4PU4C

Shewanella oneidensis mr-1 toxin antitoxin system hipa, hipb and its operator dna complex (space group p21)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
IMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Toxin/antitoxin/dna
molecule keywords Toxin-antitoxin system toxin HipA family
total genus 20
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4pu4C00
2GRLA 2XJ3A 4X4DA 3QYXA 4X4GA 3QQ6A 3EUSA 1VPWA 3L1PA 2EWTA 1R63A 4PU7A 2KEIA 4X4CA 2R63A 2LYKA 3JXBC 2A6CA 2AXVA 2XIUA 4X4EA 5K98B 2JCGA 2LYPA 2EBYA 1Y9QA 3FYAA 3PXPA 2IU7A 1BDIA 3G7DA 4X4FA 4PU4C 1UTXA 1ZZ8A 2BNNA 4YG7B 2XSDC 2PUFA 3B7HA 2L8NA 3VK0A 1WETA 1PNRA 1LCCA 2D5VA 2LCVA 2JVLA 2LYLA 1QP4A 1POUA 2AWIA 2AW6A 4GHJA 4NDWA 3GBFA 3LFPA 1NERA 4I6TA 2PUGA 1ZZBA 1S7EA 1X2LA 4IVZA 1EFAA 2HINA 3BD1A 3MLFA 4Z5HA 4PU3C 1WH6A 2GZUA 3O9XA 1ZZCA 4Z59A 2WUSR 3QF3A 1IC8A 3CECA 2KEJA 1L1MA 2KEKA 3BS3A 3OQNA 3SCFA 4YARA 3BDNA 4Z5DA 3RZZA 2KPJA 4J1WA 3CLCA 1QQBA 1PRVA 2PPXA 1QQAA 4F8DA 1E3OC 2IVQA 4I6UA 2BNOA 1SQ8A 4Y42A 2KZ8A 3GN5B 3OQOA 2O49A 3HZIB 1QP7A 1ZVVA 3DNVB 3ZHIA 3KZ3A 3TRBA 4X4IA 1NEQA 2B5AA 1Y7YA 3GN5A 1WH8A 3H5TA 3UFDA 1JH9A 2PUCA 4IWRA 1WIZA 5A7LA 3G5GA 1PRUA 4X4BA 1JWLA 4JCXA 3R1FA 1ZS4A 1ZZ7A 2H8RA 1DW9A 4YG4A 2AXUA 2LYRA 4FBIA 4Z5CA 1RZRA 4O8BA 3OP9A 1B0NA 1ZPQA 2FJRA 2OR1L 3F52A 2CROA 4I8TA 2O4AA 1GT0C 2XCJA 3CROL 1JFSA 1O4XA 1QP0A 4MCXA 1PERL 2OFYA 2R1JL 1CJGA 4JCYA 2IVBA 2PIJA 3F51A 3FMYA 2LYQA 1UXCA 2CSFA 2ICTA 1RPEL 1ZZ6A 3SCGA 3SCHA 1UXDA 4YG1A 2IVGA 1QPZA 4X4HA 3JXCL 1AU7A 4OB4A 3JXDL 2BJCA 3IVPA 3FYMA 2AUWA 1ZZ9A 2ICPA 2LYSA 3OMTA 2PE5A 2XI8A 3KJXA 2PUEA 2EF8A 1LQCA 4JQDA 3ZHMA 1ZAYA 2MQKA 4Z58A 1LMB3 2HSGA 2IV1A 4I6RA 1RIOA 3S8QA 2PUDA 1LLIA 4FN3A 1HF0A 1YSEA 1RZRD 2BNMA 1LCDA 1JFTA 3U3WA 4IA8A 2GRMA 3ZKCA 4PU8A 2AXZA 2LYJA 3F6WA 1RZSA 2PUBA 1XWRA 2PUAA 4MCTA 3QWGA 1OSLA 2MEZA 1OCTC 1PRAA 1R69A 2WIUB 4GQMA 4YBAA 4J1XA 1ADRA 3OQMA 1CQTA 2IUOA 2L49A 1ZUGA 2O38A 1DWKA 1X57A 3KXAA 3D1NI 1BDHA 3LISA
chains in the Genus database with same CATH superfamily
