2LNMA

Solution structure of the c-terminal np-repeat domain of tic40, a co-chaperone during protein import into chloroplasts
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal NP-repeat domain of Tic40, a co-chaperone during protein import into chloroplasts.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein transport
molecule keywords Protein TIC 40, chloroplastic
total genus 17
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17830 STI1 STI1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.100 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2lnmA00
2LLWA 2LNMA 2LLVA
chains in the Genus database with same CATH superfamily
3OKZA 1AU7A 1WH8A 2PUCA 1QB2A 3GUUA 1HF0A 1RZRD 4I6RA 1POUA 1X57A 2PXKA 2PUDA 1U2ZA 4I8TA 2XJ3A 4FN3A 1E3OC 3LFPA 1PNRA 3GZDC 4O8BA 2XIUA 2OR1L 1OCTC 5A7LA 4X4CA 3KZ3A 3ZHMA 2XXPA 1DULA 2IV1A 2OFYA 2PXPA 1QP7A 1QQBA 3M9LA 3GBFA 1ZZ8A 2A6CA 3ZPXA 3B7HA 2LYRA 3QFIA 4Q2JA 3GN5A 4Z58A 1LMB3 1UXCA 2LYQA 3KJXA 1WETA 1OSLA 2PXLA 3OMTA 3UFDA 2EWTA 2O38A 1X2LA 5K98B 3O9XA 4X4HA 3RZZA 2PIJA 2KPJA 4GQMA 4JCYA 1QZXA 3KL4A 2PUBA 1UXDA 5DSXA 2AXUA 3LISA 2IVGA 4GHJA 2BJCA 5DT2A 2LYJA 2KEIA 4JCXA 3CECA 4Z5HA 2J7UA 2KEJA 3OQMA 2PUEA 3MEJA 1CJGA 3TFLA 1LCCA 3H5TA 3F6WA 2XXAA 3SX0A 3L1PA 4JQDA 4IVZA 3ZKCA 2PXFA 4EZIA 2V3CC 4ER7A 1LLIA 2FFHA 3F51A 3CLCA 2XI8A 1RZRA 4Z59A 4YG1A 1HQ1A 2LLWA 3A9ZA 3FYAA 4YG4A 1Y7YA 3TELA 3ME5A 1RIOA 2IU7A 3GZDA 2HINA 2MXDA 4WVLA 1ADRA 4Y42A 1ZVVA 3BD1A 2LYSA 1SQ8A 2HCSA 1ZZBA 3SCFA 5GAHi 1R69A 2CSFA 1ZAYA 4I6UA 2KZ8A 1QP4A 4EKGA 4ER3A 2H8RA 1S7EA 3CROL 3TRBA 1NEQA 3U3WA 3ZHIA 3NXHA 1ZZCA 3PE5A 3QF3A 4OB4A 4EKIA 2O49A 2BNOA 4X4BA 3F52A 4MCTA 1RPEL 2PUAA 4ER0A 4J1XA 3HZIB 2PXVA 5DTMA 4IA8A 3SCHA 3VK0A 4PU4C 2AWIA 1ZZ7A 3R09A 4Z5CA 3A9XA 2JCGA 3R1FA 1ZS4A 4X4GA 3IVPA 2IVQA 3FMYA 2PXEA 3GN5B 3UWPA 3NZLA 3NDBB 4EQZA 2GRMA 4J1WA 2HFZA 1ZPQA 5DRYA 2ODRD 5GAGi 3QWGA 3LQXA 1L1MA 1LQCA 2JVLA 2PUFA 2LYKA 1R63A 2O4AA 4F8DA 4X4EA 1QP0A 3JXBC 3D1NI 1JH9A 2VEOA 4X4IA 2AXVA 1B0NA 3G5GA 3JXDL 2KEKA 2XSDC 3QOXA 5DRTA 2B5AA 2IVBA 2L49A 4NDWA 1ZZ9A 2HSGA 1LCDA 2GRLA 2MQKA 1WIZA 1NERA 4MCXA 3OQOA 2EF8A 1GT0C 1BDHA 4PU7A 2L8NA 4X4FA 4DE9A 1DWKA 2WIUB 1QQAA 3NROA 1XWRA 3QYXA 2PE5A 3OP9A 2XXQA 1IC8A 1DW9A 5JUWA 3DNVB 3OWQA 3MLFA 3BS3A 3G7DA 2GZUA 1UTXA 2XCJA 1JWLA 2AUWA 3OQNA 2JQEA 4HRAA 4IWRA 2LNMA 1ZZ6A 2BNMA 4ER5A 1WH6A 2IUOA 4Z5DA 1BDIA 4X4DA 2CROA 1PRVA 2PXDA 3S8QA 5DTRA 1EFAA 2R63A 2M4HA 2EBYA 3QOWA 2PXQA 1RZSA 2L1PA 1PRUA 1PERL 1QPZA 2FJRA 2LYLA 4YG7B 2BNNA 4DE8A 3FYMA 1MFQC 4YARA 2YBDA 3TEPA 2AW6A 1PRAA 3EUSA 3SR4A 2D5VA 3KXAA 3GZCA 1VPWA 2MEZA 2HCNA 2AXZA 4ER6A 1JFTA 2PXTA 2LCVA 2PUGA 3G0TA 1O4XA 2ICPA 3JXCL 2J7WA 2LLVA 2PXUA 5DTQA 1ZUGA 4PU3C 2R1JL 2ICTA 1NW3A 1YSEA 1JFSA 2LYPA 3QQ6A 2PXBA 1Y9QA 4PU8A 1CQTA 3DM5A 2WUSR 4EK9A 4FBIA 3A9YA 3VWSA 4OBMA 3SCGA 4I6TA 3PXPA 3BDNA 2PPXA 4YBAA
