2BNMA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords EPOXIDASE
total genus 46
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnmA02
1PMIA 3U10A 3EHKA 3L1PA 4I01A 4ONUA 2O8QA 1NXMA 4XFGA 4XF1A 4K8FA 1EPZA 1RTVA 2GZUA 2PAMA 4Q0QA 4X4IA 4HBNA 2IXCA 3R1FA 2UYBA 1RC6A 1O3SA 1ZZBA 3H1YA 4BHPA 3CL1A 3WW1A 4FAHA 3OF1A 2C0ZA 2PUEA 1NEQA 3D82A 4D7TA 3PVBB 3MDPA 3QYXA 4QMAA 3RPQA 1UTXA 4OLLA 1Y3TA 4FBIA 3JXBC 1WH6A 5LEJA 1IC8A 1H1MA 4PJYA 3E6BA 3QQ6A 2Q30A 3ZHMA 4Y42A 1YLLA 3E5QA 1NERA 2QCSB 3DNVB 5I8YA 1X7NA 3RYPA 3JZVA 1ZRDA 1X2LA 1O7FA 2Y0OA 1SEFA 2PA7A 2LYKA 1O4XA 1PRVA 1O4TA 3CLCA 2R1JL 3GYDA 2EWTA 4F7ZA 4LLOA 1J3RA 5KHJA 4XF4A 1ZS4A 4JTOA 3H3ZA 2B9UA 2LYLA 5E16A 2PIJA 4AVCA 1ZX5A 4EWAA 1CAUA 3FYMA 2D5HA 1L3JA 4D7SA 3KGLA 2PPXA 3ETQA 1NE4A 4IEUA 4MCTA 3H3UA 1L1MA 1JFSA 4DINB 4HSJA 4IEVA 3VHRA 1UD1A 4X4CA 4YYOA 2QVSB 3OD0A 4PIYA 5AVPA 1VP6A 4IEOA 4J1WA 2PUAA 3DN7A 3UKTA 3CROL 1ZZ9A 5JSPA 3BD1A 4I8TA 3G7DA 3D0JA 4Q0SA 5K8SA 1LCCA 4XETA 1OSLA 1FI2A 4IEZA 4X4HA 3OQOA 5I8SA 2ZKLA 3H7YA 4X4DA 1X8EA 2GAUA 2EAAA 4MGKE 4QGNA 1DWKA 4IEPA 5LRRA 5F1RA 1LRHA 3GBFA 2OA2A 1ZRFA 5D1IA 3U11A 1WETA 1ZNPA 4QXKA 2D5VA 4PU3C 3RNSA 1WLTA 4WBBA 2XHKA 4Z07A 1CQTA 4X6RB 3M3IA 1HF0A 4JCYA 3B7HA 1ZVFA 2IXJA 3FX3A 3WW2A 4NDWA 1RGSA 2OYZA 1WH8A 3I59A 4META 3S7EA 1GQGA 1OD5A 2KXLA 1VR3A 1RUNA 3BPZA 2KZ8A 3SCFA 4JV4A 2ETEA 1I6XA 1ZZCA 4I2OA 4RD7A 1WA4A 2UY9A 3KGZA 3JXCL 1QP0A 1J3PA 2EBYA 3IDBB 4GULA 3BDNA 1DZRA 3E6CC 4F8AA 2H6BA 3OTFA 4MGIE 2GH2A 4MH0E 2PUBA 1ZAYA 4FT8A 1UIKA 1ZVVA 3PXPA 2PUFA 3DL3A 4MCXA 1DGWA 5I93A 2P17A 2PUDA 3S7IA 3JXDL 4XFCA 3FZ3A 3IVPA 5CVRA 1ZREA 4KWKA 4MZUA 2FJRA 3CEWA 1LCDA 1X57A 1OI6A 4MUVA 3USSA 3QWGA 2EVXA 1BDHA 3I7DA 5I0RA 1PRAA 2XLAA 2O4AA 2Z2SB 3BB6A 1O5UA 4XFBA 3LFPA 3KXAA 3FFQA 2MNGA 2I45A 3CECA 3UFDA 3ES1A 4BIFA 3MPBA 4ZU7A 3M70A 1RZSA 3OQMA 2ICTA 1QQAA 2UY8A 3RYKA 1JFTA 1QY4A 2LYJA 3FHIB 3RDIA 1XE7A 3CJXA 1PRUA 2IU7A 3ACLA 4BH9A 3F52A 2XL9A 3TNQA 1Y7YA 4YG4A 3S8QA 2BJCA 2CAVA 3U0ZA 1RUOA 3PLQA 4KWJA 4R52A 1G6NA 3UKVA 2H6CA 1YUDA 2H0VA 3O14A 1AU7A 1PM7A 4MGZE 2IC1A 2ICPA 2EF8A 4XF0A 1UIJA 3ST7A 3SHRA 4N9IA 2B5HA 5E1RA 3RYRA 3R6SA 3FWEA 4Z5CA 3QACA 1CX4A 1VJ2A 2BEOA 4IEXA 4E2SA 3N4MA 2O38A 2L8NA 1QP4A 4LUMA 4HN0A 4JTNA 5KHIA 3SXWA 2R63A 5FLJA 2XKOA 2ZCWA 2EA7A 4IESA 5CU1A 5JAXA 2A6CA 4UBGA 4E2GA 4Q29A 4LA2A 4HVOA 5T3NA 1QQBA 3CF6E 4IA8A 3HIFA 4PU4C 4LEJA 2GU9A 4AXOA 5EFUA 2GRMA 2FQPA 2V09A 1Q3EA 3LAGA 3NSTA 1H1IA 5FQ0B 4I6TA 2QDRA 3ROUA 4XFFA 4FN3A 4E2QA 5HI0A 1EY2A 3GN5B 1J1LA 3H8UA 3EQEA 1FT9A 1NYWA 4Z82A 1YFYA 4FBFA 2XIUA 3SCHA 4MV2A 2JCGA 4EWDA 2N7GA 1TQ5A 4XFIA 3E5UA 2MEZA 1YFXA 2LYRA 1JWLA 1YSEA 2XCJA 2XGXA 1DGRA 4KU8A 4B29A 1POUA 4IEQA 4X4EA 3IBMA 2WFPA 1ZUGA 1R69A 2DCTA 1OFNA 2CAUA 2XI8A 4HMZA 4XFAA 3FMYA 3E97A 4N9HA 2IVBA 4QGLA 1QPZA 4I6RA 2Q4SA 3TRBA 3HT2A 1FXZA 2VQAA 1SQ4A 2MHFA 4HN1A 1Q43A 4XF9A 1EP0A 3ZHIA 3DKWA 4CYDA 5J3UA 2QNKA 4EV0A 1ZZ6A 4OB4A 3VK0A 4X4FA 3FJSA 2KEIA 4LUKA 3HQXA 2ET1A 1HW5A 2PHDA 3KSCA 3QF3A 3MZHA 1UXCA 1O3QA 2XLFA 4HVQA 1IPJA 4BYYA 1UW8A 3LZZA 1DZTA 4ZU4A 4Q0UA 5JCTA 1QWRA 1LQCA 4KU7A 4IVZA 4F8DA 1SFNA 3KMHA 2AXZA 4PU7A 2AXVA 1JUHA 4YARA 4HSLA 1YHFA 1WGPA 2ET7A 3FYAA 3WW4A 2IXKA 2GRLA 2GZWA 2IVGA 3WW3A 2XL7A 5K98B 1V70A 3D1NI 2OPKA 2OR1L 1B0NA 3I54A 4J1XA 5JR7B 2KEJA 5BV6A 1EFAA 5FPZA 4XFHA 2FMYA 3H9AA 4EROA 4I6UA 5KHKA 3MYXA 1PERL 4IERA 3ES4A 3QOPA 2OZJA 2LYSA 4MGYE 3ELNA 4NVPA 4Z58A 2D93A 1J58A 2HKXA 3LWCA 3EJKA 2LYQA 2BNMA 5FLIA 3F51A 2IXLA 2PE5A 1RZRD 1O5LA 4AVBA 1DW9A 2B8MA 1XWRA 1X82A 4KL1A 4ORFA 2XSDC 2K0GA 5C6CA 3H1WA 4EWEA 4LULA 2ATFA 2PTMA 5BUVA 2BNOA 3NVCA 3U3WA 3OGJA 4Z5HA 2AUWA 4I02A 5BXXA 1CAVB 3S0MA 5LEKA 2MQKA 4O9GA 5FQ0A 2B5AA 4QGMA 3D0SA 1SQ8A 4PU8A 4Q0VA 1UXDA 5FLHA 1CGPA 2O1QA 2OZ6A 2GC3A 1OMIA 3SCGA 3IDCB 2Z69A 1GT0C 4L2NA 4Q0PA 4YSFA 3L2HA 1RZRA 4L11A 2Q1ZB 3H1MA 2IUOA 4YG1A 4I0AA 5I0TA 5EZWA 1R63A 3OCPA 4HVRA 3F6WA 4FAGA 3E6DA 1NZCA 5FCCA 4GQMA 5C8WA 5J48A 4XEZA 1ZRCA 4TLFA 4X4GA 3HZIB 3KJXA 2XJ3A 1YFWA 5KHGA 3NL1A 4GHJA 1LKNA 2PQQA 4A2UA 4JVAA 3OP9A 3O9XA 1J59A 1RL3A 1Q5OA 3B02A 4O8BA 1BDIA 2VECA 3E5XA 4IEYA 4QM9A 5JSOA 3EUSA 4R8HA 1LB2A 2H8RA 5KBFA 4XF3A 4IEWA 1XRUA 3UKNA 3OMTA 1EYBA 1CAXB 3BCWA 4Z5DA 3C3VA 4MX3A 4IWRA 2VPVA 5FDBA 5I8TA 2IXIA 3PNAA 1XE8A 3GN5A 3LA2A 2PAEA 4P9GA 4WVZA 3MLFA 3SMHA 3CLPA 5LRSA 2D5FA 2E9QA 1CAUB 4I3PA 2BYVE 3BU7A 1JH9A 4O9EA 3TNPB 4I0BA 1VPWA 1O3TA 4QM8A 1ZPQA 3H7JA 4QX5A 3H50A 1ZZ8A 3LISA 1UPIA 3RZZA 4LTAA 2UYAA 5J7MA 1GQHA 2GC2A 5I0SA 1WIZA 2Q0AA 1QXJA 2AW6A 4IETA 3BALA 1E3OC 2BNNA 5I91A 4YG7B 1RPEL 1QXRA 4AQ6A 2D40A 2F4PA 2HINA 3IWZA 1YFUA 1RIOA 4YNIA 2WIUB 2MPFA 2L49A 2PAKA 4H7LA 4HLTA 2CSFA 3G5GA 2KEKA 4WZCA 2AXUA 3NW4A 1S7EA 3LA7A 2PUGA 2XLGA 1UCXA 2IXHA 1CAWA 3KCCA 2CV6A 3BS3A 1U12A 3I59B 3LA3A 2PUCA 2GC0A 1ADRA 2AWIA 1CAVA 2LCVA 3CO2A 3DV8A 3OQNA 5A7LA 2OFYA 4UBHA 3EBRA 2PHLA 1J3QA 4PIZA 4JQDA 2QJVA 3ZDSA 2IV1A 1IPKA 3KZ3A 1Y9QA 1NE6A 2CGPA 2IVQA 2LYPA 5JSRA 3FE5A 1OCTC 1ZRRA 1ZZ7A 4Z59A 4YRDA 2K9ZA 2WUSR 2PYTA 3IIAA 3NJZA 4OFGA 1QP7A 4JCXA 3H5TA 1CAWB 5BY5A 4AQ2A 1YWKA 1PNRA 3HT1A 5BPXA 2HSGA 4X6QB 1LLIA 2GC1A 1CJGA 4I09A 4PIXA 4ZU5A 2BGCA 4LA3A 1X8MA 4X4BA 3ZKCA 3LOIA 4YBAA 5CADA 2O49A 4KWLA 2CROA 2PFWA 2XKPA 1I5ZA 4HZFA 2WC2A 5I0UA 4UXAA 1LR5A 2HJIA 1O3RA 1CAXA 2JVLA 2KPJA 1LMB3 3NKTA 5KHHA 4AVAA 5FPXA 3EO6A