3QYXA 3G0TA 3EUSA 2LYKA 2PXFA 2XIUA 5K98B 2JCGA 3OWQA 3GZDA 5GAGi 2BNNA 2L8NA 1WETA 2HFZA 1POUA 2AWIA 4NDWA 1ZZBA 1S7EA 3LQXA 3A9YA 3TEPA 3O9XA 2WUSR 3QF3A 1IC8A 3RZZA 3CLCA 1E3OC 4Q2JA 1SQ8A 3OQOA 3HZIB 3ZHIA 1NEQA 2PXEA 1WIZA 5A7LA 4JCXA 2H8RA 1ZZ7A 2AXUA 5DRTA 2OR1L 1NW3A 2XCJA 1QP0A 1O4XA 1PERL 2OFYA 2IVBA 1RPEL 4OBMA 3JXDL 3TFLA 1ZZ9A 2PUEA 4I6RA 3S8QA 1U2ZA 1LLIA 1LCDA 1JFTA 4ER0A 5JUWA 2AXZA 5DTMA 2PUBA 3ZPXA 3QWGA 1PRAA 2XXAA 2WIUB 2PXBA 1ADRA 1CQTA 2IUOA 1DWKA 3LISA 2GRLA 3A9ZA 3UWPA 5DSXA 2KEIA 2AXVA 2LYPA 3G7DA 1MFQC 2MXDA 2XSDC 1PNRA 2JVLA 3GBFA 3QOXA 3VWSA 2HINA 3MLFA 1WH6A 2GZUA 1ZZCA 1L1MA 4EQZA 2VEOA 3KL4A 3BDNA 2KPJA 3MEJA 1DULA 1PRVA 2PPXA 1QQAA 2IVQA 5GAHi 2KZ8A 3A9XA 2O49A 1QP7A 2B5AA 1JH9A 1WH8A 4IWRA 1PRUA 4EK9A 4YG4A 2XXQA 4FBIA 4Z5CA 3OP9A 1B0NA 1ZPQA 2O4AA 2PXDA 1JFSA 1CJGA 1HQ1A 3GZCA 3DM5A 3SCHA 1UXDA 4YG1A 2IVGA 1QPZA 4X4HA 1AU7A 2PXLA 2ICPA 5DTRA 2PXTA 3PE5A 1ZAYA 4Z58A 2IV1A 1HF0A 2BNMA 4ER3A 3R09A 5DT2A 3ZKCA 4PU8A 1RZSA 4MCTA 4ER6A 1OSLA 3GZDC 4GQMA 2L49A 1BDHA 1X57A 3QOWA 2XJ3A 3QQ6A 1VPWA 3L1PA 2EWTA 3JXBC 2EBYA 2IU7A 5DTQA 4X4FA 1UTXA 1ZZ8A 2M4HA 3VK0A 2D5VA 2LCVA 2LYLA 1QP4A 2AW6A 4GHJA 2PXQA 1NERA 2PUGA 1X2LA 2FFHA 2LLVA 2HCNA 3BD1A 4PU3C 4Z59A 2XXPA 2J7UA 3BS3A 2KEKA 4YARA 4J1WA 3SX0A 4F8DA 4I6UA 2BNOA 3SR4A 3DNVB 4X4IA 3TRBA 3H5TA 2PUCA 3UFDA 1QZXA 1QB2A 1ZS4A 1RZRA 3F52A 1GT0C 3CROL 2R1JL 4JCYA 3FMYA 1UXCA 2CSFA 2ICTA 3SCGA 2PXPA 3IVPA 3FYMA 2AUWA 2LYSA 3OMTA 2PE5A 2XI8A 3KJXA 2EF8A 2MQKA 1LMB3 2HSGA 4HRAA 1RIOA 2GRMA 2PXUA 3F6WA 1XWRA 1OCTC 1R69A 4J1XA 2PXVA 4WVLA 2O38A 3QFIA 3D1NI 4X4DA 4ER7A 4X4GA 4ER5A 1R63A 4PU7A 4X4CA 2R63A 2A6CA 2ODRD 4X4EA 3FYAA 1BDIA 3PXPA 1Y9QA 4PU4C 2PUFA 4YG7B 3ME5A 3B7HA 2V3CC 1LCCA 4EKGA 4EKIA 3LFPA 4I6TA 4IVZA 1EFAA 4Z5HA 2HCSA 4DE9A 3CECA 2KEJA 3OQNA 3SCFA 4Z5DA 1QQBA 3NXHA 4Y42A 3GN5B 1ZVVA 3OKZA 3KZ3A 1Y7YA 3GN5A 3NZLA 3G5GA 3TELA 4X4BA 1JWLA 3R1FA 1DW9A 2LYRA 4DE8A 4O8BA 2FJRA 2L1PA 4I8TA 2CROA 5DRYA 4MCXA 3NROA 2PIJA 3F51A 2LYQA 1ZZ6A 2YBDA 3M9LA 2PXKA 3GUUA 3JXCL 4OB4A 2BJCA 2JQEA 4EZIA 2J7WA 1LQCA 4JQDA 3ZHMA 2PUDA 4FN3A 1YSEA 1RZRD 3U3WA 4IA8A 2LYJA 2LNMA 2PUAA 2MEZA 2LLWA 4YBAA 3NDBB 3OQMA 3KXAA 1ZUGA