chains in the Genus database with same CATH topology
3OKZA 2HFZA 3QOWA 4Q2JA 2VEOA 3NXHA 2L1PA 4HRAA 4WVLA 4ER7A 2LNMA 3GZCA 5DRYA 3QOXA 2ODRD 2HCNA 2HCSA 5DRTA 4ER5A 2J7UA 3GZDC 3PE5A 4DE9A 4ER6A 4EKIA 5DSXA 3R09A 3A9XA 4EK9A 3GUUA 2LLWA 3A9ZA 3G0TA 3NROA 2XXPA 4DE8A 4EKGA 4EZIA 2XXQA 3MEJA 4ER3A 3A9YA 3TFLA 3VWSA 2YBDA 3TEPA 2J7WA 2LLVA 5DT2A 3TELA 4OBMA 5DTQA 5DTRA 4ER0A 5JUWA 3ME5A 3OWQA 3UWPA 3M9LA 1U2ZA 3NZLA 3GZDA 2M4HA 1NW3A 3SX0A 4EQZA 3SR4A 5DTMA 2MXDA 3ZPXA 3QFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLW A;  2LNM A;  2LLV A; 
#chains in the Genus database with same CATH topology
 3OKZ A;  1AU7 A;  1WH8 A;  2PUC A;  1QB2 A;  3GUU A;  1HF0 A;  1RZR D;  4I6R A;  1POU A;  1X57 A;  2PXK A;  2PUD A;  1U2Z A;  4I8T A;  2XJ3 A;  4FN3 A;  1E3O C;  3LFP A;  1PNR A;  3GZD C;  4O8B A;  2XIU A;  2OR1 L;  1OCT C;  5A7L A;  4X4C A;  3KZ3 A;  3ZHM A;  2XXP A;  1DUL A;  2IV1 A;  2OFY A;  2PXP A;  1QP7 A;  1QQB A;  3M9L A;  3GBF A;  1ZZ8 A;  2A6C A;  3ZPX A;  3B7H A;  2LYR A;  3QFI A;  4Q2J A;  3GN5 A;  4Z58 A;  1LMB 3;  1UXC A;  2LYQ A;  3KJX A;  1WET A;  1OSL A;  2PXL A;  3OMT A;  3UFD A;  2EWT A;  2O38 A;  1X2L A;  5K98 B;  3O9X A;  4X4H A;  3RZZ A;  2PIJ A;  2KPJ A;  4GQM A;  4JCY A;  1QZX A;  3KL4 A;  2PUB A;  1UXD A;  5DSX A;  2AXU A;  3LIS A;  2IVG A;  4GHJ A;  2BJC A;  5DT2 A;  2LYJ A;  2KEI A;  4JCX A;  3CEC A;  4Z5H A;  2J7U A;  2KEJ A;  3OQM A;  2PUE A;  3MEJ A;  1CJG A;  3TFL A;  1LCC A;  3H5T A;  3F6W A;  2XXA A;  3SX0 A;  3L1P A;  4JQD A;  4IVZ A;  3ZKC A;  2PXF A;  4EZI A;  2V3C C;  4ER7 A;  1LLI A;  2FFH A;  3F51 A;  3CLC A;  2XI8 A;  1RZR A;  4Z59 A;  4YG1 A;  1HQ1 A;  2LLW A;  3A9Z A;  3FYA A;  4YG4 A;  1Y7Y A;  3TEL A;  3ME5 A;  1RIO A;  2IU7 A;  3GZD A;  2HIN A;  2MXD A;  4WVL A;  1ADR A;  4Y42 A;  1ZVV A;  3BD1 A;  2LYS A;  1SQ8 A;  2HCS A;  1ZZB A;  3SCF A;  5GAH i;  1R69 A;  2CSF A;  1ZAY A;  4I6U A;  2KZ8 A;  1QP4 A;  4EKG A;  4ER3 A;  2H8R A;  1S7E A;  3CRO L;  3TRB A;  1NEQ A;  3U3W A;  3ZHI A;  3NXH A;  1ZZC A;  3PE5 A;  3QF3 A;  4OB4 A;  4EKI A;  2O49 A;  2BNO A;  4X4B A;  3F52 A;  4MCT A;  1RPE L;  2PUA A;  4ER0 A;  4J1X A;  