3KJXA

Crystal structure of a transcriptional regulator, lacl family protein from silicibacter pomeroyi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
333
structure length
333
Chain Sequence
b'PLTLRDVSEASGVSEMTVSRVLRNRGDVSDATRARVLAAAKELGYVPNKIAGALASNRVNLVAVIIPSLSNMVFPEVLTGINQVLEDTELQPVVGVTDYLPEKEEKVLYEMLSWRPSGVIIAGLEHSEAARAMLDAAGIPVVEIMDSDGKPVDAMVGISHRRAGREMAQAILKAGYRRIGFMGTKMPLDYRARKRFEGFTEVLGKNGVEIEDREFYSGGSALAKGREMTQAMLERSPDLDFLYYSNDMIAAGGLLYLLEQGIDIPGQIGLAGFNNVELLQGLPRKLATMDACRLEIGRKAAEIIAKRLEDPEAEIETRITLEPKISYGDTLKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LacI family
publication title Crystal structure of a transcriptional regulator, Lacl family protein from Silicibacter pomeroyi
rcsb
source organism Silicibacter pomeroyi
molecule tags Transcription regulator
total genus 90
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3kjxA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kjxA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kjxA02
2D5VA 3KTOA 5CNKA 3FGZA 3JS5A 3CFYA 5DLEA 1E6MA 1LK0A 2L49A 1NXVA 3BDNA 4RK1A 3N0XA 5A7LA 4TMYA 5FBHA 1NEQA 2PL9A 5GQSA 3GBFA 1Z16A 3G7DA 3MQ4A 5TE9A 3HM9A 3LKVA 4XAQA 4W5RA 4MS3B 2IVBA 5K98B 2HQRA 1JL3A 1VLZA 1FFGA 3MIZA 4HNSA 1NXWA 4LDZA 3URMA 1F51E 2CWDA 1RXIA 2WJAA 4TLMB 5JNSA 3A3KA 4I6TA 1GCAA 2IUOA 3KYIB 3KLOA 3BS3A 2E4YA 1RZSA 2QVCA 3CECA 3F51A 2PUFA 1YSEA 3IP7A 5IC5A 1H9CA 1ZGGA 3F6WA 3F6PA 1K66A 4D6YA 4X4FA 3GRCA 1HF0A 2B4AA 2RDMA 4G0XA 4WWHA 4PU3C 4YV7A 2V0NA 1FFWA 4WUTA 4L4UA 3SAJA 1EHCA 2QV0A 1LBHA 4EVQA 4NCAA 1DG9A 4B09A 2JRLA 4KNYA 1NXXA 2L18A 4KK4A 1FQWA 4ZPJA 4IILA 4RKQA 5DCLA 1JLKA 4KREA 2Q5CA 2PIJA 4MR8A 2VUHB 3GN5A 2BNOA 4GHJA 1U2PA 1SXHA 3UFDA 3LUKA 4HYEA 2MYPA 3HJFA 1CQTA 2R4QA 1USIA 4RK0A 1CYEA 2QU7A 4WXEA 4E7PA 2XCJA 6CHYA 5IEBA 5DKFA 4JQDA 1KMIY 4M88A 4RU1A 4MS1B 2A6CA 1RZRA 2HINA 1QKKA 2M98A 2FN9A 2FMIA 4OG2A 3DNVB 4YGXB 2AYZA 3CG4A 3O1HB 4LRQA 4WT7A 2CROA 3CKMA 2O20A 3JY6A 3TB6A 1YK1A 2LCVA 4EYOA 1P6QA 3HDVA 3CHYA 3IP5A 3LUFA 3NHZA 3UK0A 4MR7B 4UHJA 1CJGA 1LCCA 1ISRA 2PUBA 2E4XA 4MRMB 2WB4A 4L85A 3KCNA 3N6VA 3KKEA 3KZ3A 4NICA 3H6GA 4W5NA 3K4HA 5IX8A 4Q7EA 2CSFA 4YG7B 5TQJA 5GOTA 2WRZA 3OMWA 3BRSA 1CEYA 2JVLA 5C5CA 3A0UA 1WETA 1NTRA 1ZH4A 2IDMA 1EWVA 1OCTC 1WIZA 4G0PA 3TO5A 5EWJB 1QP4A 2HPHA 4D6XA 4Z5HA 3I5AA 4JCXA 1MIHA 1UTXA 4LE0A 4RXTA 3CNBA 2P4UA 4TN5A 4F06A 2FSPA 3HUTA 1TVMA 4MQEB 4RV5A 2IVQA 3OLWA 3KYJB 2EF8A 1RPEL 1DC8A 3A0RB 1M5TA 2MYNA 2MSLA 3FMVA 4EGSA 4PU8A 3U3WA 2ID9A 4MR9B 3OLXA 1W25A 3G5GA 3N75A 3QX9A 2MSKA 1DP4A 1DZ3A 3C3KA 2LPMA 4PE5B 1X57A 1IC8A 3LUJA 3E3MA 3JXBC 4F8DA 5ABPA 4MCTA 4TLLB 4F8JA 4RKRA 1C4WA 1YMUA 2JVJA 3SNKA 2F8TA 1SXIA 3T6KA 4RY8A 3DGFC 1RXEA 5BQ3A 2GX6A 3TMYA 3JTEA 4YO7A 4MS1A 5FWXB 1UXDA 2PUGA 3O1IC 4YARA 3O75A 4QPJC 1O4XA 1R69A 3GA5A 4MQFA 1Y1LA 5KC9A 2GRLA 3SQNA 5CNIA 3H5VA 3G1WA 3M6MD 2PUEA 4RSMA 4ZMSA 2GRMA 1B0NA 2X7XA 5KQLA 5JS2A 4HNRA 2IV1A 2E4UA 4KQCA 4MR7A 3Q41A 5KQPA 3O1JC 1ZGZA 4MRMA 3CS3A 5ED4A 2FVYA 4RXMA 3FMYA 2JVKA 5IUKC 5IULC 1P2FA 2OR1L 1E3OC 1D1PA 3EQZA 3LTEA 1LMB3 4ML3A 4LX8A 1LCDA 4N0QA 5D2CA 3SCHA 4W5QA 2GWRA 3FYMA 3C3WA 4JCYA 2FEPA 3HEBA 4G0MA 4JASB 1DW9A 1ZZ6A 4EUKA 2NT3A 4RK5A 3HSYA 3KHTA 5KQGA 1Z17A 2LYPA 5EWJA 2IOYA 3MLFA 3NNDA 4ZJPA 3D02A 3EJWA 1BVHA 3DLBA 1TJYA 1I3CA 1USKA 2PUDA 2IPLA 2NZVG 3IDOA 4MQEA 4ZYLA 3CRNA 3LUGA 3IP9A 1U8TA 3O2JA 1CHNA 3OP9A 4J1WA 1VRVA 3RVRA 6ABPA 3QELB 4S04A 3HUUA 4IGAA 1POUA 4MPTA 5CHYA 2PLNA 4MR9A 5TPZD 3D8UA 2MQKA 3EQ2A 1ZZ7A 2AXZA 4YBAA 3C97A 3GV0A 3H5LA 4IMJB 3SM9A 2I6FA 1JFVA 3QLVC 2N9UA 3QWGA 1QP7A 1QQBA 1FSPA 2KEJA 2NUBA 1S7EA 2PJUA 1JBEA 3CZ5A 4YCSA 5KQMA 1YS7A 9ABPA 1JDNA 1BA2A 4Q6BA 3BD1A 1PNRA 5FWXA 3OMXA 4G97A 4LDAA 3QLVA 1LLIA 2EBYA 4QYWA 7ABPA 1DRJA 1PNTA 1SD5A 3H75A 4YG4A 3F52A 1Z18A 2LBPA 1PRUA 5CNJA 3C3MA 4MGEA 4XARA 2NT4A 4RXUA 2AXVA 2R63A 1ISSA 1BAPA 1D4ZA 1ZHHA 2FMHA 2GBPA 2O49A 4LZLA 2NZUG 4Z9AA 1JYFA 3QEKA 4N03A 1MVOA 2IPNA 3O21A 3QQ6A 4YS6A 5HSGA 3GWGA 3N0WA 4NV3A 4RS3A 1GCGA 5E3JA 4EVSA 1ZAYA 4MQFB 3I09A 1A04A 4EYQA 1YK0A 3QX8A 3A10A 3FDFA 3LMKA 4H60A 3SG0A 4DQDA 4UHKA 2F8SA 1M5UA 4W5TA 1JDPA 4Z59A 5DTEA 3IPCA 3HO1A 2MEZA 1UXCA 4PEVA 1RIOA 2QVGA 4Z4CA 1DCKA 4O1HA 1XHEA 4DN6A 3IP6A 1M2EA 3KSMA 1VKRA 1URPA 4WZZA 3W9SA 2FTKE 2CHEA 2HQOA 4O1IA 2FQYA 3O74A 3RQIA 2AWIA 2B1JA 3HZHA 1Y7YA 4HNQA 1Z13A 3I42A 3QELA 2XSDC 4ETIA 4FN3A 3LKBA 1Z25A 3UKJA 2QXYA 3CZCA 3JPYA 4NCBA 3SCFA 3HVRA 3QK7A 1MAVA 1DBQA 4G0YA 4O5AA 1LJLA 4YG1A 2HQBA 2E4WA 3EULA 1D1QA 1TLFA 3OLVA 5HM6A 2IKSA 3FFXA 4EY3A 1LJUA 1GT0C 2VUIB 2ZAYA 3NBMA 1RPJA 2IU7A 5BR1A 2MYTA 2PAFA 3C6QA 2LYJA 2J48A 3JPWA 4WXMA 1APBA 5EWMB 2JVIA 1ZPQA 2IPAB 1OXBB 2L2QA 4YLEA 5T3YA 3RVMA 5BRAA 5C5EA 5IUNC 1USGA 4XLTA 4X4HA 4YWHA 4IA8A 2ID7A 1R8JA 2JBAB 4IVZA 4KPYA 3CTPA 4Z4GA 1EWTA 1DJMA 1JHZA 4CBVA 3H1FA 4XXHA 5CNMA 2PE5A 4KFCA 1U2QA 4I6UA 1KGSA 1W9HA 3O9XA 3GT7A 1QO0D 3RVKA 1ABFA 4EYGA 2A9QA 1JFTA 4GQMA 1OSLA 1ZZBA 3H5IA 2KEKA 4RK7A 1P8AA 3R1FA 3HK2A 2PUAA 1JYEA 4Z4FA 1GUDA 1DCFA 1FFSA 1PRVA 3T38A 1SRRA 1JWLA 2YHAA 3Q7RA 4ZMRA 1NY5A 1PRAA 