2BNMA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords EPOXIDASE
total genus 46
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnmA02
3MDPA 4PJYA 4QM8A 2Q4SA 4HVRA 2GU9A 3QF3A 1PRUA 1SQ4A 3ES1A 1WH8A 1FT9A 1DWKA 1H1MA 3IWZA 2WFPA 4KL1A 2CAVA 1O3QA 3WW3A 1EP0A 3SMHA 4IEUA 2CSFA 3ZKCA 1CAVA 1ZZ7A 2O1QA 3BDNA 4IEOA 2IXIA 2BYVE 3RYKA 2IVBA 4Q0SA 1JUHA 2UYBA 5K98B 4NDWA 3R6SA 2D5VA 1ZS4A 4XFIA 1X82A 4E2QA 4EWDA 4ZU7A 5C8WA 4IERA 1RUOA 1O4TA 2GZWA 2AXVA 4Q0UA 5JCTA 4X6RB 3TNQA 1JFTA 3NKTA 4LA3A 1PRAA 5CU1A 4IESA 2ZKLA 5FPXA 3S7IA 4MZUA 4X4HA 5BPXA 3G7DA 2PUFA 1Y3TA 3H1YA 4CYDA 1VP6A 4XFFA 5EFUA 2LYPA 4LUKA 3NSTA 2AW6A 2PE5A 1WETA 3R1FA 1ADRA 2PQQA 2XLGA 2HINA 4MX3A 2R63A 5CADA 3N4MA 3ST7A 4XFAA 5FPZA 4X4EA 5C6CA 3CROL 4MGZE 2FJRA 1R69A 3D1NI 3JZVA 4HSJA 4HSLA 4AQ6A 2LYQA 3VK0A 3U10A 1CAXA 5KHKA 2GZUA 3E5XA 3NW4A 2GRMA 3C3VA 3OGJA 1PERL 3BU7A 2IV1A 1QY4A 4IEQA 2Y0OA 1X8MA 4I0AA 1X7NA 4FAGA 4JTNA 4BYYA 1CAUB 1VPWA 2PYTA 2B5AA 4QGMA 4YSFA 2WUSR 2F4PA 4KU7A 4ZU4A 4IEVA 4AQ2A 2CGPA 3B7HA 1YFUA 1WIZA 5LRSA 2N7GA 5FLIA 3RYRA 5J7MA 3OTFA 4X4GA 2R1JL 1E3OC 1TQ5A 3OF1A 4JTOA 4A2UA 2IU7A 2ICTA 1DZRA 2O8QA 3BALA 2MHFA 3ES4A 3B02A 1RZRA 4J1XA 3FE5A 5I0UA 2OR1L 4XETA 4Z5HA 2PIJA 3GN5A 2L49A 4I6TA 1ZNPA 2I45A 3MPBA 4TLFA 2OZ6A 2E9QA 2O49A 4D7TA 2ET7A 1WGPA 4I8TA 4L2NA 2Q30A 1RC6A 5KBFA 4HN0A 5BUVA 1IPJA 5BY5A 2H8RA 1YHFA 1X8EA 3IDCB 4IEWA 4R52A 4JVAA 2KEIA 1U12A 2XI8A 3ACLA 2OYZA 3ZHIA 4JCXA 2CROA 4HBNA 2D40A 3SXWA 5I8YA 1H1IA 1FXZA 1XRUA 3KJXA 1GQHA 2OPKA 1OCTC 4XF3A 1HF0A 3PNAA 3UKVA 4META 4F8AA 3F51A 3E5QA 3H7JA 3M70A 2LYLA 4LUMA 2LYRA 3OCPA 2DCTA 1ZZBA 1SFNA 4KWKA 3CL1A 4YYOA 4Z5CA 1EYBA 2Z69A 3CLPA 2CV6A 3H8UA 4FT8A 5BV6A 5FQ0A 1LB2A 3LA2A 4F7ZA 4QGLA 3ZHMA 2XHKA 1Q3EA 1YLLA 2BNMA 1EPZA 3QACA 4OB4A 2OFYA 4J1WA 3E97A 4Q0PA 5FCCA 5JAXA 5I0SA 1LLIA 2KXLA 1POUA 5FLJA 2XJ3A 4AXOA 3S0MA 3I54A 4X4BA 2ICPA 2BJCA 2IXCA 3FYAA 1R63A 4I09A 2PUGA 1LRHA 4X4DA 1CGPA 1ZRDA 4HVOA 4I6UA 3U11A 5EZWA 4IEZA 1XE7A 2PA7A 4Q0VA 4MGYE 4Z07A 3RPQA 3GBFA 4KWJA 2KEJA 1UD1A 3VHRA 3DV8A 1NYWA 3IBMA 2H0VA 1LCDA 3TRBA 1QQAA 4IEPA 1G6NA 5BXXA 3ZDSA 3FX3A 4Q0QA 2QCSB 1UW8A 2D5FA 2IUOA 2PUAA 4O9GA 5KHJA 4IVZA 4AVAA 1CQTA 3HT2A 3G5GA 2LYKA 3WW2A 2XIUA 1NE4A 1J59A 2B9UA 3QWGA 4X4CA 2XL7A 4FN3A 2FQPA 2GC1A 2GH2A 4GQMA 1DGWA 3CEWA 3I7DA 2AXUA 1J3QA 1O5LA 1DZTA 2VPVA 1O4XA 1X57A 1RPEL 2WC2A 2LYSA 3CLCA 3LZZA 2QDRA 1ZZ6A 4I6RA 3FJSA 1X2LA 4YG7B 4PU8A 3FZ3A 1NEQA 4LULA 1NE6A 3EBRA 4I01A 4QMAA 4XFCA 2B8MA 4QX5A 1QP4A 1O7FA 3WW1A 5J3UA 2EA7A 4IA8A 2AWIA 4ONUA 4JV4A 4K8FA 1NXMA 1O3TA 3RZZA 2KZ8A 1ZX5A 2H6CA 4BHPA 2WIUB 1WA4A 1QQBA 2B5HA 1ZRCA 4MGIE 1LKNA 3DL3A 4Z5DA 1PMIA 1RL3A 2PTMA 3NJZA 1RIOA 4QGNA 2EAAA 4YRDA 3GYDA 4LTAA 3E6DA 1AU7A 1WLTA 2IXKA 1J58A 1UIKA 2Q1ZB 1CJGA 3F52A 2HKXA 3IDBB 2QVSB 2UY8A 2KEKA 2H6BA 4HN1A 3JXDL 3QYXA 1UIJA 4WZCA 1NZCA 3O9XA 1PNRA 5I0TA 1V70A 3NL1A 3H7YA 1OMIA 2BEOA 2PHLA 4Z58A 2OZJA 1Y7YA 1O3SA 2PUCA 3IIAA 3KMHA 2PUEA 3F6WA 1OSLA 2PHDA 4GHJA 2D5HA 3I59B 3D0SA 1LQCA 4P9GA 5F1RA 2AUWA 2FMYA 3I59A 1J1LA 4PIZA 4QM9A 2XSDC 4EROA 2MNGA 2PAMA 5JSRA 3H9AA 4X6QB 4QXKA 4XF4A 3DKWA 1QXJA 4KU8A 3OQOA 3U3WA 3O14A 4LA2A 4D7SA 1GQGA 4OFGA 2Z2SB 4IEXA 4PU7A 1L1MA 2XLAA 4FAHA 2BGCA 5I93A 3EJKA 1QWRA 3H50A 3S8QA 3UKNA 3GN5B 2PUBA 5FLHA 2MPFA 1I6XA 2PFWA 3KSCA 3CJXA 5LEJA 3TNPB 3KGLA 3DNVB 4UXAA 4MCTA 2MEZA 2GC2A 2XLFA 4MH0E 5E16A 1OI6A 1PM7A 4HMZA 3KCCA 3PXPA 2O4AA 3ELNA 1SQ8A 3BPZA 4GULA 4YG4A 2QNKA 3QOPA 1ZRFA 4RD7A 1JWLA 1LR5A 5K8SA 2V09A 1UXDA 4Y42A 1LMB3 2K0GA 5KHHA 3LAGA 1J3PA 1B0NA 1HW5A 2PAEA 3SCFA 5LEKA 3WW4A 3BCWA 3QQ6A 2KPJA 1Q43A 4E2SA 5I8TA 1BDIA 5KHGA 1ZPQA 2Q0AA 3H3UA 3HQXA 1Q5OA 1QP0A 2BNOA 5FQ0B 1WH6A 3SHRA 4UBHA 1XWRA 5LRRA 1DGRA 4I0BA 4XF0A 4X4FA 4EWAA 2GC3A 4DINB 1YFYA 1ZZ9A 4PIYA 2ETEA 3S7EA 2XKOA 5KHIA 1CAWA 3LISA 1DW9A 2ATFA 1ZZCA 4FBIA 3EUSA 1ZUGA 1NERA 4AVBA 2MQKA 1FI2A 3OD0A 1CAVB 2D93A 4I2OA 1UCXA 3EHKA 3NVCA 1VJ2A 4PU4C 1RGSA 2EF8A 4LLOA 2IXLA 4Z82A 3HIFA 1JFSA 3RDIA 2CAUA 3EQEA 3ETQA 5I0RA 1PRVA 1ZREA 2XCJA 3OQNA 3CECA 1YSEA 4MCXA 2PAKA 1OD5A 4UBGA 1XE8A 5A7LA 4IETA 1O3RA 3E6BA 4LEJA 4HLTA 3OP9A 2XL9A 1ZAYA 1SEFA 3LA7A 4N9IA 4MV2A 5CVRA 2PUDA 3JXCL 2XGXA 3E6CC 4L11A 1UPIA 1EFAA 1UXCA 5HI0A 1YWKA 4HVQA 3LFPA 1QPZA 3SCGA 4IEYA 4ORFA 4AVCA 4O8BA 4I3PA 4XFHA 4HZFA 4IWRA 3LA3A 5J48A 3M3IA 2AXZA 1CAWB 3FYMA 3UKTA 3SCHA 3ROUA 3LOIA 2XKPA 2GC0A 3KZ3A 2VECA 3H1WA 4Q29A 4MUVA 5T3NA 4E2GA 1UTXA 2UYAA 2JCGA 5JR7B 3LWCA 2EBYA 1JH9A 1O5UA 1CAXB 3MLFA 2GAUA 4O9EA 2BNNA 1RZSA 4WBBA 1L3JA 3OMTA 1CX4A 3L1PA 5I8SA 1RUNA 1QP7A 2LYJA 3UFDA 3EO6A 1YUDA 4YARA 1I5ZA 1VR3A 2C0ZA 3D0JA 4R8HA 1ZZ8A 2IXHA 3FMYA 3DN7A 2L8NA 2PPXA 2O38A 4YG1A 2ZCWA 1OFNA 4BIFA 1ZVVA 4WVZA 5JSPA 4XF1A 4EV0A 3D82A 3HZIB 5AVPA 4FBFA 4JQDA 3KXAA 4PU3C 5D1IA 3FWEA 4JCYA 2HSGA 3PLQA 4F8DA 3H3ZA 4H7LA 2VQAA 2IVQA 1CAUA 3E5UA 1ZRRA 4EWEA 1GT0C 2ET1A 2GRLA 4KWLA 2EWTA 3H1MA 4XFBA 1J3RA 2IC1A 3JXBC 3MYXA 4MGKE 4XFGA 4XEZA 2HJIA 1RZRD 2IXJA 1EY2A 1S7EA 1YFXA 1YFWA 4NVPA 2P17A 4BH9A 2OA2A 5E1RA 4XF9A 5I91A 4I02A 1RTVA 3BD1A 4B29A 4ZU5A 3H5TA 2EVXA 2LCVA 1IC8A 3BB6A 3HT1A 4OLLA 3FFQA 3USSA 2IVGA 4PIXA 1IPKA 3OQMA 5FDBA 4YBAA 1BDHA 2JVLA 3KGZA 3MZHA 4X4IA 3PVBB 5JSOA 3CO2A 3L2HA 1LCCA 1ZVFA 3CF6E 3RNSA 3RYPA 3BS3A 4Z59A 3FHIB 2A6CA 2QJVA 1Y9QA 2UY9A 3IVPA 2K9ZA 4N9HA 4YNIA 3U0ZA 1QXRA
