4OB4A

Structure of the s. venezulae bldd dna-binding domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
69
structure length
69
Chain Sequence
SEYAKQLGAKLRAIRTQQGLSLHGVEEKSQGRWKAVVVGSYERGDRAVTVQRLAELADFYGVPVQELLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 28
structure length 69
sequence length 69
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4ob4A00
4Z5HA 2ICPA 1LMB3 4X4BA 3F6WA 2AXUA 3S8QA 3BS3A 1UXCA 2A6CA 1ZZ6A 2B5AA 2LYPA 1WETA 1RZRA 4FN3A 2LYKA 1X2LA 2R63A 4JCYA 2GRMA 5K98B 1R69A 3SCHA 2AUWA 1ZZCA 3OP9A 1B0NA 1WH6A 4NDWA 4YG4A 1E3OC 3KZ3A 4PU7A 2MEZA 2PIJA 3VK0A 2R1JL 4YG1A 3D1NI 1EFAA 1ZUGA 2O4AA 3OMTA 4YARA 2HSGA 2LYSA 4JCXA 2BNNA 2O49A 3R1FA 2BNOA 3UFDA 3ZHIA 3U3WA 1POUA 4X4EA 1ZVVA 2MQKA 2D5VA 2KZ8A 1DW9A 3B7HA 1UTXA 2AXZA 2IU7A 1SQ8A 3JXCL 2PUBA 1ADRA 1NERA 3G7DA 4PU3C 2L8NA 3BDNA 1JH9A 1PRAA 2OR1L 1Y9QA 4X4HA 2IVQA 3L1PA 1OCTC 4IWRA 3G5GA 1ZZ8A 1XWRA 3ZKCA 2EBYA 2XSDC 3HZIB 3CLCA 1LCDA 3PXPA 1QPZA 1RZSA 3OQNA 4PU8A 1CQTA 3EUSA 1JFTA 3QYXA 1LCCA 1X57A 3DNVB 4IVZA 2KEIA 2ICTA 1QQBA 1RIOA 2GZUA 2KPJA 2PE5A 3SCGA 3FMYA 4GHJA 2XI8A 1AU7A 4IA8A 3QWGA 3OQMA 1PRUA 2O38A 1GT0C 4I8TA 3KJXA 1R63A 2EF8A 2PUGA 4X4DA 2BJCA 1BDIA 4PU4C 2LYQA 4FBIA 3CROL 3GN5A 1QP4A 2L49A 1WH8A 4F8DA 3QQ6A 4YBAA 4Z59A 2PUCA 1QP0A 1BDHA 2PUEA 4YG7B 1HF0A 2XCJA 2AW6A 2AXVA 2XIUA 3ZHMA 2CROA 1S7EA 4I6TA 3LFPA 1QP7A 3RZZA 3JXBC 3H5TA 4JQDA 1RZRD 2JCGA 4I6UA 3GN5B 2CSFA 1PNRA 1CJGA 2GRLA 1ZAYA 4X4FA 5A7LA 1YSEA 2WIUB 3QF3A 1PRVA 2PPXA 2FJRA 1JFSA 1QQAA 2BNMA 2LYRA 2EWTA 2IVBA 4X4CA 2KEKA 2H8RA 2IV1A 3OQOA 2HINA 3SCFA 4MCXA 2WUSR 3O9XA 2IUOA 1VPWA 4I6RA 1RPEL 2PUFA 1L1MA 1WIZA 3IVPA 4O8BA 2AWIA 1ZZ9A 4X4IA 2PUDA 1LQCA 1JWLA 1ZZBA 4OB4A 2PUAA 3FYAA 3GBFA 3JXDL 1NEQA 1ZPQA 4Z58A 1ZZ7A 2IVGA 3TRBA 2OFYA 3MLFA 4Y42A 1IC8A 4Z5DA 1OSLA 4GQMA 4J1WA 3F52A 4X4GA 4J1XA 3F51A 1ZS4A 3FYMA 2KEJA 3LISA 2LYJA 2LCVA 4Z5CA 2LYLA 1O4XA 2JVLA 4MCTA 1LLIA 3KXAA 1Y7YA 3CECA 2XJ3A 1PERL 1UXDA 3BD1A 1DWKA
chains in the Genus database with same CATH superfamily
