3KJXA

Crystal structure of a transcriptional regulator, lacl family protein from silicibacter pomeroyi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
333
structure length
333
Chain Sequence
PLTLRDVSEASGVSEMTVSRVLRNRGDVSDATRARVLAAAKELGYVPNKIAGALASNRVNLVAVIIPSLSNMVFPEVLTGINQVLEDTELQPVVGVTDYLPEKEEKVLYEMLSWRPSGVIIAGLEHSEAARAMLDAAGIPVVEIMDSDGKPVDAMVGISHRRAGREMAQAILKAGYRRIGFMGTKMPLDYRARKRFEGFTEVLGKNGVEIEDREFYSGGSALAKGREMTQAMLERSPDLDFLYYSNDMIAAGGLLYLLEQGIDIPGQIGLAGFNNVELLQGLPRKLATMDACRLEIGRKAAEIIAKRLEDPEAEIETRITLEPKISYGDTLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LacI family
publication title Crystal structure of a transcriptional regulator, Lacl family protein from Silicibacter pomeroyi
rcsb
source organism Silicibacter pomeroyi
total genus 90
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3kjxA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kjxA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kjxA02
4H60A 8ABPA 4GPAA 4YR7A 1FFWA 4FE4A 2JVLA 4RDCA 3G85A 1ZZCA 1ADRA 3ZHMA 1SD5A 2N9UA 3LUKA 3O1JC 1APBA 1DWKA 1YK1A 5CNKA 3GN5B 5IULC 1BDIA 2LYRA 3NNNA 2R48A 1WIZA 3G7DA 4UHKA 2KPJA 2MSLA 2MYPA 3KLNA 1GCGA 4Z4HA 2BNMA 3IP6A 1JYEA 1NXSA 1ABFA 3HDVA 4N47A 2XIUA 2NT3A 4OB4A 4X4FA 3NBMA 1JYFA 3G5GA 2FEKA 5FWYB 4ETMA 3VK0A 3QX8A 4EYGA 4EYKA 1YMVA 3U3WA 3GRCA 1EWTA 4M88A 5DKFA 5IC5A 2AYXA 2PJUA 4KK3A 2W42A 4Z5CA 3SCGA 1P6QA 1NXTA 3GN5A 4MAAA 3JVDA 4FB4A 4KNYA 1AU7A 3EQZA 3L49A 1Z12A 3HXMA 6CHYA 1DRKA 1ZN2A 4KK4A 3ILHA 4RU1A 3CG4A 3EDCA 3FYAA 3IVPA 4KZKA 4J1XA 5TPZA 3N8IA 2FMKA 2CHFA 1K66A 2JB9A 1NY5A 1ZH2A 4JP1A 2FLKA 3TMYA 4ML3A 1P6UA 1DCKA 3KKEA 5E3JA 3KLOA 3OO1A 4L85A 4RK4A 4RS3A 1LCDA 4KFCA 3LUAA 2HQOA 2WWVD 3O2JA 3EULA 2LYKA 1GUDA 2B1JA 1F4VA 2EBYA 3F51A 4S05A 3R1FA 2PMCA 4JCXA 1BAPA 4WWHA 1R8JA 3NHMA 3NNDA 2H0AA 2GI4A 3O1HB 3Q7SA 1ZS4A 2M1ZA 1E6MA 1MVOA 3QLUC 1X2LA 3ZKCA 3FGZA 2MYNA 1RZRA 3H5VA 2GRLA 2MSWA 1OSLA 4H3HB 4O1IA 1KRXA 3PXPA 1YS6A 2PE5A 3F6PA 1DCFA 2OFYA 3EQ2A 3GYBA 1U2QA 4KQCA 5TQJA 1EHCA 5TPWA 1ZZBA 5HKOA 1QP7A 3BDNA 3I5AA 2E4ZA 1R69A 4G0ZA 1JBEA 5B3JA 1LJUA 4Z99A 3BD1A 3OMWA 4MS1A 3RVOA 4PZ0A 3CHYA 3H6HA 3E3MA 5TQ2B 1JFTA 2IPAB 1UTXA 3GV0A 2MSKA 4EUKA 4E7OA 3NHZA 3H75A 1PNRA 2BNOA 3VNBA 1QO0A 4RSMA 3ILYA 4G0XA 2M98A 5FWXB 3LMKA 4YG4A 2FKAA 3K9CA 4YGXB 4Z4GA 1HF0A 4I8TA 3P9YA 3D1NI 3ROTA 3S8QA 5DCLA 4D6YA 5JNTA 1ZH4A 4OATA 4Y9TA 2HQRA 4KMRA 5PNTA 2JBAA 3IPCA 4FE7A 4PU7A 1Z15A 1Z2EA 3JPYA 2HINA 5IUKC 3URMA 5BRJA 4IRXA 2JVIA 2LYSA 5TQ0A 3OM1A 4MLCA 3SNKA 3QWGA 3SCFA 2L8NA 2PUBA 3BS3A 3T8YA 1OXBB 4QICA 1ZGGA 1VRVA 2OQRA 2VUIB 3QX9A 4JB2A 2O38A 4LX8A 4NCAA 3I42A 4X4EA 4E7PA 1M5TA 4X4CA 5IBQA 4JOQA 4D6XA 5I4CA 2PAFA 2AXZA 5JNRA 3I09A 4MR7B 2KZ8A 1A0OA 2PUGA 2P9HA 5TPZD 4MR8B 1X57A 1NXOA 4WZZA 3EAFA 3Q15C 4MYRA 2H8RA 3S99A 1J56A 4Z5DA 4N41A 4PYRA 1TMYA 1DJMA 2DRIA 3F7NA 3GBPA 3QLTA 2RDMA 2OENG 3UKJA 1Z13A 2PL1A 4FN3A 1H9CA 3RVPA 1R63A 2KEKA 4L4UA 2PUDA 4RXMA 5K98B 1XWWA 2R63A 3BRSA 3HDGA 3W9SA 3FMYA 4W5TA 2CHEA 2A9QA 3C3MA 1TVMA 3KG2A 4EYQA 3HS3A 2IU7A 1D5WA 3HEBA 3HZIB 5CNMA 1RZRD 1U2PA 1ABEA 3LFTA 1USIA 3N53A 2IPNA 1Z17A 4RKQA 5ABPA 1BVHA 2PLNA 2RGYA 3OQOA 3TB6A 5BR1A 3BRQA 2XI8A 3HUUA 3KSMA 4ETIA 3H5WA 2JVKA 4LE1A 1T34A 4RK7A 1VKRA 2AW6A 1PRVA 3FFXA 4RZSA 3HK2A 4MS4A 3KCNA 1NXPA 2FLWA 5KC9A 1XHEA 1FFSA 1WETA 4XLTA 4Q7EA 3B7HA 3OQMA 3FYMA 1JFVA 1EWVA 1ZHHA 2CD7A 1AB5A 1D1PA 1LJLA 2ZAYA 3H5TA 1MB0A 3EGCA 2XSDC 1QQBA 3JY6A 1L1MA 1WH8A 2XCJA 1OCTC 3CLCA 2GKGA 3QLVC 4W5RA 1ZZ8A 4W5QA 1D1QA 2Q5CA 2LCVA 2LYPA 2E4XA 3DZDA 2R47A 1QQAA 4JCYA 4IILA 5IUJC 3L1PA 4DN6A 5EWJB 2ICPA 3FFWA 5KI6A 1PERL 4RK6A 1IC8A 1ZESA 1Z16A 4X4HA 1PRUA 4XAQA 5JNUA 1NXVA 4PU4C 4HNRA 4KQ9A 4DADA 1EWKA 5EWLA 4ZMSA 1DBQA 3HSYA 3OO0A 3QELB 5JNWA 3VNAA 4CBVA 4X4IA 1YIOA 2A9RA 2L18A 4KPYA 3DLBA 1POUA 3UUGA 1Z18A 2NZVG 3LUCA 4X4DA 3OQNA 1MAVA 4LDAA 3HJFA 4MPTA 2FMHA 4J1WA 3Q41A 1ZPQA 5EWJA 5TE9A 4YCSA 4QYWA 1JF8A 4KV7A 1DG9A 4WUTA 3LKBA 1SQ8A 4W5OA 3QLUA 3T95A 1U04A 2V0NA 3CFYA 1QPZA 2ZWMA 3BILA 3HCWA 4LE2A 1DC8A 2VUHB 1W25A 4OG2A 4QYMA 1TJYA 4WT7A 4PICA 3QELA 2QXYA 2AXUA 1NERA 4MS1B 3N75A 4YWHA 3BBLA 1PRAA 1GCAA 4Z4EA 1QMPA 5F64A 4G97A 1NXWA 4RKRA 3DNVB 3IP7A 1LQCA 4Z4CA 2MQKA 4G0OA 4MS3A 1DCMA 1CJGA 2WJWA 4G0PA 4Z5HA 4G86A 4XFKA 3SG0A 4YRZA 1JX6A 1DZ3A 4G0MA 3HVRA 3H5LA 4NCBA 1PEAA 3RVLA 2L2QA 2LYQA 2WRZA 3HUTA 1TLFA 4FBIA 1Z26A 1F51E 3CLKA 2HJ9A 4XASA 3CU5A 4N0PA 1M2FA 4TN5A 2LUOA 2QSJA 2XJ3A 1TM2A 1FFGA 4RK5A 1ZZ7A 2JBAB 4EVQA 3JXDL 4IA8A 2GZUA 1LK0A 2QW1A 4NV3A 5GQSA 1CQTA 2IVGA 3C3KA 3QEKA 1K68A 2FXIA 2A9OA 3H1EA 1DBWA 2FQWA 5DLEA 3LUFA 5TQ0B 4KREA 1L5YA 2FN8A 2QR3A 3IP9A 4HYEA 3ROFA 4S04A 4GQMA 4MGEA 2IV1A 3TD9A 4G0QA 2WIUB 1M2EA 2B4AA 1RZSA 2XDYA 5CHYA 5C5EA 1ZAYA 1S7EA 6ABPA 4IVZA 3A0UA 1HEYA 3KTOA 1KMIY 3Q9SA 4YBAA 2J48A 4RK0A 4ZPJA 4EYOA 3RQIA 5HQJA 2FJRA 5TPWB 2HSGA 1FSPA 1LCCA 5JNSA 5FBHA 2BJCA 4N76A 1XWRA 1PUXA 3OLWA 3QEMB 3E61A 3JXCL 1A2OA 3QF3A 2IPMA 1ZVVA 3L6UA 5EWMA 1DRJA 3MM4A 2L49A 2CWDA 4YG7B 2AYZA 3KS9A 3LUJA 3CTPA 3Q7TA 4QPJC 5GOTA 4F8JA 1E6LA 3T6KA 1RNLA 