chains in the Genus database with same CATH topology
2GRLA 2XJ3A 4X4DA 3QYXA 4X4GA 3QQ6A 3EUSA 1VPWA 3L1PA 2EWTA 1R63A 4PU7A 2KEIA 4X4CA 2R63A 2LYKA 3JXBC 2A6CA 2AXVA 2XIUA 4X4EA 5K98B 2JCGA 2LYPA 2EBYA 1Y9QA 3FYAA 3PXPA 2IU7A 1BDIA 3G7DA 4X4FA 4PU4C 1UTXA 1ZZ8A 2BNNA 4YG7B 2XSDC 2PUFA 3B7HA 2L8NA 3VK0A 1WETA 1PNRA 1LCCA 2D5VA 2LCVA 2JVLA 2LYLA 1QP4A 1POUA 2AWIA 2AW6A 4GHJA 4NDWA 3GBFA 3LFPA 1NERA 4I6TA 2PUGA 1ZZBA 1S7EA 1X2LA 4IVZA 1EFAA 2HINA 3BD1A 3MLFA 4Z5HA 4PU3C 1WH6A 2GZUA 3O9XA 1ZZCA 4Z59A 2WUSR 3QF3A 1IC8A 3CECA 2KEJA 1L1MA 2KEKA 3BS3A 3OQNA 3SCFA 4YARA 3BDNA 4Z5DA 3RZZA 2KPJA 4J1WA 3CLCA 1QQBA 1PRVA 2PPXA 1QQAA 4F8DA 1E3OC 2IVQA 4I6UA 2BNOA 1SQ8A 4Y42A 2KZ8A 3GN5B 3OQOA 2O49A 3HZIB 1QP7A 1ZVVA 3DNVB 3ZHIA 3KZ3A 3TRBA 4X4IA 1NEQA 2B5AA 1Y7YA 3GN5A 1WH8A 3H5TA 3UFDA 1JH9A 2PUCA 4IWRA 1WIZA 5A7LA 3G5GA 1PRUA 4X4BA 1JWLA 4JCXA 3R1FA 1ZS4A 1ZZ7A 2H8RA 1DW9A 4YG4A 2AXUA 2LYRA 4FBIA 4Z5CA 1RZRA 4O8BA 3OP9A 1B0NA 1ZPQA 2FJRA 2OR1L 3F52A 2CROA 4I8TA 2O4AA 1GT0C 2XCJA 3CROL 1JFSA 1O4XA 1QP0A 4MCXA 1PERL 2OFYA 2R1JL 1CJGA 4JCYA 2IVBA 2PIJA 3F51A 3FMYA 2LYQA 1UXCA 2CSFA 2ICTA 1RPEL 1ZZ6A 3SCGA 3SCHA 1UXDA 4YG1A 2IVGA 1QPZA 4X4HA 3JXCL 1AU7A 4OB4A 3JXDL 2BJCA 3IVPA 3FYMA 2AUWA 1ZZ9A 2ICPA 2LYSA 3OMTA 2PE5A 2XI8A 3KJXA 2PUEA 2EF8A 1LQCA 4JQDA 3ZHMA 1ZAYA 2MQKA 4Z58A 1LMB3 2HSGA 2IV1A 4I6RA 1RIOA 3S8QA 2PUDA 1LLIA 4FN3A 1HF0A 1YSEA 1RZRD 2BNMA 1LCDA 1JFTA 3U3WA 4IA8A 2GRMA 3ZKCA 4PU8A 2AXZA 2LYJA 3F6WA 1RZSA 2PUBA 1XWRA 2PUAA 4MCTA 3QWGA 1OSLA 2MEZA 1OCTC 1PRAA 1R69A 2WIUB 4GQMA 4YBAA 4J1XA 1ADRA 3OQMA 1CQTA 2IUOA 2L49A 1ZUGA 2O38A 1DWKA 1X57A 3KXAA 3D1NI 1BDHA 3LISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRL A;  2XJ3 A;  4X4D A;  3QYX A;  4X4G A;  3QQ6 A;  3EUS A;  1VPW A;  3L1P A;  2EWT A;  1R63 A;  4PU7 A;  2KEI A;  4X4C A;  2R63 