3OKZA

Crystal structure of protein gbs0355 from streptococcus agalactiae, northeast structural genomics consortium target sar127
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
297
structure length
297
Chain Sequence
KSKSHAIEETKPFSILLMGVDTGSEHRKSKWSGNSDSMILVTINPKTNKTTMTSLERDVLIKLSGPKNNGQTGVEAKLNAAYASGGAEMALMTVQDLLDINVDYFMQINMQGLVDLVNAVGGITVTNKFDFPISIAANEPEYKAVVEPGTHKINGEQALVYSRMRYDDPEGDYGRQKRQREVIQKVLKKILALNSISSYKKILSAVSNNMQTNIEISSKTIPNLLAYKDSLEHIKSYQLKGEDATLSDGGSYQILTKKHLLAVQNRIKKELDKKRSKTLKTSAILYEDYYGLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target SaR127
rcsb
source organism Streptococcus agalactiae
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein gbs0355
total genus 81
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03816 LytR_cpsA_psr Cell envelope-related transcriptional attenuator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.150 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3okzA00
2XXPA 3PE5A 3TEPA 4DE8A 4DE9A 3NXHA 3OWQA 3TFLA 4OBMA 3OKZA 3QFIA 3NROA 2XXQA 3MEJA 3TELA
chains in the Genus database with same CATH superfamily
1IC8A 3CECA 4FBIA 2JCGA 2GZUA 3SCFA 1ZZ8A 2IVGA 3UFDA 2XXQA 1JWLA 2R63A 1ZVVA 2LLWA 3KZ3A 3M9LA 2OFYA 1U2ZA 2LYSA 3G7DA 4JQDA 1LQCA 3A9YA 3GUUA 1XWRA 3FYMA 4O8BA 2LCVA 4WVLA 3CROL 1B0NA 2PXFA 3LQXA 3OP9A 1CQTA 3F52A 4PU7A 1RZRA 4MCTA 1OCTC 4ER0A 4I8TA 1LMB3 2ODRD 3GZCA 3HZIB 2AXVA 1PERL 2MQKA 3ZPXA 4OBMA 3ME5A 3F51A 2PXTA 3OKZA 1QPZA 2XXPA 2CROA 3PXPA 3B7HA 5A7LA 3QOXA 4PU3C 1UXCA 2PXPA 4DE8A 2HCNA 2AXUA 3OMTA 1NEQA 2L8NA 3ZHIA 2AW6A 4Z59A 2IU7A 1JFTA 1LLIA 5DTRA 2JQEA 1LCCA 2EF8A 3BS3A 1QQAA 4PU4C 2R1JL 2MXDA 2IVBA 5DTMA 1HQ1A 2PXUA 4X4DA 4Z58A 4HRAA 3FMYA 1QZXA 4YG4A 4YG7B 4IVZA 3TRBA 3A9ZA 1QP4A 4EK9A 2KEKA 2XCJA 4X4GA 3NDBB 2J7WA 1AU7A 4EQZA 2PXDA 2AXZA 1ZZBA 3TFLA 2AWIA 1QQBA 1Y9QA 5GAHi 1ADRA 3U3WA 2IUOA 2L1PA 3VK0A 2PXVA 1POUA 2PUCA 2LNMA 3NXHA 2L49A 2BNMA 3O9XA 3LFPA 4I6UA 1HF0A 3JXBC 1DWKA 2HSGA 5JUWA 4ER6A 3TEPA 2BNOA 1UTXA 2LYRA 4IA8A 3MLFA 2LYQA 