chains in the Genus database with same CATH superfamily
4PI2A 4QM8A 1IKQA 1CPNA 2B7YA 1S2KA 2Q4SA 4PLMA 2WSVA 2GU9A 4A3XA 5LK5A 1SQ4A 5LASA 3JU9A 4D7YA 3ES1A 2TNFA 5LZ6A 4XIOA 4CDQC 1KEXA 2RDNA 3J7HA 1DWKA 1OOPA 1ACCA 1TMF3 1NCRC 1ZA7A 3GZDC 3BPSA 3VL9A 3SMHA 5EXOA 5HCAA 3ZKCA 1VB2A 5H9QA 3PVOA 4RFRB 5F6LB 1OBNA 4TSVA 1NUKA 4BM8A 3KVBA 1MS4A 4Q0SA 3ZFFB 4NDWA 3AZZA 5DDJ3 1GP5A 1ZYBA 3WF0A 1GKBA 1T6BX 2BWCA 4AAPA 5L73A 5C4WC 4EWDA 4LBQD 2XWJB 4FVVA 1MZFA 3VBOA 1LNSA 2GZWA 5FYUA 3PUSA 1C5IA 1NCQC 2BWAA 3TNQA 1JFTA 2W9XA 2VW2A 1PRAA 5A3TA 4OUSA 1PGW1 5CU1A 1UXXX 2ZKLA 5A7QA 3UGFA 1X33A 3ZFFC 1W9FA 3S7IA 4MZUA 3AL6A 4FPHA 1X9PA 2FHRA 5BPXA 3G7DA 4RA0A 3AM2A 1AL22 4MHUA 5C5UA 5EFUA 1UZZA 2LYPA 4XQWA 5DZGA 3ILFA 1E5SA 3NSTA 4Y33A 2AW6A 1A8MA 1IHMA 1RJ8A 1T2XA 1WETA 5A6XA 5F3EA 1HKDA 1D0HA 1C28A 2VQ0A 2OX0A 3RVHA 4Y22B 3N4MA 4XFAA 2DUOA 2E63A 2J42A 3CROL 2RS11 3NV1A 1COV3 4C91A 5AFBA 5FO8B 3AMQA 1R69A 3D1NI 4QQ2A 4D69A 2WL1A 2XOMA 4HXCA 4AQ6A 1FV3A 1AR71 1WW5A 4HPKB 3UT0A 1CQ9A 3W58A 5KHKA 2GZUA 1KFXL 2X8KA 3KHCA 1OOPB 1CWPA 3FFZA 5FAXA 4F3JA 4CCNA 1QY4A 4IEQA 4V2WA 1VMHA 4FPCA 3TN92 1UMZA 2WIIB 5F6KA 2VZUA 1O91A 2B5AA 4YSFA 2C4XA 1E5RA 4JKKA 5HV4A 1N1TA 1VLNA 4AQ2A 2PQSA 1MQTB 3NNJA 1DCSA 1LCLA 2N7GA 2OT7A 3WXPA 2CYFA 3OTFA 5IYYA 3K2OA 3PMEA 3ZXGA 3K48A 3H8XA 1GOFA 1W28A 3ES4A 3SQOA 1LTEA 4CP9A 3ZXAC 4DY5A 5I0UA 1UXZA 3IB3A 3LEIA 4Z5HA 1W2AX 3LFMA 3GN5A 1OQEA 2ZEWA 3PUQA 1AR62 4G9SB 5BNOB 2XVLA 4TYSA 4Q4W2 2OVUA 4UW6A 4HANA 4Q5OA 4XQDA 4BOWA 3S6PA 4OULA 5KXBA 1G9DA 3TOJA 2GMMA 1JYIA 2A5ZA 5F3CA 1SFPA 1TME2 2ZHNA 3AP7A 3D8CA 2H8RA 1YHFA 5CYYA 3RMYA 4E4SA 4IEWA 3BUCA 3ZXEA 1W8WA 3KT7A 1HXS1 3PHMA 5DT2A 1UZ0A 3ZDVA 2KEIA 2DBNA 2GSYA 3OEBA 4QPGB 3AMNA 2OYZA 3AC0A 3ZHIA 4JCXA 1OUXA 1UX6A 2HBUA 1J83A 2YFZA 1ZM1A 4FOQA 4Q2JA 4HBNA 3SXWA 1JZ7A 5FZ6A 1XBFA 1GQHA 2TUNA 4ITCA 2A6WA 3O1UA 1NY71 3PNAA 3ILNA 5BNPB 5C33A 1DQ2A 4UWDA 1MEC2 1W8HA 3E5QA 3O0XA 4XMAA 3O1RA 2XH6A 4MGSA 2W95A 3H8OA 1ZZBA 5M0TA 5A70A 4CP1A 4EKGA 1EAH3 1RUG1 2VMIA 4N8MA 2Z69A 1WMEA 3H8UA 4FT8A 3ZYFA 3MIDA 3LQCA 2XXZA 2UWBA 3OGSA 4J6GA 4QGLA 1UY3A 4NAMA 1YO8A 2XHKA 4QKDA 2CU5A 5DMYA 1YQ5A 1YLLA 1XNCA 2WDBA 4ZXKA 1R091 4OB4A 4TWTA 5IVVA 3LF7A 2AC1A 2KXLA 1UMHA 5FLJA 2YC2A 3I54A 4XQ4A 3HAGA 3ZR5A 4AHXA 1JYCA 1XYPA 3POSA 1R64A 3QOXA 1TMF1 4Y1UA 3OJBA 4I09A 3EXUA 5JUWA 1LRHA 2ZHKA 4LBKA 3TAYA 2WJSA 4C0BA 3VBUA 2DVDA 1ZRDA 4XURA 1ZBA2 2VMCA 3J7MA 3K46A 1QJY1 4YM1A 4YGCA 5FP4A 4HVOA 4I6UA 4CDQB 3U1XA 5JOWA 4DRVA 2JENA 5EZWA 4DMIA 1XE7A 2PA7A 4Q0VA 3KV5A 3AJYA 1W06A 5C8CC 3WINE 3DV8A 5DTMA 2VZVA 1G6NA 2JG9A 4PCRA 3BIWE 4TXWA 1UW8A 1AX2A 1CQTA 3WVJA 2FDFA 5FY0A 5IVYA 2EIBA 2HWF3 4AI8A 5C9AA 3WW2A 4W65A 2XIUA 1KDKA 2B9UA 5FUIA 1W9WA 3AVSA 1DYOA 3ZYHA 2ILMA 4HL0A 1SCRA 2GH2A 3I7DA 1DGWA 3CEWA 3TRSB 2AXUA 1O5LA 4XBQA 5FZIA 3NWKA 2VPVA 1WKYA 1O4XA 2VZPA 3I2HA 4QDSA 4XE9A 3ZSKA 4A3ZA 1FMD2 1ZZ6A 4I6RA 3CNAA 1COV1 3GDBA 4LHLA 3MUZ1 2VTFA 4V1PA 1RXGA 5ABJB 1N47A 1QJFA 3HPNA 4QX5A 2WN3A 5CKMA 4X8PA 5IAXA 2WNVB 1OLRA 3LPGA 1RHI2 3N9QA 1RXFA 2VOTA 4K8FA 1NXMA 2YV8A 4XHBA 1GFF2 4IW3A 2ZMKA 5T5OA 4EN8B 1KQRA 2B4KA 2NPIA 1S0GA 2ZX2A 4YVWC 2SBAA 3ZN5A 3GF6A 3K4ZA 1WW7A 4FTBA 4LMFA 3PUAA 3HOBA 2HWE2 2EXHA 3GYDA 3Q8CA 3NV2A 2RS52 3DXTA 2WN2A 3J9SA 1I5PA 5K9YA 1GOHA 3IAQA 3HQRA 3CHXA 3F52A 4CEYB 4HK8A 3PJQA 5FWJA 3PIJA 3CZUA 2YB7A 3AZXA 2K46A 2PLV1 2VGDA 4D6RA 1NZCA 3LEGA 3O9XA 4MYEA 4FOYA 3T2OA 4MXVA 4BISA 1V70A 1VBC3 4KG8A 1KJRA 1OQ1A 2G19A 1JXNA 1BLZA 1HJGA 1RUD1 3IT8A 4DB5A 1LOAA 1OMIA 4QGNA 3WQ1A 5BNQA 2W1UA 1O3SA 5C3SA 4M4PA 3GZCA 3ITQA 3LDKA 4IV3B 2PHDA 3QFIA 3GGLA 2D5HA 4J25A 4GIQA 4I30A 3ACHA 1LQCA 4CDWC 5CEHA 5AC92 3NV4A 2AUWA 1JOPA 1WBLA 5C70A 1VMJA 2C1FA 2MNGA 4PHZA 2WZ8A 3GXUA 5FPUA 3DKWA 3QCWA 3DKQA 4O65A 2PN5A 4XJAA 5FZFA 4BK4A 2QUOA 1PVC3 4RQPC 2EAKA 3WUDA 5FBZA 4D7SA 4FTSA 1GQGA 4I0WB 5DRYA 4NAOA 4OFGA 1ND2B 1VMFA 2W87A 3RFRA 1RUG2 3FMGA 3FUOA 5LBFA 1DQ1A 1SHWB 1VBE1 3LKJA 3EJKA 3N35A 5EP9A 3BOWA 1QWRA 4IQPA 4W6YA 4BIOA 3GN5B 1W0PA 2MPFA 2G9FA 3KSCA 5DXDA 5IVEA 2BVVA 3O1VA 5LEJA 5FJKA 2RMU3 1EAH1 4K6BA 5FZAA 3WX5A 3DNVB 3ZPOA 2GNTA 2XWBB 3BGAA 3R0RA 3WDTA 2MEZA 3RZGA 2VC9A 3LOBA 5GAHi 5E89A 4Q4V2 1UY0A 3KCCA 4YVSB 4CEWA 3PXPA 3ELNA 1NT0A 1SQ8A 2RR11 3URFA 4CUBA 4GULA 1QJY2 2J22A 2WNUB 2QNKA 4QX3A 1F9KA 3R09A 4H55A 3TEWA 1ZRFA 4ER6A 1LGCA 1LR5A 3DPRC 3OD4A 5K8SA 5CISA 3OPWA 4Q1RA 4XDOA 3LAGA 4L8QA 1J3PA 2PMWB 4OVEA 4XBLA 2CY6A 2ORZA 5LEKA 3BCWA 4H14A 1Q43A 3G6JB 3I3QA 3I2GA 3KM5A 4XUNA 1QJY3 2JE8A 5TSWA 1BDIA 4HPKA 1XOYA 1JYTA 2K2SA 1W9YA 2YUEA 2Y34A 4YVSA 1FX5A 3IZOA 1W03A 3BTZA 4KI5M 1FOD3 4ZXEA 