3KJXA

Crystal structure of a transcriptional regulator, lacl family protein from silicibacter pomeroyi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
333
structure length
333
Chain Sequence
PLTLRDVSEASGVSEMTVSRVLRNRGDVSDATRARVLAAAKELGYVPNKIAGALASNRVNLVAVIIPSLSNMVFPEVLTGINQVLEDTELQPVVGVTDYLPEKEEKVLYEMLSWRPSGVIIAGLEHSEAARAMLDAAGIPVVEIMDSDGKPVDAMVGISHRRAGREMAQAILKAGYRRIGFMGTKMPLDYRARKRFEGFTEVLGKNGVEIEDREFYSGGSALAKGREMTQAMLERSPDLDFLYYSNDMIAAGGLLYLLEQGIDIPGQIGLAGFNNVELLQGLPRKLATMDACRLEIGRKAAEIIAKRLEDPEAEIETRITLEPKISYGDTLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a transcriptional regulator, Lacl family protein from Silicibacter pomeroyi
rcsb
source organism Silicibacter pomeroyi
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LacI family
total genus 90
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3kjxA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kjxA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kjxA02
4KK4A 2RDMA 4XXHA 3KS9A 1ISRA 1A04A 2PPXA 4RXUA 3H1FA 1ZZ6A 3HSYA 2JVJA 2XCJA 4O1IA 5A7LA 1E6KA 2FLKA 4WXMA 2IVBA 1PERL 4I8TA 4W5QA 1Z2DA 1UXDA 1GT0C 2GX6A 2B4AA 2WMYA 1L5YA 3QEMA 4WXEA 3T6KA 4OLAA 4ML3A 1RXEA 4KQCA 3TB6A 4MS4A 3ZHMA 2L18A 2GZUA 5EWJB 4G0OA 2JB9A 1LK0A 3GT7A 4X4DA 4MS3B 1X2LA 3RVPA 2FJRA 3IVPA 3C3WA 2R25B 4F8DA 2KEIA 4I6TA 3KYIB 3OLWA 4MR7B 1DCMA 2LUOA 3IP5A 2O49A 4RK5A 5FBHA 1Y7YA 2EF8A 1VKRA 2IPLA 2OQRA 3EQZA 4NDWA 4NV3A 5JNVA 1BAPA 4YR7A 5JS1A 3C3MA 4WZZA 2FMFA 3E61A 3LMKA 3BD1A 3M9WA 4RK1A 5CNMA 2JK1A 2NZUG 1DC8A 2LYLA 3M6MD 1UXCA 4MCTA 1RPJA 1ZGGA 4MQFA 1YVUA 3UFDA 1RXIA 5PNTA 3QLVC 1OSLA 4MYRA 5IC5A 3D8UA 1NXXA 2A6CA 2FMKA 2MSKA 2PAFA 2WY2D 5ED4A 2MQKA 1USIA 2LYSA 3O1HB 2XI8A 4Z99A 1B0NA 5FWYB 3H1EA 3CZCA 1Z17A 4EYQA 2L19A 3CU5A 1Z15A 4DQDA 1SXGA 1U0SY 4G0YA 1NXSA 4LX8A 3T8YA 4Z4FA 3CROL 4Z9BA 1D1QA 2FQYA 3OLZA 3ROFA 1LBHA 3KLNA 3LUDA 2JBAB 3EDCA 1D1PA 3SQNA 3TD9A 2YHAA 1QQBA 4X4CA 4P98A 2RJOA 4LE0A 1YSEA 2QR3A 4S05A 1F51E 3Q41A 5BQ3A 3TX6A 1JL3A 1KRWA 3KCNA 2CHEA 2DRIA 3OLXA 3GBFA 4RK4A 1POUA 1DRJA 1NY5A 1MIHA 4NCAA 3CKMA 2IYNA 1ZVVA 4OBBA 2HQBA 4XAQA 2PJUA 4RS3A 4LRQA 1DBWA 4HYEA 2PUEA 1JFVA 1PHRA 5B3JC 1Z26A 1DG9A 1P6UA 3QF3A 2H0AA 1D2AA 1KGSA 2LIVA 1XWWA 5IBQA 2PIJA 1PRVA 1FFSA 4YG7B 2FSPA 1CEYA 2IDMA 3CHYA 3MYYA 4Q6WA 2P9HA 4G97A 1FSPA 3DNVB 3O2SB 4IVZA 2CROA 4OB4A 4RV5A 2KZ8A 4FBIA 3RQIA 4OG2A 4OLBA 1QO0A 4F06A 1YK1A 3EUSA 1NATA 3DGEC 1C0EA 4KQ9A 1ZPQA 3KJXA 2QW1A 3O2JA 3MQ4A 2BGGA 1ZZCA 1CQTA 3DBIA 2AXZA 3HS3A 4PE5B 1MVOA 1CJGA 5IEBA 3G5GA 1LJUA 5EWJA 3QYXA 3SY8A 1RNLA 4YG4A 3GBPA 2L17A 4Z4CA 2PUFA 1T34A 3OQOA 1DBPA 3GRCA 3K4HA 4O1HA 1ZN2A 1J56A 6ABPA 5IUNC 1ZDMA 3LKBA 3NHZA 4HNRA 4YARA 3OMXA 4RZSA 2BNOA 5BRJA 4O5AA 2IU7A 1ZS4A 2O4AA 1ZH4A 2PUCA 2MEZA 2NZVG 4PYRA 4WT7A 3O21A 4YP9A 5GOTA 3C3KA 3A0UA 4MS4B 5KI6A 1TM2A 4J1WA 4KVFA 5CNJA 4IWRA 3BRSA 3CS3A 4FE4A 4DADA 3MIZA 1HF0A 4MR7A 3ZKCA 2PUDA 3QWGA 4YWHA 1DW9A 4Z5DA 4N03A 1WH8A 3A0RB 3HZHA 2AXUA 1NXTA 5K98B 3H5WA 2LBPA 3A3KA 3S8QA 3H5OA 4IRXA 4EYOA 2FEKA 3FMVA 2ID7A 4RXMA 3R0JA 5FBKA 3P9YA 1QPZA 4G0PA 2GBPA 3UK0A 3Q15C 4P1ZA 1LQCA 1IC8A 2AUWA 4F12A 3HZIB 1U2QA 2IPAB 4TMYA 3DGFC 4TN5A 1EWKA 2PE5A 1OCTC 4UHKA 2FEPA 3TRBA 3W9SA 4MS1B 2HQRA 2R4QA 1LMB3 3RVNA 3A10A 2E4VA 1E2BA 2PUAA 5KC9A 2HINA 2VUIB 1JYFA 4QICA 1UDRA 2LPMA 4MR9B 3CTPA 1ADRA 2J48A 3QELA 4W5RA 2A9OA 2HQOA 3QLUA 1DP4A 4X4BA 1L1MA 4CBVA 5KQLA 3BILA 4G0QA 4Z9AA 2NT4A 1FQWA 3Q9SA 3FFXA 3LUKA 2FN9A 3RVSA 1BDIA 3HK2A 3CECA 2WB4A 3O1JC 1RPEL 3VNBA 2WJAA 2QV0A 3EQ2A 3UUGA 2PL9A 4G0ZA 2KEJA 4Y9TA 3I5AA 4D6YA 1GCAA 3I09A 3GWGA 3LKVA 4MRMA 4N41A 3H5TA 2FEWB 3RZZA 2F8TA 2FQXA 4ZMRA 1ZZ7A 1JDNA 2M1ZA 1LJLA 3HDVA 1LCDA 1YMUA 3O74A 4N0QA 3BBLA 3FGZA 3EGCA 2PKXA 4YS6A 5KC8A 4ETIA 2FMIA 1MB3A 1ZESA 3SCGA 2MYTA 5TPWA 1F4VA 1LLIA 3RVKA 4EUKA 3H6GA 3KTOA 5EWLA 1DWKA 5IEJA 2QVCA 4NCBA 1RZSA 2BNNA 1DC7A 4L85A 2PLNA 4W5NA 3HJFA 3T38A 2FXIA 4MPTA 4GHJA 4YLEA 3EODA 2L8NA 5FWYA 2FVYA 5KQPA 3UKJA 1JHZA 4EVQA 3H5VA 4RXTA 4MGEA 4YG1A 2I6FA 7ABPA 2XSDC 2H8RA 4YBAA 3CG4A 3LUJA 3OQMA 3LUAA 4JB2A 4KFCA 3RVJA 4RKRA 3C6QA 5CNKA 3JPYA 4Z5HA 4YCSA 1U04A 3LTEA 1JDPA 3LUHA 3LUGA 1Z18A 1BA2A 2GWRA 4YO7A 4HNQA 3H5IA 3R1FA 5JNSA 1Z13A 2MYPA 3QLVA 5TQ2A 2LYKA 1ISSA 2FW0A 2IOYA 3B2NA 1Z25A 3IP9A 4QYWA 4JQDA 1JFSA 3HXMA 2NT3A 1K66A 4QPJC 1DBQA 1MAVA 1W25A 3GN5A 1R8JA 1ZHHA 1TVMA 3LISA 3O9XA 4IILA 4Z0NA 5HM6A 5HQJA 5I4CA 3KXAA 4G0MA 3TO5A 5IUJC 1YS7A 2IVGA 1D5WA 5CHYA 4W5OA 1A0OA 1JF8A 2QZJA 1BDJA 4JAVC 3QEMB 3CRNA 3MMNA 5JS2A 2LYJA 1FFGA 3H75A 1XHEA 3Q7TA 4GNRA 3HUTA 5CNIA 4E7OA 3OLYA 3GN5B 3CLCA 1P6QA 2WIUB 4JCXA 1EWVA 3KHTA 2IVQA 3BREA 4B09A 3LFPA 3IPCA 3URMA 4MRMB 3FMYA 2YHBA 3NNDA 4E7PA 4KZKA 1EWTA 3L49A 4MQEB 3Q7RA 5TQJA 3N0WA 1R63A 3KZ3A 1U2PA 3RVMA 4EYKA 2O38A 3N0RA 4M88A 3FYAA 4X4EA 4RK6A 3SCHA 4G86A 3EJWA 3RVRA 4PZ0A 2TMYA 3HV2A 4D6XA 1JX6A 5FWXA 3OP9A 3JVDA 4JASB 3T95A 1ZZBA 2CWDA 2OR1L 1I3CA 3FYMA 1BVHA 1DRKA 4H60A 3HDGA 3N6VA 2ZAYA 3H6HA 2WWVD 5IULC 1AB6A 1PUXA 1QNLA 3SCFA 4N0PA 1CHNA 3D02A 4OTZA 1EAYA 4RY9A 5T3YA 3NBMA 4XARA 