chains in the Genus database with same CATH superfamily
4A7KA 1R081 4FOQA 4HRAA 1V6NA 1D4M1 4PI0A 3K4AA 1NXMA 1PO21 5FWEA 5CB7A 3HEIA 4NO4A 2CL2A 2R30A 1AVBA 4BZ4A 1QQP3 4Q0QA 2VTFA 2WNOA 4H2AA 3R1FA 2QDNA 4YW1A 4AI2A 4Y26A 3IMMA 4LITA 1EUUA 3WW1A 4BHPA 5DTRA 2HFZA 4DRVA 4FAHA 1SACA 4UT5A 3P6BA 3VBOA 4PHZA 5A6XA 1TNFA 1R1A1 5DPNA 3D82A 2PUEA 4JKLA 5LW9A 2PHUA 5E8AA 2W3JA 3BTAA 1GNHA 3PVBB 3SH3A 2ZEZA 3MDPA 4QMAA 3HN1A 4GMP3 2HWD3 4B8EA 3RZJA 1UWWA 4MGQA 2OX0A 1NAEA 5LEJA 1WH6A 3A7QA 1RUC3 2YBDA 4LKEA 3POSA 4JGZB 4PJYA 5FTTC 3QQ6A 3ZHMA 3JD72 1FV3A 2QQJA 5HV0A 2BZDA 4Q4Y2 3JZVA 3ZXKA 1ZRDA 1SEFA 2BJSA 4CTEA 3CLCA 2R1JL 5DTMA 1HRV2 1SZBA 2IWGB 3GYDA 2GH8A 4LO4B 4LLOA 2YXSA 4PLMA 1J3RA 3RVHA 2VZ3A 1SBFA 5KHJA 3VGIA 1ZS4A 1H2MA 1NXD1 4CA9A 1GQPA 1G9BA 2LYLA 3O1PA 2WNEA 3GZDA 3GZCA 2QBXA 4LHNA 4NIIA 1CAUA 3INAA 4D7SA 4CEYC 5LK7B 2XQRA 2E53A 1UU5A 1Z7S3 3ETQA 5JXGA 5FUNA 4FPLA 1KS5A 4RFRB 1L1MA 3PJQA 2WKKA 2PXEA 3VHRA 2GP3A 1AX0A 4HK9A 4EKGA 2ZKNA 3IIIA 4M3CA 2QVSB 1HB4A 3B7MA 5IATA 3KV4A 1W06A 3NQHA 3AZVA 5FYMA 3DN7A 1S0CA 3CROL 4NAOA 5IYYA 1UNBA 5K0UC 1RUE2 3ACIA 5T5JA 3AP4A 2A75A 4QKBA 1UQXA 3BU0A 1LCCA 5FXVA 1UU6A 4XETA 2BU9A 1OSLA 2PXVA 4IUGA 4IEZA 4X4HA 5KC5A 3H7YA 1X8EA 2GAUA 2EAAA 1BEV3 4KI5M 4XQ4A 5JLVA 2BERA 3LDRA 1GWKA 2OA2A 4IE5A 2JE9A 3ZFEB 4CEWB 5FO8B 1ZA7A 4FOWA 1ZNPA 3RRDA 1OQ1A 3WT3A 1RHI3 3GALA 3RNSA 1WLTA 1HQWA 4N43A 2WJSA 2XHKA 5ABJB 2ZTNA 1WCKA 3OUIA 2Q8DA 4LK6A 4QX1A 1S0BA 3WW2A 1RGSA 4Y24A 3WNXA 4DRRA 1TZOA 5E88A 3MFCA 2JECA 1GQGA 3FBMA 4WVVA 1LOAA 3T1LA 3WQ0A 4OVEA 3BTXA 3V56A 1D0HA 3ZN4A 3J26N 1NLSA 2CGOA 4BQ3A 2KZ8A 3SCFA 4KNCA 5HCBA 1IG0A 3T09A 5CFDA 5L19A 1ZZCA 4YGDA 1VALA 3ZVXA 3AP5A 2A6ZA 4IE0A 4ET7A 1ENSA 5FY4A 5JR2A 2A7AA 3R05A 3BDNA 3SNMA 2JICA 4CP9A 5IVVA 3O1MA 1GZWB 2R16A 3K4ZA 5A7NA 2RDRA 3GDBA 4CCDA 1UIKA 3AP6A 3ON7A 2HWC1 5A33B 3IAPA 3GNEA 5EP9A 2W68A 5FKCA 1F2NA 5FK8A 3DL3A 4BQ5A 2I07B 3R4SA 3POWA 1PZ7A 1D4M3 1YO8A 3S7IA 5LB6A 3FZ3A 1RUH3 4BQ2A 4OMDA 4RGGA 1W9SA 2FJRA 3T2TA 4DPNA 3ZYBA 1D0GA 3ZR6A 2VG9A 2CYFA 5I0RA 3I7DA 1BDHA 2LALA 3ZFFC 5C9AA 3MIFA 2KM2A 4XTMA 4ATEA 2O4AA 3NAPC 5LK5A 2P2KA 3S57A 4E27A 4EYUA 1RUE3 4Y4YA 3LFPA 2PLV3 3FFQA 4D0QA 2I45A 4GB32 2YV8A 3AVRA 1RUF1 2R061 3M70A 2RE9A 2ICTA 3LQCA 2RHPA 3VBUB 1JHNA 4NIGA 1QQAA 4W6YA 3IDAA 5A1FA 1T2XA 2YZ4A 3MLJA 5CAZA 1FNZA 4Y20A 1PK6A 2B42B 3BODA 3F52A 1AR61 2BTVC 3TNQA 2VMCA 3PLQA 5FOBB 1G6NA 1AXYA 1OQDA 3AKRA 3UKVA 4ER0A 3NNGA 5DG1A 3O14A 1L7RA 5LA9A 3DPRB 1VBD2 5K7PA 1NCQB 1A78A 3PUQA 4HK8A 4UFIA 2GALA 2VOWA 1WD4A 3CZUA 3K77A 4YZ5A 1DU3D 4Z5CA 3QACA 4KWUA 5JOYA 3ZXFA 2RDSA 1QP4A 1JODA 1AL0G 2A6VA 2BGOA 4QPIB 3ZYJB 1HLCA 3AL5A 3SXWA 5FLJA 2P37A 3VBHB 1C5HA 3JBG1 1SPPB 1G8WA 5JAXA 4LBQA 3LSEA 1MR5A 4NMIA 2RR12 4LA2A 4FFGA 4CUAA 4BQYA 5GLWA 4GKYA 1ZM1A 4DUVA 2YBPA 4Y1ZA 2W47A 2HWF3 4FXKB 2JDPA 3KF3A 1ZBA2 3CF6E 5FZ4A 4BDVB 4PU4C 1S55A 5HXVA 5DAWA 1MPXA 5DT2A 4AXOA 2GSYA 4ITCA 1V6LA 5FBJA 4UAPA 1H1IA 4UFJA 3UK9A 3LDBA 3FHAA 1UY2A 1EY2A 1UZ0A 4RQPA 4XHXA 3BVCA 3UJQA 2R072 4HG6B 1TME2 1QMJA 1XSQA 3H8UA 4TN7A 1HXS2 2FMDA 3UGFA 1NYWA 2HBTA 4AWDA 1BBT1 1S0FA 1FOD1 4Z82A 1O8SA 5FK7A 1DYOA 2DCZA 1NCRC 2RM21 4Q26A 4OUEA 4LIUA 1POV0 4EN8B 4EWDA 2AH2A 4XFIA 1U2ZA 2E6VA 2PHFA 2QQIA 4OBMA 3O1TA 3J7HA 2DBNA 4CP1A 4N53C 2XGXA 1BHGA 4KU8A 4B29A 4IEQA 3WHUA 3KM5A 2VZRA 2WFPA 1ZUGA 1R69A 1OUSA 2VZ1A 2CAUA 4LOTA 4OZOA 4P5YA 4AGVA 3FMYA 1U5ZA 3E97A 5AFBA 5KXEA 2W94A 1W6NB 4UFMA 4COYA 4C8DA 4LO5B 4MO3M 4QGLA 2W1UA 2Z79A 4ER6A 4TLGA 4DXZA 4I6RA 4RQPC 1S0IA 3ZN5A 2B4KA 4XTPA 2OT7A 2BRTA 1ZA4A 3ZPYA 4BXFA 4HN1A 4R9DA 1Q43A 1CD3G 3TELA 2RDQA 3DKWA 3ZYIB 1NCRA 4CYDA 4EV0A 1ZZ6A 4OB4A 1NKGA 5A3OA 4LMFA 2CHHA 3AZYA 4LUKA 2Y8KA 3O0XA 3MZHA 2PHDA 4W50A 1DIWA 3WDWA 1PGL2 5AC91 4WZFA 4HVQA 4UWDA 4AL9A 1UF2C 1RMU3 5ACA1 1DZTA 4UFHA 1QWRA 5FY1A 4KU7A 5C8CA 4WM7B 4F8DA 4NHXA 3KMHA 4DXRA 1NG0A 5EQUA 3VBOC 1Q8VA 2WINB 2KA3A 3AMNA 1JZ5A 5DUVA 2ET7A 3T2PA 2WQZC 1OC1A 3WW4A 1Q8QA 3ZIWA 3FBYA 1KQRA 1RUG1 4M3CF 3OKZA 4QKFA 4XIOA 1V70A 4HKLA 5ACA3 1T6GC 5JR7B 1B0NA 1LULA 4J1XA 3I54A 3KB5A 5JPMB 4RR3B 4O7XA 1EFAA 3LE0A 3THDA 3ZKYA 4XFHA 2FMYA 3HWJA 1MS3A 2GN7A 4IERA 4FQZA 3PDQA 3VZOA 3ES4A 3I2FA 3Q8FA 5DN2A 2OZJA 2VXJA 3O0WA 3A23A 5FZ0A 2NYYA 3VD4A 4WVLA 1XNDA 1ENRA 3U37A 3J7LA 3ILRA 4IE4A 2BNMA 3F51A 4AOCA 2QUOA 3VDDB 1O5LA 4K1ZA 3I2KA 3MIEA 1REFA 3C7OA 2VULA 3AK0A 3PU8A 1W0OA 1VAMA 4MXWB 1XWRA 4KL1A 2XSDC 1Q8SA 5C6CA 1L7LA 3MIDA 4NHKA 3RG0A 4EWEA 3RI9A 3M2MA 2BDRA 2AUYA 2ZHNA 2WSVA 4Z5HA 3PL0A 3TEWA 4DY3A 3VBSC 3WZ1A 1F8VA 3S0MA 1BXHA 4WM8C 3VUOA 1Y7BA 2FHRA 5FQ0A 4BA6A 1D4M2 4CDUC 3PIGA 2IFWA 