1Q56A 4EYUA 1RJ7A 1C57A 4COZA 2QQKA 2PXVA 1BBT2 3D5OA 5A7PA 1XWRA 2L1PA 2R042 1UZYA 4X8NA 4NHMA 3ECQA 2ZXQA 2VUCA 1PK6C 1WLWA 3ZSJA 1O8SA 2PXDA 4EWAA 5EIYB 1OXCA 1OVSA 4C1WA 5FR3A 1ZZ9A 3U4SA 3LGRA 3T4HB 2XKOA 1SZBA 4LBQA 1CAWA 1ODMA 1FOD2 2HWF1 3QLQA 4FBIA 4RGKA 4QD2A 5ACA2 1IG3A 3T30A 4JGYA 1YI7A 4AVBA 2YZ4A 2R49A 3O12A 2NQYA 1FI2A 3JD73 4P9JA 1Z0HA 2VE1A 1W2NA 4CRQA 4GQ7A 4IE4A 4DNYA 2XJVA 4I2OA 1W6PB 4L0PA 3VBOC 3VBSA 1UCXA 3NVCA 1VJ2A 3I4IA 2VY0A 4PU4C 1RGSA 2EF8A 1UOBA 3KS7A 1XSQA 1DYPA 4PBOA 1N1SA 1JFSA 1SLLA 2CAUA 4Y1XA 3ZFFA 1UX7A 1PRVA 4NIGA 1L7QA 1UNBA 1X36A 2D3PA 4GJZA 1YSEA 5LY2A 2V73A 1OD5A 4LPLA 1JODA 4YG6A 1RUC3 4URAA 5C3PA 3WSOA 5KR7A 2XL9A 3UJOA 3T4VA 5D2AA 1OKOA 4MV2A 3G0TA 1D0GA 2HWD1 4UAPA 3JXCL 2ARXA 1VBE2 2M4HA 1F4HA 2NLRA 4IV1B 4BQ4A 3E6CC 4S2FA 4K7JA 4BU2A 4L11A 1UXCA 5HI0A 2P3JA 3PURA 4HVQA 2XJTA 3RZHA 3LFPA 1QPZA 3SCGA 4IEYA 3VBRA 5CBLA 1YCIA 4CCKA 2WZR3 3A9ZA 4HZFA 4DO0A 3OOXA 4IWRA 1VALA 5DAXA 5FP8A 1FPN2 2HYKA 2Y6FA 3IAPA 3VHPA 3WP4A 3EB7A 3UETA 2WT0A 2C9KA 2ZZJA 1LU1A 4BJ0A 3LQXA 2BZDA 1RINA 2GC0A 3GBWA 3KZ3A 4CCEA 2WNVA 4LBOA 3PVNA 1NOVA 3H1WA 4Q29A 2CNAA 3VB9A 5AVAA 5D8AA 3UYJA 2ES3A 3MLLA 4QX1A 4D6QA 2QQPA 3LCPA 4NWWA 2EIDA 3MLFA 4CVUA 2BNNA 1RZSA 2XVGA 3WV6A 2BTVC 1IOAA 1YIFA 2PHXA 1QP7A 4S2HA 2XXPA 1VR3A 2PXPA 4C90A 1W2UA 2HBTA 1U5ZA 1OFNA 1V6NA 1ZVVA 4A4AA 5AFEA 4CDWB 3HZIB 4A42A 5BNPC 2OUJA 1LOFC 4BZ4A 2LM3A 2R7EB 3ATGA 4BE3A 2RMU1 3BN6A 4XOGA 1TEIA 4JCYA 4UFIA 1CIWA 2HSGA 5FFOC 3H3ZA 1PIV1 4WVWA 5IUQA 1N3PA 4JKMA 3AYEA 2BFUL 4EWEA 3E5UA 1ZRRA 2DDUA 2ET1A 3ORJA 4CDQA 2JDUA 4O61A 4WM7B 1LOCA 2EWTA 2JDZA 4YW2A 2PXEA 2YC0A 2PXKA 2WAOA 3SISA 4F83A 4ZPIA 2JB4A 4CCOA 1XYNA 1CVNA 4BQXA 2EIGA 2HJIA 3JD72 2EICA 4BMEA 2AEZA 5FZ3A 4BXFA 1EY2A 1S7EA 2YC4A 4YW4A 2I07B 1VBC2 4NVPA 2P17A 1RUJ1 1QMJA 4RS5B 1QQP2 1BEV2 2D7FA 2QQWA 4YW3A 2XHNA 4JDOA 2ADEA 4PDWC 2CSGA 4B29A 1ENQA 4XXAA 3V56A 4LR4A 1BMV2 2Q8OA 1CJPA 2LRPA 5LY1A 1IC8A 4R9AA 2IVGA 1HRI2 4PBPA 5CFDA 2VD7A 2ZACA 2VQTA 4GMP1 4TN7A 3WF3A 2QQMA 1VRBA 1V6JA 1ENSA 1RITA 2X53S 4WV8A 4DUVA 4AVTA 1WD3A 1W6PA 5FZMA 4AF9A 3J4UH 5JSOA 3ACFA 3CO2A 5DG2A 3FN9A 4DQAA 2YDEA 3A9YA 5C3QA 1J1TA 4TLGA 4AR2A 4NJ4A 4NUBA 4XAAA 3RNSA 2VAUA 2PXBA 5JDBA 2DU1A 2ARAA 1UZVA 3FHIB 3MHZA 1RUH2 4JGZA 5SV8A 2J1VA 1DGLA 2QJVA 2WT2A 1W90A 2K9ZA 1QJU3 1HRV3 4YNIA 5JZGC 4Y1VA 3MDPA 4PJYA 2VW0A 3FHAA 4IGPA 2Q5TA 4HVRA 4ZONA 3OEAA 3WNKA 1W04A 1OFSA 1WH8A 1H1MA 1V00A 2WFPA 1H2NA 2CAVA 4MLOA 3WT3A 5FXWA 1EP0A 1O3QA 2CSFA 3ENRA 1CAVA 3UGHA 2O1QA 5T5PA 3GNEA 2HWD3 2R6QA 2D5VA 4ER7A 1UKGA 2ZS6B 4JKLA 1ZS4A 1RUC2 4OUMA 1AYN1 4AHWA 1W8OA 3LDRA 3POEA 2JG8A 4PLOA 4XFIA 3NROA 3WY6A 2XDVA 4UFKA 5C8WA 3UWPA 5L7OC 3P3NA 1WMFA 2WNUA 2D6LX 3KV4A 1CZVA 4QB2A 4QB6A 4ZY9A 1F5JA 4XXPA 4CEWB 5FPXA 4IESA 3WNNA 3J7LA 1SDDB 4LKEA 5CFDB 2DU0A 1XC6A 2WQZC 3VWSA 1OKQA 5H9RA 2TBVA 4EKIA 1U2ZA 5H9PA 1Y3TA 2Y8KA 4GB32 4KNCA 4M3CE 3VN4A 4CYDA 3VKOA 4A41A 1YXWA 3VHOA 3R1FA 3FHQA 2FCTA 1LEDA 2XLGA 3HVDA 3MEPA 5FZHA 3U75A 5ACA3 2W46A 4X4EA 5F8PA 4B3NA 1IPSA 4CZSA 1DIWA 2JDKA 2JXAA 2J1SA 1SLTA 4HSLA 5CIRA 2GMPA 2YGMA 2V4AA 5KXCA 4OI2A 3A4UA 2GRMA 3C3VA 1Q8OA 3OGJA 1R1A1 1RUI1 1PERL 3IM0A 5CNAA 3BU7A 4NO4A 1EV13 1F15A 2BP6A 4M4RA 1X8MA 1RYYA 4I0AA 4QDQA 2E7AA 4JTNA 4Y3OA 1KXGA 4ZS2A 3ZSEA 1D7PM 4BYYA 4ATFA 1QQP1 1DLCA 2E6VA 4HT1T 1PZ7A 4GH4C 2WLQA 2LS6A 2WUSR 5LA2A 3V0BA 4IV3A 2JWPA 4R4ZA 4W6XA 1JYXA 3B7HA 1WIZA 2PHWA 4R9BA 1B35C 1QJX2 4X4GA 2R1JL 1YEWA 4JX0A 1TQ5A 4Z2WA 4P00B 4NHLA 4JTOA 1LULA 3OG2A 5T5LA 2MXDA 2DFBA 1DZRA 2O8QA 3BALA 3PTRB 3MGUA 4LBQB 4IUGA 4WVMB 1DQ5A 1RZRA 5FYYA 5A80A 4S2DA 4YM0A 3N36A 1OVPA 5IHRA 1AR81 2X5IA 2GMEA 3PL0A 4I6TA 2QDNA 2E51A 1ZNPA 1DFQA 3MPBA 4QQHA 2A6ZA 5DQ0A 3THCA 4NRQA 2E9QA 3GCWA 2WZPP 1AYM3 2LLWA 2WZR2 1WGPA 3ZYJB 3GJBA 2E53A 1NQDA 2VBDA 4D7TA 4UI9L 3A21A 2EALA 1RC6A 2GN3A 5KBFA 1IS6A 1Q8VA 4NPLA 3NAPA 5BY5A 1VBD1 1H2MA 2W52A 1X8EA 4Q27A 1F31A 2IFWA 3ON7A 1Y4WA 4P5HA 2BV4A 4FXGB 2RV9A 2GNDA 1GZCA 1H4HA 2ZTNA 1LJ7A 3OY8B 1M06G 1I3HA 5F37A 4CDXB 3M4FA 5FZ9A 2XG3A 3MIFA 4QKBA 4AQSA 1WWYA 1UOFA 2RHPA 4PQ9A 1H1IA 1C3HA 3SH5A 2ENRA 3KJXA 1MR5A 2OPKA 4NRMA 1DQ4A 2XMLA 4RGGA 4EN6B 5A7NA 3UKVA 4B1LA 2R073 1AR82 2W08A 1ND2C 2B45X 3M70A 4QXHA 4JQRA 1I1EA 1SLIA 2VR4A 2DCTA 1S4CA 3OCPA 3Q9OA 4IL7A 1PGL1 3RG0A 1SFNA 4KWKA 4CPBA 4YYOA 3QOWA 5C9AB 1XU1A 3SKJE 2XXQA 5FQ0A 3A23A 3LA2A 1JZ6A 2WKKA 4F7ZA 3F2ZA 3ZHMA 1OA3A 1QJZA 4I3GA 4SBVA 1COV2 1HRV1 5FK7A 2WA3A 5FZCA 2D6NA 2VZRA 5FCCA 5DG1A 4LO4B 5JAXA 1C8M1 5FY7A 4BA6A 2P4EA 2XJ3A 3W21A 4E4DX 4X4BA 3ZM8A 1JN2P 2OUHA 2IXCA 2SLIA 3KHBA 4JGYC 4OHZA 3FYAA 4DXRA 3QBQA 4K21A 4ZZ5A 1LHWA 4XZPA 3IMNA 3DCQA 1CGPA 2AGSA 4CDXC 4Z8BA 1HJFA 2O0OA 3UL2A 3WNXA 4IEZA 1VBA3 2BUKA 5EHDA 4MGYE 1W05A 2PXJA 4Z07A 1AYN3 3RPQA 3GBFA 5JI7A 1UD1A 4NIIA 4JGYB 4AEDA 4YVWA 3N7JA 1QIQA 4NROA 3LIGA 2H0VA 3TRBA 1QQAA 4IEPA 3ZKUA 5LA1A 3VKMA 3FX3A 3RI9A 1AJOA 2D3SA 2FMDA 5IW0A 3WQ7A 4Q0QA 2WQ8A 4ES9A 2GH8A 1PVXA 2JDNA 2IUOA 