A 2JCGA 1E6MA 2BNNA 2XIUA 3QLVC 1QNLA
chains in the Genus database with same CATH superfamily
2BFBA 3QQPA 3NGLA 3C74A 2QZJA 3G0TA 1J0EA 1L4EA 4RYLA 2ZUTA 3HTXA 2XMRA 3L4SO 3NR2A 3M49A 4LTNA 5F5NA 2NVUB 1XR3A 5A4JA 2C9DA 2FUKA 1W59A 2WE7A 2WT9A 1M73E 2P0AA 3L02A 4DTIA 1G63A 1L5VA 1DNPA 3EXIB 3OT1A 3G85A 4L02A 3K9CA 4UPVA 3DXZA 4OGKA 1U1FA 1DHTA 1RKQA 2ZR8A 1SUAA 2R3SA 3C3KA 3DFMA 2VF5X 4R83A 1RAEA 4XLLA 3B1YA 3AZOA 3ID6C 3RIGA 5F7OA 5GINE 2ZYDA 4YECA 4YK7A 4D4IA 2JAWA 1RE0A 2BDUA 1Y8ZA 5IBCA 3FYUA 3LBIA 1Q1QA 2KEKA 2AG5A 3K92A 2JLZA 2FQWA 2X5OA 2VIIA 4I9FA 5BQFA 1W94A 5HWSA 2M9MA 1LF0A 3PC6A 4QQ8A 4HT3B 1US8B 5JV5A 1L5OA 3PD0A 4RHFA 1E9SA 1GZ4A 4QXAA 2H1WA 5BNTA 4KK4A 5BSRA 2IXTA 4F3RA 1NVXQ 4HKTA 4RLFA 1AKMA 1YBAA 4BJ6A 3GPBA 3EZFA 4IKEA 1JAYA 4PLCA 3PHJA 4ROTA 4WN9A 4QOIA 1QK3A 3VSDA 4G86A 1RWWA 3KPVA 3A8TA 3HN6A 4M89A 3DXXA 6Q21A 5MN6A 1V5GA 1NJFA 1MO6A 1GZ7A 2CJYA 3K8ZA 5JMOA 3WYGA 1H0RA 4EGQA 2QJWA 4X8HA 1BYIA 2G0TA 2XWSA 1FLDA 2Z3VA 1Q44A 3FCCA 3OFNA 5H70A 1N7GA 3STVA 3ZG6A 1U0JA 4AZVA 5FOWA 2ZBRA 3I45A 1IY0A 3EVTA 2P1RA 1R0WA 2P79A 4DJTA 4JXZA 2QX4A 5JCJD 4WBSA 4YACA 1DAPA 3CSUA 2JGAA 3URKA 4TXNA 3RRMA 1I01A 1RQPA 1JJ7A 2XDQB 2C82A 3FCOA 5HSGA 3F73A 1Z2CA 1FQKA 4ZVOA 1Q1NA 3H1FA 4HX9A 2VNJA 1AT1A 1TEHA 1XZQA 1YFKA 2H51A 2EJWA 3SEFA 4FCTA 3W6UA 4B0PA 3EVNA 1WW3A 3A4LA 4AW9A 3AWIA 2YWHA 4LF8B 3U4MA 2A6PA 3AY7A 1J8YF 4P93A 3HCAA 1W85B 3KZOA 3VR2D 1ZUGA 1NT4A 5GOZA 3DZGA 3ITNA 3IRUA 4NNJA 3QKUA 1ODLA 3KJNA 2OC4A 2XE6A 1QH1A 3FCXA 3GEDA 5MN4A 1A82A 1AUVA 4IXNA 5EE3A 4BO4A 3AIKA 2PIAA 3DNFA 4GOOD 4PYMA 3S1SA 1FDTA 1E8MA 1B73A 1BX1A 2E4ZA 2OSVA 3ZCTA 1CEXA 3PA6A 2QM0A 1SXQA 3K2BA 1GU0A 4F60A 3DKPA 2ADMA 3K0BA 1IWOA 2QYHA 4R5HA 4L75A 2C4HA 4FB4A 5KNBA 1WQ3A 4YRRA 4C21A 2QA5A 3P9RA 1GG2A 3M4JA 1VIDA 4MRMB 4QUJA 2VKQA 4F5ZA 1QIIA 2W2KB 1Z4IA 4ER5A 4CT5A 1DO0A 3A3YA 4F93B 5KB3A 1NYLA 2UVQA 2YWCA 3D43A 2Y67A 3AHJA 5AOVA 5LYYA 1A04A 5KOJA 4RV4A 2ZM6B 1OWOA 2NU9A 1OJ7A 2BKLA 3COPA 4YJHA 3G0GA 5A1JA 5D84A 3TSAA 3LBHA 3KQNA 3ZI7A 3I37X 2WB4A 3KR1A 1CJGA 1VMEA 1H5QA 3RYIA 1BMTA 3CLSD 4ZO6A 4QOJA 4AB1A 3UK0A 5M2QA 4P9NA 3EHEA 5CAEA 2V98A 3ZY4A 4YUYA 2Q9AA 1Q3TA 2D54A 1L5FA 1XPOA 1UFRA 4E1VA 4Y9DA 3NTQA 1PR6A 2D0IA 1N3BA 2TYSB 2G06A 4P08A 1NR1A 3EUAA 2OFFA 3G8YA 3U3DA 3NANA 4FLFA 4CTKA 1EQAA 4TWZA 3W5UA 4EW3A 3JRXA 2O7NA 1A1SA 1M1XB 1SXIA 1YVDA 2CVHA 1MIOA 2GRUA 4GFDA 3N8IA 1PHRA 2DAPA 4O02B 5CGZA 3VR2A 2IA5A 4O0LA 4O2LA 4RSMA 1RHUA 1BOOA 3GYGA 4C6TB 4M4SA 1E3IA 5H7XA 3AJ8A 2O5EA 2VT7A 3GMSA 3GCGA 1EX1A 1FFEA 3GFPA 3MTBA 4UU0A 4AK9A 4ZQFA 2OHGA 3O4IA 1B3RA 4PSDA 3FSRA 3F49S 4HDAA 1B6RA 3VVMA 3JVEA 3TZQA 2YS6A 4U0JA 3T7RA 4D80A 4K2AA 1Y9AA 5AM4A 3M89A 3IE1A 2IS6A 3GVHA 2JAOA 1DBWA 4GYKA 1Z8NA 3C3EA 1X7XB 4R0MA 1KYYA 2HSZA 2WT8A 1HTWA 1G8SA 3CR7A 3OE4A 1A1VA 4DE5A 1D7AA 2QRHA 4PHCA 4BQOA 3RS8A 3H2ZA 4BO2A 4C87A 5AIBA 2CLDX 6AT1A 2LZ0A 3O8OB 3WLHA 5ILOA 4N8DA 3GELA 3H5LA 1Z0AA 2WU0A 2I67A 4FOPA 1GARA 2Q2WA 2R6DA 4QHSA 4V0RA 3V8VA 4AKTA 5K9ZA 5DYIA 3OE7D 1JBEA 1NVKA 2XQKA 3Q8XB 3HY4A 4ZN6A 4FOSA 3GZTB 4BVJA 1R6UA 3QBVA 5A02A 3OOYA 2W58A 2HSWA 3JPWA 3WE7A 3SQMA 1S2IA 5LDHA 4G1CA 2BKXA 4GIBA 2VTBA 3JQGA 3GWGA 3JQ6A 4JCYA 3VFDA 3JVDA 3TF5A 2CLOB 3PEVA 4BO3A 4CJXA 3IKVA 2A4KA 3F6EX 4URZR 2MINA 1JDSA 2H2FA 4LRXA 4OHVA 4ETIA 1IBKB 4TWIA 4AMBA 1B15A 1XNHA 3B3AA 3LCJA 4US1R 4PNEA 3AVTA 3GLFB 3KKLA 2AQKA 2OOKA 2TECE 3BE5A 1XMXA 2GZHA 1DZ3A 2YXLA 1M7BA 1WDMA 3CKLA 4NLLA 4PG5A 4NVRA 4Z99A 3GU3A 4HK4A 5LXTA 3I5YA 1PYGA 1GAQA 2FZ5A 2C31A 3PX2A 2H29A 3V8RA 4L4ZA 4R2IA 4NQRA 3RVMA 4H17A 3DE2X 2XKBA 3K4HA 3PD1A 3WNZA 1XKLA 4KCGA 1AUQA 1D1PA 1C7RA 1ZMOA 2BLLA 2R00C 1M6YA 1T3ZA 3EEIA 4FGJA 4MRVA 3ANYB 1Z0IA 3OHSX 4XIFA 3RVJA 1BOFA 5DYTA 4ARAA 1NQOA 3B78A 4OJQA 4EEZA 4IDGA 1ORWA 3LLSA 3RCBA 4UASA 2E0IA 1A9QA 2ZSJA 3ONFA 4G4GA 1RLMA 5TR9A 1WUHS 3M9XA 3ZLVA 3M2TA 3X1ZA 4BEVA 5LA6F 3VPSA 2R2AA 4M53A 1UC9A 4FGWA 1XJQA 4YALA 5BVGB 2QD5A 2ATCA 5J63A 1GEGA 1Q7CA 1V7ZA 3B85A 3K05A 1VRWA 2QTGA 4EY6A 2XWJI 4CDMA 1I0LA 4HMPA 2JVKA 3CUEF 2EKLA 1SKYE 1TA4A 1VFPA 4IV5A 4LZAA 