1JFSA 1CEYA 2HQBA 4OLAA 1RXIA 4N0QA 2PIJA 2A9PA 3M9WA 3EODA 3C3WA 5ED4A 1YK0A 2E4UA 2IOYA 2JRLA 3N6VA 1O4XA 4TLMB 1BA2A 4PU8A 2FQYA 1DP4A 3OLYA 3M6MD 4ETNA 3IP5A 4Y42A 1UDRA 1JH9A 3CNBA 3CZCA 4IMJB 5T3YA 3QEMA 4RXUA 4YP9A 4IWRA 3T38A 9ABPA 1U8TA 1QNLA 2B5AA 4MLDA 4YARA 2R1JL 4MQEB 2PUAA 4Z9AA 3O74A 4LDZA 4MS4B 1GLGA 1XHFA 4YS6A 4ZMRA 1YTUA 2FQXA 2NZUG 2KEJA 3LKVA 3LFPA 2ID7A 5T7BA 1LBHA 4O5AA 4OBBA 4RK1A 4W5NA 1NEQA 4LE0A 3G1WA 3MA0A 1C4WA 3KYJB 4YLEA 2NUBA 3EJWA 2PPXA 4KVFA 2IDMA 3CZ5A 4Z0NA 1DW9A 1SXIA 3KHTA 3O1IC 4WXEA 3MF4A 3EUSA 3OLZA 4IMIB 4MQEA 1PHRA 2E4YA 2BGGA 1YMUA 4JA2A 4RY0A 2JK1A 4GHJA 3N0WA 2IYNA 3BREA 2LYLA 2CROA 1NXXA 3JTEA 4P98A 5EWLB 4EVSA 5KQLA 1C0EA 2MEZA 3K4HA 4PEVA 3JS5A 1PNTA 5KQMA 4B09A 2MYTA 1UXCA 1LMB3 2F8TA 3GA5A 1QO0D 2WUSR 4UHJA 3FMVA 5BRAA 1KRWA 5IEJA 2GBPA 4Q6WA 3RVMA 5JS1A 1JWLA 5CNJA 1FQWA 3QQ6A 4DQDA 1MB3A 3SCHA 4Z59A 1Z25A 2I6FA 4F11A 1E2BA 1BDJA 3OMXA 2L17A 2FTKE 4RV5A 3LUGA 3KJXA 2O4AA 2FEWB 2D5VA 1BDHA 4LZLA 2WMYA 3SM9A 1QP0A 1P8AA 3RVKA 1Y7YA 3OP9A 2FVYA 2PUEA 2QVGA 2FMFA 4ZYLA 5IUNC 2LBPA 3C97A 3KXAA 1PEYA 3A10A 4X4GA 1W9HA 5CNIA 5FWXA 5HSGA 2L19A 4MS3B 1OXKB 1P2FA 4TMYA 1MIHA 4EY3A 1EFAA 3R0JA 5IX8A 3H6GA 5KWSA 3OM0A 2JCGA 1CYEA 3HV2A 3CS3A 4HNSA 4X4BA 1YSEA 3MQ4A 4Z9BA 1ZDMA 2A6CA 3KYIB 4JASB 3TX6A 2AXVA 2X7XA 1Y9QA 1JLKA 1SRRA 1VPWA 2JVJA 2EWTA 3CKMA 3GBVA 3B2NA 3JVIA 2ID9A 1EAYA 2E4VA 5D2CA 4F3TA 1GT0C 1ISSA 2FN9A 3D02A 3O21A 3FDFA 5FWYA 1ZUGA 3C6QA 2PUCA 4I6TA 3F6CA 3IPAA 1GUBA 3LTEA 3GWGA 2OR1L 3A0RB 1ISRA 3A3KA 3SY8A 1RIOA 4HNQA 4F12A 1RPJA 2HPHA 2CSFA 1VLZA 2FEPA 4MR9B 5IEBA 1A04A 1E3OC 1JHZA 3DBIA 4GNRA 4YO7A 1L5ZA 4LRQA 3F6WA 4RXTA 3F73A 1Y1LA 3QK7A 4O1HA 3TRBA 2O49A 4RY8A 1JDNA 1LBIA 4RWEA 3OLXA 3RZZA 2QVCA 4Q6BA 2R25B 2TMYA 2WJAA 3Q7RA 2YHBA 4NQRA 4F06A 2PUFA 3DGEC 1USGA 1LLIA 1NTRA 4O8BA 4KRFA 5KQPA 1CHNA 5EWMB 3LISA 4MR9A 2IUOA 2LPMA 1M5UA 2LIVA 3HM9A 3RVRA 4MRMB 4EVRA 2E4WA 4N03A 2QV0A 3O9XA 1RXEA 1IIBA 4Z4FA 3HO1A 1DBPA 2PL9A 2FSPA 1ZZ6A 1WH6A 1ZITA 2YHAA 1SXHA 1SXGA 3RH0A 5A7LA 2EF8A 4IGAA 2VK2A 3MLFA 2AUWA 1QKKA 1URPA 2LP4Y 3CROL 1USKA 2PKXA 3D8UA 3DGFC 4H3KB 4NDWA 2MYUA 4I6RA 1ZY2A 3RVQA 1RPEL 3HZHA 4MCXA 1B00A 3GBFA 2GWRA 2WY2D 3GL9A 4MRMA 5B3JC 3ZHIA 2ICTA 4XARA 4I6UA 3O2QB 2BNNA 7ABPA 4TLLB 3LUDA 3MMNA 1ZGZA 3H1GA 3O2SB 5JNVA 3UK0A 3RVJA 2IVQA 2FMIA 5DTEA 4YG1A 3LUHA 1AB6A 3I45A 4G0YA 4IF4A 2LYJA 5TQ2A 4XXHA 3MIZA 3RVSA 2GRMA 3RVNA 5KQGA 1KGSA 3GT7A 3JXBC 3JPWA 2VYCA 3N0XA 5BQ3A 3DLHA 5HM6A 4NICA 3H5IA 1JDPA 4D74A 1I3CA 4EGSA 1JL3A 3FFTA 4JQDA 4RY9A 1YS7A 1E6KA 3SQNA 2NT4A 5DGCA 4PE5B 1DC7A 3N0RA 4F8DA 3H5OA 2IPLA 3O75A 5JS2A 1Z2DA 1ZZ9A 4ZJPA 2F8SA 3MYYA 4MQFB 5KC8A 4OTZA 3OMTA 3UFDA 2R4QA 2RJOA 2KEIA 3IDOA 2FW0A 3NNSA 3TO5A 3F52A 1QP4A 4JAVC 2QU7A 1YVUA 3CRNA 3SAJA 3QLVA 4WXMA 3CECA 4JB0A 1D2AA 3LOPA 3QYXA 4MCTA 1NATA 5C5CA 2QZJA 4YV7A 3KZ3A 2KYRA 4Z4IA 2IVBA 4Z58A 2O20A 2IKSA 4OLBA 4P1ZA 4MR7A 2WB4A 2GX6A 4MQFA 1U0SY 4MR8A 2RJNA 1UXDA 4PU3C 2H3HA 1S8NA 2AWIA 5FBKA 3OLVA 1D4ZA 2P4UA 3CG0A 3M9XA 3H1FA 1B0NA
chains in the Genus database with same CATH superfamily
2GCPA 2CFSA 4H16A 4HN4B 1WUJS 3WLFA 5ILOA 2RH5A 4FR0A 4P80A 2G72A 1IOZA 4A15A 1NP7A 3OI7A 5K51A 2FSIA 2NAPA 2YHIA 2BY4A 4OQLA 5EESA 3HZZA 4DW8A 4HEA6 2AN1A 2YC4C 1J1ZA 1EM8B 4US0R 3RVDA 4F92B 2CY0A 2V0GA 1NBIA 3T3OA 1E7WA 5BW8A 5A9SB 2VF5X 5IBRA 2DFDA 3SIWA 1B8NA 4BNXA 1G63A 2GM3A 1UZAA 3RWOA 3DPUA 1OPXA 1ZICA 3J81A 2I78A 2JH8A 4ZJYA 5JMOA 3VK0A 1R4MB 3VO2A 1ZWLA 3WMEA 4HPJB 3G7NA 5CA1A 1PJSA 1RPNA 2JGMA 4Q21A 2C5SA 4CM3A 5K8LA 4YNBA 4E5MA 3OCUA 1NXTA 4ZV7A 1UBGA 3GHYA 4WKNA 2JIQA 521PA 4F38A 2HEGA 4ER3A 3EGDA 1LZLA 4FHFA 1G5QA 2B2NA 1SK8A 1VYVA 1LPOA 2PXFA 3DMTA 4EPWA 4P4SA 1I6KA 1PGJA 4BEWA 5JALA 1AO0A 4W5OA 4IV0A 4ZD6A 4HQ0A 3MWGA 2FG6C 3S7TA 1H1TA 1QOQB 4I5IA 1JDBC 2PSDA 1UT6A 3DHVA 2PRIA 2HXGA 1ES9A 4LYHA 2BFFA 3D8HA 4GF5A 3E9MA 4E30A 2WWVD 1JHXA 1IH8A 3EULA 4IZIA 1CY7A 1L4LA 1F14A 1SN7A 1U5CA 2BHTA 3DMPA 3VI3B 1U0GA 5D1HA 5A6VA 5EMHA 1LDEA 4L75A 1AHNA 3GPCA 3EZYA 4Z2AA 4JCXA 5CH8A 4X3PA 5H4GA 1MQ9A 3H0CA 3NHBA 4GPZA 4DLNA 2YZMA 2EC5A 2X3YA 3GAZA 2M1ZA 3PCTA 1X2LA 3FKQA 3AYXB 1IN1A 2QX7A 4LHEA 2IP2A 3PNYA 4GP6A 3HADA 4NPAA 4QXMA 4ZOAA 1OI7A 1KXJA 1DCFA 1RI4A 3N2LA 1YL7A 4K9QA 1Q7GA 3NQ41 3OF2A 5TQJA 2C2ZA 2C96A 4QG3A 2B2XA 5CAEB 4F3NA 4CTKA 4MVXA 2DHDA 2R7MA 5KSYA 1PFGA 1W5SA 3IO3A 4O2RA 3BD1A 1Z07A 4WLOA 5DBIA 1JLHA 1D0VA 3H6HA 3E3MA 4CEHA 2NSYA 1EQAA 1UTXA 2QV7A 3DD5A 3L1UA 4FMDF 3GMSA 2XNDA 2IYUA 1QVVA 3MWJA 3PSHA 4OI1A 1TUIA 3NV7A 2P9EA 3LP5A 4LA4A 1YU6A 4YYEA 4XH9B 2ZAMA 1E1CB 4ZT3A 4Z5XA 2NP7A 5ECDA 3FMGA 5KYUB 2R44A 1NWCA 2HCJB 2OWEA 5AYVA 2WABA 5FA5A 4ZHQA 1IEVA 3EGVA 5A4DA 4OQEA 2H1WA 4EG1A 2FMXA 3CO5A 4WXRA 1X42A 1FNDA 3NTQA 4FE7A 1WXWA 4HRXA 4RORA 2BBSA 1NF2A 3U37A 3HPRA 4CIVA 4DM4A 3FJOA 1MAAA 4IRXA 4LF8B 1W5FA 1JG1A 1P33A 3W05A 4BDSA 1BFKA 2NZXA 1EAMA 4IIEA 2Z6AA 3L0BA 2G08A 4ZARA 3BGWA 2JIDA 4F9FA 3BJRA 1Z4LA 3OWXA 3QX9A 4BKMA 2WA1A 3ETDA 3CVOA 3QV2A 4DNOA 2VP6A 3A9CA 4WADA 3BRWA 4U6NA 3ZHRA 1DKRA 3H9BA 4GYWA 4TTRA 1BMQA 1CDZA 3ZOZA 