1UU4A 1TVGA 1OUSA 2VJXA 2ZKNA 4O9GA 1BKZA 2BPA2 3HT2A 3O0VA 5I0DA 2WUHA 4XBNA 1NE4A 2Z42A 2Q8EA 3OGVA 1MFQC 5DUUA 1FPN3 5FMOS 4ZKTB 1J59A 2B42B 3MIBA 3QWGA 2DFCA 4FN3A 2FQPA 3BKZA 4OHYA 1DZTA 2JDYA 2OW4A 1Q8SA 5H9SA 5IFPA 2BBVA 4UT5A 1GNHA 2DTYA 4JHZA 3VBRC 3CLCA 1R092 1GZWA 2OPWA 2QDRA 4CUAA 5ACA1 1OHFA 3N3HA 4DXSA 5FJHA 4YG7B 2VOWA 4PU8A 1G7YA 2GNMA 1NEQA 1HB3A 3KZ4C 3DPRB 4QX2A 4C1XA 1NE6A 1UYYA 4P9YA 4AEKA 2P1BA 2UWCA 5A3OA 5EYYA 1D2SA 3WW1A 5J3UA 4LBLA 1AYM2 1R1A3 1XNAA 1RUI3 2A6YA 3DGTA 1GU3A 3HN1A 3N7MA 3NJVA 1KS5A 3NJXA 4Q4V1 5FO7B 3THTA 2JECA 3KT4A 4YZ3A 5EYXA 1ASJ3 4BHPA 1UZWA 1WCQA 2B5HA 4MGTA 1QQP3 3MF9A 4EN0A 2X29A 3DL3A 4Z5DA 1RL3A 3GZUC 1MVEA 1FNZA 3MLKA 2YGLA 1SMVA 2EAAA 4JRAA 4XDPA 2XUMA 4LTAA 4YRDA 1WLTA 1JTZX 2WAAA 2AACA 1J58A 1US2A 3KQ4B 1DDLA 1CJGA 4Q4X2 5BNOC 4Q4X1 2OIIA 4SLIA 3TEXA 2HEYF 2HWC2 3WDWA 2AUYA 2R0FA 2QVSB 1JMUB 1MS0A 2H6BA 3THDA 3QYXA 5CG9A 3M3QA 4FPLA 2VMDA 3UJQA 4K1YA 5LWBA 1AR83 4NIDA 4Y24A 1W99A 2NMOA 3AKQA 3GCXA 5LA9A 1B35B 4RN5A 1JZ2A 3MICA 1AYM1 3HQUA 2PUCA 3IIAA 3KMHA 5FY9A 4HG6B 1MACA 3NDBB 4B7KA 1QNWA 1OSLA 1H6XA 2PHRA 3AFGA 4XUPA 3O1PA 2QQVA 1VPHA 2AYHA 3D0SA 4XIKA 4KGGA 4CTEA 2AREA 3DPRA 2W47A 1KDMA 4N43A 5G04L 4XUOA 5T55A 4QHZA 2ZGPA 4QX0A 1A78A 2XSDC 4IV3C 4JQTA 4EROA 5JSRA 3T0DA 1H2KA 4LBMA 1QXJA 4GWNA 4Y5Z0 4XYXA 3OQOA 3B93A 5DUXA 3O14A 5FZGA 2HFZA 1G8WA 3KVAA 4LA2A 3D4KA 3A9XA 1WCSA 4BK5A 3ASIA 5A6QA 3Q8FA 3O1SA 2Z2SB 4IEXA 4PU7A 3ZYRA 2XLAA 5J09A 4AVVA 5I93A 5CG8A 2R071 5JIUA 5A6YA 1AX0A 3MEJA 1I6XA 3AB0A 1H9WA 1VBB3 2DCZA 2Y26A 5DDJ1 3CJXA 1UY4A 2BBAA 2E33A 3TNPB 4K1ZA 4CP0A 5FYMA 1N3QA 4UXAA 4M01A 4MCTA 2NZ9A 2XLFA 3IMMA 4KH9A 3WHTA 1OI6A 1PM7A 2C6SA 5IJRA 4IDZA 3RZJA 4UF0B 1MZEA 3DF0A 1RUD2 3DYMA 2FDGA 2ZAAA 2CHHA 4CDUB 1C8M3 3QOPA 4AOCA 4RD7A 2D6KA 2OQ7A 1K42A 2P3YA 4GZ9A 1VAKA 2VNOA 3OUHA 2VTXA 2WSUA 3X29B 1HW5A 5C4WB 2OXBA 3ZXDA 3SCFA 1SPPB 3OUIA 4JRLA 3QQ6A 2KPJA 1XNDA 2RDRA 4E2SA 2ERFA 1HQWA 3VBHB 2BU9A 1ZPQA 5L36A 3EMRA 5FYTA 4ET7A 3GHMA 4PI0A 1OLQA 2D43A 3H3UA 3I3BA 3NJYA 3ZMOA 2DBIA 3SX0A 3IKWA 1V0AA 3DUIA 3HQXA 1VAVA 4FOVA 5AC93 3BTXA 1GLHA 2BNOA 1NXD1 1PVC2 5FQ0B 1WH6A 4Z1VA 3CKHA 3HR9A 1WUVA 1PGL2 4CDUA 3AMHA 4XF0A 3VZMA 1LOBA 2GC3A 1YFYA 5F5QA 5HCHA 2ETEA 5KHIA 5CFCA 3T2QA 2GN7A 1ZZCA 5J1XA 2J1AA 4DPNA 5GZEA 1DYKA 4TZDA 4Q8KA 1ZUGA 1SDWA 5CA6A 5F2SA 1IGOA 2ZOEB 1QU0A 5E88A 2BERA 5A33A 1N1VA 3B5LB 3GBGA 4FI9A 2NMNA 3CU7A 4Y4RA 2VM9A 1SLAA 2IXLA 4Z82A 3VUOA 2B39A 2DCKA 3EQEA 3VDCA 2OQ6A 2Y6GA 4AEDC 1ND3C 3JCIA 4BQ2A 5F7UA 1ZREA 5GLUA 1UWWA 2AENA 1DP0A 1JS9A 3AYDA 5ERLA 2XJSA 3VLBB 4CSWA 3ZFGA 1XE8A 1RUE3 5A7LA 2A6VA 2WLPA 3JUUA 1O3RA 4LEJA 2ZHLA 1JBCA 5F5CA 1IZ3A 1UU5A 1UU6A 2WZEA 1ZAYA 1SEFA 4N9IA 1GNYA 2Q1FA 3UNPA 1D2QA 2PUDA 5FZ0A 1HXS3 1OLMA 2XGXA 2Y6KA 1M4WA 1RHI3 1RMU2 1UPIA 1B35A 1YWKA 4ORFA 4Q4V3 4AVCA 1A3KA 4O8BA 2ODRD 2ZX1A 1SG3A 4KMQA 4UFJA 1LHVA 4AL9A 1BJQA 1TE1B 2VBPA 3MV11 4WM7C 3ZFEB 5J48A 2AXZA 1CAWB 1JH5A 5LBEA 1N1YA 3SCHA 4DXZA 2X5IC 3A7QA 1V9U2 4FQ4A 1WMXA 2XKPA 3OGGA 5CKQA 4RS5C 4GH4A 3RGBA 5JI9A 2W3JA 1ZBE3 2ZGSA 4UFLA 1OSGA 4MUVA 5T3NA 2VUDA 3VBUB 1DULA 4UOJA 4UFMA 2UYAA 2ZX0A 4BQYA 4OI0A 1W6OB 2KM2A 4LJHA 2BVBA 4KG0A 2HCSA 2HLEA 1Z7S3 1JHJA 2ZX4A 2EBYA 4RHV1 3SITA 1CAXB 3OBTA 5A3PA 5F9TA 1WA6X 4O9EA 1R093 4IV1C 3J8F3 4WBBA 5HCFA 1NG0A 1S0DA 2HWB3 2R061 3PMSA 1RUNA 3UFDA 5GZDA 1LAJA 3KV6A 4YW1A 3MW2A 1I5ZA 3D0JA 1H8VA 3I2DA 3O5SA 4R8HA 1ZZ8A 5FYHA 2FDKA 3FMYA 1DLLA 3DN7A 5FPBA 2FZ2A 2PPXA 4YG1A 4FPYA 2W0XA 4DE9A 4BIFA 1RUF3 4ER3A 4WVZA 5FV3A 2QQUA 1V6KA 4JGZC 1VBA2 4GALA 3THPA 5JVVA 1ULOA 5D1IA 5HBAA 3SR4A 3TYJA 4FPFA 1MS3A 4QKNA 3PLQA 5FYZA 4F8DA 3VKLA 4H7LA 1H8TC 4ASKA 2VQAA 3O0WA 3VD4A 1W2OA 4LK6A 4FFIA 1IS5A 4S2GA 1D4M3 1JI6A 3Q8EA 2GRLA 1W39A 4KWLA 2CGOA 5T5JA 1NCRA 1UOGA 2R30A 2WT1A 1J3RA 5F32A 1Q8PA 2W91A 2IC1A 3HNMA 3AMPA 4XFGA 5FMCA 5JMOA 1OH4A 1X9TA 1GWLA 2J7UA 5LBCA 4H7MA 1BZWA 1WZXA 5JZGA 1YFXA 3M3OA 3CIHA 1YFWA 2JG8C 5JOYA 2RS31 4FP3A 3RWKX 1JZ4A 4ISRA 2OS2A 5HPOA 1G9CA 3VKNA 3DM5A 4WVVA 5FPLA 5I91A 3KD4A 3BD1A 1AXZA 3L2YA 5C8CA 2HWC3 5FO9B 1TME3 2VCCA 1P8JA 4LQRA 4P9XA 3VBHC 5JXJA 1CX1A 2LCVA 3B7MA 1PZ9A 2W1WA 4OLLA 3FFQA 4JAAA 4INDA 4EZIA 3AKSA 1IPKA 1D4VB 2VZ3A 5FDBA 2WO1A 2KD7A 3QH7A 5EQUA 5FZOB 5T50A 4ARYA 4X4IA 1Y43B 3ETPA 2J1UA 3PVBB 4UFHA 3K4DA 5T54A 5B4NA 3L2HA 3M7AA 1LCCA 5IATA 4H3WA 2WNUC 2XJRA 4E8CA 4QX7A 1UN1A 3H0OA 5DN2A 2D6OX 2WWSA 5L19A 4CEYA 4DY3A 2C26A 1UOJA 2ZABA 2DWRA 3BS3A 1AL21 1OPMA 3OGRA 2JKBA 2VVFA 4KWUA 5E6HA 2QQJA 4W8JA 2ZGLA 2PLV3 3WHUA 2YYOA 2RS51 3NO8A 2D3RA 4NOTA 5D21A 4AEDB 1A34A 1VBC1 4DOUA 1QXPA 4GA9A 1RUD3 5CAZA 1FAYA 4HKLA 2QQNA 3TN93 2VVEA 2ZZQA 1REEA 4Q26A 4A6SA 4AI3A 4Y20B 1PO11 1QDCA 3VD3A 5BNNB 2GALA 5JXHA 4KL1A 5FZLA 4OI4A 1KGYA 2B9VA 3AK0A 3T1LA 3M1HA 1H2LA 4K3UA 5FP9A 1XPWA 3DYPA 5F5IA 3VKFC 3BDNA 2D44A 2BYVE 3LEMA 1W9TA 2IVBA 4OBMA 3RYKA 3B3QE 1JUHA 4A45A 2ZGTA 5K98B 2VBBA 2ZGRA 1RUE2 2WYFA 4BQWA 5FYIA 1X82A 4FPEA 1PVC1 5IFTA 2BJSA 1XJAA 