4Z5HA 2ICPA 1LMB3 3BS3A 4FN3A 1NW3A 1ZZCA 3ME5A 4DE8A 1WH6A 4NDWA 3ZPXA 3OWQA 2MEZA 3VK0A 2R1JL 4YG1A 3D1NI 1ZUGA 2O4AA 3OMTA 4YARA 2HSGA 2LYSA 1POUA 2IU7A 1SQ8A 3G7DA 1PRAA 2OR1L 4X4HA 4IWRA 1ZZ8A 2VEOA 5GAGi 3PXPA 4EKGA 1JFTA 3QYXA 4IVZA 3VWSA 2ICTA 2GZUA 2LLWA 2PE5A 4GHJA 1AU7A 3OQMA 3KJXA 4PU4C 4FBIA 1QP4A 2PXTA 2PUCA 2AXVA 4ER6A 5DTRA 5DTMA 3GZCA 1RZRD 2CSFA 1YSEA 2WIUB 1PRVA 1JFSA 1QQAA 2KEKA 1HQ1A 2HINA 2IUOA 3GUUA 3KL4A 2PUDA 4OB4A 2PUAA 3GBFA 4Z58A 3TRBA 2OFYA 3QOXA 1OSLA 3QOWA 4EK9A 1LLIA 2JVLA 3KXAA 2XJ3A 1UXDA 4X4BA 2AXUA 1ZZ6A 1WETA 2R63A 4JCYA 2YBDA 5K98B 3GZDA 3SCHA 2AUWA 4EQZA 1B0NA 4YG4A 2PXLA 2PIJA 2ODRD 3LQXA 3R1FA 1ZVVA 4X4EA 2MQKA 3B7HA 1UTXA 3JXCL 1ADRA 1NERA 4PU3C 2L8NA 1OCTC 3L1PA 3G5GA 3ZKCA 2XSDC 2LLVA 1QPZA 3OQNA 1CQTA 3EUSA 1LCCA 3DNVB 2KEIA 1QQBA 1RIOA 3MEJA 2KPJA 3FMYA 4ER3A 2XI8A 3SR4A 1PRUA 5DT2A 2EF8A 4X4DA 3GN5A 3QQ6A 1QP0A 3OKZA 5DTQA 1HF0A 3ZHMA 2PXKA 2CROA 2PXFA 1MFQC 1QP7A 3JXBC 2JCGA 1PNRA 1ZAYA 5A7LA 3QF3A 2PXVA 3SX0A 2FJRA 2BNMA 2LYRA 2M4HA 3SCFA 2PXDA 2MXDA 1ZZ9A 4X4IA 1ZZBA 3JXDL 4HRAA 2HCNA 1ZPQA 2IVGA 4X4GA 5DRTA 3LISA 3TFLA 2HCSA 4Q2JA 3S8QA 1UXCA 2A6CA 3A9YA 3OP9A 1EFAA 4JCXA 2O49A 2BNNA 2LNMA 3UFDA 3U3WA 1DW9A 2PUBA 3GZDC 1JH9A 1Y9QA 2IVQA 2EBYA 3HZIB 3UWPA 3CLCA 1LCDA 2XXQA 1RZSA 4PU8A 1X57A 3SCGA 2FFHA 1GT0C 4I8TA 2BJCA 2L49A 4F8DA 2PUEA 4YG7B 2AW6A 5JUWA 3DM5A 3LFPA 2J7UA 3NZLA 1U2ZA 3H5TA 4I6UA 2GRLA 4X4FA 3CROL 5DSXA 2EWTA 2H8RA 3NDBB 3TEPA 4MCXA 3O9XA 3NROA 2HFZA 1VPWA 1RPEL 2PXQA 1L1MA 3IVPA 2AWIA 1LQCA 3QFIA 1JWLA 4ER5A 1ZZ7A 1DULA 4Y42A 4Z5DA 4J1WA 4J1XA 3F51A 1ZS4A 3FYMA 4Z5CA 2LCVA 1O4XA 4EKIA 2J7WA 3TELA 3PE5A 3F6WA 4WVLA 2B5AA 2LYPA 1RZRA 2LYKA 2V3CC 1X2LA 2GRMA 1R69A 3G0TA 1E3OC 3KZ3A 4PU7A 2PXUA 2BNOA 3ZHIA 1QZXA 2D5VA 2KZ8A 2AXZA 3A9XA 3BDNA 2JQEA 1XWRA 4IA8A 3R09A 3QWGA 5DRYA 2O38A 1R63A 2PUGA 1BDIA 2LYQA 1WH8A 2PXPA 4YBAA 1QB2A 4Z59A 1BDHA 2XCJA 2XIUA 1S7EA 4I6TA 4OBMA 3RZZA 4JQDA 4DE9A 3GN5B 1CJGA 4ER0A 2PPXA 2IVBA 4X4CA 2IV1A 3OQOA 2L1PA 2WUSR 2XXPA 5GAHi 4I6RA 3A9ZA 2PUFA 1WIZA 4O8BA 2XXAA 2PXBA 3FYAA 1NEQA 4EZIA 3NXHA 3MLFA 1IC8A 3M9LA 4GQMA 2PXEA 3F52A 2KEJA 2LYJA 2LYLA 4ER7A 4MCTA 1Y7YA 3CECA 1PERL 3BD1A 1DWKA