1I1EA 5CIRA 3KLSA 3RZHA 3ZX7A 1UXDA 2WSUA 2XUEA 1BKZA 2F17A 1XB9A 2OZ6A 3AJYA 4SLIA 4YWAA 4E4HA 1YQ2A 4EN9B 2NP0A 4Q8KA 3IDCB 2Z69A 1AR82 1OVSA 4Y4RA 4HL0A 2XJPA 4FSJA 1RZRA 3HD8B 4C0HA 4L11A 1JYCA 1CVNA 5A6QA 2IUOA 5I0TA 4I0AA 4AFMA 4DS0A 1CJDA 1MFQC 3OCPA 3VBFA 1LOEA 4XEZA 4IV3C 1H8TB 3HZIB 2PXQA 1MS5A 2DCJA 1LOCA 5GLUA 1OH4A 2JQEA 3B3QE 1YXWA 2PQQA 4GMP1 4A2UA 2DDUA 4N43C 2FDFA 3B02A 1BDIA 4D6RA 4QM9A 2VMIA 3O12A 2ZGKA 3OY8A 1AZDA 2H8RA 1UZYA 1LB2A 1F4AA 3EYPA 2WO1A 4DFSA 2YBSA 5F39A 1OH3A 1AYM1 1GLHA 5FYBA 5IAVA 3FUOA 3C3VA 4Z5DA 5FDBA 2VPVA 2ZAAA 2IXIA 3ASIA 2XJTA 5KXCA 4P9IA 4YM2A 4RQPB 1TMF1 1XE8A 4PBOA 4K6BA 3LA2A 1VMFA 2Q1MA 3WQ7A 1GP4A 2XDVA 4XIKA 1JZ6A 4WVZA 3NXHA 4LORA 3SMHA 2MEV2 1REEA 2ARAA 3ABZA 4LO8A 4LIVA 2JG8A 1RJ8A 4XILA 5CNAA 2XUMA 2ILMA 4D69A 4I3PA 2D3RA 2P4EA 3NJVA 2HWE2 4YVWC 4CXYA 5HPOA 1VE0A 1O3TA 1W8WA 3AYEA 4QM8A 4XURA 5B4XA 1ZPQA 4I30A 4KGGA 4QX5A 3LISA 3CZJA 1UPIA 2WL1A 3APBA 5C9AC 3POGA 1KXGA 2AW6A 2OVUA 4IETA 2YBKA 5LA1A 2FDIA 1H4HA 1PVXA 3M3QA 4XACA 5DG2A 1MS8A 4ARYA 3T30A 1RPEL 4ZONA 1QH7A 3I8TA 3GZEA 4PDWA 2E51A 2F4PA 1IQAA 2HINA 1TE1B 4AE2A 1AX1A 2WN2A 4DMIA 2WNVB 2O8OA 1DYPA 2VH9A 4S2HA 1JU4A 1PMHX 4BCUA 4BPZA 3FN9A 4B4QA 2CSFA 4JDMA 2DWRA 1IZ3A 4RA0A 3V0AB 4WZCA 4Q4Y3 3W59A 4IW3A 2E31A 2W5FA 3NW4A 4A41A 1R093 1MACA 3AB0A 3FLPA 4RN5A 3LA7A 4LJHA 1AR81 1US3A 4JAAA 2IXHA 1WW4A 3SEEA 3KCCA 1OKQA 3I2JA 4PT6A 1A8DA 3ZN6A 3ZXGA 4CCOA 3BS3A 3WVJA 2P3YA 1GUIA 1ADRA 1ND3B 1W6PA 2LCVA 3MHZA 4KGQA 2Q8OA 3T0DA 2JJ6A 3DV8A 3BN6A 1NQJA 3C7GA 1JI6A 1O4ZA 2HWB1 3EBRA 3OGSA 4UBHA 4HKOA 4XZPA 4LE4A 2XXAA 1BLZA 3DF0A 5AVAA 5IFTA 5EYYA 3ZXDA 3KZ3A 4RFT0 4AI0A 3GJBA 4DY5A 1PZ9A 2CGPA 4CDQA 2LYPA 1VRH1 4K8RB 3RSJA 3FE5A 1HRI1 1ZRRA 1ZZ7A 1W6OB 5GALA 1MEC2 2WUSR 1E5HA 2K2SA 1CIYA 4EN6B 1V9U1 1W6QA 3SX0A 1NOVA 4O65A 5F5IA 2A71A 1IOAA 4N7UA 3VKOA 1G9DA 1GSLA 2EXKA 3T1MA 1JTZX 3H5TA 1H4GA 2X10A 3B9CA 4HPKB 4XUTA 2WUHA 4A4AA 3KL4A 5BY5A 1PNRA 1HX6A 2PHRA 2RJLA 4NR1A 5JIAA 3S6PA 5A6YA 2BVBA 2GC1A 4BQ1A 2ZPXA 1S0JA 3DUIA 5FYZA 1RUH2 3WCSA 2G9GA 1SBEA 1S0EA 2CROA 1MQTA 1FATA 1H8TC 1I5ZA 2RJKA 2WC2A 2XKPA 2YFZA 3QOWA 3MW2A 5DDJ2 3VKMA 3RWNA 3BTZA 5LATA 2DBIA 2HJIA 4H14A 3UNPA 1LECA 3BOWA 3NKTA 2RR11 2OUJA 1LOBA 1OOPB 3UV9A 3ZPOA 2WR9A 1UOFA 3EO6A 3I97A 3N35A 1PMIA 4L99A 1UOJA 4Z92B 4I01A 4AEDB 4XFGA 2HWD1 4N8MA 3H3LA 5IAXA 3OBTA 1W8HA 1MS0A 2IXCA 1J84A 4QDQA 1VBD1 1S2EA 1UYYA 3CL1A 4GMP0 4FFIA 5CFCB 1YIPA 1GANA 2D6KA 4JKKA 2XBO3 1GNYA 1L7QA 1ODNA 2R071 1UMZA 1NEQA 2DCYA 2H0BA 2NMNA 5HXMA 2J7WA 4D7TA 3R0RA 1KD7A 1YJLA 4OULA 4DOUA 1UTXA 1DP0A 1DQ1A 1PO23 2L9LA 2ZABA 4JHTA 4YG0A 5FYTA 4D6SA 5JXIA 5DUWA 2VTXA 1ZRIA 4Q4X2 5FO9B 2HYKA 1H1MA 5BNQA 1NQDA 3AMHA 3SH4A 5IWFA 2WS91 3I3BA 3E5QA 2QCSB 5A3TA 1X7NA 3I3DA 5FO7B 1XXNA 1O7FA 2PA7A 1O4XA 1RMU2 5FZCA 4FCAA 1R1A3 4CEYA 4CCCA 2EWTA 1HQLA 2VOXA 1N1TA 1KRIA 4GD4A 2LM3A 1WUVA 4Q5OA 1W3XA 5CG9A 4TSVA 5LY1A 2C5DA 3H42B 2RDNA 4COVA 4JTOA 4DQAA 3H3ZA 2IVIB 5E16A 4AVCA 5A1AA 4QKNA 4XQWA 4TZDA 2X5IB 3I2OA 4EWAA 2W1WA 2PXFA 1HXS1 3AVSA 1UXXX 4H7MA 2WN3A 2PPXA 2WAOA 1R083 2BGPA 4AAXA 1POQA 4NPLA 2ZMKA 4EK9A 3WNKA 5GZEA 2Z5WA 1QDCA 4DINB 4XJZA 3B69A 1UO9A 4OHYA 1K12A 4ZHNA 1VP6A 4AFAA 5D2AA 3HPNA 1ZZ9A 1XNBA 3BOPA 5FZ3A 3GHNA 4BJ0A 4M3CE 3M9LA 2VOTA 4I8TA 1MZEA 3G7DA 4LKFA 1W28A 1XNCA 1XYPA 2JG9B 5JOWA 3UGGA 1FI2A 4FP3A 5FZ1A 2L1PA 3RQ0A 1LHWA 2ZKLA 4PQ9A 4YZ2A 3W5MA 3AM2A 2Z4FA 3NV2A 4MGKE 1DWKA 4IEPA 4QGNA 5LRRA 1FYUA 3AL6A 1PVC2 3POYA 5F1RA 5FJKA 3GBGA 3V0AA 3KVAA 2WWJA 3ZSLA 5D1IA 2OQ7A 5L9RA 4QXKA 1HKDA 3LFIA 3MV01 1WW5A 1M06G 4JGYC 4WBBA 1KJRA 1D4VB 4ISRA 2W0XA 4JCYA 1GP6A 4LXLA 3BIEA 5CKMA 1W2OA 1C8M1 2OYZA 3ZN6B 1PO11 4QX0A 3ZXEA 5A3UA 1BMV1 3S7EA 4Q4X3 1JW6A 4M3CB 3ZR5A 5EJ3A 5DXDA 5L7OA 4P9JA 4YW2A 4AQTA 1RUNA 3N9MA 4TYSA 5DDJ3 2ETEA 4NRMA 4YZ3A 4AVVA 4QB1A 1GZ9A 1GOGA 2C9AA 3JXCL 1KS4A 1QJU2 1J3PA 2A3YA 2W2IA 3GBWA 1WMFA 3IDBB 5FZKA 3VBFC 2VNRA 4F8AA 1MVQA 2DUQA 3D5OA 3MV11 2Y6HA 3OTFA 2D44A 4OMCA 4CCEA 1ASJ3 5BNPB 2GH2A 2WS92 4MH0E 4YW6A 1OOPC 2BV4A 3ZFEA 3D8CA 2AEYA 2CDOA 1BK1A 1ZVVA 3GZAA 3HBZA 1DGWA 4P02B 1ZBA3 5I93A 1D7PM 4M01A 4B1LA 4XJAA 3H8RA 4XFCA 1XYOA 1VMHA 3UT0A 1UZWA 5C5UA 3CEWA 5JZGA 1HDKA 3RS6A 3OPTA 1QZXA 4MUVA 4NOTA 4V1PA 2EVXA 4KMQA 2FZ1A 2VXRA 4LLFA 4CCMA 3QCWA 1MQTB 1NLQA 2ARCA 4XFBA 4ZKTB 3WP3A 1LHVA 3QBQA 3J8F1 3UFDA 3K3NA 3IDEA 3OQMA 4CXXA 1OOPA 3OEAA 2UY8A 3TN92 2JXAA 3HNBM 4YVWA 2LYJA 3FHIB 1Q56A 2BOIA 3GCXA 2A3WA 3RZLA 4P9YA 1XE7A 2RMU1 5FYCA 1J83A 2QQWA 3MW3A 4BH9A 5G04L 5KXDA 4F3JA 3HMYA 4LO7A 3M7AA 1Y7YA 1YYNA 3VZJA 3PIJA 4KWJA 2EXJA 2H6CA 5A3MA 5FMDA 2DURA 2DYCA 4GKXA 4MGZE 4XPVA 5DZFA 5F37A 2RS11 2EF8A 4UF0A 1VBA3 2VVDA 4AHYA 4DXTA 4IXLA 2HWC3 2Q5TA 1QJX2 2J7MA 4LT5A 3DM5A 2B5HA 3C7FA 3DPRC 3I2HA 3T0AA 1EPWA 4GB33 2ORZA 2ZXQA 4Y22B 2BEOA 3VDAA 3N4MA 4FQ4A 4LBKA 4OHZA 3L9JT 2L8NA 1OKOA 2CTVA 4HN0A 2IZWA 2JKXA 3PHMA 3NNMA 4JTNA 3USUA 4DEQA 2DV9A 5CFDC 2P1BA 4CDWA 5HV4A 2XKOA 2YDEA 1ALYA 3OBZA 3Q8BA 