2PPXA 3UUGA 4XASA 3KJXA 4PU4C 2FLWA 3RVOA 4Z4HA 3Q7SA 5JNVA 1NXPA 4KVFA 4IRXA 2GZUA 2O38A 1E6LA 1ZZ8A 1XWRA 1ABEA 1YS6A 2GKGA 2FQXA 2OENG 2FMKA 2QSJA 3EODA 1QNLA 1PHRA 3H5OA 1R63A 1A0OA 1JF8A 3O2SB 5JNUA 1U04A 2CHFA 4OLBA 4G86A 2R48A 3BRQA 4G0QA 3O2QB 3H5WA 2XI8A 5IUJC 3MMNA 4JA2A 3HCWA 2FQWA 3BBLA 4MYRA 3RZZA 1P6UA 3R0JA 4FB4A 3F73A 1YTUA 4GPAA 2BNNA 3H5TA 4MAAA 4PZ0A 4IMIB 2KEIA 1D2AA 3LFTA 3S99A 2QZJA 3B2NA 3MM4A 5FBKA 1ZZCA 1DBWA 4H3HB 1ZDMA 4X4CA 2JCGA 1PERL 2OFYA 1Z15A 1ZS4A 4X4DA 1MB3A 1YIOA 2VYCA 3DZDA 3K9CA 3L6UA 4OATA 3HZIB 3SY8A 1OXKB 4H3KB 5EWMA 4KRFA 4G0ZA 2M1ZA 3ZHIA 4F12A 2AXUA 3FFWA 1Z26A 4JB0A 3TD9A 1AB5A 3M9XA 5JNRA 4Z99A 4NQRA 2JBAA 4G0OA 2VK2A 2LYQA 3ROTA 3VNAA 2R1JL 2FN8A 2LUOA 2OQRA 3HV2A 1WH6A 1L5YA 3KLNA 1NATA 3QLTA 2QR3A 5DGCA 5EWLA 5TPWB 2RJOA 3GBVA 1NERA 3L49A 3LUHA 4MS4A 2L8NA 1GLGA 3JXDL 4X4IA 1D5WA 2A9RA 3ROFA 3IVPA 4KQ9A 1ZY2A 2PMCA 3B7HA 4Y42A 4EYKA 3RVPA 3EGCA 1WH8A 1C0EA 1DBPA 3OLZA 4N41A 2B5AA 3OQMA 1UDRA 2KYRA 3QF3A 3Q15C 4X4GA 2YHBA 3LUAA 3QEMB 1QP0A 1KRWA 1DWKA 4W5OA 2FW0A 4Z58A 3M9WA 1QO0A 3NNNA 1BDJA 2AW6A 1TM2A 2XDYA 4LE2A 3OM1A 3LUCA 1ZVVA 1JH9A 3H1GA 4RDCA 3RVNA 5I4CA 3CROL 1Z12A 5TQ0B 5FWYB 5BRJA 1YMVA 4FE7A 4O8BA 5PNTA 4F3TA 4FE4A 5TQ2A 4YRZA 2FJRA 2FXIA 2R25B 3P9YA 4OTZA 3CLCA 3VK0A 1M2FA 1MB0A 4PICA 1ADRA 3ILHA 2KPJA 1NXOA 2FEWB 4P98A 4X4BA 2P9HA 2WY2D 1J56A 3F6CA 3JXCL 4DADA 4PYRA 2RGYA 1ZUGA 1NXSA 3N8IA 4RZSA 1QPZA 2BGGA 3D1NI 1GUBA 3OQOA 2GI4A 3LUDA 3QLUC 1HEYA 4Z4IA 3ZHMA 5HKOA 5IEJA 5B3JC 2MYUA 1DRKA 4QYMA 3T8YA 3KG2A 1PUXA 1X2LA 2A9PA 1SXGA 2FMFA 2ICTA 3CU5A 1EFAA 3Q7TA 1QQAA 2AYXA 4YR7A 1SQ8A 4MLCA 1AB6A 3TRBA 1S8NA 3QLUA 3TX6A 3LFPA 1ZN2A 2WMYA 3RVLA 4ETNA 4Q6WA 5B3JA 1VPWA 2IYNA 5TPWA 2E4ZA 3OO0A 4LE1A 3QYXA 3L1PA 2QW1A 4Z5DA 3H6HA 4KMRA 3FYAA 1XWWA 3DBIA 2BJCA 3ZKCA 2LYRA 2WWVD 2ZWMA 3Q9SA 1K68A 1JFSA 2JB9A 3S8QA 1L1MA 2WJWA 3T95A 5KI6A 4J1XA 4FBIA 4OB4A 3NHMA 1DCMA 1LBIA 4KV7A 5TPZA 3HS3A 4N0PA 3LISA 2HSGA 2IVGA 3N53A 1Z2DA 4IF4A 5F64A 1EAYA 1L5ZA 3CLKA 5IBQA 1T34A 4Z9BA 1KRXA 2RJNA 3BREA 3OMTA 2ICPA 3QEMA 3N0RA 3GL9A 1A2OA 3JVDA 4MS3A 4I6RA 4OBBA 5KWSA 4D74A 3OQNA 1RNLA 2FLKA 2LIVA 4QICA 5EWLB 2XJ3A 3DGEC 3GYBA 3EUSA 1ZESA 4MS4B 3PXPA 3RH0A 3MA0A 1ZH2A 2WIUB 1B00A 3FFTA 3OLYA 1Z2EA 4JB2A 1AU7A 4I8TA 4P1ZA 4RY9A 5TQ0A 2JK1A 3HXMA 5FWYA 1BDHA 5JNTA 2LYLA 2HJ9A 2BNMA 3ILYA 4MCXA 4Z5CA 4MLDA 2L17A 2LYKA 2PKXA 2LYSA 4JP1A 3LOPA 5JS1A 1F4VA 2LP4Y 2R47A 3KS9A 1JX6A 3HDGA 1IIBA 1QMPA 1Y9QA 2PUCA 2FKAA 4JOQA 5KC8A 2H3HA 2IPMA 1PEYA 3G85A 3RVSA 3DLHA 1ZITA 4Z0NA 1TMYA 2XIUA 1XHFA 3IPAA 1PEAA 2WUSR 2AUWA 2KZ8A 4RK6A 5TQ2B 4E7OA 4YP9A 4N47A 2FEKA 3BILA 3GBPA 2W42A 3KXAA 1YVUA 4F11A 4X4EA 3EAFA 2O4AA 2TMYA 1E2BA 1RZRD 2A9OA 2DRIA 2MSWA 2L19A 2PL1A 5JNWA 4JAVC 3MF4A 3GN5B 4MR8B 4RWEA 1BDIA 4PU7A 3JVIA 4OLAA 2H0AA 3F7NA 3E61A 4KK3A 3EDCA 3VNBA 3OM0A 4Z4EA 5HQJA 1U0SY 4EVRA 2CD7A 3RVJA 4IWRA 1NXTA 1DC7A 4NDWA 4S05A 1LQCA 4RK4A 3MYYA 4RY0A 4ETMA 1ZZ9A 3SCGA 2EWTA 3NNSA 4N76A 4KZKA 3CG0A 4XFKA 3RVQA 2H8RA 4GNRA 2E4VA 1EWKA 3H1EA 3OO1A 3I45A 8ABPA 4Y9TA 1E6KA 5T7BA
chains in the Genus database with same CATH superfamily
1V4VA 1BO6A 1C0KA 1FRQA 1WIWA 3ESQA 4NQZA 4F1JA 5H9WA 3RDPA 3K4QA 5AW9A 1ZW6A 2PCJA 3QXJA 5DLEA 3TYXA 3UH1A 3GUCA 5AM2A 1E99A 2L49A 4M7WA 4IIVA 1N9ZA 4AS2A 4BWGA 3BJRA 1U9CA 2FPOA 4JLNA 1QG4A 1Z36A 3RKSA 3H9JA 3PYLA 2QUKA 4XAQA 3W2HA 3EFHA 4DJ5X 3O0TA 1ENPA 1RI1A 1RXIA 1WUKS 3WLJA 5JISA 1P1CA 1F5NA 2EL9A 4Q4JA 5FBRB 1JDBC 2Y1XA 4BX3A 3ISJA 3OZUA 1WSAA 1R0XA 4FBGA 4JA0A 1ISGA 4J0GA 3VH3A 1XPJA 2JGDB 4GPZA 2A8YA 3M1AA 3UJ7A 3CH4B 5BUQA 4AJ9A 1EFVB 4Y6GB 1T2EA 4G81A 4ABYA 2RDMA 1AU9A 2VBIA 3C7DB 4MRSA 1A9PA 4E94A 3DVLA 1I3LA 1VHDA 4C4RA 1AMOA 3SR4A 1AGPA 2L18A 3KR2A 1Z2AA 4YJHA 1JLKA 2B5WA 1ZGCA 3VDXA 4TSRA 1AKYA 4OV6B 3R7SA 3A1NA 1KVQA 1NUUA 2TMDA 4JXJA 4UM9D 4ESOA 5BN3A 1SEPA 1D2EA 4ZYVA 1YC2A 3GRAA 4U39A 3VHQA 6CHYA 4JQDA 1S9HA 4KBYA 2J0VA 2GDJA 2VAMA 1BU5A 3ZWKA 3V7YA 4PC1A 1PHPA 1U81A 2C94A 2XNDD 3JSXA 4CL3A 3KEMA 2CCGA 4MUJA 3QKSB 4WZAE 5F4BA 3FH0A 4BVGA 4EGAA 5TT0A 3CWCA 5EE3A 3V2HA 2JKZA 2LCVA 3WB0A 3GG2A 3C4QA 1P6QA 4JLVA 4EK9A 1ZYUA 4U7PB 2PH3A 3E9DA 2Q41A 4FWTA 2D2XA 1TX4B 1W0KA 2BLLA 1OAAA 4K6KA 6NULA 2B7BA 4J7CA 4TWRA 4R5MA 3KZ3A 4TRNA 4DC1A 3ED1A 2WMOB 4W8HA 3SYTA 4AM8A 1F2UB 1H8HA 4O2BA 2D4AA 4MHSA 2OORC 2WRZA 4DDWA 4ZIRA 1CJUC 3RAGA 4C0BA 3RU3A 3LT1A 5KDOA 2DPLA 3CJTA 3EXHA 3TO5A 1XG5A 3MBIA 5K05A 3KYDA 1K5PA 4R2JA 2Q7DA 1MNQA 4D0LB 2CLMB 4EJ2A 2AFVA 4ZWNA 3NEJA 3DZGA 4M1MA 4F06A 4ZKDA 1AKQA 1TVMA 1SHLA 3OFVA 3P9QA 4LNAA 1X7WB 4XDYA 2UUBB 2WQZA 1NDQA 2IYFA 3KYJB 3OM8A 1ORTA 4PZDA 1Q0PA 4S1PA 2SNIE 4D3DA 1CE8A 2MSLA 1WEKA 1XQWA 2PANA 5KUTA 1K6IA 3Q72A 2P2NA 3OLXA 2C7QA 3QENA 2ZBVA 3B5IA 4M53A 1DKNA 2L82A 3LRPA 5JSUA 1UBGA 3ZWOA 5AXCA 3GH3A 1GCIA 3KUXA 3CLRC 1H94A 4I7EA 2IRWA 4EKEA 4I9FA 4GR9A 2WTBA 2JVJA 4OY3A 4FMCB 3CUWA 4X1KA 4R1OA 3U4MA 1WDKA 4L3VA 4C20A 5A6SA 1L5VA 1Z0ZA 4HN4B 1CIVA 2GX6A 1KBOA 4GYYA 4CDNA 2A1TS 1JDBB 2ZDQA 1SCQA 3ETGA 5LZ5A 3TXXA 3GA5A 2FP4A 5HKBA 3L8CA 1UFVA 3H5VA 3V4FA 3VU1A 4EQ6B 4XRRA 