A;  2LYK A;  3JXB C;  2A6C A;  2AXV A;  2XIU A;  4X4E A;  5K98 B;  2JCG A;  2LYP A;  2EBY A;  1Y9Q A;  3FYA A;  3PXP A;  2IU7 A;  1BDI A;  3G7D A;  4X4F A;  4PU4 C;  1UTX A;  1ZZ8 A;  2BNN A;  4YG7 B;  2XSD C;  2PUF A;  3B7H A;  2L8N A;  3VK0 A;  1WET A;  1PNR A;  1LCC A;  2D5V A;  2LCV A;  2JVL A;  2LYL A;  1QP4 A;  1POU A;  2AWI A;  2AW6 A;  4GHJ A;  4NDW A;  3GBF A;  3LFP A;  1NER A;  4I6T A;  2PUG A;  1ZZB A;  1S7E A;  1X2L A;  4IVZ A;  1EFA A;  2HIN A;  3BD1 A;  3MLF A;  4Z5H A;  4PU3 C;  1WH6 A;  2GZU A;  3O9X A;  1ZZC A;  4Z59 A;  2WUS R;  3QF3 A;  1IC8 A;  3CEC A;  2KEJ A;  1L1M A;  2KEK A;  3BS3 A;  3OQN A;  3SCF A;  4YAR A;  3BDN A;  4Z5D A;  3RZZ A;  2KPJ A;  4J1W A;  3CLC A;  1QQB A;  1PRV A;  2PPX A;  1QQA A;  4F8D A;  1E3O C;  2IVQ A;  4I6U A;  2BNO A;  1SQ8 A;  4Y42 A;  2KZ8 A;  3GN5 B;  3OQO A;  2O49 A;  3HZI B;  1QP7 A;  1ZVV A;  3DNV B;  3ZHI A;  3KZ3 A;  3TRB A;  4X4I A;  1NEQ A;  2B5A A;  1Y7Y A;  3GN5 A;  1WH8 A;  3H5T A;  3UFD A;  1JH9 A;  2PUC A;  4IWR A;  1WIZ A;  5A7L A;  3G5G A;  1PRU A;  4X4B A;  1JWL A;  4JCX A;  3R1F A;  1ZS4 A;  1ZZ7 A;  2H8R A;  1DW9 A;  4YG4 A;  2AXU A;  2LYR A;  4FBI A;  4Z5C A;  1RZR A;  4O8B A;  3OP9 A;  1B0N A;  1ZPQ A;  2FJR A;  2OR1 L;  3F52 A;  2CRO A;  4I8T A;  2O4A A;  1GT0 C;  2XCJ A;  3CRO L;  1JFS A;  1O4X A;  1QP0 A;  4MCX A;  1PER L;  2OFY A;  2R1J L;  1CJG A;  4JCY A;  2IVB A;  2PIJ A;  3F51 A;  3FMY A;  2LYQ A;  1UXC A;  2CSF A;  2ICT A;  1RPE L;  1ZZ6 A;  3SCG A;  3SCH A;  1UXD A;  4YG1 A;  2IVG A;  1QPZ A;  4X4H A;  3JXC L;  1AU7 A;  4OB4 A;  3JXD L;  2BJC A;  3IVP A;  3FYM A;  2AUW A;  1ZZ9 A;  2ICP A;  2LYS A;  3OMT A;  2PE5 A;  2XI8 A;  3KJX A;  2PUE A;  2EF8 A;  1LQC A;  4JQD A;  3ZHM A;  1ZAY A;  2MQK A;  4Z58 A;  1LMB 3;  2HSG A;  2IV1 A;  4I6R A;  1RIO A;  3S8Q A;  2PUD A;  1LLI A;  4FN3 A;  1HF0 A;  1YSE A;  1RZR D;  2BNM A;  1LCD A;  1JFT A;  3U3W A;  4IA8 A;  2GRM A;  3ZKC A;  4PU8 A;  2AXZ A;  2LYJ A;  3F6W A;  1RZS A;  2PUB A;  1XWR A;  2PUA A;  4MCT A;  3QWG A;  1OSL A;  2MEZ A;  1OCT C;  1PRA A;  1R69 A;  2WIU B;  4GQM A;  4YBA A;  4J1X A;  1ADR A;  3OQM A;  1CQT A;  2IUO A;  2L49 A;  1ZUG A;  2O38 A;  1DWK A;  1X57 A;  3KXA A;  3D1N I;  1BDH A;  3LIS A; 