5CU1A 1ULGA 2ZACA 2A6CA 1WW6A 1I3HA 5JOXA 4Q29A 1WCQA 3N9LA 4HVOA 4Y20B 1ZYBA 4GZ9A 5T3NA 4Q27A 5CEHA 5SV5A 5BNOB 5JMOA 3CU7A 1H0BA 4LEJA 2Y0IA 4Z8BA 5EFUA 1XNKA 2V09A 1Q3EA 5ABJA 2BWCA 4MADA 4R4ZA 4YZ4A 3VKNA 1COV2 1FMD3 3OBAA 4XFFA 4A42A 4FN3A 1RUI1 3MI8A 5HI0A 4AQSA 1HJFA 1Q8PA 3URFA 3GN5B 1J1LA 1NUKA 1TMF3 1FT9A 3D6EA 1F15A 5J36A 1S1AA 1VLNA 5LASA 5CISA 4M0HA 3IMNA 2XIUA 1CZVA 3SCHA 1DGRN 1JU3A 4P5HA 2JCGA 1C3HA 1VIWB 2DU0A 4U36A 1DLLA 3KCXA 3NROA 3NAPA 5IW0A 3E5UA 1YFXA 2VMHA 1JYTA 3LCPA 2ZGOA 3VWSA 4BISA 4AEMA 1QJY3 1JS9A 1Y4WA 4XDQA 3IBMA 2R49A 1H2LA 2DCTA 5A33A 1OFNA 5D8AB 4QPWA 3VBRB 4XFAA 3I2IA 4N9HA 5FXXA 3VHOA 3V0BA 2IVBA 2W91A 4Z2AA 1LEDA 5FZBA 2JDNA 5IVFA 2Q4SA 3TRBA 2ERFA 4K1YA 2HCNA 1AR91 1EV12 5EJ1B 3QD6A 4XDPA 1SQ4A 2MHFA 4AHZA 2A6XA 3AMPA 4L92A 3O1SA 1K3IA 4LNVA 2QNKA 1XOYA 4B7KA 3VK0A 4Y1UA 3WOGA 1C5IA 5DSXA 2KEIA 4PBPA 3K4DA 1HJGA 2A70A 4BWOA 4EN0A 3KSCA 3QF3A 4JZRA 1JZ8A 3J7MA 4C91A 3TFLA 1A6CA 3HNYM 4ZU4A 5JCTA 3KF5A 1PIV2 4INDA 4MG2A 3ME5A 5DDJ1 1AR93 1YQCA 1W03A 2DU1A 2JX9A 4FPFA 3VL9A 5AC93 2PHXA 3CKHA 3POBA 2D3PA 2AXZA 4C0BA 2XONA 5F3CA 2XJQA 1JUHA 3ZSEA 1YHFA 5FZAA 3FYAA 3NNLA 2IXKA 1W6NA 1W9TA 4QPGC 4LBLA 1DQ5A 2IVGA 5K98B 1N3PA 3D1NI 2OR1L 5A7QA 3PJYA 3CDZB 1HRI2 3ZFGA 2X8KA 3D4KA 1IGOA 5EWSA 2GN3A 5FPZA 4Y5SA 2HBUA 2IVJA 1WMDA 2ZZQA 3H9AA 2ZA9A 4WV8A 5FREA 2VNVA 4AI9A 2NMOA 3U75A 2ZAHA 2BOJA 5JWPA 4MGYE 3LB9A 4PQQA 3CJIA 3NV3A 5LWBA 1SLIA 1J58A 5DRTA 1H6XA 1K5JA 2WFF2 2VTXJ 3EJKA 3HOBA 1COV1 2LYQA 3LWCA 4W65A 3ZSJA 4CDXC 1SPPA 2Y64A 5ERLA 5CA6A 3GZUC 4K9SA 3AFGA 5FP8A 1DW9A 3B5LB 2XOMA 1YRZA 5TSWA 5GLVA 3WINE 3WUCA 1F5FA 3AKTA 2Z42A 5A3WA 1X82A 3B01A 5DAXA 4N53A 5FUPA 3MUY1 2A3XA 3WF0A 1W2AX 2CU5A 2XJRA 4LULA 3TYJA 1AYN1 1OPOA 4AI1A 4AFDA 4GIQA 4RHV3 5C3PA 1W99A 5A32B 2XPJA 4OHWA 4DNYA 5IVEA 4XQDA 5F5QA 5BXXA 5LBFA 4A6OA 4QQ2A 5L73A 4URAA 4RR3A 2E33A 1XNAA 3BPSA 2B5AA 5FAXA 3K46A 3VBSB 3D0SA 5A7PA 2Q1FA 1WLDA 3MEJA 1H9PA 2J22A 3BYWA 4GWNA 4LBNA 4MLOA 4R9AA 4WM8B 5FLHA 2BBVA 2R041 5BNOC 2GC3A 1B35B 2TNFA 4QX8A 4YG3A 3WF1A 2RS33 3AC0A 1IS4A 1BYHA 1SCSA 1R091 3LPFA 1W0PA 1XC6A 3WG2A 1V00A 5IVBA 1DHKB 2DVAA 1KJLA 1PHMA 1R63A 3SR4A 5EZWA 4LBMA 3WHTA 2DUPA 2WS93 3E6DA 5HCFA 2VBDA 2LTNA 3HBKA 4Q4X1 2ARBA 2XJ3A 1RJ7A 3UJOA 1QJEA 3NL1A 5KHGA 1GZCA 1LKNA 2VC9A 1RUF2 2R062 3TAYA 2VVEA 1SDWA 2W95A 3M3OA 1WMXA 1ZBE2 4XJ9A 4B3NA 1ULFA 2VECA 3E5XA 1LESA 5C70A 5JSOA 3EUSA 4Z1VA 1N1SA 1LENA 2EIGA 3MBWA 1URXA 2JKBA 4XVHA 3OMTA 3ZYGA 3VBRC 5J09A 1CAXB 3BCWA 1C1LA 4MX3A 4YGEA 3K51A 3PNAA 5EHDA 1MS9A 3O0VA 3A0KA 3GN5A 1KITA 1OLMA 1PK6C 1DDLA 1PX3A 2PAEA 3B93A 4P9GA 1AR62 1LU2A 5IK4A 3MLFA 5GLTA 4P9WA 1W8FA 1UY4A 3ZFFB 2JDHA 1UX7A 4UW5A 3NAPB 3TBDA 3OWQA 1IKPA 1OSGA 2HWE3 1JH9A 2HCSA 2ZGTA 5JVVA 4B7EA 1CONA 4EJRA 5JXHA 1VPWA 1W90A 3N9NA 4XAEA 1RHI2 1W8TA 2LRPA 5ANQA 5C4WA 3J8F3 4CVUA 4OUMA 1O91A 2P3JA 3H50A 4L0PA 5C7GA 2VNGA 5BYNA 2BP6A 3RZZA 4YVSC 3VBRA 4D94A 3V0BB 5T54A 5I0SA 1EV13 2JE7A 1BBT3 1DQ6A 4JGZC 4AVSA 4YFZA 4YW4A 1QXJA 3DXUA 3UL2A 3ZO0B 3VDCA 2QFEA 3JD73 4LOSA 4QPGA 5JOZA 2LUWA 5CZKA 3N3HA 4JQRA 1F9KA 2D40A 3EMRA 3PUAA 1NX9A 4CU9A 1YFUA 1RIOA 4NRQA 2WIUB 4C90A 1W9WA 1C8M3 2PAKA 2VW2A 4H7LA 2LW8A 5C3SA 1ZBA1 4DE9A 1H1AA 2WT1A 4BQXA 3VKLA 2KEKA 1XNTA 1MZ5A 2WNVC 2AXUA 1H2NA 4UFLA 1S7EA 5JDBA 3LSDA 2WQ4A 5C4WC 4ASLA 3ZPXA 4K21A 4IV1B 2ZS6B 1OF3A 3UYJA 1OVPA 1Z7S2 3F2ZA 4YLZA 1QIQA 3AKSA 2C4XA 1PVC3 1UMIA 5FY5A 1BBT2 4RS5A 1F4HA 3I59B 3AJZA 2QE3A 2OKXA 3RZKA 1E57A 1QEXA 3M4FA 5FIXA 3A22A 1LCLA 1IS3A 2F4LA 1AJKA 1HRV1 3NZLA 1JOPA 2QJVA 1QOOA 3IN9A 4QHBA 3ZDSA 4EQVA 3ZDVA 2IV1A 1TG7A 2PXDA 2D43A 1Y9QA 4A44A 5JSRA 2XVGA 4IDZA 3GM8A 2DFCA 1R64A 4YRDA 4FTEA 5DUXA 4D6QA 1UMHA 4KQ7A 2WAAA 4COUA 5DUUA 1UYPA 4OFGA 1GBGA 1QP7A 2G4IA 2VOVA 4AVTA 2JDZA 2R32A 5GAGi 2Y26A 1UY0A 5AC92 2ADDA 4Z2WA 4D7YA 3SH5A 1HQ1A 4NHYA 1YWKA 1QJX1 3HN3A 1H9WA 2VQTA 5F2SA 1CESA 2HSGA 4X6QB 5FZMA 1LLIA 1PGW2 3WNMA 1XU1A 4I09A 4PIXA 1W6PB 1FV2A 2BGCA 3IZOA 4LA3A 4ZU5A 1RUE1 2X05A 4XUNA 3ZKCA 3LOIA 2YU1A 3OY8B 4CP2A 4GH4A 1OA3A 2VBPA 4HZFA 4S2DA 5A32A 1NY72 4KBBA 3ECQA 2JB8A 2VMDA 2YC0A 4BLJA 2KPJA 1O3RA 4CDQB 1LMB3 2J1RA 2RV9A 2VO5A 1UY3A 3VBSA 3U10A 1C4RA 3EHKA 3L1PA 1RUI2 1VBB1 2LS6A 2O8QA 3SISA 2FDHA 3WNLA 4NWVA 4RL7A 1EPZA 1RTVA 1RUD1 2JE8A 2GZUA 4HXCA 4JHZA 1RB8G 4HBNA 3E1F1 2PXUA 2VVFA 3I2GA 3H1YA 1AR73 4ZS2A 5GLZA 2XBO2 1I5PA 5FP7A 5T5PA 1ONAA 1PO13 1QNWA 2C0ZA 3PU3A 1DGLA 4NJ4A 4ZZ5A 1XQNA 2QZ2A 3QYXA 1GV9A 3SQOA 5J96B 3RPQA 2GNBA 2JDMA 3VBOB 1F35A 4GQ7A 5E89A 3VV1A 1WA6X 4ZZ8A 1DG6A 3CHXA 1QJFA 2I74A 1AHSA 1JHJA 1WCSA 2PLV2 2Q30A 3NWKA 1YLLA 4Y42A 4IE7A 3BTYA 1QQP1 3DYPA 3MICA 1NERA 1ULDA 1DQ0A 2VMGA 1HB2A 3MLLA 4AR2A 3RYPA 1EV11 1XSRA 3JB4C 2Y0OA 4Q2JA 1W0NA 3MFAA 4QHZA 3MF6A 4AEDA 1O4TA 3UGHA 5FPBA 4CP0A 5JUVA 5EV7A 5GAHi 1DGWX 3WNPA 3S5AA 4F7ZA 4KBZA 1VRBA 1JYWA 1AR92 4XF4A 2B9UA 5AFEA 2PIJA 4EQZA 2Y6KA 2B45X 4FTSA 3FYMA 1AJOA 1GFF2 1L3JA 2D5HA 2WWUA 3NRUA 4AEJA 2ZJCA 1E5SA 4MXVA 5A6ZA 