2JVKA 4MQEA 5DLEA 3HVRA 1JH9A 1ZH2A 4PU7A 1U8TA 5T7BA 4ZPJA 1GLGA 4HNSA 2KPJA 3HEBA 4XLTA 1S8NA 3RVOA 3BRQA 2WUSR 3F51A 1E6LA 3KLOA 4X4FA 2RJNA 3DLBA 2B1JA 2FQWA 4RKQA 2LYQA 5JNUA 2E4WA 1GUDA 1QP7A 2ZWMA 3OO0A 3QX9A 4MR8A 1ZY2A 3CG0A 1USGA 3F73A 4JCYA 1YMVA 4X4IA 5D2CA 2AXVA 2OENG 4WWHA 3RH0A 3H1GA 4RK7A 5JNTA 4Z4EA 3E3MA 2CSFA 2GKGA 4ZYLA 2JRLA 3BS3A 2MYUA 3OM0A 4PU8A 4F8JA 1DCKA 5TQ0A 2MYNA 4MAAA 3RVLA 5C5EA 2XIUA 4UHJA 3D1NI 1ABFA 2HJ9A 2R47A 3MM4A 3OMWA 1Z16A 1KMIY 3IPAA 5F64A 4Q7EA 1ZZ9A 1VLZA 1EHCA 1M2EA 4RY0A 4FB4A 2GRMA 4XASA 1WIZA 1ZITA 4EYGA 2R48A 4S04A 2BJCA 1JWLA 3CNBA 4JA2A 4MLDA 3F6PA 4YV7A 1TMYA 4RK0A 5TPZD 5TQ2B 1KRXA 4YRZA 1RZRD 2XJ3A 3OQNA 4MR9A 5FWXB 1VRVA 4Z4HA 3QEKA 5BR1A 2WRZA 2R1JL 3NHMA 4F3TA 4KREA 2N9UA 3GBVA 1S7EA 3U3WA 5TPZA 1M2FA 2FLWA 3CFYA 4IMJB 4PU3C 3IDOA 5HKOA 5KQMA 4D74A 1E6MA 1W9HA 3I42A 3HO1A 4LDAA 3IP7A 3SG0A 4NQRA 2IPNA 5BRAA 3KG2A 3LOPA 2LYPA 4Q6BA 3ZHIA 2EWTA 4N47A 1SQ8A 5E3JA 1QP4A 3O75A 1O4XA 2AYZA 4W5TA 3DLHA 5KWSA 2GRLA 2JVLA 4GQMA 2MSLA 3M9XA 5TE9A 5TQ0B 1ZUGA 3N75A 4EGSA 3L1PA 2CHFA 8ABPA 4PU4C 4Z58A 2D5VA 5GQSA 5HSGA 5EWMB 4IA8A 3H5LA 3MF4A 1QKKA 6CHYA 1ZZ8A 3JXCL 2AW6A 3JXBC 2A9QA 2FMHA 3L6UA 4I6RA 3DZDA 2PUGA 4JOQA 2QVGA 1Z12A 4QYMA 1B00A 1UTXA 2IPMA 3F6WA 1PNTA 4WUTA 1RZRA 1H9CA 1IIBA 3G1WA 1TLFA 2NUBA 3OLVA 2LYRA 2VK2A 2H3HA 1YTUA 4RDCA 3JXDL 2E4ZA 2ICTA 3GA5A 3BDNA 1K68A 4MR8B 4TLLB 4ZJPA 1NTRA 2QU7A 2IV1A 1YS6A 2B5AA 1YIOA 2EBYA 1ZAYA 2A9PA 2IKSA 3ILYA 2HPHA 4JP1A 3G7DA 1AU7A 4Z59A 2FN8A 4LE2A 4O8BA 4NICA 4PICA 1PRAA 1SXHA 3EAFA 1Y1LA 3JVIA 3N53A 3QK7A 2OFYA 4G0XA 3S99A 2O20A 2AWIA 3SNKA 4DN6A 9ABPA 4I6UA 3SAJA 1C4WA 2FTKE 4F11A 2IUOA 2X7XA 4ZMSA 4ETMA 1QP0A 2WJWA 1URPA 3N0XA 4N76A 1XWRA 2JBAA 4H3KB 3JY6A 4X4HA 1DZ3A 2M98A 2KEKA 4IMIB 4J1XA 4MS1A 3Q7SA 5IUKC 4EY3A 5IX8A 3FFWA 3I45A 5C5CA 1LCCA 2PUBA 1RIOA 4KK3A 1NXWA 1WH6A 1D4ZA 4Z4GA 1GCGA 1X57A 3O2QB 1P8AA 4FE7A 4Z4IA 2E4UA 4KV7A 2F8SA 3JTEA 4RU1A 3KKEA 3OM1A 2QSJA 2RGYA 3CLKA 1ZGZA 1EFAA 1M5TA 2E4YA 3GV0A 3IP6A 3MA0A 4H3HB 4LDZA 2CD7A 5JNWA 3LUFA 3HM9A 1L5ZA 2ID9A 1GUBA 4OATA 1QQAA 5KQGA 1SRRA 1PNRA 1WETA 2KYRA 5JNRA 2QXYA 3C97A 4IF4A 3MLFA 3F7NA 3JS5A 4Y42A 3QX8A 4LZLA 4MS3A 3QQ6A 2LP4Y 2A9RA 1NERA 3HUUA 2LCVA 3FDFA 4LE1A 1R69A 3B7HA 1JFTA 2JVIA 1JYEA 3GL9A 4KMRA 5ABPA 1CYEA 3EULA 2MSWA 1PEAA 4L4UA 3SM9A 1QMPA 3KYJB 3LUCA 5DGCA 3QELB 2PMCA 3NNSA 4RY8A 4IGAA 1OXKB 4KPYA 1TJYA 2JCGA 3K9CA 2VYCA 5DKFA 3FFTA 4Z5CA 1PEYA 3O1IC 4RSMA 5DTEA 1JBEA 2ICPA 2GI4A 2Q5CA 3F6CA 4PEVA 5DCLA 1NXOA 3VNAA 3GYBA 1PRUA 4MCXA 1FFWA 3TMYA 1A2OA 3JPWA 2AYXA 3QLTA 1HEYA 4XFKA 2PL1A 1SXIA 4YGXB 1APBA 2W42A 1QO0D 1BDHA 2BNMA 1JLKA 4MLCA 3OO1A 4EVRA 4GPAA 1M5UA 5EWMA 1ABEA 5B3JA 1NXVA 2L49A 1NXPA 4ETNA 4FN3A 1MB0A 1AB5A 1Z2EA 1DCFA 3N8IA 1VPWA 3QLUC 2VUHB 1NEQA 3OMTA 1USKA 3CZ5A 2FKAA 1LBIA 3RVQA 4EVSA 1OXBB 3KSMA 5TPWB 3ROTA 3VK0A 3NNNA 2XDYA 4KRFA 3HCWA 1SD5A 1YK0A 3G85A 2L2QA 2P4UA 2V0NA 4RWEA 5EWLB 4KNYA 1DJMA 4X4GA 1XHFA 1P2FA 3F52A 3LFTA 2R63A 3PXPA 1E3OC 2E4XA 4TLMB 4MQFB 1Y9QA 4JB0A 2HSGA 3ILHA
chains in the Genus database with same CATH superfamily
3IALA 2HO4A 1WCIA 4ZEWA 4AY2A 3JQQA 1ZINA 1Y5LA 1SVNA 3KELA 5MGBA 3IHKA 3EC2A 3RKSA 3WIUA 4F4JA 3PD0A 4B6PA 2FPIB 3ZZTA 1YDGA 1ZN9A 2C04A 1CB0A 3ETJA 4OSEA 3EXHC 3STTA 3R9XB 2ODBA 3H2BA 4TVOA 5LQNA 3E5NA 1ZKMA 3RVBA 2AMFA 2DYKA 1GZUA 1KIFA 1O94D 1Z6PA 1WY7A 2N42A 1VYHA 3WK6A 1T9AA 3HXPA 3AVTA 1U28C 3G1TA 5A2QA 3GMSA 4DBZA 1E98A 4F8DA 1SQ6A 1S9HA 4G09A 2ZAMA 4CMJA 4ZODA 1DKUA 3QUTA 3FNEA 1E1RD 5J4LA 4F9FA 1W1UA 2B82A 4Q9KA 5DP2A 2GBLA 1XP8A 3D3WA 4D82A 5ERGB 3RIXA 1V8ZA 3WK9A 3BCSA 3PWKA 4OPMA 2WB2A 4MI1A 3UFDA 1SAYA 3MCZA 1Z0IA 1ST3A 1TF2A 3BMNB 3FE2A 1UH5A 4DS3A 4BJ3A 2OZVA 3LWZA 4DV4B 1GR0A 1IJFA 3UO8B 2XCLA 2CLMB 3TMKA 2MQKA 4L2IB 4Q1AA 4JQYA 1WPXA 4OYYA 4LBVA 4BLRA 4BMSA 4YJFB 3TR5A 1XVTA 5KYWA 3DKIA 2YS6A 4G0YA 4TLBA 1Q1BA 2R1UA 5EJMA 4GP7A 4GVXA 2AWNA 3QHAA 5J58A 4FW9A 3IDSA 1HT3A 2FQYA 1WMDA 1EFTA 3AO0B 2Z6UA 1RRPA 5EIHA 4RYDA 1D1PA 2YHAA 3NIGB 4AZTA 1OI4A 3LLSA 4E5MA 5IAEA 3KVYA 3AB3A 4Y2XA 3ZDZB 4PAWA 2P9YA 3UAZA 3DC7A 3TX6A 2WLSA 1NOIA 4BCDA 4DLBA 3JU3A 1JL3A 3FZQA 4K3UA 4A73A 4LFCB 4FFWA 3GBFA 3BIFA 1POUA 1QTRA 2RJ3A 3EB9A 5CVVA 1TM1E 3A9WA 5SYNA 4CGYA 5JI3E 2IYNA 1ZVVA 5KQSA 1TUEA 4XAQA 2PJUA 2OB2A 5DGXA 3VDRA 1V8FA 2HY7A 4LQDA 2A3NA 4B3BA 1SUCA 4FDVA 4QBGB 2VHQA 5K3OA 1E7YA 3UAXA 2OP0A 1TIBA 3I4FA 4N7RA 4EB8A 2YWGA 3UHAA 1HOXA 2IDMA 2W48A 4W1QA 1OC4A 2I9PA 3AFGA 2JD2A 3BJEA 1YBHA 4OG2A 3EOBI 1Z0DA 3PU6A 2I2FA 3UAWA 2LIPA 3RLFA 2REOA 3UWKA 3QE4A 2CVPA 4YA6A 1W5FA 1ZZCA 1SHZA 2CYAA 2QSZA 2V0CA 2WU4A 2ZCVA 3BGIA 4IYJA 4B2LA 4DTCA 4EYEA 1I7SB 3JW8A 3TTUA 2G6BA 1SQSA 2ACVA 4CR7A 4QYIB 4OX9Y 2P8SA 1RNLA 3FNBA 2PRYA 4YDHB 2DWQA 1NSTA 3MFYA 4MITA 3S8MA 5I7UA 2FKNA 3EWAA 3GRCA 3D0KA 3I5UA 1OXVA 3A9SA 1PG5A 4I50A 1ECJA 2X41A 3VH1A 2BSAA 1UM8A 1WHTA 3ND9A 5GJBA 5JZMA 4Y6GB 5MGNA 2O4AA 2X86A 2MEZA 5KKCA 2BI7A 1NF3A 3O21A 3S7ZA 4TV9B 4GQIA 2PU7A 5KI6A 3C1AA 1RAEA 3ABQB 4L8YA 1A2QA 4PR3A 2Z5VA 3ZKAA 3HKCB 1HM5A 3JD2A 1OI2A 4GMFA 3HXOA 2DR3A 3TFOA 