3F6WA

Xre-family like protein from pseudomonas syringae pv. tomato str. dc3000
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
82
structure length
82
Chain Sequence
SNATKTIHNARYQALLDLLLEARSAAGITQKELAARLGRPQSFVSKTENAERRLDVIEFMDFCRGIGTDPYALLSKLEAMTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title XRE-family like protein from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Dna binding protein
molecule keywords XRE-family like protein
total genus 30
structure length 82
sequence length 82
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3f6wA00
1ZZBA 2ICTA 2FJRA 2IVBA 4FN3A 3OMTA 4GQMA 1JFSA 1PRAA 3BDNA 1BDIA 4YG7B 1QP7A 1UTXA 4OB4A 2IUOA 3VK0A 2JVLA 1OSLA 1R69A 3S8QA 1HF0A 3F6WA 3TRBA 1ZZ7A 4X4DA 2L49A 2WUSR 2BNOA 4Z5HA 2PUBA 2AXZA 1LCDA 4J1XA 1RIOA 4YARA 2PUCA 2EBYA 2LYQA 1WH8A 3ZHIA 2KPJA 1ZPQA 1JWLA 4PU7A 2LYPA 3OQMA 5K98B 1X2LA 3LFPA 3IVPA 3QQ6A 2EF8A 2PPXA 1OCTC 2KEJA 2PUDA 3JXBC 4MCTA 3ZKCA 1O4XA 4X4EA 2IU7A 1S7EA 1B0NA 2HINA 1PRUA 2IV1A 3FMYA 3G5GA 4X4CA 1CJGA 1QP0A 2PUEA 3KZ3A 2KEKA 1CQTA 4I6TA 4JCXA 4IWRA 2AWIA 3BD1A 4PU3C 1VPWA 4JCYA 2O4AA 2LYSA 3R1FA 1XWRA 4Y42A 1EFAA 2AUWA 2IVQA 3D1NI 2AW6A 3EUSA 3KXAA 1RZSA 1LLIA 4JQDA 1LMB3 1POUA 4YBAA 2R63A 1QP4A 2LYRA 2PUAA 2XJ3A 2GRMA 4I6UA 2CROA 4J1WA 3SCGA 4I6RA 4I8TA 3U3WA 2XI8A 1NEQA 1ZAYA 1WH6A 4X4BA 1L1MA 1R63A 2OR1L 1E3OC 2PUFA 1RZRD 4X4HA 3H5TA 3ZHMA 2IVGA 3QF3A 3GN5B 2XIUA 4IA8A 1ZZ6A 4X4FA 3O9XA 1ZZCA 2CSFA 4GHJA 3HZIB 2H8RA 1ADRA 3UFDA 1AU7A 1QQAA 1LCCA 1YSEA 4NDWA 3F51A 4Z59A 3GBFA 1ZZ8A 3GN5A 2EWTA 2D5VA 2LYKA 3G7DA 3QWGA 2BNNA 3DNVB 4FBIA 1WETA 3BS3A 1Y7YA 1RPEL 2LYLA 4YG1A 2ICPA 2LCVA 4PU4C 3PXPA 1QQBA 3OQNA 1PNRA 1PRVA 3SCHA 2MEZA 1ZS4A 2B5AA 2PE5A 2PIJA 3CLCA 3B7HA 4Z5DA 1UXDA 1DWKA 2OFYA 1X57A 3CECA 3CROL 1LQCA 1QPZA 3LISA 1BDHA 2XCJA 4Z58A 1UXCA 3OP9A 2KZ8A 3QYXA 3MLFA 2LYJA 3OQOA 1ZUGA 1ZZ9A 2HSGA 1IC8A 4IVZA 2BNMA 1Y9QA 2BJCA 5A7LA 1WIZA 3JXCL 2JCGA 2A6CA 4X4GA 2GZUA 1PERL 3KJXA 1JH9A 1SQ8A 2AXUA 4PU8A 4Z5CA 2KEIA 1NERA 3FYMA 2L8NA 4X4IA 3JXDL 4O8BA 2PUGA 1DW9A 2O38A 3RZZA 2XSDC 2O49A 2WIUB 1ZVVA 2R1JL 4F8DA 1GT0C 2AXVA 3FYAA 3F52A 3L1PA 3SCFA 2GRLA 2MQKA 1RZRA 4YG4A 1JFTA 4MCXA