#chains in the Genus database with same CATH topology
 3QYX A;  3G0T A;  3EUS A;  2LYK A;  2PXF A;  2XIU A;  5K98 B;  2JCG A;  3OWQ A;  3GZD A;  5GAG i;  2BNN A;  2L8N A;  1WET A;  2HFZ A;  1POU A;  2AWI A;  4NDW A;  1ZZB A;  1S7E A;  3LQX A;  3A9Y A;  3TEP A;  3O9X A;  2WUS R;  3QF3 A;  1IC8 A;  3RZZ A;  3CLC A;  1E3O C;  4Q2J A;  1SQ8 A;  3OQO A;  3HZI B;  3ZHI A;  1NEQ A;  2PXE A;  1WIZ A;  5A7L A;  4JCX A;  2H8R A;  1ZZ7 A;  2AXU A;  5DRT A;  2OR1 L;  1NW3 A;  2XCJ A;  1QP0 A;  1O4X A;  1PER L;  2OFY A;  2IVB A;  1RPE L;  4OBM A;  3JXD L;  3TFL A;  1ZZ9 A;  2PUE A;  4I6R A;  3S8Q A;  1U2Z A;  1LLI A;  1LCD A;  1JFT A;  4ER0 A;  5JUW A;  2AXZ A;  5DTM A;  2PUB A;  3ZPX A;  3QWG A;  1PRA A;  2XXA A;  2WIU B;  2PXB A;  1ADR A;  1CQT A;  2IUO A;  1DWK A;  3LIS A;  2GRL A;  3A9Z A;  3UWP A;  5DSX A;  2KEI A;  2AXV A;  2LYP A;  3G7D A;  1MFQ C;  2MXD A;  2XSD C;  1PNR A;  2JVL A;  3GBF A;  3QOX A;  3VWS A;  2HIN A;  3MLF A;  1WH6 A;  2GZU A;  1ZZC A;  1L1M A;  4EQZ A;  2VEO A;  3KL4 A;  3BDN A;  2KPJ A;  3MEJ A;  1DUL A;  1PRV A;  2PPX A;  1QQA A;  2IVQ A;  5GAH i;  2KZ8 A;  3A9X A;  2O49 A;  1QP7 A;  2B5A A;  1JH9 A;  1WH8 A;  4IWR A;  1PRU A;  4EK9 A;  4YG4 A;  2XXQ A;  4FBI A;  4Z5C A;  3OP9 A;  1B0N A;  1ZPQ A;  2O4A A;  2PXD A;  1JFS A;  1CJG A;  1HQ1 A;  3GZC A;  3DM5 A;  3SCH A;  1UXD A;  4YG1 A;  2IVG A;  1QPZ A;  4X4H A;  1AU7 A;  2PXL A;  2ICP A;  5DTR A;  2PXT A;  3PE5 A;  1ZAY A;  4Z58 A;  2IV1 A;  1HF0 A;  2BNM A;  4ER3 A;  3R09 A;  5DT2 A;  3ZKC A;  4PU8 A;  1RZS A;  4MCT A;  4ER6 A;  1OSL A;  3GZD C;  4GQM A;  2L49 A;  1BDH A;  1X57 A;  3QOW A;  2XJ3 A;  3QQ6 A;  1VPW A;  3L1P A;  2EWT A;  3JXB C;  2EBY A;  2IU7 A;  5DTQ A;  4X4F A;  1UTX A;  1ZZ8 A;  2M4H A;  3VK0 A;  2D5V A;  2LCV A;  2LYL