4EABA 3DE5X 1G5RA 1AQNA 2Q45A 3FAZA 4Z51A 1FZQA 2X7XA 3CB4A 3V1TC 5IFLA 1SUIA 1EGHA 1NPTO 1HETA 3C8HA 3P32A 3GDFA 3OCJA 4L78A 1K5HA 2CFOA 2XUHA 3LTEA 4J7UA 4QD3A 4LX8A 1PBNA 1IPFA 1WA5A 2YJ4A 3GHYA 5BYKA 5FOUA 1D04A 1DXQA 3GN2A 3AR8A 1PUJA 3RIGA 3AUUA 3NNDA 4KU4A 3PIRA 4LGVA 2IV2X 3C1TA 3I8XA 2W2LA 5BYAA 2CGEA 1SZCA 3QV2A 4E14A 3GY0A 1GL6A 1OUMA 2YZ2A 1I30A 1QIEA 3K15A 4DR4B 2VNSA 4F97A 1IBKB 1D4OA 1DKRA 3ESBA 3LXMA 4IV0A 4D41A 4E4YA 4C0WA 4S04A 4UM8B 4IGAA 2WDZA 3MNFA 3AO0B 1GAEO 2I7CA 2VXOA 4MCIA 1MXHA 2GPAA 3EEOA 1DQYA 1T8WA 1JXAA 3TZHA 5DIZA 4RTSA 4B34A 2B0CA 4CEIB 4AIRA 2V4ZA 4PHGA 1NPDA 1RRFA 1U1EA 3OCZA 1QLWA 5K51A 1OH7A 4GAEA 3LYUA 4UPDA 1FX1A 4R3UC 1TAGA 2ZFUA 1CNEA 1IBSA 4G2NA 1JBEA 1Z56C 2G9ZA 4PS1A 2VJLA 1Y6ZA 2YFQA 3A06A 4LDAA 2TYSB 2I2DA 3AEKA 3P27A 1EK1A 1CJVC 1BVYF 2YS6A 3RAJA 2FA9A 2EQBA 2XNKA 3OA2A 4MRPA 2FWBA 1MT0A 4N0EA 4XARA 2NT4A 3F0TA 4UUBA 1II0A 4CRWB 2BUCA 3MXTA 3PX2A 4RX1A 4UZFA 4B6PA 1I2DA 2FPWA 4ZO7A 4XRGA 4YAUA 1JDVA 2NZUG 4N03A 5BSTA 2Z56A 1AHHA 1FYVA 1QR6A 4YROA 3N9IA 1HBJA 1RHKA 2Q3MA 2XRMA 3MMZA 3STYA 3MG9A 1OWLA 3NHFA 1P2UA 3PQFA 5H9VA 2YRXA 4EJMA 2A5FA 2AXEA 3JQQA 1N57A 1GZHB 2JHPA 2JLYA 4WBNF 5LXTB 1TO6A 3MJCA 1M5UA 3A6ZA 3BD6A 3FVTA 4KOAA 3AEZA 5LJLA 4NESA 4WINA 4GP9A 1XOIA 2ZJ4A 4WZZA 2OHJA 4YMUA 2E5LB 4O1IA 2X0JA 1MAHA 1DO0A 2CDRA 4ZTUB 4C05A 2B1JA 4G09A 4LY9A 2HJHA 2VP2A 1LDMA 2AOUA 1YOVA 2QVBA 3A9TA 4LSZA 1FDSA 4NV1A 4YAJA 3LKBA 4YREA 4B44A 4E0BA 1W7AA 1GEEA 1U3VA 3G7NA 4AN4A 4D4LA 3ND9A 1DBQA 3GOQA 4G0YA 4N40A 2XYVA 2AFIB 1T0JB 4EW1A 1D1QA 1E2UA 2FRVA 2ZTMA 1WCYA 3A6FA 1JR2A 3EZGA 3FG9A 3GMIA 2QTTA 3IUBA 3LDGA 3MOSA 3P2JA 4UNPA 4BMPB 1U1IA 1NVXQ 1N2CA 3TQTA 1H6DA 3QW2A 5JTTA 2GNPA 4EPTA 3KD3A 2UDPA 2OR3A 4Q16A 1NJ8A 2FF7A 2L2QA 1KARA 2VJYA 4J4HA 3X1YA 1R6VA 1O8CA 1ZVMA 2NN3C 1CPYA 2F3QA 4RACA 2IHVA 2BZGA 3FVQA 3C5VA 3UYLA 5HMMA 2OOSA 1KWGA 2UZ1A 4NULA 5AKJA 1CS4C 3K6SA 4NVRA 4C7VA 1S4QA 4LXGA 4IS2A 3VAZA 5D7BA 1Q0RA 3AY0A 3VV3A 4RYDA 4XOIA 1LLDA 1W34A 3BTSA 3GFOA 4ILEA 4X54A 1SVKA 2GZSA 3FD8A 4Q82A 4AO8A 3I9V6 3H5IA 3JATA 1XD9A 1QG2A 2YY6A 5ER9A 1SCKA 3NH6A 2XF2A 2VA9A 4PPFA 4FTWA 1IWOA 1W96A 2J0UB 3K0HA 1JWLA 4QUHA 2KBFA 2BR3A 1XMSA 5DHRA 1P2GA 2ZSBA 4B74A 2FLVA 4C2BA 2ZUCA 4A27A 1QVWA 4URXR 4AYXA 3GR6A 3PLNA 3AYXB 3IBCA 4K9LA 4EMSA 2O59A 2DQYA 1BXRB 1TTHA 1PWHA 3HPQA 3PFKA 2Z30A 3SHWA 1X80B 1Y5LA 5I7VA 721PA 1CJBA 4OJMX 4XX0B 4IIFA 2QXTA 1MX3A 3W78A 5AUPB 2JATA 3ITKA 3R0JA 2GD6A 4MIOA 3PUIA 5A0FA 4I46A 3ROXA 1T29A 3TQSA 1T9KA 5GADl 3W04A 2NQTA 1HL7A 1LZKA 2Q4TA 2WG0A 3IT1A 3GUZA 4RM2A 3T34A 1XEFA 2A67A 3PQ8A 2B4TO 3C5WP 1QZ3A 4Y7DA 2AMFA 4Y2XA 5DCYA 4BU1A 1DSSG 1ZOLA 2KS6A 3DOCA 2IWRA 5BVHA 3IEMA 1E6CA 2RHMA 4LISA 3DL7A 1PNOA 1W52X 1RXCA 3U0VA 4JVLA 1E1LA 1VE6A 2P3OA 1IVYA 3FX2A 3K0BA 5FLXA 4LXXA 3TL6A 3P20A 2GETA 2WZBA 1KMHB 2BBWA 1KMMA 4B3HA 1V95A 4DCNA 1JNYA 4DZZA 1O57A 4AN0A 1NYRA 5BN5A 1OBOA 1WS6A 1XQVA 1ZXLA 3EARA 3SHFA 1XEXB 1NC1A 3JARA 4OJTA 4ZAZA 4X4IA 1LU9A 1QGDA 5HCIA 5JZVA 2VKQA 5IT0A 1U63A 4KQ9A 4I3FA 1NVMB 4Y42A 4IEEA 4PG5A 2R00C 3OCXA 2Z57A 1R0BA 5B4UA 5JU6A 1DIOB 5J4VA 1JIQA 2G8LA 4G9BA 4B1FA 1GQ2A 1FJ2A 2HXYA 3UMFA 4RTRA 1ZMXA 1HK7A 1WE2A 2V6IA 5G1OA 2EWVA 2GF9A 4YUXA 3H05A 1HWYA 3VI3B 1KZGB 1KH2A 3CH6A 2W37A 3L4BA 2O3TA 1MAAA 3WV5A 3WGNA 2Q29A 3AIIA 1ZVVA 3ZDAA 1E3TA 3Q0TA 4F3YA 1N78A 4TROA 3WL6A 2IZOA 5LQNA 1AOXA 3OJOA 3BS4A 4FT2A 2BFAA 5FKJA 2CSXA 4YRZA 1WOYA 5LQSA 4LF4B 4DM7A 1RFGE 2JQEA 3COZA 2VXYA 3FPFA 1WBJB 2BR4A 3STUA 3F6CA 4EPYA 1GLVA 1B14A 1DNPA 4RZSA 1FXUA 4KZPA 1N5DA 1N8TA 2G5GX 4BQPA 5LNK6 1YB2A 1BHQ1 1C41A 2V7EA 1N2OA 1QRDA 3QEAZ 1X9IA 3P4UA 4G41A 3SE7A 3VR5D 3H0CA 5HCUA 2EZ9A 2XCQA 3KZVA 4FJ0A 4IIGA 5JATA 3FSGA 1YJBA 2PL3A 3IEIA 1NI4A 3I9OA 4N5MA 1L5RA 4LSWA 1SQ8A 4OLFA 1JN0A 5F9MA 1WMEA 4NCIA 4ZP1A 2I76A 4H6VA 2MDTA 5ALHA 1VPWA 3N2YA 3AG5A 2FSHA 1U2GA 3E1GA 4LE1A 3PIIA 1GY8A 1Z83A 3R9XB 4KMRA 1JHQA 2I22A 4JIGA 4MTCA 3I6IA 3ZKCA 2C5FA 2B94A 3UV7A 3II6X 2X5NA 2B92A 3HY6A 2N47A 3EGVA 4F2DA 3SLGA 3ZCXA 5DNUA 1L3IA 4CIAA 3H4VA 4YJ2A 2ZETA 2PG3A 3B85A 3IDFA 4ND1A 5A5FA 2PRJA 1KFKB 1QRRA 4RUKA 1PZGA 4UEOA 2OMKA 3MJRA 2FX5A 2V0CA 1PZXA 1ZOOA 2X0NA 3RJTA 4I1IA 5JSZB 4DUGA 2IHJA 1GSHA 1LDNA 4N5LA 2AVNA 3LPMA 4HJXA 4XE5A 1CY2A 1SXPA 1RE1A 4JUFA 5FPSA 2P67A 2R62A 1R27A 1WXWA 3IX7A 4UUQA 5G3ZA 2CHUA 3RH0A 3FCYA 3M8KA 3GNSA 5G2OA 1BJRE 5CB8A 2VDKB 4BO2A 4FCCA 1RABA 1PFKA 3PBKA 4WA7A 2HJ9A 3PB3A 4X1IB 3KALA 1ARZA 1F60A 1WBBA 2OVBA 3D1VA 1QIGA 3T7IA 3LJKA 1W5FA 1Y6RA 2CNKA 3MPOA 2A0WA 4U7HA 3ZKWB 1H3NA 1KI9A 2GDZA 1FSSA 4JMPA 3MD0A 4XCXA 1MABB 1QUEA 5J9FA 1JZTA 3OOSA 4MUYA 3GJ4A 7MDHA 1GADO 1JBKA 1IWBB 1P5ZB 5KC8A 1PWZA 1GSOA 1Q16A 2ZSUA 1GV0A 1B1CA 1Y7TA 3OTGA 4WOPA 4F6CA 5JXWA 3EXFA 3IVAA 3N2IA 3F2VA 5DHAA 3I2JA 3K5HA 5JAOA 1WVGA 3L06A 5C4MA 2GNAA 3BILA 1QZXA 3MJVA 4A6PA 5REQB 1NU8A 1L4EA 4BBAA 2VQFB 4YMHA 1S02A 1E2BA 3HDYA 4R68A 4WUVA 1UC5B 1X7ZB 2ZRDA 2PL1A 3OPXA 3M9LA 3ZXUB 1F4LA 1O6ZA 4IVPA 1ANKA 1BDIA 1Y1PA 1NR7A 3JVIA 4EOGA 1OZFA 2F3SA 1P62B 3A1UA 3E3AA 1OZ0A 5C35A 3LQKA 2REQA 3UK7A 4CN9A 4J3NA 2X5OA 4G37A 