3KJXA

Crystal structure of a transcriptional regulator, lacl family protein from silicibacter pomeroyi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
333
structure length
333
Chain Sequence
PLTLRDVSEASGVSEMTVSRVLRNRGDVSDATRARVLAAAKELGYVPNKIAGALASNRVNLVAVIIPSLSNMVFPEVLTGINQVLEDTELQPVVGVTDYLPEKEEKVLYEMLSWRPSGVIIAGLEHSEAARAMLDAAGIPVVEIMDSDGKPVDAMVGISHRRAGREMAQAILKAGYRRIGFMGTKMPLDYRARKRFEGFTEVLGKNGVEIEDREFYSGGSALAKGREMTQAMLERSPDLDFLYYSNDMIAAGGLLYLLEQGIDIPGQIGLAGFNNVELLQGLPRKLATMDACRLEIGRKAAEIIAKRLEDPEAEIETRITLEPKISYGDTLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LacI family
publication title Crystal structure of a transcriptional regulator, Lacl family protein from Silicibacter pomeroyi
rcsb
source organism Silicibacter pomeroyi
molecule tags Transcription regulator
total genus 90
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3kjxA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kjxA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kjxA02
3LUGA 1ZDMA 1FSPA 1USGA 2QVCA 1JFTA 4GNRA 1ZZBA 4Q6WA 1JDNA 3SG0A 1DW9A 3BREA 1U04A 3Q41A 5IBQA 4D74A 6ABPA 4RKRA 3RVRA 1S7EA 2IVGA 3GN5B 2FLKA 3IPCA 3KLNA 5CNMA 4N41A 2R47A 2J48A 1JYFA 3F73A 1Z2EA 2FEPA 4PE5B 4D6XA 3SQNA 3RVQA 4EYQA 1ZZ6A 1A2OA 1D2AA 3GBVA 4H3KB 2PE5A 1YSEA 2IOYA 1TJYA 3HV2A 4RK6A 3URMA 3HJFA 3JXBC 4G0XA 2NT3A 1SXIA 2GZUA 3L6UA 1D5WA 3LUHA 3M9XA 4MLDA 1PRVA 4YLEA 2AXUA 3MMNA 5C5EA 2IPNA 4JCYA 1JFSA 4JAVC 2JBAA 4LX8A 1DCKA 3LUJA 4I6TA 3JXCL 2MSLA 2QU7A 2YHAA 4MCXA 2L19A 2QR3A 3QEKA 5CNIA 4YWHA 2WJWA 2MYPA 2TMYA 3CZCA 3QEMB 4N76A 3JS5A 3FDFA 3KG2A 3OLXA 3QQ6A 3KKEA 2X7XA 4KV7A 1NATA 1TM2A 2NT4A 5IEBA 1RNLA 1NXXA 2A6CA 4XXHA 3HZHA 3A3KA 2HJ9A 2ID7A 3CU5A 3M9WA 4X4GA 3PXPA 1J56A 4MRMB 3TO5A 1C0EA 3Q15C 4PYRA 1S8NA 3P9YA 4NICA 3IP7A 4QPJC 2QV0A 4X4HA 2AXZA 5EWLA 1EHCA 3RVSA 3F7NA 3CKMA 3CROL 3MA0A 4YBAA 4NCAA 1RZRA 3A0UA 1HEYA 2N9UA 1ADRA 3BBLA 1SD5A 1QP4A 1CYEA 3EQZA 4OATA 2L18A 2BNMA 1QO0D 4OLAA 1USKA 3QLUC 3IDOA 5HM6A 2WUSR 2E4ZA 1LMB3 2IU7A 4MYRA 1K66A 3SY8A 2KEIA 3H5WA 2M1ZA 2FLWA 1YMVA 3LUAA 2HQOA 4O8BA 5F64A 1K68A 4MQFA 4RU1A 1ZPQA 3G7DA 3HUTA 4Z4HA 3LFPA 1NEQA 1DZ3A 3TMYA 4XFKA 9ABPA 1E6LA 4GQMA 1LBIA 3DGFC 4F8JA 1OSLA 3KTOA 5TPZA 3H1FA 2LYRA 4RXTA 3CLCA 1ISSA 4X4FA 2MYNA 4YO7A 1PRAA 3SCHA 4RY8A 3OMXA 4M88A 2DRIA 3JVDA 5BQ3A 1D1QA 3HDVA 4QYMA 3K9CA 4RY0A 4XARA 4DADA 1VLZA 3LTEA 4N03A 3RVPA 3IVPA 2IDMA 3OQNA 1YMUA 3NNDA 3LUKA 4Z0NA 4WUTA 1YS6A 4FE7A 3O74A 4LE1A 1XWWA 2AWIA 2PKXA 4EVSA 4MR8A 3CNBA 3MQ4A 3B7HA 2IYNA 1A04A 4OLBA 2RGYA 4UHJA 1M2EA 3LFTA 4Z4GA 3Q7RA 4PU4C 4Z5DA 4YARA 2PUCA 3L1PA 1PUXA 2PLNA 4D6YA 1YK0A 3JTEA 2NUBA 3G1WA 5KQMA 4IF4A 4X4BA 2W42A 4W5NA 1ZGGA 1X2LA 4KRFA 1DCMA 1CEYA 1Z26A 3ZHMA 2KYRA 2NZUG 3IP9A 4RV5A 5EWMA 1DWKA 1SQ8A 4KK4A 5TQJA 3BD1A 3O2QB 3H6HA 7ABPA 3ZKCA 3QYXA 2OQRA 3O2JA 4X4EA 5IULC 3HXMA 3O1IC 1ZHHA 1R63A 3FYMA 1ZZCA 5DKFA 4EGSA 2E4WA 1DCFA 1ZH2A 5TQ2A 2LP4Y 2QZJA 1TVMA 1Z16A 3T38A 5FWXB 1M5TA 1DRKA 1NERA 1RIOA 1T34A 2JB9A 4IGAA 1DBQA 4S05A 2PUDA 1SXHA 4MQEB 1USIA 4G86A 4MR7A 1JYEA 5KC8A 4PU3C 3CFYA 1JL3A 1IIBA 4J1WA 4LE2A 2E4VA 2R63A 1ZZ8A 1B0NA 4Z9AA 4KREA 2ICTA 1ZESA 3IPAA 2FMFA 4PICA 4ETNA 4EY3A 1EAYA 1O4XA 2HPHA 3D1NI 4MQFB 5T3YA 3DLBA 3F6WA 4PEVA 5GQSA 2AYZA 4ML3A 5HKOA 5JNSA 4F3TA 1ZZ7A 2IVQA 3GYBA 3H75A 5ED4A 2JVJA 3H5LA 4N0PA 4YG7B 3D8UA 3DZDA 3OLZA 2L2QA 2GI4A 3QLUA 4Z4CA 1Z15A 3TD9A 3E3MA 1QO0A 1QQAA 2H0AA 2O49A 5KI6A 2GRMA 4MLCA 2RJOA 4MS3B 4YRZA 5KQLA 4W5RA 4H3HB 1ZGZA 2AYXA 3E61A 1GT0C 3FFWA 3GWGA 1D1PA 4RK4A 4WZZA 2L17A 5HQJA 2PL1A 3TB6A 3OM1A 1E6KA 2FXIA 3OLYA 3LKVA 4XASA 1E3OC 1NY5A 3G5GA 2R48A 3HUUA 1P6UA 4WXEA 2F8TA 3C3WA 5KQGA 3W9SA 1PRUA 3NHMA 1OXBB 2KPJA 4W5QA 1PHRA 1XWRA 4IWRA 3MF4A 4ZPJA 2MEZA 3IP5A 1EWVA 3QX9A 5TPWB 4KNYA 1DJMA 3QLTA 3NBMA 1NXOA 1D4ZA 4KFCA 4LZLA 2XCJA 2MSWA 2QVGA 4NV3A 3SNKA 1YVUA 2B5AA 3U3WA 1QKKA 2IPAB 4MS4B 4G0ZA 2LYKA 2FQXA 5EWMB 1AB6A 4EVRA 3FMYA 1ABEA 3LUFA 1BDHA 2FJRA 3QELA 4KPYA 5FBKA 3BRSA 1JWLA 1OXKB 1P2FA 3EDCA 1KMIY 1BVHA 3N75A 4MAAA 4IMIB 4W5OA 3DGEC 5IX8A 3KYIB 1E2BA 4LDZA 3CTPA 2B4AA 4GPAA 3QF3A 1RXIA 1ZZ9A 2EWTA 5FWYA 4Z4IA 1WH8A 1ZITA 2M98A 2JCGA 4DQDA 2FSPA 2XJ3A 3ILHA 5D2CA 5IEJA 4HNRA 3F52A 3KZ3A 4ETMA 3Q9SA 3R0JA 3FFXA 3UK0A 3OO1A 4S04A 1PNTA 1U2PA 2FEKA 4ZJPA 3EGCA 1JDPA 3BILA 5TQ0B 3O1HB 2PUBA 4ETIA 2Q5CA 1DRJA 4MPTA 4RZSA 3N0RA 2WY2D 3RH0A 3KHTA 3O1JC 2WWVD 2L49A 1LBHA 4RK1A 3C97A 5BRAA 4LE0A 2BGGA 1QPZA 2QW1A 3NHZA 2HSGA 2QXYA 4Z58A 4I6RA 3CLKA 4RSMA 3FGZA 2VUHB 3L49A 4YG4A 2E4XA 5CNKA 1WH6A 3TRBA 2IV1A 2JVKA 1TMYA 3LUDA 1JHZA 1ZVVA 2EBYA 3M6MD 4Y42A 2FMHA 2P9HA 2MYTA 5TE9A 1Y7YA 4MR9A 1BDJA 2BNOA 3GA5A 1L5YA 3N53A 1SRRA 5FBHA 3RVNA 4FN3A 2FQYA 1HF0A 1BDIA 4RXMA 2JBAB 1U2QA 3H5IA 3F51A 2GBPA 4JP1A 4NQRA 4QYWA 4CBVA 4N47A 4RKQA 3I5AA 4YGXB 2H3HA 5PNTA 3OQOA 8ABPA 1ZS4A 4B09A 1Z17A 3CZ5A 4RS3A 3FMVA 4DN6A 1F4VA 3KS9A 4MGEA 4O1HA 2FN9A 4KMRA 2ID9A 5BRJA 1FFGA 3B2NA 1LLIA 3LKBA 5CNJA 5K98B 4Z5HA 2JRLA 1JLKA 2HINA 2EF8A 3A0RB 2IPLA 3HCWA 3UUGA 5IUJC 4JB0A 4O1IA 3RVLA 3D02A 3GL9A 4IRXA 4JASB 4E7PA 4EYKA 