4K9SA 1NZDA 3W77A 4AO8A 4CIWA 1F6WA 5EJ5A 1Z5OA 2HDWA 2B35A 3I9NA 3IV9A 4M9UA 4XUDA 5TR9A 1S5PA 4ABYA 2Z2JA 4BEVA 3D6JA 1H2AS 2PUWA 1QH1A 4GXTA 4EFKA 3DMRA 1JZQA 4X95A 5I7RA 3ZJUA 4RL4A 3R0JA 1F0KA 5A0FA 1QPZA 1MU0A 3AJDA 4GPIB 2DBRA 5DYIA 3WA6A 3RW9A 4R68A 3N5KA 2DEUA 2B4RO 3VZSA 2XD9A 4ZOQI 1DX4A 1EX6A 4V0NA 2A86A 4ND1A 4MSUA 4D98A 5HQ3B 2Q3LA 1IDN1 2FEPA 3TRBA 1PT6A 2XD4A 4P9NA 4Q00A 1BWSA 3C5HA 1Z4IA 3ZN2A 2J9ZB 3PCXA 1JSLA 4RF3A 4ENPA 4AURA 1MZPA 4L7QA 1QGOA 4WSOA 5ARCA 1RLTA 1CKEA 2OGUA 2J08A 1BX3A 1N6HA 1Q0PA 4TV8A 4HOYA 3RFFA 1EGHA 3ESCA 1OROA 2PRIA 4PG6A 3LQYA 4MRNA 1AC5A 4EG6A 1CJUC 2WWFA 3RV3A 4FZ3A 3SYRA 4FBGA 1GKUB 3JQCA 4RD0A 5G0WA 1L1MA 4ZWNA 5EJ7A 3VKHA 1HV8A 1YE3A 3BILA 3Q9SA 3LFHA 1NYQA 4IDOA 3DL2A 3BCRA 5HE9A 5C35A 1OT5A 5CXQA 1JJ7A 4MEJA 2HRRA 3EZNA 3SKVA 3W4JA 5DRYA 1HSZA 3V42A 2C3MA 4AD8A 2PGLA 1PCXA 1E2KA 2ZBGA 4NENA 1V8PA 4RCZA 4DMKA 4WKPA 1I32A 2Q6LA 5ALNA 4WBNB 1PJ8A 1JVNA 1THZA 1GAQA 1NFRA 1QYVA 1PDVA 3AUAA 3EG9B 3SD7A 5CCEA 4FFLA 4Q93A 2BGWA 1JAYA 2CNLA 1GTMA 2ZVDA 5G3ZA 1N57A 5JWOA 5KS2A 5FV7A 1U3WA 3U40A 1GVNB 4DXDA 2LCQA 4X64B 1OH5A 1AQUA 2AFVA 3IFSA 4YRBA 4K9QA 4F9TA 4N5NA 1JS1X 1RZSA 2O5VA 1M54A 3IAUA 1TJ5A 4JBHA 2PLNA 4IOJA 3DLTA 4L1KA 4J7AA 3OPQA 3CZQA 4AX4A 4WCFB 4KFTA 4MPTA 3ASVA 1AN0A 1CW2B 1UDAA 4TTQA 5KQPA 3HSKA 3P20A 5GZ6A 3W5JA 2UUCB 4B45A 3DEKA 4AXBA 4CQNA 3LUAA 5D6OA 1B0AA 1ZUNB 5KTTA 3K2IA 3C6QA 3LJKA 1A8HA 2ERXA 4HNHA 5EY5B 4PC3A 1BA2A 1ZCAA 3F78A 5JD6A 3T9AA 1A72A 1XCMA 1RHRA 3D9QX 3AVPA 4R8LA 4XYEA 3QRWA 3QVGA 3R75A 2XA9A 4CUJA 3D6HA 2Q0QA 4NAVA 3KK0A 3KWJA 4UDOA 5AT1A 3O3CA 1IB0A 4E21A 1JFSA 2H92A 4IHAA 1LS6A 2QUAA 5ALRA 2AMJA 4AY5A 4MHTA 2JGLA 4J7CA 2FPXA 4OL9A 1UK8A 5DW0A 1UJMA 3ZDEA 5JEEA 3O9XA 4U7WA 3UG6A 5I4CA 5CIYA 1TM5E 1GV0A 2A6PA 2PWZA 4B83A 1E5TA 3LCRA 2IPXA 4QLBA 1VRCA 4HP8A 2AOTA 1GG9A 4FEEA 3GUUA 4MJ3A 2JEOA 4X85A 1UJNA 3LT4A 1GZ4A 4BMZA 5CPFA 2P9FA 4WLVA 3U4CA 4II3A 4RAQA 3HUTA 1RKXA 2WTEA 3GRKA 3GN5B 4PHTA 2KPOA 2IXAA 4IQFA 2BHNA 3C8DA 2WUEA 2GCIA 2IVQA 5EFOA 4CN8A 1Z56C 3DMNA 3RU9A 3ELUA 4AAYA 3NHJA 1UPTA 1XNHA 4B6EA 5JW6A 4P4TA 2H5JA 1AKTA 1J2JA 1GGKA 1BXRB 3HY6A 3NTUA 4HH0A 5M3BA 4N5IX 2NSYA 3GJ4A 1W581 5ELLA 2BEJA 1V5EA 4GOND 4Y9SA 2PGDA 3P27A 3DPSA 4NAHA 2OR1L 3IRUA 1T0BA 5F7ZA 2P4HX 3SF8A 3NWOA 4PY2A 2BZSA 2DCUA 1B8UA 2AWOA 2IU0A 1L4LA 1VCMA 4UEQA 2WWVD 1RACA 3SXJA 3UEOA 2CLDX 1CHNA 1Q14A 3ML1A 4KKVA 1C4KA 4OYRA 4WXYB 3AY3A 5AXCA 2JVKA 3LPNA 1NI3A 4EG4A 2OCLA 4A9AA 2DJ5A 2SNIE 4LF7B 1PQYA 1PDWA 1ODLA 2BZGA 3QOFA 1H42A 3HY3A 4J9VA 3OTOB 4Y1EA 1HNZB 3UFXA 3PEYA 2XCSB 3ZKWA 2D2IA 4UE2A 1X1SA 1TTTA 4YRMA 4Q9JA 2IFTA 4TT8A 2WWIA 5E9AA 1ZY2A 2RAFA 5IJ0A 4BBAA 3BQ9A 4G9BA 1QDUA 9GPBA 3W2EA 2WSIA 5LQDA 5DSTA 4ZV7A 2W2VA 4G67A 4AJKA 4EUHA 1RIIA 3V2HA 1ZONA 1QRUA 3FLEA 5CFOA 3UB2A 1NNI1 1W29A 2VZEA 3AT1A 2HMYB 1O6GA 4B3HA 5ITWA 1PL6A 3H4IA 3P2OA 4JS0A 5A4JA 1FRQA 2HDNB 1L1EA 3HCRA 2H4ZA 4OQQA 5FBZA 4N7MA 4DA9A 1JHXA 1XCJA 1B15A 4MTLA 2ODWA 4XFDA 3DTNA 4FYMA 2PQ0A 4M9QA 2ZU0C 2GXSA 1ADCA 1XLUA 4WOBA 4NOKA 2N9UA 5E0OA 5JANA 4B3RB 4HAZA 1W96A 1JSRA 1Z62A 3ORSA 3BDAA 4NV1A 2C1XA 2R1VB 3Q0TA 2C4VA 3EISA 4NCJA 1IBMB 2YZGA 1E9FA 3BDIA 4NQRA 2DC1A 5DXAA 3DCIA 4MWGA 4WZAB 3ZW9A 1Q1EA 2NV2B 1YUMA 1O4XA 5EPUA 5HIJA 4DA7A 1PR0A 4J29A 4HY3A 3R5SA 1RI2A 2JIBA 3RIEA 3UA3A 4HB0A 1RRGA 3KQOA 4EGSA 6PFKA 3UNXA 1KTVA 1EFDN 2D5VA 4MK4A 3Q9UA 3B1KA 4I1VA 4I1OA 3KP1A 4NIMA 1R0ZA 4DSOA 4UFOA 3OOWA 1LDBA 3JXCL 2A67A 3N2IA 4M2LA 4EDFA 4UTRA 4UBIA 4ZQHA 1QCZA 2R6JA 1E2JA 1RW4A 1GG5A 2VQFB 1Z68A 1H9CA 1O96A 3ZYCA 2LYRA 3NORA 8GPBA 1Q57A 4FOSA 1CUBA 1M8FA 1QVAA 3LC0A 4YK7A 3KETA 2HLNA 1SVUA 1JVSA 3ITDA 2V54A 2IHTA 2IV1A 4MO9A 5ILQA 4BFVA 4ZCPA 5KJEA 2QJFA 2EP7A 3PNPA 4ODIA 4Z59A 5KSWB 4M3NA 2EQBA 4EHAA 3THWB 2C7PA 4ZKEA 4LQLA 2X5XA 1VHWA 1L5VA 3IPYA 2JJ8A 2C8KA 3I53A 3RYIB 3DT9A 3PWSA 2B99A 2CNWA 4HL6A 4F11A 1EYZA 1UXJA 2H1CA 2V3VA 5LZ7A 2JBAA 2RK4A 1MX9A 4ZOLB 5LMZA 1DZ3A 1VL1A 2C2ZA 3L7LA 1L4KA 1QNFA 3MTDA 2XMCA 4LHEA 3R9IA 3RJZA 1JTVA 3LPAA 3K15A 4ZU1X 4OGFA 2C59A 4A23A 2EF1A 1R6UA 1E2PA 1RWVA 2FWPA 3AM5A 3G0GA 3GRUA 4PLPA 2HA3A 1RKQA 2QAGB 4RVFA 4F86A 4RABA 2O5CA 1A4XA 3OMLA 3OJLA 3JTEA 4DZTA 1OB5A 5JQGA 2YZMA 3VVCA 2ATVA 5K8JB 4BEBA 1SMKA 1U0JA 1X9IA 1ZGZA 3AU9A 5HBRA 3JZMA 1JDBC 1IY8A 3FIJA 4OATA 1OBOA 1XK7A 2IEZA 3IEUA 4D3FA 1Y1TA 3AYZB 2GXAA 1IVNA 2JGDA 1AE1A 5BUQA 2CDAA 1KFJB 4LZLA 5LWQA 4GLBA 1NERA 3OQ6A 5DTMA 4L8LA 4FLFA 3CPHA 1E2IA 3OEEA 3IAFA 2O50A 3EULA 3K1AB 1R8XA 2MSWA 4N5DA 4UMDA 1V1RB 3D6UA 1Y33E 2CXQA 3VR1A 3T7SA 1L3IA 1NX6A 3TQRA 4BKRA 4MUEA 5BN3A 4QC2A 1V43A 5DYNA 1ONNA 1RVV1 2HV8A 1U81A 1F2DA 1GQQA 1P1HA 4NEQA 5EXSA 3RTAA 2G9ZA 3AG6A 4CEIB 3HZZA 5JVDB 1HYHA 2WABA 1T8TA 2OK7A 2R8PA 3F3KA 1KQNA 1C0IA 2JGJA 3TIIA 4AY3A 4I1SA 5LZ9A 4M9XA 4O2AA 4N40A 3A9XA 4LY9A 3GEGA 5EIAA 5TT0A 4O4IF 4BLQA 4PNHA 3HR8A 2WF7A 4X7RA 3K0FA 1W4CA 2EBHX 2VHUA 3AI7A 1SWWA 3RFTA 1DCFA 1GO2A 4KYVA 3SLRA 4OVKA 2W70A 3M6WA 2JD1A 4MVJP 4G5GA 1QH0A 4MMYB 5HUHA 2IP4A 4KMOA 5K6AA 1NJ8A 1H2BA 2QNBA 1IOVA 3NNNA 5EKDA 4X7PA 1SD5A 3TVTA 3L43A 3MGGA 1EDBA 