3DYIA 3EGXB 3TLKA 5MFPA 2EWMA 2DUWA 2KHZA 4YDRA 4DKXA 5J63A 2J5XA 1G8YA 1LPPA 2GZHA 1PFQA 2J4DA 3Q3GE 3HCEA 4PYRA 1DJMA 3SKXA 1HG1A 1N3YA 3L1JA 3UKJA 2EKPA 4YJ2B 3MILA 3N74A 2JL1A 3RJ5A 3TD6A 1H3EA 3H11B 2G07A 2W4QA 2OFPA 1R8XA 2V7XA 2P8SA 2VC2B 5DYGA 1PZXA 4LV8B 4B6PA 1R6VA 1EVYA 4DF3A 2DWUA 3TJZA 1PDVA 3D6HA 4YRSA 3DFIA 4OBMA 4EARA 3FCAA 2CLSA 3U3ZA 2G6BA 3LY5A 2NYVA 5ABPA 1KO4A 3DZGA 1B76A 1BX0A 3D3NA 2WMOB 4EG0A 4KDFA 3NVKI 2ZYHA 1RRFA 1GZUA 3KSMA 1O94A 2PWBA 3H5WA 4TTAA 2G09A 1N6IA 1VECA 2RAPA 4FYXA 2JAUA 4QYIB 5C7IO 3I2FA 2FRDC 2OP0A 3R23A 3ZBUA 1Y37A 3B1FA 5LMZA 3KCNA 2FLWA 2WV7A 1K7SN 4QHYA 2WT8A 5LP6C 1MO5A 2OV4A 4NV1A 1N1EA 4C78A 1KI2A 3ZWCA 4Q34A 1XG5A 2NNWB 3GFRA 4UD2A 4AX8A 4BE9A 3LPDA 2J0QA 3NZEA 4ZODA 5AVOA 2GEUA 1Q92A 3QLVC 1R5BA 3U7GA 2Q4BA 3C74A 5HPYB 3A06A 4LAFA 5CHEA 1ZZEA 4YMVA 1O97D 4PHCA 1G8MA 1T2VA 2CVOA 1HG0A 2R97A 5LR6A 2GNOA 3QXXA 3WWZA 1OIXA 5AI4A 1C3XA 4EEXA 1WDWB 3V1KA 3V42A 3P19A 2B8NA 4U3JA 2CXNA 3NH9A 5G4KB 1Q0RA 2R8PA 3HNRA 1DBQA 4FNOA 1BXGA 5JNWA 3ROKA 1P7YA 1TJPB 5EE0A 4D5EA 2Q8QA 4N3BA 2QM3A 2XMSA 1NPDA 4E2XA 3J7AC 1YIOA 4E3WA 1KO5A 3DOJA 3DLBA 5AM4A 2QJRA 3FSRA 4IO1A 4NRDA 2X9LA 4FFSA 2PJRA 3GPDG 1ZPQA 4C6RA 1Z4QA 5K20A 3W3AD 2V8OA 4X9XA 3Q0EA 1JDVA 1NN1A 4I8DA 1YS1X 4KYUA 1D2EA 2CZCA 2GF2A 1QAQA 3L82B 1EXVA 1ICEA 1YCDA 1NVEA 4QOGA 2Q41A 3ZDBA 1E6WA 3ESXA 1V4NA 2G5TA 2Q49A 3KJEA 3EAGA 3WQHA 1V37A 2NX2A 4KFSA 1T0BA 9ATCA 1HO3A 4IOKA 3K09C 4CQNA 1SGWA 2PKYX 1CIPA 1ZD5A 3Q87B 4CIDA 2XYVA 3DQPA 3L8DA 4BO8A 1DFHA 3NHFA 4JITA 2VTKA 3E5MA 2ZI5A 1ZK4A 3ETJA 4JXKA 1UBNA 4NQZA 4UAUA 3R76A 1JB1A 1E2NA 2HJ9A 2M32A 4E13A 3FD8A 4IZOA 3A1TA 4ZT2A 2BBOA 1J9EA 1JYSA 4BTVA 3M4XA 5ESRA 1LK0A 2Y68A 3GLFE 5I6DA 2XUJA 1W0CA 3VKGA 1M1UA 4FYJA 4I36A 2XCQA 1WF3A 3IP9A 4Q05A 5CFLA 3I2GA 4GQMA 4PPQA 3UNXA 4WLUA 4CG1A 1U63A 2IV1A 2V4MA 3FF1A 5CHYA 4BFTA 2Y9MB 1E2PA 4LYFA 4TZTA 3BB4A 5L4NA 2GAFA 3RS3A 1SU7A 1U0NA 2UVPA 5KWIA 4HWGA 3OQIB 3KTOA 1RHUA 1FB5A 4FKMA 1WU8A 4K8RB 4LY9A 4URVR 2EATA 3MBOA 5HQJA 1CZLA 1A8PA 1HZZA 5EKDA 5JG7A 1WPGA 4MIYA 4TWAA 8ADHA 1PKEA 4E32A 1NM5C 1Y1RA 4WMLA 3DE4X 5BPFA 5EWMA 1FW6A 1UKCA 4MKXA 2YMQA 5GOTA 1JJ7A 5E1BA 1E6LA 2PWAA 5LQJA 1FX1A 2GARA 3T5DA 4DARA 2DXIA 1QBGA 5I4KA 2AJDA 3AFIA 2VQFB 2RH8A 4DKJA 3LZCA 1YK0A 4RD2A 3D1VA 2WQZA 1PYGA 5HM6A 4ETNA 1QONA 3CZCA 3GXBA 4YRJA 3REQB 4UD6A 1MNQA 2VUTA 3T38A 1L7PA 5A06A 4MLDA 1OT5A 2HUNA 4XIIA 4C2UA 1QIMA 4HVCA 1W96A 2ZK7A 1NPYA 3QOFA 4Z9AA 2YV1A 5JSYA 3SSNA 4BVJA 3WMWA 4C21A 4ENTA 1GAWA 1UJ2A 2NOAA 4IDCA 2JS7A 3A37A 4C0AC 3I3OA 4KAFA 4D9HA 4V0ME 1P2VA 2K2WA 4N7BA 4XJXA 4Q3CA 2H5LA 5K3BA 2ZB8A 1FYFA 4Z0NA 2QL9A 4K5QA 3VTFA 1OT3A 2PRJA 2ECFA 1XLUA 2DY0A 1RAAA 2ZYRA 4ZV4A 3AJ8A 3WB2A 1L7MA 3ZXIA 1W6RA 1O87A 1OTXA 1VE6A 4XX1A 1VPVA 5LYJA 4C0LA 3K0AB 4ZDKA 1SBIA 2HJGA 2PBZA 1Z5VA 2LYLA 1G3IA 1DXOA 2GJ9A 3NTRA 1ZI8A 4GKVA 2G0TA 3JXEA 4CV1A 8GPBA 4RLFA 2IEZA 3L77A 1TJ3A 2I6QA 1E99A 2P2SA 2FW1A 2VBIA 3AOEC 1Y5MA 1B74A 5FL7D 1CQZA 4O4JB 4C7VA 4A82A 2O8CA 1QZZA 3OHMA 2YNMC 5G40A 4OI4A 4QJBA 1PR9A 3VI4B 4F60A 3QQ6A 1MOPA 4NJMA 4A6PA 2CVZA 4R5MA 1KA9H 4LMBA 1LI5A 3H19A 2QJFA 1KEUA 5IKPA 1F6WA 1SIWA 4FYHA 3T5BA 4XGNA 4YV1A 4MDFA 3CBQA 4J0CA 3GROA 1R0CA 1XU9A 1SC3A 4I4CA 4HX9A 2BFPA 4CMHA 4D0RA 4ZMBA 1HETA 3P4UA 3SXPA 1LTKA 5C8XA 5IUNC 5CNIA 1EA7A 5HDQA 2GVZC 2XYHA 3TTSA 3OZBA 4URFA 4AZ0A 2ZRPA 1ZGCA 1E60A 2HSWA 3B1JA 4IUYA 5IX8A 3CZAA 5CX1A 2ZJ5A 3EVBA 1V4VA 4YP5A 1O95C 1IN4A 2CZQA 3NORA 4BZWA 4V03A 5AI9A 1CB7A 2Q99A 3W2GA 3P9PA 1G60A 5K8TA 4FZ3A 3T54A 3WWCA 3AU9A 5E6SA 3IQIX 3L1HA 2EJUA 421PA 3AM3A 3GRYA 1VLVA 1SPXA 3GBVA 1WX1A 4II3A 5I8ZA 2I6GA 3C24A 1R6XA 1ISSA 2Z2IA 1GZ6A 1XZDA 4KWCA 4U9UA 5FFNA 5JNLA 1UC5B 4RADA 3WDLA 1AC5A 4MHTA 4HNVA 4L3VA 2MMGA 3KR9A 1RP1A 4HP8A 4OGKA 1F8FA 4LIPD 1JV2B 2R6GA 3AEKB 4IH1A 3CB2A 5FWNA 2RGUA 1EFPB 2ZTHA 3UAOA 1V2GA 2RARA 4YRKA 2PA0A 3I9MA 1MQ8B 1XEFA 3C8MA 5EI5A 1RMYA 3ZN2A 1NVGA 2J09A 1D8TA 3HGMA 3DHWC 4FMBB 4K46A 4NBVA 4GL2A 2YXDA 3C3JA 3PC8C 2W11A 3QA9A 5B37A 4O4HF 2JIRA 5LMCA 1T3TA 1KDVA 2Y1LA 5AVRA 4YUZA 5IKEA 1U31A 4X64B 4M8LA 1GAJA 1P0QA 2JHPA 2Z0MA 5JC8A 2K4MA 4ENQA 2DWPA 2FPRA 2OYCA 5C8YF 4YACA 4ZTZB 1IIBA 3WL6A 4A26A 1QCCA 3AHHA 1DBPA 3DEFA 5EERA 1QV6A 3ZHUA 3QEBZ 1PR6A 2C1EA 5TEWA 1OZHA 2PCLA 2YCLA 1OC4A 1F0NA 1FMLA 4PYIA 4K0KB 1YQ9A 3UH1A 3ML1A 2WPDD 2O5EA 3HVKA 3IBFA 5IP5A 4HLDA 3BBPA 3U26A 3P20A 5KJ6A 4K7JA 4Y1EA 4XVQA 3Q11A 1PZNA 4XZ3A 5HBGA 3ZHIA 4UE6A 4RAQA 2QL7A 3B1ZA 4HWSA 3MMNA 4PINA 2DGDA 3H1GA 2Z8YA 5JNVA 1HTBA 5KI6A 3FVRA 1VGQA 4E5SA 3I45A 1C7QA 4Q1EA 3HLKA 5FV7A 5CM9C 3QEOA 2OCYC 1H2RS 2YWCA 4E12A 2VYCA 4RHCA 4ETWA 4EW3A 1KARA 2Q0XA 3S3TA 5B7QA 2V98A 2Z04A 2ZJ8A 1GY8A 3QNMA 5JASA 2QEQA 2YUTA 1EVLA 4P9NA 5KTYA 3AL0C 1V39A 4RQAA 1K9SA 1P5HA 3DB2A 3E3OA 3H5OA 1AK9A 1OAOA 5AM5A 2J7UA 5G1PA 4C7MA 5LZ9A 1UBJS 2RE8A 2CBGA 3VH4A 3N05A 3BC1A 3O4IA 3L1IA 3TO5A 3GPBA 1ZCBA 1B8OA 3HWRA 4Z86A 5AJVB 2XUIA 4YJKA 3REFA 1MBZA 2JZCA 1T5TA 2X0RA 4NFLA 4GPIB 3ZI0A 3MHPA 4Q0MA 2OXTA 1PFKA 1UT8A 2ANBA 3LT5A 7GPBA 1KS9A 1B23P 3ABSB 4TSRA 1F2UA 3BXPA 3NBQA 3CW9A 4C4XA 