3O1UA 4QXHA 1YJKA 3WQBA 5FZ7A 1NCQC 2E32A 4IEUA 4YG6A 4MCTA 3H3UA 4G4FA 4NN0A 1QJX3 4JQTA 4SBVA 1JFSA 5C4WB 5M0TA 1UD1A 4IV1C 5BNNA 4YYOA 2XXQA 5F3IA 4M00A 5AVPA 3UKTA 1ACCA 1C8NA 2JIJA 4AHXA 1WW7A 3VBHC 3A9ZA 3BD1A 2I2SA 2NZ9A 3D0JA 3HQRA 3PURA 4Q0SA 5FR3A 3WNNA 1DQ2A 3U1XA 1QOSA 1AYM2 1JN2P 2B9VA 4QX7A 3TEXA 3ACHA 5IT6A 1DQ4A 3Q8EA 4LK7A 2YYOA 5I8SA 4X4DA 4H55A 2JG9C 3WD5A 3BGAA 5F3EA 3WY6A 3LDKA 4O61A 3J7NA 1DF0A 2UU8A 1ZRFA 3I3MA 5DAPA 3U11A 3ZXJA 1CIWA 2QQUA 4R9BA 1QJZA 2OW4A 3JBG3 2Q8CA 4PU3C 4CU6A 1POV1 4Z07A 4GALA 4XBNA 1TMF2 5BNNC 3M3IA 1HF0A 1RVF3 3B7HA 1LOFC 2WNUC 3FX3A 3J4UH 4E9KA 2NLRA 3I59A 4X8PA 5FPAA 1OXCA 1OD5A 2IUWA 4OI2A 5C71A 3WP5A 3NO8A 2KXLA 1VR3A 4NHMA 4RSUA 4CXWA 3BPZA 4JRLA 4JV4A 2VBBA 1I6XA 4DUXA 3R09A 1WA4A 3QH7A 4M4RA 1G9FA 1QP0A 2EBYA 3B00A 3E6CC 2PN5A 1EUTA 2H6BA 4MHUA 1DULA 1HB1A 4Y1YA 5DAVA 2VE1A 2PUBA 1QOTA 2WA3A 2XQXA 3I2DA 1QQP2 2YC2A 1UPSA 2DTWA 4CDQC 1R092 3RZGA 1N3OA 4Q4Y1 1N1YA 2XH6A 4IQPA 1AUYA 1VBB3 4DE8A 2CWSA 2P17A 2WQ8A 3UWPA 2PUDA 2J1AA 2RM22 2ZX1A 3HAGA 4GWMA 1AL22 4Q1RA 5J98B 3IVPA 1FPN3 3WX5A 2BBAA 5FZ9A 5J1XA 4KWKA 4MZUA 3IPVA 1JZ2A 5LA0A 2YUEA 1OHFA 1SDDB 3USSA 1WCDJ 3QWGA 2V72A 2WZR3 3K2OA 2BFUS 4CPBD 2OQ6A 1PRAA 2PXJA 3VBUA 2Z2SB 1TME3 4QQOA 3BB6A 5ANNA 1O5UA 5C8CC 2D6LX 5FZGA 3KXAA 1V9U3 2MNGA 3CECA 1GOFA 3ES1A 1MQTC 3MPBA 3O7OA 4FPEA 4I3GA 1RZSA 2X29A 2ZEXA 4V2WA 2G1MA 3W21A 1WWYA 3N7LA 1GYKA 2VZVA 1ZBE1 5F9TA 5EJZB 4MGTA 1QY4A 3ALQA 2HYXA 3LFMA 3N7KA 4CUCA 5E6HA 3RDIA 1QJY2 2CY6A 3ACLA 2LLWA 4YM1A 3U4SA 3ZYFA 2M4HA 2BJCA 3KCYA 3RJRA 2KR2A 3MGUA 1MEC1 3DPRA 5FZOA 2WLQA 4P14A 5EIYB 1ST8A 4R52A 4HFSA 4DEVA 1C1FA 4JC1A 3KHBA 4B4PA 1XBFA 1LGCA 1O6UA 1UY1A 2WZ8A 4EZHA 1PM7A 5GZCA 2ICPA 2JIGA 2XVKA 5LBEA 4JGYA 2HWF1 2WO3A 4XE9A 2E7AA 5LY2A 5T5LA 4EN7B 1WLCA 1X50A 3RMYA 3T3YA 5A7WA 4R4XA 4FXGB 4N9IA 4MHRA 1AR71 2J1EA 2SBAA 3RYRA 1CX4A 1OQEA 4IEXA 4E2SA 3POJA 3LIHA 2PHTA 1LNSA 2RG4A 3R4DB 4JDOA 4CCLA 4NUBA 1V6OA 5KHIA 1V6KA 5T5OA 1NT0A 1UOBA 1VB2A 5K0UB 1RHI1 2EIBA 2NN8A 2PMWB 1WBFA 2VZSA 3ME2A 2EA7A 3U07A 4TTGA 3SC7X 3ILNA 2VZUA 2UWAA 3U0ZA 4UBGA 1RITA 1REDA 2R0HA 1KFUL 2YPDA 1Y9MA 5HBAA 1W39A 2VM9A 1QQBA 4MOAA 4CPBA 4LBQB 4RS5C 4C1WA 1W9FA 3RMXA 3HIFA 4OCTA 5F8PA 3TRSB 2K46A 4OQ8A 2PXBA 4LBOA 2FQPA 3LAGA 4CCJA 3G0TA 2PXTA 4E2QA 4F83A 1GU3A 4A6SA 4XXAA 3EQEA 5L7OB 1ND2B 4Y22A 2WZEA 5LA2A 4GA9A 5GM0A 2OS2A 4ES9A 4FPOB 4FBFA 3ZMOA 4XAAA 4MV2A 2N7GA 2PXLA 5BNNB 1AX2A 1Z7S1 2C9KA 2WNUB 2LYRA 1OA2A 1IKQA 3FLTA 4FFHA 4QHOA 1WBLA 4QX3A 5FP4A 4JRAA 1JYVA 2JEMA 3ZYHA 1QF3A 2XCJA 1WKYA 2J1UA 3NV4A 3PVOA 1DGRA 2A73B 2V4VA 4XBLA 3ZSKA 1POUA 2V4AA 1DBNA 4QPYA 2VR4A 2V73A 3KT7A 1AXZA 1NA1C 2VUAA 2W1SA 2FCTA 4XZUG 4X8NA 2E26A 1UN1A 1ULCA 1G7YA 4GH4C 3HT2A 5HCAA 1GKBA 3A9XA 1FXZA 2ZBJA 1HXS3 2VQAA 3VD7A 3OOXA 1HIXA 1DLCA 1KDMA 4P00B 2OPWA 1W8OA 1MVEA 2Y6LA 1S0DA 1X36A 4YM0A 5IK8A 5H9RA 4CZSA 5FZLA 4FVVA 1SFYA 4XC9A 2D3SA 2ET1A 1HW5A 3HQXA 4WM7A 1UXCA 5FZ8A 5FYSA 3JQWA 1IPJA 4BK5A 2VZTA 1UW8A 4BYYA 4XOGA 5DTQA 2ZHLA 4WVMB 3ZM8A 4IGPA 1C8M2 1LQCA 2PXKA 1O59A 1POV3 2VJXA 3GF6A 4LHLA 4UW6A 3NV1A 3ZFGC 3AMQA 1SFNA 2AGSA 3N9OA 5IJRA 4YPJA 4PU7A 2AXVA 3I4IA 1JOBA 4YARA 2Q8EA 1WGPA 2G19A 5D8AA 4FPJA 4DIQA 2GRLA 1O4YA 3K75B 2ZGMA 2V5DA 2GZWA 4DXSA 3WW3A 2XL7A 4QQHA 3SKVA 4E8CA 1JYXA 5FWJA 3CJIC 3NNFA 1FX5A 4XHBA 4OI1A 2VCAA 2KEJA 2JDUA 3OGVA 5BV6A 2W39A 4LO6B 2MEV1 4XJWA 4HOOA 4PF1A 1VBD3 4D3WA 4EROA 1BEV1 1PERL 1RINA 2ZMNA 1JBCA 1WCUA 2WABA 2Y38A 2LYSA 1LODA 2FDJA 3ELNA 1X9PA 3IPVB 4NVPA 4IL7A 4RGKA 5DQ0A 2B46X 2D93A 4AGGA 4D8MA 4S2FA 5DZGA 1NLRA 4COWA 4QPIC 3TEZA 5A7SA 2IXLA 2PE5A 2YU2A 1RZRD 3Q8AA 4H3WA 2NM1A 3WP6A 2B8MA 1FOD2 5SV8A 2FBEA 1RIRA 4ORFA 3HR9A 2WZR1 2K0GA 4FOYA 3ZYRA 4FI9A 4XUQA 1ASJ1 3NVCA 3DXTA 3U3WA 1ND3C 3J8F2 4FOVA 5BUVA 3W9AA 2ARXA 3S5QA 4I02A 1CAVB 3TN91 1YI7A 2MQKA 1Q8OA 5EYXA 4CE8A 1CX1A 4O9GA 1VBB2 4Q2FA 3GZDC 1C28A 1RUG3 2VUDA 2D98A 4BE3A 2YFUA 3GZTB 4Q0VA 5FRAA 2ZEWA 1WZXA 1CGPA 5H9SA 2FZ2A 4HONA 1OMIA 3SCGA 4JGYB 3UESA 1GT0C 1RUC1 4YSFA 2VZQA 5DMYA 5JI9A 4FPCA 2XVLA 3L2HA 4PF5A 3VHNA 4QB6A 2PHWA 3ZFEC 2XJSA 2Q1ZB 4B4RA 1CQ9A 2YMZA 3V65A 3I3EA 1SCRA 3ITQA 4MYEA 2VU9A 4E4DX 4QWNA 5ISLA 5FCCA 3OSDA 4GQMA 1FAYA 5J48A 4N53B 3GHMA 1SMVA 1UKGA 4QU1A 4TLFA 1N1VA 3MIGA 3MF9A 3SLIA 5L9VA 3KT1A 4GHJA 4UOJA 3VBFB 4ZXKA 5IFPA 3OP9A 4TWTA 1J59A 3IT8A 1Q5OA 4O8BA 2CNAA 3JB8A 4ER5A 1IS6A 2B7YA 3T2QA 3WF4A 4R8HA 2GP5A 4LR4A 2R6QA 4XF3A 4IEWA 2ZGUA 1XRUA 2BWAA 1AR83 4PI2A 3TOJA 3TB0A 5K9YA 5F5CA 4AZZA 2ZHMA 1B35A 2RMU3 5FYHA 5I8TA 2TEPA 3P1IA 1H30A 1XJAA 2ADEA 2JG8B 2P3KA 2ZGNA 4QQPA 4WVWA 1PGSA 1IG3A 2RS12 1SG3A 2VL4A 5FPUA 3KWVA 1MEC3 3NNJA 4LBJA 2D5FA 1BEV2 1QHDA 2E9QA 2YROA 4NPMA 4WM7C 2BYVE 3BU7A 1EAH2 2BUKA 1RUJ3 3EXUA 4DUWA 1VRH3 4I0BA 1E5RA 1PNFA 3MO4A 5C33A 4RHV2 2Y33A 4YW3A 3LGRA 2XXPA 1W6MB 3HVDA 5A1LA 4LTAA 3POFA 3ZFGB 2UYAA 5J7MA 1GQHA 2GC2A 3MW4A 2HWC2 1J1TA 4ATFA 2P6CA 1JH5A 1I9RA 1WIZA 4YGBA 2ZHKA 4RR3C 5DAQA 4GWIA 4L97A 4OUSA 2ID4A 