chains in the Genus database with same CATH topology
4Z5HA 2ICPA 1LMB3 4X4BA 3F6WA 2AXUA 3S8QA 3BS3A 1UXCA 2A6CA 1ZZ6A 2B5AA 2LYPA 1WETA 1RZRA 4FN3A 2LYKA 1X2LA 2R63A 4JCYA 2GRMA 5K98B 1R69A 3SCHA 2AUWA 1ZZCA 3OP9A 1B0NA 1WH6A 4NDWA 4YG4A 1E3OC 3KZ3A 4PU7A 2MEZA 2PIJA 3VK0A 2R1JL 4YG1A 3D1NI 1EFAA 1ZUGA 2O4AA 3OMTA 4YARA 2HSGA 2LYSA 4JCXA 2BNNA 2O49A 3R1FA 2BNOA 3UFDA 3ZHIA 3U3WA 1POUA 4X4EA 1ZVVA 2MQKA 2D5VA 2KZ8A 1DW9A 3B7HA 1UTXA 2AXZA 2IU7A 1SQ8A 3JXCL 2PUBA 1ADRA 1NERA 3G7DA 4PU3C 2L8NA 3BDNA 1JH9A 1PRAA 2OR1L 1Y9QA 4X4HA 2IVQA 3L1PA 1OCTC 4IWRA 3G5GA 1ZZ8A 1XWRA 3ZKCA 2EBYA 2XSDC 3HZIB 3CLCA 1LCDA 3PXPA 1QPZA 1RZSA 3OQNA 4PU8A 1CQTA 3EUSA 1JFTA 3QYXA 1LCCA 1X57A 3DNVB 4IVZA 2KEIA 2ICTA 1QQBA 1RIOA 2GZUA 2KPJA 2PE5A 3SCGA 3FMYA 4GHJA 2XI8A 1AU7A 4IA8A 3QWGA 3OQMA 1PRUA 2O38A 1GT0C 4I8TA 3KJXA 1R63A 2EF8A 2PUGA 4X4DA 2BJCA 1BDIA 4PU4C 2LYQA 4FBIA 3CROL 3GN5A 1QP4A 2L49A 1WH8A 4F8DA 3QQ6A 4YBAA 4Z59A 2PUCA 1QP0A 1BDHA 2PUEA 4YG7B 1HF0A 2XCJA 2AW6A 2AXVA 2XIUA 3ZHMA 2CROA 1S7EA 4I6TA 3LFPA 1QP7A 3RZZA 3JXBC 3H5TA 4JQDA 1RZRD 2JCGA 4I6UA 3GN5B 2CSFA 1PNRA 1CJGA 2GRLA 1ZAYA 4X4FA 5A7LA 1YSEA 2WIUB 3QF3A 1PRVA 2PPXA 2FJRA 1JFSA 1QQAA 2BNMA 2LYRA 2EWTA 2IVBA 4X4CA 2KEKA 2H8RA 2IV1A 3OQOA 2HINA 3SCFA 4MCXA 2WUSR 3O9XA 2IUOA 1VPWA 4I6RA 1RPEL 2PUFA 1L1MA 1WIZA 3IVPA 4O8BA 2AWIA 1ZZ9A 4X4IA 2PUDA 1LQCA 1JWLA 1ZZBA 4OB4A 2PUAA 3FYAA 3GBFA 3JXDL 1NEQA 1ZPQA 4Z58A 1ZZ7A 2IVGA 3TRBA 2OFYA 3MLFA 4Y42A 1IC8A 4Z5DA 1OSLA 4GQMA 4J1WA 3F52A 4X4GA 4J1XA 3F51A 1ZS4A 3FYMA 2KEJA 3LISA 2LYJA 2LCVA 4Z5CA 2LYLA 1O4XA 2JVLA 4MCTA 1LLIA 3KXAA 1Y7YA 3CECA 2XJ3A 1PERL 1UXDA 3BD1A 1DWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5H A;  2ICP A;  1LMB 3;  4X4B A;  3F6W A;  2AXU A;  3S8Q A;  3BS3 A;  1UXC A;  2A6C A;  1ZZ6 A;  2B5A A;  2LYP A;  1WET A;  1RZR A;  