2F8LA 1HT1E 2WDPA 3WGUA 4AKGA 4FHDA 2HLDD 4MRAA 3B7WA 4RWEA 3VOSA 4A1OA 5H59A 1TNDA 1DJMA 1FYFA 3ZVKA 3PXGA 4G4GA 2Z8YM 3FPCA 4YDQA 3F52A 3SJCA 3R20A 3O3NB 4DUYB 2HSGA 5CT5A 4EKIA 5JCXA 2WKWA 1DAFA 3KEMA 3H1FA 3PHIA 4M89A 4MV3A 4EZBA 1GRVA 3LL4A 2OWEA 4RJLA 2GN9A 4I2NA 3OD1A 3HYRA 3UKDA 1UXDA 1RI5A 4HDOB 5KJ1A 1XNGA 3HC7A 1WVMA 3P9NA 3N0TA 3W04A 3BS4A 3MCTA 1K7SN 3QPVA 1GPMA 2ZAOA 5ALOA 2OQVA 3GLGA 1FP7A 4KYIB 1YKSA 1TK3A 1YC5A 2IHNA 2WG0A 4DCSA 5KMGA 3DCNA 5IYZA 4MW5A 2UYHA 1QIJA 4WZBE 5GJWC 4MWOA 3HKBB 1NBEA 1IMOA 3K73O 4LF8B 3ZW7A 5G3YA 3G7NA 1YIAA 4GMXA 3ZGNA 5DM60 1XRMA 2DLCX 4AROA 2O2CA 1OU0A 2EW1A 3L8EA 3M9WA 2WAMA 3BEDA 3EBOA 2I4IA 4LHZA 1BVYF 3M6MD 4YY3B 5BVGB 4XW2A 3UGJA 5K9ZA 5A71A 4R8RA 3BX1A 5FLYA 5C1BA 1JEYA 1DEXA 4AUEA 2MMGA 3CUWA 3RYFB 4EF6A 2PAFA 4IIJA 1QCYA 2NSDA 4TYPA 3R24A 5ALUA 1E77A 3FUWA 2XI8A 3UB4A 2X4IA 3KV1A 4D0NA 2H18A 1E0DA 4B9EA 4RV9A 3QLJA 5JZVA 3PFHA 4BO2A 4WTOA 4B5KA 1MC8A 4XVHA 3GNTA 2AR9A 4E08A 4DY4A 4O3MA 2YYSA 3B36A 2YYAA 2XVMA 1DKQA 5U1PA 3L1VA 5EJ2A 3ZY2A 3JD4A 3TD9A 2EZTA 3P9IA 3G2NA 3PKZA 3GZNB 2QRVB 4FDMA 1MO3A 4Q82A 1WP9A 1BXZA 4WMLA 5FOQA 4EI8A 1DT5A 3NAGA 3A4NA 1AUQA 1RVDA 2BHRA 3S2EA 4IQ0A 2Q6VA 1TC1A 2Z8YA 4N3CA 4Z7NB 5DU2A 4I6GA 3RRJA 2FZEA 5B7NA 5JASA 1PV4A 1PW7A 3G9ZA 2WWXA 1P91A 3EGWA 1XLTC 3Q3CA 1PP4A 3F90A 4YRAA 4C6RA 4XGKA 1EGMB 4BNYA 3MFQA 3DTVB 2J09A 2JIZD 1JAHA 3DEHA 4FDTA 1LLFA 3EA0A 1R6TA 5IJAA 5IZ4A 5A5GA 1SD2A 1I33A 1XMQB 1DMRA 3U60B 1N33B 3RC3A 1JALA 2PZGA 2F00A 3OKPA 2B8WA 2QGNA 3JQGB 4OY3A 5IKOA 2XCTB 3AR2A 3GPCA 4JLMA 2QN2A 1LTHR 3KFVA 4LJ4A 1L5GB 4F7WA 1PFKA 4FOLA 3I28A 3RS7A 2BLNA 1DLJA 3QY9A 2PZFA 3CLUD 4M0LA 2QAIA 1OBVA 1UC4B 1QO0A 4DNPA 3EY9A 2O6HA 1U8FO 1F17A 3CZRA 2A88A 3LHFA 3OU2A 1YZFA 4NDAA 5DN6D 5KYWB 2C2MA 4GS5A 4R16A 4FGKA 4FNOA 2IY9A 3HS3A 1W35A 4WBSA 3ESRA 4RPLA 1M1NB 4QREA 3DOUA 2GZ2A 3QYXA 2IEIA 2W4QA 4S1OA 4ZALA 4UTNA 2AW3A 2JLRA 1DBPA 3NUZA 1ZN2A 2I8CA 1J56A 4JI5B 1D9ZA 1ZDMA 3CYFA 3ONEA 3WP1B 5LR6A 2IX3A 4D5GA 3RC1A 1ZS4A 1O0SA 1WL8A 2CB9A 3OURA 3PNQA 5BRNA 3P0RA 1KE2A 3VOBA 5BYBA 3ZGXA 3C3KA 4FILA 1TM2A 4KIFA 3CO0S 3TSZA 1NMXA 5AICA 1OTXA 3D6MA 3G2LA 2C84A 3QF4A 1UBHS 1VE7A 2OO7A 4IH4A 5T8KA 1UBKS 3L0CA 1L5HA 3WHPA 3T5AA 4M1SA 1PBTA 1M76A 2OCGA 3CSSA 2AXUA 5HKBA 3K05A 1A9ZA 4BNXA 1AY0A 1E2LA 1FTQA 1VKHA 4MNTA 2XMRA 4M8NE 3SJUA 2BKEA 1XJWA 3EZFA 4I5DA 3ZNOA 5C2JB 5C31A 4KSCA 2HA2A 4U2GA 1VL6A 5A02A 3DR5A 2OYRA 3HZIB 1ES9A 2O2IA 5FTWA 3CIFA 4EO9A 3ZHBA 1WVIA 2Z5FA 2V5VA 3T7EA 4BO3A 4C03A 1UBTS 5L4NA 2E0IA 4UNRA 2HCTA 2R00C 3Q10A 3DDZX 5FBQB 2HQRA 1TQ4A 2IXGA 3OQHA 4HDNB 4PZYA 5E6SA 4M7RA 1EVYA 1AURA 3I0MA 2N1MA 5J4KA 1E2BA 1ENOA 4XTCS 1SHTX 4YUVA 2VUIB 3PNLA 3R0ZA 2LPMA 3W5VA 1JDSA 1XXHA 3A4TA 1PQUA 4A8HA 1MOZA 3TM4A 1JMVA 2EFCB 3OEWA 4R05A 3VR3D 2UYCA 2XCQA 1L8OA 3DE1X 4DLNA 2P77A 1G2PA 2A5GA 1U8CB 5IVPA 1DIGA 4MTCA 5EQDA 1W88A 1YBFA 2FYTA 3IBSA 4JBNA 3GJRA 1W85B 3VHRA 3CECA 2JBWA 4F4HA 4H77A 1U2ZA 1PK9A 3TNDA 1V3UA 2KEJA 3COWA 4RPCA 1F14A 1DXQA 2VJKA 4YHHB 1KH2A 4MVYA 3BE6A 3RT7A 1XMPA 2VSXA 4BVJA 3L7MA 3QKIA 2ZT8A 1SUPA 1OHHD 1ZOPA 4Z0PA 1XNQB 1XPRA 5C9ZA 1YJ5A 1LCDA 2QM8A 4N0QA 2OGZA 1JEDA 3BBLA 4L16A 4M8KA 5DYWA 3SHFA 4E4YA 5IHPA 2BR3A 3A2NA 2QQEA 3FI0A 1Z6AA 3H8VA 3OWOA 4Y1RA 3W4KA 2FPSA 1MTZA 1QGED 4H4DA 4C7OA 1OJLA 1A95A 2DHEA 1LLIA 1BG6A 3NATA 2GJKA 4KIUA 1H0SA 1GYPA 2WYHA 1VL0A 4EUKA 3DFKA 1LPOA 3PC4A 2I80A 2SKDA 3WGQA 3UOWA 1N6KA 1GL3A 4KQHA 1KBZA 5EA2A 3AYXB 1RWNA 3DLIA 3G1UA 1M8PA 5LDDC 3KPYA 2NYAA 3TCKA 2LLWA 3ZD9A 3DHVA 4Q4AA 5CDYA 3KPUA 5CB4F 3OTWA 4ER0A 2CFCA 1I0IA 2XGSA 1U3TA 4PXYA 2J9FB 1P7WA 1XA4A 4D79A 1L7DA 2IC5A 3TDNA 1OY1A 3NGMA 2FN3A 3D64A 1H5NA 2Z9BA 3DEFA 3LTEA 4RA6A 5DCWA 1E5QA 1G17A 2SCUB 5LOVB 3B3QA 4HXYA 3NDRA 2LYKA 3RLIA 4PSUA 1JU4A 3FBWA 4GG1A 1AIPA 5B2EA 5B57C 1O77A 1HEUA 4W5HA 4QPJC 1DBQA 2OD9A 1FZTA 1P4GA 2IXTA 4Z0NA 3K32A 3FJOA 1SVIA 4A0HA 1E4EA 1PD0A 1PT5A 2DB3A 1A0OA 1JF8A 2R97A 3HDHA 1HQ1A 1EVKA 2ON6A 2HWYA 4GMDA 3GLKA 1T2UA 3Q7TA 5CNIA 4CIAA 1TD9A 5AKIA 5AIBA 1LWOA 4D8TA 1K8QA 4LTMA 3ELWA 4M86A 5C34B 3E9CA 3P5SA 4I81A 4H59A 5CT6A 2IW3A 3PIRA 3WGHA 4UEJA 5AJTA 1TKBA 4EABA 2WT4A 4FFRA 4GP6A 4MRMB 4TQAA 2BL4A 3U4GA 2PXCA 3KUDA 4C6HA 4CLDA 4UTPA 2VYQA 3A3NA 2QV7A 3E4DA 4MQEB 3ND8A 3PVZA 3VHQA 4BATA 5K8IA 3RVMA 3A1FA 1LLQA 1RQPA 4PW0A 3DTYA 2XXJA 4QUDA 3PFIA 3B1WA 3SCHA 1JAXA 1YBMA 3F8TA 1F0NA 3PI7A 3MJFA 1YF3A 3QU7A 2JFGA 3BFPA 3GGSA 1N6OA 2QT9A 4QJ5A 3RYCB 3ZIDA 1I1QB 2WJIA 5I47A 1GL9B 2XDQB 3E81A 5AJZA 1L7XA 5IULC 3TL3A 2Q07A 1S02A 3LBIA 5FOSA 1U3DA 1VG1A 1W1WA 2ZIAA 1FS5A 3ZBTA 4R40A 4US0R 5KYGA 3KZCA 4NYJQ 1PV1A 2XA1A 3E1KA 3LPCA 3NBKA 4P2GA 4XD7D 4RMNA 2UZ1A 1S9DA 2D1YA 2ZT5A 4GYKA 4ZA2A 2XMQA 1VBNA 3EOAI 1FFDA 1YAHA 4P81A 5L3SA 2DY1A 1TZCA 4P80A 3HN7A 1A5BB 2VP0A 4V3CA 3GPDG 4AWXA 2OENG 2VJDA 4H18A 4TL8A 4BEJA 2JLAA 3T5DA 4CMHA 1DAEA 1MC1A 3CJTA 3SC2A 4DQ0A 4N48A 2EFYA 1FMCA 1CY0A 1XRLA 4UVEA 3BGOS 5IBRA 2UZ1B 3ZQUA 1KU6A 4AF6A 4EB6A 1J1IA 5CYPA 3VPGA 5F7JA 5C5EA 4CEHA 2DPMA 2J3IA 2IUSA 1MG0A 2QE7D 2GAIA 2JEZA 5EZYA 1Z16A 1Q74A 4M55A 1E3QA 5LNK6 1D7AA 