4X4EA 2PUBA 1X57A 2VEOA 1ZZCA 4I6TA 2PUGA 4EKIA 2KEJA 1NERA 1PNRA 3BD1A 4GHJA 2CSFA 4JCYA 3NROA 2V3CC 4X4IA 2HINA 2IV1A 1R69A 2PUDA 3EUSA 2O49A 3TELA 2PXKA 1QP7A 4I6RA 4X4FA 2GRLA 4OB4A 3SX0A 2AUWA 1DW9A 1YSEA 4X4BA 2HFZA 4Z5DA 3OQOA 2WUSR 1RPEL 3CLCA 3H5TA 3ZHMA 3UWPA 2PUFA 3GN5B 2O4AA 3L1PA 3JXCL 2PIJA 2OR1L 3IVPA 3KL4A 1DULA 2LYKA 3SCHA 2GRMA 2HCSA 1Y7YA 5GAGi 1BDHA 1LCDA 4DE9A 2XIUA 4X4CA 4Q2JA 2EWTA 1GT0C 1ZPQA 1RZRD 1WH6A 1RZSA 3SCGA 2BJCA 4IWRA 1MFQC 5DT2A 1JFSA 2LYPA 2PUAA 2PXBA 1ZZ9A 1JH9A 2D5VA 2PXQA 2IVQA 1PRAA 3GBFA 1UXDA 1X2LA 4YG1A 2EBYA 5DRYA 2LYLA 3BDNA 3LISA 3QF3A 4F8DA 2PE5A 2M4HA 4EZIA 1ZS4A 1E3OC 4FN3A 2WIUB 1WIZA 2J7UA 2PUEA 2KPJA 3QYXA 2A6CA 2XJ3A 1OSLA 3OQMA 2B5AA 1ZUGA 1WETA 1PRVA 3OWQA 3QWGA 2H8RA 1S7EA 1QP0A 4NDWA 1PRUA 4ER5A 4MCXA 5DSXA 2XSDC 3DM5A 3QFIA 3OQNA 3KXAA 1WH8A 3GN5A 1R63A 1BDIA 2KZ8A 3JXDL 2PXLA 1SQ8A 4PU8A 3R1FA 3G0TA 3MEJA 4Y42A 4EKGA 4ER3A 4JCXA 5DTQA 3ZKCA 2FJRA 4ER7A 2ICTA 3GZDC 3PE5A 2XXAA 1ZAYA 5DRTA 1VPWA 3VWSA 3D1NI 4YBAA 4Z5CA 1ZZ6A 2BNNA 2ICPA 3SR4A 4X4HA 2O38A 4J1XA 4YARA 1RIOA 3KJXA 3A9XA 2YBDA 2PXEA 1EFAA 3GZDA 2KEIA 3R09A 5K98B 2LYJA 1CJGA 3NZLA 2LLVA 3G5GA 3RZZA 3FYAA 1O4XA 1L1MA 3DNVB 2JVLA 1ZZ7A 4J1WA 4Z5HA 4GQMA 2XI8A 3F6WA 1QB2A 2PPXA 3S8QA 3QQ6A 1NW3A 2FFHA 2MEZA 3QOWA
chains in the Genus database with same CATH topology
3SX0A 5DSXA 4DE9A 2VEOA 2J7UA 4EKGA 3OKZA 3SR4A 4Q2JA 2HFZA 2XXQA 3QFIA 3A9ZA 5DTRA 3A9XA 4ER3A 2YBDA 2XXPA 3GZDA 5DTQA 2LLWA 4EKIA 3M9LA 4EZIA 4ER0A 4ER7A 2L1PA 5JUWA 1U2ZA 3R09A 3QOXA 3NROA 4ER6A 5DRYA 3UWPA 4EK9A 3GZDC 3PE5A 3TEPA 3A9YA 4DE8A 2MXDA 2LNMA 3GUUA 3NXHA 2HCNA 3NZLA 2J7WA 2ODRD 3GZCA 2LLVA 3OWQA 4EQZA 5DTMA 5DRTA 3TELA 1NW3A 3G0TA 5DT2A 3VWSA 3TFLA 2HCSA 4WVLA 4OBMA 3ZPXA 4ER5A 4HRAA 3MEJA 3ME5A 2M4HA 3QOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXP A;  3PE5 A;  3TEP A;  4DE8 A;  4DE9 A;  3NXH A;  3OWQ A;  3TFL A;  4OBM A;  3OKZ A;  3QFI A;  3NRO A;  2XXQ A;  3MEJ A;  3TEL A; 
#chains in the Genus database with same CATH topology