2D8MA 4WOJA 4GG1A 1PGQA 1MNAA 4I66A 3VRHA 1D2RA 1JR3A 1W1WA 5B64A 1SOAA 4FBLA 4H0FA 3ORSA 2VSYA 3GDOA 1SKAA 3BL6A 3MJSA 3GZCA 4Q48A 3R7WB 4GRAA 4CIXA 1TYEB 2YVAA 1XTKA 4HSEA 3U1VA 2P91A 1X1CA 4DUGA 3WNQA 1LCIA 2WF8A 4I1VA 4B3DA 1S9HA 3I6MA 3CN9A 4AIRA 4PTYA 5GONA 2VHYA 4FR5A 2IYRA 1HKUA 4YJHB 5REQB 4PNEA 4TV8A 1EJBA 2R1VA 2IBSA 2AZ4A 2LCIA 3RFVA 1H3FA 3K1YA 4ARAA 3Q8LA 5FAXA 5LBUA 2FFHA 1SCUA 1JYFA 1OBHA 3DTVB 4FOPA 1BJKA 3QX8A 5H1YA 3M3PA 1Z73A 1DS6A 1JG3A 1Q17A 3OG9A 3I5MA 4M9UA 4PRZA 2PGIA 1L3CA 5H3CA 2PS3A 1P6QA 3UJBA 5CCDA 1TADA 3FYHA 4DCTA 4EVIA 4QKQA 5A5FA 1KWGA 3B78A 4L7VA 4X8LA 3HCPA 3C3XA 1RBMA 3DAOA 1SZJG 1U2SA 2CGEA 2ZI9A 5GWXA 1ZN2A 4BLWA 2XRZA 1TIKA 5NULA 3DHEA 5MHTA 1N5RA 5EJ2A 2J0SA 1XZBA 1HDIA 1OI4A 1NY5A 3ZY3A 2O2XA 4RH3A 4L78A 2BYTA 5ALNA 4V3BA 4MV1A 2JZNA 1IVYA 3DUFA 3NAMA 3ZHQA 1Z82A 3KPUA 4CCWA 3D9QX 3BK2A 5KDLA 4AECA 2B8TA 4OXRA 2Y0BA 3SYTA 5B30A 4TLBA 1VSQA 4O1MA 3FFAA 3IUJA 4DHWA 4ZI2A 3Q3JB 3HCCA 1TKAA 4Y6RA 1HQYE 2PUJA 3BFKA 4YT2A 2KE5A 1UAAA 4JL6A 3FOFC 2QK4A 2WKSA 3O8LA 5ITWA 2DTDA 4GX1A 2WJVA 2N1BA 4QYXA 1XTBA 3LI2A 4GMHA 4P7FA 1E6MA 5K4HA 3IT3A 5JU6A 3JYPA 4LS3A 2HU8A 1EK1A 4HR7A 1GT91 2J9YB 5TJ9A 2W0MA 3VISA 3UO8B 2QVZX 3EDYA 5FT9A 1N4DA 1JLLB 1LV7A 3IHTA 3R3XA 4R2MA 3ZYZA 1ULTA 5JD5A 1W48A 2V6IA 1RWBA 2B69A 3TTUA 1ACLA 1GHTA 4HMQA 2O8DA 3BE8A 1IBKB 2XA9A 1JJVA 4B33A 1RDFA 4P3PA 4ZVSA 1K6IA 3CE9A 3ED1A 5A4MS 1DARA 2EBWA 4PZ0A 4XGKA 5ALKA 1WCIA 3AUXA 5EZ5A 5B4TA 4HEA1 1Y6FA 4I1UA 1UPTA 4GI1A 4A0QA 1KQOA 2BVNA 2PQMA 2QPOA 2O9JA 4PFJA 3E0QA 5F21A 1GFWA 1FTWA 4LZJA 3BFVA 2E87A 4I1IA 2QL6A 3L4BC 4R9SA 1CLEA 1P2DA 1A8QA 5DV9A 2PMWB 1NVUQ 1NI4A 2E82A 3K6JA 4C30A 5JSZA 4ALNA 2JRCA 3ENNA 4OQ4A 1Z6XA 1O95D 4GOOD 5BQXA 2IS2A 1OFUA 1VL0A 1TQHA 4IIJB 4M9QA 1KSJA 3ROTA 2XOKA 4EA9A 3TNJA 1JKJA 4XJSA 5DI3B 4DCPA 4KMRA 1CNFA 1XSEA 5F4ZA 5LP6B 1Q0LA 4EHHA 4PU7A 5IUKC 3ND6A 1UP4A 4K2HA 2ZI6A 1ZP6A 2XUGA 3A6EA 1XRSB 4LGMA 2DM6A 3P71T 4FI3C 4EKDA 3AQ4A 3EG9A 4QTUB 4EMSA 1FJGB 5JWOA 1J9GA 1QFZA 1H69A 4CQLB 1ST3A 2PZKA 4U2KA 3ZWMA 1KP9A 2OQRA 4IF6A 4ZQEA 5J5VA 4RDHA 3U16A 3QKUA 2QYOA 2WTMA 5JNRA 4A7PA 2PAFA 2XKJE 3GXOA 1N2IA 2CNWD 4MR7B 3RD5A 1CY6A 5ICMA 4H4CA 5F78A 3AVUA 2OZPA 3DNMA 1MOQA 2CV0A 3OPMA 3S99A 4M1KA 1XZJA 4M49A 4IL5A 2ODBA 5DRTA 2DRIA 3DL4A 5A3VA 2OO3A 1QH0A 3FPEA 4P34A 5A02A 2FPOA 1MT0A 2P0EA 3GUHA 3O95A 4PW0A 1T0HB 5EMJA 3S4YA 2SECE 3WGUA 5JAMA 5JXIA 1VMAA 1QRAA 1ZC3A 2OZLB 4QT0A 3ROXA 4RHYA 1Y8AA 1N2CE 3NZLA 1JFLA 3I39X 3MWEB 1T2CA 3JYOA 1IVSA 2JK0A 1TVMA 2E5LB 1UJ5A 2VNIA 4MCIA 4QUBA 2JJQA 5F33A 2JIMA 1U3CA 4Y30A 3SQDA 5CFOA 4FD3A 2GJSA 1U3VA 3BXEA 3WJ2A 1KE1A 2GCOA 2Y3IA 4UPDA 3VR1A 3E03A 3D2CA 3ZNNA 1CQJB 2PXEA 5L4LA 3GAMA 3AP3A 4EJFA 2YV4A 3B7GA 3GJTA 1GADO 3KETA 1XD9A 1T5OA 3K9QO 3VR4A 4KKVA 4YAFA 5C1DA 2E89A 3JQFC 3I6YA 2R7NA 2AFRA 2RHHA 3NS7A 4IHQA 2QRNA 3FYMA 1JPVA 4RUKA 4RETA 1N5OX 1MMFB 3DBRB 7YASA 2XCJA 3X3HA 4PGGA 4TXMA 1XL0A 4LVNA 3ZVNA 2VHCA 4XB6B 2FSVC 5GOZA 1BWPA 1QV9A 2WNIA 4N7MA 2VTBB 1RQLA 2IU3A 1M34A 3P2JA 1U2GC 2QRPA 4MP3A 1D3AA 1CJBA 2AD5A 1NX6A 4RK6A 3T99A 3VHRA 3VTKA 4LYAA 1QC5B 4Y2RA 1C2YA 4HAOA 1DL5A 4JJKA 2VDQB 2Z8YM 1J0DA 1U1EA 4KQXA 1PS8A 1TVKA 2BTOA 3DMGA 3OO0A 5LZ7A 3HB9A 2JEZA 5KCMA 3VNAA 4C43A 2M4HA 2WKPA 4CBVA 3QE9Y 3B6JA 4PX5A 5G0TA 1HYGA 1N57A 3T5TA 2XV1A 3WB9A 5IC4A 3HKDA 1Q11A 1ULAA 1WQ3A 3PQCA 1TPZA 1K92A 3BWMA 4J1WA 3R9XB 1TM1E 4ODIA 4BFSA 4B2PA 3QLUA 2DR3A 1R7RA 1RLUA 2V0CA 4YCMA 1O8BA 3UFXA 3PXEA 4H7EA 3WKBA 2WFAA 3MLEA 2G67A 5IKMA 2XODA 2HRZA 3OD5A 2O5CA 3TDMA 1Z6PA 4DLPA 4TS4A 1LI4A 4ISBA 3NPMA 2IV3A 2DLCX 1WKBA 2BI8A 2YZ7A 4R01A 1X2EA 1VPLA 4C05A 1PQWA 1FQJA 2DWQA 2J07A 3K9BA 1LQCA 2V55B 1NDHA 1THGA 2UZ3A 4BKPA 1LRKA 1XA4A 2BKAA 4RZHA 1DZ3A 4WGFA 3WSVA 1JQEA 2PIAA 3C15C 3KOWA 2AGVA 3PFGA 1HA3A 4G2TA 2L2QA 3G23A 4KGZA 3S29A 2WRZA 4KITB 2W2VA 1CETA 1M2KA 3EPRA 3MS7A 1K27A 1F5NA 3TQSA 5CCEA 5CYGA 3GJYA 3GRRA 5K6AC 2GZDA 3JXDL 1PWZA 3FNIA 3G82C 5E0OA 5KYWB 1Q0TA 5U1PA 3H1EA 3U80A 1ISJA 1N5DA 3RC9A 2PXPA 1P1IA 1MHPA 2NU7B 4H3SA 2GD0A 4MGEA 2IHJA 5CVTA 2WZBA 2B9EA 4CMGA 4RA6A 2PRSA 5FUQA 2O05A 4X7RA 1Y8QA 5BNWA 2BDTA 3I12A 3L3BA 4IVPA 1GG5A 2XCIA 3DC2A 2Q2OA 2VYVA 2XTMA 3FHLA 5BSTA 1E3TA 1C7IA 1Z6GA 2F8MA 3D5TA 1FSPA 3ZKWA 4GYYA 4M0UA 4BOYA 1J90A 3RS7A 3ZE0B 4DZTA 4BEJA 5CA0B 3K3PA 3OLWA 5DTQA 5MN6A 1US8A 1TCCA 3GRVA 4N12A 1BS1A 4ZGBA 2IPMA 1L7BA 4RH0A 4A8TA 4URXR 2J3QA 3CZRA 4BNDB 1O8CA 1PF7E 5FFFA 4YX9A 5IJWA 1Q84A 2IEBA 1RNLA 5DWDA 3N8GA 3I73A 1E2IA 3GB9A 2FJPA 5E7QA 1I1OA 4OLAA 2A94A 3KUXA 4ZCSA 1FMTA 3M9WA 3OSUA 3ETNA 2I8LA 2REQA 2JRLA 3CLUC 1GPYA 4YP1A 4PU8A 3VH1A 3QVXA 5AMXA 4PZAA 4UHEA 4ZZIA 1UPCA 3OQJA 4GM0A 2WIBA 4TWRA 3GGCA 3OFKA 4REMA 4K6OA 2HV8A 5I7OA 4WCFB 5F73A 3SJAA 2X0IA 3OPQA 3U1BA 2WHYA 3PQDA 1XX6A 3O74A 4WECA 1BMTA 5EZQA 5EJAA 1Z56C 3VPFA 5ARCA 1A9OA 1Y1QA 4PHTA 3WK8A 5BWNA 3CUWA 4TMZA 4DCVA 4O5AA 2CXQA 4RWZA 3ND8A 3PQ2A 1Y6QA 3CR3C 1YJ5A 4PVDA 1PR3A 1TW2A 4RQBA 3UBMA 5KHLB 1X77A 3TMKA 3QF4A 3LW7A 5K4GA 2NVUB 2NADA 3D7NA 2PXLA 2XZTA 3KALA 2DHQA 4IP0A 5FWDA 1FDVA 5TMEA 1KU6A 5TMPA 4C7JA 