A;  1QP4 A;  2AW6 A;  4GHJ A;  2PXQ A;  1NER A;  2PUG A;  1X2L A;  2FFH A;  2LLV A;  2HCN A;  3BD1 A;  4PU3 C;  4Z59 A;  2XXP A;  2J7U A;  3BS3 A;  2KEK A;  4YAR A;  4J1W A;  3SX0 A;  4F8D A;  4I6U A;  2BNO A;  3SR4 A;  3DNV B;  4X4I A;  3TRB A;  3H5T A;  2PUC A;  3UFD A;  1QZX A;  1QB2 A;  1ZS4 A;  1RZR A;  3F52 A;  1GT0 C;  3CRO L;  2R1J L;  4JCY A;  3FMY A;  1UXC A;  2CSF A;  2ICT A;  3SCG A;  2PXP A;  3IVP A;  3FYM A;  2AUW A;  2LYS A;  3OMT A;  2PE5 A;  2XI8 A;  3KJX A;  2EF8 A;  2MQK A;  1LMB 3;  2HSG A;  4HRA A;  1RIO A;  2GRM A;  2PXU A;  3F6W A;  1XWR A;  1OCT C;  1R69 A;  4J1X A;  2PXV A;  4WVL A;  2O38 A;  3QFI A;  3D1N I;  4X4D A;  4ER7 A;  4X4G A;  4ER5 A;  1R63 A;  4PU7 A;  4X4C A;  2R63 A;  2A6C A;  2ODR D;  4X4E A;  3FYA A;  1BDI A;  3PXP A;  1Y9Q A;  4PU4 C;  2PUF A;  4YG7 B;  3ME5 A;  3B7H A;  2V3C C;  1LCC A;  4EKG A;  4EKI A;  3LFP A;  4I6T A;  4IVZ A;  1EFA A;  4Z5H A;  2HCS A;  4DE9 A;  3CEC A;  2KEJ A;  3OQN A;  3SCF A;  4Z5D A;  1QQB A;  3NXH A;  4Y42 A;  3GN5 B;  1ZVV A;  3OKZ A;  3KZ3 A;  1Y7Y A;  3GN5 A;  3NZL A;  3G5G A;  3TEL A;  4X4B A;  1JWL A;  3R1F A;  1DW9 A;  2LYR A;  4DE8 A;  4O8B A;  2FJR A;  2L1P A;  4I8T A;  2CRO A;  5DRY A;  4MCX A;  3NRO A;  2PIJ A;  3F51 A;  2LYQ A;  1ZZ6 A;  2YBD A;  3M9L A;  2PXK A;  3GUU A;  3JXC L;  4OB4 A;  2BJC A;  2JQE A;  4EZI A;  2J7W A;  1LQC A;  4JQD A;  3ZHM A;  2PUD A;  4FN3 A;  1YSE A;  1RZR D;  3U3W A;  4IA8 A;  2LYJ A;  2LNM A;  2PUA A;  2MEZ A;  2LLW A;  4YBA A;  3NDB B;  3OQM A;  3KXA A;  1ZUG A; 
#chains in the Genus database with same CATH homology
 2GRL A;  2XJ3 A;  4X4D A;  3QYX A;  4X4G A;  3QQ6 A;  3EUS A;  1VPW A;  3L1P A;  2EWT A;  1R63 A;  4PU7 A;  2KEI A;  4X4C A;  2R63 A;  2LYK A;  3JXB C;  2A6C A;  2AXV A;  2XIU A;  4X4E A;  5K98 B;  2JCG A;  2LYP A;  2EBY A;  1Y9Q A;  3FYA A;  3PXP A;  2IU7 A;  1BDI A;  3G7D A;  4X4F A;  4PU4 C;  1UTX A;  1ZZ8 A;  2BNN A;  4YG7 B;  2XSD C;  2PUF A;  3B7H A;  2L8N A;  3VK0 A;  1WET A;  1PNR A;  1LCC