3HZI B;  2PXV A;  5DTM A;  4IA8 A;  3SCH A;  3VK0 A;  4PU4 C;  2AWI A;  1ZZ7 A;  3R09 A;  4Z5C A;  3A9X A;  2JCG A;  3R1F A;  1ZS4 A;  4X4G A;  3IVP A;  2IVQ A;  3FMY A;  2PXE A;  3GN5 B;  3UWP A;  3NZL A;  3NDB B;  4EQZ A;  2GRM A;  4J1W A;  2HFZ A;  1ZPQ A;  5DRY A;  2ODR D;  5GAG i;  3QWG A;  3LQX A;  1L1M A;  1LQC A;  2JVL A;  2PUF A;  2LYK A;  1R63 A;  2O4A A;  4F8D A;  4X4E A;  1QP0 A;  3JXB C;  3D1N I;  1JH9 A;  2VEO A;  4X4I A;  2AXV A;  1B0N A;  3G5G A;  3JXD L;  2KEK A;  2XSD C;  3QOX A;  5DRT A;  2B5A A;  2IVB A;  2L49 A;  4NDW A;  1ZZ9 A;  2HSG A;  1LCD A;  2GRL A;  2MQK A;  1WIZ A;  1NER A;  4MCX A;  3OQO A;  2EF8 A;  1GT0 C;  1BDH A;  4PU7 A;  2L8N A;  4X4F A;  4DE9 A;  1DWK A;  2WIU B;  1QQA A;  3NRO A;  1XWR A;  3QYX A;  2PE5 A;  3OP9 A;  2XXQ A;  1IC8 A;  1DW9 A;  5JUW A;  3DNV B;  3OWQ A;  3MLF A;  3BS3 A;  3G7D A;  2GZU A;  1UTX A;  2XCJ A;  1JWL A;  2AUW A;  3OQN A;  2JQE A;  4HRA A;  4IWR A;  2LNM A;  1ZZ6 A;  2BNM A;  4ER5 A;  1WH6 A;  2IUO A;  4Z5D A;  1BDI A;  4X4D A;  2CRO A;  1PRV A;  2PXD A;  3S8Q A;  5DTR A;  1EFA A;  2R63 A;  2M4H A;  2EBY A;  3QOW A;  2PXQ A;  1RZS A;  2L1P A;  1PRU A;  1PER L;  1QPZ A;  2FJR A;  2LYL A;  4YG7 B;  2BNN A;  4DE8 A;  3FYM A;  1MFQ C;  4YAR A;  2YBD A;  3TEP A;  2AW6 A;  1PRA A;  3EUS A;  3SR4 A;  2D5V A;  3KXA A;  3GZC A;  1VPW A;  2MEZ A;  2HCN A;  2AXZ A;  4ER6 A;  1JFT A;  2PXT A;  2LCV A;  2PUG A;  3G0T A;  1O4X A;  2ICP A;  3JXC L;  2J7W A;  2LLV A;  2PXU A;  5DTQ A;  1ZUG A;  4PU3 C;  2R1J L;  2ICT A;  1NW3 A;  1YSE A;  1JFS A;  2LYP A;  3QQ6 A;  2PXB A;  1Y9Q A;  4PU8 A;  1CQT A;  3DM5 A;  2WUS R;  4EK9 A;  4FBI A;  3A9Y A;  3VWS A;  4OBM A;  3SCG A;  4I6T A;  3PXP A;  3BDN A;  2PPX A;  4YBA A; 
#chains in the Genus database with same CATH homology
 3OKZ A;  2HFZ A;  3QOW A;  4Q2J A;  2VEO A;  3NXH A;  2L1P A;  4HRA A;  4WVL A;  4ER7 A;  2LNM A;  3GZC A;  5DRY A;  3QOX A;  2ODR D;  2HCN A;  2HCS A;  5DRT A;  4ER5 A;  2J7U A;  3GZD C;  3PE5 A;  4DE9 A;  4ER6 A;  4EKI A;  5DSX A;  3R09 A;  3A9X A;  4EK9 A;  3GUU A;  2LLW A;  3A9Z A;  3G0T A;  3NRO A;  2XXP A;  4DE8 A;  4EKG A;  4EZI A;  2XXQ A;  3MEJ A;  4ER3 A;  3A9Y A;  3TFL A;  3VWS A;  2YBD A;  3TEP A;  2J7W A;  2LLV A;  5DT2 A;  3TEL A;  4OBM A;  5DTQ A;  5DTR A;  4ER0 A;  5JUW A;  3ME5 A;  3OWQ A;  3UWP A;  3M9L A;  1U2Z A;  3NZL A;  3GZD A;  2M4H A;  1NW3 A;  3SX0 A;  4EQZ A;  3SR4 A;  5DTM A;  2MXD A;  3ZPX A;  3QFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...