2AXVA 2LBPA 2IKSA 2WIUB 5E3JA 2A9PA 4Q6BA 1URPA 2FQWA 4N0QA 3H1EA 2LUOA 3I09A 5EWLB 3TX6A 3QEMA 4O5AA 3SCFA 4P98A 4PZ0A 5FWYB 4P1ZA 3RVMA 4Z5CA 2QSJA 4G0MA 4IVZA 3Q7SA 6CHYA 3KXAA 3OLWA 2O38A 3N0WA 5A7LA 2O4AA 3A10A 1Z18A 5DLEA 2FMIA 4G0OA 2PPXA 2AW6A 1LCCA 2PUEA 2HQBA 4UHKA 1FFSA 5DTEA 2FTKE 1Y1LA 1QNLA 2CWDA 1F51E 3CECA 3CS3A 2KEJA 4I6UA 3QK7A 4MRMA 3VNBA 3EQ2A 4OTZA 1C4WA 1QQBA 1POUA 1APBA 3QWGA 1YTUA 1RPEL 4HNSA 3NNNA 1P8AA 4KQCA 1ZN2A 2L8NA 4ZMSA 3DBIA 3OMWA 1UTXA 1PEYA 1UDRA 4RK5A 2MYUA 2BNNA 3EJWA 3QLVA 4YV7A 3H5TA 1L1MA 1MVOA 2PJUA 4L4UA 5IUKC 1A0OA 1SXGA 4KVFA 1U0SY 2IVBA 2GRLA 2XSDC 4X4CA 3CG4A 3JXDL 3N0XA 3OO0A 4MR9B 4E7OA 5KQPA 4W5TA 5EWJA 2V0NA 4Z59A 2D5VA 2RDMA 3OLVA 4MR8B 3QX8A 1DC8A 3BRQA 4KK3A 3VK0A 5ABPA 3C3MA 4WWHA 1ISRA 2GX6A 4Z9BA 4KQ9A 3UKJA 1ZUGA 4NCBA 5JNVA 1QP0A 1NXVA 4KZKA 4ZYLA 5IC5A 3KYJB 4F06A 1LK0A 2FVYA 3KSMA 2F8SA 3DNVB 4IA8A 1U8TA 1JFVA 3HDGA 5T7BA 3C3KA 3MLFA 3GV0A 2E4YA 1WIZA 2IPMA 4TLMB 3ZHIA 4NDWA 5JNTA 4Q7EA 3H5OA 4JB2A 1L5ZA 3JVIA 3HO1A 2O20A 4G0YA 2KZ8A 3FFTA 1KRXA 2BJCA 4Z4FA 4Y9TA 4EYOA 1IC8A 2RJNA 2MQKA 1YS7A 4IMJB 1NXPA 4YCSA 2A9RA 1KGSA 2CROA 5BR1A 2JVLA 5TQ2B 1AU7A 4TMYA 1B00A 3RVJA 1GUDA 2H8RA 1VKRA 4TLLB 1GUBA 2FMKA 1Z12A 3RVKA 3SCGA 2PMCA 3RZZA 3ROFA 4X4IA 1MAVA 3KJXA 5KC9A 3EUSA 4MS1A 4MR7B 2A9QA 5JS2A 4LDAA 3CG0A 4F12A 4OG2A 2WMYA 3C6QA 3HK2A 4MCTA 1VPWA 3QLVC 3NNSA 1CJGA 4WT7A 1LJLA 4G0QA 1DP4A 2PUAA 2E4UA 4OBBA 2I6FA 2PUGA 4F11A 2XDYA 3T6KA 1XHEA 4RWEA 2LYJA 4IILA 5GOTA 2IUOA 1NXTA 1W25A 5FWXA 4RK0A 1DG9A 1YK1A 1Z13A 3G85A 2NZVG 3VNAA 4EYGA 1NXWA 4HYEA 3ROTA 3DLHA 4EUKA 4MQEA 5B3JA 1UXCA 3LISA 2CD7A 3S99A 3OMTA 4JA2A 3BS3A 5I4CA 1DC7A 3N6VA 2JVIA 4YP9A 5IUNC 1NXSA 3JY6A 3K4HA 2LYSA 1M5UA 5DCLA 1ZAYA 4FE4A 3R1FA 1CHNA 2VUIB 4TN5A 1GCGA 1ZY2A 3GBFA 1X57A 5JS1A 1UXDA 3GRCA 4PU8A 4QICA 4F8DA 4FB4A 2LCVA 4OB4A 1XHFA 1ZH4A 3H6GA 3KLOA 1WETA 4RK7A 2P4UA 3JPYA 2JK1A 3T8YA 1W9HA 3Q7TA 1AB5A 3GBPA 2OFYA 5JNRA 3GN5A 1KRWA 2PUFA 4X4DA 1EWKA 3HEBA 3I45A 5DGCA 4Z99A 2LYQA 1DBWA 2XI8A 1JBEA 1JF8A 2PAFA 3F6CA 1JX6A 4MS3A 5HSGA 3LOPA 1RZSA 3SM9A 2KEKA 1TLFA 2VK2A 2FEWB 4RY9A 3RVOA 4JQDA 2AUWA 1PNRA 3EULA 5KWSA 2FW0A 3LUCA 1M2FA 1RXEA 2YHBA 3F6PA 2ICPA 2OR1L 2CHEA 1FFWA 2PL9A 2GKGA 1FQWA 2HQRA 1PEAA 3QELB 4HNQA 1GLGA 1RPJA 1QP7A 3HZIB 3CHYA 3FYAA 1P6QA 2MSKA 3GT7A 1I3CA 2PIJA 1JH9A 1LJUA 1QMPA 1Z25A 4JCXA 2R4QA 3MYYA 5TPWA 1E6MA 2LYLA 1DBPA 3OM0A 4G0PA 3O9XA 3N8IA 4EVQA 2OENG 3MIZA 4YR7A 3ILYA 3LMKA 1R69A 1EFAA 3EODA 3IP6A 1NTRA 1CQTA 3S8QA 4PU7A 2LIVA 2R25B 3O75A 3OQMA 1BAPA 1EWTA 2FN8A 3O2SB 4MS4A 3SAJA 5JNWA 4MS1B 1RZRD 2WRZA 3BDNA 4H60A 4FBIA 4WXMA 1ABFA 5JNUA 3T95A 1PERL 2XIUA 5B3JC 1OCTC 4YG1A 3RQIA 1Z2DA 2B1JA 5EWJB 3HM9A 1R8JA 4XAQA 3KCNA 1BA2A 3OP9A 2A9OA 1LQCA 5CHYA 4XLTA 2ZAYA 4LRQA 3CRNA 3HS3A 3UFDA 2VYCA 3I42A 4G97A 3HVRA 2WB4A 1VRVA 4YS6A 2ZWMA 4J1XA 4L85A 3HSYA 1GCAA 2CHFA 2LYPA 2LPMA 4RXUA 4I8TA 3JPWA 4Z4EA 5TPZD 1MIHA 2CSFA 1Y9QA 4RDCA 2GWRA 1LCDA 1MB0A 3EAFA 3H1GA 3H5VA 4JOQA 2FKAA 4ZMRA 3O21A 5C5CA 4GHJA 1MB3A 2R1JL 1YIOA 3MM4A 1H9CA 5TQ0A 2WJAA
chains in the Genus database with same CATH superfamily
1ZDMA 4KX5A 3UXMA 1TD1A 1VE3A 3HYCA 3C1AA 1USGA 4ZAYA 1HLDA 4YJ3A 4YNBA 1T29A 1U3DA 3LP5A 5JAZA 4RKWA 3NTOA 2PKQO 1K7CA 3OUTA 4WY5A 4DYDA 3ESRA 2BI4A 4W7IA 4JGBA 4ZHQA 2FLKA 2PRKA 4Z8YA 5JVDA 3LDUA 1U9YA 3DNPA 5IP5A 3RVQA 1IN1A 6REQB 4IZ6A 2X6RA 2IBMA 1VPLA 3NHJA 2DWCA 1TJYA 5E4JA 2WOOA 1XZ8A 2PUTA 4ZIRB 4PX9A 3MLEA 3R9KA 3GN1A 2DUWA 5AXBA 5MGBA 3QH4A 3E23A 1Z6PA 3NHKA 5D1NA 5KOHB 1OYVA 1T3GA 4RFSA 4IR7A 2Q3HA 5DBEX 4H7FA 1A9TA 1KK2A 1UMBB 2QR3A 4K46A 4C1NA 5LZ9A 3I6YA 1NZFA 1CJUC 1GGMA 2L0XA 4LYJA 1I6MA 2BFDA 3KG2A 3OLXA 2FR1A 4YUAA 5K8UA 1XTQA 1GGFA 1SBCA 3DDSA 3HKCB 1UDXA 3PV0A 4G5OA 1O8BA 1NUTA 1RNLA 2BTQA 2E4AA 2ZBGA 4RHTA 3Q3CA 4F4FA 4Q39A 1T2NA 2HK6A 2OGTA 3B8HA 3RWBA 5EZYF 4BGDA 3KTDA 1XTZA 3NATA 4FHGA 4GI2A 3SIXA 3WHLA 2PJZA 3IP7A 4PLGA 4QPJC 1PSWA 2WHPB 4Z7QB 2ZCUA 1BGWA 4EGAA 1KO8A 4EG0A 3RSHA 3TPZA 3CROL 2M1XA 5CXXA 4B34A 2WD8A 1R4AA 3ECSA 4HWTA 4CIAA 3U19A 4QULA 5DM60 2CV2A 1OLSA 4M55A 4MVCA 6ADHA 1NUSA 2XUAA 3ZY5A 1CVIA 1H93A 2FPRA 2G70A 1LNZA 1QDUA 4ZA2A 5HXAA 1PNOA 4WLFA 1R7RA 3DO5A 1U7WA 4D02A 1OI2A 4JUDX 1L4LA 2QVXX 2E49A 1STOA 2WK1A 4MKIA 3L2OB 1ZPQA 4GS5A 2NP7A 2FP4A 3K5WA 1BEZA 3G02A 1NEQA 4LISA 5JZVA 2I1WA 1F4PA 1OX4B 1RHUA 2CW5A 3OZ7A 4PLVA 4UVHA 4U7FA 3TQSA 4BLRA 1DCTA 4ES6A 2X9QA 4R1TA 4DIUA 4AS1A 4X4FA 2E1RA 3T3MB 2PUWA 3BKXA 2HMSA 3AVWA 1US8A 2DRIA 2QXUA 2DWPA 2C77A 2I4LA 4MVXA 4ZU1X 2VTKA 4Z9YA 2BVNA 1EWRA 3HJTA 3OQNA 1PFGA 4RHFA 1U7PA 1W2HA 1HT2E 3F3YA 4A8JC 4I0WB 3O74A 4K2HA 3RYHB 2R8YA 5G0WA 3W9UA 4EDFA 3DPIA 2VSOA 5LJIA 2HBZA 1C7QA 3CNBA 4GRIA 4MR8A 5A6VA 1K8RA 1EE2A 1L7MA 3NJ4A 5DDIP 3GLHE 4KXQA 3P94A 2ERYA 3LFTA 4IKEA 2QTTA 5THXA 2QRNA 3T99A 2CNNA 3IELA 3G1WA 3JQGA 3U39A 3MRXA 2CLDX 3O4HA 3P97A 2PRYA 1S3IA 2GFIA 3G79A 3V8MA 5EWMA 2O3QA 4KK4A 1SRQA 4E5SA 4TRNA 3I4LA 5IKMA 1Q7TA 3IV7A 1Z36A 3MB5A 3L6CA 5D5QA 1PFQA 5C34B 4MP3A 2ATIA 1VKZA 2G82A 4M6WB 3I01M 2ZSEA 2JIDA 2CMGA 1A7AA 5H3LA 1U3CA 4KO3S 