chains in the Genus database with same CATH superfamily
1ZZBA 4FN3A 2MXDA 3OMTA 3QOXA 1R69A 3R09A 3F6WA 4Q2JA 4Z5HA 1LCDA 1RIOA 2EBYA 2LYQA 2KPJA 2LYPA 3NXHA 3IVPA 1OCTC 3JXBC 3MEJA 2IU7A 2HINA 2KEKA 1CQTA 1VPWA 2O4AA 3GZCA 2LYSA 3R1FA 2LLVA 1EFAA 2IVQA 3QFIA 2PXDA 2R63A 2LYRA 3SCGA 4I8TA 4X4BA 1RZRD 5DTMA 4X4HA 4X4FA 3F51A 2PXPA 1ZZ8A 2L1PA 3G7DA 2BNNA 2LYLA 1QZXA 3CLCA 3CECA 1X57A 3OP9A 2KZ8A 3MLFA 3SR4A 3OQOA 1IC8A 2J7WA 5A7LA 4X4GA 4PU8A 3FYMA 2PXLA 3JXDL 3UWPA 2XSDC 2AXVA 2YBDA 3L1PA 3OWQA 2FJRA 1JFSA 3OKZA 4YG7B 1QP7A 2IUOA 1DULA 3S8QA 1HF0A 2PXBA 3TRBA 2WUSR 2BNOA 2PUBA 4ER6A 1WH8A 1JWLA 1ZPQA 4PU7A 1NW3A 3OQMA 5DTQA 3LFPA 2PPXA 1S7EA 1B0NA 1PRUA 1HQ1A 4I6TA 4JCXA 4IWRA 3BD1A 4PU3C 4JCYA 1XWRA 3D1NI 2AW6A 5DRYA 2LNMA 2JQEA 4EKGA 3ME5A 4YBAA 1QP4A 2PUAA 2GRMA 2CROA 2LLWA 3U3WA 2XI8A 1ZAYA 1L1MA 1R63A 1E3OC 3QF3A 3GN5B 2XIUA 1ZZ6A 2H8RA 1ZZCA 4GHJA 1LCCA 4Z59A 2EWTA 3QWGA 3NROA 4FBIA 1WETA 2LCVA 4PU4C 2PXQA 3PXPA 1PRVA 4WVLA 2MEZA 3SCHA 2PE5A 4Z5DA 1DWKA 1QPZA 1BDHA 4Z58A 1UXCA 4DE9A 1ZUGA 2JCGA 2A6CA 2GZUA 3KJXA 2L8NA 4O8BA 3A9XA 3RZZA 2O49A 1ZVVA 1GT0C 3GZDC 2IVBA 3GUUA 5GAGi 1PRAA 3BDNA 1BDIA 1UTXA 4OB4A 3VK0A 2JVLA 1OSLA 4X4DA 2AXZA 2PUCA 4J1XA 4YARA 3ZHIA 5K98B 1X2LA 3QQ6A 2EF8A 2PUDA 4MCTA 2ODRD 3ZKCA 3G5GA 2IV1A 3FMYA 4X4CA 1CJGA 3KZ3A 3A9YA 2V3CC 3NZLA 1MFQC 3EUSA 3KXAA 4ER7A 2PXFA 1RZSA 3GZDA 2PXEA 4JQDA 1LMB3 4HRAA 1POUA 4I6UA 4J1WA 5GAHi 5JUWA 1WH6A 2PUFA 2OR1L 5DT2A 2HFZA 3H5TA 2IVGA 3KL4A 3O9XA 2XXPA 2CSFA 1ADRA 3UFDA 3GBFA 3GN5A 3DM5A 3PE5A 2LYKA 1Y7YA 4YG1A 2ICPA 1PNRA 3ZPXA 2B5AA 2PIJA 1UXDA 2OFYA 3CROL 1LQCA 3LISA 2XCJA 4EZIA 3QYXA 2LYJA 1ZZ9A 2HSGA 5DRTA 1Y9QA 1WIZA 3JXCL 1SQ8A 2KEIA 4EQZA 2O38A 4ER3A 2WIUB 3FYAA 3F52A 3SCFA 2GRLA 2XXAA 4ER0A 4YG4A 2FFHA 5DSXA 2ICTA 4GQMA 3TEPA 1U2ZA 1ZZ7A 2L49A 4EKIA 2KEJA 2PXKA 1O4XA 4X4EA 3SX0A 1QP0A 2PUEA 1QB2A 3QOWA 2AWIA 4Y42A 2AUWA 2J7UA 1LLIA 2XJ3A 4I6RA 4ER5A 