1PK6B 3A0NA 1O4TA 4IERA 2AXVA 3INAA 3ME2A 4Q0UA 4QPYA 4XJ8A 5A6ZA 2FDIA 3ZXJA 1LENA 4YFZA 3NKTA 4LA3A 2LUWA 1VBE3 4Q1PA 4XMIA 2XVKA 5A7WB 3W20A 1C1LA 1K5MC 5FMDA 3VV1A 4ER0A 1HRI3 2LROA 3U14A 4LO5B 2V5DA 2XXAA 3IDEA 5A7WA 4MADA 2V5YA 3N7KA 4JDNA 5DUWA 2JQEA 2A3XA 4XFFA 3V0BB 3KQRA 4EZHA 1F2NA 2ZBJA 5J98B 3SH4A 2PE5A 4XUQA 1SPPA 2XB6C 3IN9A 4RYDA 2PQQA 4DXTA 2HINA 3AKRA 5DDJ2 2JDAA 2R63A 1K12A 4MX3A 5CADA 4AI9A 1S0FA 1JU3A 2J7MA 2JE7A 2HWB1 2RM22 2R063 3J8F1 2KA3A 3M8LA 4MGZE 4WM8B 3JZVA 5FZ4A 4HSJA 1HB1A 3RZLA 4RQPB 2LYQA 4M3CF 1W8ZA 2IFRA 5FXZA 3U10A 3E5XA 5D8AB 3RWNA 1GNZA 4QXCA 1UPSA 5DABA 2IV1A 4EN7B 5C3OA 4DZGA 2ZMNA 1NLQA 5IK5A 1X7NA 2NN8A 4FAGA 1JHNA 1CAUB 5KXDA 5ABJC 2AH2A 1AF9A 1KD7A 3PU3A 4QGMA 3AXEA 3VDDB 1W3XA 4KU7A 1FOD1 3VZKA 4A7ZA 3JBG3 4XACA 3NNGA 5JXGA 1FYUA 5J37A 3I49A 3GALA 1MS9A 2IVJA 3N7LA 1EV12 3K3NA 3C8XA 2JD4A 4L97A 4FFHA 1UYXA 2EF6A 4AHZA 2P5BA 4MXWB 2IU7A 2ICTA 4HETA 2ADDA 2G9ZA 1GP4A 3B02A 4N7UA 4BQ1A 4J1XA 3FE5A 1QOTA 2QKDA 2OR1L 4XETA 1JU4A 4YFWA 4GKYA 3N9PA 4IE7A 1V6OA 2I45A 2ORXA 1IS3A 1ZRIA 2JG8B 2YU1A 4I8TA 1ZA4A 2VOKA 3FC0A 2YBDA 1UAIA 5IK8A 2ZGNA 1JOBA 2Q30A 2FBEA 2XBO1 4YGBA 4HN0A 3P6BA 4MHRA 5FY5A 5BUVA 3T2PA 1PO23 2W5FA 4XVHA 1QJU2 4YVSC 5C8CB 2PHUA 3ZR6A 4R52A 2C9AA 1QJEA 4JVAA 2DCJA 2ZGQA 2RE9A 1H0BA 3V65A 2CWMA 1YI9A 4E4HA 5BYNA 2XI8A 3ACLA 3WG4A 1OF3A 4BPZA 4MOAA 1JZ8A 2D40A 3KV9A 3PVEA 5I8YA 1RUC1 4CU6A 4A6OA 1XRUA 4ES8A 1XNBA 3NXHA 2PXQA 2A73B 3GZEA 4BB3A 5CKNA 4XF3A 5LK7B 1HF0A 4F8AA 4CP9B 3F51A 3H7JA 5ANQA 4YM2A 4ER5A 1GSLA 2PHTA 2LYRA 4LUMA 2PXUA 1H4GA 1MS1A 3EYPA 5A1FA 1D4M2 3D3AA 1WW4A 4QDRA 5K0UB 3TEZA 3ZLIA 3ZYGA 4IXLA 4Z5CA 2RJ2A 1EYBA 1Q8QA 4NPRA 2DVAA 2QZ3A 4GAZA 1BXHA 1KITA 1RVF1 1S1AA 1OC1A 2VOVA 4ZZ8A 1LB2A 3MLJA 2EXIA 3WDYA 5A3NA 4AE2A 2BNMA 2ZJCA 2CTVA 4MGIE 3QACA 4V2VA 2OFYA 4J1WA 3E97A 4JZRA 4L99A 2VMFA 4Q0PA 4Z2AA 1YNAA 1SLBA 2DVGA 3TN91 3S0MA 4BLJA 4Y26A 2RDSA 4GB33 5FUPA 3HEIA 4Q8LA 4WM8A 1UL9A 2D6MA 3BU0A 3RRDA 4RR3C 5JPMB 4IE5A 4X4DA 4JDMA 1W2TA 3C7GA 2XBO2 2X5IB 4Q4W3 3U11A 5BNNC 1SBEA 2WA4A 2RM21 3J8F2 1AR91 3SLIA 4QHBA 1PZ8A 2ZGMA 1BQPA 1H1AA 5KC5A 2KEJA 3UESA 3IBMA 4QQOA 1ENRA 1QF3A 3AYCA 5BXXA 1JOJA 5EJ3A 4AFCA 1BMV1 5ISLA 1HN1A 1IQDC 2RVAA 2PUAA 1I9RA 1V9U3 4IVZA 4KGQA 2W94A 2PXLA 4LK7A 4AI1A 1YJLA 1TNRA 1RUJ2 3G5GA 1PMHX 2LYKA 2WFF3 4O7XA 1S0BA 5F5AA 2JDHA 1PGW2 3O7OA 2A6XA 2BGOA 3HJRA 1H8TB 2XL7A 4BQ3A 5C3RA 2GC1A 4GQMA 3RQ0A 1J3QA 2DV9A 4OMDA 3AKTA 4NMIA 2P3KA 1HLCA 1X57A 1RPEL 3ZIWA 1CESA 1LOGA 3POFA 3FJSA 4XABA 1CIYA 5ANNA 1DHKB 1LU2A 3CJIC 2XQRA 3WF1A 3ZMNA 5IVFA 1K5JA 3EBRA 4I01A 4LOTA 4QMAA 3POIA 2B8MA 4PDWB 4XFCA 4LLFA 1QP4A 3AFKA 1DQ0A 2EA7A 2RG4A 2Y6LA 3GJAA 2QE3A 3OBAA 4L9BA 4M0HA 1PO12 1XSRA 4AGVA 4CP2A 4Q4Y2 2HWB2 2P37A 3T09A 3FLTA 2KZ8A 2H6CA 1UYZA 1YJKA 1WA4A 3I3EA 4U2AA 1XE0A 2CGNA 3BOPA 4E27A 1AUYA 1US3A 4D8MA 3W5MA 3BIEA 4MXWA 1W8TA 2VMGA 3E6DA 3GM8A 4P02B 1W9SA 3KL4A 3ZXLA 2HCNA 3U4XA 4XDQA 2Q1ZB 4CU7A 3TEYA 1W6NB 3N9NA 1NLSA 3CDZB 5FPAA 4COVA 5C5TA 3RZMA 2UY8A 3VDBA 4IE6A 5JWPA 2VZQA 4LE3A 3VBFB 1POV1 3WCSA 4XZUG 2WS91 1S0CA 4WZCA 1PNRA 1DF0A 1GICA 1Z78A 2BQPA 4EQVA 1AR92 1O8PA 3ALQA 3H7YA 3ZSMA 3WG2A 2BEOA 4FXKB 5IT6A 2I2SA 5HXVA 4CEWC 1U5YA 4GWMA 1MQTC 2E7TA 2V4VA 1NCQB 4GHJA 3I59B 1TMF2 2XBO3 1C5HA 4P9GA 5ABJA 5F1RA 1PO21 3WUCA 3PTYA 3RS6A 2FMYA 2MEV1 4PIZA 4CUGA 2W39A 4QM9A 4GKXA 1LECA 4AEMA 2PAMA 3C7OA 4CDUC 4BCUA 1XU2A 2YMZA 3ZKYA 4QHOA 3VBHA 4KU8A 1UY1A 3SKVA 4OUEA 4QQPA 1OF4A 1RUI2 1UKRA 4ASMB 4XTPA 5F3GA 1QZXA 4QU1A 3I2KA 5GKAC 1T6GC 1NLRA 4FAHA 2BGCA 1ULCA 3DXUA 2HWD2 3VBSB 4C8DA 3UKNA 2F17A 2PUBA 3WF2A 3OKZA 5A7SA 5HV0A 4EQZA 4MGQA 4QPWA 5FXXA 4CXYA 2HEVF 2UU8A 3KGLA 2O14A 3Q8AA 1OQDA 4P08A 3M9LA 3T2TA 5F39A 5E16A 1OD3A 2GC2A 5FZDA 5A1LA 3ZOIA 4XJ9A 5JLVA 3BPZA 5LATA 1W6MA 2YBSA 2RS13 3PDQA 3VD5A 4LKSA 4YG4A 5A3LA 5JUVA 2YROA 5B2GB 1JWLA 1AVBA 3I97A 4JHTA 4B4RA 4FSJA 3F95A 3IPVA 5T52A 4LORA 4Y42A 3ZN6A 5FOBB 1LMB3 5FPVA 2PAEA 2WABA 2WBKA 1STMA 2Q1MA 2YY1A 2P6CA 2IWGB 4QKFA 1MZ5A 1AYN2 2D98A 4Q4W1 4RQPA 1OLME 3M3CA 2Q0AA 3WDUA 2P2KA 2RM23 2Z79A 3BYWA 2O8OA 1BVVA 1GQPA 1S2BA 3C7EA 4DE8A 4WM7A 4ASLA 2ZX3A 4N43B 2E26A 1Q5OA 4MSVA 1HB4A 4QPIB 4A7YA 1WLDA 1YQ6A 2V72A 3CQOA 3JB8A 4UBHA 3SHRA 4DS0A 3S5AA 3MV01 4R9DA 1DGRA 2KR2A 4XCBA 4I0BA 4FPKA 1NX9A 1EV11 2J7WA 4X4FA 4Q2FA 1JZ5A 4PIYA 1U0AA 3LISA 2WFF1 5FKCA 2UWAA 4RFT0 1HX6A 1GWKA 1OA2A 4QAWA 4CDWA 4WVLA 5JPNB 2QQLA 2MQKA 4LOSA 4XPVA 4Z92B 4XHXA 1DGWX 1CAVB 1LODA 4QWNA 2RJLA 4Y1YA 4AG4A 1RB8G 2D93A 2XJUA 1QHDA 4DUXA 1MS5A 5A3MA 3EHKA 1WCKA 2JE9A 4CPBD 4URTA 1AR72 5GLZA 1YIPA 3P1IA 3HIFA 2DUQA 1CN1A 5JZGB 3OBRA 2XCJA 3WNPA 2D6PA 3J26N 4MCXA 3K51A 4UBGA 3ACGA 4NIHA 1KRIA 4IETA 2GP3A 1YQCA 2VTXJ 5KC6A 3OP9A 3LA7A 1XNTA 5A33B 2WO7A 2YFUA 4P5YA 3H42B 1VBD3 1W6QB 1MEC3 1Z7S2 4YZ4A 2A70A 2LALA 2JDPA 1YYNA 2VCMA 3H3LA 4NRPA 4AI2A 1EFAA 4NR1A 5JIAA 5C71A 2VCBA 4AFMA 1W8NA 2VQUA 4XILA 1SCSA 4RGAA 3ZVXA 3PE5A 1A6CA 3MW4A 4LKFA 1C8M2 5A3UA 1VE0A 