4MAFA 2C98A 1G98A 1GTMA 1PR0A 1Q5PA 3OCWA 1Y1QA 3KVVA 4KQFA 4OGLA 3RVJA 5SZJA 4AMVA 4CMCA 4E03A 3EDOA 4FR5A 1ICIA 3TTYA 2MTBA 5GJWC 4R6WA 5CVJA 3AVVA 1XTJA 4UU0A 1Z29A 2C99A 1LLFA 4ITRC 3FOZA 3BMNA 1LSUA 3NYWA 4IDCA 4M89A 3DA8A 2R87A 3RUEA 5GJBA 2B4KA 4AKSA 3SYLA 3THXA 1NDHA 2QLMA 2VWPA 1F48A 2X1HA 4QG3A 3L8ZA 2A14A 4GRDA 4MI9A 5AT1A 3EIFA 4RK1A 5A7LA 3WL7A 1SD2A 1SIWA 3WS7A 5A4MS 3P9XA 3HM9A 2WPNA 5LKRA 3QI7A 3N2LA 2FZLA 1MFPA 3GZCA 1CEQA 1NVEA 2CLCX 3C1UA 3F9IA 4KQXA 4Q1EA 3AZPA 5IJAA 1JH8A 5JE8A 4URUR 3D8RA 3A3KA 4LQDA 5LQKA 5EMKA 3VR2A 3S8EA 1H9CA 4OFWA 4U7WA 5HKAA 1ZVKA 2NUPA 2HEGA 3FOEC 1GPH1 1D4AA 4IDDA 4K9SA 1U9YA 1YZVA 4KN6A 2Z5VA 3KQTA 4MMXB 4QGGA 4BYGA 2G04A 2VPQA 3A7DA 3SX2A 3TOZA 2R66A 2WTUA 1TUBA 3N8HA 1A95A 2XAAA 1K6JA 1RJGA 3BIJA 5CVUA 4EI8A 1U7DA 5D85A 4IZ6A 1ZIPA 2X9NA 4BQOA 3M89A 3RYFA 3R0ZA 1GPKA 2HYDA 4FONA 2BM1A 2VUUA 1CQTA 4REMA 4C3UA 2V6GA 3BN3A 4FMBB 3OJEA 4HAWA 4GF5A 3RQSA 1Y4AE 3LNTA 1WD7A 1HMPA 2LRHA 4M98A 4PSVA 1M2VB 4MEAA 1NG1A 2QR2A 3TIXB 3UUFA 1GFSA 4Q21A 4WESA 3VU9A 1XZBA 4BQSA 4YT2A 3GRUA 5JROA 5KX5B 3N2GB 3LBAA 1K3UB 1V41E 4D9FA 5F1PA 2ZVQX 4M36A 1UJ5A 2DT8A 3OTQA 2UZ4A 3PC3A 5DTMA 4DY6A 2OAQ1 2R68A 4KR7A 1AM4D 2DUJA 1K7SN 5LQRA 1C30B 3NHZA 3UWMA 4MR7B 2JFHA 1GD1O 4IHJB 3N8KA 4PG4A 4EX7A 4M7OA 2E4XA 2I7VA 2YZKA 3A1SA 1Z73A 3L9XA 4KXYA 4BMSA 3T3NA 2F9LA 1XTZA 2X6RA 4QECA 4GC9A 1S8AA 5EKTA 4FWBA 2LIPA 5J2TA 4MYTA 3HI6A 3OFJA 1L4BA 2GGSA 1EG7A 1N3IA 1Z9BA 1AN9A 1WETA 2OGUA 1XE3A 3AR6A 3DQPA 4G5GA 1GR0A 4LDPA 3DV9A 2CKDA 1SB8A 1YQTA 1L7PA 3V1KA 2H5IA 3SJ7A 1QYWA 1E9EA 4Z53A 2JNWA 3OIDA 3I5AA 4O0MA 4P3KA 4ZYUA 3RYHB 1UTXA 4LE0A 5IS2A 3S1LA 1N5MA 4YRTA 5AVWA 4J6EA 4BAGA 4M60A 4RV5A 5KTPA 4K3UA 2WIKA 1R8XA 3L8MA 5K0ZA 3TW8B 3CLUD 1EFDN 3OLWA 1NOIA 5AM4A 3N0TA 5HFAA 2BKUA 3U9SA 5LDHA 2J4FA 2MYNA 5DNYB 4X44A 4XWWA 2C29D 4OBMA 1U4OA 1CRPA 3COSA 1W88B 2CFRA 1GL9B 1I13A 5EHNA 3QNUA 2E18A 1EFRD 2Q8QA 2WZDA 2P6UA 3RS8A 5BUSA 2CBGA 4U7FA 1SG9A 1SH7A 1XEWY 3HR7A 2ZTHA 4Y8VA 4TRMA 3LVBA 4JKIA 2HEIA 4LWZA 1DBRA 2IWHA 1NW5A 3CXRA 2CDCA 4J7AA 4MS1A 4QDZA 1JWBB 3P9ZA 4P3YA 3RKUA 4E12A 1E5LA 1SKYE 1R69A 1JQ3A 2NZ2A 4R0NA 1A2BA 4MDHA 4URWR 2IH5A 2II6A 3UT5A 2I2WA 2XMRA 4DLZA 3ZCRA 3H4MA 5G4KA 2WYVA 4BBZA 2GRMA 1B41A 4GX2A 1Q0HA 2W2VA 2E4UA 4KQCA 5DIFA 2DUNA 4UOZA 4M8LA 1SUAA 2VPTA 2GPJA 2O1XA 2RGDA 2RGAA 5IUKC 1OH5A 2D59A 4KN5A 2EQ5A 4KXFB 1D1PA 1GNLA 1HQKA 1ENZA 4NZYA 1H6CA 1VG0B 4KQWA 4LBZA 3Q8XB 8ADHA 3GH1A 2VP0A 5IBPA 2IH4A 2CXNA 3R20A 4MYHA 3K70C 1QE5A 4J1SA 1QF6A 3HVUA 1CUDA 1OREA 2OC4A 3IA2A 2WAOA 3PQ5A 4LXQA 4ZI5A 5BT8A 5HRUA 4BRZA 3NGXA 4HYYA 3NX4A 2AF3C 4ME6A 2C5LA 4AX4A 4OB8A 4ZQGA 3K9FC 1M1YB 2RAUA 5CDUA 3ICQB 4P0TA 5E7QA 3C6BA 1A8SA 2ODQA 3ICCA 1Z22A 2WVGA 1W4AA 2XCUA 5DNVA 3DT8A 4NSNA 2H92A 1CZKA 2FSVC 4B43A 1XMIA 2QPTA 2JLUA 2Q0SA 3HN2A 3THOA 2A0FA 4W82A 2F3PA 2QENA 3SZOA 1G9TA 3O4RA 3HU1A 2CXQA 4QTXA 2O2XA 1XK7A 2AG0A 4N7JA 1KP2A 1BX0A 3TIIA 5EQTA 3A6GA 3WNVA 4EKYA 1C3JA 5LP6B 4HSEA 4RFLA 4QPPA 4UUNA 1MX9A 1DTEA 2DR3A 5MHTA 2QGNA 2ZI4A 1CUJA 1X1QA 3OMXA 4YDHB 3VZCA 4CLDA 5B7QA 1OF1A 4MV5A 4QYWA 4RD4A 5IASA 1RMYA 1DRJA 3QMWA 4R3NA 4A8PA 4IQ0A 2FOIA 3B48A 4PLWA 3LBFA 1ZNZA 3ZHCA 4WXHA 3G0CA 2LBPA 1UWLA 4NEHB 1IG0A 1NBMD 3NHUA 4ZVUA 3AZOA 1M0WA 4DCCA 4I9GA 3IVRA 3VGJA 4U5QA 4KDCA 3UA3A 1GLNA 5CBPB 1AG9A 1O5TA 3C2QA 3UMVA 3QU5A 3PRHA 1ZSYA 4D0RA 1E89A 3W9BA 4EA7A 3KM0A 2ZJAA 5GZ3A 4V2UA 3PTLA 4X92A 1XZ8A 3RFVA 4HYQA 4PZUA 2ZE5A 2J9GA 1M7BA 2Y1WA 4RF3A 3JQ9A 4TOIA 2HY7A 3LQFA 3OX1A 2NUTA 4ENVA 4TYYA 4Z4CA 3CEJA 1G6OA 1L7BA 2QTLA 3TDMA 4AN1A 2XT6A 1RZ3A 4YRLA 2C0PA 3FWNA 3UY4A 1RWBA 4BRUA 2X8JA 4GM4A 2ZWPA 4ZO9A 1DOAA 4RH0A 4ETIA 2FR1A 2GXUA 4AK9A 4L6CA 3H3XA 1I7NA 4CM4B 4YMLA 5AKIA 3QPCA 1UFKA 3ZHQA 1L5FA 1T1GA 4FHZA 1CR4A 3IKVA 5G0VA 3MHTA 3E8XA 5J59A 4CXMA 4EIWA 1JSRA 1U0OC 1UM9A 1V47A 2WJ6A 4M7RA 3U7QA 3IH5A 2D3WA 4K81B 1OVGA 1OFGA 1MC8A 3OE4A 4B2PA 3ZCUA 4DQVA 5B4TA 3QVTA 1MHPA 1ODFA 4ALLA 1FS4A 1QIKA 1NDUA 5AVUA 4UEQA 3MJ4A 5T3YA 2YTZA 3RVMA 1Z5UA 2Q5JA 3GDHA 3LZCA 3PC2A 3PXAA 3MVEA 4Q24A 2BLNA 5EJGA 4AY3A 4C0KA 4W8GA 4KPYA 1J8FA 1R8JA 4DAEA 3KAKA 1HFKA 2X41A 3D3WB 3NTLA 4NYJR 1IQUA 1GA6A 2ZROA 2ILVA 4O2AB 3VKFA 1G60A 3ZZ1A 4BNTA 5HGXA 3TIFA 5ITZA 5F5NA 4YTEA 1P7ZA 4HUQB 5IVKA 1NJ5A 2Q5LA 2W4IA 3H18A 3IMKA 3BRCA 1PDOA 3SC3A 4KXUA 3MUOA 3WBFA 4CG0A 1RJ9A 1H5NA 1WXHA 4JUAA 4NBTA 1MG0A 1U98A 3AOEA 3BWYA 3NR2A 1P3JA 1HRDA 5BV7A 3OQIB 3WKEA 4YJFA 3EMVA 4CQMD 1OBHA 5JQGF 2VRWA 1G41A 1M2NA 1YDHA 1DRUA 2Z3WA 4I50F 1O7JA 4DCUA 4F56A 1NLYA 1R37A 2G83A 3RVOA 4CR7A 3Q7SA 3CUKA 2Q6LA 3DWIA 4BO6A 2R8EA 3KR0A 2WBLC 2WKRA 3GP5A 3S2IA 4A0SA 4C4ZA 5A5EA 1WOMA 3ML1A 5ARBA 1JSLA 5C34B 1L4NA 3CX3A 1GGEA 2TSYB 1XLUA 3O2SB 3AINA 3AVQA 3R3JA 4HGOA 3K1ZA 5I7UA 3E2IA 4N5HX 2VWQA 5E6UB 1V25A 3AUYA 5FL7A 3VJKA 5CJJA 5J2UA 4Q7LA 2EKQA 1PT6A 3A9UA 3AF3A 1ICEA 3DQZA 2I4MA 3JVUA 1IBCA 1EX6A 4AKTA 3KJIA 5JZ9A 2QN9A 1RWNA 3IFSA 1B42A 3MM4A 3QI2A 1U2RA 5FBKA 1ZZCA 4RDXA 2OV4A 2Z4RA 4DOMA 3GHHA 1LCIA 1X13A 1NQTA 2GTHA 3WAKA 3H7AA 1ACMA 1PERL 3IUEA 4L0DA 1D6SA 4OATA 1YIOA 3EAQA 3G9UA 