1NEQA 2M4HA 3M9LA 3ZHMA 3HZIB 4IA8A 4EK9A 2VEOA 1AU7A 1QQAA 1YSEA 4NDWA 2HCNA 2D5VA 3DNVB 3BS3A 2PXTA 3VWSA 1RPEL 1QQBA 3OQNA 5DTRA 1ZS4A 3A9ZA 3B7HA 3TELA 4DE8A 4IVZA 3LQXA 2BNMA 4OBMA 2BJCA 2PXVA 1PERL 2PXUA 1JH9A 4Z5CA 2AXUA 1NERA 2XXQA 4X4IA 3NDBB 2PUGA 1DW9A 2HCSA 3G0TA 2R1JL 4F8DA 2MQKA 1RZRA 3TFLA 1JFTA 4MCXA
chains in the Genus database with same CATH topology
1ZZBA 2ICTA 2FJRA 2IVBA 4FN3A 3OMTA 4GQMA 1JFSA 1PRAA 3BDNA 1BDIA 4YG7B 1QP7A 1UTXA 4OB4A 2IUOA 3VK0A 2JVLA 1OSLA 1R69A 3S8QA 1HF0A 3F6WA 3TRBA 1ZZ7A 4X4DA 2L49A 2WUSR 2BNOA 4Z5HA 2PUBA 2AXZA 1LCDA 4J1XA 1RIOA 4YARA 2PUCA 2EBYA 2LYQA 1WH8A 3ZHIA 2KPJA 1ZPQA 1JWLA 4PU7A 2LYPA 3OQMA 5K98B 1X2LA 3LFPA 3IVPA 3QQ6A 2EF8A 2PPXA 1OCTC 2KEJA 2PUDA 3JXBC 4MCTA 3ZKCA 1O4XA 4X4EA 2IU7A 1S7EA 1B0NA 2HINA 1PRUA 2IV1A 3FMYA 3G5GA 4X4CA 1CJGA 1QP0A 2PUEA 3KZ3A 2KEKA 1CQTA 4I6TA 4JCXA 4IWRA 2AWIA 3BD1A 4PU3C 1VPWA 4JCYA 2O4AA 2LYSA 3R1FA 1XWRA 4Y42A 1EFAA 2AUWA 2IVQA 3D1NI 2AW6A 3EUSA 3KXAA 1RZSA 1LLIA 4JQDA 1LMB3 1POUA 4YBAA 2R63A 1QP4A 2LYRA 2PUAA 2XJ3A 2GRMA 4I6UA 2CROA 4J1WA 3SCGA 4I6RA 4I8TA 3U3WA 2XI8A 1NEQA 1ZAYA 1WH6A 4X4BA 1L1MA 1R63A 2OR1L 1E3OC 2PUFA 1RZRD 4X4HA 3H5TA 3ZHMA 2IVGA 3QF3A 3GN5B 2XIUA 4IA8A 1ZZ6A 4X4FA 3O9XA 1ZZCA 2CSFA 4GHJA 3HZIB 2H8RA 1ADRA 3UFDA 1AU7A 1QQAA 1LCCA 1YSEA 4NDWA 3F51A 4Z59A 3GBFA 1ZZ8A 3GN5A 2EWTA 2D5VA 2LYKA 3G7DA 3QWGA 2BNNA 3DNVB 4FBIA 1WETA 3BS3A 1Y7YA 1RPEL 2LYLA 4YG1A 2ICPA 2LCVA 4PU4C 3PXPA 1QQBA 3OQNA 1PNRA 1PRVA 3SCHA 2MEZA 1ZS4A 2B5AA 2PE5A 2PIJA 3CLCA 3B7HA 4Z5DA 1UXDA 1DWKA 2OFYA 1X57A 3CECA 3CROL 1LQCA 1QPZA 3LISA 1BDHA 2XCJA 4Z58A 1UXCA 3OP9A 2KZ8A 3QYXA 3MLFA 2LYJA 3OQOA 1ZUGA 1ZZ9A 2HSGA 1IC8A 4IVZA 2BNMA 1Y9QA 2BJCA 5A7LA 1WIZA 3JXCL 2JCGA 2A6CA 4X4GA 2GZUA 1PERL 3KJXA 1JH9A 1SQ8A 2AXUA 4PU8A 4Z5CA 2KEIA 1NERA 3FYMA 2L8NA 4X4IA 3JXDL 4O8BA 2PUGA 1DW9A 2O38A 3RZZA 2XSDC 2O49A 2WIUB 1ZVVA 2R1JL 4F8DA 1GT0C 2AXVA 3FYAA 3F52A 3L1PA 3SCFA 2GRLA 2MQKA 1RZRA 4YG4A 1JFTA 4MCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZB A;  2ICT A;  2FJR