1JDUA 4IZIA 5F64A 3H97A 2O4CA 2JIQA 3VU0A 4HGPA 3M5WA 4Y6LA 4L5YA 4EGCB 4R2JA 3PXUA 4IP0A 4QRIA 5KHLB 1WRBA 2FPLA 2JLWA 1DIOB 5CB0A 5B58T 3T1VA 4MR9A 1NI5A 1CEEA 2F9MA 4WX2B 3EK2A 5AWFC 4Z4HA 1BYUA 4WDRA 3RUDA 2ETXA 2NXNA 2AOUB 1E94E 4DCVA 2Q1TA 2W90A 3MTBA 4YT5A 4OUKX 2JFBA 1VPEA 4J0DA 4BB9A 3GO4A 1G3QA 1YB6A 2CCKA 3A4MA 3BFJA 3FCXA 3L18A 4UKDA 1PTKA 5KYUA 4PYJA 2C7VA 4FSHA 5C1IA 3T7AA 2QF7A 5JWRA 5LSAA 5CVDA 1K6MA 5TMBA 4KN9S 2CE2X 3UJAA 3ZHIA 2BELA 3FVWA 1E2GA 3IDZA 4JELA 3U6KA 1LRLA 2HHHB 1YBAA 5KWSA 3C3BA 4YRDA 4BTVA 4XTRA 3T1HB 1EAMA 5LB2A 1Z4OA 2OXIA 5HUJA 2H57A 2O3SA 4HHEA 4AS3A 3SQXA 2HRQA 1VIAA 3GELA 1USVA 3RIMA 5FHQA 3GPBA 2ZQ5A 1QDEA 4FMDB 5KVSA 2NSJA 5HCNA 1P17A 4MA0A 4BB5A 1Y8CA 2QVGA 3PGKA 5JEDA 4L74A 4HAOA 2EP5A 1TYEB 2G3YA 3FPHA 4Q9IA 1PNTA 3MEJA 4ZEOA 3VZPA 4EPRA 2FOIA 4OUDA 5THQA 4DDTA 1GDDA 3OH8A 1YTUA 2QNRA 4LWZA 4H08A 2C98A 4TMKA 4UBNA 3RGWS 1GPDG 5I8WA 3N8NA 1V3QE 3E3NA 1HE1C 1TE2A 4RESA 2JAUA 4GOJA 3B5EA 2B5AA 3NHSA 3LOQA 1Z0JA 3G7DA 2R6ZA 4ALNA 3V4SA 2PV0A 3AERB 4PX9A 2O2EA 1KSGA 2JFZA 2R6CA 1Q1GA 3ROZA 1ZI6A 4OOEA 1YKFA 4PZUA 2XF2A 4EPTA 1F2VA 1DKRA 3RU7A 3HKEA 2GM4A 5GJCA 3IOCA 5C3UA 1J09A 3T34A 1Z35A 4BAZA 1TQ6A 4MYUA 3DDWA 4DM3A 1IY9A 4W1SA 4AS1A 1NHGA 2O2JA 4HLDA 1A50B 4RHYA 4I08A 1NMEA 1T5DX 1UDXA 1B74A 3LYLA 1HEIA 4ZCQA 1R0SA 3QBDA 2AFIB 1TCVA 1WY5A 1G5HA 4E32A 3TQIA 2PX5A 4EW6A 3I9KA 2OA0A 3ZV5A 4UBJA 4MKRA 2MCFA 3QJGA 1IWPB 1XXHE 2MSCB 4GGPA 1HWYA 1OAOC 2C61A 5BNTA 5K4GA 4QTTB 3ZGYA 5THXA 3T35A 3L0PA 1R4MA 2CE7A 4ZMBA 1XU7A 1ZIXA 4F9EA 1L6IA 2OEPA 1P0IA 2Y99A 3ZK9A 2AG1A 3VZRA 2O57A 1F7VA 1NY6A 1Q1QA 4Y2VA 1P4AA 2W2XA 3MXTA 1TCUA 3MT9A 4TWIA 1PNRA 2ZBPA 4WAUA 3L93A 2QPOA 5JJ5A 4U2BA 1UANA 1GGVA 3ZHTA 4N01A 1E32A 1M0TA 2R79A 4RE5A 4O4JA 3K71B 1NAIA 5IAOA 4I2VA 2RAVA 3HXTA 4JL5A 4JH0A 2ECKA 1R69A 2QIOA 2IYLD 5J2TA 3EVBA 1XVVA 1A71A 3DOIA 5CLQA 4JUBA 4TXMA 4M1TA 4R1TA 1G1MA 4A8PA 2D5BA 4RNCA 1HL7A 1ATZA 1UZAA 1VDMA 2UZIR 3G79A 4KRGA 4PYKA 3UYLA 4BVHA 1FTNA 5JAUA 1N9KA 4BFUA 1N77A 5JRJA 2HIAA 1JZSA 1Z2CA 2NV0A 4M1OA 2JFUA 4KE9A 3EGXB 2ZSAA 4LKOA 3NO4A 4HS4A 4QJBA 4HFJA 5EIFA 2B98A 2GFQA 1IOWA 3Q7IA 4HR7A 2O0MA 3GEEA 3HJRA 4TKVB 1ACLA 1ESMA 3SICE 4CR8A 4HMOA 4WFIA 1GGJA 2QMUA 3LC1O 1FEZA 4GMHA 4HTFB 5F1KA 1PZEA 2Z2ZA 2OK8A 1MHTA 4QDTA 2L49A 3NETA 3AJ8A 2VR1A 5CW2A 1B7GO 4QELA 4N49A 5ER9A 4HX5A 1LTQA 4F9GA 1Z37A 1H1LB 4NZMA 2OAP1 2ODRD 1CJCA 2YICA 3SBXA 2XH8A 3SZUA 1YJAA 4R7ZA 4PLWA 3SS8A 2QTHA 3BEOA 2IP1A 3MJRA 4C0QC 4G1UC 4BQOA 5BQFA 1M7HA 2WHYA 3A14A 3L01A 2L2QA 1HK7A 2IZ7A 4QUAA 5DNVA 3RSSA 3RBZA 1ICEA 1Y1PA 4D9IA 3E9QA 1P2FA 1DEKA 3F5SA 2WSSD 1JHYA 3K8YA 3E7FA 3F6SA 1E5LA 2NV6A 3P4UA 3ECSA 4NF2A 4MVJI 1LQUA 1MEEA 1AKRA 3ANMA 3CVXA 2D3TA 4BO7A 3AF2A 3BXPA 4CU2A 1ZZ6A 2AZ4A 5AJVB 4L3OA 4NU6A 3KR2A 4WXMA 2JATA 2WR8A 2Y1DA 3T9DA 3DHWC 1GITA 1CS0B 1YHYA 3PWTA 3VFDA 5EUQB 3QUSA 2GZUA 1YGYA 4URUR 4F8YA 3L06A 1JECA 4HWSA 4A2PA 3IT0A 4JX8A 3L7YA 2R6R1 5AQEA 3F96A 3DMDA 3E48A 1BE0A 2WHXA 3F7MA 4HQ0A 2W2KA 1QUFA 2BT4A 2FPUA 4M7PA 2XX3A 4RGVA 3OEYA 1UOQA 2QTMA 3KB1A 5CA0A 1RADA 2A3RA 3BD1A 4JZYA 1KH3A 2QMQA 2QD2A 4Q7KA 3V6LA 4AZ0B 1I3KA 4BS9A 2I2DA 4IRUB 1UXCA 1UKVY 2H16A 2WAYA 2JHPA 3OZIA 3OPVA 2YVLA 4QPPA 3WIOA 3V8BA 2J6IA 2Q1WA 4TPKA 4U7TB 3LSYA 3OLQA 1OGJA 3BBPA 5PNTA 2OLJA 3KKPA 4HNGA 3U4MA 3U44B 3SXUA 2A6CA 1MAHA 2FSVA 3FMPB 4PSCA 3HVKA 3WIVA 1AKMA 1RU3A 3O38A 1FRFS 1FXUA 1VG0B 3CXRA 3V4FA 4BO0A 4CM9A 1QX4A 4UHBA 3U3MA 3W78A 2BM1A 1Z34A 3I37X 5KAMA 4HQKA 3FBGA 1HYGA 2A78A 2WZCA 4GP9A 4OIMA 2GPYA 2A1UA 3VR5H 5HKKA 2BRUA 3GZNA 4NQZA 1RWKA 2RJOA 1OJ7A 1RYZA 1DARA 2B2XA 3ABOB 4H27A 4S1NA 1BMFA 5NLLA 3LP8A 5AVZA 2F43A 5K0TA 3EMKA 1PZHA 3K09A 4J7UA 1XZEA 5A9SB 4M1QA 4EQZA 4IGFA 4CW7A 2DRIA 5ALLA 1AZWA 2R1ZA 4TT3A 3D3QA 2IIPA 3RO7A 1WZCA 1I7DA 4XWKA 1E5DA 1DG3A 3ZE2B 1E0KA 2Y1XA 1Z22A 2BJVA 4OBBA 1H2FA 3VR6H 1AJEA 5L6LB 1K2VN 4JY7A 4RV4A 5E9WA 3M4JA 2G67A 4G8BA 4L95C 4INAA 3TECE 4GU5A 2YWXA 1SU6A 3ADBA 1XTTA 1DFGA 3JVEA 4QVGA 4RVNA 2RARA 4Z8XA 2ZTSA 4F7DA 3WNQA 1L1QA 3CKKA 3WL3A 3GJ6A 3W8NA 2X6RA 3L8FA 2AX3A 2YXBA 3M6FA 3R41A 4D44A 1TAGA 2OR3A 4RV5A 3ZCUA 3OQVA 2H6EA 3K1ZA 1C7RA 4IEFB 3X1MA 1J2EA 5C37A 1SXQA 2P2DA 3F49S 3RARA 1Z6YA 1ZNXA 1MAUA 2FQQA 3NKFA 4MV8A 3L8MA 4I1PA 2XGJA 3CNHA 1ZPQA 3KWFA 3L07A 4HMPA 5CB8A 3MQ4A 5F5NA 3PHHA 5FXMA 3B6MA 4MVJF 4C3VA 5BVGA 1JFRA 2X1VA 4PAOA 5KMGB 3W9BA 2E3JA 1PZMA 2I2AA 3PC3A 3TTTA 3R0XA 3SY8A 1E89A 4KMMA 5SZHB 1UBJS 3FTNA 4S12A 1KI6A 1SD1A 4V1CA 1RAIA 2V7UA 3QU2A 2POCA 4Q12A 2BDTA 4QDZA 1GTJ1 4RA9B 3V7FA 4FMDF 5C3MA 5DM2A 2ZPUA 1SKMA 1ZH4A 2RCNA 3HKEB 4X45A 1UMKA 1L5FA 2Q27A 3CIOA 4DSTA 3QE9Y 1U4OA 5MN5A 3WOHA 4LJRA 2B8EA 3TBKA 3BWXA 3QE3A 1H69A 1TK2A 3R7WA 4EA9A 2G0AA 1P81A 2VF7A 2XHZA 4TWJA 3LRPA 1XDBA 1UOOA 2F8MA 2OVFA 3Q5DA 3HCEA 1NN5A 3T4XA 2CMFA 1CUGA 3H5WA 1UXKA 3CO5A 2LBPA 1E62A 3OE5A 1FZQA 3CUVA 4JLKA 4BO5A 5JC8A 2HF9A 1WOYA 5F7OA 1ENYA 4KFRA 2PV7A 2C29D 2SECE 3WE7A 3ZHYA 2V98A 3TRHA 1IN4A 1OQAA 1C50A 3NXKA 3P9YA 2MSEB 4KQFA 1DQNA 1PFYA 3KZMA 5DM1A 1G7CA 2P91A 3I1IA 1XXLA 3CF2A 1W1IA 4S2UA 5A62A 1L5WA 