2QQKA 1VPHA 1OLME 2OXBA 2ZX0A 3VBUC 2V3CC 4YG7B 1MZ6A 1FMD1 5FUIA 3JU9A 5I91A 1X33A 1V0AA 1UYZA 5FYUA 1BK0A 3IWZA 1OF4A 1QJU3 4YNIA 2MPFA 3SITA 3H8OA 3ACFA 5KC6A 1RVF1 4HLTA 3ZFFA 3G5GA 1HB3A 2FCUA 3FC0A 4PDWB 1QB2A 4GWJA 4HKWA 4CDUA 5FOJB 2O0OA 1UOGA 2X5IC 2PUGA 2Y6GA 3KHCA 4P9XA 5FXZA 3WQ1A 5FMOL 4NIHA 1CAWA 3J9SA 2WRAA 3WXPA 4BIOA 5FMOS 5F2WA 2CV6A 5D21A 3WEZA 1U12A 3O1RA 3LA3A 2GC0A 2C6SA 2AWIA 3KV6A 2JD4A 3CO2A 2EIEA 1QDOA 4Q8LA 5A7LA 2PHLA 3OBRA 4PIZA 4JQDA 1V6IA 3WDXA 1IPKA 4Q1PA 4GJZA 3WDVA 3WV6A 3ZLIA 4XABA 2IVQA 1E5IA 4ER3A 1QJY1 1RUD3 3NJYA 2XXZA 4NIDA 1OCTC 1GMMA 1GP5A 4LBQD 2FD8A 3KS7A 1YI9A 2A1XA 3MIHA 4OQ9A 2QKDA 4C1XA 2EIDA 3NJZA 2DTYA 2VAUA 1UAIA 4XMAA 3AFKA 4JX0A 2ZZJA 4JCXA 4U2AA 3BI3A 3HNMA 5HCHA 4JDNA 5FBZA 3WDYA 1U0AA 2CDPA 2R1DA 2AZ5A 4IV3B 4AQ2A 1W6QB 5IK7A 4G9SB 2WFF1 2XR4A 4Q4V3 1HV1A 3HT1A 5A3PA 4AK3A 3AZXA 1CJGA 4NHLA 2LLVA 2QTWB 1YIFA 4N43B 1JMUB 4HPKA 4X4BA 4J6GA 4YBAA 1AL23 2YG0A 3VD5A 5CADA 3I3QA 1HRI3 2RM23 4KWLA 4QAWA 4XDOA 2PFWA 4YVSA 3V64A 1JZ3A 5FZ6A 4Q4W3 3ZKUA 2GMPA 3A21A 1LR5A 4JGZA 1AYN2 3AP7A 2JVLA 1CAXA 3M1HA 3VZLA 3VZKA 4M4PA 2P5BA 4AVAA 1LU1A 4CEWC 1BVVA 1N47A 2P6HA 2A6WA 2ZX2A 3PUSA 4E4ZA 2WT0A 3PUIA 4MVTA 1VMJA 4ONUA 1LAJA 1KEXA 4XF1A 4K8FA 4BK4A 4JKMA 4PLNA 2PAMA 2R1BA 2R042 4X4IA 2J1SA 2VCMA 2UYBA 1RC6A 2HWF2 1O3SA 1ZZBA 1US2A 2JG8C 1UKRA 4XJ8A 1SLAA 3CBNA 4N90A 3M3EA 5FYVA 1GWMA 3VLBB 3OF1A 1FPN2 3WR0A 4FPKA 4KH9A 1SLTA 2ZX4A 4URTA 4GJYA 5JZGC 1WLWA 3RJ2X 1VBE1 3LQXA 3F95A 2D6MA 2EF6A 1A34A 3MIBA 4OLLA 1Y3TA 1LHNA 1SBDA 4FBIA 1STMA 4W8JA 3JXBC 3LF7A 4CDXA 1IC8A 2RS31 4ER7A 2ZGQA 3CNAA 3EB7A 5C9AB 4QPGB 3E6BA 2WYSA 5FY7A 4QDSA 2E7TA 4OI0A 3DNVB 3GUUA 5I8YA 3N7JA 1X2LA 1CPMA 4OYUA 1JZ4A 2LYKA 1H2KA 1PRVA 2HH9A 3LEKA 3NJXA 2ODRD 4G3YC 1MZFA 2VD7A 1VAKA 4ES8A 1K5MB 1SLCA 1KGYA 4EZ4A 5FZHA 2EXIA 4EE2A 5EPAA 4GXLA 1PGL1 5CYYA 3N9QA 4Q4W1 1RUJ2 2VZPA 1W2TA 1ZX5A 4CEWA 1XPWA 4HT1T 2VOKA 1S4CA 3KVBA 2GNMA 2D97A 3POIA 3PMEA 2DFBA 3KGLA 4NPRA 2PXPA 4Y3OA 3THTA 4QQLA 3PVEA 2X5IA 4TXWA 1NE4A 5G05L 3H0OA 1C57A 2DUOA 3ZOIA 1O8PA 5ACA2 3W5NA 5C5TA 4FTBA 4HSJA 4IEVA 3VB9A 4X4CA 3OPZA 4XCAA 3THPA 3WF3A 2X53S 2VQUA 3OD0A 4PIYA 4RYDA 1YCIA 5GJ6A 4IEOA 5L9BA 4J1WA 3IB3A 2PUAA 1TEIA 5FKBA 4ZS3A 3KD4A 4QPIA 3A0NA 5JSPA 1RUH1 5K8SA 2PQSA 1VB4A 4OZXA 2HEWF 5A7OA 1VAVA 4CU8A 4DZGA 4CP9B 3OQOA 1PNGA 2VEOA 3O1VA 4YW5A 1DCSA 3GJAA 5FP9A 3O5SA 1LRHA 2XJVA 3GBFA 3M3CA 3ZXLA 1QH6A 3NMBA 1PX4A 5ABJC 1WETA 1P8JA 4BOWA 2D5VA 2QQLA 3DYMA 1D2QA 4AGRA 3QFIA 4QB2A 2ZGRA 1PM4A 5C3OA 1CQTA 4X6RB 1ZVFA 2IXJA 2VCCA 1Y43B 2Y6JA 4NDWA 2RS53 1U5YA 1WH8A 4A7ZA 4PCRA 4W6WA 4META 3IAQA 1Z78A 1OUXA 2JB4A 2FDKA 2LNMA 2GNTA 2VGDA 3WCRA 3WP4A 2VW0A 4YGCA 3R4UA 2GNDA 3DCQA 5FMBA 2RS13 5FY8A 2YY1A 4AFCA 2WZR2 1BQPA 2WO7A 3OG2A 2GMMA 4UW4A 5BNPA 1WD3A 5C3RA 4RD7A 4XUPA 4I2OA 2UY9A 3AZWA 3ENRA 3KGZA 1SLLA 4GULA 5FZDA 1DZRA 4OHVA 3WNOA 2ZGLA 3VKFC 3BKZA 2V5YA 4MGIE 4XJUA 3OGRA 3C7HA 1ZAYA 4FT8A 4LKDA 2R043 1JZ7A 1PK6B 4NIAA 5A80A 1ULOA 3L2YA 5GZDA 2ES3A 2JWPA 3PXPA 2PUFA 1IS5A 3W58A 4MCXA 2G9FA 2RVAA 2WBKA 1S2KA 1PZ8A 4CU7A 4E8DA 1QGLA 4EKIA 4K7JA 4OHXA 1JXNA 3JXDL 2D6OX 1RUC2 2WLPA 4YW7A 2UURA 5CVRA 4K20A 4IV3A 1APNA 3T2OA 1LHOA 1ZREA 1K42A 2XG3A 1W8NA 1Y9GA 1LCDA 2DF7A 1X57A 1OI6A 2QQMA 2VQ0A 3P3NA 1NCQA 4Q4W2 4UYBA 2JDKA 5JIUA 3AMMA 5FYIA 1AXKA 3SKJE 2SLIA 3DEMA 4J25A 4ARXA 4BB3A 2QQVA 5CBLA 2XLAA 3ZYPA 4YVSB 5JZGB 4YVWB 2WZPP 1VBC2 3MUZ1 1RUI3 2QQOA 1X9TA 2DVBA 1ASJ2 1OT5A 4ZU7A 1A3KA 2VUJA 3VBHA 3GCWA 2WFF3 4BIFA 3AX4A 5C8CB 5JUWA 4W6XA 3KT4A 1JFTA 1YQ8A 5IVYA 3RYKA 4LQRA 1UZZA 3GGLA 3OYWB 4MSVA 2XWJB 1PIV3 2WYFA 3AKQA 1PRUA 2IU7A 3CJXA 3KZ4C 3LKJA 3OUHA 2G9ZA 4RGAA 4L8QA 4OI4A 4COZA 5KWRA 2XL9A 4YG4A 3S8QA 2CAVA 4AG4A 2JDAA 1RUOA 4K3UA 1WMEA 2D6NA 3FLRA 1PO22 4M0NA 1BJQA 2HLEA 2Y34A 2AREA 1YUDA 1UXZA 3NKGA 4W4ZA 3C7EA 2H0VA 3QLQA 1AU7A 1K5MC 2IC1A 5L36A 3MPPG 4Y1XA 2VY0A 1N3QA 3DKQA 1PVC1 3N9PA 4XF0A 1UIJA 2PELA 1TNRA 2R0FA 2XBO1 5LBCA 3RI8A 3ST7A 2VUCA 3SHRA 1W04A 3USUB 5E1RA 3R6SA 3FWEA 1AR63 2XHNA 4CDWB 1VJ2A 2AR6A 2D7FA 3MEPA 2E7QA 5FPVA 4DB5A 2O38A 4FO9A 4UF0B 1KFXL 4LUMA 3PE5A 5H9QA 4CDXB 5T55A 1G86A 4XBQA 1S2BA 3U14A 3H8XA 1CN1A 2R63A 4LE3A 5F6KA 5FMCA 3RWKX 1H6YA 3ZIXA 3FHQA 1YQ5A 3VD9A 2ZCWA 4ASMB 1UYXA 4IESA 5FZIA 4XYXA 1V6MA 1W8ZA 2W08A 4NRPA 5JI7A 4CCKA 2PLV1 4E2GA 1XU2A 4MGSA 2RR13 3TEYA 3WUDA 2RJ2A 2YC4A 3AKPA 2D6PA 2VW1A 1LHUA 2P3IA 1JYNA 4Q4V2 1IQDC 1W9YA 4AFBA 1NY71 4IA8A 1K5MA 1RVF2 5CKQA 2CSGA 4FP2A 2ZMLA 2GU9A 1UL9A 2J1TA 5FYYA 3WG4A 2ORXA 2GRMA 4B1MA 3NSTA 3U78A 1G9CA 5LCWL 4XMIA 3OJBA 5FQ0B 4I6TA 2QDRA 3ZMNA 2ZOEB 3ROUA 5B2GB 3FFZA 1QKQA 5BNOA 5F3GA 2WWSA 2QQPA 4CUBA 4YM3A 2VNOA 3VZNA 5A7WB 1NCRB 2YB7A 4ZY9A 2R7EB 3I49A 1FNYA 4BLIA 1EAH1 1YFYA 2HWE1 1YNAA 1AYM3 3POEA 4QT6A 2Y6FA 4UI9L 5L7OC 1S0GA 1TQ5A 4RHV1 2MEZA 5CG8A 1JWLA 1YSEA 3UETA 4V2VA 1BZWA 2BQPA 1AF9A 1EAH3 2AC1A 2VMEA 3RFRA 4X4EA 4P08A 5BNPC 3VDBA 3AZZA 3AYDA 2XI8A 1ULPA 1VBC1 4HMZA 3AYCA 5GZFA 