4FN3 A;  2LYK A;  1X2L A;  2R63 A;  4JCY A;  2GRM A;  5K98 B;  1R69 A;  3SCH A;  2AUW A;  1ZZC A;  3OP9 A;  1B0N A;  1WH6 A;  4NDW A;  4YG4 A;  1E3O C;  3KZ3 A;  4PU7 A;  2MEZ A;  2PIJ A;  3VK0 A;  2R1J L;  4YG1 A;  3D1N I;  1EFA A;  1ZUG A;  2O4A A;  3OMT A;  4YAR A;  2HSG A;  2LYS A;  4JCX A;  2BNN A;  2O49 A;  3R1F A;  2BNO A;  3UFD A;  3ZHI A;  3U3W A;  1POU A;  4X4E A;  1ZVV A;  2MQK A;  2D5V A;  2KZ8 A;  1DW9 A;  3B7H A;  1UTX A;  2AXZ A;  2IU7 A;  1SQ8 A;  3JXC L;  2PUB A;  1ADR A;  1NER A;  3G7D A;  4PU3 C;  2L8N A;  3BDN A;  1JH9 A;  1PRA A;  2OR1 L;  1Y9Q A;  4X4H A;  2IVQ A;  3L1P A;  1OCT C;  4IWR A;  3G5G A;  1ZZ8 A;  1XWR A;  3ZKC A;  2EBY A;  2XSD C;  3HZI B;  3CLC A;  1LCD A;  3PXP A;  1QPZ A;  1RZS A;  3OQN A;  4PU8 A;  1CQT A;  3EUS A;  1JFT A;  3QYX A;  1LCC A;  1X57 A;  3DNV B;  4IVZ A;  2KEI A;  2ICT A;  1QQB A;  1RIO A;  2GZU A;  2KPJ A;  2PE5 A;  3SCG A;  3FMY A;  4GHJ A;  2XI8 A;  1AU7 A;  4IA8 A;  3QWG A;  3OQM A;  1PRU A;  2O38 A;  1GT0 C;  4I8T A;  3KJX A;  1R63 A;  2EF8 A;  2PUG A;  4X4D A;  2BJC A;  1BDI A;  4PU4 C;  2LYQ A;  4FBI A;  3CRO L;  3GN5 A;  1QP4 A;  2L49 A;  1WH8 A;  4F8D A;  3QQ6 A;  4YBA A;  4Z59 A;  2PUC A;  1QP0 A;  1BDH A;  2PUE A;  4YG7 B;  1HF0 A;  2XCJ A;  2AW6 A;  2AXV A;  2XIU A;  3ZHM A;  2CRO A;  1S7E A;  4I6T A;  3LFP A;  1QP7 A;  3RZZ A;  3JXB C;  3H5T A;  4JQD A;  1RZR D;  2JCG A;  4I6U A;  3GN5 B;  2CSF A;  1PNR A;  1CJG A;  2GRL A;  1ZAY A;  4X4F A;  5A7L A;  1YSE A;  2WIU B;  3QF3 A;  1PRV A;  2PPX A;  2FJR A;  1JFS A;  1QQA A;  2BNM A;  2LYR A;  2EWT A;  2IVB A;  4X4C A;  2KEK A;  2H8R A;  2IV1 A;  3OQO A;  2HIN A;  3SCF A;  4MCX A;  2WUS R;  3O9X A;  2IUO A;  1VPW A;  4I6R A;  1RPE L;  2PUF A;  1L1M A;  1WIZ A;  3IVP A;  4O8B A;  2AWI A;  1ZZ9 A;  4X4I A;  2PUD A;  1LQC A;  1JWL A;  1ZZB A;  4OB4 A;  2PUA A;  3FYA A;  3GBF A;  3JXD L;  1NEQ A;  1ZPQ A;  4Z58 A;  1ZZ7 A;  2IVG A;  3TRB A;  2OFY A;  3MLF A;  4Y42 A;  1IC8 A;  4Z5D A;  1OSL A;  4GQM A;  4J1W A;  3F52 A;  4X4G A;  4J1X A;  3F51 A;  1ZS4 A;  3FYM A;  2KEJ A;  3LIS A;  2LYJ A;  2LCV A;  4Z5C A;  2LYL A;  1O4X A;  2JVL A;  4MCT A;  1LLI A;  3KXA A;  1Y7Y A;  3CEC A;  2XJ3 A;  1PER L;  1UXD A;  3BD1 A;  1DWK A; 