A;  2IVB A;  4FN3 A;  3OMT A;  4GQM A;  1JFS A;  1PRA A;  3BDN A;  1BDI A;  4YG7 B;  1QP7 A;  1UTX A;  4OB4 A;  2IUO A;  3VK0 A;  2JVL A;  1OSL A;  1R69 A;  3S8Q A;  1HF0 A;  3F6W A;  3TRB A;  1ZZ7 A;  4X4D A;  2L49 A;  2WUS R;  2BNO A;  4Z5H A;  2PUB A;  2AXZ A;  1LCD A;  4J1X A;  1RIO A;  4YAR A;  2PUC A;  2EBY A;  2LYQ A;  1WH8 A;  3ZHI A;  2KPJ A;  1ZPQ A;  1JWL A;  4PU7 A;  2LYP A;  3OQM A;  5K98 B;  1X2L A;  3LFP A;  3IVP A;  3QQ6 A;  2EF8 A;  2PPX A;  1OCT C;  2KEJ A;  2PUD A;  3JXB C;  4MCT A;  3ZKC A;  1O4X A;  4X4E A;  2IU7 A;  1S7E A;  1B0N A;  2HIN A;  1PRU A;  2IV1 A;  3FMY A;  3G5G A;  4X4C A;  1CJG A;  1QP0 A;  2PUE A;  3KZ3 A;  2KEK A;  1CQT A;  4I6T A;  4JCX A;  4IWR A;  2AWI A;  3BD1 A;  4PU3 C;  1VPW A;  4JCY A;  2O4A A;  2LYS A;  3R1F A;  1XWR A;  4Y42 A;  1EFA A;  2AUW A;  2IVQ A;  3D1N I;  2AW6 A;  3EUS A;  3KXA A;  1RZS A;  1LLI A;  4JQD A;  1LMB 3;  1POU A;  4YBA A;  2R63 A;  1QP4 A;  2LYR A;  2PUA A;  2XJ3 A;  2GRM A;  4I6U A;  2CRO A;  4J1W A;  3SCG A;  4I6R A;  4I8T A;  3U3W A;  2XI8 A;  1NEQ A;  1ZAY A;  1WH6 A;  4X4B A;  1L1M A;  1R63 A;  2OR1 L;  1E3O C;  2PUF A;  1RZR D;  4X4H A;  3H5T A;  3ZHM A;  2IVG A;  3QF3 A;  3GN5 B;  2XIU A;  4IA8 A;  1ZZ6 A;  4X4F A;  3O9X A;  1ZZC A;  2CSF A;  4GHJ A;  3HZI B;  2H8R A;  1ADR A;  3UFD A;  1AU7 A;  1QQA A;  1LCC A;  1YSE A;  4NDW A;  3F51 A;  4Z59 A;  3GBF A;  1ZZ8 A;  3GN5 A;  2EWT A;  2D5V A;  2LYK A;  3G7D A;  3QWG A;  2BNN A;  3DNV B;  4FBI A;  1WET A;  3BS3 A;  1Y7Y A;  1RPE L;  2LYL A;  4YG1 A;  2ICP A;  2LCV A;  4PU4 C;  3PXP A;  1QQB A;  3OQN A;  1PNR A;  1PRV A;  3SCH A;  2MEZ A;  1ZS4 A;  2B5A A;  2PE5 A;  2PIJ A;  3CLC A;  3B7H A;  4Z5D A;  1UXD A;  1DWK A;  2OFY A;  1X57 A;  3CEC A;  3CRO L;  1LQC A;  1QPZ A;  3LIS A;  1BDH A;  2XCJ A;  4Z58 A;  1UXC A;  3OP9 A;  2KZ8 A;  3QYX A;  3MLF A;  2LYJ A;  3OQO A;  1ZUG A;  1ZZ9 A;  2HSG A;  1IC8 A;  4IVZ A;  2BNM A;  1Y9Q A;  2BJC A;  5A7L A;  1WIZ A;  3JXC L;  2JCG A;  2A6C A;  4X4G A;  2GZU A;  1PER L;  3KJX A;  1JH9 