1AU9A 4Q05A 2QOEA 3QENA 2MYTA 4UVIA 2PZLA 5KO2A 1ZIPA 1FPQA 1M0WA 4MHTA 2FDRA 1ZCFA 3OE7A 4OP2A 4B3XA 4PXAA 4BLSA 1AX9A 1GQ2A 2QTWB 3CB2A 3GJ3A 2Q1XA 1QXSA 1Y5MA 2AC4A 2W48A 1VDMA 1QZ3A 2DJIA 3CX8A 3ENNA 4BP9A 1N75A 4B75A 3K6KA 3TD9A 3E6AA 2C42A 4AWBA 3USCS 2P9BA 2FEAA 5EVCA 2NYAA 3MYRA 3UQZA 1F6DA 1ULSA 1P0PA 1TOAA 3BIOA 1AUOA 2FG7C 3HDGA 3HKCB 3LGAA 4IQ4A 4BWFB 3GLGA 2VXBA 5G1NA 3K2IA 2NT3A 4EUFA 4GLLA 3LQYA 3GJQA 4CNBA 3W90A 1IK6A 3GJYA 4RBNA 1THMA 5FNVB 2QZPA 3ISJA 3OQ6A 5IUKC 4EG8A 4RTPA 2HEGA 3COJA 1H2AS 4EO9A 2R8RA 2HJGA 1W0JD 1T26A 5IK2D 2DBVO 4X65B 2PSHA 3A6PC 3VOBA 1XCJA 5EJEA 1OQAA 3T5TA 5IU6A 2JVIA 3S5UA 4PAQA 3HZOA 2I8AA 1UQRA 2EATA 3CWQA 4EABA 4ACBA 3U4AA 5ARBA 5AVQA 1ZZGA 1M2KA 2PWAA 5FV7A 4EMUA 4HNVA 3T5PA 1J0CA 2GUWA 2NYRA 1XB2A 1GDDA 3KKKA 3G2IA 1PZGA 1T2EA 2JL1A 5IUJC 2JHCA 3IODA 5C1IA 4MVJI 5JS7A 2Q3DA 2X4IA 1B00A 3AFIA 3GB9A 4MGYR 4I7EA 1HRDA 1JJVA 2AIRA 4M38A 5GIPE 5ITVA 2IJGX 1V0JA 1WCXA 3CISA 4P2BA 5KOIA 1OHHD 1PDVA 2FZCA 3BH7A 1NQTA 4JC8A 1H22A 4U9HS 3WNCA 4MLPA 3OU6A 4ZRDA 2XCUA 5CDSA 1E64A 3QXXA 1TO1E 2VXCA 2OAEA 2YASA 4AF6A 4S1WA 5B7QA 1YRAA 2C4VA 1KPHA 2UVPB 1NZDA 1NZFA 4N0EA 2CNKA 4OREX 2IEYA 2YNMC 4YMHA 1V8ZA 1ZOLA 4IHQA 1RKUA 2BV3A 2OP0A 2BKAA 1NJ6A 3L6EA 5EHXA 4LYEA 1N25A 5CEEA 1I3KA 2FUG6 2A9OA 1I24A 2P3QA 2QRZA 1UWLA 4Y2VA 4E7OA 2AEEA 5AVUA 3NMUF 4HQ6A 4M22A 4Z7OB 3K96A 4DLRA 5LU8A 4C4SA 5JVDF 1GFIA 3QF3A 5CLGA 5KJ6A 3NH9A 1QNFA 1VLHA 3C8HA 4M9XA 2FF5A 1QFMA 4X5OA 2ZK7A 3HUTA 1VPDA 4XTRA 4QLBA 4WK4B 4PFJA 2P5UA 5GIOE 2VHTA 4W99A 1L3BA 2VDPB 3GA5A 5HK8A 2C9BA 2WJHA 4IMIB 4V1CA 4M7PA 1HFJA 4ALLA 1LC0A 5JWOA 2EGGA 3D2LA 1XK7A 2QLLA 4YMIA 5EWMB 2EZUA 2QMZA 2F90A 2YQZA 2DUNA 3JVIA 3L6UA 3NIDB 2XE7A 1RM0A 1SHKA 5KYKA 3DO6A 1DKOA 4DIDA 4JP1A 2FOIA 3QM1A 4DIMA 3Q7PA 1NLMA 3C0KA 2QY6A 3NT4A 3MWJA 1P7VA 1WUTA 2QM7A 3W1WA 2DFTA 2YVLA 3FJOA 3G2LA 4EL5A 3BIXA 1Q11A 3ESZA 5KI6A 2EL9A 3E9ZA 5KJ1A 3SPXA 1FP7A 2AZTA 2XB6A 3JQ8B 2GN0A 4IHJA 1XMVA 1SB8A 3PXPA 2GCNA 2QVBA 3K5WA 1XMPA 2IK8A 3ET5A 3ENQA 4ZZIA 3RU2A 2Y2VA 1P4HA 2DRIA 3EMBA 3F9RA 1QANA 1UIRA 4S35A 1UPBA 1IUKA 2EV9A 2YDXA 4ZOEA 1Y7YA 4X4HA 1K63A 2EKPA 1A71A 3F47A 4R01A 4Y9UA 1LPBB 5FBQB 1JR6A 1EK1A 4X60A 2JGDA 2QM8A 2FPGA 5DOZA 3OFJA 4ZZ1A 4LDRA 3RKRA 4RK0A 1RRFA 4MJXA 5ECYA 5HS6A 2B2CA 3UMCA 1E18A 1N2GA 2WHEA 3D0KA 2G4VA 1O2DA 2HF7A 5DBGA 4JIMA 2A6CA 4QVKA 4U7TB 3SYKA 1SZCA 2BWJA 5KTRA 2I3DA 3SHQA 4F8YA 4Q9JA 4RKRA 2GZUA 5C32A 3HDYA 4F2PA 2WJYA 3N2KB 4G1MB 4C7OB 4YVFA 5AW7A 2W6OA 1XD8A 3OLXA 3ZHOA 4CKYA 3RAFC 2WYVA 3LTEA 1VBFA 2BIFA 4HRXA 2OOSA 1YFZA 5E4YA 4JP3A 9ABPA 4NF2A 5IJAA 2Y1CA 4JLOA 4O1HA 3P52A 1Z63A 5ER6A 1ZAYA 4J03A 3TOZA 3ZHRA 1GAEO 4M1OA 2AZDA 1O95D 1ZZEA 2I3ZA 2J9FB 2P90A 3OICA 3OJWA 1SIUA 1GCAA 4CM8B 3SJAA 1M1YE 3W2GA 5F51A 1Y8RA 3BSSA 1KYIA 3DKKA 3ITDA 3R2JA 4DDVA 4LDZA 3P0HA 3R3UA 3HM9A 3QLUC 2H1SA 3V8NA 2RI0A 1KMHA 1G5RA 4JOSA 1GUFA 3CLTD 1WP9A 4R51A 2XVYA 3FYDA 4LY0A 3DMPA 1QK5A 3AOEA 1J0DA 5F3DA 3VGJA 5KNBD 1FW6A 2VOEA 5DIFA 1YZUA 4U7GA 1E3OC 2G4CA 2UVDA 3JYLA 1E1DA 5IULC 1F8XA 1QR6A 3QEAZ 5EUMA 1QC5B 3C6QA 3K0SA 1Z74A 1G59A 4J0KA 3ZWDA 4IIJF 4HZUA 1R0LA 2OSBA 1P91A 3GW8A 4NDZA 3D0QA 1ZJYA 4PQGA 4Q7KA 4LNAA 4QOHA 4UTXA 3ULKA 1BCRB 2ECKA 3IUMA 2BY4A 5TGTA 4NZYA 1AGYA 2W6JA 4RMGA 3UFXB 1MEOA 4DXDA 3ORHA 1EXWA 1NWCA 4ZAZA 2ZI9A 2EFEB 2AX4A 3C41J 4PGFA 2GX6A 4DQ0A 3A6GA 1ODCA 2HQ1A 2V1XA 4IJ6A 5EXXA 2MT9A 3KV1A 2YHUA 1Q83A 2YZKA 4NSNA 4PC2A 2YHSA 3EZ2A 5K8JB 1R27A 4ZI2A 1AMOA 1C7EA 2HK8A 5D1HA 5K0EA 1WCYA 2PWYA 2XIJA 3D64A 5TF4A 4GRIA 5BV7A 2ACWA 2EXXA 3SICE 2W9XA 2J3LA 1ORHA 3N2EA 2V6JA 3SI7A 2EC5A 3QYPA 1QIEA 3NNDA 4J0QA 5B57C 3PLRA 4OUDA 3A9CA 3R44A 5CJ2A 3TSCA 1F7VA 1VM6A 3UG6A 2ZJ2A 1EUZA 4AFNA 3A1EA 2B8JA 3OIVA 2JBAB 3BHIA 4QTXA 1DC8A 3Q9SA 1O1YA 3W2FA 4HNUA 4DV4B 3OLWA 3EIFA 4N1AA 3DLTA 4LV6A 3RM3A 1PSZA 1ZWLA 4D0RA 2VTDA 3HU1A 3RV3A 4KLNA 2YWXA 1E3SA 2WWTA 3N58A 1SIBE 4ZCLA 3GOQA 1M6HA 2APJA 5IXYA 3K8OE 2B9VA 3ZX5A 1J25A 5BR4A 4JWKA 3ICQB 3W78A 1DAFA 5AVKA 3ERCA 1YASA 4LGYA 4LECA 4NECA 5TJ9A 3N2GA 4CMGA 4XWWA 3N8HA 3DLBA 