1IG0A 2GP5A 2WO3A 2BW8A 3E1F1 2MEV2 3ROUA 1TZOA 5FZ7A 1PO22 4M3CB 1WMDA 2LLVA 1VIWB 2VVDA 4RS5A 2VH9A 3IIIA 1BHGA 2F6BA 3PUIA 4N53B 3SEEA 3AYAA 4PDWA 2F4LA 3JQXA 1UTXA 1W8UA 1X50A 1GR3A 4CCLA 2X05A 3KF5A 4YG0A 2MEV3 5JR7B 3LWCA 2ZEZA 3LB9A 1G9BA 3BVCA 4DEVA 4CU8A 1JYNA 1W6OA 2GAUA 3RJ2X 2WS92 1UO9A 3RI8A 4GWJA 1L3JA 2W1SA 1Y7BA 2BFUS 5FKBA 3ZFGB 2Y6JA 5B4XA 3USUB 1YUDA 2C0ZA 2XJQA 3AP6A 4QX8A 2GNBA 2IXHA 3FUQA 1QH6A 3JB4C 1AZDA 2ZCWA 2YHJA 1VB4A 4YZ1A 1HQLA 3ZO0B 1O59A 3T1MA 4FBFA 4JQDA 1HQ1A 5DPNA 4PU3C 2JEMA 3U78A 5FMOL 3AKPA 3VBOB 5L9VA 5G05L 3WOGA 2QQIA 1GT0C 3C7FA 5IAVA 4COUA 3ZIXA 4W50A 5D8AC 2I74A 3H1MA 4LIUA 4XCAA 5E8AA 5F3IA 5CB7A 2Y60A 5FZEA 4MGKE 3JXBC 1J84A 1FPN1 3MI8A 3MYXA 2E31A 2X10A 4WM8C 1ASJ2 3HWJA 1LOEA 2WO2A 2VL4A 3DYOA 5J36A 1R083 2Y6HA 5FWEA 5L7OA 4W6WA 3LPFA 3OY8A 4P9LA 4Y20A 4L92A 4OHWA 3WLUA 4AHYA 1HV0A 5BNNA 1AXYA 5E1RA 5DSXA 4PT6A 3VDAA 3MW3A 4GWIA 4I02A 1RTVA 4YWAA 3CBNA 1WW6A 4ZU5A 3VZLA 2V3CC 2VCAA 3HT1A 1RUOA 2A3YA 1F4AA 3USSA 5CFCC 3WD5A 1DGRN 4LO7A 3OQMA 3POWA 3S5QA 5DTRA 4YBAA 1BDHA 3KGZA 3VGIA 3MZHA 4RR3A 3WF4A 4G3YC 2R16A 3NNMA 2VXJA 3V0AA 5J96B 1HIXA 2JIJA 1ZVFA 2XR4A 2YPDA 5LW9A 3I3MA 3T3YA 4YW6A 1CZSA 3AMMA 3ZFGC 4AEJA 1F35A 2Y38A 1EPWA 2ZEYA 4Z59A 5EJZB 2NM1A 5FY1A 1L7LA 5BNPA 1JYVA 1Y9QA 2ZHMA 2E32A 4FPOB 3MFAA 5DZEA 3NNFA 4UW3A 3AZWA 2RS32 3U0ZA 2HWF2 4GMP0 4PF1A 3HMYA 1REFA 2PHFA 4N53C 4D94A 4QPIA 3UGGA 3QF3A 1PRUA 3I2FA 1L7RA 3USUA 4OZOA 1FT9A 3AZYA 4NHYA 4NN0A 1UMIA 3WCRA 3TEPA 3IWZA 3VHNA 3WW3A 3K75B 1GZWB 1BBT1 3QD6A 3VD7A 1URXA 4IEUA 3WDVA 5DTQA 1ZZ7A 3LE0A 4AGRA 3AP5A 2ARBA 4IEOA 2IXIA 4UF0A 1MEC1 3T0BA 5CFDC 4A44A 2JB8A 5GLTA 4FTEA 2UYBA 4ISQA 3R6SA 2DVBA 4OMCA 1O4YA 3SC7X 2OKXA 4AAXA 5FOJB 1W8FA 1ZBA3 5JMCA 4KBZA 2Z5WA 4OHVA 4E2QA 1U5XA 4ZU7A 1TNFA 1QH7A 5EPAA 5JCTA 1BK0A 3SH3A 4X6RB 1VRH3 1W6MB 2JD9A 4CXWA 1S0EA 4KBBA 4EZ4A 1OT5A 5FUNA 2RR13 4D6SA 2QQOA 5CFCB 2WRAA 4CCMA 4H2AA 4X4HA 2J1RA 5FZKA 2PXTA 1VBB1 1QJX3 2R1DA 2PUFA 3B9IA 1MQTA 1QOSA 3H1YA 4LE4A 2Q8CA 3OYWB 1VP6A 4ATEA 4OQ8A 4BQ5A 4E8DA 1VRH2 4QQLA 4LUKA 5FBJA 4KQ7A 2R062 1EAH2 5EWSA 1ADRA 4COYA 3VBSC 3LEKA 3KT1A 2VU9A 2VZSA 4RHV2 4WZFA 5FMBA 1XYOA 3ST7A 4TTGA 4JCKA 5FPZA 3WG1A 5IK7A 2ZAHA 2FJRA 1BYHA 3T08A 4JC1A 4DIQA 3N9MA 3OBZA 5C7GA 3VK0A 3MIEA 2QFEA 1CAXA 4QB1A 1WCDJ 3NW4A 2B46X 3DECA 2J1TA 3W5NA 2R043 2E7QA 3ACIA 1FNYA 1ST8A 5C4WA 2Y0OA 5FK8A 1ENXA 1VPWA 2FFHA 5FREA 4AZZA 2EXJA 2PYTA 4HONA 5DAWA 4LITA 3B9CA 1NCQA 2F4PA 2X09A 4ZU4A 4IEVA 3NV3A 1W0OA 1DU3D 4OI1A 5AC91 2CGPA 1CD3G 1YFUA 5LRSA 3KCXA 2VOXA 3JD71 3PIGA 4JGZB 5FLIA 2JG9B 3RYRA 1E3OC 4R9CA 5J7MA 1ND2A 2YBPA 1HB2A 3C7HA 1QEXA 3OF1A 5FYVA 5FZ1A 4K20A 2VO5A 5GM0A 4AFBA 1U5IA 3HNYM 4A2UA 5JOZA 4XW3A 2ZGKA 2JJ6A 2MHFA 4NPMA 3ZYIB 5GALA 1PMJX 3VBFC 4HRAA 2W1QA 2PIJA 2H0BA 2IZWA 4CDXA 2L49A 2HEWF 4TLFA 1A8DA 1OA4A 4PF5A 1LHOA 2OZ6A 5DRTA 3FBYA 2O49A 1HQNA 3FLRA 2ET7A 3N9LA 5L7OB 1PGSA 4L2NA 3MF6A 2FDHA 3PUHA 1R081 4MG2A 1S0IA 3AXDA 1H9PA 3S57A 1HN0A 1IQAA 1IPJA 2HWE1 5IK4A 2C5DA 3IDCB 5FYSA 3W9AA 2D97A 1XXNA 5EJ1B 1PHMA 1QGLA 1U12A 2VMEA 2CDOA 1R082 4OQ9A 1H30A 2YXSA 3TB0A 2CROA 3JBG2 2VUAA 3WP5A 4BWOA 4B1MA 3ZFEC 4WVMA 1RUE1 2WZR1 1FXZA 1CR7A 1GUIA 3CJIB 3HN3A 4CCDA 3O1OA 1OCTC 4IE0A 3K77A 4DRRA 3KLSA 1NA1C 4FQZA 3I8TA 4META 1AJKA 2XUEA 4Y5TA 2ZMLA 5FRAA 2LYLA 1RUH3 1O6UA 1PNGA 4PLNA 4YGDA 1LOFA 1OPOA 3ABZA 4Q4Y1 2FD8A 1RHI1 3U07A 1TG7A 4YVWB 4YW7A 2A75A 3CL1A 5L9BA 1R1ZA 3FL7A 4G4FA 1XB9A 3CLPA 2CV6A 2PELA 2XJPA 2LW8A 4M0NA 4LKDA 5BV6A 2JDMA 4QPGA 4LXLA 2JIGA 2G9GA 4B8EA 3I2JA 4CXXA 1EUTA 1K45A 1Q3EA 4XAEA 1XNKA 4HFSA 1MVQA 1SLCA 3O1TA 3KCYA 3UK9A 1EPZA 3I2OA 1GOGA 1IKPA 1WD4A 5I0SA 1LLIA 1POUA 4LO8A 5FYBA 4AXOA 2BJCA 2ICPA 3OUJA 4XTMA 1ZBE1 3VZNA 4BLIA 1V6LA 1R63A 1OH3A 1R1A2 4P9IA 2PUGA 1BBT3 2VUJA 2VXRA 1KS4A 5BNOA 1W3VA 1VBD2 1LHNA 1NCRB 4B7EA 5JOXA 1Z7S1 1OURA 4D3WA 1CZTA 2VW1A 4RHV3 2LNMA 3TELA 1HDKA 5K7PA 4GD4A 1ZBA1 4OYUA 4KWJA 3POJA 3L9JT 3VL8A 3VHRA 2AZ5A 1O4ZA 1JZ3A 1NYWA 2VZ1A 1GYKA 1LCDA 3MO4A 1PIV3 4YPJA 2QBXA 3ZDSA 2DUPA 1VRH1 2DURA 2P3IA 4XUTA 4RL7A 2G1MA 2QCSB 4LHSA 1K3IA 2D5FA 1RUF1 1ODNA 4U36A 5KHJA 3VD9A 4AVAA 2R072 1PNFA 3OWQA 3KWVA 3K4AA 1E5HA 4M00A 1QJX1 3LDBA 4GJYA 1W6QA 4N43C 5K0UA 4CA9A 2Y33A 4W4ZA 4X4CA 3N9OA 3ZX7A 1RVF2 1CONA 3GHNA 3QH6A 4HKOA 1GMMA 2ZGUA 3WDXA 1F8VA 4FPJA 5FP7A 3WNLA 2WC2A 1NW3A 3GZTB 3WNMA 2BRTA 2LYSA 1ND3B 1SFYA 2AR6A 1D4M1 2YG0A 3LZZA 4FFFA 1RUJ3 5DAVA 3ZPXA 3B94A 3WR0A 2WFF2 5LCWL 1X2LA 4YZ2A 2JICA 2IVIB 2UURA 4Y1ZA 5GZFA 3FZ3A 4B4QA 5FYCA 4AVSA 2A1XA 2ID4A 4LULA 5CZKA 3ZXFA 3H8RA 3IPVB 3ZN6B 5APAA 3D6EA 5L9RA 4DUWA 3NRUA 1O7FA 1WCUA 2R041 4IA8A 2AWIA 3HD8B 3POBA 1LEMA 4JV4A 4GXLA 2FDJA 4ONUA 3MFCA 1OOPC 4GMP3 3RZZA 1O3TA 4AYUA 1ZX5A 1QDOA 2WIUB 2RS33 1AL0G 3R4DB 1QQBA 4P9WA 1ZRCA 2FCVA 1APNA 1JW6A 1LKNA 1NY72 1PMIA 3NJZA 2PTMA 2C24A 1RIOA 2XQXA 3MBWA 3OB8A 1KJLA 4P14A 5LBBA 5GZGA 1AU7A 2WWUA 1NA1B 2HWC1 2IXKA 4QXBA 1TME1 1UIKA 1N3OA 2BDRA 4B4PA 3WP3A 3VBUC 