A;  2D5V A;  2LCV A;  2JVL A;  2LYL A;  1QP4 A;  1POU A;  2AWI A;  2AW6 A;  4GHJ A;  4NDW A;  3GBF A;  3LFP A;  1NER A;  4I6T A;  2PUG A;  1ZZB A;  1S7E A;  1X2L A;  4IVZ A;  1EFA A;  2HIN A;  3BD1 A;  3MLF A;  4Z5H A;  4PU3 C;  1WH6 A;  2GZU A;  3O9X A;  1ZZC A;  4Z59 A;  2WUS R;  3QF3 A;  1IC8 A;  3CEC A;  2KEJ A;  1L1M A;  2KEK A;  3BS3 A;  3OQN A;  3SCF A;  4YAR A;  3BDN A;  4Z5D A;  3RZZ A;  2KPJ A;  4J1W A;  3CLC A;  1QQB A;  1PRV A;  2PPX A;  1QQA A;  4F8D A;  1E3O C;  2IVQ A;  4I6U A;  2BNO A;  1SQ8 A;  4Y42 A;  2KZ8 A;  3GN5 B;  3OQO A;  2O49 A;  3HZI B;  1QP7 A;  1ZVV A;  3DNV B;  3ZHI A;  3KZ3 A;  3TRB A;  4X4I A;  1NEQ A;  2B5A A;  1Y7Y A;  3GN5 A;  1WH8 A;  3H5T A;  3UFD A;  1JH9 A;  2PUC A;  4IWR A;  1WIZ A;  5A7L A;  3G5G A;  1PRU A;  4X4B A;  1JWL A;  4JCX A;  3R1F A;  1ZS4 A;  1ZZ7 A;  2H8R A;  1DW9 A;  4YG4 A;  2AXU A;  2LYR A;  4FBI A;  4Z5C A;  1RZR A;  4O8B A;  3OP9 A;  1B0N A;  1ZPQ A;  2FJR A;  2OR1 L;  3F52 A;  2CRO A;  4I8T A;  2O4A A;  1GT0 C;  2XCJ A;  3CRO L;  1JFS A;  1O4X A;  1QP0 A;  4MCX A;  1PER L;  2OFY A;  2R1J L;  1CJG A;  4JCY A;  2IVB A;  2PIJ A;  3F51 A;  3FMY A;  2LYQ A;  1UXC A;  2CSF A;  2ICT A;  1RPE L;  1ZZ6 A;  3SCG A;  3SCH A;  1UXD A;  4YG1 A;  2IVG A;  1QPZ A;  4X4H A;  3JXC L;  1AU7 A;  4OB4 A;  3JXD L;  2BJC A;  3IVP A;  3FYM A;  2AUW A;  1ZZ9 A;  2ICP A;  2LYS A;  3OMT A;  2PE5 A;  2XI8 A;  3KJX A;  2PUE A;  2EF8 A;  1LQC A;  4JQD A;  3ZHM A;  1ZAY A;  2MQK A;  4Z58 A;  1LMB 3;  2HSG A;  2IV1 A;  4I6R A;  1RIO A;  3S8Q A;  2PUD A;  1LLI A;  4FN3 A;  1HF0 A;  1YSE A;  1RZR D;  2BNM A;  1LCD A;  1JFT A;  3U3W A;  4IA8 A;  2GRM A;  3ZKC A;  4PU8 A;  2AXZ A;  2LYJ A;  3F6W A;  1RZS A;  2PUB A;  1XWR A;  2PUA A;  4MCT A;  3QWG A;  1OSL A;  2MEZ A;  1OCT C;  1PRA A;  1R69 A;  2WIU B;  4GQM A;  4YBA A;  4J1X A;  1ADR A;  3OQM A;  1CQT A;  2IUO A;  2L49 A;  1ZUG A;  2O38 A;  1DWK A;  1X57 A;  3KXA A;  3D1N I;  1BDH A;  3LIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...