4D0GA 3L41A 3MJFA 1IQ0A 4TMTA 4AS2A 3AGQA 4DDWA 1EJ0A 1XZDA 2GXQA 2UZ1A 2NZWA 3MVEA 5J2UF 1UM9A 3REQA 4AYTA 1JU3A 5JS6A 1PU2A 1ZIOA 4I1YA 3BRSA 2YFQA 2C04A 3WIDA 1NW3A 3UMFA 4KQKA 3NZEA 1Q95A 1LBEA 1Y7LA 2KWIA 1P2GA 2NSLA 3FBWA 4MCJA 5EQFA 3FRJA 1SBZA 1UBSB 1B0AA 3G7SA 1Q1EA 3N3BC 5I4IA 1V11A 1WF6A 1NVMB 3TW4A 1X86B 1Q1GA 2ZWPA 1E2LA 1IDOA 1U7TA 2HGZA 2I1WA 4FOTA 4M1QA 4OG2A 3PGLA 1FU8A 2C5HA 2H1RA 1J22A 4BP8A 5KHLB 2R84A 2RH4A 4J49A 2QRPA 4YI5A 1QTIA 2D5CA 3DLAA 2ZIWB 4G37A 5FAKA 3Q5EA 1XNQB 5K8LA 4O59O 2CBGA 3SF0A 3BD6A 4L16A 4EG1A 5K2MA 1OXTA 2ZIEA 3OHMA 2DFNA 2JFVA 1FS4A 5L3ZA 1KFKB 2SKCA 1L6RA 1Z29A 2Q6LA 2GBFA 4M6WA 3TDMA 5M3BA 2I1QA 3KV3O 4UBLA 3IEPA 2XUDA 4Q3CA 3DL4A 3FPEA 5H9VA 1GPYA 1M67A 3H6KA 1Z6YA 3PJEA 3ZHMA 4L22A 4RAQA 4GQIA 4NNOA 1E6LA 1L8AA 1ZM2A 1BS9A 4ZOBA 2JK0A 4QGGA 2POQX 3EZGA 1GNLA 1QE5A 3PL5A 1UTXA 5DSTA 3VHQA 3KL4A 2HGSA 3VMFA 3JVVA 4GMKA 1U4NA 4C4TA 4UM9B 4AJ1A 4ENRA 1HURA 3NAGA 1ZINA 4BMVA 4X4EA 2HAEA 1Q0SA 2D5LA 2VP4A 2BN4A 4NZZA 4BJ3A 3VNRA 3IKLA 4PCAA 2BCGY 5L51A 4F7DA 2BYTA 3HJRA 2NXEA 3BMOA 1NGSA 5IAJA 3GP8A 3A2NA 4HWPA 1ETUA 5IKOA 3DUFA 2PU5A 1ZNQO 1PJ2A 2RBEA 3BXFA 1YWGO 2RAVA 4NOJA 4P4NA 1R15A 1N4AA 1M33A 1DEXA 2WWRA 4DIEA 3A70A 1NNLA 4C04A 4EZEA 1E4VA 1X3SA 2PD4A 1K2VN 4ARUA 3CVVA 1MJFA 4C1NA 3L05A 3LCVB 1P5JA 2IP1A 2QN8A 4MARA 3T5MA 4P4UA 4DMUB 4ZJUA 4OP3A 3WI7A 4BMCA 4MQFB 1U4SA 2HSDA 1VHWA 4C07A 1TXGA 1VLZA 5HK9A 4UEQA 4MDEA 2A9FA 1FDOA 4Z4HA 4KQJA 1NU6A 3T7TA 2XQFA 3L7DA 2WZQA 4D2IA 4M37A 5ILGA 1VE5A 3ADBA 1A69A 1I3LA 2EP8A 4HYQA 1E2HA 2IZ1A 4R5MA 3FSJX 1HETA 1R6VA 4QRDA 3ZLTA 2E4XA 3M1IA 3EXAA 4Z54A 5JRDS 3W7AA 1KZ7B 4AY6A 1D4ZA 5BUSA 4TMZA 2CJWA 5C7YA 1XOIA 2BUCA 2Q6KA 4RGYA 1ZLYA 5CXQA 4MHOA 4JYZA 4MUNA 2IHNA 2TSYB 4KFRA 4JT8A 3BD1A 2Y1FA 3H0KA 2IOHA 2Q0XA 4DUPA 3K8YA 2GNPA 2Y6UA 4IIBA 4U2CA 3PGVA 5U4XA 1JALA 1OBHA 2NXCA 5DLYA 5FFMA 3RRBA 3U9TA 4EA6A 1NDQA 1AKYA 5CFOA 1TZCA 3HMQA 2E48A 4KPGA 2HJWA 2LP4Y 2XTJA 4R2JA 4RLHA 2CDCA 3KXDA 3QYFA 4UXHA 2HLDA 3DOCA 2YXPX 3LPMA 3TJMA 5L6LB 2JI7A 3EIQA 1IB6A 4RS3A 1NVBA 5FA8A 1HYBA 4YEDA 3DQQA 1RQ7A 3HCBA 5FPTA 3RVPA 4CHGA 3PNBA 4CT4B 2AN1A 2O5CA 4GOXA 4CLEA 3RFFA 1L8LA 3GLSA 4FFPA 1G20E 3FMFA 4RORA 3TN7A 1S2OA 1KJJA 1NR7A 2E55A 4RULA 2HF8A 3C87A 3ZU6A 1GTG1 2QR3A 3TSWA 5BPFA 2NYVA 3I2IA 1DAMA 4O63O 3QMVA 2NTNA 3KJXA 2VP6A 3OIYA 1XD2B 2Q5LA 3BEOA 4BEBA 4OGFA 3DV0B 2XXAB 3IIJA 2Y27A 4QSMA 1NYTA 3OQIB 4EW1A 3RU7A 4POOA 2OO5C 5FCDA 2VJMB 3CH4B 3GLIE 3ZGOA 4BUCA 2R6ZA 4DWVA 4WJLA 1POUA 4N7MA 2CJFA 2HREA 2ZTVA 3THRA 5HIKA 4KAFA 3HB7A 3W4KA 1RHJA 2O20A 3KOWA 4I9UA 4WOJA 5FTKA 4E5SA 1IBLB 4ZEXA 3UHFA 2VF2A 2Q4EA 4QTZA 1YKFA 3BKXA 1F0KA 4WI1A 4H16A 2RHBA 4ZO7A 3MCAA 4YMUA 1Y1QA 2Z5LA 4WZBB 3UBTA 1UJ4A 5EIAA 4NCBA 4CQLB 2RGWA 2AGVA 3MGGA 2VZEA 5EKUA 4MW1A 4XDGA 4C2AA 4BB6A 2CXQA 4B84A 2CMKA 3DMRA 3TD6A 4WX2B 1M2VB 1MX1A 3GEMA 4EEKA 2WJVA 2O8FB 5HKOA 3QVGA 4E2FA 1MZPA 2X2OA 1PWEA 2F8TA 1KO1A 2PM8A 2WHYA 3L8EA 3E7FA 3ZCVA 4V3BA 3DHEA 1PRUA 1FUKA 3R23A 2G5PA 4L8GA 1NN3A 2KW5A 4J3NA 3EFOB 3IUSA 1WCIB 3X2FA 4TYMA 4YRKA 1ONPA 3ZU5A 1LJ8A 2DUJA 2XNCA 1QVWA 2O50A 2AOTB 3DHVA 4GEKA 4P2GA 5FAXA 5T5QA 1FSPA 3MJRA 3I42A 4UHFA 5BV2P 4IDPA 1EK0A 2B35A 3BULA 3BJZA 3L9XA 3R6WA 4B9EA 4CBVA 5KQRA 4KI0A 3BXHA 2JEYA 3WGJA 2BHNA 1Y4SA 3I32A 3CCFA 2CL0X 2EFDB 4OLBA 3HBAA 3LT2A 4F3TA 1KDTA 2P9GA 2FPIA 1C4XA 1KZGB 3RUCA 3WAKA 1E5QA 2GF2A 3A31A 4NR0A 3FMOB 1MFPA 2HHHB 1T1RA 3Q3EA 2PXFA 1I3CA 3AK4A 1XLUA 1AKQA 4RVCA 3SKVA 5BN4B 4JL8A 4KQCA 1F5SA 1OIWA 1CUJA 2AKAB 4EX7A 4KR3A 2LUOA 3GCDA 2P4HX 4D4LA 3EAGA 4UKDA 1MJGA 2AQ8A 1NQAO 2NU8B 2M1XA 3NM4A 4FXOA 3C16C 1HZZA 2ID4A 3IBFA 3G23A 3GH1A 4K3UA 5FP0A 4CUZA 1VCNA 1YOVB 1WB5A 3LL7A 2VWGA 4TT3D 4YRSA 5DMXA 1DADA 2FPUA 4ND6A 4NOMA 5C5IA 4TRRA 2OGSA 1K2WA 4ML3A 1YR1A 4A92A 1YZNA 3PC8A 4RANA 3A9SA 1RP1A 1C4WA 5JE8A 3ZWQA 1I2ZA 1DJMA 4FDMA 1CX9B 2XGSA 3HNOA 3L46A 4BKOA 3O0DA 3OKFA 2PXDA 3FETA 4F2GA 1P0FA 2GR9A 3TTSA 3WZ2A 4RFVA 3ZJYA 1R74A 1XU4A 3FZQA 3GP3A 3KVRA 5DYGA 1Y3BE 3AEYA 3DSRA 3JD4A 4NH4A 2GNOA 3RDPA 1GU7A 4UBKA 2N47A 4UHJA 