1MX3A 5FL7A 2PH5A 3B36A 5BN4A 4ENUA 1YR1A 1IOVA 5EJ5A 2EYQA 1NOIA 2D1FA 1TZBA 4AKHA 1JB9A 1ORDA 3WV4A 1MO5A 3KUXA 3WWPA 3MT9A 3FYSA 1KL7A 3N8KA 3AF4A 4FFNA 4LNUA 1P2GA 2DLDA 4PYOA 1LSOA 3EN0A 4OQ4A 1V9LA 1WUTA 3HKDA 4KDEA 2VJAA 4P4NA 1E9FA 1G5RA 1U0FA 2REBA 3TRFA 5LXTB 1AQLA 2AI1A 2WJ6A 1EAYA 4Y6OA 1W36D 1FTNA 2IYVA 3D1NI 3IR5A 4MB6A 2VCEA 5F51A 3AR3A 3THWB 2DFPA 9LDBA 4TL6A 4QUHA 3B7PA 3FPAA 1BYUA 4N7MA 4D0LB 5AI4A 4LZJA 1IQRA 4G1BA 4BVEA 4FNOA 3W2GA 2VT7A 4OHYA 4ARAA 4Z4CA 1L5HA 1XD9A 2VXBA 5I47A 3RBAA 2XBUA 1Z08A 1RKBA 3RJMA 1UZAA 2ZE6A 4OGFA 1RAGA 1KVTA 2RHHA 4BWFB 2NSLA 2GEFA 1MOZA 4RD6A 3IODA 2VG8A 2FX5A 3NG1A 4ROSA 1WHTA 4H7DA 2ZIUB 3W9SA 3GQBB 1T36A 2YS6A 4X24A 3NHMA 5JSUA 2FUG6 5DLPA 5JCZA 4IWRA 1V47A 1DNPA 3A9WA 2BRUC 3V2GA 3IP5A 2ZE7A 1EWVA 4IHJB 1JJBA 2VHWA 3WYNA 1JQBA 1V4BA 3DZIA 3FKJA 3TINA 5C4GB 1C41A 4NDNE 1T43A 1YD7A 4OHXA 2MINA 2FPIB 4XEUA 4PLWA 4Y9RA 3TLZA 3V6LA 1Y6QA 1XMIA 1V6SA 3AKYA 2RAFA 4ESEA 4ZYVA 2EIXA 1AB6A 4OHFA 4XD2A 3VHXA 1G5FA 3G0CA 3LUFA 3PI6A 2UYHA 3LK6A 1G20A 2B4RO 4YDRA 5BSEA 4MRSA 3I9NA 5FBKA 3LC0A 3LPCA 1DX4A 1KDPA 4QHYA 4ZEXA 5T6BA 1NVVQ 3NFYA 4PNEA 4TPKA 1RI2A 3KSBC 3B3QA 5CT5A 2YIJA 3R4CA 2YQ5A 4G9GA 2C2ZA 3OOYA 3KU1A 4GPAA 4KO4S 2W00A 4LY6A 3VDNB 4B43A 2LXNA 3OD5A 5LLTA 2OKGA 1JXOA 5D84A 3FX2A 5FWYA 5HMLA 1B43A 3U7GA 5EMLA 1TFRA 3W8EA 2POCA 3LIPA 5EHZA 3QWAA 3BD7A 4DA7A 1JIKA 5GV7A 1EHIA 3OO1A 4M8LA 3NZEA 4ZT4A 2XXAA 2VWHA 1UJNA 1WDTA 1BOOA 2QUBA 4KQFA 1RIFA 1T9ZA 3U48A 2V74B 1DPFA 4MWOA 2J87A 1COZA 2XZLA 3H17A 3GVPA 1Z4JA 3DAPA 1WL8A 2ZBQA 4JN6B 4IDHA 5LIRA 4F2PA 4RSMA 3OIUA 1NA5A 2BPOA 3SQMA 1KHHA 4GPD1 3R0QA 1ADJA 2OESA 4ZAFA 1E5LA 3P19A 4D9JA 4GX5A 3U5TA 1RZVA 1YQUA 1XX6A 2O7SA 2Z3WA 3HA3A 5I9TA 2EBYA 2V5VA 4LFBB 1H2AS 3IUMA 3N86A 3ZIAD 1KDVA 3G5AA 4E1VA 4DJFC 2F9MA 2XTAA 3CMCO 2XVXA 3LSYA 3DZ8A 3P5BA 1B0UA 1F17A 2GD0A 2DSTA 2FQYA 1PDVA 4L4YA 5IDVA 1C1DB 3M6XA 4ZGWA 3H5IA 3F51A 1KI7A 3K96A 4TYNA 1SH7A 4D9KA 5ECGC 3TAUA 1ZXBA 3C5CA 3G8DA 3KZCA 4LECA 3U0VA 3WQHA 3W5DA 1K1EA 1CF2O 1TXGA 4X1IB 1H4QA 2C4KA 2Y6UA 5IN4A 1ZXLA 4LCJA 6REQA 3B70A 3IHKA 4Z1OA 2FUNB 4A23A 1XA0A 3O4FA 3FVWA 3ZE6A 4LHEA 3WGHA 3WNZA 3MGKA 2WIAA 5C8ZA 1BGXT 2JRLA 4ZIRA 2IPLA 3K15A 1EK0A 3DDCA 1G3RA 3WRXA 5KOHA 4JJIA 5I7EA 2A9PA 4BFTA 1ZGJA 2AZTA 2FQWA 1UMBA 3GNTA 4D81A 4QKQA 3QA3E 3VPXA 5AO9A 5KOJB 2BELA 2GVZC 3SCFA 4JX9A 5EEGA 3RC1A 4N5HX 1TCUA 3WJ1A 4EB8A 4QG3A 3TW8B 4CKXA 4Q7LA 1Z47A 4R1MA 3HKCA 4FWBA 4Q1AA 3QVWA 3UENA 2PPXA 1IHDA 4HL6A 3PS9A 4R2HA 1O9BA 2FTKE 4D4MA 4LF6B 2Z0MA 3KOOA 2C99A 4CQMB 4ZJUA 4NX2A 1MPTA 4ZU3A 4XQEA 1NF2A 2AFHE 5AK5A 3LVRE 4I50F 2X1MA 3JQQA 2I3BA 4WPGA 3ZBQA 1YB2A 2DUMA 1HY3A 2VVTA 3E7DA 3NNNA 3PITA 4R05A 5JR3A 2JLAA 4ER0A 5F2KA 5L7YA 5DGXA 2ZUTA 1M1NB 3KZVA 5B7NA 4PLCA 3FZNA 4BY9E 1ZJJA 3G8CA 3D7KA 3IQEA 1UJMA 4GVXA 4HUJA 3U4QB 3EDMA 3A1SA 4A0FA 2AQHA 3R24A 3QOWA 1IZYA 2WU3A 1U0HC 3OO0A 4PO9A 4Y6QA 2JIZD 2BMJA 3LQKA 3AB7A 1AKEA 1L5FA 5KJ6A 4JBGA 5BN5A 3PFGA 4CM6A 3D2AA 4Q3KA 3A1VA 4Y7DA 1JEOA 4FBMA 4C2AA 1SVUA 2YVQA 1LBTA 2I3AA 3AL0C 3KX2A 1AQNA 1W1WA 1P81A 4BMNA 5KSPA 3GD5A 1BEEA 1GZDA 4XM1A 4RLFA 1G9XA 5LOVF 4NDWA 3H5OA 2INGX 4JB2A 1ZA1A 2C5EA 3RYHA 2O20A 1GWNA 3K9WA 1U0NA 3O84A 5GGXA 1SIWA 5T5QA 1I4LD 4CLXA 4DQVA 1FP7A 4C2UA 1W48A 1WTCA 1R4NB 3W3AD 4RA9B 4U5QA 5CDFE 5ECDA 2IVFA 2IEZA 4B2IA 1N0UA 4BGVA 1PLJA 1EQAA 1ZJ5A 1PX0A 3EGIA 1OJ7A 3PFBA 3F5SA 1NBIA 4KFRA 4EY6A 1DBSA 3A04A 3F6BX 1Z4NA 3EUSA 3K6RA 4ZK2A 5JSYA 4PYLA 1XE3A 1UC5B 3C7KA 3DAFA 5T41A 4E15A 1FL9A 1SVKA 1FDVA 2PVPA 3K0AA 3QVKA 4M6WA 1QHSA 2OOSA 1VSUA 1HURA 4MUNA 1FLNA 2R97A 2HO4A 5IG2A 1HNNA 1XALA 3HJBA 4UCFA 4WV3A 2XDYA 5I8WA 3FUTA 3VTFA 1NXTA 1EB8A 1W25A 4MWGA 1FTSA 4NXNB 3KKKA 1FFXB 3G85A 2JANA 3H5AA 1AZSC 5JNLA 4HYEA 2GEDA 3GFSA 5IVIA 3G7NA 1VCOA 1WZUA 3GLKA 1X3LA 3PU6A 1T5LA 1OXXK 3GJ3A 2JIQA 1H6DA 1M7GA 4IJMA 2AK3A 4CEIA 2H7XA 1D5CA 3T3IA 3WGKA 1TMOA 2AD5A 4CMBA 4RJIA 4RTKA 2IBTA 4KHPB 4CV2A 3IEXA 5LXTA 3O4RA 5D00A 4PG5A 3KSZO 4F1JA 2WLSA 1X7DA 3K1AB 3THWA 3MTIA 3UHFA 4I6EA 1MO6A 1L3CA 3H3JA 2Q27A 3H6GA 4L16A 1QAMA 3K0KA 3DZJA 3H4IA 3PUIA 1P5FA 4PAQA 3ZV7A 4EHLA 5JNRA 4QDTA 2PUFA 2PKRA 3NHUA 1G8KA 2VH5R 3I45A 2O1XA 2LYQA 1P1RA 1XZBA 3C3YA 3ROQA 5KHOC 1M0EA 2H29A 3R1IA 4C2TA 1SUFA 4MV6A 4QOHA 5CGQB 3SMQA 5FA6A 5JWOA 3SM9A 2J30A 2ZI5A 3RHTA 3W5CA 1T4MA 4RD3A 3P8ZA 5KUTA 1YTLA 2HC9A 1N4AA 1TYZA 1TEHA 2V7WA 3WB9A 1Q0ZA 5HHTA 2DHCA 4KLRA 3ENZA 2O8CB 5ALHA 3MNFA 4CFYA 1GTZA 1RI1A 3AF1A 3AR7A 3GQBA 5LZ4A 2FPPB 1KE1A 3C85A 4IHJA 4GYYA 1NN0A 3ETGA 2ET6A 4PTZA 2YHUA 3ILYA 2FPIA 2DY1A 3DOOA 1ZOIA 2ZBUA 3EA0A 3NU1A 3EHEA 1DTEA 4QYIB 3R9IA 1E3QA 4OMFG 3LBIA 5K6RA 3ZZ1A 5JNWA 4WXMA 3ZDAA 2DFVA 5DHSA 2C8JA 4EUNA 4ZAWA 2A6PA 2V0GA 1NQUA 1YZ3A 2WOJA 1NW8A 3PT5A 4TXLA 4D0RA 3LG2A 2A9OA 3A9CA 3PX3A 4U63A 3EJ6A 4YDHB 4QXQA 1J90A 5EEHA 1IH8A 1UK7A 1VHDA 1E2LA 1K9SA 2WZQA 4EFLA 1NURA 1ZVKA 2ATEA 1PLLA 3FBTA 3V7NA 1N78A 2WKQA 5IVPA 2J08A 3RRXA 2QPAA 1AHHA 4C05A 3SSNA 3MFQA 1P4GA 1JW9B 1SC9A 1SUAA 3H1GA 4E31A 1OREA 1S89A 4IKOA 5TEWA 3ILVA 4FOOA 4WGFA 1O87A 4RLSA 2ZS8A 4C4XA 3USZA 3T5GA 