2DCKA 3CMGA 3B9IA 1QNYA 2FFHA 1COV3 1FMD2 1GOHA 1OBNA 2HWB3 1QPZA 2X09A 3FUQA 3PTRB 4K40A 3P5BA 4AAPA 1YQ6A 5I0DA 5EXOA 5IVJA 1XYNA 1VBA2 4KG8A 2CWMA 4Y1VA 2RMU2 2QQNA 5F7UA 3LD8A 4XF9A 1D2SA 3ZHIA 1EP0A 4AEDC 1H8VA 3NDBB 2WA4A 5CKNA 5J3UA 4X4FA 1V9U2 3FJSA 4CRQA 1F31A 1OLQA 5APAA 3X29B 1O3QA 1W2NA 2XLFA 3KQRA 1YEWA 4DO0A 2C26A 5LZ6A 3LZZA 2E63A 5CFCC 2WNUA 4YZ1A 2EALA 4Q0UA 3C2UA 3S30A 4IVZA 3VDDA 5DABA 3BIWE 2JDYA 4MXWA 4NAMA 2HWB2 4HSLA 3A9YA 4XUOA 2RS51 3WG3A 1UZVA 3M8LA 3KQ4B 5FZOB 1HN1A 1GZTA 2W1QA 4UFKA 3QOXA 1ZBE3 3OB8A 1VRH2 2OPKA 5FZFA 2EXHA 3SEPA 1RUF3 2R063 4BXSV 2YGLA 3JQXA 3OEBA 5FXWA 4A7YA 4FPYA 2DVGA 1MS1A 2IFRA 3CJIB 1DZQA 1AYN3 4I6UA 2HWD2 5KHKA 2XMLA 1PMJX 3MYXA 4Q4V1 5DZEA 2F6BA 3QOPA 2DVDA 5LBBA 1HV0A 4QXCA 2JD9A 3WG1A 1DYKA 3OD4A 4BQWA 2A6YA 1AL21 3VDDC 4Z58A 1BCXA 2HKXA 2WNVA 4IGOA 4EZIA 4CCNA 3N7MA 1FPN1 5K0UA 5FLIA 1OFSA 1KDKA 2RS32 2TUNA 5FY0A 3AXEA 4AI8A 5F5AA 3T08A 2XB6C 4A3XA 4AVBA 1UU4A 1F5JA 5T50A 1JUIA 5JMCA 1VBE2 3THCA 4CDWC 4XXPA 1HQNA 1H8TA 1QU0A 2ZGPA 2FCVA 3KV9A 4NE9A 3H1WA 2OUHA 3T4HB 1OLRA 2ATFA 2PTMA 4QD2A 2BNOA 3OGJA 3OYWA 2AUWA 4CDUB 1NA1A 5IVCA 5FY9A 2J1VA 2DVFA 3LIGA 4QDRA 5LEKA 4BQ4A 1GR3A 1SFPA 5IUQA 1IHMA 1UX6A 5FPLA 2LROA 2GMEA 1SQ8A 4PU8A 1RMU1 4JCKA 1K45A 4QGMA 4AF9A 1SHWB 5A70A 3ATGA 2ENRA 2O1QA 5JXJA 2W52A 1ND2A 3FL7A 3LEMA 3VZMA 4L2NA 5H9PA 2AACA 4Q0PA 4PLOA 5FV3A 4WM8A 4BU2A 5C3QA 1W6OA 2MXDA 3RGBA 1VBA1 1T6BX 1VBE3 3H1MA 2J42A 2EICA 4YG1A 4IGQA 5A3LA 3PVNA 3IM0A 4HVRA 3F6WA 2Y60A 2KD7A 1NZCA 4FAGA 5C8WA 3FMGA 1ENXA 1ZRCA 4NROA 1LTEA 5KR7A 4Y5TA 4X4GA 2ZX3A 3JCIA 4LHSA 3KJXA 1IPSA 1CZSA 1YFWA 2NQYA 1RXGA 1ENQA 3ORJA 5F6LB 3ZSMA 3QH6A 5D8AC 4JVAA 3O9XA 1PIV1 2B39A 1RL3A 2GDFA 4I0WB 4HETA 4Y33A 1U5IA 4LPLA 4IEYA 2VMFA 1OPMA 2R073 4LKSA 3W20A 2W87A 5KBFA 2W46A 4GB31 3UKNA 1LGBA 1W3VA 1LEMA 2RS52 1G9AA 1EYBA 1VBC3 1LOGA 2UWCA 2HEVF 5FJHA 4S2GA 4AW7A 4IWRA 1JYIA 4P9LA 3ZXAC 1R1ZA 5KXBA 1CJPA 1RUJ1 4HANA 3ETPA 4ZPIA 2EAKA 4FFFA 4WVMA 4E4SA 1GNZA 1CZTA 4XCBA 1PGW1 3CLPA 5LRSA 5F32A 1TME1 3AYAA 4AI3A 2AENA 1CAUB 3Q9OA 4CSWA 5FFOC 1OA4A 1Z0HA 4A3ZA 3O1OA 2OIIA 2UWBA 3WDTA 4O9EA 3TNPB 2BPA2 1QXPA 5IK5A 5CFCA 1PO12 3VD3A 3IKWA 4QXBA 1BMV2 2AYHA 1OD3A 2J7UA 5J37A 3DGTA 3JBG2 1RYYA 1AR72 3H7JA 1W2UA 3LEIA 1OURA 1ZZ8A 4YFWA 1ND3A 1ULEA 1R082 5DRYA 2JENA 4NWWA 2NPIA 1DFQA 1RXFA 2W9XA 2XWBB 4Y5Z0 2Q0AA 4BMEA 2YPJA 1A8MA 3BALA 1RUD2 3C8XA 2ZEYA 2AEZA 3ACGA 1E3OC 5IHRA 2BNNA 3OPWA 4N7IA 1QXRA 4AQ6A 2TBVA 3TWIA 3A4UA 4AYUA 4CUGA 1XE0A 2L49A 1R1A2 3VN4A 1CPNA 4CEYB 4FPHA 5GZGA 1ODMA 3D3AA 2P34A 4QKDA 4ISQA 4IE6A 3HJRA 4KG0A 3BUCA 1M4WA 2BVVA 3JUUA 3LEGA 2FDGA 4QX2A 2VZOA 3DECA 2VCBA 4BMBA 4BM8A 4PDWC 2XLGA 1UCXA 3Q8CA 3PTYA 2C1FA 1LJ7A 2W92A 2C24A 3PUHA 3AP9A 3JD71 4GAZA 2WT2A 1W05A 1SLBA 1CWPA 1NW3A 1W6MA 2PUCA 1NZIA 4R9CA 1CAVA 4IV1A 1GWLA 2CGNA 3K48A 4AEKA 3OQNA 1HN0A 3MLKA 1QJU1 2OFYA 2XJUA 4FPGA 1J3QA 3PMSA 3VHPA 1YC61 3AXDA 2WO2A 4RS5B 5GKAC 2QZ3A 5CFDB 3RZMA 4AHWA 2BFUL 2O14A 3T0BA 1NE6A 3VL8A 1RUG2 3TEPA 4UW3A 3WSOA 4ZXEA 1B35C 1GZWA 3HQUA 4XW3A 3GXUA 3TN93 4Z59A 1LGNA 3ILFA 3CIHA 2K9ZA 3P3PA 2JG9A 5T52A 3U4XA 1B09A 1JOJA 2PYTA 3LPGA 4QU2A 3IIAA 3JXSA 1ND2C 1MS4A 4ASKA 1TVGA 4LHKA 3K3OA 2BW8A 1FOD3 5FZEA 3DYOA 2ZGSA 4L9BA 1CAWB 2YGMA 4A45A 3B94A 3CQOA 1GICA 1V6JA 3G6JB 3WLUA 5BPXA 1LOFA 2WIIB 3T4VA 2WDBA 5B4NA 1U5XA 2A5ZA 2HEYF 1X8MA 1CR7A 5K4LA 5A3NA 2O49A 3N36A 2YHJA 3WDUA 5I0UA 1NA1B 3OUJA 4UXAA 3WF2A 1W8UA 5KHHA 3KV5A 5FP3A 4GH4B 1BVP1 2MEV3 5FPXA 3OGGA 1HRV3 5JPNB 3LOBA
chains in the Genus database with same CATH topology
4A7KA 1R081 4FOQA 1V6NA 1D4M1 1NXMA 1PO21 5CB7A 4NO4A 2CL2A 2R30A 1AVBA 4BZ4A 1QQP3 4Q0QA 3R1FA 2QDNA 4YW1A 4Y26A 4BHPA 3WW1A 4DRVA 4FAHA 1SACA 3VBOA 1TNFA 1R1A1 3D82A 2PUEA 2PHUA 5E8AA 3BTAA 1GNHA 3PVBB 3SH3A 3MDPA 4QMAA 3HN1A 4GMP3 2HWD3 4B8EA 5LEJA 1WH6A 1RUC3 3POSA 4JGZB 4PJYA 5FTTC 3QQ6A 3ZHMA 3JD72 1FV3A 4Q4Y2 3JZVA 3ZXKA 1ZRDA 1SEFA 4CTEA 3CLCA 2R1JL 1HRV2 2IWGB 3GYDA 4LO4B 2GH8A 4LLOA 2YXSA 4PLMA 1J3RA 1SBFA 5KHJA 3VGIA 1ZS4A 1H2MA 1NXD1 1G9BA 2LYLA 2WNEA 4LHNA 1CAUA 3INAA 4D7SA 4CEYC 5LK7B 2E53A 1UU5A 1Z7S3 3ETQA 4FPLA 1KS5A 1L1MA 3PJQA 2WKKA 3VHRA 1AX0A 4HK9A 2ZKNA 4M3CA 2QVSB 3B7MA 3AZVA 3DN7A 1S0CA 3CROL 5K0UC 1RUE2 5T5JA 3AP4A 2A75A 1LCCA 1UU6A 4XETA 1OSLA 4IEZA 4X4HA 5KC5A 3H7YA 1X8EA 2GAUA 2EAAA 1BEV3 4XQ4A 5JLVA 2OA2A 2JE9A 3ZFEB 4CEWB 5FO8B 4FOWA 1ZNPA 3RRDA 1OQ1A 3WT3A 1RHI3 3GALA 3RNSA 1WLTA 1HQWA 4N43A 2WJSA 2XHKA 5ABJB 2ZTNA 1WCKA 3WW2A 1S0BA 1RGSA 4Y24A 3WNXA 4DRRA 5E88A 3MFCA 2JECA 1GQGA 3FBMA 4WVVA 1LOAA 3T1LA 3WQ0A 4OVEA 3V56A 1D0HA 3ZN4A 3J26N 1NLSA 2CGOA 2KZ8A 3SCFA 4KNCA 5HCBA 5L19A 5CFDA 1ZZCA 4YGDA 1VALA 3ZVXA 3AP5A 2A6ZA 1ENSA 2A7AA 3R05A 3BDNA 3SNMA 2JICA 1GZWB 2R16A 1UIKA 3AP6A 2HWC1 5A33B 3GNEA 2W68A 1F2NA 3DL3A 2I07B 3R4SA 3POWA 1PZ7A 1D4M3 1YO8A 3S7IA 3FZ3A 1RUH3 4RGGA 2FJRA 3T2TA 4DPNA 1D0GA 2VG9A 2CYFA 5I0RA 3I7DA 1BDHA 2LALA 3ZFFC 5C9AA 3MIFA 2KM2A 4XTMA 4ATEA 2O4AA 3NAPC 5LK5A 