4EELA 3Q8MA 2PX4A 1AKNA 1WMFA 3LIIA 2R2GA 4D3XA 1GDTA 3IB3A 1UOPA 1ZIXA 3P96A 4ND7A 4YRLA 4MUBA 2AFIA 4B82A 2YHBA 2ILVA 4DBVO 3O7WA 3AMVA 3KKNA 3VC2A 2Z8YA 1B43A 1ONOA 1KZHA 4C0QC 1G8AA 5KHOC 4UXJA 3HXTA 5K8UA 3GN2A 1CDDA 3AFNA 3TECE 5I5GA 3CLKA 1SKMA 3HO1A 2GN6A 2HHCA 2IU4A 2ZREA 2ZBDA 3V32A 4UUOA 1EBBA 6ADHA 4I50B 4TQAA 5ALEA 3NTVA 4K9KA 2QI9F 2OR3A 3A3KA 4REQA 4WEQA 2FQ1A 5SY6A 3WB0A 1GPAA 1UXHA 5U1PA 2I33A 2D1RA 2VP3A 2WM9B 5EINA 3AC0A 5CGQB 3FFBA 2G72A 3GX1A 3K53A 3V55A 5AXBA 3BZUA 4HJRA 1C0PA 1OUMA 3JARA 3FSGD 1ZHOA 2D4AA 4OQDA 2Z9DA 4WQMA 2FW9A 4MIEA 4M9RA 3H2KA 2GEFA 4PU0A 1HF0A 3DMFA 4GM4A 3V6MA 2GEBA 4FDTA 1GRNA 5HJ5A 3MSCA 1GG8A 1CHNA 2AMJA 1WIZA 4G0PA 4UDNA 1CIJA 3GZJA 3Q6MA 2J07A 4I8DA 1M2GA 1VKNA 1YHYA 1O97C 2XX3A 3G3EA 1P2FA 1SBNE 3OOHA 1JX6A 1LW7A 1RI2A 3AX6A 4G0YA 4HUJA 3GUYA 2BSQA 4G89A 1FFCA 5CLQA 5A05A 3M70A 2GEKA 3ZZTA 4FHCA 2H52A 2ZZNA 1H69A 3UFBA 2FLWA 3K8QA 5B1HA 1T4DA 4GYYA 5DKFA 3CO0S 3EGDA 5K3FB 4M7RA 2WWYA 3HBFA 4GPZA 3GOHA 4QEZA 3NV9A 3PNSA 5IMBA 2ZJ4A 2A5LA 4HWSA 4DMRA 2DTXA 5EHIA 2P2ZA 4FN4A 3Q8WA 3OTIA 4XCXA 4C7VA 3SFTA 3VPDA 1PUJA 3QEBZ 5G4LA 1U2ZA 3FPKA 5JZBA 1N4DA 2JCXA 3ELDA 4U1RA 4LZLA 4I4IA 3VDNB 1II8B 1YI0A 3O31A 1X7YB 2ZQ5A 1X9GA 1UDAA 4AP9A 4EGSA 1IVNA 3K0EA 1Y1SA 1SA0B 1ZO8A 5IAOA 3QPAA 1FOEB 3F4BA 4POAA 2WWGA 4BY9E 3BMCB 1OT5A 4QXMA 5ARDA 2P9QA 5CX1A 4GM0A 4ODIA 3VYUB 1LLFA 4YDQA 3NEYA 1QE3A 4BMSA 1FQWA 3C3BA 4WY2A 3UJCA 3QUBA 4JI8B 3OF3A 1U7DA 1UPTA 2ZITA 3JRWA 4D44A 1KEEB 2MSLA 3KFVA 4G07A 4ZYYA 5A2GA 3MJHA 2Z6UA 3OE1A 4QGHA 4AZ0B 2FRXA 3PZBA 2ORIA 2HLHA 4TKZA 4O8ZA 3C5VA 1N3LA 3H7AA 5ILQA 3Q15C 5AVJA 4TZ0A 3P26A 4P7KA 5ICCA 3F1KA 1NXVA 1M1YA 3A1FA 2NUTB 5BR1A 1KNXA 1J9GA 4LJ5A 3ASUA 3CGGA 5KEIA 3EK2A 1LS6A 2A3NA 2CCJA 4GUAA 1JYFA 2J09A 3K6RA 3PUHA 2IWHA 2FSFA 4EL0A 4BNTA 2PRSA 4ER7A 3N0TA 3I5MA 2FKNA 4G0XA 2UZAA 3U09A 1WB4A 1BHJA 3KT8A 2C2WA 4LXIA 4ZCIA 4M1KA 1I51A 1W52X 3OH8A 4B6PA 4GUDA 2GD6A 3BPSA 1VYTA 1XCLA 1M2OB 1SXJE 3FXAA 1QE0A 1XWWA 1UMBA 2XTMA 4MR7A 4RQTA 5FUYA 4RTNA 1YT5A 1D09A 1H2YA 1I2AA 5E6SA 5ESWA 1V4NA 3QF4A 4KUGA 5BSWA 4OB4A 3HH8A 2XH8A 2WU3A 4B45A 4IF4A 3ZXUB 2ZYWX 1QHSA 3Q40A 4YPFA 1ZK1A 2PQ2A 1GCGA 1VI6A 3OMWA 4CEJA 1AO0A 4WNAA 3NHBA 3WGZA 4GVPA 4TRJA 5DNEA 4UU1A 2XGMA 4IJWA 4A8PA 1RXSA 4J1NA 2IUUA 4CM6A 1P73A 2Y0PA 4ZYVA 2B8WA 3CE6A 1YXMA 1PT5A 4PAGA 1BXKA 2IYOA 4BS9A 4E33A 4OXRA 4WK0B 5F77A 5HOQA 5LQNA 2IX3A 3TTUA 4DUZB 2JCBA 1TDJA 5A9SB 2JFWA 1B2RA 1JIKA 1G21B 1I4WA 3QIAA 4KLCA 4RX1A 1JUDA 2R1JL 1M34E 4OAPA 4TRMA 5HKAA 4MX8A 4U4AA 5I48A 3IJ5A 1LU9A 1K6JA 3D0OA 1MXHA 3S29A 5B55A 4TKVB 5EIHA 4Z53A 1R5NA 2GLTA 3S2SA 4MGIR 1R9GA 1A2BA 4ZDJA 4R2LA 2RB5A 6REQA 1G18A 4G26A 3TPFA 4ZP1A 4MRRA 3ZWXA 5SY4A 3UMBA 3ZDFA 3CNEA 1XZGA 1ISJA 4Y18A 3M6VA 1AXEA 4TWBA 3O93A 2AE2A 3OQOA 2VL7A 4ZVSA 1Z6XA 2VPIA 3I6ZA 1Q21A 1V4VA 2X9GA 3SBDA 3ZI4A 5MF6A 1P1HA 5IBPA 1T91A 2A3RA 3R7SA 5LP6F 4LY9A 3OKAA 3V5NA 3UWPA 1K86A 3MT0A 5TDHA 4IP0A 4LGVA 3PWSA 4MDFA 1I4DD 1JSRA 1CZHA 2OCGA 2FQQA 3HKEB 1RJWA 4R54A 4RVUA 5D2CA 1D8TA 3WLQA 4N9QA 4DBLC 1O6FA 2CXRA 2EQBA 4PPNA 3RFVA 5CBPA 5ALFA 2UUAB 4YXFA 3F9IA 1DJOA 4HG2A 1XCOA 2PNJA 4EBBA 1NP3A 4NENA 3VH2A 5JIBA 1XLVA 1GT91 3IQDB 1B26A 4EGFA 3T12A 4QWMA 3W8DA 3S99A 3IESA 2BZGA 4R71A 1GUAA 2A7QA 3GVCA 4B71A 4DDUA 1XYGA 3CJTA 4D3ZA 4EJSA 1R8YA 3GN1A 3OFVA 3JXDL 1A88A 5D01A 9LDBA 1O0CA 3N2YA 2ONYA 3HYCA 4YG4A 3RU9A 2G5CA 3T5GA 1E3MA 3ZWCA 4PR0A 2PX0A 3VPFA 2PQ0A 1G291 2D5IA 2PVSA 4LS3A 5JNWA 2H1OA 4O29A 3C5EA 4UZFA 3S4YA 4PPQA 5EP1A 2XDWA 4G4JA 2L18A 4IFBA 1X94A 4Q7EA 5B4VA 3WB2A 2IIPA 3TO5A 4YT4A 1PG2A 1T6ZA 5IT9A 2AW5A 1I30A 2LWIA 2EOAA 3TELA 2D0DA 5LMCA 1QLHA 1PT8A 2B8NA 5DASA 4GOJA 1LF5A 4FFNA 5BORA 2HDNB 5SYNA 4M9QA 3OA2A 3BDVA 3HGQA 3OZWA 1OD6A 2OWEA 5FR2A 3EXFA 4H77A 4ZGGA 3KVOA 2H63A 1AN0A 3O4FA 4MR8B 1Q84A 4R6WA 4W1PA 1QTQA 2VAWA 1ZR2A 2QW0X 4ZI3A 2HRRA 1KOFA 4GE3A 2PS1A 5IG2A 1UJBA 1RYZA 5C0OE 4CF6A 4KBYA 1FVFA 1TK2A 3K71B 4QPNA 1OTYA 2H5EA 3SG0A 5KJCA 4KMRA 3ZHIA 3HJTA 1A95A 3PKIA 4Q16A 2VT3A 3FWZA 2FP3A 4TXJA 1I2CA 1M2NA 2AC2A 4GI7A 