4RABA 4BGIA 5CXUA 1V7QA 1TQ6A 1L1RA 3OZEA 3R77A 4AJOA 4KRFA 4K87A 1SEVA 3KP1A 3REGA 2XWPA 1HZZC 1KK0A 1L6RA 1CUVA 4MVJH 4OP2A 2JZOA 2ECPA 1SVMA 1FXWF 2W9XA 4IO1A 4KGVA 4X00A 3V34A 3ROTA 4B3XA 3HV2A 1UMCB 5A4IS 3U4QA 1QONA 2XZTA 1NATA 5G4LA 3MUNA 1M66A 2XEXA 3N76A 4JSTA 2YC4C 2GYYA 4MV6A 4TWZA 3ZLVA 2W0SA 3PEEA 1NT2A 2A9RA 1LBQA 2W6JD 4I81A 3LXUX 2FFRA 2ZKLA 4RTOA 4UTZA 2QD2A 3GLGA 4MV9A 3WLSA 3T5PA 1V11B 3OJLA 3M81A 3S5JA 1EAMA 3PPXA 2D7DA 1C0EA 2ODWA 2PT5A 4HEQA 3R8CA 1DKOA 5CFOA 2VDQB 1OAKA 3TAXA 3MPUA 3UXYA 5SZHB 3V2GA 2D0OB 5BSGA 1J06A 5ALRA 1I7LA 1T8PA 4OCZA 1N5OX 1UMDB 4C6HA 1GDDA 1GFZA 1NRJB 1EVLA 3NIFB 1KJIA 3ZWVA 4DA7A 3DEIA 5L6LB 5EZYA 3SHQA 1E9BA 3IQWA 5B3AA 3ZHOA 1N3BA 1WXIA 2VSYA 2ZS7A 3G88A 4C7OA 1U7TA 5EMJA 3U61B 2WF8A 5BWNA 4KI0A 4QJBA 4OI1A 2FJRA 2C2GA 4FPXA 1O3YA 4XSVA 4E07A 1KY5A 3CLCA 3VK0A 4YRAA 4PICA 1SQFA 1RADA 2XXBA 5I8WA 2QM0A 4M0KA 3D31A 3LP5A 1Z07A 3NC0C 3V3TA 1GPJA 1N0VC 3CO5A 4J0KA 5ILOA 4LW8A 2BGGA 4KXWA 2FZVA 2RCNA 4O4IF 3LUDA 5ERGB 4CDMA 1SUWA 4B4WA 1C8LA 3I73A 3K09A 5B3JC 1WW2A 1GRNA 1SHTX 1A7UA 1DRKA 3AUSA 4O29A 3B9BA 3ZI4A 2AXNA 5LYJB 1A1SA 4OLJA 2XW6A 3G89A 4CKEA 2HA6A 3WGIA 3GGPA 3PR2B 3AGQA 2FE1A 3D6VA 2PV7A 4FR0A 5EERA 4K40A 5HIJA 4RPGA 4CFZA 2ZUBA 3SJBA 3FHJA 4XWOA 1SK9A 3WLNA 2PNJA 3TE6A 2DWQA 3EVBA 1EZZA 1UOOA 1XZMA 3TI7A 4DIBA 3GZ4A 1M6WA 2IYYA 3KE8A 4DMLA 5BXQC 5CDGA 1L1MA 2E82A 3QFTA 3PRJA 1JU3A 2BUBA 3N28A 4UMDA 1ESMA 1NUQA 1ISIA 1U0LA 1T15A 3RYTC 1XL0A 2AUTA 3GJRA 3HS3A 4PIVA 4KIJA 1OA1A 2ZIVB 4RENA 4REQA 4O4LA 1N0WA 3E8MA 1Z2DA 3AUAA 2YIDA 4K3VA 4L75A 3NHBA 4RMIA 4RULA 2WSLA 4MVJI 3JWEA 4KXNA 1R0WA 2J45A 4H7KA 1M10A 4I6RA 4XCVA 5KHLB 3WHKA 3CZPA 1E4OA 1XXHE 3WAJA 3MRXA 4UEWA 2YVLA 1X8KA 3AFMA 5CYPA 3AR4A 3FFTA 4C78A 2GJSA 4DB4A 1QUFA 2G9QA 2V7WA 2ZIXB 4I19A 1NLFA 1WB9A 1JHMA 2FFQA 1OOEA 4XH9B 4H1VA 2AC2A 3ZQUA 3F4BA 3DC7A 2PBRA 2QRVB 2ISCA 5TB5A 1E66A 2LYKA 3FJYA 4IKPA 4ZPXA 1YT5A 2GHTA 2P62A 3PCRB 4PO3X 3J81A 2BTQA 3SC2A 2VEOA 1KDVA 1R64A 2X3UA 3AV3A 5BR4A 2WK1A 4CMBA 2VTDA 1Q0TA 5IFKA 2X0RA 3R75A 4P3PA 2OM2A 5JSQA 4RVNA 2A92A 4H7HA 1NE7A 2FPUA 4JYMA 5H5JA 1G291 3BGSA 2GQ0A 1E1CA 3CJRA 4QODA 3LECA 1OKKA 3IPAA 1P4RA 1PUIA 2BF4A 3MGGA 2Q5FA 1F8UA 1S2MA 1BE0A 1QH0A 2RHHA 3TLBA 3SIPA 2NXWA 3W3ZB 4G0VA 1MV5A 1Y5MA 3TZBA 3KXAA 3A32A 2ZUWA 5JWRA 3DDHA 5TJ9A 2CFCA 5AK4A 3K9QO 2GCIA 1YRWA 2RSLA 2WD8A 1YRQA 1FMTA 1W85B 4D25A 3TTVA 1RHMA 3HKDB 1T1IA 5AKZA 3VNBA 1A9TA 1NUAA 1WG8A 1X1EA 2PGLA 2YFYA 4PZLA 1FLDA 2F64A 3C0KA 1JZQA 2G3YA 4IW3B 2MOKA 4IUCS 4EY4A 4DV6B 5FJJA 1LQCA 1UCFA 3JWPA 3MYYA 4BWVA 3HKEB 3ISVA 5FH9A 5LXTA 3MWDA 4KZKA 1Z2CA 5DHPA 3KQOA 4GBGA 1D9ZA 4MQ4A 5EJ5A 3I45A 5HPYB 3K73O 5J5CA 3WADA 1HKHA 2FB9A 2ZG6A 4YXFA 4E13A 1HQDA 1B6GA 1XKXA 2OCXA 4X8LA 1X38A 3FGZA 3NV9A 2EZ4A 2QYSA 4BNWA 5GTDA 4ZJZA 1U7PA 2V96A 3HRHA 4MJXA 3A05A 4MPJA 2DWUA 3NEYA 4BGVA 2UAGA 3PGKA 3SEQA 2H52A 4AKHA 2XH8A 5BVGA 2HLNA 3LKVA 2RGEA 3AQIA 4OFZA 2HQRA 4NE9A 5CLHA 4LC0A 5EJ7A 3GLIE 3K1AA 3TAUA 3DWFA 2AJCA 2FP3A 5EHQA 1E61A 3ZR4B 2D0DA 3L7IA 1VJGA 1XTBA 3NOQA 1EX9A 1QMGA 3GUVA 1GAXA 1CB7A 4BNZA 3HGQA 3OZGA 3F6PA 3A9VA 3CF0A 3I6ZA 1U0GA 4X6YA 4IH9A 2V0NA 3IOCA 3BT7A 1RBYA 2O05A 4L8YA 5DGTA 1JPNA 4E4TA 5JXHA 2JJ2A 3B7WA 2Y67A 2C4UA 2GFHA 4M1KA 2C3PA 3GCWA 2QN2A 1CDDA 4RLSA 5ALUA 4HDRA 1P1FA 2QUAA 1RPAA 2YDXA 1PSDA 2C0QA 3QVSA 4AZTA 3BFJA 1U2PA 2J0SA 3C8ZA 4DA9A 2O2GA 3OCCA 5H80A 3CJQA 1KXZA 1IONA 3TSCA 4F21A 2GHQA 4F93B 2ZIUB 5HNKA 1C0LA 4NHEA 3KJNA 1M6VB 1X42A 3WJ1A 1QYVA 3OEHA 1LQ2A 1BROA 1QRAA 2PM8A 4O3FA 3V4LA 4RPHA 1Z74A 3WNCA 4CMAA 1A4XA 4B80A 2HINA 1GPUA 3DTYA 4NR0A 3P9CA 3C8DA 5B2EA 4QGBA 2JD0A 4YGXB 5E0KB 1KU0A 1R5JA 2XTNA 3GLVA 4YHBA 1TK3A 1TVCA 2BFDA 3WWDA 4OXKA 1O9GA 2BKXA 3HWSA 1CJGA 2QRPA 2WYHA 1NURA 4N6OA 4XQGA 4K0KB 2NVUB 1KVRA 3ZCPA 1CDOA 4W5NA 2G1AA 1KETA 3DBHA 3DZ8A 1YS9A 3EWAA 3SJUA 4N82A 1YR8A 1V2HE 4IJMA 1JQJC 1Y34E 1XYYA 4GX5A 4KCGA 5TQJA 4E2YA 4DCVA 2FEAA 3K70D 1V45E 4NJEB 1ZJYA 4TTIA 2REBA 1UBOS 4JFRA 1XP5A 5DT9A 3TJZA 1OYYA 1U2EA 1M34B 5JH7F 1W36C 4EY5A 1OTHA 1EBBA 4ZT2A 5FT9A 1KJNA 4R8VA 4U63A 1SBQA 3CGGA 3HUTA 5HG0A 3REQA 4AUMA 1GQSA 3BPSA 3S1AA 1KAMA 4IDFA 1VZ2A 2L42A 4QOEA 4R9SA 4BE4A 2FKNA 1WV0A 4R0MA 1OLUB 2PWYA 1X7YB 3Q3JB 2DECA 521PA 3WWPA 1MDFA 4DE9A 1E1YA 1Y1SA 2PSEA 1I0ZA 2YV2A 5EVCA 3WHLA 3WLKX 3N75A 1IEVA 4PLHA 2MSKA 2X15A 1MH9A 4PE5B 5HQ3A 3SP1A 3KFVA 4F4HA 1IC8A 1XMVA 1G7CA 5B1SA 2O8EB 3W79A 4QATA 3B3JA 4JJ4A 1LH0A 3AHIA 3OZWA 4MMZB 3NHWA 1GU1A 1X2BA 2QT1A 1CJCA 3JTEA 4H4CA 5AVKA 2Q2WA 4NZZA 4XB2A 3RUDA 4EJ6A 1EK0A 3M82A 2HK9A 1MU0A 1PNQA 3ASVA 2IK8A 5FI3A 1GPAA 5JW6A 1IXYA 3HB9A 2QMUA 2BFMA 3DC2A 4HQLA 1FPMA 1K6XA 4O8CA 1F17A 3EA5A 3QTLA 3OMLA 4K9PA 4FNAA 4QJIA 2XOEA 3AHFA 3EA0A 5GAGi 3HJCA 4ECAA 5DO9A 1ZGZA 4RBNA 2NV6A 2XNDA 1N7JA 3DNMA 3ELWA 1UK7A 3KKZA 3L7AA 4BCDA 4UOEA 5DN6D 1I3KA 4YX9A 1YONA 1E1RD 1CY8A 5DV9A 2YXEA 3IVXA 3K8OE 5DWQA 3HEBA 4M2LA 1Z5ZA 2BFBA 2QJOA 1I4DD 1GM5A 1QZZA 2R6DA 1QRTA 2W71A 1R00A 1K89A 4H31A 3UWPA 1PZHA 1LSJA 5CIWA 4ZJPA 2R6ZA 5T41A 5HQTA 1KFCB 3MTAA 4UUOA 1MGOA 2GWHA 4Q4DA 2IPLA 3M4NA 3OOWA 