3ZPXA 4DSUA 3P2IA 3G5TA 1UBTS 5AOVA 4CDGA 1XEWY 1YAJA 3R7SA 5HJ7A 2BKLA 2Y1DA 1P1JA 3HYTA 4PAQA 4PF1A 5EWLB 3TE6A 1BGXT 4UVEA 1D7AA 1ORWA 1IXSB 2M1XA 3DCJA 4K6KA 1I13A 5M5BA 1XQ1A 2C94A 1H1LB 1U3FA 3KZCA 3PNBA 4IHJB 2MINB 2A33A 3OOWA 1JT9A 2TMKA 1S96A 4N9WA 3D4NA 4CKWB 3RWBA 3L18A 1FQWA 2PL3A 4H18A 2EP5A 3AONB 1MB3A 2PUHA 3ADBA 2B21A 3B6IA 3L6EA 4R1UA 2AUMA 1ZCFA 4DM7A 3C41J 4MUGA 2LKDA 2H2DA 3RT9A 3I92A 4ZAYA 2BKVA 2QG4A 2XUQA 1XELA 5AVJA 1SD1A 3RE1A 5D3MA 3T3PB 5CDYA 4KLNA 3THWA 2FVYA 4QFMA 2X5KO 2ZSAA 3DZKA 1HL3A 4BIIA 1PJBA 4HADA 4J75A 4TMYA 3UAWA 2NO0A 3AI2A 4NTZA 3R0JA 1PJZA 1X13A 3S1SA 2BGTA 2X8WA 4UASA 2NUPB 4UM8B 3EEFA 4MZXA 5DHQA 2BOVA 1N2GA 4ZOLF 2NPOA 1C0KA 3ND9A 4LGVA 3VVMA 3KD2A 5CIYA 2VRCA 3WMGA 1DQRA 4MVCA 1XQVA 5AI8A 4CL8A 4R69A 4FCTA 4J7UA 4JOSA 2RGDA 2G8NA 2XXAB 1TTHA 3E18A 4KFTA 2Z4TA 3JYLA 4D74A 1EUYA 4I6TA 3KOUA 1H85A 3ZCXA 5AW4A 4MCHA 3VU1A 2A1UA 4OYHA 1FF9A 4BNHA 2QLFA 1SUWA 2O2YA 5EIBD 1YQGA 5AT1A 5IEBA 2IV7A 1E3OC 4J0GA 5B1YA 3KB6A 3OPYB 2AXNA 1RLJA 1A97A 3F6WA 1VB3A 3F6EX 3N9IA 4RXTA 1ZBDA 5KZMB 3QK7A 3KQHA 5FB3A 1WUHS 3ESDA 4O2AB 1G0NA 3NIGB 3ENKA 3QKRA 4GHWA 2OQIA 2D0OB 1A8HA 1E1RD 3W8DA 3WK5A 2VXCA 4K3UA 1W36B 1E5XA 4F06A 2V7BA 4KE8A 4NZMA 1OXMA 3EQ8A 1HE2A 1W4LA 4LRSB 4ZDWA 2HGZA 1SAYA 2E21A 1UKBA 2QTBA 2Z2XA 3IV7A 4XIFA 3WYAA 2CSXA 3OE7A 1A5ZA 4Z51A 5I51A 2WE8A 3PE6A 1RRVA 3P7MA 2JFOA 4J6FA 1H0RA 3RH0A 1NX9A 1XTQA 1CSEE 3FN4A 2VHZA 3JZDA 4M9RA 4YCNA 5UKDA 2FF7A 2LP4Y 3SLRA 2POQX 1ZCZA 5TR9A 5FORA 4EGFA 2O1EA 4U7WA 2MYUA 2I7TA 4JFRA 4ND6A 8ATCA 1B0ZA 4OQZA 4ZOQI 2XB6A 1ADGA 1IHXA 3O4GA 4KRFA 1SVOA 1I2CA 4QDTA 3VAYA 4X45A 3TVYA 3NHWA 4KYTA 3EHDA 4G0YA 1IHDA 4L9SA 4LKRA 3T5AA 2H1LA 1R8YA 1SIBE 3IMEA 4LOJA 4UU0A 5HILA 4O59O 1NUAA 3U7HB 3GT7A 1TA4A 1THMA 2KBFA 4LNUB 2YWEA 4CFZA 1Z7WA 1JA0A 3KTFA 3SCZA 3SC3A 3AJDA 2X2PA 4B17A 4CT5A 5KOIA 5BN3B 1RMQA 1Q1BA 1TF5A 4JKOA 3WJ1A 3DBHB 1MC5A 4K9RA 5LOVF 3QMWA 1E3WA 1VJGA 2GZ2A 3P52A 1W7AA 4TQGA 1V1MA 2EGUA 1AJEA 5CM2Z 2EZTA 3VPHA 3LT0A 3VR5D 1S89A 2PX4A 1VJDA 1KAGA 2UZ1A 3B3JA 3UXEA 3O7WA 1XXHA 5SYAA 3T94A 3V4FA 4BN5A 3EEIA 4E5KA 3FVVA 3GPIA 5AJUA 2AVNA 2NU8B 4JVNA 3MCTA 5KVQA 3AILA 5AW5A 3CR8A 3NJ8A 1S01A 5EQTA 3U3KA 4YAUA 1TNDA 3O8RA 2I9PA 2CT8A 1SKYE 4ZAZA 3PICA 4UHCA 1M0EA 4KLZA 5KYYA 1DTSA 2JCVA 1SU4A 2BISA 3H84A 1EGHA 1U0SY 2RHBA 1S8NA 2X5JO 2E37A 1GGEA 3CUTA 3OLVA 2JJ1A 4PSDA 5G02A 3ZDFA 1NBME 5JISA 2WTNA 1G6HA 1J25A 1B0NA 1TW3A 2NVBA 4CT0A 1AF4A 3T3HA 3V7UA 3TRIA 2RCNA 1N2JA 3E4DA 2K7ZA 2ECKA 3ELDA 1E2FA 1PX0A 5EP2A 4DR2B 2Y4NA 1F9AA 2HLDA 3FDZA 1CKEA 2WWWA 3TCKA 5FX2A 1SC6A 2X0FA 1IU9A 3MCAA 4U0JA 2DR2A 3FSGD 1LSUA 2EDCA 3EGDB 1N6OA 3KU1A 2P75A 1JDUA 1T3HA 4NY1A 5D3KA 1VHLA 3QUCA 4R2HA 1U5BB 4X00A 1KZ9A 3NBMA 2I62A 3CH5A 5FWYB 1I10A 4DSOA 3MCZA 4QO8A 1KI6B 4Q82A 4GD3Q 3U3WA 1E6UA 1XTIA 3H5NA 3UUFA 4B4UA 1II8B 5ADUS 1JJFA 3PNSA 3JWHA 3PC6A 4AQDA 1RYNA 2OQVA 1XXLA 2G36A 5E2AA 2ONCA 4H7FA 5BR7A 3Q8WA 3U7QA 5LJLA 1R0XA 5E2IA 3T12A 1N6RA 2HK9A 2ORIA 3ZE8A 4B75A 5J3JA 5FO0A 1TUGA 2IVFA 3HB0A 1KK2A 1XMIA 3ILHA 3MFYA 4RU1A 5IK2A 5K3DA 1UMBB 4PGFA 2ZSJA 4KZKA 2Y1GA 1Y6JA 2R8RA 5CCBA 3I6QA 4TROA 1P6UA 5JAOA 1NMXA 2R8ZA 2B8JA 3E7XA 1W8DA 4RPLA 1JSZA 1UBFA 4ENUA 4FIZA 2Q6IA 3T7SA 4NF2A 3L06A 4K6FA 2DLNA 4DJDC 3LY9A 2NP6A 2QAGB 3P27A 3I83A 4IOJA 4D3XA 4UVIA 2IY8A 3KKKA 3K1AB 4S05A 3R1FA 1VMIA 4YRMA 2OESA 3ODGA 3QTTA 3DEIA 4U7GA 4D9NA 3CKYA 1DIAA 4I19A 3DDZX 5ENDA 4Q5IA 4TWJA 4NDNE 3B5IA 5KUTA 3WRWA 3GHHA 3BXOA 4YMWA 3ZDDA 4MNTA 3C43A 2G5GX 1CUGA 3RSGA 5DSXA 3PUVA 4MGYR 1QFYA 3IKTA 4RMGA 2YQ5A 1G21A 4JLMA 1JNYA 3RYCA 3NV9A 4JFAA 3G59A 4QDXA 3GMTA 1U2QA 4MUNA 1UINA 2G4LA 2OEPA 1PT5A 5TPWA 3T4UA 3HCBA 3L79A 4ZHQB 1UOOA 2VG8A 2WOOA 3HY4A 1N78A 1R69A 2PYIA 3KXPA 2Y0EA 3P0RA 5AKHA 4D9IA 5I8PA 4Q4CA 4OL9A 3TGPA 4ND5A 4H6WA 4MEJA 1VMKA 3B3GA 3WOVA 3AU8A 2SNIE 2DH6A 3QPCA 4DILA 1ADYA 1QAOA 5CLQA 1M3SA 4BCDA 5A0TA 2R5FA 3WQRA 2QN2A 2GDJA 2XR1A 3KAQA 1T8WA 1V7CA 1NW4A 4TKVA 1YHNA 2J9FA 3WLQA 4Z1MA 1XQYA 2QLNA 1CRLA 3EB9A 3W5JA 3DO8A 2P9TA 1PG0A 2GBIA 1CQXA 3QYAA 2ZRQA 2IYLD 1K3FA 2FKAA 3NC0C 1FIUA 4JYAB 5JZSA 2BEWB 3V7FA 1SVNA 4TTIA 1A9XA 1RSZA 4EEZA 1JIJA 4OATA 3EF3A 2D8AA 2MMCA 3FWNA 2P2LA 1L6RA 2JBAA 4DMGA 1N7GA 4IJKA 5D5HA 2DYKA 4B5LA 1O3YA 3DM5A 1XZCA 2LYSA 4HZUA 4O63O 4P54A 5DX8A 1UH5A 4GXRA 3SNKA 3LAWA 4PONA 3SQXA 2NZJA 4NCKA 1Z5OA 4IQGA 4D26A 1JNXX 1VE5A 1QB8A 1YQUA 1QNFA 2UV8A 3I4FA 3TZQA 5F1KA 4F3CA 2R8BA 3I42A 1DINA 5ITSA 4ARZA 1U0OC 1E2UA 2BC9A 2VHJA 3O3OB 3QGMA 1G0OA 4HC4A 5IBQA 2JGJA 2PMKA 3N8NA 2PS1A 4EFLA 1MG5A 3L0YA 4O29A 5TPZD 5ALWA 2O0HA 4XWKA 1SZDA 2J59A 2B61A 2VWGA 1L7XA 1NI5A 1SO8A 2QT1A 3AWDA 3HXKA 5P21A 3F96A 4AG5A 5ELLA 1R2QA 1UODA 2H7CA 3A6KA 1NURA 3C3CA 4XYEA 4YLYA 3ZD7A 4KYIB 1FJHA 4UDOA 1YA8A 1JHOA 1EFVA 3CF4A 4D9MA 1KBOA 4BLQA 2R87A 1J42A 3LF2A 5CFNA 1CUJA 4W5TA 1GU1A 1GO2A 2PYDA 2PT5A 1J7KA 2WWFA 3U39A 1FNMA 2ZR7A 4TYWA 1HE4A 2H11A 2E3JA 1TAUA 2Y1EA 5DH9A 4FN5A 4YYZA 1E8DA 4IJMA 2VSQA 2GEKA 2D0PB 2BJVA 2VI5A 2WG1A 4J16C 3EOBI 4NONA 4F56A 1UXHA 2P9BA 4F91B 4RZIA 2BEUA 4X0EA 5HW0A 4A27A 