1U1GA 3A4YA 2JKZA 2OO3A 4X5OA 1O4WA 4FUTA 3BL6A 3DA8A 3OJXA 4UDYX 4DANA 2BT4A 4HTAA 1EZ4A 4HY3A 1YC2A 2O06A 4LGCA 4FC7A 4YYEA 3IPCA 5IBCA 1WCXA 4ZCRA 1KO7A 2Z30A 4QXOA 1XTTA 3VR3A 1U7XA 4K9LA 1TJ5A 5CB4F 3VJLA 4E4TA 1UFRA 3TE7A 2FHPA 3FTDA 3LHIA 4JI1B 4IWXA 4DUZB 3RUDA 1D2AA 1KXZA 1I6WA 3X44A 8LDHA 1EM6A 3BAZA 1DUSA 2CVQA 4HFJA 1AQJA 2H0RA 1U8EA 1BXGB 2RJ3A 4L5CA 4DARA 5EJ8A 2HPAA 4Z51A 3U61B 3BXPA 2J7WA 1T8UA 2PKQP 2LTAA 4L9WA 4NY1A 4P38A 2PWZA 1C1DA 3DZKA 1JFSA 2EFYA 3AL2A 2XMZA 2SCUA 2O3JA 1U02A 3LWZA 1L5GB 5IK2D 2B1GA 2HDHA 3S8YA 3KSRA 5KO2A 1Y4UA 4YV0A 4LPSA 1P39A 2XNHA 4X1IA 2TMYA 4JBIA 3F7TA 1QPGA 4KO8A 1L1FA 1C9EA 4UPVA 5KNBH 2QAIA 1JN0A 3LP6A 2FUG1 1J7KA 1I0ZA 3Q3HA 2VQEB 4JUAA 1MJHA 4IXTA 5IEBA 4YRBA 3KTFA 3PFWO 1Q1ZA 2P77A 1XDWA 3QVVA 1GG9A 1J70A 1WXIA 2SKEA 3A3KA 1ISMA 1YE8A 2VNAA 3G2HA 3IAFA 4YJKA 1NR1A 3EZNA 2BV3A 2JDID 3PQ2A 4MHTA 1FSFA 1FE8A 4RYDA 4B83A 3E03A 1YDGA 3JD0A 4G5HA 4RPCA 4B80A 4EY7A 3F7NA 5KOJA 3PHHA 3RLFA 4DMMA 3QMPA 5A3RA 3IUBA 3A9YA 1ZCZA 4UAJA 5I7WA 3OCWA 1FFAA 3BBLA 4FGJA 2EATA 4CQJA 3GRAA 2GILA 4K9NA 1YHNA 3EZLA 4B7ZA 1T6NA 2NXWA 3VNQA 4DZTA 5HM6A 4I08A 5C8YB 3K0SA 4ARCA 3QYFA 1VPDA 2R7KA 4R0MA 4CQMA 1K8XB 4MQBA 3K0HA 4G25A 1NJ6A 4XWWA 2B83A 4BWGA 5AVQA 4O4HB 1KZ6A 1U7TA 2OWEA 3BDAA 3B6JA 1TI7A 4W5HA 2W37A 1EBBA 2HDOA 3KTOA 4QU5A 4CEIB 2WP0A 4JOSA 2ENWA 1RFLA 2KSQA 3ANTA 4NPCA 3OC6A 2GBGA 1FSZA 3SBEA 1A77A 2Z3VA 2FOXA 3EWNA 3JW8A 3W4IA 1BE1A 3AOEA 3EHDA 2GO1A 2QLFA 4RJLA 3FH0A 2CL5A 4PZCA 1WVMA 2WYOA 3IBCA 1Y7LA 3IVPA 2IDMA 1VG8A 3LHKA 5T8KC 4BNXA 3GCXA 4D3XA 2E9SA 2Y05A 3IIMA 2PKXA 4OD0A 4J4HA 3I4FA 4EECA 5J2UF 2ZJ6A 1CFJA 3U3DA 2YJTD 4MGKR 4CDRA 1RU3A 2ZSAA 4X8MA 1O9GA 2BJWA 2P4HX 4FOTA 4YARA 4PC2A 2C5BA 5AKGA 2CV1A 3IEVA 1PUXA 1P1FA 1TX4B 2HIGA 2MXDA 3HCRA 3LDGA 4GOJA 3VTZA 3AIMA 4BNJA 1H8EA 3IPXA 1HKHA 1CUEA 4IF4A 4YBZA 3EPLA 4QXPA 3K6SA 1VA5A 1UKVY 3I5MA 3BRCA 5C7IO 4PQFA 3WDKA 3IVCA 3E9DA 4K9MA 2JGKA 3VR6D 3ZKCA 1NVWQ 3R8CA 4E5YA 1H85A 2GXUA 1NW5A 1Z5OA 3MOIA 1ISHA 3B1ZA 1X86B 4RVGA 4XOUA 1R4NA 3L0DA 5H4GA 1UJ2A 2R751 1R63A 3WR5A 4AUNA 4BO1A 1NVTA 3BXHA 1I2BA 2E4WA 1DCFA 1ZH2A 2TECE 2X7HA 3H2HA 1T0JB 2LWIA 3JZAA 2NZWA 4IQFA 1GNQA 3H83A 4N9QA 4P3NA 3GP8A 4FYYA 5FWXB 4DV3B 1E5TA 1E1RD 3UKOA 4PGFA 5IKEA 5IVHA 1L9XA 1Z34A 1SXHA 1USIA 1PFYA 4GR5A 1I36A 4KSYA 1U0BB 1NDQA 1HE2A 1U5BB 1OB5A 1NBWB 4KRYA 2O4UX 1UBFA 2OO5C 4XYGA 3SJCA 4ZVMA 2P9CA 4B1FA 4OQNA 1OKKA 2QJWA 3O2NA 4M54A 1PK8A 1IE3A 1ZESA 1FCJA 2FI1A 2W8BB 3IPAA 4EUSA 2YWDA 3OJ0A 2H57A 1LBEA 1OWLA 3O6VA 4B8WA 4EJSA 1O1YA 1FFXA 3WLPA 3D8UA 4QOIA 2Z04A 3K5IA 4EHKA 3IFSA 2G63A 2XW6A 2DY0A 1EKXA 1ECGA 2AYXA 2HRCA 2NYUA 2Z83A 1PYOA 3GWGA 4H3HB 4TXNA 4W7HA 1AUVA 2CVZA 3PDIB 1Y3FE 3OLYA 1B2LA 3ORRA 3UPUA 3HADA 1YR3A 2A4KA 2C42A 4WNCA 5EZ5A 1N75A 4V24A 1L7BA 3K1AA 1RBMA 1MN6A 2NXNA 3V3KA 5EPEA 3KSAC 1E6EA 2H5EA 2X0NA 3ZHBA 2WTAA 1Z37A 2JJQA 1L1QA 3ZZUA 4JVNA 1CUIA 1K5HA 4URWR 1M34E 2Q8PA 1JSLA 3NBQA 4JDPA 3BA6A 4CCWA 3ENVA 4RJTA 4HN2A 2CNDA 3PHJA 5EAIA 1JG7A 1UKAA 4PPYA 2QVYX 2R7NA 3LLSA 4XGQA 1RI5A 1VE6A 5AJYA 5JARA 4GMXA 2O8CA 4IEFB 3I2FA 4REOA 5B7QA 1E2HA 4NMWA 3L43A 1HTBA 1IIRA 4GI7A 4MUMA 5D6NA 4I5EA 2SKCA 4N49A 2ZFUA 2IQIA 4RQTA 4IMIB 2OHOA 2N0SA 3KYIB 4MVYA 4BAGA 1GTRA 1E2BA 3ELUA 2FY8A 2QF7A 1PL8A 2I62A 2KPOA 2Z09A 2Z2ZA 3GRKA 1ZWKA 4U2GA 4Y2VA 3UB2A 1Y81A 2DX7A 4I3HA 3DW1X 2FOLA 4JFAA 3GLHB 4QYIA 4US2R 1O5TA 3HA7A 3WK5A 5LNK6 3OQHA 2PFKA 2PKYX 2UUOA 1QC5B 5ADUS 4NMMA 4PZUA 1MO4A 4TYMA 4KAXA 2X1VA 5HE8A 3FMFA 3SJAA 5CFPA 3SHWA 5CA1A 2ZM5A 4EKNB 3CZMA 2WU0A 1U2DA 4BTLA 2HT6A 3VZBA 4K6OA 1KIFA 4NLLA 4S1TA 2C3UA 4FNAA 4EITA 1ZICA 3D2BA 3C97A 4MV4A 4RK1A 3HYLA 5HVNA 1NX9A 4Q4HB 5KJCA 1B41A 1EG7A 1DQSA 3NWOA 2OCYC 3DTTA 3FGZA 3EEYA 1HEUA 2XTZA 3EA4A 4G4SP 5CNKA 5LQMA 1IBSA 3O3MB 5HTKA 1E59A 4D5EA 1USUA 3E27A 1GRQA 4INAA 1Z74A 1BS9A 2PWPA 4E07A 3LWBA 1Y7YA 1GPBA 1F0YA 1G63A 1QGED 2ACVA 2YMLA 4WK0B 5FOXA 1NAHA 1KMHB 1GG5A 3TLEA 2CF6A 3RRFA 4BX2A 1HETA 2COKA 4GOOD 3ZQ4A 1SRRA 1IY1A 2FWBA 1EM8B 1BDIA 2EFGA 3DMGA 3EBOA 3P9SA 3VHQA 5C52B 1DKMA 3AR8A 1GPLA 3B1XA 4Q24A 2HYDA 4BLUA 2PXCA 4QRIA 2H3HA 3VVLA 3FB1A 4RD2A 4BZPA 4UNRA 1G41A 2YFYA 2DF8A 1XEXB 2ZROA 3KZOA 4CTKA 4I1SA 1X70A 1RRKA 5BRJA 3VZQA 1BXGA 3QIVA 5CNJA 4R31A 4NE2A 3PFKA 3A0RB 1T4CB 1RKQA 3UUGA 1XNQB 4BUZA 1CUXA 1XNGA 5K20A 1DB3A 1XAHA 3BYZA 4K9PA 2LBPA 3MPOA 4OF4A 5L40A 2WIUB 4CCAA 4J7AA 3TLXA 1P1KA 2C2KA 3IAXA 2ODBA 2A5JA 4XWTA 4O5AA 1DIBA 4P98A 3CR7A 4Q47A 1NUPA 1QE5A 3CUTA 5BV2P 5ICMA 2IS6A 1LTHR 1OFUA 2HM7A 4C6HA 4H4DA 1W85B 2VJPA 3K32A 3N0WA 1UJBA 2EKLA 4DLPA 3VX3A 1R0CA 4G0WA 2Q5JA 4LHXA 3NOQA 4N3GA 3ENNA 4IO1A 5DFAA 5TMEA 5H4HA 3CECA 5AUNB 5ES4B 3OCUA 1FP6A 1T24A 1K86A 2QRGA 2ZS9A 2UV8A 3VNBA 3SVLA 3PF9A 5D3QA 5ALJA 1SHTX 1P80A 1UP6A 2GN4A 2ZREA 1JLLB 4JVLA 2P41A 2L8NA 4OX9Y 4Q0MA 3G0GA 1MA3A 1J2UA 2P91A 2DC1A 2VQ3A 4R0NA 4HAYA 4ZWNA 3OCJA 4DNPA 3VR4H 2EF0A 2P9BA 1QHGA 2BNNA 1GYPA 2FXVA 3C6MA 5DI9A 3IOYA 3RIGA 3LZCA 1L1MA 3E8SA 3KXDA 1KI2A 1Y7HA 4GF5A 4KQ1A 1X39A 2XQKA 3J81A 3KWFA 1MDFA 1QHXA 2GQ0A 4NPAA 2A8YA 2VQDA 1KZHA 2CBGA 