1H8TA 2HKXA 4NIAA 3PU8A 1LGNA 3IDBB 2KEKA 4HN1A 2VNGA 1HXS2 1CPMA 3JXDL 1LGBA 2FCUA 1YQ2A 4YLZA 4LNVA 1UIJA 3NMBA 1QJU1 3V0AB 4K8RB 2FZ1A 5I0TA 3AP9A 4DEQA 4RR3B 4AFDA 2RR12 3NL1A 1NZIA 2WR9A 3LSDA 5K4LA 3ME5A 2JG9C 1HV1A 2A3WA 4Z58A 2BOJA 2OZJA 2PHLA 1Y7YA 4LT5A 2PUEA 2LTNA 3F6WA 3VDDA 5JXIA 5GJ6A 1AL23 5HCBA 4RSUA 2XPJA 1C4RA 2VEOA 1ZBE2 2HWE3 2RS53 3I59A 1J1LA 2XONA 3OSDA 1BEV1 3H9AA 3LSEA 3NQHA 4LBNA 4QXKA 4X6QB 4XF4A 3ZN4A 1H6YA 1V6MA 1G9AA 3U3WA 5A1AA 2VG9A 5FIXA 3DEMA 4AWDA 4LHNA 1PO13 5FP3A 1ONAA 1WLCA 3AJZA 1RMU1 2JKXA 5GLWA 4CCCA 3WEZA 1L1MA 3AVRA 3RSJA 4K9SA 1SBFA 3W59A 3VBFA 5IVBA 3HBKA 1Y9GA 3H50A 3S8QA 2ZGOA 1VAMA 5FLHA 1RUH1 3VZJA 4LO6B 4AFAA 4Q4Y3 3MPPG 2PFWA 4FP2A 5IWFA 3JQWA 2CL2A 1V6IA 5A32B 2BGPA 2ZEXA 3MIHA 4HOOA 4ZHNA 1PIV2 1REDA 3IDAA 4MH0E 3WP6A 1DBNA 4HKWA 1MPXA 4HMZA 1AR63 2PXFA 2O4AA 2RMU2 3LFIA 4XC9A 5A3WA 4BMBA 4DFSA 3GZAA 3SEPA 4LBJA 3ZSLA 5IVJA 1HRI1 1GV9A 3BTAA 3MIGA 5FXVA 2RJKA 2V09A 1UXDA 1S0JA 2K0GA 3I2IA 4Y22A 5KHHA 1B0NA 3M2MA 4MO3M 4NWVA 4C0HA 3TBDA 3WW4A 3ZYPA 5I8TA 4FCAA 1PX3A 3AX4A 2Q8DA 1YQ8A 5KHGA 2TEPA 1HRV2 3NAPC 2Y0IA 4CCJA 1AHSA 1S55A 2WWJA 1QP0A 1GBGA 2EXKA 1POV0 4LIVA 2P34A 3A0KA 4R4XA 1LHUA 1ULEA 2R1BA 5LRRA 4N53A 3OPTA 5FY4A 3K3OA 4IGQA 2JX9A 4ARXA 2DYCA 4EK9A 3ZYBA 4M3CA 3TWIA 4DINB 4E4ZA 1W6NA 1E57A 3GZDA 3S7EA 2ARCA 3V64A 1Y9MA 5KWRA 1DW9A 2ATFA 2HH9A 2VNRA 2NYYA 1FMD1 3JXSA 3EUSA 2A71A 1NERA 1ULGA 5JR2A 4D0QA 3JBG1 5A32A 2P6HA 4IV1A 3OD0A 3VZOA 1MZ6A 4XJZA 3AZVA 1UF2C 4IGOA 5GAGi 1PX4A 5A7OA 3R05A 3OPZA 3J7NA 4LLOA 1FATA 4ZS3A 1CJDA 4MVTA 4EN9B 2BOIA 3RDIA 2WNEA 3MUY1 2A7AA 3ETQA 2EIEA 3RJRA 5GLVA 5I0RA 4XJUA 3PJYA 3UV9A 3OQNA 3CECA 2ZPXA 5C6CA 3NAPB 2PAKA 5EV7A 4BDVB 5SV5A 3E6BA 4N7IA 1WBFA 1K5MB 4HLTA 1B09A 1XQNA 4FFGA 4BXSV 5DAQA 5C9AC 3Q8BA 2YU2A 5CVRA 4AGGA 2VZOA 5K0UC 3WZ1A 1FV2A 2WNOA 2CWSA 2DVFA 3B00A 3FBMA 1AX1A 5IVCA 4E9KA 1GZ9A 2VMHA 1SACA 4AW7A 3CZJA 4I3PA 4XFHA 3A22A 4CUCA 4Y4YA 2W2IA 3CMGA 3RMXA 3LA3A 3M3IA 3P5BA 3POYA 1MS8A 3FYMA 2R0HA 3R4SA 1NAEA 5FZ8A 3UKTA 1BCXA 3P3PA 3AP4A 4A7KA 3LOIA 1PM4A 2DF7A 3NNLA 1KFUL 3APBA 3WNOA 5HXMA 2VECA 1UY2A 1PK6A 3WQ0A 4E2GA 1BK1A 3M3EA 1POQA 2WINB 4HK9A 1JUIA 2JCGA 2AEYA 1RVF3 4YG3A 4YM3A 1GWMA 3POGA 5DZFA 3TFLA 4EE2A 3T0AA 1DG6A 1JH9A 1O5UA 2CDPA 1BEV3 1VBA1 3ZPYA 5FY8A 2GDFA 3BODA 5FZBA 3OMTA 1CX4A 3L1PA 5I8SA 5F2WA 4XJWA 4YZ5A 2LYJA 1AR73 1GP6A 3EO6A 4GB31 4YARA 3SNMA 1RMU3 2QZ2A 5LB6A 4AI0A 1ALYA 1VBB2 3OYWA 4OZXA 4QT6A 2YBKA 2L8NA 3R4UA 5DAPA 4CE8A 2O38A 4EJRA 1W0NA 5JSPA 4YW5A 1ND3A 3LD8A 4XF1A 1NKGA 3D82A 4EV0A 5AVPA 3S30A 4K40A 1RIRA 3LIHA 1AR93 2DTWA 4FPGA 1ULDA 1ULPA 3VBRB 3WQBA 3KXAA 3FWEA 3VDDC 1YC61 2RDQA 4GH4B 3ZXKA 1GZTA 5GZCA 4QPGC 2Z4FA 1ULFA 1JYWA 2IVQA 3NZLA 1AR61 1CAUA 3I3DA 3ZFEA 2WQ4A 1SBDA 1V9U1 4CEYC 3KF3A 4NHKA 4XFBA 1NA1A 2YPJA 4FO9A 5FTTC 5FZOA 4FOWA 2VNVA 4PQQA 1BVP1 4UW4A 5LA0A 4YGEA 3WG3A 3RZKA 3KB5A 4XEZA 3O1MA 1E5IA 1RZRD 2G4IA 2IXJA 3B69A 1QNYA 2DCYA 1ASJ1 1EUUA 4BH9A 2OA2A 4QPIC 1GANA 2WNVC 4XF9A 1RUF2 1IS4A 3BI3A 4AQTA 2WYSA 3ILRA 4OCTA 3HBZA 5DUVA 1S2EA 3BTYA 1G86A 3H5TA 2EVXA 1NQJA 1DZQA 3AL5A 1QKQA 3BB6A 2QTWB 3NKGA 4Q4X3 3GUUA 4PIXA 1UQXA 2IUWA 2VZTA 2JVLA 2HYXA 3HNBM 1C8NA 2RS12 1FMD3 4LHKA 3CF6E 1QOOA 2L9LA 4UW5A 2VULA 2PLV2 1QB2A 4NHXA 3U37A 5KXEA 2W92A 3RYPA 2R32A 4COWA 1K5MA 1RUG3 4OHXA 4QU2A 2A6CA 1G9FA 3FLPA 1DQ6A 1POV3 2Y64A 4N90A 1YRZA 4Y5SA 2UY9A 2WS93 3IVPA 1F5FA 1LESA 4AK3A 4CU9A 1AXKA 3B01A 1C1FA 3CJIA 4N9HA 2W68A 2J1EA 2ZA9A 3C2UA 4UYBA 2NP0A 4NE9A 1UYPA 1QXRA
chains in the Genus database with same CATH topology
4QM8A 1IKQA 1CPNA 2B7YA 1S2KA 2Q4SA 4PLMA 2WSVA 2GU9A 4A3XA 5LK5A 1SQ4A 3JU9A 4D7YA 3ES1A 2TNFA 4XIOA 4CDQC 1DWKA 1OOPA 1TMF3 1NCRC 3VL9A 3SMHA 5EXOA 5HCAA 3ZKCA 1VB2A 5H9QA 3PVOA 5F6LB 4TSVA 4BM8A 1MS4A 4Q0SA 3ZFFB 4NDWA 3AZZA 5DDJ3 1ZYBA 5C4WC 1GKBA 2BWCA 5L73A 4EWDA 4LBQD 2XWJB 4FVVA 1MZFA 3VBOA 2GZWA 1C5IA 1NCQC 2BWAA 3TNQA 1JFTA 2VW2A 1PRAA 4OUSA 1PGW1 5CU1A 2ZKLA 3ZFFC 1X33A 3S7IA 4MZUA 4FPHA 2FHRA 5BPXA 3G7DA 4RA0A 3AM2A 1AL22 5EFUA 1UZZA 2LYPA 4XQWA 5DZGA 3ILFA 3NSTA 2AW6A 1A8MA 1IHMA 1RJ8A 1WETA 1HKDA 1D0HA 1C28A 2VQ0A 4Y22B 3N4MA 4XFAA 2DUOA 2E63A 2RS11 3CROL 5AFBA 3NV1A 1COV3 4C91A 5FO8B 3AMQA 1R69A 3D1NI 4QQ2A 4D69A 2WL1A 4AQ6A 1FV3A 1AR71 1WW5A 4HPKB 1CQ9A 3W58A 5KHKA 2GZUA 1KFXL 2X8KA 1OOPB 3FFZA 5FAXA 4F3JA 1QY4A 4IEQA 4FPCA 3TN92 1UMZA 2WIIB 5F6KA 1O91A 2B5AA 4YSFA 1N1TA 1VLNA 4AQ2A 1MQTB 1LCLA 2N7GA 3WXPA 2CYFA 3OTFA 3PMEA 3ZXGA 3K48A 3ES4A 1LTEA 3ZXAC 4DY5A 5I0UA 4Z5HA 3GN5A 1OQEA 1AR62 4G9SB 5BNOB 2XVLA 4TYSA 4Q4W2 2OVUA 4UW6A 4HANA 4XQDA 4BOWA 3S6PA 4OULA 5KXBA 1G9DA 3TOJA 2GMMA 1JYIA 2A5ZA 1TME2 2ZHNA 3AP7A 3D8CA 2H8RA 1YHFA 4E4SA 3RMYA 4IEWA 3ZXEA 3KT7A 1HXS1 3PHMA 2KEIA 2GSYA 4QPGB 3AMNA 2OYZA 3ZHIA 4JCXA 4FOQA 1UX6A 4Q4V1 4HBNA 1ZM1A 3SXWA 1GQHA 2TUNA 4ITCA 2A6WA 1NY71 3PNAA 3ILNA 5BNPB 5C33A 1DQ2A 1MEC2 3E5QA 3O0XA 4XMAA 2XH6A 1ZZBA 4CP1A 1RUG1 1EAH3 2VMIA 2Z69A 1WMEA 3H8UA 4FT8A 3MIDA 2UWBA 