A;  1SQ8 A;  2AXU A;  4PU8 A;  4Z5C A;  2KEI A;  1NER A;  3FYM A;  2L8N A;  4X4I A;  3JXD L;  4O8B A;  2PUG A;  1DW9 A;  2O38 A;  3RZZ A;  2XSD C;  2O49 A;  2WIU B;  1ZVV A;  2R1J L;  4F8D A;  1GT0 C;  2AXV A;  3FYA A;  3F52 A;  3L1P A;  3SCF A;  2GRL A;  2MQK A;  1RZR A;  4YG4 A;  1JFT A;  4MCX A; 
#chains in the Genus database with same CATH topology
 1ZZB A;  4FN3 A;  2MXD A;  3OMT A;  3QOX A;  1R69 A;  3R09 A;  3F6W A;  4Q2J A;  4Z5H A;  1LCD A;  1RIO A;  2EBY A;  2LYQ A;  2KPJ A;  2LYP A;  3NXH A;  3IVP A;  1OCT C;  3JXB C;  3MEJ A;  2IU7 A;  2HIN A;  2KEK A;  1CQT A;  1VPW A;  2O4A A;  3GZC A;  2LYS A;  3R1F A;  2LLV A;  1EFA A;  2IVQ A;  3QFI A;  2PXD A;  2R63 A;  2LYR A;  3SCG A;  4I8T A;  4X4B A;  1RZR D;  5DTM A;  4X4H A;  4X4F A;  3F51 A;  2PXP A;  1ZZ8 A;  2L1P A;  3G7D A;  2BNN A;  2LYL A;  1QZX A;  3CLC A;  3CEC A;  1X57 A;  3OP9 A;  2KZ8 A;  3MLF A;  3SR4 A;  3OQO A;  1IC8 A;  2J7W A;  5A7L A;  4X4G A;  4PU8 A;  3FYM A;  2PXL A;  3JXD L;  3UWP A;  2XSD C;  2AXV A;  2YBD A;  3L1P A;  3OWQ A;  2FJR A;  1JFS A;  3OKZ A;  4YG7 B;  1QP7 A;  2IUO A;  1DUL A;  3S8Q A;  1HF0 A;  2PXB A;  3TRB A;  2WUS R;  2BNO A;  2PUB A;  4ER6 A;  1WH8 A;  1JWL A;  1ZPQ A;  4PU7 A;  1NW3 A;  3OQM A;  5DTQ A;  3LFP A;  2PPX A;  1S7E A;  1B0N A;  1PRU A;  1HQ1 A;  4I6T A;  4JCX A;  4IWR A;  3BD1 A;  4PU3 C;  4JCY A;  1XWR A;  3D1N I;  2AW6 A;  5DRY A;  2LNM A;  2JQE A;  4EKG A;  3ME5 A;  4YBA A;  1QP4 A;  2PUA A;  2GRM A;  2CRO A;  2LLW A;  3U3W A;  2XI8 A;  1ZAY A;  1L1M A;  1R63 A;  1E3O C;  3QF3 A;  3GN5 B;  2XIU A;  1ZZ6 A;  2H8R A;  1ZZC A;  4GHJ A;  1LCC A;  4Z59 A;  2EWT A;  3QWG A;  3NRO A;  4FBI A;  1WET A;  2LCV A;  4PU4 C;  2PXQ A;  3PXP A;  1PRV A;  4WVL A;  2MEZ A;  3SCH A;  2PE5 A;  4Z5D A;  1DWK A;  1QPZ A;  1BDH A;  4Z58 A;  1UXC A;  4DE9 A;  1ZUG A;  2JCG A;  2A6C A;  2GZU A;  3KJX A;  2L8N A;  4O8B A;  3A9X A;  3RZZ A;  2O49 A;  1ZVV A;  1GT0 C;  3GZD C;  2IVB A;  3GUU A;  5GAG i;  1PRA A;  3BDN A;  1BDI A;  1UTX A;  4OB4 A;  3VK0 A;  2JVL