2WJYA 4BJ6A 2FGKA 4JP8A 5DP2A 1MKYA 1IUPA 1P5ZB 5ADHA 1XPUA 2VATA 3V3KA 4MS4A 1Q1GA 2MHCA 3KEMA 3VV3A 4M38A 4C01A 1JA9A 2GKOA 5FPQA 2C3PA 1ENPA 1Y98A 3N8HA 2B4TO 1LJLA 2IYYA 1PJ3A 2J41A 2BGWA 1YR3A 3LCJA 4FDAA 4JHLA 1IK6A 4ESOA 3EA5A 2P6UA 1OX4A 2HD4A 3HKEA 4GZ5A 1KWKA 3IX7A 1Z7YA 4JCYA 2EBHX 3TLZA 1YGYA 1XZNA 3COWA 4XE5A 3JVVA 2XVYA 3R6DA 3A8TA 1QFJA 4X4HA 3CRW1 4BASA 2ZWAA 1E62A 3THYB 5EINA 2IZ1A 1QH8A 4PY2A 2X5XA 4WFKA 2R5NA 3GY0A 1L1EA 3SBEA 3BQ9A 4F5WA 5HK9A 2J0UB 1HNXB 1WJGA 2R00A 3DE2X 4BMDA 3ZHYA 1L5QA 4M1SA 1T5BA 1PLLA 2ZTUA 1G3UA 1V5WA 2FMHA 1NVWQ 1NU8A 4YCSA 4YJFB 1P1KA 1JF8A 1BG6A 1LSOA 2WJ3A 4YAKA 1BCRA 2J85A 2JGRA 4I08A 3T95A 2V0NA 1OD6A 3H2SA 4JMLA 3BWBA 5IEJA 3GLVA 3PDHA 4WH0A 3T9CA 1R15A 4FDLA 5ALZA 3RFTA 1UBUS 2FSUA 4PICA 5EL0A 1E9CA 2FWNA 2AOWA 1ZA2A 2VPQA 1GNQA 3RFCA 3QVJA 3LVRE 4FKBA 4KDEA 1GA4A 4TYYA 4XDHA 2Z3ZA 1ZD8A 3RYIA 2BFOA 4XWWA 3L7JA 4JT4A 4NZZA 5M3BA 1BRMA 4DLXA 2Z1NA 4YC7A 1J2EA 4MS3A 4FHEA 4G0PA 4JHXA 4K87A 3RIYA 3GLIB 4TRNA 2VSOA 3AQIA 4D0GA 3GLGA 1HQDA 1ND5A 3W8FA 2XEXA 5I8WA 5D5PA 3FWZA 3DL7A 1XN4A 4P82A 2WSMA 4Q03A 1IJFA 1ULHA 2AB0A 1DOZA 2C7GA 2FSFA 2UVPB 3VBCA 2CXTA 2XJ3A 1ZQ1A 1T8TA 1FFGA 4G4JA 4LXUA 3GFOA 1WZCA 2J3KA 4CKBB 1CDDA 2GZUA 1J0AA 3V8VA 4YV2A 2VTDA 3B38A 3MUOA 3DEAA 4PC7A 5B2ZA 1TZMA 1VYHA 3GP5A 4IDAA 4KR3A 1MA3A 3H5AA 2CL5A 4TKUB 2ATVA 3RANA 4R0NA 3AR3A 4CTJA 1JUDA 3UBTA 4TXJA 1YS2X 2YWDA 2PGOA 3PGXA 3JU3A 4N5DA 5EHQA 3UG7A 2BGMA 2BT4A 2OC4A 4I9UA 3WV5A 1QTIA 1ZAYA 4L4ZA 4AP6A 5A0VA 1YONA 1N6NA 2FR1A 2IYFA 3F3MA 3NT2A 3JQAD 1WVIA 3R44A 1ZJ4A 4YDQA 5ADWA 3P1JA 4OHCA 4E51A 4GE3A 3K05A 5GM2A 5FYDA 4WJZA 5K03A 2Y99A 1EFRA 4CDMA 4DC9A 1TEZA 2L69A 1PD0A 1OBCA 3WWYA 1EGAA 5E8JA 3OA2A 1PSDA 1E4VA 1QO7A 1JT2A 3D8RA 4ZXFA 4X60A 2ZBRA 2VNSA 3SX0A 3EUAA 5JLAA 4DVGA 3ZBTA 5IT4A 4ID3A 4A0RA 2JFPA 1VM6A 2AHRA 1HDRA 4EKIA 1BU5A 2IL1A 1PAUA 2YINC 4KRGA 4NS1A 3RC7A 1RHMA 3WIBA 4D4LA 1CF9A 4QOEA 2OPBA 5LD2B 4OKSA 1RKBA 2FQYA 1PFYA 1L4NA 4BRWA 1DBRA 3ZWNA 1TEHA 5KAPA 5HF9A 3PUWA 1IE3A 4H7PA 1TJ5A 2FDXA 1W0KA 3CONA 1NQTA 2XMCA 1UUFA 2W83A 3R20A 1HYQA 4G9BA 1KE2A 5ER6A 3ZLUA 3MTIA 3NKFA 3GPLA 4CM6A 1PLKA 2W8ZA 3TOSA 4L5AA 3NBXX 1IC6A 2VOJA 1C1YA 3KT6A 4JJ8A 2BFCB 2P0YA 2G25A 4Y1RA 3V48A 5JJ5A 4Q3EA 4D02A 3MOSA 5F5NA 4PIVA 2R751 1JG4A 2XMPA 3A4TA 4M21A 4CVNA 3OZWA 5A04A 1CRPA 4LE0A 1DTEA 1GNSA 4YLEA 4GI3A 3F8SA 2PXCA 1WHTA 1MENA 3T3MB 2JLUA 2QMZA 5JI2E 3B51X 2HNAA 1WPQA 1P1RA 4WXEA 1E2HA 3MF4A 4G4IA 2V03A 3OLZA 2W71A 6REQB 3QVGB 1YZUA 2OM2A 3BJMA 3KIPA 4K28A 3NI2A 4XTCS 3L7KA 1MW8X 4FZVA 2CLFB 4O33A 4IUBS 2BN4A 4X5OA 1B6GA 1SVMA 3OD1A 5FXMA 1B3BA 2CDBA 1MGOA 3C7TA 3D2AA 2EG5A 4P98A 4BNKA 1O5TA 3H2ZA 1CEQA 5FUMA 3AFMA 1FC0A 3RBVA 3CEJA 1M75A 4B09A 2ZRHA 1NRWA 3RHFA 3CEPB 2HRRA 3GA5A 4GSYA 4UHJA 2QUJA 3OEHD 2WSSD 4F1JA 1O9BA 1FDTA 4J7CA 1WCWA 1TD1A 4AZ0B 2F1KA 2QD5A 2EJBA 4LOLA 4F3KA 3LQ1A 5AVTA 4BJ3A 3JWGA 4W5HA 1K6XA 2GYUA 2OLKA 4P0TA 1WP4A 3T7AA 1NKSA 4LCJA 4MWGA 4C0HA 3ICVA 5K3FA 5KQRA 3Q9NA 4C7OA 2NG1A 3MTAA 2V8BA 2HB6A 2VZ0A 4MROA 1Z4PX 5DWQA 3WNBA 1ECPA 3EC1A 2A1TS 1NW8A 1B7GO 5CW1A 3W4KA 5COAA 4GR4A 4GMFA 5KDDA 2QVGA 2W2LD 2O19A 2QI9C 2LBPA 1ZW6A 5KIAA 1PQ4A 4JL8A 5J4YA 2YW2A 2GBFA 3DMHA 4OUKX 3SOPA 3DE3X 1FUUA 1LQTA 1TT7A 3MCVA 1AN0A 3V4SA 2JCSA 2ZIAA 4JVMA 3ZDQA 3OM0A 1TMGE 3L6OO 2L0XA 1X1AA 3HCOA 4B7UA 3E9CA 3G7SA 3MQFA 1YSEA 1VP3A 3C85A 3H2BA 5FQNA 1L1RA 4PZYA 3B7PA 1NG9A 1PEDA 3EXEB 3KFXA 3J81k 1V5EA 2J4CA 3NIDB 2IYTA 3P5SA 2YKGA 2AG0A 1XK6A 3HVJA 1FDRA 4EYSA 3DKVA 1JIUA 4NH0A 1DC5A 2OV8A 4HAXA 1ZUGA 3ABRB 2PUCA 1RKUA 3B13B 4A4DA 4DMRA 4HT3B 2LIPA 3K20A 1BS2A 3OM8A 4D46A 4QLBA 3OQ1A 1LPAB 2FPUA 3BG5A 3GLSA 3RB8A 2I3BA 4LVCA 5K8VA 1A72A 1I6WA 2DHRA 1BEZA 2GKSA 4OXYA 2PO5A 4CPDA 3BGVA 2B7BA 1NBOA 3K9LA 1YKGA 3DZJA 3P9QA 4CKCA 1Y5RA 5HJEA 2OQ2A 4EG4A 4UM9B 4IX9A 1VJ5A 2G77B 2OUKA 3IDSA 5FUBA 4S1NA 3R9IA 3TEPA 2QJWA 3ANTA 3URKA 4UUAA 4XOIA 3D4PA 3I9KA 1FCJA 4G1EB 4Q9HA 2PUFA 4MUXA 1QTRA 1AXGA 4OV6B 5ICSA 4MQ5A 4M8KA 3H0EA 1T4DA 1Y9DA 2IUOA 2AXPA 1PBTA 3PHHA 5AKEA 3GNSA 5KNDH 4WLNA 1G41A 1TC1A 1Y6RA 4Z4FA 3IXMA 2TS1A 2ODPA 1GL9B 1N3BA 4HXFB 4EJSC 3BD7A 1ZZ6A 3E2PA 3UXMA 4J1TA 5IDQA 1KAEA 3FOEC 5A7LA 2YMMA 3MJTA 4UDYX 1TZBA 4C03A 3QNWA 4DR4B 3GLHA 4D92A 3F49S 3PD0A 3P2OA 3R6LA 3D3WB 4MW4A 2EARA 4MHOA 3JWIA 4QUKA 3UT5A 2JGNA 3A14A 4E0BA 2YWXA 1EU1A 4TVKA 1Z75A 1Z6QA 1YZYA 4MYHA 1KQFA 2MSDB 4QUEA 4RTMA 1UZMA 3ZU5A 2VF7A 2AS0A 2PR7A 5THKA 4E03A 4MJLA 1BKDR 3TUZC 4AXXA 7ABPA 2HF7A 1OPRA 2EW2A 1VTKA 5HS4A 4W9MC 5AK5A 5LPNA 2X4IA 1HOTA 5CYFA 4CF4A 5THQA 2O23A 4NECA 4ZA2A 4U2BA 2K7FA 4B3BA 4YPVA 5JARA 4GMXA 5BQ3A 2LV8A 1O57A 3DLHA 1J0XO 1EVKA 2YJ6A 3QKIA 1ORDA 4OVKA 5KKAA 1C4XA 2LW7A 3HJUA 3D6JA 1GV0A 2IXBA 4KDCA 5M34A 1Z2NX 5E2BA 1WMAA 3W3AA 1U3WA 3I4LA 5DZSA 5EC8A 2ZRJA 1PW5A 1DX6A 1FRQA 1KS2A 1IB0A 2ZJBA 3EVDA 4O4IA 4XGRA 4ARSA 1PL6A 4YRAA 4H6PA 4ZJPA 1JRLA 2B98A 3S55A 2RJOA 3NNSA 5BMOA 1NJFA 3A9VA 4I5EA 3UXHA 2J7WA 3RSHA 4CQMD 3F0TA 2ODQA 1E8NA 4L8WB 2J4FA 1L8AA 1X7GA 4RZUA 4HI0E 3ESQA 1L6IA 4N54A 1SCBA 4J03A 3KZ3A 2R6DA 1JZTA 2AN5A 3H9QA 