2P2KA 4E27A 1RUE3 4Y4YA 3LFPA 2PLV3 3FFQA 2I45A 4GB32 2YV8A 1RUF1 2R061 3M70A 2RE9A 2ICTA 2RHPA 3VBUB 1JHNA 1QQAA 4W6YA 2YZ4A 3MLJA 5CAZA 1FNZA 4Y20A 1PK6A 2B42B 3BODA 3F52A 1AR61 2BTVC 3TNQA 3PLQA 5FOBB 1G6NA 1AXYA 1OQDA 3AKRA 3UKVA 5DG1A 3O14A 3DPRB 1VBD2 5K7PA 1NCQB 1A78A 4HK8A 2GALA 2VOWA 1WD4A 4YZ5A 1DU3D 4Z5CA 3QACA 5JOYA 3ZXFA 1QP4A 1AL0G 2A6VA 4QPIB 3ZYJB 1HLCA 3SXWA 5FLJA 2P37A 3VBHB 1C5HA 3JBG1 1G8WA 5JAXA 4LBQA 3LSEA 1MR5A 2RR12 4LA2A 5GLWA 4GKYA 1ZM1A 4Y1ZA 4FXKB 2HWF3 1ZBA2 3CF6E 4PU4C 1S55A 5HXVA 4AXOA 2GSYA 4ITCA 1V6LA 1H1IA 3UK9A 4XHXA 1EY2A 4RQPA 3UJQA 2R072 4CEWC 1TME2 1QMJA 3H8UA 1HXS2 2FMDA 4AWDA 1NYWA 5KXBA 1BBT1 1S0FA 1FOD1 4Z82A 2DCZA 1NCRC 2RM21 4Q26A 4EN8B 1POV0 4EWDA 2AH2A 4XFIA 2E6VA 2PHFA 4CP1A 4N53C 2XGXA 4KU8A 4B29A 4IEQA 3WHUA 3KM5A 2WFPA 1ZUGA 1R69A 4AGVA 2CAUA 3FMYA 1U5ZA 3E97A 5AFBA 5KXEA 1W6NB 4COYA 4LO5B 4QGLA 2Z79A 4DXZA 4I6RA 4RQPC 1S0IA 3ZN5A 4XTPA 1ZA4A 3ZPYA 4HN1A 4R9DA 1CD3G 1Q43A 4CYDA 3DKWA 3ZYIB 1NCRA 4EV0A 1ZZ6A 4OB4A 3AZYA 4LUKA 3O0XA 3MZHA 2PHDA 1DIWA 3WDWA 1PGL2 5AC91 4WZFA 4HVQA 1UF2C 1RMU3 5ACA1 1DZTA 1QWRA 4KU7A 5C8CA 4WM7B 4F8DA 3KMHA 1NG0A 3VBOC 1Q8VA 2WINB 2KA3A 3AMNA 5DUVA 2ET7A 2WQZC 3WW4A 1Q8QA 3ZIWA 3FBYA 1KQRA 1RUG1 4M3CF 4XIOA 1V70A 4HKLA 5ACA3 1T6GC 5JR7B 1B0NA 1LULA 4J1XA 3I54A 3KB5A 5JPMB 4RR3B 1EFAA 4XFHA 2FMYA 3HWJA 1MS3A 2GN7A 4IERA 4FQZA 3VZOA 3ES4A 2OZJA 3O0WA 2NYYA 1XNDA 1ENRA 3ILRA 2BNMA 3F51A 2QUOA 3VDDB 1O5LA 4K1ZA 3MIEA 1REFA 2VULA 3AK0A 1W0OA 1VAMA 4MXWB 1XWRA 4KL1A 2XSDC 1Q8SA 5C6CA 3MIDA 4NHKA 3RG0A 4EWEA 3RI9A 3M2MA 2AUYA 2ZHNA 2WSVA 4Z5HA 4DY3A 3VBSC 3WZ1A 1F8VA 3S0MA 1BXHA 4WM8C 3VUOA 1Y7BA 2FHRA 5FQ0A 4BA6A 1D4M2 4CDUC 1I1EA 2IFWA 5CIRA 3KLSA 3ZX7A 1UXDA 2WSUA 1BKZA 2OZ6A 3AJYA 4SLIA 2NP0A 4EN9B 4Q8KA 3IDCB 2Z69A 1AR82 4HL0A 2XJPA 4FSJA 1RZRA 3HD8B 4C0HA 4L11A 1JYCA 1CVNA 2IUOA 5I0TA 4I0AA 4AFMA 4DS0A 1CJDA 3OCPA 3VBFA 1LOEA 4XEZA 4IV3C 1H8TB 3HZIB 1MS5A 2DCJA 5GLUA 1LOCA 3B3QE 1YXWA 2PQQA 4GMP1 4A2UA 4N43C 3B02A 1BDIA 4QM9A 2VMIA 3O12A 2ZGKA 3OY8A 1AZDA 2H8RA 1UZYA 1LB2A 4DFSA 1AYM1 1GLHA 3FUOA 3C3VA 4Z5DA 5FDBA 2VPVA 2ZAAA 2IXIA 3ASIA 2XJTA 5KXCA 4P9IA 4YM2A 4RQPB 1TMF1 1XE8A 4PBOA 4K6BA 3LA2A 2Q1MA 3WQ7A 4XIKA 4WVZA 3SMHA 2MEV2 1REEA 4LO8A 2JG8A 1RJ8A 4XILA 5CNAA 2XUMA 2ILMA 4D69A 4I3PA 2D3RA 4YVWC 2HWE2 1O3TA 3AYEA 4QM8A 1ZPQA 4I30A 4KGGA 4QX5A 3LISA 1UPIA 2WL1A 3APBA 5C9AC 1KXGA 2AW6A 2OVUA 4IETA 1H4HA 1PVXA 3M3QA 5DG2A 1MS8A 1RPEL 1QH7A 3I8TA 4PDWA 2E51A 2F4PA 1IQAA 2HINA 1TE1B 4AE2A 1AX1A 4DMIA 2WNVB 2O8OA 1DYPA 2VH9A 4S2HA 4BCUA 4BPZA 4B4QA 2CSFA 4JDMA 2DWRA 1IZ3A 4RA0A 3V0AB 4WZCA 4Q4Y3 3W59A 3NW4A 1R093 1MACA 3AB0A 3FLPA 3LA7A 1AR81 4JAAA 2IXHA 1WW4A 3KCCA 1OKQA 1A8DA 3ZN6A 3ZXGA 3BS3A 3WVJA 1ADRA 1ND3B 1W6PA 2LCVA 4KGQA 2Q8OA 2JJ6A 3DV8A 1NQJA 4UBHA 1O4ZA 2HWB1 3EBRA 4HKOA 4XZPA 4LE4A 3DF0A 5AVAA 5EYYA 3ZXDA 3KZ3A 4RFT0 4AI0A 4DY5A 2CGPA 1PZ9A 4CDQA 2LYPA 1VRH1 3RSJA 3FE5A 1HRI1 1ZRRA 1ZZ7A 1W6OB 5GALA 1MEC2 2WUSR 2K2SA 4EN6B 1V9U1 1W6QA 1NOVA 2A71A 1IOAA 4N7UA 3VKOA 1G9DA 1GSLA 2EXKA 3T1MA 1JTZX 3H5TA 1H4GA 3B9CA 4HPKB 5BY5A 1PNRA 1HX6A 2PHRA 2RJLA 4NR1A 5JIAA 3S6PA 2BVBA 2GC1A 4BQ1A 2ZPXA 1S0JA 3DUIA 1RUH2 3WCSA 2G9GA 1SBEA 1S0EA 2CROA 1MQTA 1FATA 1H8TC 1I5ZA 2RJKA 2WC2A 2XKPA 3MW2A 3VKMA 5DDJ2 3RWNA 2HJIA 4H14A 1LECA 3BOWA 3NKTA 2RR11 2OUJA 1LOBA 1OOPB 3UV9A 3EO6A 4L99A 3N35A 1PMIA 4Z92B 4I01A 4AEDB 4XFGA 2HWD1 3OBTA 1MS0A 2IXCA 1VBD1 3CL1A 4GMP0 5CFCB 1YIPA 1GANA 2D6KA 2XBO3 2R071 1UMZA 1NEQA 2DCYA 2H0BA 2NMNA 4D7TA 3R0RA 1KD7A 1YJLA 4OULA 4DOUA 1UTXA 1DQ1A 1PO23 2ZABA 4YG0A 5DUWA 4Q4X2 5FO9B 2HYKA 1H1MA 5BNQA 1NQDA 3AMHA 3SH4A 2WS91 3E5QA 2QCSB 1X7NA 5FO7B 1XXNA 1O7FA 2PA7A 1O4XA 1RMU2 4CEYA 4FCAA 1R1A3 2EWTA 1HQLA 2VOXA 1N1TA 1KRIA 2LM3A 1WUVA 5CG9A 4TSVA 2C5DA 4COVA 4DQAA 4JTOA 3H3ZA 5E16A 4AVCA 4TZDA 4XQWA 2X5IB 4EWAA 1HXS1 4H7MA 2PPXA 1R083 2ZMKA 5GZEA 2Z5WA 1QDCA 4DINB 4XJZA 3B69A 4OHYA 1VP6A 4AFAA 1ZZ9A 1XNBA 3BOPA 3GHNA 4M3CE 4I8TA 1MZEA 3G7DA 1XNCA 1XYPA 2JG9B 5JOWA 1FI2A 4FP3A 3RQ0A 1LHWA 2ZKLA 4PQ9A 4YZ2A 3AM2A 3NV2A 4MGKE 4QGNA 1DWKA 4IEPA 5LRRA 3WDVA 1FYUA 5F1RA 1PVC2 3POYA 3GBGA 3V0AA 3ZSLA 5D1IA 4QXKA 1HKDA 1M06G 1WW5A 4JGYC 4WBBA 1KJRA 1D4VB 4ISRA 2W0XA 4JCYA 1C8M1 2OYZA 3ZN6B 1PO11 3ZXEA 1BMV1 3S7EA 4Q4X3 1JW6A 4M3CB 5EJ3A 5DXDA 5L7OA 4P9JA 4YW2A 4AQTA 1RUNA 4TYSA 5DDJ3 2ETEA 4YZ3A 4AVVA 1GZ9A 2C9AA 3JXCL 1KS4A 1QJU2 1J3PA 2A3YA 3GBWA 3VBFC 1WMFA 3IDBB 2VNRA 4F8AA 1MVQA 2DUQA 3D5OA 3OTFA 5BNPB 2D44A 1ASJ3 2GH2A 2WS92 4MH0E 1OOPC 3ZFEA 3D8CA 1BK1A 1ZVVA 3GZAA 3HBZA 1DGWA 1ZBA3 5I93A 4M01A 4XJAA 4XFCA 1XYOA 3CEWA 5JZGA 1HDKA 3RS6A 4NOTA 4MUVA 4V1PA 2EVXA 2FZ1A 2VXRA 4LLFA 3QCWA 1MQTB 4XFBA 4ZKTB 3WP3A 1LHVA 3QBQA 3J8F1 3UFDA 3IDEA 3OQMA 1OOPA 2UY8A 3TN92 2JXAA 4YVWA 2LYJA 3FHIB 1Q56A 2A3WA 4P9YA 1XE7A 2RMU1 4BH9A 5KXDA 3MW3A 4F3JA 3HMYA 4LO7A 3M7AA 1Y7YA 1YYNA 3VZJA 4KWJA 2EXJA 2H6CA 5A3MA 2DURA 2DYCA 4GKXA 4MGZE 4XPVA 5DZFA 2RS11 2EF8A 1VBA3 2VVDA 4AHYA 4IXLA 2HWC3 2Q5TA