#chains in the Genus database with same CATH topology
 4Z5H A;  2ICP A;  1LMB 3;  3BS3 A;  4FN3 A;  1NW3 A;  1ZZC A;  3ME5 A;  4DE8 A;  1WH6 A;  4NDW A;  3ZPX A;  3OWQ A;  2MEZ A;  3VK0 A;  2R1J L;  4YG1 A;  3D1N I;  1ZUG A;  2O4A A;  3OMT A;  4YAR A;  2HSG A;  2LYS A;  1POU A;  2IU7 A;  1SQ8 A;  3G7D A;  1PRA A;  2OR1 L;  4X4H A;  4IWR A;  1ZZ8 A;  2VEO A;  5GAG i;  3PXP A;  4EKG A;  1JFT A;  3QYX A;  4IVZ A;  3VWS A;  2ICT A;  2GZU A;  2LLW A;  2PE5 A;  4GHJ A;  1AU7 A;  3OQM A;  3KJX A;  4PU4 C;  4FBI A;  1QP4 A;  2PXT A;  2PUC A;  2AXV A;  4ER6 A;  5DTR A;  5DTM A;  3GZC A;  1RZR D;  2CSF A;  1YSE A;  2WIU B;  1PRV A;  1JFS A;  1QQA A;  2KEK A;  1HQ1 A;  2HIN A;  2IUO A;  3GUU A;  3KL4 A;  2PUD A;  4OB4 A;  2PUA A;  3GBF A;  4Z58 A;  3TRB A;  2OFY A;  3QOX A;  1OSL A;  3QOW A;  4EK9 A;  1LLI A;  2JVL A;  3KXA A;  2XJ3 A;  1UXD A;  4X4B A;  2AXU A;  1ZZ6 A;  1WET A;  2R63 A;  4JCY A;  2YBD A;  5K98 B;  3GZD A;  3SCH A;  2AUW A;  4EQZ A;  1B0N A;  4YG4 A;  2PXL A;  2PIJ A;  2ODR D;  3LQX A;  3R1F A;  1ZVV A;  4X4E A;  2MQK A;  3B7H A;  1UTX A;  3JXC L;  1ADR A;  1NER A;  4PU3 C;  2L8N A;  1OCT C;  3L1P A;  3G5G A;  3ZKC A;  2XSD C;  2LLV A;  1QPZ A;  3OQN A;  1CQT A;  3EUS A;  1LCC A;  3DNV B;  2KEI A;  1QQB A;  1RIO A;  3MEJ A;  2KPJ A;  3FMY A;  4ER3 A;  2XI8 A;  3SR4 A;  1PRU A;  5DT2 A;  2EF8 A;  4X4D A;  3GN5 A;  3QQ6 A;  1QP0 A;  3OKZ A;  5DTQ A;  1HF0 A;  3ZHM A;  2PXK A;  2CRO A;  2PXF A;  1MFQ C;  1QP7 A;  3JXB C;  2JCG A;  1PNR A;  1ZAY A;  5A7L A;  3QF3 A;  2PXV A;  3SX0 A;  2FJR A;  2BNM A;  2LYR A;  2M4H A;  3SCF A;  2PXD A;  2MXD A;  1ZZ9 A;  4X4I A;  1ZZB A;  3JXD L;  4HRA A;  2HCN A;  1ZPQ A;  2IVG A;  4X4G A;  5DRT A;  3LIS A;  3TFL A;  2HCS A;  4Q2J A;  3S8Q A;  1UXC A;  2A6C A;  3A9Y A;  