1CNFA 3FHOA 1TZBA 1EUDB 1JQLB 1P0CA 2JD0A 1IHPA 2RG7A 2WG2A 1B76A 2NLOA 3B89A 4LECA 4YLYA 2AZMA 3PP8A 4FNAA 5AOVA 4GWLA 1QM5A 4L51A 1A3CA 3E3OA 3H13A 4G1BA 3WRWA 2H59A 3B7PA 1ZMBA 1ONOA 4Y2HA 2X0NA 4OMDA 2OXTA 2F3QA 1L6RA 1K8ZB 2YZ7A 2CVOA 3P45A 3PNKA 4IWNA 1ZSVA 4L4SA 8LDHA 3PPYA 4KQMA 4Y98A 4PBTA 5E3HA 1IDOA 1FMFA 3GFPA 1DHRA 4COKA 5CFPA 5EJ6A 5DHTA 3FA2A 4C78A 4JJKA 3AVYA 3N2NA 1YR8A 1RPEL 2WJVA 5ALXA 1M2GA 1UJCA 1D03A 4MKZA 5JS6A 5FYDA 3I1FA 5I01A 1E1CA 1Z36A 2J67A 4DIUA 2GAAA 4DQUA 3FDJA 2ZSBA 1JR6A 3VKGA 2RGGA 3GWGA 3IMEA 2DJIA 4GM1A 5IDVA 4YRNA 1LDEA 1ZD1A 3D7KA 2M1ZA 2R66A 1F3LA 1WLYA 4IG9A 2B83A 4UBKA 4FU0A 3FGZA 2VJYA 3A6KA 1QAMA 4F56A 1JR3E 1DJPA 3JYNA 5DLDA 3KQMA 3QMWA 4M98A 1C81A 1Y48E 2B94A 3D8SA 3MB5A 4N65A 3OFJA 4OYLA 5TB5A 4F1JA 3BCHA 2UVPA 5KWJA 3J81k 1X92A 1ZXXA 3GT3A 5CIQA 4E22A 3QPWA 5KX5F 2QVCA 1VB3A 2BNNA 4YYZA 2EAUA 4Q1FA 3SZRA 4DQXA 5JFTA 2TRSB 5CD9A 2BM9A 5JNLA 1KJ9A 5CYOA 3VV3A 2O1SA 1Y7LA 3EQ9A 4CV1A 2XZOA 5AKXA 3RYIA 2XDWA 2YRXA 4YG1A 2FSIA 3HMKA 4JX9A 1F38A 2DKOA 4GX0A 4ZOEA 1GNTA 4FBMA 4C01A 5KNBH 3GRPA 2J5RA 2HJHA 1UBOS 4YC7A 2AE2A 2Y0DA 3B51X 3LQ4A 2O7QA 2C1EA 2CVHA 5ESWA 1E79D 2YHSA 2J4FA 4A6EA 1E9SA 2YASA 4LSGA 5ITVA 1ORVA 4G4SP 1I13A 2B20A 3TM5A 4ALJA 3ICWA 3IIEA 3IURA 4FDUA 1T8PA 2GBLC 2X2OA 1E79A 4XEUA 4OGWA 4OO3A 1ZIPA 3K96A 2VK4A 5AKHA 3ZY5A 4A8JB 2XRYA 3HM2A 1ZVJA 4OXKA 4IV5A 4AZ3B 1JKXA 4MRRA 3RCBA 1D5WA 2WAOA 4RJKA 3U7RA 4MEBA 3UVEA 1VMDA 2YINC 2BOVA 4JUCA 4JU9A 4Y2PA 3RKRA 3IUMA 5B6PA 5CEFA 2EKBA 3IUJA 3MMNA 1T6ZA 3PT9A 1UP6A 3R3JA 4TTSA 5SICE 2WP0A 1P6QA 1JLHA 1G42A 3TRKA 3F6BX 3S2ZA 4DE8A 4U2EA 2YV5A 3EH2A 4YN3A 3TLAA 2PU5A 4D4GA 4UM8B 4C29A 2HJGA 4IVRA 1BH2A 5F5LA 4CL0A 3LX4A 2LKCA 3AF4A 7AT1A 3GFOA 2CHGA 2Q9CA 1JU3A 1G98A 1QQTA 1M6EX 1UEXC 2NGRA 3KSDO 3AIKA 4K1XA 1TUBA 3F9CA 2O38A 2H9IA 3A05A 4V0QA 4KR9A 3FYAA 3HBFA 4JEIA 1GCOA 2G1PA 1FC0A 2IYYA 3V3TA 1KI9A 4FC7A 1XEXB 4JITA 4UQOA 2QJRA 4MB6A 1P72A 3T95A 3EFOB 2UXBB 4MV5A 3IIIA 1I3CA 1KZHA 3Q8XB 3FYMA 3O31A 4MQUA 2X5OA 5GADl 4CQMD 3OIDA 1TZKA 3O73A 4IUCS 3V4LA 2O0LA 4CTOA 3KQYA 3WY9A 4MDHA 4RY9A 5BORA 3NBMA 5F3DA 5BSWA 3HVRA 2GS9A 1CJKC 2KPJA 3AUTA 4ZOCA 1US8B 5C8YF 2R8YA 1F12A 1V96A 4IVQA 3ZCQA 4I5FA 1IJKA 3BE5A 3LQQA 4D9CA 1YE8A 3AV3A 5DCYA 1JPVA 2LYQA 3UJ6A 1GUDA 3RRFA 4FR5A 2QN9A 2HK9A 4CRWB 3PNVA 2AQIA 3PSAA 1HKHA 1RM5A 2RG1A 3DQZA 5A7HA 4IJVA 5CRIA 1RJ9B 1VI5A 4UVGA 1K8RA 3LHDA 4WWHA 4ARBA 3E2IA 2MMCA 2WIKA 2PXXA 1QVZA 2VT6A 1AD2A 3D3NA 1TAHA 2GKGA 3E3MA 4JR2A 4EJFA 3D7SA 4ER5A 4N8SA 3ONFA 1ZMXA 3RSQA 1G66A 4FFOA 5MF6A 3QFIA 3AEZA 2OD7A 1P0MA 2F1HA 3HCPA 3HBLA 4ZJPA 5CDUA 3HHPA 2D4HA 2JJ1D 3VNRA 1M0SA 1KVUA 4AJEA 3N2EA 2O48X 4YHBA 2P1DA 1W7AA 4ND5A 1A69A 4TV9F 5K8CA 5D5QA 4EWLA 2WNHA 3FPFA 2BYTA 2H17A 5A5VA 3V4OA 1CUFA 2NO4A 3A70A 4S1PA 4ZHSA 5JO0A 2JHCA 2YZNA 3NAZA 3NWJA 1QH9A 1UJ6A 1GTSA 5A5DA 1P9WA 5D1HA 2GPTA 3GZTB 3ANTA 3QPDA 1LBEA 2RGUA 3FUCA 4ND7A 4Q4HA 5CX4A 4GR5A 3CXUA 2KMLA 1QS0A 4MGIR 4F2WA 1EVQA 3WO1A 3B6EA 2MDTA 2YYZA 2QY9A 2LYPA 5IAKA 3CWZA 5TGTA 2D7CA 3U81A 4NKRA 4RF2A 4K9PA 4B4DA 1JHOA 1IJBA 2Y9MB 4ZVTA 2O59A 2QLJA 3B9QA 3FTPA 2FR0A 5E4YA 4Z58A 2WJ6A 1C3JA 3T15A 5B36A 4FEYA 1M8KA 1LSOA 1PL7A 4B7XA 2GCOB 4UEWA 3O8BA 3QE2A 3AL3A 4JJIA 2ONYA 4ZVKA 2CW5A 1TPYA 2XXQA 2ZRAA 3V55A 1JEOA 5HGJA 5C5IA 3GLUA 4FWBA 3WMRA 1TD1A 3UH1A 2NU7A 2NZJA 2VP9A 3KU4A 3TKLA 1JSZA 4EG0A 4X54A 3CPEA 3D8RA 1QYIA 3LZCA 1VSUA 5KYXB 3R3YA 5CLHA 1K68A 3DO8A 1EE9A 1C9DB 1WTCA 3HY4A 1WZIA 1AQIA 4NSNA 2HPHA 3F6RA 3VPXA 1RMTA 4CDRA 3VSCA 5A9SA 3GDHA 1KK3A 3A2LA 3MWKA 5G0UA 1Y7TA 1VJ0A 2TYSB 1RE0A 4F0JA 4O4LB 3HU2A 3S1SA 2O7NA 4ZMSA 4WVFA 4V0RA 4Q3LA 3CTMA 1R3DA 2WJWA 3JVUA 3GZCA 1NP6A 1TYDE 1ZUWA 3H99A 1FP2A 1F3OA 3JY6A 4AN0A 2G04A 1ESDA 3REGA 2QX4A 2Q0SA 3D2BA 5E8RA 4CWAA 2QS9A 2GDJA 2GJ9A 3HA5A 2HXYA 2I62A 3ELBA 3LCMA 4KPUB 5IUKC 3ZJ5A 4DMCA 4M38A 5TX7A 1WS6A 4C4AA 5LU8A 4YXWD 3AI1A 3NOVA 1N36B 4W9MC 4Y6QA 2AOUA 3FCOA 3UY4A 4L0CA 4Z7JA 2QZ4A 1UC9A 4C0BA 1OBHA 2GA9A 2V6IA 2QT1A 3AW9A 4I7EA 5I6DA 3U44A 3U4QB 1VSBA 2OXFA 4RGQA 2GOYA 3BA6A 5KSYA 3LXMA 3Q6MA 1KR2A 1XRJA 1G19A 3RRNA 3ZLUA 5F9FA 1LTKA 2HPAA 4YO8A 3ZQJA 3HE3A 1TJ4A 5EJIA 1XIVA 3A9CA 1N1EA 1IYZA 3F7NA 4IDQA 1SNYA 3UM9A 3J81A 1I94B 2QTTA 2ZSEA 1ODSA 1Y7HA 4TL7A 4P36A 1Z4JA 1JQJC 1KYIA 4I4CA 3SX4A 2FPWA 5AI8A 3SSAA 3UK6A 4QPDA 2YXEA 3I2GA 3G68A 5J5AA 2XCUA 1J8DA 3G5LA 3DWEX 3UMBA 5LP6F 2G76A 2QHXA 3AUFA 1IHYA 1XF9A 2DVMA 3L8GA 1H3FA 3NNSA 3PX2A 5A3RA 1CSEE 1G20A 5BN1A 3ZHQA 4L5JA 2JCGA 5AI4A 1ENZA 3GHYA 1PEYA 2V7TA 1Y3IA 4L9AA 1SM4A 1L3CA 1ZC4A 3C14C 3F5QA 3E9RA 4FLEA 1A5AB 5EXXA 5DBIA 2OPBA 2R6FA 4PXSA 1QGUB 1CERA 1SXIA 2GLTA 4L5BA 1Q6YA 3OVMA 3KSRA 4LTNA 3ZHOA 1DUVG 2WD7A 4YCBA 4E4RA 2K2WA 3WYGA 2ANBA 2EF0A 2ST1A 1X8LA 5K6AC 4UAGA 3JAMA 2VUHB 4HUQA 3EFEA 2HA6A 3QPBA 1RXYA 4OEHA 4WCFC 3HCWA 4U0KA 4UU1A 1DXOA 3PNSA 4NC9A 3I23A 1OTHA 5JTUA 1FUKA 4D4IA 4JN6B 4BQNA 1O4WA 1KJYA 2AJCA 2V0NA 4PGMA 1TQDA 4HKTA 4KXWA 4Q0MA 3S8YA 2CHVA 2D7DA 5EAIA 1AKNA 2CUNA 2RC6A 1Z6QA 1M1UA 3CV3A 3RUHA 2ZZNA 2VN8A 2YDXA 3GP3A 3UCEA 3VKFA 4EBFA 5C46F 3H2ZA 