4EHAA 4INPA 3OCVA 2WSSA 1QF6A 4O4HA 3IAM6 1IM5A 2V9ZA 1MEEA 3VQTA 2QPTA 4LNAA 3LC1O 4P3XA 2D5VA 3LC7O 1VIYA 3ANYB 3LBAA 4JR1A 4M99A 3VOBA 3VK0A 4BOYA 2WP8J 5DM4A 4EY5A 1E0SA 2PX6A 1N5OX 4MGYR 2WI8A 3KWJA 4Y8VA 2Q99A 3VGPA 3WRXC 4LY0A 1NXVA 2OV6A 3A1TA 2VWGA 4NULA 2H2WA 3O8QB 3RUAA 5LQKA 1XWFA 1J2RA 3KOUA 1EVQA 5I9LA 1JDTA 4CHTA 2BONA 2GBLA 3GY0A 2VF4X 1EXDA 1A97A 2WFLB 3DOUA 3T7RA 4DMUB 5BWLA 3P9ZA 4GOND 5C3MA 3ZDCA 4LSMA 4K28A 3QNMA 4Z4FA 1VIAA 3PX2A 4TLDA 1JG2A 2KHZA 3X2FA 2QLNA 4BC1A 1ONOA 3MCUA 4WW0A 3IQGX 5CVDA 5IARA 2A9RA 3FM9A 3RT9A 4BL5A 4BNHA 4AKSA 2O1EA 1AU7A 5KNDD 4C4ZA 5AW6A 2ZS7A 1GUBA 3EQ7A 4P92A 4NZ9A 4INOA 3Q0TA 1NSFA 1ZMBA 3WOVA 2OSVA 3IUPA 3ACDA 1PT6A 3ACCA 3AXSA 3TYXA 2NTNA 1TB4A 2GTPA 4BKRA 1SU6A 3C7DB 4UNIA 1FIUA 3PJFA 2FGJA 2B92A 2PSSA 3H86A 5DSTA 1NZJA 4ZI7B 2QTCA 1H4TA 1CJGA 5A02A 3NTLA 1O5IA 2GBFA 1EX1A 2QAGA 3B7GA 4GR4A 1P4RA 1A9QA 1F2UB 1U8FO 4RWEA 1LI7A 1S02A 2RB5A 2IXAA 3DVQX 2FW9A 3BMNB 5FWXA 5IAEA 1YK1A 4EYGA 3DLHA 3ZW7A 4D46A 2ODPA 2ZVJA 1NNSA 3DH0A 1T0PA 4OQPA 4DAEA 3W6PA 1IB6A 3QE0A 3AGPA 5BN1A 1U5BA 5K8TA 1UBHS 2FJUA 1F5NA 4BMVA 2XUJA 3NONA 2FN3A 2WAMA 3CLSC 3M8KA 1YE3A 1XLUA 4DR4B 2I2DA 4QNNA 1E98A 1Y9AA 1P9WA 3G5TA 4BXOA 1X7HA 3GF4A 3HA2A 1IBCA 2QL6A 1E92A 2XUQA 2ZBEA 1S0UA 4RPJA 3VUEA 4EATA 121PA 4OB4A 1JKIA 3G2JA 3TEPA 3V4VB 3PR1A 1P4HA 3FPHA 3L18A 4TVBA 4XJTA 4JUFA 4X4DA 1LZLA 4Z99A 2OXIA 1D7OA 3ZLTA 4II7A 2AFHB 3S2EA 2B82A 2C2YA 2PAFA 1JX6A 3M6IA 3PNQA 4PLHA 2Q5LA 3MAGA 5AICA 4B35A 1O08A 2HMWA 4PR3A 2RE8A 3ZHVA 4XD7D 4A36A 5BW6B 1TLFA 3PDIA 4MARA 4ENQA 3A6FA 2VT3A 3F6PA 4FBGA 2NTYC 2Q3MA 4P5PA 5KX5F 2PL9A 2WWTA 3FVTA 4DL9A 3DWEX 3N8HA 5K3CA 3LFHA 4AJ2A 2WU8A 5CIQA 3SC6A 1N0HA 2MSKA 1E9CA 5DSZA 3ZWOA 4L5IA 2Q49A 2QB5A 3RFUA 3RKRA 4F6CA 1B14A 4OA8A 2D8AA 2HH9A 4EVQA 2YWFA 3FMPB 3OM0A 2UUAB 1BJTA 3ETJA 1SZCA 3TDKA 1LLUA 5I9IA 4Z7NB 4C3ZA 2F3SA 4TQUS 2DP4E 4KFSA 1FNBA 3JQFC 4CKCB 4HEQA 5FBZA 1WSAA 2WSBA 3AEQA 4OXIA 2NACA 1LLFA 3WLHA 4Y2HA 5AIBA 2HDNB 4AJJA 1M2OB 4DY6A 1ZR2A 1XQ1A 2DJ5A 2YHIB 1PERL 1G6OA 4NHOA 4O29A 4ME6A 2HF7A 1NUUA 1BC5A 3HCEA 3K9BA 3E3AA 5JXHA 2MMCA 1NBOA 4F56A 2CL7X 1B93A 1OGYA 2B3DA 1JLSA 3TAXA 4FWIB 4G8BA 2J8ZA 2R79A 4O3MA 4CQLB 4L85A 4C0JA 4EEZA 4KZPA 2FR8A 2VRWA 2ICAA 4N8EA 2GHRA 1U0OC 2XKKA 3FMIA 2PGXA 1QC5A 1TQ8A 2WKRA 3UJ8A 2E85A 4BNVA 5IW8A 2FKAA 3AYXB 4EKIA 3J7TA 2XNJA 4V3BA 4P0PB 4D9IA 1W36B 5C2JB 1I4DD 1MG0A 4JQCA 3RT1A 4J8PA 4NABA 5F7OA 4TZ6A 4M1YA 4M87A 4PZLA 2VZ8A 3COVA 4Z1MA 2I91A 1ZIYA 2X5XA 4EW3A 1T3ZA 2XNSA 4NFLA 2V54A 1Y6GA 1YNSA 6PFKA 3E22B 4RZQA 3KQKA 2OHGA 2VYVA 1T2DA 3EBLA 1BS2A 5A4DA 2E5LB 1XJCA 2IVGA 2ECFA 1JKMA 1NNUA 4QNMA 3PXXA 4JT9A 2O8DA 3N2GB 3X2SA 4AAYA 1IUKA 2CCKA 3CKKA 2A67A 3TNFA 4IRUB 1DJOA 1ML3A 3HJRA 1ZZ6A 1HDOA 3DMNA 4TT3A 3EYAA 3W5VA 3WWCA 1ND5A 1Y98A 2F8LA 1VGRA 3HV2A 4H27A 1TU3A 4FFMA 1KMHA 1OZ0A 5DP2A 1XCGB 5CJJA 1PRVA 4EMTA 2PZGA 4UUMA 1CERA 5HIMA 2CLLB 1EM8A 2IITA 3E1GA 3BMCB 1QAOA 2BD0A 1EI9A 4G81A 4XW2A 3NWPA 4CHGA 2HMYB 2QU7A 3EZ9A 2C04A 1RRGA 2H4HA 4YWHA 5ENVA 2O0HA 3W05A 2WU4A 4DKXA 1RXWA 1J8VA 2P1ZA 2VJCA 3MAAC 1W59A 2GD2A 3KYCB 2NT4A 3W6NA 3QTBA 1T4CA 4IGKA 2WHYA 4KVZA 1V3VA 4F9FA 1QRTA 2FDRA 3SF0A 1TQ6A 3PBKA 5FPHA 2ZPTX 2HA4A 2UDPA 4M0PA 1KXJA 2IYTA 3KNZA 1VJGA 4PYRA 1DC3A 4RZUA 1WTAA 3P2KA 2FCAA 1ORVA 3RADC 3WMGA 5A5GA 1CDDA 1OIVA 2B5WA 2EXXA 2XOEA 3QFSA 2HK7A 2O8FB 3L3BA 1VFPA 4FDLA 5ARDA 4CKBB 4S12A 2QT0A 1QH1B 5JOQA 2DECA 1X38A 2FB9A 2CLIB 5BVGA 1B6TA 1W85A 3WYDA 10MHA 4I7EA 4R9UC 1O97D 4OLAA 4Y2TA 4H35A 2JJ2A 1QK3A 2YJ4A 4HC4A 3T41A 1P0IA 4R41A 1HORA 3M6LA 3MJSA 1EFHA 2G83A 3ZV5A 1PGQA 3U4AA 4J0DA 2GSDA 3H2SA 3VYWA 3KB6A 4TTTS 2H17A 5LNK1 2OCXA 2CDCA 2ZU6A 2GZSA 3LM8A 4URYR 3TMYA 4B85A 5FOQA 3BC1A 1OSLA 3QV2A 4KN9S 2XWBF 5DZSA 5A2GA 3JQBA 4TZ0A 2RARA 4B6GA 4YPFA 4XDGA 4RY8A 3GJSA 5AK3A 5BQ3A 4YI5A 4NFSA 1JU9A 4RY0A 1ZPDA 4L4XA 1FTWA 2ONJA 5L3VA 4JQOA 1PTJA 4KP7A 5CCDA 5CB6A 3BSYA 3X1ZA 2OXCA 2GUGA 3LUKA 1WO8A 3V00A 4WASA 3I2JA 2WMOB 2KBEA 4RJJA 3TSYA 5I3ZA 2AWIA 5B7PA 1MTZA 2H07A 2W2LD 2PXTA 1W0CA 3VR5H 3GDGA 5L45A 1A04A 1JPUA 1OFTA 3EC1A 1FX1A 4QGHA 3SXUB 3MCTA 3GLFE 2GPAA 4O2BF 5DO9A 1KZ1A 4FEAA 3DLTA 3ZWPA 1A82A 3IDSA 4YEDA 4FOSA 4Q1BA 1LPOA 4HEHA 2W2XA 4TTVA 1KQNA 1ZGGA 3RODA 2G80A 3SYTA 4HSEA 3OFKA 4KR9A 4BMSA 1TJPB 1QRDA 4IMPA 4RV5A 4BQFA 2WFLA 3EW7A 2XB9A 4NEHB 1N8KA 2DTXA 3CLUD 3ADDA 1OXUA 1THTA 2VDUE 4X4EA 3KWLA 4Y2PA 3HB7A 1I30A 3IP1A 5JYDA 4KXLA 4I9NA 1HFEL 4O4IB 2IQ5A 4GWGA 2J9YB 4DLXA 2UZIR 2Y1EA 3M4XA 1QRAA 2FCRA 2IODA 2XTMA 3RREA 3AEUB 4PVDA 4HDSB 4XB2A 4BO5A 3EIQA 4TL9A 5E4FA 3TZCA 4WEQA 1RIOA 2PQ6A 2Z6QA 1GFZA 2QM3A 5C7OO 1ZMXA 1SBNE 1GRRA 3ULKA 4BEBA 3VR2D 3LKDA 1X74A 2QTFA 1PWHA 5KAMA 4K3VA 4HUQB 3QW2A 1ZZ8A 1B0NA 3E84A 3AOEC 4ZI7A 5DYYA 1U1FA 2XTNA 4B76A 1ATIA 1IK6A 4IVPA 5LWQA 5DX0A 5J4HA 1F2UA 2BEJA 3UH1A 2RFLA 2P9QA 5IF9A 1J20A 3EDQA 5JNSA 2PIDA 2Q4TA 3BMNA 1DKPA 3E5MA 3FWZA 3H75A 4RTMA 2C78A 1FYXA 2QRQA 3E5RA 3OLZA 3OZEA 2GI4A 4XIIA 4OBMA 5LQSA 1Z15A 1N57A 1QQAA 5JALA 2P0AA 4W5RA 2XCQA 2PGIA 1RWPA 1SXJD 2WTUA 4DIDA 2YJ5A 3FFWA 5F7XA 3FETA 