1WZCA 4RIGA 1YK1A 5A71A 2VPQA 4DCPA 4FYVA 3EVGA 1WKVA 4RADA 5JUWA 5KMGA 5BW5A 2VWPA 4UXIA 1VJCA 4I9HA 2LLVA 1DUVG 5DIZA 2NP6A 3RBVA 1GFSA 2RK3A 1VKZA 3OO1A 4MPTA 5ALDA 1QJ4A 2EL7A 1D4AA 3O03A 4DNQA 3ZQJA 4JI4B 1E0SA 3EWNA 3ISVA 4X1YB 1KE1A 5KX5A 3RYFB 3CNBA 4Q19A 4L8FA 2WA2A 4L6AA 5AKZA 2ZJBA 2O2CA 1T36B 2O4CA 4K6OA 4ECAA 2ZE7A 2G6BA 1PEKE 4IUCS 4N54A 3L8CA 1IN7A 3GNLA 4JC4A 4MQ5A 2NSDA 1J99A 1V96A 4QEKA 3QWBA 3KJZA 1PW5A 2WZCA 4GPTA 4L2IA 5A4IS 1WEHA 2QRGA 1F4PA 1XTUA 3AEZA 3H11B 1CQIA 4Y1GA 5A4MS 1XF9A 2FSVC 2JLRA 3A0RB 1X15A 4LRWA 4B7AA 5MFPA 3UMJA 4HDNB 2ZRNA 1UMDA 2FEPA 4D02A 1UBCA 1PFUA 1IJEA 1H4TA 1ZJZA 2KBFA 7ADHA 1CDEA 2FGKA 5JNUA 4OKNA 3OEYA 4R41A 2DUMA 4U9UA 5AXCA 1G0OA 3PHHA 1PVOA 3HWRA 1CP3A 4Z0HO 3PICA 1OU4A 1C1DA 1I6LA 1AZWA 1YBVA 2F48A 3C1AA 1UBJS 2GAFA 5GAGi 3IBTA 3LGSA 4I5FA 5DHTA 1NOJA 4LK2A 3Q8KA 1H8HD 3IXLA 4M49A 4OTZA 1DAKA 5IKXA 3K1ZA 3E9MA 1LZKA 2TRSB 2XF8A 1N9GB 3K31A 3KQMA 4GGMX 4KNVA 5C8YA 3QKSA 3T7JA 3KAKA 2X6QA 4MEAA 5KC8A 1PKXA 3WV5A 1KBOA 4DC9A 2NZ2A 2VJCA 4QNMA 4K8OA 5JJBA 1BQEA 1NV9A 1Q16A 3QVWA 4INPA 4Z4IA 3ENZA 4G5RA 2GAIA 2AFVA 5IC5A 1FFWA 1KI6B 2R8EA 4G5FA 1Z45A 4Q4JB 3CECA 3WK6A 5CB4A 2EIHA 2Q0SA 1Y1RA 3O8BA 1SHZA 2IYVA 2C5LA 1Y9JA 3GT0A 4I55F 2VHXA 2P6OA 4B3HA 3DAPA 4MQ6A 1MABB 1AU7A 1F2UB 2BRUA 4YCJA 3DONA 2HMUA 2CHVA 2W83A 3E0QA 5K6AC 1VGQA 1GTMA 4P3NA 1GGEA 5TPZA 4BBZA 3P4XA 3CONA 4A16A 3DLHA 1XDGA 4OYHA 3LA8A 5BN5A 3GFOA 2WPDA 4CLRA 1OASA 3M33A 3UOGA 4RESA 4QSHA 3TMKA 2ZJYA 2B21A 4DCTA 4UZSA 2X58A 1G4UR 1KJNA 2QVYX 4NJEB 1HLFA 4ER3A 3UAYA 2O0KA 3MSXA 3E7WA 3JY6A 1R9JA 4AKEA 1Z07A 2X1MA 4G1FA 5FBHA 4E2WA 4DM7A 4I5DA 4FNMA 4IIDA 1NXOA 1RR6A 5D86A 1JPJA 2PXCA 3D1VA 4NBKA 2AFRA 4JLUA 3LXXA 4WKPA 4HO1X 2H4YA 3ZWBA 3THOA 1YR2A 1IJKA 2QU8A 2OG2A 5KYUB 2HUPA 1E9AA 4YBZA 4KOAA 1FA9A 5HCNA 1KKUA 4BQPA 3VNVA 1OW3B 3BORA 1JLLA 1PG0A 2PPLA 3AKEA 1AHNA 4HTFB 1PLLA 3ZHVA 2NNWB 1JEYB 3ZY5A 4DQKA 1M2HA 3TK1A 1KRHA 2G0AA 2VDNB 5CVUA 1H8HA 2X8LA 4MIKA 5JAMA 5JVDB 3ZTYA 3CEJA 1JN0A 1IHXA 1V47A 2VAPA 3ETLA 4QQRA 1FNMA 4MKIA 2V7GA 4W82A 4KXLA 4B0OA 4IH9A 4X7RA 2B7CA 1D2EA 3I1FA 1YKGA 1NM5A 2GVNA 3OCYA 5BOVA 3R5JA 3RW9A 3HU3A 4YYEA 1NVGA 3GZDA 4FLMA 1FDSA 2ZRMA 3SGLA 2PUJA 3QLJA 4ZEOA 2PSDA 2ANCA 5LMUB 4KDCA 3SS9X 2OORA 1SG6A 1VZ3A 2PTGA 4MS4B 1HDOA 2E49A 1O95C 3CO5A 1GQQA 4HGYA 4LKOA 2BEUA 4LHVA 3ZKWB 2O6LA 4HS9A 3BTVA 1ULHA 1BKYA 3TW0A 5IYZB 3UYLA 4UHBA 3IHWA 1HSZA 2BGLA 4Z1MD 3G5MA 1T2FA 1MV8A 1BH6A 2ZBUA 3IT0A 2X9NA 3MRSA 1OSLA 4Y6OA 2VZ9A 3QEMA 2SICE 4NPCA 1GL6A 4KIFA 1ZOSA 4YRQA 2DERA 3Q4GA 4PPGA 2YZMA 1U1IA 5SZKB 3T0GA 4RETA 3GEHA 2ZSEA 4BRUA 4UMFA 2BW0A 4LYJA 3I9NA 5I8ZA 4E2XA 2H1LA 3G13A 5AW6A 4X7PA 1I5EA 4EHKA 4EVIA 3L8DA 4LRQA 1UK9A 3AF6A 1LB1B 2WIGA 4JYPA 4O4JA 1GL7A 3HA5A 3A9RA 1YTUA 2J3HA 3DZBA 1E2GA 1LW6E 1U9ZA 1Y6RA 1ZVQA 2F8MA 4KP7A 4RTSA 4UARA 2OGTA 3NUQA 3BD7A 4IKOA 1GLVA 2J3QA 3N7UA 3P8ZA 3PXBA 2EWMA 5DTMA 2F3QA 3T35A 3UICA 3KETA 2XB8A 1R7RA 1A0OA 5BYBA 3A6FA 4C5BA 3OZGA 4E1AA 1KFCB 4FOLA 1WQ1R 2AG1A 1U5CA 2R5FA 1EVJA 1MH1A 2YX1A 3P9YA 5BOSA 1MDBA 5KCMA 3ZE1B 3EZXA 1E1YA 2VQSA 3ORQA 3V1LA 4E5VA 5L3SA 2QZSA 3F46A 3RWBA 3NZLA 4D81A 1RXCA 4D6PA 4M7OA 3U4QA 4TUYA 4IX9A 1TJPB 1UAGA 1YS7A 4K88A 4MLDA 3UW1A 2BZSA 4Q6WA 4DIFA 1P1CA 1XQ1A 3LPLA 1IEQA 5AKLA 2D1SA 1AF7A 3OBBA 5AI8A 1DAHA 3G6KA 1YMUA 3ZD7A 5EPUA 5F35A 5AICA 1ZXBA 5PNTA 2J0VA 1B3BA 4JQCA 2HV8A 4DSNA 3STUA 4DT1B 5L9AA 3RIYA 1NFFA 1FXUA 4TXHA 1ESZA 2BI4A 2QGFA 3FMGA 3FUTA 5IM4A 2MHCA 3SCFA 1TQHA 1LJLA 3K20A 1X57A 3PUIA 4EO4A 1QH9A 1YZTA 3AUXA 3MTDA 4K8RB 1WM1A 2JCYA 2ZB3A 4R2MA 3VZRA 5CK5A 2Q3HA 4IIJB 3WLAA 2F6RA 3CROL 4HFNA 5KQGA 5EESA 4RA6A 5FYQA 2Y1DA 1Y4ZA 5EGNA 3TD2A 4LF4B 4NCXA 5JAPA 1DWOA 1VKHA 1AS3A 2PL5A 3ZGXA 1STOA 5FJIA 1U0HC 5HRAA 2CXOA 4AC9A 2OGUA 5KYVA 1G9TA 3QW2A 3LFUA 2MYNA 3DAFA 5EZYA 1IAQA 3STTA 4C4PA 5EMKA 3IDSA 3KOOA 4L5YA 2Z95A 3HVKA 1RJFA 2A58A 1OR8A 1IZ9A 2G28A 3HA2A 1QV7A 1L7NA 1RQ2A 2FW6A 3BHNA 3SHVA 1IL0A 2ON6A 1CKEA 4XYLA 5E2AA 1N6IA 4KBGA 5CVCA 3THYB 3VISA 4BFUA 4URVR 1H4QA 2AE1A 2PIDA 3ICPA 1E2JA 1M54A 