 1IC8 A;  3CEC A;  4FBI A;  2JCG A;  2GZU A;  3SCF A;  1ZZ8 A;  2IVG A;  3UFD A;  2XXQ A;  1JWL A;  2R63 A;  1ZVV A;  2LLW A;  3KZ3 A;  3M9L A;  2OFY A;  1U2Z A;  2LYS A;  3G7D A;  4JQD A;  1LQC A;  3A9Y A;  3GUU A;  1XWR A;  3FYM A;  4O8B A;  2LCV A;  4WVL A;  3CRO L;  1B0N A;  2PXF A;  3LQX A;  3OP9 A;  1CQT A;  3F52 A;  4PU7 A;  1RZR A;  4MCT A;  1OCT C;  4ER0 A;  4I8T A;  1LMB 3;  2ODR D;  3GZC A;  3HZI B;  2AXV A;  1PER L;  2MQK A;  3ZPX A;  4OBM A;  3ME5 A;  3F51 A;  2PXT A;  3OKZ A;  1QPZ A;  2XXP A;  2CRO A;  3PXP A;  3B7H A;  5A7L A;  3QOX A;  4PU3 C;  1UXC A;  2PXP A;  4DE8 A;  2HCN A;  2AXU A;  3OMT A;  1NEQ A;  2L8N A;  3ZHI A;  2AW6 A;  4Z59 A;  2IU7 A;  1JFT A;  1LLI A;  5DTR A;  2JQE A;  1LCC A;  2EF8 A;  3BS3 A;  1QQA A;  4PU4 C;  2R1J L;  2MXD A;  2IVB A;  5DTM A;  1HQ1 A;  2PXU A;  4X4D A;  4Z58 A;  4HRA A;  3FMY A;  1QZX A;  4YG4 A;  4YG7 B;  4IVZ A;  3TRB A;  3A9Z A;  1QP4 A;  4EK9 A;  2KEK A;  2XCJ A;  4X4G A;  3NDB B;  2J7W A;  1AU7 A;  4EQZ A;  2PXD A;  2AXZ A;  1ZZB A;  3TFL A;  2AWI A;  1QQB A;  1Y9Q A;  5GAH i;  1ADR A;  3U3W A;  2IUO A;  2L1P A;  3VK0 A;  2PXV A;  1POU A;  2PUC A;  2LNM A;  3NXH A;  2L49 A;  2BNM A;  3O9X A;  3LFP A;  4I6U A;  1HF0 A;  3JXB C;  1DWK A;  2HSG A;  5JUW A;  4ER6 A;  3TEP A;  2BNO A;  1UTX A;  2LYR A;  4IA8 A;  3MLF A;  2LYQ A;  4X4E A;  2PUB A;  1X57 A;  2VEO A;  1ZZC A;  4I6T A;  2PUG A;  4EKI A;  2KEJ A;  1NER A;  1PNR A;  3BD1 A;  4GHJ A;  2CSF A;  4JCY A;  3NRO A;  2V3C C;  4X4I A;  2HIN A;  2IV1 A;  1R69 A;  2PUD A;  3EUS A;  2O49 A;  3TEL A;  2PXK A;  1QP7 A;  4I6R A;  4X4F A;  2GRL A;  4OB4 A;  3SX0 A;  2AUW A;  1DW9 A;  1YSE A;  4X4B A;  2HFZ A;  4Z5D A;  3OQO A;  2WUS R;  1RPE L;  3CLC A;  3H5T A;  3ZHM A;  3UWP A;  2PUF A;  3GN5 B;  2O4A A;  3L1P A;  3JXC L;  2PIJ A;  2OR1 L;  3IVP A;  3KL4 A;  1DUL A;  2LYK A;  3SCH A;  2GRM A;  2HCS A;  1Y7Y A;  5GAG i;  1BDH A;  1LCD A;  4DE9 A;  2XIU A;  4X4C A;  4Q2J A;  2EWT A;  1GT0 C;  1ZPQ A;  1RZR D;  1WH6 A;  1RZS