3OP9 A;  1EFA A;  4JCX A;  2O49 A;  2BNN A;  2LNM A;  3UFD A;  3U3W A;  1DW9 A;  2PUB A;  3GZD C;  1JH9 A;  1Y9Q A;  2IVQ A;  2EBY A;  3HZI B;  3UWP A;  3CLC A;  1LCD A;  2XXQ A;  1RZS A;  4PU8 A;  1X57 A;  3SCG A;  2FFH A;  1GT0 C;  4I8T A;  2BJC A;  2L49 A;  4F8D A;  2PUE A;  4YG7 B;  2AW6 A;  5JUW A;  3DM5 A;  3LFP A;  2J7U A;  3NZL A;  1U2Z A;  3H5T A;  4I6U A;  2GRL A;  4X4F A;  3CRO L;  5DSX A;  2EWT A;  2H8R A;  3NDB B;  3TEP A;  4MCX A;  3O9X A;  3NRO A;  2HFZ A;  1VPW A;  1RPE L;  2PXQ A;  1L1M A;  3IVP A;  2AWI A;  1LQC A;  3QFI A;  1JWL A;  4ER5 A;  1ZZ7 A;  1DUL A;  4Y42 A;  4Z5D A;  4J1W A;  4J1X A;  3F51 A;  1ZS4 A;  3FYM A;  4Z5C A;  2LCV A;  1O4X A;  4EKI A;  2J7W A;  3TEL A;  3PE5 A;  3F6W A;  4WVL A;  2B5A A;  2LYP A;  1RZR A;  2LYK A;  2V3C C;  1X2L A;  2GRM A;  1R69 A;  3G0T A;  1E3O C;  3KZ3 A;  4PU7 A;  2PXU A;  2BNO A;  3ZHI A;  1QZX A;  2D5V A;  2KZ8 A;  2AXZ A;  3A9X A;  3BDN A;  2JQE A;  1XWR A;  4IA8 A;  3R09 A;  3QWG A;  5DRY A;  2O38 A;  1R63 A;  2PUG A;  1BDI A;  2LYQ A;  1WH8 A;  2PXP A;  4YBA A;  1QB2 A;  4Z59 A;  1BDH A;  2XCJ A;  2XIU A;  1S7E A;  4I6T A;  4OBM A;  3RZZ A;  4JQD A;  4DE9 A;  3GN5 B;  1CJG A;  4ER0 A;  2PPX A;  2IVB A;  4X4C A;  2IV1 A;  3OQO A;  2L1P A;  2WUS R;  2XXP A;  5GAH i;  4I6R A;  3A9Z A;  2PUF A;  1WIZ A;  4O8B A;  2XXA A;  2PXB A;  3FYA A;  1NEQ A;  4EZI A;  3NXH A;  3MLF A;  1IC8 A;  3M9L A;  4GQM A;  2PXE A;  3F52 A;  2KEJ A;  2LYJ A;  2LYL A;  4ER7 A;  4MCT A;  1Y7Y A;  3CEC A;  1PER L;  3BD1 A;  1DWK A; 
#chains in the Genus database with same CATH homology
 4Z5H A;  2ICP A;  1LMB 3;  4X4B A;  3F6W A;  2AXU A;  3S8Q A;  3BS3 A;  1UXC A;  2A6C A;  1ZZ6 A;  2B5A A;  2LYP A;  1WET A;  1RZR A;  4FN3 A;  2LYK A;  1X2L A;  2R63 A;  4JCY A;  2GRM A;  5K98 B;  1R69 A;  3SCH A;  2AUW A;  1ZZC A;  3OP9 A;  1B0N A;  1WH6 A;  4NDW A;  4YG4 A;  1E3O C;  3KZ3 A;  4PU7 A;  2MEZ A;  2PIJ A;  3VK0 A;  2R1J L;  4YG1 A;  3D1N I;  1EFA A;  1ZUG A;  2O4A A;  3OMT A;  4YAR