3CW8X 3RTBA 4UU8A 5JLJA 1B6TA 1X7DA 3STHA 2P8JA 3SJUA 3TLCA 1WXIA 2C98A 4L5BA 1JFFA 1WLYA 4MW1A 4BGVA 1ETUA 2GX6A 2YN0A 3OE1A 4MQFA 4P84A 2WPNA 4MO2A 4W4TA 2H3HA 5DGIA 4AZ3B 1ML4A 2CHQA 2MU1A 1KHTA 5FBKA 1BVUA 2AUNA 3HQ4O 4LSGA 4UNIA 4EHNA 1PR5A 3H1FA 1CP2A 1LI7A 4IDOA 4UTVA 4AN0A 5FWXB 1DAKA 3FRIA 4ZRMA 3DV0A 3NIFB 2HK6A 1ADRA 1I30A 3MIIA 1HNZB 1SD5A 1L7DA 1CIVA 1KK0A 4IIYA 4LF5B 1OH6A 1G2IA 1JBKA 3UV7A 2BELA 3TAUA 3HBAA 3G7DA 3FVTA 3A11A 3I34X 4G5XA 3EC7A 1PFVA 5GJBA 4NCHA 3BE4A 4NZYA 5CT5A 1NXSA 2PTHA 5IARA 2W4IA 2ETXA 4YT5A 4AJ4A 16PKA 3CSSA 4HNAA 4EKGA 2D1SA 5DJ5A 1VCMA 3G5GA 2J08A 4U9IS 3ITKA 4Q4AA 4BV2A 2WTEA 3K70C 1YMVA 1G5PA 1BA3A 3WAKA 5JQWA 1S3GA 4PZDA 3GRCA 1YZNA 1YCHA 1D04A 2Z09A 3DUFB 2RI1A 1L9KA 2NQTA 3P9RA 4R68A 1QIHA 4UBOA 4S35A 5J4KA 3KKMA 1L7AA 4R05A 1R27A 1HXHA 3A2LA 1XJWA 2F1HA 3L6BA 5ENVA 3WIEA 1VFNA 4KNYA 1M2OA 1N5JA 3T1QA 2W5UA 2XTJA 4FEEA 4K9SA 1AZTA 2OOSA 3ZCPA 1R3UA 1J20A 1KC1A 3EG5A 2WU0A 2OORC 4ZEWA 5EJ9A 2GM4A 2CHFA 1SBZA 2ODAA 1ZH2A 2PQ2A 1QFXA 1WW3A 2N1MA 2CMFA 3AR9A 4G3XA 4FYIA 4TGLA 4CEHB 2J3HA 4W82A 1UBHS 4BNLA 4URYR 1DAFA 1H8HA 2V3WA 3D43A 4XWGA 1P7PA 5HHTA 2AC7A 3PSAA 3ZDXB 5KNCH 3F4LA 1KEEB 4QHSA 5EMKA 3BDVA 3T1OA 5MFZA 1WB9A 2VJOA 1OFVA 3ZU6A 1ADBA 5HJ2A 3RUCA 1KKLA 3KX2A 2O8DB 2Y1KA 2OHJA 3FETA 2QBYA 1YKFA 2AYYA 2FUG6 4UUMA 1IZ0A 3TFWA 3Q7SA 1KO8A 3O7MA 3KAPA 3H1AA 3PC2A 4XYLA 1TZJA 3ZKCA 1MH1A 2R4TA 1GG8A 2PXKA 3ZJ5A 2XA2A 2R85A 3GC6A 3DFFA 3INRA 3Q40A 2X8JB 4FR2A 3V55A 2BM9A 3WLSA 1E4YA 4PGAA 1JIXA 3QH4A 4IWXA 1GD1O 4Q02A 4WY8A 1EHCA 4L9AA 4X20A 4XOUA 3UVEA 4HVLA 1XCLA 5ALQA 5JSZB 1CBUA 2AG8A 1RABA 3MAJA 4G0ZA 2PY6A 5B3JA 4LYEA 1Q50A 3ZIDA 1FXWA 1C1DB 1RC1A 3OMWA 4S1VA 3CHYA 3LDGA 4FILA 1I1NA 1I2MA 3SE0A 1K8QA 3F7OA 1I32A 3SF8B 2CEAA 2GH1A 3KBBA 4W7SA 1LDGA 2R1ZA 4GDMA 1YVRA 4C2AA 5C51B 1IQPA 1O96B 3R5XA 1C7RA 1UWLA 4R6XA 1VPTA 2GTPA 1PV2A 5ARDA 5DNYB 4AI6A 2H0QA 2C7VA 5GADl 2EEZA 1CNEA 3NTOA 4G0XA 1GTL1 4I4IA 3ECCA 4IY1A 3JYNA 4EHFA 5ICCA 1T4CA 1VLQA 4IQ8A 5EN4A 3RFXA 5K3OA 1ULSA 2RHCA 3N7AA 4KQ1A 4I9NA 1ZH4A 5J2TB 2HQRA 1TECE 3U7IA 4MH0R 3G2IA 1GLNA 3P0FA 4Y2SA 3PGA1 4KPUA 1FTQA 2L8NA 3FWPA 2ZB3A 3GEDA 5JZOA 1YQQA 5TGZA 1DZIA 1Q19A 5CYOA 4LJLA 2IYSA 1GL3A 4NCAA 1GTMA 5GJWC 1O6ZA 2WDZA 2YMPA 4IJWA 4PIMA 3BSYA 1RWPA 3VR0A 5LM3A 2BHNA 3DTVD 2AJTA 4IINA 5DXJA 2YUIA 3PEYA 1XMOB 1E3MA 3TXAA 1QGZA 3OCCA 3GQBA 3ZW7A 3C39A 3HWWA 3D4LA 3QY9A 3FTCA 5GINE 2XZOA 3CPSA 2J1LA 4GBMA 3V80A 3UQZA 1BMFD 2YWGA 2Z9DA 3O9MA 2PPLA 1R63A 5CW2A 4YR9A 5DOVA 5DYIA 2FR0A 3G2MA 4JZYA 2GXAA 3BJZA 4ZOLA 3TTXA 2RGNA 3Q85A 4WOBA 3AEXA 2IKQA 4AU1A 1BFUA 4EHDA 4OSPA 3S1AA 2G9UA 2JHAA 3GF4A 3O8BA 4QHTA 4IFIA 4JWTA 2IPNA 3TDKA 1SCAA 3MBIA 3MD0A 2J5QA 2OD2A 1PVDA 3QXHA 3W7VA 5SZHB 1X1RA 3PUXA 4JUAA 4BZQA 1NLYA 4D96A 3CUYA 5B7NA 3KVRA 4Q12A 4B45A 3AX6A 3E9ZA 2G1UA 4BKQA 1LLUA 1EB9A 3D7LA 4PLWA 3W6NA 1AUOA 4EATA 1V1RA 2OHXA 2P6OA 4BLRA 4HB2A 1WETA 3H2HA 5B57C 1YB4A 4H15A 2C8KA 1MB0A 3RADC 3O9VA 5JTUA 4DAEA 4NX2A 1K86A 1ZVKA 2AI1A 2GYVA 5JHGB 5TC4A 5KC8A 1P4RA 4XCVA 1II9A 4DG5A 3O92A 1TU4A 2RHLA 4WEQA 5CJ2A 3VKWA 2PHZA 3X1ZA 3OU6A 2ATXA 1GJRA 1QAMA 5D1NA 3K4QA 1Z16A 4LBWA 5T3UA 3AZOA 5TF4A 2C4VA 2RB4A 5AUPB 1NQXA 1JBQA 1STOA 5IJ0A 3H04A 3ZXUB 1I4EB 5IF3A 4Y2JA 3TQHA 3AM1A 2H29A 2G1AA 2OYRA 4UUNA 3LCRA 4L08A 4BZXA 1EFDN 2OOKA 5DYNA 2NYUA 4X4DA 3HDQA 1IAVA 4MPTA 2VS1A 1EQUA 4B9EA 2VXOA 4MPPA 5LA6F 1Z83A 1BU8A 3SK0A 2CUZA 2A5YB 3H83A 3KQUA 1OBVA 1U6IA 5KJEA 7MHTA 4GLLA 2JQEA 1KEVA 3BILA 4WD3A 1W25A 4RAOA 3OQ6A 3D0KA 3PHIA 5JFTA 2YY7A 3JZAA 3HEMA 3L7IA 2XMGA 2OMEA 3V8NA 3KWMA 1QLHA 1T8PA 4QELA 4NFHA 3DF9A 3AZQA 4F1KA 3DMNA 1PBNA 2D5BA 4KP7A 4JI3B 1NQUA 1FU7A 4ASUA 4DJFC 1M2GA 2AV6A 4G0OA 4B4OA 4WY2A 3RROA 4EY5A 4Z5HA 2BFDA 5DFAA 1DWPA 3ZWYA 1P1HA 4BO5A 4B2YA 4YLGA 4DS3A 1CC1S 2WWIA 2JZOA 3LHSA 4FBIA 3QKWA 4EWLA 2H7VA 3NXKA 1Y8QB 2IEDA 1MPTA 2IXDA 5CDSA 1QIJA 5L7YA 2KBEA 3B6ZA 4R2LA 4P7JA 1X6VA 1PJQA 3MUFA 1X1DA 4X93A 2DPXA 1K68A 3ZCTA 4DC0A 4WHMA 4HNUA 1QVZA 3BK1A 4KREA 1NP3A 1XQ9A 1E4EB 3KVNA 2RHRA 2WF7A 4BMCA 3QFTA 4KACA 5JDIA 4OLHA 4EQZA 1J6UA 3NTVA 3N2NA 4MUMA 3U62A 1S7EA 5FI5A 3A0UA 3SDZA 5CXQA 3JCZA 3E7PA 4KRYA 2MDTA 2REQB 3IAS1 1H2WA 5FBHA 3W5SA 1WP9A 4EY8A 3BWDD 3SJCA 2B0CA 2GBLA 3HXTA 2PRZA 4GC5A 4GI5A 4U2GA 2GTHA 1XTVA 2CKMA 1H5NA 1YE5A 2OSVA 3JARA 1CY8A 3L5KA 3B9RA 3L6UA 2L49A 3HXPA 4YFVA 2VJMA 1G9SA 3TLBA 5FI3A 4QPJC 5AQ1A 1E96A 1Z47A 2BF4A 2NZWA 4ZI5A 4C6SA 2AWNA 1DQSA 1GVNB 3AEQB 4Q4HB 4XYMA 1P4HA 3AEUB 2FW9A 4B46A 1Z0JA 2ZULA 4LV5B 1Y8RA 5DM70 1UPAA 3O9ZA 4N49A 3D5EA 4X1KB 1U0TA 3MMSA 4X90A 1UZNA 3CNBA 5H9VA 5SZJA 3PXDA 4UTNA 4B8YA 5BN4B 3DE7X 3DVRX 3IBYA 3QF4B 3ZGNA 1CUHA 1QNLA 3JAKA 3FZYA 1U99A 3T06B 1FQKA 3C4VA 2FK8A 2R96A 5HG0A 1UXKA 5M04A 1XMQB 4JK3A 3MTDA 4BY9E 1GLGA 2NMVA 4EG7A 4F21A 2PGAA 1EUDA 1FUIA 4RK1A 2HBQA 3M49A 3WLMA 1QIDA 1HC7A 4QD3A 3KYJB 3A3PA 2W93A 4KVFA 3IP1A 2IDMA 1TM5E 3H8VA 4JUIA 4M0CA 2BEVA 1EE2A 3UHJA 1EVQA 2Q9CA 3PUZA 3U5ZB 5EHGA 5JMTA 3HCAA 2E4YA 2GASA 4NCIA 1PWHA 3JSAA 4RY0A 3IDAA 4HN2A 5F2NA 3ICEA 5KTPA 4DDVA 1F2VA 1NN0A 3OZCA 3QYPA 4N6NA 3SFVA 4MWSA 3KR1A 1G5TA 3I1FA 3R5SA 4TMXA 1KETA 1T4GA 2D59A 4BMOB 1XC7A 1I24A 3DW3X 1YRLA 2FXVA 1ARZA 3BD6A 4KN9S 5D3MB 1IWBB 1YF3A 1E59A 2OO5A 4FMDB 5MGNA 4HLUA 4BBAA 3ZR4B 4K9KA 3GLFA 1EDEA 2FGJA 3BXGA 3KT8A 4OB6A 4NNJA 5B53A 2X1VA 3GJ4A 3PLNA 4HH0A 3U17A 2E2WA 1J8VA 1L4KA 1ZIDA 1PKXA 1TCVA 3HCRA 3MJDA 4MWDA 4NP6A 2IWHA 3SCHA 4Z59A 1CT9A 1ZIPA 3DHYA 4ALMA 2P9JA 1D09A 1A4XA 4NS4A 3UYKA 2C4UA 4B6FA 3LUGA 1S6YA 2V7QD 2FEWB 3H87A 1P7WA 2X3FA 4C7BA 4NH4A 1J8MF 3FZNA 4F71A 1CJCA 4B3SB 4XWYA 1KOGA 3KJNA 1NT2A 1SUDA 2PUEA 2JDIA 5LZ5A 1OFGA 3L7CA 3C97A 3IIIA 5F1YA 3RJ9A 4CN8A 4MRRA 2JFNA 3PBKA 4EZIA 4BVHA 1L5VA 2M6KA 4PAWA 5DLQC 2ZTVA 4NVRA 4W9NC 2KSQA 3K35A 1M2HA 2WSIA 4OQQA 1QYVA 3GJ6A 3AB7A 4MP8A 1W581 3ZV7A 4UZFA 1QTQA 1SRRA 2GEDA 1D0SA 2AXEA 1U90A 3PRJA 5CG1A 1E2GA 1CQIA 1PQYA 4HMOA 5BVHA 2F62A 4RD0A 2AZMA 2FSGA 4KUEA 4LJ9A 5K0LA 3RLIA 4BU0A 2XF2A 5CMLA 4JVLA 3FYUB 3P5BA 1FNSA 3PITA 4MJ7A 1DEKA 1XDGA 4IQ0A 1U0LA 1ND6A 2CHGA 4IDFA 3IQDB 5ALPA 3VV2A 4NOMA 2IWRA 3SJZA 3JD2A 3HDJA 4NABA 4JN6B 3RIEA 1JWAB 2CSFA 3BL8A 3K0KA 1VPEA 3PVSA 2H16A 3BRCA 3KXIA 3DMTC 4L76A 3AETA 4X3CA 2GO7A 4XIJA 4KXWA 3LWBA 2FZEA 3LKZA 2O49A 5KOJB 2Y4OA 3RZZA 1QM5A 3HRHA 5MF6A 4Q6BA 4DIFA 3VPSA 4IXNA 2QJOA 4NQRA 4P4NA 2C3OA 2V9ZA 3OJOA 3S2FA 3VH2A 1WSDA 3ZNQA 2PZEA 3TG8A 3GJ0A 3D1JA 3OHSX 3QPUA 4L8VA 4ZI7A 3LISA 3L02A 2H1VA 2IPOA 2LIVA 2JGDB 1X7ZA 3CC8A 3O90A 3QWFA 3JASA 4KQGA 5FA6A 1VXRA 3NOVA 2G4VA 2H7XA 3ZDEA 4C0JA 1FUKA 3I1IA 4LTDA 5CK5A 1D1TA 3RUHA 1Y34E 2EF8A 1RHJA 2GMWA 4GI2A 2ZB2A 3OURA 4IJ6A 1T8RA 1W9MA 4OOFA 5F35A 3RARA 2PZFA 2HQ1A 4FGKA 4HGOA 3SC6A 3VPAA 3DVAB 3RABA 3AUUA 1QIFA 1E1NA 2EWVA 3C5CA 3LXRA 2O3JA 2WWTA 4OBWA 5DDIP 2VZ9A 1YJ8A 1E58A 4RNCA 2B6HA 4MVYA 1DBSA 4XARA 2CDNA 3IT1A 1ZVJA 4Q1VA 1QPGA 3PHGA 1FX0B 3ZHVA 1ZGZA 2JFVA 4ENWA 4X97A 2FFBA 3G0DA 2RIPA 1V5FA 2GCIA 3L93A 2FZCA 4YDSA 3F4KA 5HCNA 3D0QA 3TX2A 4QAJA 1S2NA 3WP0A 3DOOA 1Y7IA 3ZWKA 3MIZA 4XQGA 5AR1A 1WDLA 1K7CA 3CN7A 3RRXA 3QE2A 3TI7A 2YIVX 2R6ZA 5L7TA 1MIOA 1X7HA 1OJ7A 4AMBA 1C8LA 2O8VA 2OBBA 1P4GA 2Q0SA 4M6WA 4QU0A 1P3Y1 4ED9A 1P8JA 1SOWA 3VOBA 4H7HA 5DHTA 4RFVA 2POCA 4FHCA 2NV0A 5CDFE 3U4QA 2AMYA 1DC7A 4LW8A 2WHPB 5LBTA 2A2ZA 2ZJ4A 4BO0A 3BK7A 5TQVA 4ZPXA 3E27A 2KEIA 4WFIA 1BQ3A 3T4EA 1AMNA 3EEOA 2IUSA 1XTJA 2ASVA 4F85A 2HT6A 3SAJA 1YBVA 2QPAA 2C3MA 5JQGA 2JFUA 1D2AA 3B89A 4E15A 4G1CA 2KMLA 2BLLA 3HMQA 5K6TA 2I91A 1P0IA 3QBJA 5DOZA 3U13A 3VC3A 1OSNA 5A62A 4LF6B 2Q9AA 1Z6TA 1QYDA 4DLLA 1D4OA 1UCFA 3FGPA 3TZEA 1PQUA 2ZUVA 4BN4A 3JQGB 2YZGA 4CE6A 1VCHA 2P6MA 3QE4A 4I8IA 1GGVA 4XD7A 1KFBB 4RIGA 4YHHB 1ODFA 3OU7A 5C3UA 3I9V1 5FEUA 1P45A 2XHEA 4K2AA 4QUDA 5ALJA 1GR0A 3TL3A 2AC2A 2R6JA 2QVXX 1KO7A 1XP5A 4TTSA 1G1MA 13PKA 5JMPA 3ZZ0A 4AYWA 3CZPA 4D0LB 1RTTA 3HNPA 1APBA 4AB1A 5CCXA 2HW8A 1A8SA 1I4OA 3OIVA 1BJTA 4GR5A 3DBLB 3P96A 2R1UA 1J5PA 2ZE6A 1A5TA 4QPPA 3QE0A 4NAVA 1JECA 2P3OA 3HB5X 4DL9A 4YMSA 2EZ8A 2JNWA 1G18A 1GZDA 2GXQA 2OT3B 1GVHA 1JIQA 2AA3A 2NT3A 4LWOA 4FTWA 2XWSA 5BW6B 4CMAA 1S4QA 4ZO7A 5LZ4A 4GPTA 3V1NA 2ZI3A 1IN7A 5C80A 4AG6A 4KK3A 2CMKA 5HIIA 2JGLA 1SXJA 4Z5CA 2ACKA 3GCDA 4G37A 3WBJA 1UKEA 1B16A 4CM9D 1UPFA 4TZKA 3G0CA 3GGJA 1R0BA 4QVIA 1Z12A 2I76A 3AOGA 3E82A 3HXMA 1G1AA 1L5KA 5HZGA 4YBZA 1N4AA 2B2CA 1SBHA 4WINA 4LDQA 3OQPA 3O73A 4O2BA 4REOA 1KVUA 2A7XA 3B6EA 1RC0A 1AOXA 2G3YA 4Z7JA 4ZZ0A 2WWRA 3IQEA 3FCSB 4RK4A 3N2IA 1NSTA 2I54A 2W2NA 2AFHE 3ID6C 1GTJ1 1GTSA 5HFAA 3JQDA 3SLGA 1JXOA 5D3ZA 5KYVA 4CLOB 1JU9A 2Q8NA 2VPTA 5TX7A 3LZ6A 4D8XA 3QHQA 3BWYA 5FBRB 2RGBA 3NLLA 1VYUA 1R8JA 4DV5B 1KY4A 1NLZA 1BGWA 3NOQA 2GI4A 3NWBA 5BR4A 1YZGA 4R81A 4QU9A 4WNAA 2BM0A 3V1LA 2W2OA 2WSBA 2CFIA 1OSLA 1IOVA 3R6WA 4EZBA 1FP4A 2YRWA 2PE5A 2Q1WA 3F6PA 4EHKA 2J9FB 4CTOA 1JQKA 3L07A 3BDNA 4EW1A 3TAHA 2QN6A 4BMVA 1F3LA 4OHUA 4D9EA 1VIMA 3D7RA 1GCUA 3KDAA 3F7TA 4FQ8A 1A9XB 1DGQA 4MUKA 1CR4A 4FWTA 1ZN7A 1DO8A 1KEZA 3IQGX 4HDNA 2GNPA 3WDMA 3ZX5A 4ZALA 1T2EA 1XVIA 2D5CA 3PD1A 3QIVA 2PCJA 4IVNA 2Y93A 3OZSA 1XCJA 4OK6A 3KFLA 3M4JA 4M7RA 3KRTA 1J7JA 3LSYA 5IBPA 2V74B 3IC5A 2VQEB 1RI3A 1H2YA 3RU2A 2HR1A 5J4VA 3DQZA 5LSAA 1L5GB 2ZSKA 2XKBA 2DF8A 3OIWA 4NHOA 1MQAA 4D9GA 3HJNA 4EGJA 3H1PA 1IK4A 3REOA 3D1NI 2CXXA 4ZI3A 1OV4A 1ADFA 5HNKA 1AQ6A 2QPTA 2AOUB 2FZWA 4M9ZA 1CUXA 4BQEA 2ZTMA 1DIRA 2IOFA 3U5TA 5BRJA 4IEEA 1NP6A 1UMKA 3T7EA 5AIBA 3BMNB 3GLQA 4PYOA 1VI6A 3H4VA 1WDKA 3OFVA 1NZJA 3P4XA 4JBIA 3KT3A 1BXRA 4FNAA 4NI5A 2RGAA 4H1UA 4MUYA 1MJGM 1OXBB 3I32A 4FJ0A 1SQFA 1B8PA 1GPKA 1W49A 1EFVB 4WE3A 2YN2A 4LX8A 1L5WA 4RIEA 3E3LA 3U4HA 1MO2A 3BTSA 3IHKA 1O89A 1YVEI 1F1JA 4GNKA 5EJGA 5DTRA 2PX3A 3OWQA 4RBNA 5GZ3A 1DXYA 2ZR8A 2ZBGA 3PC7A 4WZZA 1PYOA 1E79D 2XQVA 4OP2A 2CV1A 3PC4A 3DVQX 4MYRA 1J56A 1MJHA 1ZVMA 2YY6A 4YCJA 4D1YA 5BW4A 4ZV9A 3EXFB 5COQA 5J2UF 3SE7A 3GJ8A 1Z13A 4HGRA 4MUHA 2ICAA 2FUG1 3G1TA 4F2WA 4R54A 4FN3A 3A9XA 3K92A 2X1LA 3IEIA 3RC1A 3RVPA 2IVZA 2IXAA 5KJ1A 3QSYA 2I4IA 2GRUA 3KHKA 1REQB 5BUSA 5LU9A 2H54A 4N82A 1ID1A 1V8BA 5T64A 1T1EA 2EX4A 2NQ8A 2OG2A 4OHVA 5JFGA 4HOYA 2GZRA 3GEEA 3IHWA 2BUCA 1L5MA 3INTA 3VC2A 3LFTA 4DJAA 5CJPA 4O4HB