A;  3SCG A;  2BJC A;  4IWR A;  1MFQ C;  5DT2 A;  1JFS A;  2LYP A;  2PUA A;  2PXB A;  1ZZ9 A;  1JH9 A;  2D5V A;  2PXQ A;  2IVQ A;  1PRA A;  3GBF A;  1UXD A;  1X2L A;  4YG1 A;  2EBY A;  5DRY A;  2LYL A;  3BDN A;  3LIS A;  3QF3 A;  4F8D A;  2PE5 A;  2M4H A;  4EZI A;  1ZS4 A;  1E3O C;  4FN3 A;  2WIU B;  1WIZ A;  2J7U A;  2PUE A;  2KPJ A;  3QYX A;  2A6C A;  2XJ3 A;  1OSL A;  3OQM A;  2B5A A;  1ZUG A;  1WET A;  1PRV A;  3OWQ A;  3QWG A;  2H8R A;  1S7E A;  1QP0 A;  4NDW A;  1PRU A;  4ER5 A;  4MCX A;  5DSX A;  2XSD C;  3DM5 A;  3QFI A;  3OQN A;  3KXA A;  1WH8 A;  3GN5 A;  1R63 A;  1BDI A;  2KZ8 A;  3JXD L;  2PXL A;  1SQ8 A;  4PU8 A;  3R1F A;  3G0T A;  3MEJ A;  4Y42 A;  4EKG A;  4ER3 A;  4JCX A;  5DTQ A;  3ZKC A;  2FJR A;  4ER7 A;  2ICT A;  3GZD C;  3PE5 A;  2XXA A;  1ZAY A;  5DRT A;  1VPW A;  3VWS A;  3D1N I;  4YBA A;  4Z5C A;  1ZZ6 A;  2BNN A;  2ICP A;  3SR4 A;  4X4H A;  2O38 A;  4J1X A;  4YAR A;  1RIO A;  3KJX A;  3A9X A;  2YBD A;  2PXE A;  1EFA A;  3GZD A;  2KEI A;  3R09 A;  5K98 B;  2LYJ A;  1CJG A;  3NZL A;  2LLV A;  3G5G A;  3RZZ A;  3FYA A;  1O4X A;  1L1M A;  3DNV B;  2JVL A;  1ZZ7 A;  4J1W A;  4Z5H A;  4GQM A;  2XI8 A;  3F6W A;  1QB2 A;  2PPX A;  3S8Q A;  3QQ6 A;  1NW3 A;  2FFH A;  2MEZ A;  3QOW A; 
#chains in the Genus database with same CATH homology
 3SX0 A;  5DSX A;  4DE9 A;  2VEO A;  2J7U A;  4EKG A;  3OKZ A;  3SR4 A;  4Q2J A;  2HFZ A;  2XXQ A;  3QFI A;  3A9Z A;  5DTR A;  3A9X A;  4ER3 A;  2YBD A;  2XXP A;  3GZD A;  5DTQ A;  2LLW A;  4EKI A;  3M9L A;  4EZI A;  4ER0 A;  4ER7 A;  2L1P A;  5JUW A;  1U2Z A;  3R09 A;  3QOX A;  3NRO A;  4ER6 A;  5DRY A;  3UWP A;  4EK9 A;  3GZD C;  3PE5 A;  3TEP A;  3A9Y A;  4DE8 A;  2MXD A;  2LNM A;  3GUU A;  3NXH A;  2HCN A;  3NZL A;  2J7W A;  2ODR D;  3GZC A;  2LLV A;  3OWQ A;  4EQZ A;  5DTM A;  5DRT A;  3TEL A;  1NW3 A;  3G0T A;  5DT2 A;  3VWS A;  3TFL A;  2HCS A;  4WVL A;  4OBM A;  3ZPX A;  4ER5 A;  4HRA A;  3MEJ A;  3ME5 A;  2M4H A;  3QOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...