1WP9A 4OK3A 2WYUA 4KB5A 2ZULA 1UXIA 1QXSA 3D6UA 3TR0A 3ADCA 2ILVA 2R48A 1QQ5A 3HL0A 4HH4A 1R6DA 1XP8A 2JGNA 3RCBA 2HSWA 2QORA 1FVXA 4MLZA 2JGMA 1IHYA 2KPJA 1BDBA 1P19A 1RLUA 3I0NA 3KK0A 4QGFA 2ZQZA 1IY8A 4Z7OB 4KNYA 1KARA 2R84A 4EG3A 1WB9A 2OILA 1KYZA 3IAM1 3S40A 9LDTA 2JGIA 2C07A 2O50A 1JMYA 2HNBA 3L1JA 1RP1A 1JEAA 1N1GA 1RQXA 5DOZA 3VKUA 2NO1A 1EMDA 2QM0A 3M2TA 4HN9A 3SZGA 4CETA 4JLKA 1CR0A 2XBLA 4M9RA 1SOWA 1TVKB 2MSCB 4LMBA 3RV3A 4X1KB 5ESWA 2CFRA 4P5EA 3DBLA 1DQYA 1QWOA 4ZI3A 5HA5A 3KKMA 2PXLA 5CJ2A 1U3FA 4OJKA 2EOAA 2ISSD 2WHQA 2OCPA 1DAFA 3GHHA 8OHMA 1SJ9A 4RF3A 4DQDA 5EJ7A 3UMMA 1P0PA 1YZNA 2FZLA 1OT5A 1YB4A 3UXHA 3W5IA 3AHCA 1LPBB 2D7CA 4NOJA 2Q07A 2YTZA 3W6OA 3JATB 4KFUA 3HVHA 3UWKA 2JLYA 5KVCA 1E7SA 3QKTA 2G25A 3AF2A 2IEDA 4MPTA 1PR2A 3N0RA 4DAOA 1JHVA 1NASA 4RGQA 2G07A 3HBMA 4LDNA 2DQYA 3ZBPA 1A95A 4PGAA 4IQ0A 3TK1A 4B3SB 4DV1B 4DBLE 3PA8A 1TZKA 4CQLA 3ZOZA 4I6RA 5FTMA 2BKUA 3AUXA 4UVEA 2SKDA 3SX0A 4HHEA 3A9SA 2E4XA 2Q3BA 2ZRHA 3GLIE 1ZH8A 2WMNB 1UUFA 1RYYA 3F8WA 3UJDA 1TMYA 2QL9A 4DGQA 1QZ3A 3LUDA 4KGXA 4GMHA 2JF0A 1R8QA 4ENRA 4R9VA 5EIWA 3SR0A 2IXBA 2NU9B 1T9DA 1EP3B 2D2VA 2I4IA 3JQ9A 4AFNA 2XGJA 1IY2A 1ORIA 3E22A 3CPEA 5TF0A 1U2QA 3PXGA 4US1R 3QWIA 2A0XA 2XUKA 3CLTD 1ZM9A 1U0TA 2W2MA 2R2AA 2JLSA 3LPLA 3N2GA 4S1WA 4MTLA 4NECA 3WGUA 4E2YA 1U8UA 2WIDA 3PEEA 4MGEA 3EIEA 5AVYA 4O1HA 2FN9A 2XYHA 2Y9MB 2BSQA 3TR6A 4R6WA 4KMRA 1A9RA 2BOVA 1XU4A 5K98B 3RG2A 1JHOA 2EF8A 2BH2A 1QYXA 1RPTA 4B6JA 2HGSA 1Y33E 1CEXA 2I6UA 3PVSA 3HTXA 1TADA 2FEAA 2IKSA 2ZDQA 3BMCA 3ZWYA 2Y1LA 1NVMB 5CLHA 5WRFA 2PFSA 5CFLA 1U2DC 1QGUB 4ZEWA 1URPA 4CFZA 1B3BA 4LPKA 2IU0A 2P2LA 4C3OB 4COOA 2RAPA 1VGVA 4LA4A 3Q3VA 2NVWA 4N82A 4P1ZA 1M34B 1P0QA 3RS4A 2H11A 3SWWA 1UBGA 3KYCA 3SKXA 2XT6A 4AC9A 1AS0A 5DLEA 4EKEA 5FOSA 2FUCA 3ITDA 4AN4A 1N6RA 1VM6A 1QNLA 2CXTA 1PJBA 1Y82A 3EPPA 2IDJA 3F5MA 2KEJA 5E3HA 5FI5A 5F4BA 3WSWA 3NS7A 1DLJA 3SS7X 3P2YA 4KRGA 2LDBA 1C4WA 1LPMA 2IIPA 3GAFA 2ZUSA 1IMJA 3BERA 1XQWA 3FYTA 4OGLA 4Q19A 4EG1A 2O8FA 3U4CA 1PBTA 3MTAA 5EXPA 4CKBA 4ZVUA 3B6EA 2YY6A 2GZAA 1QH1A 3AP3A 3I04A 2I5PO 4FD2A 2ZSKA 3EYWA 1OTXA 2NO4A 1YBMA 3UAYA 2MYUA 2Q5FA 2XE4A 3BDIA 2Y4OA 3I1FA 4JLSA 2FETA 3J7AC 3M2PA 1ZA2A 2IHUA 2IUFA 1AHNA 2P4EA 4AUMA 3CGGA 4FFOA 2ZVQX 3SQWA 4TRRA 5EA2A 3ANSA 3W90A 3I62A 3CG4A 5DYWA 1I1QB 1JZQA 2RDMA 2RGEA 1TRHA 3QX8A 5CDSA 4AX4A 1C3JA 2QR5A 4HPJB 5SYAA 1FFEA 1TEVA 1V0JA 1L7QA 2YYZA 4KQ9A 4L8GA 4NH4A 3WGOA 2P7HA 3I5UA 4A82A 2PXEA 5CA0F 4DQKA 5D5HA 5LPNA 1E8DA 4HQOA 4LKOA 2B5OA 2GK4A 2XDAA 2X8AA 4V39A 2FE4A 5HYVA 5SZJA 3GUYA 3RC2A 1XVIA 3ZIAA 4WOCA 2JLWA 1JEQA 4BQEA 2JFYA 3DT6A 4E4YA 2ZRLA 2ABWA 3I4CA 2YXLA 1N1DA 1G291 2IFTA 2PGNA 3N3AC 4I55F 3RW9A 5I8PA 3ENQA 3TFOA 2PPLA 1I3OA 1Q1QA 3PHBE 2YWEA 4Q1DA 1KGSA 1VYHA 5A0VA 3KOZA 2BSAA 5K3OA 1JR4A 3F97A 1EVIA 4UZSA 1CUSA 4IO0A 5TQ2B 4E2XA 4MI3A 1FDUA 5L3RA 4QBFA 2XDWA 3JYHA 2H7CA 4CDNA 4D0SA 3QVSA 5GONF 3RGWS 4FZRA 3QU2A 4QQ8A 5EERA 5ILOA 3FF4A 1Q7GA 4RVHA 1K75A 4MVJF 1NV9A 3IEMA 4RH3A 1M2VB 5AJZA 2ZI7A 3T0GA 4O4IA 4RH1A 5ESDA 1XQYA 3M82A 4OHVA 3JU3A 1LJLA 3R0VA 4Q4DA 1SXJE 5AXDA 1AUQA 3G8AA 4CMEA 3TRJA 3GCZA 4F11A 3GLUA 1EVEA 1B0PA 1XHEA 3AEUA 3AHJA 4HDSA 5A4IS 3TOCA 4KNWA 5ENDA 1KMMA 5DN6A 4B7CA 4P82A 2VQFB 2Q9BA 3STYA 4GU5A 4EUKA 2ZK7A 2CK3D 5B3JA 2PX5A 1KFBB 3BS3A 1XRPA 3SEFA 3ONWA 2HMVA 1RYZA 4WUVA 3UJPA 2HJSA 3AILA 3A9ZA 3QKIA 3VU9B 3QFFA 3AESA 3WDSA 1CY7A 4Q12A 2JFZA 4JIGA 2D5LA 1PJ8A 2X2EA 2Q1TA 2X3FA 4Y6PA 5D7NA 3U81A 3AP1A 1UXDA 3GRCA 3GNQA 4B4VA 2IS1A 1KZ7B 1M1YB 2GBLC 2E1PA 2XKBA 3AFNA 3OVMA 4IY1A 3TI7A 5LQRA 4RW0A 2G9VA 2P4UA 1XJWA 3I2IA 4BDTA 1I9CA 2CDBA 1A50B 3EZ7A 1CUVA 1NFFA 2QN6A 3AM1A 1EWKA 1T5BA 3EUEA 2HSEA 3SFVA 5IDYA 3P52A 1VLMA 1AXEA 4H0NA 4IX1A 3PLAE 2VK2A 4QPPA 1II0A 4H0CA 1AKRA 2IS4A 1FX0B 4LS3A 2FUKA 4NYIQ 4F60A 4PS0A 2JIZA 1VBMA 4F04A 3LUCA 1SVIA 5FQNA 2C8VA 4DWWA 1KY5A 1L8XA 2PKWA 3N7AA 4BMDA 1GDHA 3OIGA 1KU0A 1NPTO 1YF3A 1G8HA 1VLHA 2VDQB 4DCCA 5JJ5A 3HZIB 1CJSA 2LD4A 5CYPA 3NIBA 4F9EA 4Q1VA 4RVCA 4L28A 3UN1A 2H52A 4HG2A 4IFBA 3IAUA 4ZOLB 5FWNA 3OZBA 1EFDN 2XV1A 4UD6A 4KC0A 5EOVA 3SQDA 4ABTA 3UICA 4MWTA 5AKJA 2O3UA 1G21A 1QWSA 2W2KB 3F3KA 4XQCA 5LDHA 4LOLA 4I4TF 3U49A 4TYQA 5HG0A 4LCBA 5C0OE 3TSZA 5E4TA 2E37A 2ZXFA 2YUIA 3NDPA 3W3AA 4ESHA 1TVKA 1U2GA 4X1KA 4PM4A 2P3LA 1JZSA 5JYCA 2YRFA 3ACBA 3COSA 4NJMB 2WM3A 4PX5A 2R8OA 1M6YA 2FZVA 3MJTA 5IJXA 3HVRA 3E3NA 4MJ3A 4TXJA 1T8YA 3ED5A 2BBWA 5JC8A 2IYXA 1LQ2A 3QVUA 4WJZA 3IEPA 3ND9A 3HSYA 1YI1A 3WY9A 4EHIA 1A7KA 3WJ7A 1LS1A 1UMCB 2PT7A 1F20A 1W93A 5TPZD 2HZ7A 1Z73A 3V33A 1JFRA 4IIJB 1IWBB 2YC4C 1W4AA 5IKPA 2IEIA 3PGA1 1R6VA 3COZA 1ZL2A 1G64A 1MB3A 3K4QA 4M1WA 4Q9NA 5CW1A 2ZYGA 4YCDA 5HGXA 4R2XA 5HQ3B 3NTQA 1SPBS 2WM9B 3ZGOA 1WDWB 3EVCA 1QE0A 4GNRA 5JSHA 3AP2A 1Q0TA 2X13A 4OBXA 5CH8A 3BREA 5CW2A 5T4FA 3SSMA 4M0MA 3C8DA 5LD2B 2HDWA 1NVGA 3GN5B 2QA5A 2GJ8A 3RE1A 4DQUA 3VSDA 1PV4A 3OSUA 3SJZA 4F6LA 4O4JB 2C57A 3E9MA 4P7FA 1K92A 1NBHA 2G4CA 4EUEA 4NV1A 1G0OA 1H1TA 2ES4A 2OECA 3U1VA 2IZ6A 2R5FA 3DO8A 3KR9A 2HF2A 4H3KB 2AOTB 3JXBC 4G26A 2UZ3A 4WOJA 5LYJF 2NT3A 3JXEA 