1PJ2A 3CR7A 1AQLA 3A2KA 2VC2B 4PYIA 2C4WA 3IXQA 4FLMA 2CXNA 1A04A 3ZV6A 3PG5A 4RULA 2HYIC 4OXYA 4YXWA 3WV5A 3I2JA 5A7LA 2H00A 4JYAB 5KBYA 3SFZA 3W6ZA 1OCEA 3IOBA 4XWYA 1GT0C 1BGWA 3GIDA 4M60A 3QEMA 4L5CA 3T3HA 3U4DA 3U3OA 3UN1A 4BXOA 4DUGD 3JAKB 1NBIA 4TLCA 3O4RA 5BVHB 3T3NA 2HO5A 4U7GA 1OVMA 4GX2A 1POXA 2IK8A 1IXZA 3C3WA 3HYNA 3P32A 4GX1A 1W5AA 2W0SA 1CUWA 2O49A 1SG9A 2PR2A 5FPQA 1OV6A 1J07A 4ZCIA 3R74A 1Y82A 4AJ2A 1IQ0A 4DLUA 3L4SO 3PDIA 4WZZA 1JIVA 2FPGB 3E61A 1ZBDA 3TSYA 1GPLA 2A58A 3S5JA 4HEHA 1L4YA 3DOCA 3OSUA 4EB3A 4HVLA 2LYLA 1W0CA 2F62A 1NP3A 3CX3A 1RPJA 4GBJA 3TE6A 2HMAA 4IJ6A 3ZUPA 1QR2A 3C4QA 4D4HA 4MIYA 4J7XA 1MJ5A 4KVAA 2GEJA 4ZICA 3MUFA 3OP4A 1W8DA 5EMMA 4OH1A 5GZ1A 2QJTA 2CHUA 2HGZA 5HE8A 3ZWBA 1UP4A 3PRKE 5ICFA 5I4BA 1B0NA 3DD5A 1Z07A 4YMLA 4O2LA 1PYGA 2X77A 3OQBA 3RS3A 1EUQA 4G56A 2L19A 3DOEA 3AM1A 2V03A 3IJPA 3U3DA 3NH9A 3SC4A 2M2IA 1UC5B 2VTVA 4EA8A 2CXTA 3NP9A 5KCZA 4Z4FA 3LYUA 4OM8A 3IQHX 2RIPA 4LMPA 4ZI3A 2VK1A 2JAPA 3BH6A 4B3GA 2P9TA 4OM7A 3UJCA 4C7OB 3SQNA 2IHKA 1K8YB 2I34A 1VJRA 1XKXA 3I9V6 3NUGA 4CMIA 2WHQA 2ZSIA 4O2AB 5H82A 2PZKA 4RMHA 1D8TA 2P79A 3MYRA 3IT2A 2YWCA 3CNOA 1RRVA 3JATB 1DRVA 1UFVA 1Y1QA 1HPLA 1Z5PA 2I03A 4BIIA 4RTNA 3SYKA 2DQSA 3QVWA 1NY5A 2D1FA 4E11A 1SURA 1FYWA 3J7TA 4NESA 4IIHA 4UM5A 5A3VA 2PIDA 4CIBA 2PRJA 3GLIB 1BC5A 5JXWA 1K86A 1PHRA 1O9BA 4YB8A 4L6IA 1Q19A 1YRLA 2ETVA 1PW5A 5L3RA 1XLWA 4H16A 4IY1A 2QQ5A 4I46A 3LUBA 3SMVA 4E2WA 4Y7DA 3I76A 3WDMA 4EKYA 4NPAA 1R6XA 1EX7A 4D8UA 4BWGA 2JFWA 4DLVA 1SCNE 4ROTA 2PAAA 4OKNA 1II8A 2RC5A 1NVVR 4UFNA 5F51A 5I7WA 4MQBA 5B4TA 8MHTA 1GPJA 2EERA 5CDGA 5AXBA 5HKKD 4BPBA 1YK1A 3P71T 2NUAA 3K9LA 2C5FA 4Y3UA 2VLIA 1JRLA 5K4AA 1DRWA 2JGNA 5JMOA 5JD4A 2CT8A 4MAFA 4PCLA 3KOMA 4UD6A 5LUAA 4RD3A 4CM7A 4DR6B 3D1VA 3NIFB 5CITA 1XVLA 4B4OA 5DBGA 1OW3B 3PWZA 3GB9A 3JWJA 2XE4A 3AUUA 3GGDA 3RU3A 4G5OA 3ZVLA 5IUNC 1R6DA 2W2PA 4F4FA 3MOSA 5K7SA 4YARA 1P45A 1QG4A 3ED1A 1A8PA 4QNRA 2XGOA 2XF8A 1M34E 1M6HA 1HA3A 2NZVG 3Q2OA 5IK2A 3ZXUB 3L05A 2P9QA 5K0FA 4RHTA 1KAQA 2NQTA 3Q1KA 1UJ2A 4IDFA 4Q3BA 2AMLA 2FX5A 2QA5A 3HADA 4DADA 4UOQA 3L7IA 4PYNA 5BNFA 1UP7A 4N3AA 2WWHA 1UAYA 4FSDA 3I0ZA 4YWHA 4KWTA 3PGA1 4CMIB 3N70A 3UTCA 2NTJA 4A27A 4L9RA 5AESA 6REQA 3HL4A 1TDJA 1TMGE 1ZUIA 2FWJA 3D6FA 1CRWG 1T4CA 3EEIA 1O94A 2A4MA 2PWAA 5B1DA 2M6LA 4G23A 4A2CA 4ERNA 5A1TA 4JB8A 2C9DA 1BW9B 1JQAA 1M7BA 1QTIA 3VTKA 1M0EA 1H05A 2BTQA 4B2IA 2GBPA 4RANA 4RDIA 3O92A 3M5CA 4DWWA 4F12A 4KI7A 3BAZA 5IAGA 1NVGA 2L0XA 4LI0A 3W5SA 2XMZA 3DGFC 4J8PA 4J76A 3G5TA 4TQ9A 2X6TA 3DE3X 2XUIA 3O93A 4HK4A 3BHIA 4PHFA 1R4AA 3IA7A 1O8CA 2VTKA 4MRSA 2PYZA 2DWOA 3CLRD 5GIPE 1VPVA 2O2GA 3IKLA 3OU6A 3UFBA 5KWVA 1RWQA 3VR5D 5G1NA 2G7MC 2BUCA 1NUPA 2P2LA 1LDGA 4O6VA 1P44A 1M6YA 1F2UB 3PXEA 1GOTA 3QELA 2A9OA 1QH8B 4UJ3A 5K51A 5CCDA 3L04A 1FX1A 3GJYA 2H1OA 1KZ7B 4Z9AA 3L3BA 1ODIA 2XUGA 5F1YA 5FA5A 4R9UC 1BCRB 1JHQA 1FUIA 1YA8A 2ZJ6A 3EQ6A 3NDPA 3SKYA 3DEZA 3VNBA 1JJFA 3IDQA 1IHDA 2Q7XA 3NIDB 4WLFA 3HLYA 5ETJA 1KTIA 5F4BA 1U8XX 3UBTA 1EJ0A 4MRMA 3B7GA 1EK5A 4JXZA 2QUBA 2Z2XA 1GFIA 3N7AA 4HFNA 2HSWA 4QUKA 4W9NC 1MZVA 4IUDS 2WUVA 3EGCA 1M34B 2O8VA 4JT2A 2FJUA 2VFAA 2YYYA 3MMXA 2I6GA 2PXDA 2NTEA 4EUNA 5I9TA 1XX6A 1N3LA 3EWSA 1SCBA 4MWEA 4ZYWA 2PXTA 1YE5A 5JMTA 5IEJA 1ISHA 1Y9ZA 2J3DA 3AJEA 5IJ0B 4L5AA 2WA1A 3OIUA 1A9OA 3GGJA 1V1MA 3JYOA 4U02A 5TARA 5JV5A 4IIJF 5CFZA 3PJRA 2WIAA 4PLGA 3T99A 10MHA 4ED9A 3I39X 4E33A 2IXEA 3ETDA 1WJGA 4J16C 3GCXA 1UK7A 3UKJA 3VKVA 5IN4A 2UYGA 2A9VA 1OLSA 4KDEA 5K99A 4AUKA 2PS3A 7ABPA 2Y77A 5F98A 4AKTA 1UJ5A 2OOSA 3B6KA 4E2FA 2HTFA 1VCHA 3JPYA 3LUHA 2QXUA 1IXRC 2XI4A 1V1MB 2WAXA 4K86A 1XMIA 3DM5A 4ER7A 1ECBA 2ZRGA 1HDZA 1ODKA 1U0RA 1T5HX 4IV8A 5KSPA 3KFXA 1LNZA 3EIQA 5JNSA 4HQNA 3LYHA 2SBTA 4HBZA 4FFSA 1L5RA 2FSHA 2V7PA 4KGVA 2P9JA 3JQ9C 3PFGA 4JQDA 2A5LA 3UAVA 1HDYA 4ZVPA 5HKAA 2AVNA 2FNAA 5FI5A 1OFUX 1VKNA 3M1AA 1ZNYA 1I51A 4H6XA 4HT3B 2UAGA 4D9KA 5KNCD 1EHYA 3TO5A 4K1LA 4CCSA 2H8GA 3MPUA 5E7QA 4NY1A 1Y7PA 1I36A 2ZT7A 2C78A 5LA6F 1GSHA 3HDYA 2XB9A 2HWXA 2LYJA 1YULA 2HQ1A 1M0WA 2HCRA 2GHRA 2ZANA 3FPSA 4FKMA 4MW6A 4YCMA 1X9GA 3D1LA 2WIUB 1C0KA 2Z83A 3QHQA 5J40A 4OXXA 4PZAA 1XV5A 2ZVQX 5AM1A 4B09A 1M1YE 2I78A 3IPCA 4MA4A 5DP1A 3DYVA 3FMYA 5AVOA 5HUQA 3EFHA 1PJSA 2OFOA 2JPDA 4HC4A 4KZKA 3WK7A 4INZA 1U65A 3L0ZA 4I4IA 3G02A 3HGQA 2WJ4A 1BD3A 3FLBA 1EDZA 1UMCA 5JCPA 2CFIA 2D8MA 3GAAA 1VPLA 3KOZA 3DHEA 4IX1A 4LC1A 5AVUA 4LRYA 1QORA 2WT8A 3FTDA 4LOHA 3CZPA 4QYXA 1O0BA 5K0EA 4AULA 3NUQA 1D4FA 2OP1A 4BBPA 2XR1A 2NXEA 1PFVA 1N6NA 4FINA 1RRKA 2BGIA 4REMA 2BFDB 1PUXA 3GFQA 1LQTA 3EVCA 1AKYA 1KI7A 2HIMA 1QB2A 2X22A 2P9CA 2X5KO 4Q39A 5ICSA 3G5MA 5KYYA 5DTQA 4MQEA 5DLEA 1TM7E 1ZH2A 4O4LA 2XNDD 4IHJB 1UPCA 4NARA 1M6NA 4HNSA 2IYZA 2JFYA 4RUKA 5DZSA 4DQKA 4F96A 1QLWA 3REOA 1M9NA 3IO5A 4R84A 5LDGA 1OH6A 1V16A 4IKOA 1ZA2A 1JIIA 1PRYA 16PKA 3GLFE 1HGXA 1KMQA 3AFNA 3NKVA 3E4CA 4MJLA 4V39A 1ZM9A 2WWYA 1QP7A 4HH3C 4FYKA 4ZANA 3DMTC 4S35A 2RHBA 2AXVA 1KJ8A 1ORWA 2C99A 2GJSA 5ECWA 3NWBA 5TY0A 2WV9A 3SKXA 3U49A 1Y5RA 4I1IA 2NUPB 4QUEA 4R1QA 3GG2A 1DJOA 1WP4A 4MAAA 