1NQWA 1UBEA 3LVQE 4FZJA 4MLZA 4R3UC 4Y1FA 5AWFC 1XA0A 1CEYA 2XTZA 4YLEA 3L04A 3AI7A 4N6OA 3WGOA 2QD3A 4GH5A 4BBJA 2YCBA 1C81A 2CNWD 4B9AA 2F64A 1NMSA 5E1OA 1PN3A 1ZD3A 3H4MA 4LFBB 4PNPA 5JJIA 5B1DA 3T3EA 2CB9A 1QFSA 3KAQA 3EY9A 1D07A 3ZCRA 2WSSD 2Y0CA 3GGSA 1DTSA 2EYUA 3EIHA 3OP1A 4P4SB 3W9UA 3IPXA 1MKYA 1O54A 2WSBA 2HMAA 2NGRA 4YCNA 1G4AE 3HC7A 5G53C 1GD1O 2ZUCA 2O5RA 1B41A 1KYZA 1QOZA 1QSGA 2EDAA 3GCZA 1ADFA 3EF3A 3NETA 1BA3A 1SBIA 3CY6A 5E95A 1JDJA 4NAHA 1XTJA 2QTRA 4R05A 4EY8A 1V7QA 4P7JA 5C46F 1SBQA 4LYGA 4C01A 3F3SA 9LDTA 2G71A 5AW5A 3GUZA 4DNXA 3O2QB 3SF8A 4XDYA 4C7BA 5D3MB 3T1HB 2GGSA 4GAEA 4PGHA 5CT5A 5DXJA 3T3OA 5BNWA 2B2NA 3A9YA 2AKYA 5K3SA 3AKCA 3K0AB 2A86A 5BW8A 5I3ZA 3THWB 3MCVA 2ZRFA 3RROA 2IS4A 1EWYA 2C8JA 4MP6A 1ND5A 2JLBA 1WY5A 1BU5A 1BZYA 1ZRMA 2BFDB 2V96A 3AERA 3QYAA 3C3XA 4ZQCB 3KJEA 4K9MA 5J2UB 4K6CA 3P9SA 1S02A 4ESVA 2OV1A 1FDIA 1RACA 4MWZA 4OGLA 3AEUB 4RABA 1E92A 2I4NA 2IP2A 4ZV7A 5E1BA 3GN5B 2RFLA 2IBMA 1QYCA 3ZKCA 3F4KA 1QG0A 3N0RA 3IV6A 3SC6A 1EAYA 1UBRS 2JIMA 4F4CA 4F3NA 1CFJA 1BRTA 3LKVA 4LSZA 1JKIA 4WSOA 5B1IA 4D97A 2OECA 3I01A 4NG4A 4XZ3A 1H2BA 1J5XA 1J2UA 3X2EA 2CLHB 2Q45A 3JSAA 3Q1LA 5FL3A 1RNLA 4JBIA 1UBKS 1HYQA 4QARA 4TVKA 1UP4A 1X8XA 5LUBA 7ABPA 5FWXB 3HGTA 1R0YA 2H9AA 1TIBA 1JVBA 2DGDA 4TL8A 4I5GA 2QIPA 4U0KA 1U8AA 3LDUA 1ZSVA 3DE5X 1JKXA 1PNTA 1RHQA 1X14A 2WPNA 1LLIA 3EPHA 2IZ6A 2R1VA 3U56A 1W9MA 4D1YA 5CLLA 4FC6A 4FZVA 2ZAOA 4IIUA 4XJTA 3I04M 3KSMA 5CURA 5TEWA 3TQQA 1K97A 4RUKA 3TQOA 2PH5A 1XXLA 2ZIGA 3LC0A 3V7YA 4IHAA 2ZBVA 2OO7A 4JSRA 4WK2B 1H42A 3KXLA 1TVKA 1T1SA 4RMJA 1JE1A 1K5PA 2JGIA 2YJNA 3EZYA 2GFHA 2PWZA 4HEHA 4PX3A 1RC8A 4YRIA 1PT6A 2GJ8A 4OJMX 5EKTA 4U2FA 4AM8A 1M0TA 3KQOA 4HNGA 5A06A 4YARA 4IIYA 4RQBA 3VO8A 3P9PA 4M8SA 5FOSA 4YUVA 1TK9A 4K0RA 4NE7A 3FPBA 2YV4A 1K8QA 3WWDA 4C0BA 5ADVA 3QW4B 5TE9A 4XYGA 4XFJA 3DP9A 3G2KA 4GX2A 1WOMA 1IZ8A 4N0DA 3U7RA 2I2DA 3ZBUA 1T34A 3CPHA 2QF7A 3NC1C 3QOFA 2WBLC 4B3IA 4QU8A 1QO0A 2Z04A 3N6VA 5FLEX 6CHYA 2QV0A 2QI9C 3HDJA 2QG9A 221PA 1U0TA 4MPDA 4ZRMA 5JC1A 2HT1A 3CRVA 5J5AA 5TVKA 2VYND 2BF4A 3OX3A 2G67A 3CIFA 3M6IA 1W93A 4BP1A 1VHLA 4IUBS 4TV8A 4LNHA 1ECJA 4E31A 5JADA 3PC3A 4JR1A 4L9RA 4ZMBA 4YRCA 1QZXA 4N7RA 4B5KA 3HXKA 1N5JA 5JXWA 2W37A 4KE7A 4Y1RA 4YRFA 5BSMA 1CVRA 1N2EA 3NTOA 3PHIA 3OZAA 3DE3X 4OV6B 4B3CA 4M1EA 5B3KA 3WLKX 5GVSA 3ETGA 1R4ZA 3PT5A 5CH3A 2YV3A 4L08A 2I9PA 1DQZA 1TAGA 1U3DA 2XMBA 4QOSA 1JRLA 1M10A 4HMOA 4B6RA 3CCBA 1RLJA 2HXGA 1XA4A 1J7JA 2JFZA 1T1JA 5TVGA 4D56A 1DKQA 2JRCA 3A9VA 2ZBFA 1GEEA 4JA2A 4Q3KA 4RHCA 5AVOA 3EEOA 2JCGA 1CUWA 1VJRA 5KNDH 2XMDA 2QHXA 1D8AA 1PP4A 4ADSG 4KAAA 2CROA 4QGBA 4YR9A 5JD3A 1E6EA 1P81A 3GLFA 2Q5EA 3WR5A 4CLOA 1MT3A 1SULA 1HNNA 4B79A 1YQDA 3H97A 4BMXA 2HRCA 1URPA 3A1WA 4N48A 3V2HA 3M9LA 4XLZA 2A57A 4QJBA 3GLRA 1EHIA 1BVHA 2YOFA 3UK2A 1KOJA 3E8MA 1BQ4A 3IHLA 1EXVA 5F4BA 2NU7A 4EUKA 5AR1A 4KN8A 4QGSA 1R18A 2EJTA 2HEIA 1EWQA 3U7GA 4WVFA 3VHRA 4DM4A 3LZCA 5EYPB 2PD3A 4BV3A 1CJCA 4AZSA 3PKZA 2CUTA 3AM3A 3PE5A 1CR2A 5CG1A 1UPFA 1FUEA 2O57A 2W8BB 1TM7E 2VJNA 4LQ4A 5K03A 3ONWA 1XYYA 4WOKA 1UJ2A 1OLXA 2LYRA 1OOEA 1P61B 1PQ4A 1WKCA 1WVIA 3E4DA 3EAFA 3L4BA 4HPXB 4CMCA 5C1DA 3QWGA 5M04A 4JLVA 3U4DA 1C0EA 5BW6B 1JFVA 4LJ8A 4G97A 4HAYA 3A3PA 2ZB4A 3AUSA 1JMKC 1JKJA 2C9CA 4MP3A 4LISA 4B80A 1BDHA 1U1GA 3NHFA 4PN7A 3WTBA 1VJTA 4FVTA 4M0KA 1CC1S 5CIWA 2Q4OA 4XLTA 2FJUA 1YCDA 3FFAA 3KKZA 4WWHA 2ZAMA 3A36A 2MCFA 3EGXB 2C07A 5B5SA 2ONJA 1G8HA 1YCHA 4W6QA 1MRSA 1CNEA 2O14A 2PPXA 1KJYA 1RWVA 2AD5A 1VYVA 4WCFC 4IVQA 3FRHA 1GGFA 2E89A 2Q49A 2GTPA 2QB5A 5JBNA 1CY6A 1EBUA 4TS3A 3FUVA 3QBEA 3CUKA 3T41A 5EIXA 4MQ4A 4WFQA 3HADA 1SMKA 4X91A 1W5FA 1YQTA 3DHYA 1KK3A 3MQFA 1DTWB 3WLOA 3FG9A 3DGEC 3GNSA 2HNKA 2O7QA 4D0LB 3DMYA 1N2CE 2OK7A 1A5TA 4B6OA 1PR3A 2J5XA 1XZAA 1XWFA 1FNSA 1I2DA 1MAVA 1L5WA 5CPBA 4C4YA 5B6PA 1Q0HA 4DLKA 2QXUA 3QX7A 4O4HA 2ZT7A 2PANA 3HY3A 1C30B 1IUPA 4WZZA 3D2CA 4KO3S 1FUIA 2PUCA 1NVUQ 4B3GA 3QX8A 2REOA 4HYTA 2D1QA 2O05A 3VAYA 4HSEA 4D5EA 1TMYA 4IV0A 2RH8A 5ALSA 5A3QA 5IJ9B 4PFQA 3I28A 3WNBA 3LT4A 2AXQA 4TYNA 