5CDYA 2BFPA 3LUGA 1W87A 4I55B 2CE7A 2BEJA 2X86A 2HZ7A 2EKLA 4J3JA 4JLJA 4QG7A 2XKKA 1JQAA 3OPMA 4QEDA 2GM4A 1T2NA 2VP3A 3QELB 1APBA 1E62A 1HNXB 4MROA 5DF1A 3ZWCA 3DAGA 3PE4A 2VHEA 5CB4B 1FMLA 1A3CA 4YAFA 1IZ8A 3KBOA 3PQ2A 3QLVC 3QWGA 4L9SA 3N59A 4N01A 4UCQA 1YU9A 1FTWA 1TECE 4C9BA 5B36A 4M0LA 4YCSA 1SC6A 2HA3A 3EJ6A 4M0DA 1L3BA 1L5SA 1JDUA 1J8VA 2XGOA 4R8RA 2QNBA 2VAWA 4WZAA 5EJ4A 2Q4EA 1S5PA 2IS6A 5JVDB 2CLLB 2OZEA 2X76A 5B1EA 4GE0A 2JI7A 1YACA 2ATIA 2GTPA 3K0FA 4ZYZA 3HJAA 3TUJC 2QAIA 5A4JA 1HPLA 2HWYA 2NXCA 2O6LA 1X94A 4JQOA 5DXAA 2BCGY 2BGRA 3BL8A 3O9ZA 3AVUA 3BXZA 1DE0A 2G07A 2RI6A 4QU9A 4YS6A 2PXXA 3TTSA 1QQ6A 1Z0IA 3NOVA 4E5VA 2ZB2A 3ORYA 4JBWA 4E6PA 2DQ4A 4MKZA 2ZJZA 1OQAA 3NJ8A 3WRVA 4EUSA 3I8SA 1T4CA 1UDCA 1YZQA 4X24A 5CK4A 1Z68A 2Y2UA 4YUWA 2H1LA 1ZN9A 3Q9UA 3T7AA 1WW8A 2NU6A 3S2SA 1D4FA 4TKLA 2P68A 4U7TB 2WYUA 2CUKA 5A06A 2HPAA 3ACBA 5F73A 4CFYA 4H6PA 5T4EA 4B3GA 1WXQA 1SCUA 1Y7YA 2IU0A 1KE2A 4DARA 1Z25A 3SCFA 2GBIA 1RLMA 3UXMA 3PTAA 1JEAA 2GK4A 3KHSA 3M4XA 2X42A 1TAUA 1ORRA 4W6QA 5ICFA 4BFSA 3OF2A 3HH8A 1LW6E 5A9SB 3S3TA 4KOEC 5CITA 1GSAA 2VUIB 1KPHA 3R5JA 1HLPA 1HQCA 3DOJA 5EMMA 5AK6A 5IYZB 1P1KA 5BR1A 2Z0MA 4IFBA 4RHYA 2ZEJA 5GGYA 4GOXA 2XNCA 3PCXA 4EECA 3HADA 1P9OA 2WWFA 3W34A 3RODA 4ZA2A 4Q9NA 4D45A 3GJXC 1UQTA 3GJZA 1VKZA 4WX2B 1PR3A 1VPEA 1ZLYA 3C3YA 1RAFA 4B35A 3CTPA 2OGTA 2CLIB 1XDWA 3UGKA 3M2PA 5G0SA 1G3QA 3F3MA 3EG9B 4RV4A 2OHIA 1I1OA 2VDRB 3Q87B 1FS5A 3DVRX 3CRMA 1XZPA 1T13A 4I5IA 1UINA 2IY8A 2WT4A 5BMVA 2B61A 2YMLA 2BBOA 3T3PB 4C0XA 2P2SA 3OICA 2WOOA 5CCXA 2AZDA 2XGMA 3MUEA 2KEKA 2GCNA 5D3MB 5K3FB 1NSTA 1WUIS 2QZ9A 3EFOB 3MSCA 3QKWA 3LX8A 2CHGA 3GEPA 1U3TA 2WV7A 4P82A 1PI3A 1ZI6A 3FCXA 3IAS1 3KJXA 1C4KA 1OU0A 3DDWA 3TVDA 3VR6H 4F4FA 3T5TA 1EINA 2JKVA 2XE7A 2ZRQA 2IYEA 5FTKA 1IB0A 5AWFC 1QLJA 2F67A 3OOYA 4BNDB 1OFVA 2PWBA 3DE2X 3TQQA 3S2GA 1KYXA 2C5SA 4U4AA 1CIPA 1QHYA 2PNFA 3T3EA 4BUCA 1R63A 4RZ3A 4Y0NA 2NPIA 3A1TA 1CJSA 3LPLA 3G0BA 4PPYA 3RS9A 3RREA 4EMUA 1GILA 2HSWA 4G1BA 4X8HA 5IUJC 4PZYA 3I53A 3GZJA 2ACVA 2FQQA 3HJGA 3INYA 3AF6A 1MO3A 3EGDB 4M37A 1A8HA 2J4DA 3BBLA 4QXRA 5KOHB 5TLSA 5EPUA 1T91A 4MAAA 2RAPA 2ZCVA 4GQAA 2QDXA 3I61A 3BE8A 1U2DC 3OY7A 1YJQA 4LZJA 4UJ5A 1NX9A 5IU6A 4LUCA 4QUDA 5JCXA 1LXCA 4GGOA 2IZ7A 4UDXX 4X4DA 2BN4A 3FNHA 2V9ZA 3JYHA 1QTRA 4A91A 4EAAA 1A9XA 1MX1A 2IW3A 5KPJA 2NZYA 2I5PO 1I14A 5T67A 4FDMA 5JIBA 1U3CA 4MIYA 4WI1A 2V5VA 2XBLA 2FMTA 1WBDA 3EZ2A 3HUDA 3IILA 4GIBA 2JBAA 4NE2A 2E7ZA 4PFSA 5ECYA 4YLYA 4HNTA 1EFCA 1T8RA 4FSXA 4OQMA 1CT9A 4R9NA 5CTJA 1NBOA 2QRLA 2HRCA 1J1UA 2M6RA 4GEKA 3RB8A 3A6EA 3KDSE 2EGUA 3I04A 1HT3A 3V2IA 4B79A 1MOSA 3IVPA 1Q50A 2EVWX 5LZ4A 4GDMA 3D6JA 3OU6A 1EJ2A 3KB2A 3PYXA 4YBRA 1N5LA 1DBPA 2VCEA 2FY8A 4MW6A 3T1OA 2BHTA 1VIDA 3OQMA 2EG5A 1Y82A 2I34A 3BVPA 4L0CA 4RC9A 4Y2PA 2B98A 1LTKA 3FGNA 1WR8A 2QE6A 2ZIZA 4FMCF 4UAVA 2EFHB 4ARUA 5K3EA 3TSAA 3U60B 5HJ5A 2BIFA 1UOPA 2RMKA 1U2SA 4HGYA 4UHHA 3WC4A 4FZ5A 3IBFA 4FFOA 1Q22A 4LYFA 3WYCA 1ENYA 4V0KA 2BTOA 4JC8A 5DXFA 5KCZA 4WOCA 2IOQA 1HE4A 2HA0A 1QYDA 3C5CA 5FWYB 1R3UA 1E9CA 1PDWA 2CWWA 2NTJA 1JFFA 4REOA 1R9GA 3U0BA 1TMKA 1ES9A 3DPSA 1UBSB 1M2FA 2QX8A 3AQ4A 5DM1A 4Q9DA 1U0FA 3FPGA 3UN1A 4K6MA 1JQ5A 4ARZA 3JXCL 3CVOA 1UC9A 5T6MA 3UFXB 2YHUA 4LI3X 2YW9A 2DB3A 3IT2A 3ZD7A 3WMXA 1Z2NX 5JADA 5EMHA 2Q3EA 4P7FA 1SVSA 3AETA 2VDWB 4JP3A 3INRA 5I4BA 2IITA 5JECA 1OPRA 3ZHMA 4JBGA 5EI5A 4OP1A 3ZHUA 4QYMA 3N7AA 1TQ4A 5EYPB 2A9PA 1VSQA 4P4SA 1W48A 4AP9A 2H4FA 5LQJA 2PGNA 1QQAA 4RELA 3WISA 4BMNA 4DHWA 1XZAA 1ISPA 3EXIA 5ALNA 1GRCA 3G6KA 3MERA 4F84A 2VEDA 3C98A 2JRCA 3DBIA 3FYSA 4QUIA 1XFAA 1E3LA 5BSMA 3COJA 3WA7A 2Z95A 2OE2A 5ESDA 4YJGB 5J1TB 1DC4A 1P4HA 4KVGA 4LZWA 3B8HA 1VIYA 1AZLA 5TPZA 4F8EA 2H63A 1TU4A 2ZJBA 4MOWA 2XLBA 4J91A 5FBWB 1XLWA 1XTVA 2BBTA 1LRKA 5LSAA 4D57A 4DWJA 3NT5A 1VDMA 1RC0A 2Q1XA 2Q3DA 4HPWA 3E84A 4BQQA 1G8JA 3CYFA 4EAQA 2I3ZA 2GBLC 4U7DA 3MRVA 3ZNOA 2ATCA 4LDQA 5BYBA 5DLQC 5C8YF 1SAYA 3CRW1 3OOEA 4MX8A 1DMSA 4MW9A 5DYWA 5CH3A 4Q7MB 3EEFA 3ZY6A 2XOXA 3F8TA 2QKYA 2XCLA 3CF4G 1YIDA 3EIWA 1IULA 1ODJA 3T06B 5TX7A 2H5EA 3VR3D 4NMWA 3D4LA 3ILYA 3O4HA 4AS1A 1FXSA 2NNWB 4NENA 1LLQA 2IU6A 3AK4A 3TSWA 2YBEA 4YIKA 2DBQA 2GZ2A 5K8JB 1EHYA 4QFCA 2HHCA 3RYCB 3ITNA 1R7RA 2KLBA 5C7LO 3CN9A 1F20A 1U02A 2HO5A 3PEVA 4G1VA 1JQBA 1NOJA 3O6VA 5DGHA 5DXJA 1PKEA 1ZD9A 4BNMA 4JOQA 4PXSA 1C7IA 2QRQA 1MO4A 1PLKA 3DHNA 2XGSA 3SJZA 1FQOA 3BF8A 1KTIA 3D7SA 1CETA 3OZRA 3OURA 4FFRA 4PAWA 4CM8B 3IR5A 4DIKA 1JSXA 1OBFO 5IK2D 1INLA 1KOFA 5AOVA 1Z5OA 4OO3A 4DA6A 5KOJA 4AF7A 1S6YA 2ZLBA 4K8OA 2VHVA 3QVXA 5GJVC 3C6XA 5GJCA 3MELA 3BEDA 3LPNA 5AW2A 2PR2A 4FQ5A 4KWIA 4Q9KA 5TF4A 4CM5A 2GXQA 5EJ8A 3WX0A 2ZVJA 4X4EA 2ZIAA 2O4AA 2REOA 4LI0A 1G20A 4X60A 3VR5A 3JD4A 3AM3A 4HZGA 4BMCA 2L19A 4Q4AA 1ZH0A 2JFFA 2GBFA 3R41A 4RWEA 5KS2A 4XVQA 2A9VA 2D0IA 3WIVA 4KO3S 4EL0A 3L79A 3T1QA 3ZI0A 1E79D 1C8BA 2ORIA 1JVSA 4IJ5A 2W6ZA 4YP5A 4R1TA 4UC0A 4UREA 4CHTA 1U0SY 1DC3A 1Q0QA 4EVRA 3KKMA 2ORED 1LC3A 5CA1B 3P9SA 3PJEA 2YJ6A 3PRYA 3KTAB 1IOZA 5CXXA 1LX6A 3CUUA 3SQLA 1W0JD 4L4ZA 4LKRA 2HM7A 2P78A 3OG9A 4Q9AA 