3ENVA 2XIUA 4DMFA 1UBUS 1RMQA 2NVOA 3L1KA 4HDAA 5AHKA 1N0HA 1REQB 5KYKA 3ZVMA 1H8ED 5J23A 3N74A 3CUTA 3QF4B 5C8YB 2H65A 5JT1A 1W2GA 1YZ3A 4PFQA 3TZLA 3UPDA 4JHLA 1JEEA 4Q01A 3HP1A 3BQMB 3QA3E 1JWLA 4JA2A 4EYSA 4YMUA 4HQOA 1TMYA 5EZYF 2WJGA 3S3TA 2XJ3A 1CF2O 1YO6A 4L4RA 3DV0B 4TRNA 3FLAA 3UGQA 2AUMA 5HJEA 2WLTA 2OCBA 3H83A 5JQGB 4F3TA 2JQEA 5LLTA 2QAGA 2GO7A 1KEZA 4MV1A 4JC4A 4LZNA 1SCIA 3PXBA 1NRWA 4K6HA 4DXAA 2BSXA 5C8XA 4LDAA 3HO1A 3IP7A 2ES4A 2G25A 1A7JA 3ECCA 3TEJA 2VDKB 2WINI 3C8HA 3SP1A 3B3FA 2VHWA 1SQ8A 1E0AA 2AYZA 4B3DA 4FEAA 1JLRA 1ONPA 4OQDA 3G0BA 1ST2A 3D31A 4BX2A 2D2EA 4CG3A 5AJYA 1LBTA 3QFCA 4F5ZA 3QTLA 4DB4A 4TM8A 3MQFA 4AJJA 3IAHA 5FAKA 5EI5A 1U0BB 1N3YA 3TUIC 3ENQA 1H1DA 3R5TA 1XZKA 4NBRA 1CF9A 3THWA 2OAQ1 3DZDA 1U2GC 4W63A 1HC7A 1YRWA 1AV7A 3KKNA 3WVNA 1C4XA 1DIAA 2H4HA 2YRFA 1H0HA 3CPJB 5K3AA 4CTJA 3RQSA 4CV3A 1JEJA 4TTRA 3ZCSA 1TLFA 3JQ6A 2BMAA 3O1LA 3WLHA 2HFKA 3H3JA 3K1TA 4LW8A 3OSZA 4EQ6A 4CM4A 3G2KA 2GETA 3K0KA 1XVUA 1B3RA 2DY0A 4P4UA 4WESA 3K8QA 1P7YA 3KJEA 4DNOA 1OB2A 1IZ7A 3WGOA 2A35A 1ZAYA 1W73A 3FR8A 4JBIA 1YR7A 3G2IA 3PC2A 1H94A 4YH1A 1AU7A 2WTUA 1X8XA 1PYOA 4ZC1A 4YUXA 1JWBB 4RVOA 3X0DA 1S8AA 1VBKA 4INPA 3PKJA 3Q4GA 4NZ9A 3Q88A 2Q5OA 2I7CA 2QRGA 3WLNA 3B9BA 4Q47A 3SAJA 3SS9X 4EY5A 1XXHB 3LX6A 121PA 1QZTA 2GASA 3DD1A 1T9GR 4O4IB 4XDZA 1NNLA 3GLSA 1XZNA 2F64A 3PXDA 1N0WA 3IYLW 2XTZA 3QE0A 3E9EA 1K7EB 1BYIA 1E66A 1ZN7A 4QU8A 4FE3A 3A4IA 4BYMA 3LT5A 3LD9A 3Q7SA 3FNQA 4OQFA 3PYLA 1U2SA 1DKMA 1GU1A 4D41A 1TJPB 1GCGA 4GWGA 2OC4A 3R6GA 3T54A 5E2AA 3X2EA 1XPUA 3ITEA 2C94A 1ZG3A 2QT0A 4KN5A 1Z0AA 3MJCA 2ENWA 4RKWA 2ZJ8A 1UEIA 5TGDA 2QRPA 5WRFA 3GEHA 4JUDX 2D74A 2B4KA 2ZS9A 3TCNA 3JV7A 1LI7A 3KVOA 3IQDB 1GAWA 2FZLA 2P9ZA 4QJIA 5CVCA 2H2AA 5GGXA 3REFA 3ZD7A 4D9HA 4JOCA 1GZ3A 1SRRA 1A97A 3SQWA 3RUIA 3HU1A 5JNRA 1U6IA 2GTIA 2Z3ZA 3OA0A 5DULA 1ISGA 2BPOA 3VGPA 3BMCB 4YRKA 1SELA 1V3TA 3HEAA 1UBFA 4JP2A 4WN9B 4ZVLA 3IS3A 3R09A 2IODA 2OECA 2QR5A 3ANXA 3B7HA 2JVIA 2AFHE 1VSQA 4GR9A 1YVDA 1EFVA 2PXAA 4PO9A 3V1NA 3HKBA 1XO1A 5L6MB 4LZWA 3I6IA 1QMPA 3M3PA 1SXJA 3LUCA 4FX5A 1JHUA 3ZV3A 5JBNA 3I64A 4BE9A 5LYYA 3RTGA 3DULA 1PS9A 1IQPA 4KPYA 3A26A 2VYCA 4DPLA 4LY3A 1XHLA 3O1IC 1GNPA 4YWJA 2ICPA 3KKZA 5JPDA 1OAAA 3GEIA 4LDNA 5FD8A 1PQWA 1PRUA 1L5NA 1K6EA 3MRVA 1C8LA 1XRNA 1LDMA 4J6EA 4DLXA 3JWGA 3ESXA 5LP6A 2DERA 3T5MA 1F9EA 5DM0A 1J2TA 4WECA 5A3JA 3HM9A 4Q1CA 4KZPA 1U1FA 1Y3CE 2HUNA 5EN4A 1MOQA 2YVKA 3ROTA 2J0SA 4ZREA 3WDSA 2XDYA 4KTTE 4D46A 2GBIA 4WPGA 2P6PA 2JGKA 3QXHA 3EPKA 2YN4A 3EPPA 1XJQA 1RP7A 2LW7A 3TLXA 1EP9A 1TB4A 1ORRA 3ER9A 1UMBA 3O8LA 5IBPA 2IV2X 2R62A 5FUBA 1E3OC 3NWPA 4DAEA 1NOKA 2E4XA 2D2VA 2R87A 2O54A 4RF4A 2XUAA 5A05A 3WXMA 7YASA 3ILHA 4F4DA 5IKMA 1JA9A 3BGDA 2YWFA 4NFYA 2G88A 5LMNB 4TZ0A 1C3VA 4N4AA 4YTEA 5KQRA 2IGTA 4X1YA 5DF1A 2NVWA 3OQIA 4E94A 4QT4A 2VPXA 2NO0A 1SVKA 4DCUA 2GJ8A 2IQ5A 3MELA 4CJXA 3ZYZA 2IE8A 1Y4ZA 4P31A 3LBAA 1ULZA 1XD2A 3WL4A 1TFUA 1LK0A 4UZSA 2EKQA 5CX1A 1Q7GA 3UIEA 5JH7F 1WBDA 4CKYA 3HJNA 4LJYA 5DMHA 5CEJA 2BHTA 4DC9A 4RZQA 4QXPA 2LR0A 3WBFA 1BRTA 3R0IA 1MW8X 5LD2C 1O9GA 5LQUA 2UYYA 1MORA 1V5IA 4UU7A 3F0TA 4YT8A 4ESVA 3B1YA 2CSUA 3ZEIA 2C20A 1N25A 3FOFC 1DC4A 1QKIA 2ZREA 4KGDA 3H5NA 3PX3A 4Q03A 3UUFA 3OCJA 2C5SA 3EVFA 2J7PD 3GUHA 2Y1FA 4WH0A 2I66A 4R81A 2FUG6 2OFPA 1NPTO 1RJFA 3QMMA 4KAFA 1TT5B 2BGKA 4LRWA 3D8UA 4MYRA 1NXXA 4XRGA 2BZ0A 2FJ0A 4FZVA 2P3OA 4QRHA 1E9RA 4UHFA 1QMGA 2DLNA 3F46A 5JXJA 1QRTA 2V97A 1EBUA 1JI0A 2AXQA 1N1DA 1XBTA 4TGLA 2IPOA 4KO3S 4QDXA 3TI7A 2UXDB 1NXSA 2FVXA 2ZYWX 1B14A 1E4VA 3ETGA 5D3KA 3VC3A 5IAJA 4XR9A 2A59A 3IE0A 1A96A 3LUDA 1CIPA 1N2IA 4UUOA 3OOEA 1KI2A 2AS0A 2LCIA 1QVVA 5DN6A 2D1RA 1DUSA 4PX2A 1JLSA 3FZGA 4D9FA 5I4IA 1YSEA 3ZS9A 3DF7A 2AG0A 3FNHA 4LZPA 1BHSA 3FLMA 4LYAA 2GK6A 4MV6A 3BXFA 1HDCA 4QGHA 1JQEA 2ORVA 2OO3A 3G17A 1THTA 2G71A 2NYVA 1NX9A 1ZM3A 2PIAA 3G88A 4MPDA 4XSHA 5CYFA 5KNLA 1U90A 4JI4B 3PXXA 1TXGA 4DIDA 2ZB3A 3RROA 5HP4A 4X71A 1ZRMA 4RS3A 3I1JA 3WGMA 2Q2VA 2MOKA 4DJFC 1KOGA 3RRMA 4AFNA 1D2AA 1P2GA 2ZSKA 1X1RA 5JYBA 1O08A 5FORA 1GPH1 2QPAA 2X0KA 4HSGA 4HH1A 3WLAA 1CEYA 2P5YA 3DOJA 4G97A 3DA8A 4CI9A 1Z3CA 4JT4A 4AZSA 3U0BA 1G8JA 3HUDA 5E6RA 1Q11A 4CMGA 2JZOA 5K5EA 1TRHA 5KDOA 4O08A 1W4ZA 1Q0ZA 2ILVA 4RHEA 4DKXA 5I45A 3WMWA 2LDXA 3KXPA 3AP1A 3LQXA 1H6BA 2AXZA 2HGSA 4JJEA 1VYTA 2H48A 2NSHA 4MVJG 1JEQA 3GD5A 2PUFA 3NKLA 3OQOA 4CV0A 4OQLA 4US2R 5HQTA 1YCDA 5IARA 5B2FA 1YB4A 2ZDHA 1QCCA 3OMXA 4NHEA 3JQ8B 2J41A 1NDUA 1VKZA 2VKQA 4A4DA 1IN1A 1NVTA 2YXLA 2W6MA 5BN3B 3HU3A 4X1IA 1VDZA 4KWCA 4BU1A 2VAVA 2ZVPX 1GRRA 3K94A 4I55F 4J1WA 5K3BA 7MDHA 3T1QA 4DCCA 4HAXA 3R77A 4DC0A 3PBKA 4RPIA 2CNKA 4M0FA 1AGXA 3CVUA 1B0UA 1SVMA 3V2GA 3NYQA 3G0TA 2WK1A 3BB4A 5DXFA 3EH1A 1LB1B 2XMSA 1H2RS 1GDTA 2IHUA 4JKIA 3HYCA 2EDCA 1ULUA 1Z75A 4UUMA 2DQZA 1KP2A 5AXAA 2CL6X 4TQGA 2DAPA 1CFZA 3JRXA 4K6FA 3ED5A 4R7TA 9ATCA 4DIBA 3W8FA 1LA2A 2C9BA 1RQNA 1Z2PX 2B37A 1IY2A 1YOVB 3BHMA 2YHUA 2QXTA 3SVZA 2PX6A 1T6NA 1UXGA 3MTIA 1FYDA 2IQIA 3L6RA 2DFLA 2Z1MA 2JDID 3FB4A 1A8SA 1BMQA 3FYUC 4QU5A 4PZ9A 5JCZA 2IYUA 4UXIA 4YNBA <