1Z0JA 3HO6A 4EFDA 3N8DA 5JY6A 1MOSA 1T43A 3K32A 1CUVA 3KOXA 4PQEA 4XM1A 2X6RA 5AVXA 3WK5A 4C14A 4CCWA 1WDLA 1A5AB 2YIMA 4P1ZA 3P2OA 4QXPA 4YFYA 3UV3A 3INYA 4F4FA 3LHFA 4BYGA 1NVAA 3C2QA 1PJ8A 3JQAB 4Q9NA 5LXTF 4EKYA 4O8BA 4KXXA 2C3YA 4F9EA 3KZVA 4EJMA 4IV8A 1G16A 4OYLA 1JXAA 4KFUA 3I64A 4UE6A 3V9AA 4H6VA 1QBKC 3NB0A 1XJ0A 2P3LA 5AVRA 1OZFA 4KGZA 1G7CA 2M6SA 4Z4FA 3TAXA 1ID8A 1NI5A 1OXVA 1Z75A 3CSDA 5LP6C 1TVEA 4RCVA 1S01A 2FR0A 3ZGNA 1DXHA 4U9IS 3GGDA 3DDWA 3K9BA 3W9SA 1E8DA 3INRA 3SM9A 5JRJA 5C18A 1RRVA 3OI7A 4ZYTA 3VKWA 3C3MA 4XDZA 1CULC 5HS4A 1MQ8B 4FBIA 2J0SA 4RFSA 1FFYA 4P81A 3GHHA 4BECA 2YCLA 4L5AA 4B8ZA 3QFSA 1MU0A 1JJIA 2IPOA 5AKHA 4J1SA 4C7XA 1QHHB 4FSHA 4RHXA 3R09A 5K1ZA 3O2NA 5REQB 5DWVA 4C30A 2WAMA 3I4FA 3ROFA 5IJZA 1PR4A 4YUAA 4OLAA 3K0CC 2J5RA 1RWOA 1E2IA 3GGOA 3Q0IA 4BMZA 2ID8A 1WZEA 4WOBA 3NNNA 1KXZA 1FFGA 3JD1A 5JLAA 3RABA 1XTTA 2AOXA 3N1UA 1MO3A 5IFLA 1ZPQA 2DBYA 4B4WA 3SYLA 3QE9Y 1RM4A 4GSYA 2FW1A 1SXHA 4R69A 3ND8A 4JYMA 3QXHA 1ZH2A 5HHTA 1U02A 3TIIA 4DRZA 7MDHA 2R60A 2WF7A 3DW1X 1ZD2P 3B20A 4F9TA 3AP2A 3IHKA 3RHZA 2R7AA 1V3QE 3A7DA 3VPAA 5JS1A 1NX9A 4PLVA 1R10A 1H3NA 2OTCA 4N82A 3TMAA 4YMSA 1USVA 3DFKA 5JPCA 3JZAA 3RVKA 4HGOA 3H5AA 3CTMA 2R7KA 3JZIA 3WMXA 3DVRX 4EHFA 2PV0A 3OWQA 5TQ2B 2QN7A 4NFYA 3EC7A 4AN4A 2FPWA 2I8CA 3GLTA 3ND9A 5AK6A 3NJ4A 2JANA 3V9PA 2O52A 5T4FA 2E1RA 3RC9A 4YIKA 3L8ZA 2JLWA 1G5TA 3VU1A 3EVBA 3IEIA 4JJAA 4BNDB 2J3DA 5K8TA 3SDSA 5J4LA 1E7RA 3NTXA 4ZYLA 3FX2A 4QUDA 4LXUA 2ZSKA 4RZSA 1JSLA 3PI7A 3KWMA 5LBUA 2PKRA 3MTGA 3OOEA 1ZCAA 3RSGA 3UBMA 3D59A 5LYJA 1WX1A 2FEOA 4UTPA 1PLKA 2XBMA 3QNWA 1G60A 1QB8A 3FOCA 4PG4A 3C1UA 1E3JA 5ADWA 3TL2A 1W4LA 3H3FA 3LPNA 2QORA 4BB5A 2R66A 2ZDHA 1ZJJA 3H18A 3BMQB 5JALA 1NMZA 1PUIA 1A5ZA 4AXXA 3GAAA 2WG0A 3JYHA 2YVQA 3TIGA 3WBJA 1F17A 4BNLA 4HUQA 5FV4A 2H4ZA 2I62A 4OBXA 1CP2A 2R96A 2NX2A 5AVYA 3MC1A 3W9BA 1JEDA 2QVGA 3OURA 4HQLA 4G6ZA 3DCYA 2QBYA 2ZIXB 4ZTBA 1KE2A 3T3HA 4DA7A 3A6ZA 2RH5A 3ZDAA 3QWIA 3ZVMA 1JDUA 5G1PA 4Z7NB 4MCIA 1DO8A 1JVSA 2X8JA 3C1TA 4BFCA 4I8IA 3KTDA 3LQRA 4MVXA 3IKJA 3QYXA 4WW0A 2AOVA 1YZHA 2IUSA 1IFXA 3I1IA 1EDOA 2RD2A 5ALQA 4WH0A 1HNWB 3LX6A 2XSDC 2NVWA 3NHZA 3LPAA 4JLBA 1N57A 3DAHA 2CZCA 1P2DA 2FZ4A 3IDOA 1IZYA 2QMOA 1RBYA 3HXPA 1HO3A 3RFCA 3ZNOA 4AL4A 3SY8A 3BGOS 1WPQA 1B8NA 1O94A 4M8LA 3FHLA 4WLNA 4XX0B 2P6MA 4RTJA 1N6HA 3GAFA 5H82A 4DPMA 5AOAA 4WCFB 3CZMA 3MK31 2F3SA 1OVMA 4YCDA 2CMFA 1KI4A 3TJZA 2ODPA 5TGDA 1P2TA 1NW8A 1HZJA 2J48A 3AI3A 2H00A 2D7DA 5LM3A 3ZNQA 1NBWB 1W44A 2HJHA 2WJ3A 2PZAA 2YJ5A 2PR2A 3KDAA 5HZGA 4IHJF 1IN5A 2QE7D 3I8SA 3WMGA 2WVHA 5C8DA 2PK3A 2OHHA 5BNZA 3TCKA 4Y9RA 2CVFA 4L1KA 4QFDA 4CL0A 2VKTA 2V4MA 4GBED 4NI5A 1UP6A 1DINA 3AESA 2DG2A 4V0SA 5CDTA 1RWKA 4DEVA 1NTOA 1USKA 2WR8A 3RVSA 3WZLA 4X6XA 2QSJA 3EVZA 4DOMA 3D8NA 1VL1A 3AF0A 1ZYUA 3QWAA 4RVSA 2REQA 1QB7A 4URWR 1J0BA 3MEQA 2I4OA 1V1JA 2HCNA 5EXTA 5DM60 2I1VB 3D3NA 5FL7A 1J2YA 1IULA 2ZS7A 4NEGA 4YAIA 3M3DA 3D3WB 2FEKA 2HFJA 3JQ7A 1RWPA 1ZGGA 2IXEA 2OHJA 4HXGA 2E6UX 1P1IA 2FK7A 4HEJA 4LMRA 5DNWA 5KKNB 3TZKA 2Z3ZA 1G9SA 3BIWA 1U9YA 2PUBA 3GG9A 4FTWA 3GRPA 3ONDA 1WVGA 3Q2IA 1PRYA 3R3VA 4IIXA 1TAHA 4QFCA 5LOVA 4E14A 1P75A 3AKZA 3P7MA 4KRYA 3AP3A 3F6PA 3C7AA 2R63A 1IPEA 2ODAA 3G8BA 1UWVA 7REQA 2P9JA 3D5QA 4UCFA 5A3SA 4CKBB 2RC6A 3WK8A 3CBGA 3TL3A 2WOJA 3JQFC 4AZTA 2B4YA 4WACA 4KUHA 4M8IA 3EA4A 3OSUA 1POXA 2EZ9A 2Z8ZA 1AG9A 3RPEA 4UPEA 4LC1A 4EDFA 4PO8A 1N36B 5DZSA 3A9XA 2CGEA 3O2SB 2QTCA 1BJRE 5IEBA 5FI0B 3R7DA 5LP6B 3ZEIA 4LCJA 1DWQA 3N53A 4JJ4A 2GN4A 3LH5A 1DBIA 2B1JA 3BK7A 1U65A 2B1GA 3JWHA 3K1TA 2QP3A 2XMQA 4YR7A 1T2DA 3KCNA 4O33A 2FMXA 4UBOA 4FDLA 4GEGA 1Z88A 2QE7A 2VRCD 4YUXA 2BH2A 4LZNA 3GEBA 1S9HA 1K7FB 3OU2A 2C8VA 2CKMA 4RHTA 4BX2A 4KR6A 4DLBA 3GV0A 5CD9A 1GPWB 4LJSA 4PYQA 4JIGA 2GZSA 3UQYS 2Y1XA 4MW6A 1EB8A 4NHOA 3PYXA 1ISGA 1FFSA 1XVLA 2R65A 5ALLA 1ZUWA 2AJ8A 3LX4A 1L5YA 4V3CA 3M81A 1FX0A 4J0CA 3U7EB 3OEEA 5DB4A 1PK8A 2JW5A 1EGQA 3RG8A 4EHNA 3KELA 5ADUS 1FRFS 1G3RA 3LQXA 1XQWA 4LXYA 3RAPR 1XHEA 5KNDA 3LV8A 3I4LA 4TMYA 1KL7A 4E13A 2D1YA 1ZCBA 1PJTA 