4TYYA 4D9GA 4EW6A 4B75A 4WCFA 2G08A 4CG0A 2XOXA 4LX8A 2HK8A 4HB4A 2PYZA 3P1JA 3R77A 1JVNA 2EFJA 1N1MA 2VRBA 1MXHA 1U3WA 3GDFA 3GO4A 3IEKA 3STXA 2JIOA 1EBUA 1S8OA 2WF5A 2Y0PA 5FXMA 1K6EA 5CNIA 2PR7A 3BOSA 4GHWA 3GLQA 3ADKA 4WFQA 3E8MA 3AUTA 1I4OA 4QREA 3K7EA 1Q6ZA 5CYGA 3Q2KA 1DQNA 1FVOA 1K5PA 3K70B 5DK6A 1OMOA 4DR1B 1CZKA 2VUTA 3S3TA 1MF7A 1TM2A 2FR8C 1W581 2K7ZA 2J0EA 4BX3A 3CXRA 3JYQA 1XL1A 2IU4A 1TLLA 4X92A 1NXQA 4B4KA 8ADHA 2G5PA 4TV8F 3ZCSA 2XUFA 3ILXA 3PNPA 4BO2A 2CLHB 1QGUA 3CX7A 1ESEA 3FN4A 4LW8A 4W8HA 4E51A 4Y6RA 1QTNA 5B53A 1XPOA 1RQNA 7MHTA 4YUZA 1B42A 1M34A 4YDSA 5FNVF 3MVEA 3E35A 3UCFA 3I37X 3PXBA 1CYEA 3ZU3A 4FT2A 3DDWA 3GBSA 4KO1S 5ECYA 3RYIA 4C7OA 4UU8A 3ZZMA 1NRJB 3HYSA 4F3YA 5L3QB 1NYRA 4MIEA 4EO7A 1FY2A 1RT9A 1RAHA 3S2UA 2IC5A 3U3ZA 3SHVA 2QIOA 2NNWB 1J8QA 3M3PA 2ZLBA 3CF0A 3O8BA 4ZYYA 1ZSYA 4GG1A 2ZITA 3KQMA 3QZUA 4MV8A 5AHOA 4Y3UA 4G1UC 2XMDA 1DC5A 2ZRKA 1YDEA 3HY4A 1OVMA 3DC7A 5FUYA 5CFNA 1WOYA 3IUNA 3IMFA 3WMRA 2YASA 3B9PA 4Q18A 2MYNA 3LQ1A 4JJKA 4QUIA 4WOKA 4YO7A 3FGNA 4IXNA 2DKOA 4M88A 4AJ1A 2JZCA 2A0YA 4BGUA 1ORHA 3PRHA 5A4MS 2WAAA 1D1QA 1N5MA 2WE7A 4MQUA 3JYNA 5EIHA 5JRDS 4N03A 1A5AB 2H5LA 3K5PA 1Z4LA 2XXJA 4EDHA 3KVVA 5JAQA 4WINA 4Z0NA 1L9KA 3JD1A 5FBQB 3LVFO 4ZJYA 1XZEA 3B6KA 3NBFA 3EOAI 1JQKA 3FE2A 3MQ4A 2HA7A 1V5IA 4XWAA 4NZNA 4AURA 2RK6A 4UTXA 1L7AA 3N5CA 1MR3F 2BMFA 4Z5DA 1TUIA 2RCYA 3MS2A 5F3RA 5IZ4A 2BZGA 3X43A 3CXUA 5AM3A 2ZYRA 1UWVA 2NUBA 1EHYA 5LDGA 5KQMA 3N9IA 4X4BA 4RF4A 1C0PA 2F8MA 4FEEA 4UQLA 1JIQA 2G72A 2KYRA 2ODNA 3VISA 4BJ5A 4CV3A 4DSAA 4RHYA 5AMXA 4F3CA 1JJIA 2QD4A 3F98A 4ZVQA 5HIIA 5E8JA 1P72A 1VYUA 1E3DA 1OAAA 2OQRA 3AUAA 3L7JA 1JHQA 1OZAA 1VPEA 2BBOA 3CEMA 4RANA 2GYYA 4Y9SA 5ALPA 3TRKA 2FMTA 3MELA 3UBTA 1KVSA 2W2QA 3MG9A 3O4VA 4G8CA 4R9RA 3MBOA 1OCEA 1E2NA 1Z4OA 2YR0A 1B0AA 1IZ7A 3LC2O 3MGAA 1YS1X 1YB6A 1NRXA 5TQ2A 1ZK1A 4CF7A 4II3A 5LBIA 2XYPA 4I9FA 4BBPA 2EGUA 4QAQA 1MC4A 4GH5A 4F0JA 3LFUA 5KC8A 3BS4A 3KKNA 1F06A 5H3HA 1NNEA 4J0FA 4UULA 4B0OA 4D8YA 5K8IA 1M2VA 3AVVA 3WGZA 2R63A 1SZJG 3FPFA 5EL0A 5EKUA 3RTCA 4KREA 4HDMA 2JDIA 1SZDA 1L7PA 5J23A 1CHDA 2QR2A 4UUBA 1FFBA 4JBWA 3ZNOA 1KYVA 3PNMA 1DSSG 2H1CA 2J6BA 1RRMA 4ZZ1A 1QK4A 4ZI5A 4YG7B 1RAFA 5CLLA 4Y6SA 1NQOA 2V7UA 1MV8A 1H2HA 1NYTA 4RO0A 4KIGA 3AYZB 4GSLA 5GJVC 4Q2JA 2J85A 3WQRA 4A5OA 3DWIA 1IFXA 1HFWA 3DHYA 3N8DA 3WBBA 4MW5A 2LLVA 1A9OA 4TOIA 1H66A 2PANA 3KKZA 3ONNA 4J07A 4JVSB 4CDGA 3A4IA 4S1PA 3CZRA 2R6AA 4WXEA 4BFWA 5IJ9A 3VPBA 4AWXA 2C5HA 3ZDDA 1UEIA 2AXNA 4QO8A 1T8SA 2I7DA 5BV0A 2A9JA 2BIFA 2WUWE 2YVUA 4KQEA 4WLUA 4EMSA 7ABPA 3A1CA 5I7UA 2GYUA 1WA5A 2X3UA 4NRDA 3V8RA 1Y3BE 4ZALA 2PXHA 2C97A 1E3IA 1SR8A 3QY0A 4LZLA 1FX0A 3KT0A 4OGGA 2HNKA 4REMA 3W8RA 1V7CA 2LYKA 1ZM7A 2ZRCA 4JLPA 3P4YA 4WFIA 3CUUA 4YMHA 2F1JA 1FMLA 2AFRA 2HXYA 3M49A 3QJYA 2F3QA 3B6MA 3DZFA 3L0BA 4F97A 1W52X 5KPDA 3F6RA 3BDVA 1T5SA 2CB9A 2HRZA 1FZTA 3RS3A 1RKXA 4LOIA 3IMCA 1JLHA 2NM0A 4ZOLA 3ONFA 2X15A 2Y8EA 3RUFA 1HOXA 1GKLA 4TMTA 4AJKA 3QF3A 1HV8A 5C1OA 2A9KA 4RHXA 1LS6A 5CFZA 1JE0A 2HA6A 3BCRA 4U39A 5IEJA 1MAHA 1X1DA 1TTQB 3KD3A 4HAIA 4ZZ3A 3GLFB 3EK2A 3I3OA 1THZA 3P9IA 5G41A 1YOVA 2OFOA 4ZK6A 2EW1A 4E5VA 4NBNA 1XZGA 4J3JA 5BOSB 4LC9A 4OJMX 2VYQA 3EIXA 3W8NA 2YXDA 1VJTA 3LA6A 4TSFD 4KUHA 5KPJA 4ZDKA 4ZPXA 1Z68A 3AJRA 2AI3A 1BGVA 2QL5A 2R6CA 2RGCA 1E1RA 1FRZA 2ZJ3A 3BAFA 3NUZA 4NL4H 4R8SA 2WWVD 1ZN7A 2OB2A 4FX2A 1PGNA 4A8HA 1CZRA 1YVEI 5K01A 4Z0HO 3NUGA 4CL3A 3OIVA 4AMYA 1UMCA 4YG4A 3BRWD 3ROKA 4LGYA 1GD1O 4Q3BA 2HWKA 2A0KA 1ZIDA 4L2IA 5TQVA 4B47A 4BWVA 1HDIA 1GOTA 1Q12A 2D5CA 2MYTA 4K9SA 5ALOA 1LDEA 3UPTA 2Y71A 4TTQA 3U6BA 2I34A 2F55A 4I5IA 4MWDA 4KLAA 1AO3A 3AEKA 3CIFA 2HKIA 5HKKD 1A2QA 2F1RA 2CCJA 3CF4A 3KOYA 5A3QA 1KOLA 1ADYA 3PFHA 3T1VA 3MWEB 1MBZA 3HCCA 3RHZA 1G19A 4MVJH 4AY6A 4O4JA 5IN5A 1Z17A 4MIOA 1KYYA 3CUEF 4BRWA 7AT1A 4MA4A 2ZTLA 3C3BA 4YAIA 2ID9A 2AOTA 2AF3C 4M3NA 2HIMA 2IT1A 4PZEA 4WKPA 1DJLA 4JB0A 3H8JA 4O1IA 5IXJA 3ZJ5A 2G06A 2D5IA 5F21A 3NVDA 3NHRA 5E3JA 5FWDA 3RD5A 4A0QA 4QFMA 1GPWB 1LFDB 2O2HA 2VDVE 2WWGA 4RELA 4TT8A 4AZSA 1G38A 1H5QA 2OKCA 3H1EA 1BMFD 2B8WA 4EI2A 4ENPA 4KMOA 3NM4A 1OHHD 1BNCA 4QPNA 5GGYA 1J49A 4CXMA 3E3OA 3DCYA 5CG1A 3T3OA 3FB4A 4J2HA 2VHUA 3OLWA 3PPYA 4X85A 3WO1A 5KWEA 2B7BA 4WQMA 2CMFA 1O0CA 4C3UA 3DD1A 4JB3A 4AG6A 3EW9A 1I1NA 4B32A 2PO5A 1A9YA 1UEXC 1SCBA 1ZBDA 2G28A 4GM1A 4TTIA 5H68A 5TMBA 3AHDA 5CVTA 4Q66C 3TNYA 1W36C 1DZIA 1U3GA 3UG6A 3H87A 1T9AA 2V7PA 1XKXA 1POUA 1SUBA 3ZDXB 1EX6A 1G8MA 4WN9A 3ZWCA 1V71A 3V9PA 4F9GA 4C6RA 4LYYA 3EIWA 3T3DA 2WFAA 3IUSA 3W8DA 4BN4A 2DVMA 3E9EA 3KFLA 1XXHB 1YQWA 3AO0B 4PSVA 4W7SA 4BO8A 2BJHA 1A4XA 1PR0A 2F7SA 5EUMA 5F12A 3RB8A 4IZOA 5LQCA 4J4BA 5DHFA 2YWXA 4X4CA 2QUIA 1CRWG 3VNRA 4K8OA 3I05A 1J24A 3SSOA 3TM5A 5B6IA 3R75A 1MDBA 2KX7A 2OB1A 2V6IA 4B40A 4LQLA 1YI8A 4KK3A 5E6UA 5K0BA 2XJ9A 3TH5A 5ABPA 3BXOA 1WXXA 4CG1A 2X4LA 4Y9DA 4DNQA 2UKDA 5DRYA 1Y37A 2UYYA 1OD6A 4GRDA 1GUZA 3MTJA 4I6JA 1KH2A 1X9HA 1U8TA 1JFVA 3AEYA 1EVLA 1QE3A 4D6YA 1ZW6A 1TJNA 4K03A 4MGIR 1DHTA 4Y67A 5T57A 5J59A 1HZJA 4ITUA 3GLIB 5CTAA 4BLOA 2D2FA 4BC0A 2EP5A 