4J6GA 4QGLA 1YO8A 2XHKA 1YLLA 1XNCA 4ZXKA 1R091 4OB4A 4TWTA 2KXLA 5FLJA 3I54A 4XQ4A 3HAGA 4AHXA 1JYCA 1XYPA 3POSA 1TMF1 4Y1UA 3OJBA 4I09A 3EXUA 2ZHKA 1LRHA 3TAYA 4LBKA 2WJSA 4C0BA 3VBUA 2DVDA 1ZRDA 1ZBA2 4YGCA 1QJY1 4YM1A 4HVOA 4I6UA 4CDQB 5JOWA 4DRVA 2JENA 5EZWA 4DMIA 1XE7A 2PA7A 4Q0VA 3AJYA 5C8CC 3WINE 3DV8A 1G6NA 2JG9A 4PCRA 3BIWE 1UW8A 1AX2A 1CQTA 3WVJA 2HWF3 4AI8A 5C9AA 3WW2A 4W65A 2XIUA 1KDKA 2B9UA 2ILMA 4HL0A 1SCRA 2GH2A 3I7DA 1DGWA 3CEWA 3TRSB 2AXUA 1O5LA 4XBQA 3NWKA 2VPVA 1O4XA 4XE9A 3ZSKA 1FMD2 1ZZ6A 4I6RA 3CNAA 1COV1 4LHLA 4V1PA 5ABJB 1N47A 4QX5A 4X8PA 2WNVB 1OLRA 1RHI2 4K8FA 1NXMA 2YV8A 4XHBA 1GFF2 5T5OA 2ZMKA 4EN8B 1KQRA 2ZX2A 2NPIA 1S0GA 4YVWC 2SBAA 3ZN5A 3GF6A 1WW7A 4FTBA 2HWE2 2EXHA 3GYDA 3NV2A 2RS52 3J9SA 5K9YA 3F52A 4CEYB 4HK8A 3PJQA 3AZXA 2PLV1 2VGDA 1NZCA 3O9XA 4MYEA 4FOYA 4MXVA 1V70A 1VBC3 4KG8A 1KJRA 1OQ1A 3IT8A 1JXNA 4DB5A 1RUD1 5KXDA 1LOAA 1OMIA 4QGNA 3WQ1A 5BNQA 1O3SA 4IV3B 2PHDA 2D5HA 4GIQA 4I30A 1LQCA 5AC92 3NV4A 2AUWA 1WBLA 2C1FA 2MNGA 3DKWA 3QCWA 2PN5A 4XJAA 2QUOA 1PVC3 4RQPC 2EAKA 3WUDA 5FBZA 4D7SA 4FTSA 1GQGA 4I0WB 4OFGA 1ND2B 1RUG2 3FMGA 3FUOA 1DQ1A 1VBE1 3N35A 3LKJA 3EJKA 3BOWA 1QWRA 4IQPA 4W6YA 4BIOA 3GN5B 1W0PA 2MPFA 2G9FA 3KSCA 5DXDA 2BVVA 5LEJA 2RMU3 1EAH1 4K6BA 3WX5A 3DNVB 2GNTA 2XWBB 3R0RA 3WDTA 2MEZA 3LOBA 5E89A 4Q4V2 4YVSB 3KCCA 4CEWA 3PXPA 3ELNA 3URFA 1SQ8A 2RR11 4GULA 1QJY2 2WNUB 2QNKA 1F9KA 1ZRFA 4H55A 1LGCA 1LR5A 3DPRC 3OD4A 5K8SA 4Q1RA 3LAGA 4L8QA 1J3PA 4OVEA 4XBLA 2CY6A 5LEKA 3BCWA 4H14A 1Q43A 3G6JB 3KM5A 1QJY3 5TSWA 1BDIA 4HPKA 2K2SA 2YUEA 4YVSA 1FX5A 1FOD3 1Q56A 1RJ7A 1C57A 4COZA 1BBT2 3D5OA 1XWRA 2R042 1UZYA 4X8NA 4NHMA 3ECQA 1PK6C 1WLWA 3ZSJA 4EWAA 4C1WA 1ZZ9A 3LGRA 2XKOA 4LBQA 1CAWA 2HWF1 1FOD2 3QLQA 4FBIA 4QD2A 5ACA2 4JGYA 1YI7A 4AVBA 2YZ4A 2R49A 3O12A 2NQYA 1FI2A 3JD73 4P9JA 1Z0HA 4CRQA 4GQ7A 4DNYA 2XJVA 4I2OA 1W6PB 3VBOC 3VBSA 1UCXA 3NVCA 1VJ2A 3I4IA 2VY0A 4PU4C 1RGSA 2EF8A 3KS7A 1DYPA 4PBOA 1N1SA 1JFSA 1SLLA 2CAUA 4Y1XA 3ZFFA 1PRVA 1X36A 2D3PA 1YSEA 2V73A 1OD5A 4YG6A 1RUC3 2XL9A 3UJOA 4MV2A 1D0GA 2HWD1 3JXCL 2ARXA 1VBE2 2NLRA 4IV1B 3E6CC 4S2FA 4K7JA 4L11A 1UXCA 5HI0A 2P3JA 4HVQA 2XJTA 3LFPA 1QPZA 3SCGA 4IEYA 3VBRA 5CBLA 1YCIA 2WZR3 4HZFA 4IWRA 1VALA 3VHPA 1FPN2 2HYKA 3WP4A 2WT0A 2ZZJA 1LU1A 1RINA 2GC0A 3GBWA 3KZ3A 2WNVA 4LBOA 3PVNA 1NOVA 3H1WA 4Q29A 2CNAA 5AVAA 5D8AA 2ES3A 3MLLA 2QQPA 3LCPA 4NWWA 3MLFA 2BNNA 1RZSA 2XVGA 3WV6A 2BTVC 1IOAA 1YIFA 2PHXA 1QP7A 4S2HA 1VR3A 4C90A 1W2UA 1U5ZA 1OFNA 1V6NA 1ZVVA 5AFEA 4CDWB 3HZIB 5BNPC 2OUJA 1LOFC 4BZ4A 2LM3A 3ATGA 4BE3A 2RMU1 4XOGA 1TEIA 4JCYA 1CIWA 2HSGA 5FFOC 3H3ZA 1PIV1 4WVWA 5IUQA 1N3PA 3AYEA 2BFUL 4EWEA 3E5UA 1ZRRA 4CDQA 2ET1A 4WM7B 1LOCA 2EWTA 2JDZA 4YW2A 2YC0A 3SISA 4F83A 1XYNA 1CVNA 2EIGA 2HJIA 3JD72 4BMEA 1EY2A 1S7EA 4YW4A 2I07B 1VBC2 4NVPA 2P17A 1RUJ1 1QMJA 4RS5B 1QQP2 1BEV2 2D7FA 4YW3A 4JDOA 4PDWC 4B29A 1ENQA 4XXAA 3V56A 4LR4A 1BMV2 2Q8OA 1CJPA 1IC8A 4R9AA 2IVGA 1HRI2 4PBPA 5CFDA 2ZACA 4GMP1 2X53S 1V6JA 1ENSA 1RITA 4WV8A 4AVTA 1WD3A 1W6PA 4AF9A 3J4UH 5JSOA 3CO2A 4DQAA 5DG2A 2YDEA 1J1TA 3RNSA 5JDBA 2DU1A 3FHIB 1RUH2 4JGZA 5SV8A 2QJVA 1DGLA 2WT2A 2K9ZA 1QJU3 1HRV3 4YNIA 5JZGC 4Y1VA 3MDPA 4PJYA 2VW0A 2Q5TA 4HVRA 1OFSA 1WH8A 1H1MA 1V00A 2WFPA 1H2NA 2CAVA 4MLOA 3WT3A 1O3QA 1EP0A 2CSFA 3ENRA 1CAVA 2O1QA 5T5PA 3GNEA 2HWD3 2R6QA 2D5VA 1UKGA 2ZS6B 1ZS4A 1RUC2 4OUMA 1AYN1 4AHWA 4XFIA 3WY6A 2JG8A 4PLOA 5C8WA 5L7OC 3P3NA 1WMFA 2WNUA 2D6LX 1F5JA 4XXPA 4CEWB 5FPXA 4IESA 5CFDB 2DU0A 2WQZC 1OKQA 5H9RA 2TBVA 5H9PA 1Y3TA 4GB32 4KNCA 4M3CE 3VN4A 4CYDA 1YXWA 3VHOA 3R1FA 1LEDA 2XLGA 3MEPA 5ACA3 4X4EA 4B3NA 4CZSA 1DIWA 2JXAA 1SLTA 4HSLA 5CIRA 2GMPA 2YGMA 5KXCA 4OI2A 3A4UA 2GRMA 3C3VA 1Q8OA 3OGJA 1R1A1 1RUI1 1PERL 3IM0A 5CNAA 3BU7A 4NO4A 1EV13 1X8MA 4I0AA 2E7AA 4JTNA 3ZSEA 1KXGA 4BYYA 4ATFA 1QQP1 2E6VA 4HT1T 1PZ7A 4GH4C 2WLQA 2WUSR 3V0BA 4IV3A 4R4ZA 4W6XA 3B7HA 1WIZA 2PHWA 4R9BA 1B35C 1QJX2 4X4GA 2R1JL 4Z2WA 1TQ5A 4NHLA 4JTOA 1LULA 5T5LA 2DFBA 1DZRA 2O8QA 3BALA 3MGUA 4LBQB 4WVMB 5J37A 1DQ5A 1RZRA 4S2DA 4YM0A 3N36A 1AR81 2X5IA 2GMEA 4I6TA 2QDNA 2E51A 1ZNPA 1DFQA 3MPBA 4QQHA 2A6ZA 3VKOA 2E9QA 2WZPP 3ZYJB 1AYM3 2WZR2 4D7TA 1WGPA 2E53A 1NQDA 2EALA 1RC6A 2GN3A 5KBFA 1IS6A 1Q8VA 3NAPA 5BY5A 1VBD1 1H2MA 2W52A 1X8EA 4Q27A 1F31A 2IFWA 4P5HA 4FXGB 2GNDA 1GZCA 1H4HA 2ZTNA 1LJ7A 3OY8B 1M06G 1I3HA 4CDXB 3M4FA 2XG3A 3MIFA 4AQSA 2RHPA 4PQ9A 1H1IA 1C3HA 3SH5A 2ENRA 3KJXA 1MR5A 2OPKA 1DQ4A 4EN6B 4RGGA 3UKVA 2R073 1AR82 2W08A 1ND2C 2B45X 3M70A 4JQRA 1I1EA 1SLIA 3OCPA 2DCTA 3Q9OA 4IL7A 1PGL1 3RG0A 1SFNA 4KWKA 4YYOA 5C9AB 1XU1A 5FQ0A 3LA2A 2WKKA 4F7ZA 3ZHMA 1OA3A 1QJZA 4I3GA 4SBVA 1COV2 1HRV1 2WA3A 2D6NA 5FCCA 5DG1A 4LO4B 5JAXA 1C8M1 4BA6A 2XJ3A 4E4DX 4X4BA 1JN2P 2OUHA 2IXCA 2SLIA 4JGYC 4OHZA 3FYAA 3QBQA 4K21A 1LHWA 4XZPA 3IMNA 1CGPA 2AGSA 4CDXC 4Z8BA 2O0OA 3UL2A 3WNXA 4IEZA 1VBA3 2BUKA 4MGYE 4Z07A 1AYN3 3RPQA 3GBFA 5JI7A 1UD1A 4JGYB 4AEDA 4YVWA 3N7JA 2H0VA 3TRBA 1QQAA 4IEPA 3VKMA 3FX3A 3RI9A 1AJOA 2D3SA 2FMDA 3WQ7A