1NYQA 2X9QA 3RCBA 1E1QD 4B5LA 2BSQA 4X8MA 3CURA 4G2TA 4Y2TA 4GNRA 5A7FA 1OWPA 3QEJA 2JGFA 4Y1GA 1MN6A 5AVQA 2XTZA 2BGJA 8ABPA 1ODSA 3DVAB 3COYA 4CQJA 2RGWA 4TTRA 4DNFA 5B58C 4PW0A 5EQJB 1ESEA 5JRJA 2BISA 2GVDC 3AESB 2JAOA 3JVEA 1EYZA 3G2KA 1NT4A 1HY3A 4BDTA 2QUZA 5AW8A 4GKBA 2RAVA 1KYWA 2HFJA 2XNHA 3CF4A 4FOPA 5THXA 1M76A 5CT6A 1NXQA 4JMLA 2QNRA 4M46A 2IHNA 5AKLA 1KZ7B 3L41A 4UUMA 3MJFA 1B3BA 1JL3A 1CUXA 1K06A 1W36D 5K7SA 3SK0A 4KMMA 3QY0A 1J0AA 1EVEA 3KLOA 1SUPA 5KWVA 4W1QA 3K53A 3ZVNA 3P26A 4E70A 2D2VA 1T6YA 2V1UA 3VYTB 1CR0A 2H31A 3HXQA 4IP0A 3DUFA 4LTNA 1TPYA 2W90A 4DCJA 2YV4A 1QGUB 3EIXA 1WCXA 3PXCX 2GCGA 1EHCA 1KNXA 1UT6A 2IEDA 2Q5HA 1ORIA 1PSZA 3P2OA 5ALPA 1JJBA 1PJSA 3TPFA 5EUMA 3ZE9A 3M33A 4EQ6A 4ARVA 2XB4A 1GNQA 1IOWA 1UJBA 1G5IA 2DUMA 3D6AA 3ASYA 1HZJA 3HL4A 1UOEA 2FSIA 2ACWA 5IVPA 2BJVA 3OZAA 3ER8A 3MJTA 3NYRA 4URVR 5CJPA 5YASA 4D3FA 1KA9H 2YZNA 2BP7B 4RSGA 4ZCLA 3IKTA 1XMPA 4L5BA 2XAUA 3I4LA 4DV7B 4K6GA 1KMIY 2HRQA 2QIPA 4FGSA 5L3ZA 1S3GA 3WOVA 2DFKB 4FYVA 3L0IB 1SQ0A 4IDPA 5LLTA 2AMLA 1WABA 1X1RA 3E5RA 2WWHA 1EXWA 3QUAA 3DYVA 1F1BA 3L01A 2VQ6A 1MQSA 5C8VA 4D9HA 3TVYA 3QY9A 2FUG6 3A6PC 2Z8XA 4LOIA 4Y18A 1TO1E 1DHTA 4CM1A 1GXSA 1VLVA 1XRSB 3ORSA 3PFGA 4GYWA 4PYJA 1N6HA 3GEGA 1XLVA 4FKMA 4GUDA 4C01A 5K4GA 4KR3A 2JCVA 1Q0SA 5H70A 1U9JA 3MZ0A 3BB1A 1G7SA 2V45A 4FNOA 4ILKA 3OSUA 4PZEA 4BFYA 3SIRA 4I66A 3TW4A 3X44A 1T2CA 2R79A 4BEWA 3P97A 1E4EA 4LNHA 4DSZA 2WNIA 3NXSA 1XVTA 4QQFA 4TKMA 4JCXA 1FK8A 2OORA 3LCJA 4NHOA 3RPEA 2B2XA 1UFOA 2WWGA 4IS3A 1F3LA 4M7PA 2HSZA 3LBNA 4XQ0A 3OM9A 1NVVR 2CJWB 2O7SA 4AJ4A 1XDBA 4U2GA 1VYUA 3ZE7A 4RQTA 2EF8A 5CVTA 5F52A 4IOLA 3HYCA 2A0UA 2VT6A 3AM4A 4CMJA 1UPTA 1M5RA 5F7JA 1BU8A 4I1UA 1F3OA 3MWEA 4Q48A 3C8UA 3U81A 2H11A 1BRMA 1X19A 3D6MA 4FYPA 5C3UA 2DAPA 2QQ5A 3E3MA 3ZDRA 3ROZA 3QLEA 4GM0A 1B3RA 3L93A 4DEXA 4JLOA 1RXEA 3BE6A 5CDFE 5CDSA 4BMZA 4OMUA 1PGNA 2HB6A 1IBLB 1KDPA 2FUKA 2GRLA 4ER5A 1ONSA 1RCUA 2O2JA 3GVPA 3U4IA 1IUPA 4TS1A 4OJQA 5DMHA 5ECDA 1UEXC 3KT8A 5JHGB 1TK2A 4CTJA 3Q7PA 1FMJA 1SCJA 2W6QA 3FROA 3AW9A 5K45A 2X0IA 4AMZA 1NMSA 5KWEA 4AKIA 1PVVA 2PT9A 3B6JA 1Z6PA 1ZK0A 4BLWA 3GGOA 4BKOA 2VXBA 2WYOA 3NGLA 4H15A 2PVPA 2GPBA 2WNSA 4R1QA 2X7HA 4RD6A 3K35A 1K7XB 3A37A 3PDWA 4HNHA 4M6WB 2ALJA 5D2CA 5G0TA 1OB2A 1KGDA 3C3WA 1KZHA 5TY0A 1EBUA 2JI8A 2O2IA 3IAUA 3PHHA 3QPDA 1UP4A 3UJPA 4CEHB 1SBTA 1ZAKA 2P75A 4NMHA 5CX1B 4ATNA 5IDQA 1FBTA 4P7GA 2FPMA 5ALMA 3VDNB 2JPDA 3O31A 4ITUA 1WUJS 4AO7A 2BW0A 3GXOA 2RCYA 4US0R 3UUEA 2O07A 3OZFA 5CPBA 4FDAA 5H1YA 1CLEA 4PSAA 2Y1LA 3GROA 3S2FA 2BEVB 3CRNA 1XZIA 4MDFA 4KQMA 3AKYA 1M0EA 4B3RB 5DASA 2CZCA 3RT1A 4JLAA 3OPYA 2E5WA 3OF5A 1OH8A 1L8LA 3KOOA 5BSEA 4PCUA 4BY9E 2PLNA 5ALWA 1W0CA 1AO0A 1GPYA 3D8UA 5BNIA 2CBXA 3B3FA 1X7XA 2JHCA 3H5LA 1E5XA 3SM9A 4DM4A 4GZ3A 4OXYA 5AKGA 3B52X 1Q57A 4HNUA 3FHTA 4RFSB 2DE0X 3LUPA 4EHNA 1WW3A 3ZTTA 4EFKA 1FDOA 1UZUA 2NUBA 3T9EA 1QPBA 4AZSA 4DDHA 1L0BA 2F6RA 1XD8A 3CZ4A 1J5EB 1Y6QA 4DMGA 4DB2A 3DTVD 2QPAA 2QMOA 2RIRA 4G97A 5KEIA 1EFRA 4IWYA 1NMYA 2EBYA 4V03A 1Z0AA 3OY2A 1H4SA 2ZYTX 4PINA 4N12A 3ET4A 1PFGA 4RVFA 2XQFA 3MB8A 2WQ6A 4YPOA 4JLBA 4PG8A 1QHHB 3BX1A 2D1QA 1RBQA 2OECA 1P5JA 2WFLB 2XMGA 5CNJA 3YASA 1Z2OX 3UJ9A 3RLIA 5C1OA 2B6HA 5ED0A 1L2TA 2I4NA 3KOZA 2WAYA 4RXUA 4WBNA 1FRVA 4QM7A 3BZBA 1T43A 1ACLA 3K0CA 3UGQA 4W1RA 5ADHA 1Z8FA 3UAXA 1A2QA 3K6KA 4X84A 3GWGA 1PJAA 3E4DA 5LBIA 1GCGA 2XT0A 3RO7A 3O9MA 1ZUD1 4TMWA 2F48A 1DLJA 3DWEX 1ZH8A 3EXG2 1KK2A 2ERXA 1VG9B 2R7AA 4H60A 1K8YB 1CWUA 2F4NA 1EZ1A 2ZDHA 1PTJC 2MEZA 3ME5A 4KAAA 4KBFA 3WSWA 2I2FA 4KXQA 4BB6A 2XUOA 2FU5C 5JAIA 4KVAA 3A1CA 3KJZA 3W9SA 2ZRMA 1KSGA 2QSZA 3ZXSA 4V0ME 3IULA 4JS0A 2JJYA 2A5JA 1AUVA 2H2HA 4HUJA 5CFMA 3H2ZA 3MW8A 3BHNA 3B82A 4WZ6A 1AKWA 2FPXA 4JR0A 1B74A 1UXGA 3L7KA 2BV3A 3EUAA 5EFOA 1YCGA 2QU8A 3VA7A 5FWNA 2Z1NA 3M83A 4DZRA 4EY3A 3QVGB 4EJSC 1TDJA 4MWEA 1YS1X 3ZOZA 4F7DA 4FNMA 2ISQA 4BVLA 1TJ4A 2VP9A 5FL3A 4AZ0A 1P9RA 2ZAIA 4UTVA 1G8HA 4IDHA 4NYIQ 5EWMB 2PMDA 5BRAA 1CUUA 3BMOB 4EO7A 4LF6B 3G0IA 2ZB7A 3ICVA 2JFBA 3VM6A 1KI1A 2V7GA 1ULAA 4IIDA 5L3SB 5IWAB 1Q7GA 2GPNA 4Z4GA 2BGIA 1SM4A 1Z75A 3VVCA 2F1RA 2QMEA 4I08A 1P29A 3U1TA 3UOGA 1T26A 4B2LA 3UA4A 4KFCA 1L4GA 2C00A 1T9GS 1Y3CE 2YZMA 4CQNA 3GAFA 2GJKA 4DSNA 4FNGA 4GPEA 4ARSA 5KYYA 3AUJB 3M1IA 4ARBA 1B15A 1E7SA 3ENVA 3PITA 3JQAB 2D7CA 3R1FA 3DAYA 1HTWA 1II9A 3R9KA 1V8PA 2I4LA 1GUDA 1STOA 1NBMA 4NABA 4OXRA 1JG1A 4Z4FA 4L5AA 2OZLB 4BB9A 5T3UA 3ZJVA 6ADHA 4KWCA 4IDNA 1WTCA 3ZWWA 3S29A 1IMOA 2H6EA 2XQVA 5K0JA 3EOZA 3LFUA 1I5OA 2OV2A 1MZPA 4HS9A 3PHJA 5TVGA 2GZUA 1J42A 4NTZA 3E22A 5FNZA 1YKGA 1L1QA 5LMZA 1EG2A 3M6VA 4XOUA 1DAEA 2FGKA 2G1KA 1IZZA 4JI8B 4NZPA 4OHKA 6REQA 1Y1TA 2EIHA 4TYMA 2BSXA 3LZDA 3NM4A 1FNNA 2PXCA 1CVLA 5D5QA 1AS2A 1GUYA 4K6CA 2VOJA 1BS2A 3CM0A 1AGXA 3GJSA 3FDIA 4PZ0A 5KSPA 1LQTA 4PTZA 4UAGA 4BNNA 1CIJA 2JF0A 1T6XA 5E7JA 4X4CA 2XJ4A 2C61A 4HDCA 4RSHA 1SB9A 2JIZD 3EGXA 5U4XA 2DY1A 3E81A 3U9LA 3NRCA 3IAM1 4LOAA 4G0ZA 4CYMA 1Y7PA 2C92A 3NAZA 1QK4A 2ZRKA 3DONA 4P9NA 4YRQA 1NNSA 1NNLA 4GRAA 2PXDA 4EATA 3TF5A 3KR9A 1RI4A 2I2CA 1PJQA 3GEEA 