1PJQA 4HWOA 5DGHA 5HA5A 2P62A 3BUSA 2ZRLA 3Q3JB 1GCUA 3HCWA 5KPDA 3M6WA 3PLNA 4J3FA 2ZBPA 2QNBA 2UZ4A 4BX0A 3EGWA 1ODTC 2FUCA 4HX2A 4ZAXA 1FSZA 1DJQA 2SCUA 3UOAB 3GVIA 2CJPA 4MW9A 4PAOA 1L8XA 3KUCA 4LJAA 1LPNA 1YULA 4MVJH 3W2HA 1UFVA 3D02A 5ULLA 3EIUA 3HL4A 1TUBB 4AJJA 1GQRA 2X2EA 3DEFA 4LMBA 1KYWA 1U0FA 1D5CA 1MOPA 4B73A 4EF4A 4B87A 1GADO 4IY1A 3LY8A 4I3FA 3VVCA 1M2FA 1Q7EA 1W8DA 4JMPA 3F6YA 2RJNA 5LVAA 4G5GA 1ZI8A 1VG1A 1X38A 4KSYA 2IKQA 3RUHA 4Z58A 3SEAA 3CJQA 1DARA 4ISCA 3U0VA 2YVUA 5CIYA 5JDIC 3Q5GA 4JVNA 2GPNA 4MCXA 3ELYA 3KTFA 3X1YA 1OE0A 1ADRA 1GRQA 1JQJC 2ORYA 2ZANA 3CEAA 1R2QA 3E9DA 3F8WA 3KWFA 1S2NA 2G9UA 2MSKA 4TTPA 4CMHA 2V8BA 2IV1A 3KXKA 5AFSA 4CM5A 2VRCA 3ZU3A 4Z51A 3MMNA 1QFJA 4MI6A 3RBXA 4K0KB 2UYYA 5ALTA 4MRNA 1LDNA 1Q14A 1L4MA 2PX2A 1ZP6A 5H4HA 3X2SA 1IHDA 3ZCQA 3KTAB 1E94E 4UQOA 1KMIY 1SCAA 4FT2A 1ZD5A 5DISB 1KO7A 2BFFA 4QPCA 2VEOA 4UDXX 3RNOA 1PG5A 1TECE 2CXPA 1JDTA 3N2LA 4GKBA 4OHWA 3T9AA 1U8CB 4DAOA 2BP7A 1DAIA 3ZD8A 4HVLA 4YB8A 4W8GA 3NROA 3B1KA 4GZ5A 3T7DA 5JH7F 1NXSA 4MKFA 2BH9A 5HG0A 1P62B 3WHLA 5KSYA 5KSPA 5DO9A 2Q2QA 1ZQ1A 2YV1A 3E22A 3OJFA 4I4TF 4V0QA 2ZT5A 3GLHE 1J33A 1R8JA 2BE7A 2MEZA 1HV8A 2I3GA 2VSOA 3K0KA 2BT4A 4PLTA 3VO9A 4BRZA 5EJ8A 4GKJB 2P40A 2ZRHA 4Q4HA 4YO7A 1GT6A 1RJDA 1E4EB 5CXXA 4F97A 5IXSA 1RHRA 1MAWA 1IBRA 1Q50A 2QD1A 2X9QA 4ND8B 5I7UA 2ZAIA 2CY0A 1BKDR 1C3VA 1J07A 1R0SA 2OP1A 1GPBA 2WTBA 4QHTA 4L9AA 2DU8A 1BCSB 2HHAA 1Z7GA 3JD0A 3TNYA 2GFIA 3UCEA 1P5ZB 4DQDA 1Q3KA 4LE2A 3OMTA 1U99A 3NC4A 1IAVA 3P5BA 2H8KA 4DKXA 4BFZA 1W4AA 3IP1A 1KP2A 1DC7A 1P0MA 4JQDA 1E3EA 3PDJA 3PPIA 4FX5A 4MUKA 2WUVA 5AJTA 2F3TA 4ER0A 1YO6A 3GWZA 3V1YA 3QKTA 1Y4DE 3KUKA 4E11A 5IHPA 5ALMA 5CTJA 4EHJA 5U9CA 1QRAA 4ME6A 1OLSA 3ZCUA 1PJRA 4KFTA 1LPSA 3GJTA 4ZTUB 1NRXA 1Y3HA 1B0NA 3I6BA 3QKIA 2EX4A 3ISTA 1Y33E 4KN6A 3ZC3A 5BV8A 5JCOC 4I55B 2FR8C 4HV4A 3DS8A 3L0ZA 5L3QB 3AF5A 1G3UA 3FCSB 1HKHA 3A4TA 3JYPA 1NMEA 4JJ6A 1GPLA 3GUHA 1CIVA 1JEEA 1FLAA 4J43A 1Y63A 4OAQA 3NBMA 4RH0A 3SP1A 4MVJG 1UQUA 2WI8A 3QPWA 3AM5A 3O9VA 1KKLA 3G0BA 3PQ2A 4RXMA 2VSYA 1Q0RA 4HUTA 3L0OA 2ENUA 4JOQA 4Z7JA 3H6GA 5EMNA 2R6AA 2PXAA 3FYHA 5E0OA 3DBLA 4TLDA 3TINA 2Y3IA 4ISBA 1SVKA 3VZDA 4EG3A 3HJUA 2VPYA 3KTOA 3HXOA 4DJAA 4GBJA 3W0LB 1IC8A 5P8WA 3L8HA 3UV6A 1ISHA 3R4CA 5JNTA 1P74A 1WAMA 2BGUA 1JEJA 3OETA 1BEZA 4K81B 4AJLA 4Z4CA 5AVZA 4DS3A 4MA0A 5ELLA 1TZMA 2I7CA 4AURA 4RDHA 1BWPA 2X41A 3S2GA 4DF3A 3LJKA 4X62B 2OXCA 3UG7A 5DHAA 1C8BA 4H3SA 5A4FS 4F38A 3UOWA 3BFKA 4UM8B 3R5XA 1QGDA 4HWKA 2B8TA 5K4HA 1WB6A 1HLGA 1D2AA 2DQKA 1ZICA 1UL1X 3PNPA 1YOBA 3L6DA 2RC5A 1N2CA 2P9YA 4MR9B 4NC9A 4R9VA 4X4CA 5FTLA 5CUQA 1C1HA 1DKUA 4YRAA 1JQKA 8OHMA 3QUAA 3ZHUA 3OFSA 3PFBA 4IWNA 3B38A 4IO0A 4M3NA 1WRBA 4PBSA 1CR6A 4HDRB 3R5FA 1DIBA 1UPXA 3O1LA 4KQ6A 1ENOA 5CDUA 1DKPA 4QKQA 2BZ0A 2OWDA 4PSUA 5JXIA 1C1XB 1RAFA 2NU6A 1UJCA 1AK1A 1NI4A 4ZV9A 1G8KA 1F3LA 1IN8A 2QP9X 2XMPA 2XA9A 1LVUA 3G9UA 2QL5A 1EINA 4RSRA 4OQXA 4HLCA 1FP4B 4RNCA 3U3WA 3ZGVA 2WAXA 5HF8A 4Z9FA 1QIHA 4CIYA 2ZG6A 3JQPA 4Q4AB 1V7CA 1U3GA 1YQGA 4RPGA 1EU1A 3DXYA 4YJGB 3CKMA 3TLYA 2O8CA 3GG2A 2DF8A 4EATA 5EKXA 5DTJA 2R1ZA 4BKQA 1R5OA 2I34A 2A0XA 3PUWA 1QFZA 4OU4A 3VTAA 4U7DA 3R3JA 2IZOA 3EDYA 1N8KA 1Y89A 4NAUA 2PJUA 4NZNA 3Q85A 1L0BA 1PW7A 1IOLA 2MR5A 3EFBA 3GPDG 3FF1A 4WGGA 4DA6A 2HK9A 4DIUA 3AUUA 1H2FA 3H9GA 3NKVA 4LDAA 4TYPA 3SFVA 1EWTA 3T5BA 3WL7A 4DUGD 1IMOA 1CIPA 4BO5A 2AOUB 3FZNA 4B4DA 3UGJA 2UUOA 2FMFA 5ALIA 2ZIAA 1GHTA 3AO0B 3FMIA 4HYYA 1E3WB 5K3AA 3SC2A 1NASA 5LQMA 4HXEB 5KYGA 3GF4A 3T54A 1Z28A 1NKSA 1YR8A 2ZXFA 1BEUB 1JKFA 3KEMA 3S2EA 3JWGA 4XIJA 2V3WA 1W46A 5K4AA 4D0SA 1O96A 1SB9A 3FNFA 2ZJ8A 1SZPA 2D06A 2EBUA 4QXQA 4WE3A 1FVXA 2AXUA 1UINA 4L51A 4LAFA 4DDTA 2C8LA 5G40A 2I7TA 4XA8A 1P1KA 3BB4A 1U7OA 1VLJA 3MCTA 4G1UC 4OEHA 4UHCA 1R63A 2CLIB 5AO9A 3DPIA 3EPPA 4GLBA 4YRZA 1QIGA 3RR2A 3FHCB 1JTVA 2V4UA 3SAJA 4AI6A 2ZOSA 3AYXB 3K9QO 1P1BA 1RZ3A 5EWLA 2RHOA 1MW8X 1XQYA 4PCVA 4DR6B 1QYIA 4JCOA 2JVLA 4J16A 4OI1A 2G25A 5CA1B 1J06A 4PYIA 2CLKB 2PZKA 4OY3A 1BXGA 1U0RA 1WW2A 3FUXA 3PNMA 1TIPA 3VAZA<