1H0HA 3PLRA 5EFZA 3AINA 1EFRD 221PA 3NALA 3GA7A 4UHFA 1PQ4A 3ZYZA 1O0BA 4LBZA 1N7HA 4QT4A 5EXXA 2D3WA 4DR7B 2FSFA 2BKVA 4TMYA 2NQ2C 2GM5A 4HDOB 1PFWA 2A1TS 5AKLA 4H1VA 3HO6A 4DWJA 1R6BX 3CNQS 4LRXA 5CFOA 1SU8A 3ZWKA 4E1BA 1W19A 3U26A 2GS9A 4MS1A 1CQPA 1YL6A 2ZKIA 2H1SA 2IOFK 3TTXA 4HS4A 5JD6A 4GZ3A 3D2LA 3DD5A 4LNHA 4F12A 3THRA 2I99A 3HJCA 4MRVA 3L41A 3GFGA 3U09A 5KEIA 4AK9A 3FUXA 1NTOA 1DP4A 1G9TA 1O5OA 2HXGA 5IXYA 2ZZMA 4DB2A 4JWTA 5HILA 4LUCA 1XV5A 2QQFA 1BCRB 1EGVB 3NDRA 2FX2A 4IILA 1NX6A 1V4VA 1D2MA 5GOTA 1IONA 3WNQA 2EG9A 2AWOA 1BE8A 1Z13A 4KNVA 3TSAA 3VNAA 4NMLA 4NFYA 4EYEA 4X62B 1XDDA 4KQ6A 1NM5A 2RGAA 4G8DA 2RK3A 4RV9A 1T8RA 3C3PA 1BIFA 1BE6A 3S99A 3HEMA 1WBJB 4AULA 5I4CA 4N1AA 1NXSA 3EXAA 1B23P 1IN4A 1Z6XA 4B4OA 5DCLA 4BB0A 5AW8A 4PCVA 2HI0A 1ZY2A 4NCIA 4DCGA 4PTLA 2AN9A 1XDUA 3I30X 3I8SA 3TZHA 4A7PA 2LCVA 3A31A 1K7YA 4RK7A 3VO2A 4HLNA 3I12A 2EJWA 3KQQA 4W1QA 1N5RA 4UD2A 2OOKA 2XWJI 4XRRA 1GDDA 1DIRA 5IPFA 1M1ZA 1DTWB 2OFPA 4P33A 3NHAA 1NKTA 1AGPA 2F48A 3HE3A 1WM1A 2NU8B 1Y3AA 2WIKA 5U1PA 3QEJA 1SQ5A 2PGLA 1E2DA 3TPFA 2HHHB 1NJ5A 1BKYA 1RXEA 3QEAZ 4W6ZA 4IXDA 2JJMA 4FC6A 2H8KA 2X58A 2QMQA 3EEFA 2QVLA 1TC1A 1BMQA 4UM7A 1X87A 3A25A 3QVLA 1J8YF 3ZE1B 4AYXA 4BNDB 4KRXA 2XUDA 4XRGA 2R4QA 3CINA 1NONA 1UODA 5EINA 3ONVA 3M6AA 4GP7A 1J1ZA 2PMFA 1TM4E 1E6MA 1HBJA 3CJRA 3HI6A 3I9FA 4JLAA 5TGDA 1RWBA 4UQPA 4BASA 2SECE 4CMEC 4MQ6A 3ROEA 3KOMA 3GOQA 2EQBA 4P22A 1RXSA 3HZRA 3S8QA 4EKYA 3IGFA 4ZHSA 1XOIA 3DL4A 3COPA 4IWNA 4LF4B 3JSAA 3A6GA 2E55A 2VCHA 5TLSA 4A9AA 4D9CA 3JASB 1NI5A 3KQWA 1LFAA 4TN1A 5B3JC 3KQUA 2JLUA 1A1VA 2OCDA 2O0JA 3SZUA 4D4HA 1MU0A 2FPWA 2UAGA 1J21A 3CM0A 2ZSUA 5GPBA 4EHNA 3OP9A 4GXNA 4OJYA 5KNDA 1RRCA 2Q5QA 3ILSA 4XWOA 1QP8A 2QLJA 3GJRA 5JH7B 3UFDA 2A5LA 1KHTA 5IKOA 1F9AA 1KETA 1Q19A 5LA6F 3REQA 4Q4AB 2I6QA 4TWRA 4WNAA 4ZOAA 1AKVA 2M6RA 3E2MA 2JI6A 2WBLC 1O57A 3OTQA 2RBGA 3LXRA 2OLEA 3JWPA 1HDXA 3PUYA 3W1VA 4BNTA 3GLFA 1QRRA 2JAXA 4JLUA 1GAEO 5FYQA 3T4XA 5B12A 4E5NA 1N33B 1ORTA 1EVZA 1Y42X 5BOSA 5CBKA 1WZEA 2JPDA 1OZFA 2R5NA 2V7GA 1WUYA 2X3YA 1BEUB 3SZOA 3WC4A 3NWBA 1KDZA 4MUFA 4L27A 1N2ZA 3ZJYA 3EGOA 4RKYA 3RWOA 3KPVA 2ZUDA 4KBYA 2BBTA 3H18A 3LBNA 4C3VA 2YQZA 1V37A 4FFBB 6ABPA 2FR0A 2HX1A 3E1SA 1V7ZA 4RFVA 4R68A 3SE0A 4DV2B 4G84A 1SXJB 3OKCA 1JECA 2DQKA 1DKQA 3AG5A 3O8LA 1KIAA 3GJ7A 4GMFA 4HGNA 3NTVA 4XUDA 1GCOA 3LY8A 1NUHA 2YWBA 2GAFA 3QTTA 4P31A 4RFLA 3ZBUA 4X66B 1UDCA 4XM0A 1DEAA 1SAYA 2XMCA 3LUHA 4HD8A 1XZPA 5CB8A 2I33A 1GU7A 2WPNA 4ZMBA 2JG3A 2B4QA 3BXFA 4D3DA 2IPNA 5JXWA 4AN0A 1SKBA 4I6TA 1ATZA 3MWEA 2HUNA 4XUGB 1C3VA 2F4NA 1CW2B 5EIOA 4XD7A 3WP1B 3BCUA 4LFAB 2CUTA 1DS6A 2E87A 4DWVA 4N76A 1VI2A 3K9LA 3LUBA 2ZRFA 4NU8X 4O4LF 1WKCA 3QXJA 4F86A 4OMDA 5KTMA 3KQNA 3FTEA 4KV7A 1N3IA 1KE2A 1JDJA 1OWPA 4M76B 3TSOA 4ACBA 4PYQA 1JJFA 1O94D 3G9UA 4ID9A 5AYVA 4KR2A 2GSWA 5IT4A 3QVMA 2J6IA 4V2UA 1ETUA 1U0JA 5EFOA 3UHJA 1T9CA 5DNYB 2J32A 3TO5A 1MJFA 2O1WA 2I6GA 3P9YA 4MYDA 5TMDA 5MN4A 1Q7RA 3RS8A 3GDWA 4HNTA 1X80B 4X4HA 4UPDA 3LVBA 3TTUA 2X0KA 1U1DA 1UBSB 1JT2A 3BSSA 4YBAA 3AM4A 3MA0A 3N2KB 4PFSA 4ZQBA 1MAWA 2VK4A 2O1SA 3FHOA 4ZVTA 2Q5HA 4M9QA 2L18A 3AVOA 2WVAA 3KJGA 3ZVLA 4Y2QA 2BM1A 2CDNA 3E53A 4JUCA 4OL9A 2AWNA 4JEIA 4TLEA 5GY7A 4XFDA 1O4VA 3TW4A 2Q9AA 5EMKA 1VCIA 1N0VC 1PT5A 2ZIVB 4GR9A 4EM6A 1FOEB 3T9BA 1P9NA 3EG9B 3WQQA 1KAHA 3B48A 5EJGA 5IZCA 1EFVA 2OZKA 3Q72A 3RIEA 3LGXA 1QFSA 4G1CA 3IHLA 2ON6A 2BUAA 5FYDA 2HW8A 2HCBA 5JO0A 2HA2A 3R3HA 1WIWA 3KT3A 2WYVA 3T5MA 4PAMA 1NMQA 3TFWA 2R8RA 3WMWA 1RE1A 3CVJA 1P4JA 1V96A 4GOMD 1WMBA 2WUGA 3RSQA 2XWQA 1VRWA 4YAOA 1E63A 1PBNA 1YCFA 4K6CA 3WLKX 5B1IA 3R7DA 4EVSA 2I4OA 5IF3A 5KSWB 4IGFA 1PU2A 4JLJA 5TVGA 2A86A 2PN1A 4O1MA 1SG6A 2J3HA 1M2EA 5A4AA 5E7QA 5K0CA 1R8YA 2PUCA 2G5GX 3L1PA 2PZ8A 1AY0A 3H2KA 3T5DA 1RJEA 1U9IA 3QKUA 3W5JA 3I8OA 1OBHA 4LZNA 3PUHA 2ZUVA 1FF9A 1Q2XA 3NOXA 4YECA 3OOJA 4QO7A 3FSGD 1IPEA 3GLIA 4LJAA 5TQJA 3WS7A 4IXWA 2LCIA 4WN3A 2CYAA 2HTEA 1JLMA 3GARA 4PXAA 5TT1A 3T9CA 5GADl 4BMZA 4V0ME 5D51S 3GMTA 4NS4A 4IDFA 4RLQA 1ZNZA 3L7NA 4EGSA 1HG0A 1P7YA 3O8DA 3CWQA 5KB3A 4JL5A 1O2DA 5EKDA 5KYUB 1TVMA 3BMOA 1I7SB 1M0SA 1V1JA 2LW7A 2QY9A 3FIUA 4PCUA 3R7FA 4DCNA 5CDUA 2Y1WA 4EAAA 2QMHA 3PHGA 4RH0A 1X14A 1JHRA 4WI1A 4U8HA 1N2BA 2R62A 2FWJA 3JARB 1BQ3A 2QX6A 4MQEB 4Q9JA 4ZAXA 2B4YA 2YOGA 4PU3C 4IUYA 3TELA 1MQ8B 1QYVA 4ESVA 2ZBPA 2CJPA 5TF4A 3WL7A 3IMKA 4DM7A 1W8DA 5L95A 2FMFA 4X64B 3CBGA 3AH8A 1IM8A 1L7NA 1ZOLA 3MINB 1M2HA 1A8UA 2OP0A 3U40A 1OWNA 2IRWA 1QB7A 1A2KC 2IYYA 3I8XA 1OYWA 1HNWB 3OCZA 3QLUA 4R4JA 3D8SA 2DG2A 4BLTA 3E3MA 3HR7A 2YWCA 2O49A 5ESXA 3RDPA 4YRZA 3ZVRA 1SOAA 4K9RA 1W34A 1JSZA 1NJGA 4MB2A 4RK4A 3IR7A 4JC0A 1CUCA 1T9HA 3CSSA 3ZW9A 4F4HA 2AUTA 2J0QA 1RLIA 1U9CA 3NAMA 4BUCA 2ZG6A 4F1WA 1WPGA 4Q34A 4Y98A 4DDHA 5IVKA 1P6UA 3ZWXA 5CVJA 2ST1A 3TKYA 5KYWB 2B4TO 4JNCA 1ZG3A 5KNBD 1RJFA 2W6CX 1UJCA 3AU9A 3ZH9B 3U9LA 4DUPA 1DTWA 3I6ZA 5TPWB 5KHAA 1Q57A 3C98A 2X0FA 1XK6A 4AP9A 3NBMA 5DK4A 1F7VA 1XLWA 1QIJA 3N1UA 5M7EA 1PFKA 1AKUA 1XB2A 3L9XA 1JI0A 4RVUA 3GMDA 5LZ5A 3ZNPA 2XQFA 4DLWA 3KSDO 5JHGB 4RZ2A 2YXEA 5AXAA