4MKIA 4EHLA 4P0QB 1XNQB 5HWSA 1DAKA 1ZXBA 2RJOA 1SU4A 2C95A 4NCHA 2OBFA 2VDOB 5ILQA 3IALA 3DW1X 3O4VA 4HDQB 5BR7A 4ENRA 4JELA 5TNXA 1CF9A 1D2CA 2P6PA 1B8VA 3A6LA 3O84A 4GU5A 2XZDA 1FW8A 3DW3X 4X1IA 4TYQA 1S2GA 4CQLB 1FP4A 3AXSA 1AIPA 4OHUA 5EUQB 2BKAA 2VSOA 3ZV4A 5KTMA 3VPFA 2O7NA 2KYRA 3QF3A 2UYYA 5KMGA 3KPJA 3LT0A 3PUWA 1OD6A 1P3DA 4KBGA 4KLCA 1Q2XA 4J3FA 4PSDA 1XJCA 1FIUA 1U1GA 2R00A 1V26A 1RDFA 3PA8A 1BQEA 3HB5X 4HF7A 4PGMA 4TKZA 1KEKA 4IXTA 3C6ZA 2G7MC 3OX4A 1WHTA 4EENA 4CQMA 2PXEA 3THWA 2KLHA 3HMKA 4LGCA 1JI3A 4R6XA 4TXNA 421PA 4KQ6A 4DR7B 1RQXA 2H4WA 4HDKA 3A3NA 4LXTA 3K2QA 2BH2A 1KJ8A 2P79A 3D1LA 1IOVA 5E3HA 5FBQB 3CCFA 1BHSA 2VTKA 3ADBA 3UBTA 3BZUA 4L9RA 3I37X 3OCUA 3PXUA 4FC7A 4POAA 5AXBA 4C4PA 2VTBB 4P33A 1G1MA 1GZSA 4DYVA 1O0BA 1DQPA 1VI6A 1RSZA 3TLGA 2AW3A 1PK9A 4LYDA 4MUAA 1LK7A 1DEAA 1ZMRA 2IP1A 1MJGA 3TEPA 1U6IA 3QJGA 3ZLJA 3ANTA 5E8RA 3HA5A 1N0HA 1ZC4A 4F96A 1YFJA 2VIIA 4DVGA 2FDXA 4UD6A 3W5SA 4JOBA 5DVZA 1DDIA 5LLSA 3Q7TA 2QX9A 2AJBA 3DKPA 1RP1A 3EY4A 1WV1A 3D4NA 1YB4A 4MQ6A 5CFRA 1E96A 1AB6A 1O5IA 1XEAA 3EW9A 3M6UA 1PP4A 3CUSA 3N8NA 5DP2A 2HCTA 1DG1G 5A03A 3D3KA 3IOEA 1R5NA 5TPWA 3RRNA 1DTWA 1QHIA 2NSJA 5JI2E 2FG7C 2EJUA 2BJCA 1IXKA 3BC1A 2CYAA 1I9CA 3IIMA 4NCNA 1Z7BA 3K92A 1DKLA 3HNPA 3OSZA 5LCXA 3RSCA 4AJ2A 2R7MA 3T7KA 4ARAA 4CUKA 4OX9Y 2OD9A 2M6KA 1P7WA 3AEQB 3LDUA 4NFYA 5J3JA 3F5SA 3WLTA 2ESRA 5JBNA 3HVKA 1W581 4KUGA 2RJNA 3BREA 3QEMA 2ICPA 1JS1X 1UC4B 1XNHA 1T2FA 3TD6A 3H99A 1AS3A 1Z3CA 2W6JA 3HE3A 4XW2A 5EWLB 5G3YA 2A7QA 4ZCPA 2BT4A 5JDCA 3V8QA 3C3XA 3GYBA 4MINA 4KRGA 3LTNC 1Z2EA 4FLFA 1NLMA 4J6FA 1R4NA 5HZGA 1BDHA 4D96A 3T5DA 1HT0A 1WNFA 1JUDA 1J9GA 1OILA 1SUSA 4RE6A 5K2MA 2D5LA 2QRKA 5LIRA 1FP1D 1TJPB 4P7BA 2B8TA 3M6LA 1QFXA 4HRAA 2VRCD 1ZHOA 4G8CA 3GFVA 3D9QX 3MTEA 3EIUA 1ZA1A 3H1PA 5DBIA 1OIXA 4HXEB 3UPDA 4ADSG 3CT4A 4Q4JB 4C87A 1TU0A 2QN6A 2OP0A 4K0RA 2KM1A 1N5KA 3AKCA 3QEBZ 5EUCA 4FS8A 4J7XA 1JR3E 3CIFA 3HKCB 3C5EA 5HBRA 1FFYA 2PGAA 5TQ2B 4BFZA 1X87A 1PJ2A 1XQYA 2C97A 2NNLD 2CVPA 1X8XA 3OT4A 4HPXB 1KO4A 3A7EA 1Q7RA 2PYIA 4G1FA 1QOZA 1RMTA 2AF4C 2YV1A 4JKYA 4YJHB 2F9FA 3BERA 1RR6A 2J7WA 4PAMA 3SC4A 3R7LA 2W48A 3AVYA 2H0AA 3F7NA 4KK3A 4IHJA 4JX8A 2QX6A 3L8YA 4I1RA 3LHSA 3SPXA 5BN3B 1Z0UA 4ROTA 5KTNA 4IWRA 4GW3A 3VR0A 1CUGA 1NMEA 2KQUA 3Q9NA 3ODGA 2IYWA 1ZK1A 5EJMA 1DUIA 4PHFA 1G42A 4ETMA 2Y1OA 4ND7A 3I3SR 2XY4A 5H0IA 1QGAA 1ZVQA 3RVQA 2ODEA 1DI0A 1JSCA 2DKOA 1KSJA 3PWKA 4DRYA 3HBNA 1E5VA 3E6AA 3TFWA 1LSSA 3FWPA 4Y9SA 1NA5A 5DX1A 4H35A 5IAAA 3KTOA 4ISCA 3TKLA 1X1AA 4BX2A 5JYDA 4JI0B 3WJAA 1G3MA 3QWAA 4B7CA 3JSAA 4DUZB 3I9V1 4UXIA 4O2AF 2O7VA 2CMGA 2GXAA 2YOFA 2IEBA 4J2HA 4OU5A 3DO8A 3OQHA 1F0YA 2VPIA 3BWCA 5B4VA 5AVJA 3GDWA 4P2GA 1RKXA 2ZYGA 4U2CA 4IEIA 4C6RA 2NU8B 3K0AA 3NBUA 2LV8A 4Q19A 5F1YA 1BG6A 1VFPA 4XPIB 4I6TA 10MHA 4ZQIA 3KYDB 1SC1A 2C9BA 1NASA 4FMDF 1NV9A 2V65A 4I8DA 4KQGA 3CCCA 2V9CA 1BXGA 1WZUA 1G8KA 3IP7A 4P2BA 3RSSA 4B6OA 1MLDA 3AONB 1AZSC 6YASA 4JYZA 3CLSC 3SS8A 2MWMA 3FFBA 3SAJA 4PQEA 4BO1A 3H4TA 1LLCA 1R0ZA 4YCJA 2VZEA 2HJSA 3AUTA 3AWDA 1FBNA 2OXEA 1C80A 4I5DA 4QNRA 4B4UA 2D3TA 5HVNA 1YA8A 4MR8A 3W5AA 1E0SA 3QU4A 3OFND 5DNCA 4ZICA 4PQYA 4HYEA 5FO1A 3FLBA 4QXQA 1YVRA 4GXQA 5BSHA 1N4DA 4RK0A 2HU8A 3AIOA 2EW8A 3OFSA 4X1KB 4LF9B 5TPWB 2OV1A 4JSYA 2XCJA 4M8IA 5A6SB 3DV2A 3FMIA 5DKFA 3JCZA 4E31A 2EJWA 3D4IA 3N58A 4EHFA 2ZUEA 2A6CA 1GPMA 4DMHA 2C58A 4AZ3A 1FEZA 5EIBC 2FMIA 4NECA 2GD2A 4WFJA 3DNVB 2GK3A 2AYZA 4MUXA 5H02A 3QJ5A 2FE4A 4RZIA 1YK1A 3ZDQA 4BL5A 2YC2C 4RVUA 3I6MA 3T41A 1Z0SA 1A27A 1KYZA 2J5RA 2P69A 4H0FA 4EM6A 3KCNA 3SCZA 4HDNB 3VR6D 4QZVA 5JXIA 1U0HC 2JFWA 1RWVA 1TM4E 1UKCA 2I55A 1SN7A 4LX0A 1CB0A 2AI1A 1RC1A 3EQ6A 3FZNA 2BZ1A 4RLQA 5D84A 4LXHA 5IMSA 2ID4A 1Q21A 1PQ4A 2C1EA 4JI4B 2WSSD 1H65A 3D8HA 1KSFX 2ASVA 3QMPA 1BCRA 5BSUA 3R23A 4D2IA 5CGQB 1XELA 4ZK2A 5BY2A 3GLIB 3ZY3A 1PQYA 3ZTWA 4IQ8A 2CNWD 3JXEA 4TS9A 1JTFA 4BNIA 1D5CA 4UNIA 2O5EA 2FEXA 3ZWYA 3D0OA 1YZKA 4RHFA 2P1RA 4LMPA 3RBZA 4M76B 2OQIA 1MZVA 3LVQE 4EWLA 3IIJA 2DZDA 2PJRA 2XHZA 5TARA 2PLRA 1PJ8A 1FQKA 2OLKA 2ZPTX 4BMYA 5JCOA 3JD1A 4IVRA 3HYTA 4NRDA 3ILXA 4V02A 1AKEA 3BDIA 1DZ3A 1SGWA 1VCHA 1Y89A 2OFPA 3PQ4A 5E38A 5EESA 4B3CA 3NATA 4QBIA 2AQHA 2C7VA 2B3TA 3FBWA 4PU0A 3SZGA 3X1WA 1ZD3A 3TEFA 2SBTA 2BVNA 2PU5A 2JLXA 3SNKA 5LM3A 2NO7A 3FVVA 3AJ9A 2DXIA 2C2KA 2ZSKA 2ZBDA 2ADFA 2O6HA 4N7RA 4QYXA 4S1NA 3DYBA 1K88A 1MQ8B 3WO0A 1AHNA 3GVIA 5KWIA 3BSSA 4OBWA 2ZT8A 4BVBA 4MP3A 1NI3A 3I0ZA 2OY0A 1RHUA 3G8DA 5HF5A 4BGDA 1QV6A 1N8SA 4MO2A 2QP3A 3KPYA 1CF2O 4O4JA 4HSGA 1GARA 1V43A 1B0NA 3E18A 1E7RA 1BNCA 2ACKA 3EOBI 3HA7A 4HNRA 4GH5A 5C1IA 3RAPR 2O5RA 1WDWB 2DULA 2E4AA 3MB5A 4K6OA 3DFZA 2OFFA 4ALNA 4CKBA 5K8TA 1AKVA 1VYTA 3DDUA 3T5AA 5KTRA 1YR3A 3K71B 2V7XA 2CJFA 4U0KA 2NO9A 5U1PA 1H23A 2HMUA 3D7MA 3DEZA 2FQ1A 2QSYA 2GWRA 2JIBA 1IY9A 3PU6A 4FIZA 2NMVA 3QXSA 4OHOA 2YIJA 1Z3IX 1LVUA 3KLMX 2VR1A 1J70A 3IOYA 3ZGYA 1Z17A 2ZVPX 3FPAA 4ZAVA 3P2IA 1BH2A 4CJXA 2DETA 1ZD1A 1WXDA 1MBZA 2BCJQ 5IM5A 5F3WB 2YJGA 2CMFA 1UK6A 2JCSA 4MQEA 4NI5A 1DX4A 2HIHA 5AW7A 1B8PA 1X7GA 2Q1UA 3L0PA 4XTCS 5DBFA