A;  2HSG A;  2LYS A;  4JCX A;  2BNN A;  2O49 A;  3R1F A;  2BNO A;  3UFD A;  3ZHI A;  3U3W A;  1POU A;  4X4E A;  1ZVV A;  2MQK A;  2D5V A;  2KZ8 A;  1DW9 A;  3B7H A;  1UTX A;  2AXZ A;  2IU7 A;  1SQ8 A;  3JXC L;  2PUB A;  1ADR A;  1NER A;  3G7D A;  4PU3 C;  2L8N A;  3BDN A;  1JH9 A;  1PRA A;  2OR1 L;  1Y9Q A;  4X4H A;  2IVQ A;  3L1P A;  1OCT C;  4IWR A;  3G5G A;  1ZZ8 A;  1XWR A;  3ZKC A;  2EBY A;  2XSD C;  3HZI B;  3CLC A;  1LCD A;  3PXP A;  1QPZ A;  1RZS A;  3OQN A;  4PU8 A;  1CQT A;  3EUS A;  1JFT A;  3QYX A;  1LCC A;  1X57 A;  3DNV B;  4IVZ A;  2KEI A;  2ICT A;  1QQB A;  1RIO A;  2GZU A;  2KPJ A;  2PE5 A;  3SCG A;  3FMY A;  4GHJ A;  2XI8 A;  1AU7 A;  4IA8 A;  3QWG A;  3OQM A;  1PRU A;  2O38 A;  1GT0 C;  4I8T A;  3KJX A;  1R63 A;  2EF8 A;  2PUG A;  4X4D A;  2BJC A;  1BDI A;  4PU4 C;  2LYQ A;  4FBI A;  3CRO L;  3GN5 A;  1QP4 A;  2L49 A;  1WH8 A;  4F8D A;  3QQ6 A;  4YBA A;  4Z59 A;  2PUC A;  1QP0 A;  1BDH A;  2PUE A;  4YG7 B;  1HF0 A;  2XCJ A;  2AW6 A;  2AXV A;  2XIU A;  3ZHM A;  2CRO A;  1S7E A;  4I6T A;  3LFP A;  1QP7 A;  3RZZ A;  3JXB C;  3H5T A;  4JQD A;  1RZR D;  2JCG A;  4I6U A;  3GN5 B;  2CSF A;  1PNR A;  1CJG A;  2GRL A;  1ZAY A;  4X4F A;  5A7L A;  1YSE A;  2WIU B;  3QF3 A;  1PRV A;  2PPX A;  2FJR A;  1JFS A;  1QQA A;  2BNM A;  2LYR A;  2EWT A;  2IVB A;  4X4C A;  2KEK A;  2H8R A;  2IV1 A;  3OQO A;  2HIN A;  3SCF A;  4MCX A;  2WUS R;  3O9X A;  2IUO A;  1VPW A;  4I6R A;  1RPE L;  2PUF A;  1L1M A;  1WIZ A;  3IVP A;  4O8B A;  2AWI A;  1ZZ9 A;  4X4I A;  2PUD A;  1LQC A;  1JWL A;  1ZZB A;  4OB4 A;  2PUA A;  3FYA A;  3GBF A;  3JXD L;  1NEQ A;  1ZPQ A;  4Z58 A;  1ZZ7 A;  2IVG A;  3TRB A;  2OFY A;  3MLF A;  4Y42 A;  1IC8 A;  4Z5D A;  1OSL A;  4GQM A;  4J1W A;  3F52 A;  4X4G A;  4J1X A;  3F51 A;  1ZS4 A;  3FYM A;  2KEJ A;  3LIS A;  2LYJ A;  2LCV A;  4Z5C A;  2LYL A;  1O4X A;  2JVL A;  4MCT A;  1LLI A;  3KXA A;  1Y7Y A;  3CEC A;  2XJ3 A;  1PER L;  1UXD A;  3BD1 A;  1DWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...