A;  1OSL A;  4X4D A;  2AXZ A;  2PUC A;  4J1X A;  4YAR A;  3ZHI A;  5K98 B;  1X2L A;  3QQ6 A;  2EF8 A;  2PUD A;  4MCT A;  2ODR D;  3ZKC A;  3G5G A;  2IV1 A;  3FMY A;  4X4C A;  1CJG A;  3KZ3 A;  3A9Y A;  2V3C C;  3NZL A;  1MFQ C;  3EUS A;  3KXA A;  4ER7 A;  2PXF A;  1RZS A;  3GZD A;  2PXE A;  4JQD A;  1LMB 3;  4HRA A;  1POU A;  4I6U A;  4J1W A;  5GAH i;  5JUW A;  1WH6 A;  2PUF A;  2OR1 L;  5DT2 A;  2HFZ A;  3H5T A;  2IVG A;  3KL4 A;  3O9X A;  2XXP A;  2CSF A;  1ADR A;  3UFD A;  3GBF A;  3GN5 A;  3DM5 A;  3PE5 A;  2LYK A;  1Y7Y A;  4YG1 A;  2ICP A;  1PNR A;  3ZPX A;  2B5A A;  2PIJ A;  1UXD A;  2OFY A;  3CRO L;  1LQC A;  3LIS A;  2XCJ A;  4EZI A;  3QYX A;  2LYJ A;  1ZZ9 A;  2HSG A;  5DRT A;  1Y9Q A;  1WIZ A;  3JXC L;  1SQ8 A;  2KEI A;  4EQZ A;  2O38 A;  4ER3 A;  2WIU B;  3FYA A;  3F52 A;  3SCF A;  2GRL A;  2XXA A;  4ER0 A;  4YG4 A;  2FFH A;  5DSX A;  2ICT A;  4GQM A;  3TEP A;  1U2Z A;  1ZZ7 A;  2L49 A;  4EKI A;  2KEJ A;  2PXK A;  1O4X A;  4X4E A;  3SX0 A;  1QP0 A;  2PUE A;  1QB2 A;  3QOW A;  2AWI A;  4Y42 A;  2AUW A;  2J7U A;  1LLI A;  2XJ3 A;  4I6R A;  4ER5 A;  1NEQ A;  2M4H A;  3M9L A;  3ZHM A;  3HZI B;  4IA8 A;  4EK9 A;  2VEO A;  1AU7 A;  1QQA A;  1YSE A;  4NDW A;  2HCN A;  2D5V A;  3DNV B;  3BS3 A;  2PXT A;  3VWS A;  1RPE L;  1QQB A;  3OQN A;  5DTR A;  1ZS4 A;  3A9Z A;  3B7H A;  3TEL A;  4DE8 A;  4IVZ A;  3LQX A;  2BNM A;  4OBM A;  2BJC A;  2PXV A;  1PER L;  2PXU A;  1JH9 A;  4Z5C A;  2AXU A;  1NER A;  2XXQ A;  4X4I A;  3NDB B;  2PUG A;  1DW9 A;  2HCS A;  3G0T A;  2R1J L;  4F8D A;  2MQK A;  1RZR A;  3TFL A;  1JFT A;  4MCX A; 
#chains in the Genus database with same CATH homology
 1ZZB A;  2ICT A;  2FJR A;  2IVB A;  4FN3 A;  3OMT A;  4GQM A;  1JFS A;  1PRA A;  3BDN A;  1BDI A;  4YG7 B;  1QP7 A;  1UTX A;  4OB4 A;  2IUO A;  3VK0 A;  2JVL A;  1OSL A;  1R69 A;  3S8Q A;  1HF0 A;  3F6W A;  3TRB A;  1ZZ7 A;  4X4D A;  2L49 A;  2WUS R;  2BNO A;  4Z5H A;  2PUB A;  2AXZ A;  1LCD A;  4J1X A;  1RIO A;  4YAR A;  2PUC A;  2EBY A;  2LYQ A;  1WH8 A;  3ZHI A;  2KPJ A;  1ZPQ A;  1JWL A;  4PU7 A;  2LYP A;  3OQM A;  5K98 B;  1X2L A;  3LFP A;  3IVP A;  3QQ6 A;  2EF8 A;  2PPX A;  1OCT C;  2KEJ A;  2PUD A;  3JXB C;  4MCT A;  3ZKC A;  1O4X A;  4X4E A;  2IU7 A;  1S7E A;  1B0N A;  2HIN A;  1PRU A;  2IV1 A;  3FMY A;  3G5G A;  4X4C A;  1CJG A;  1QP0 A;  2PUE A;  3KZ3 A;  2KEK A;  1CQT A;  4I6T A;  4JCX A;  4IWR A;  2AWI A;  3BD1 A;  4PU3 C;  1VPW A;  4JCY A;  2O4A A;  2LYS A;  3R1F A;  1XWR A;  4Y42 A;  1EFA A;  2AUW A;  2IVQ A;  3D1N I;  2AW6 A;  3EUS A;  3KXA A;  1RZS A;  1LLI A;  4JQD A;  1LMB 3;  1POU A;  4YBA A;  2R63 A;  1QP4 A;  2LYR A;  2PUA A;  2XJ3 A;  2GRM A;  4I6U A;  2CRO A;  4J1W A;  3SCG A;  4I6R A;  4I8T A;  3U3W A;  2XI8 A;  1NEQ A;  1ZAY A;  1WH6 A;  4X4B A;  1L1M A;  1R63 A;  2OR1 L;  1E3O C;  2PUF A;  1RZR D;  4X4H A;  3H5T A;  3ZHM A;  2IVG A;  3QF3 A;  3GN5 B;  2XIU A;  4IA8 A;  1ZZ6 A;  4X4F A;  3O9X A;  1ZZC A;  2CSF A;  4GHJ A;  3HZI B;  2H8R A;  1ADR A;  3UFD A;  1AU7 A;  1QQA A;  1LCC A;  1YSE A;  4NDW A;  3F51 A;  4Z59 A;  3GBF A;  1ZZ8 A;  3GN5 A;  2EWT A;  2D5V A;  2LYK A;  3G7D A;  3QWG A;  2BNN A;  3DNV B;  4FBI A;  1WET A;  3BS3 A;  1Y7Y A;  1RPE L;  2LYL A;  4YG1 A;  2ICP A;  2LCV A;  4PU4 C;  3PXP A;  1QQB A;  3OQN A;  1PNR A;  1PRV A;  3SCH A;  2MEZ A;  1ZS4 A;  2B5A A;  2PE5 A;  2PIJ A;  3CLC A;  3B7H A;  4Z5D A;  1UXD A;  1DWK A;  2OFY A;  1X57 A;  3CEC A;  3CRO L;  1LQC A;  1QPZ A;  3LIS A;  1BDH A;  2XCJ A;  4Z58 A;  1UXC A;  3OP9 A;  2KZ8 A;  3QYX A;  3MLF A;  2LYJ A;  3OQO A;  1ZUG A;  1ZZ9 A;  2HSG A;  1IC8 A;  4IVZ A;  2BNM A;  1Y9Q A;  2BJC A;  5A7L A;  1WIZ A;  3JXC L;  2JCG A;  2A6C A;  4X4G A;  2GZU A;  1PER L;  3KJX A;  1JH9 A;  1SQ8 A;  2AXU A;  4PU8 A;  4Z5C A;  2KEI A;  1NER A;  3FYM A;  2L8N A;  4X4I A;  3JXD L;  4O8B A;  2PUG A;  1DW9 A;  2O38 A;  3RZZ A;  2XSD C;  2O49 A;  2WIU B;  1ZVV A;  2R1J L;  4F8D A;  1GT0 C;  2AXV A;  3FYA A;  3F52 A;  3L1P A;  3SCF A;  2GRL A;  2MQK A;  1RZR A;  4YG4 A;  1JFT A;  4MCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...