2BNMA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords EPOXIDASE
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
total genus 46
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnmA02
4KU8A 3CEWA 5KBFA 3E6BA 1VJ2A 2ETEA 3LWCA 5I0UA 2BYVE 1ZAYA 2UY9A 3U0ZA 5FPXA 4XFFA 1RGSA 1ZVVA 5JSPA 2EWTA 1RZRA 2H8RA 4P9GA 3LFPA 3RYRA 1LCDA 1G6NA 4JVAA 1UCXA 1O3QA 1CAVB 4FBFA 1O7FA 4N9IA 3ES1A 4X4IA 3UFDA 1YHFA 1WIZA 1PRVA 3ZHIA 1LR5A 1QY4A 1YFXA 3F6WA 1ZZ8A 3CLCA 1UIJA 3B02A 4LA3A 3E97A 4XF4A 2Q30A 1GQGA 3FHIB 3S7IA 4MGZE 3CECA 2Z69A 2D5VA 2GZUA 4MGIE 1J1LA 1LRHA 4PU3C 1YWKA 5JCTA 4I0BA 3FMYA 1LB2A 4Q0SA 4O9GA 1LKNA 2HINA 2UY8A 1EPZA 5FLIA 4Z5CA 5BV6A 3ZKCA 2PAEA 2PE5A 1JFTA 3TNPB 4HSLA 2GRMA 3KZ3A 1DGRA 1UW8A 4D7TA 4X4HA 1EYBA 3FYMA 2O38A 3H7YA 4BIFA 1UPIA 4KL1A 1UTXA 4MH0E 4QGNA 3ST7A 1WLTA 2IVQA 2OA2A 2KEIA 3SCFA 1LMB3 4O8BA 2Q0AA 2XSDC 4JQDA 5F1RA 1FXZA 2AXZA 1J3QA 2ET1A 2B8MA 3EO6A 5LEJA 2PIJA 1JH9A 4L11A 4Q29A 5LEKA 4ZU4A 1QP0A 3ELNA 1ZZ9A 1ZS4A 3OMTA 3BDNA 2KEJA 3TNQA 2CSFA 4JCXA 4ORFA 4FAGA 4Y42A 3RPQA 3N4MA 3E5UA 4X4DA 1NE4A 3DKWA 3OGJA 4PIYA 3QQ6A 3BB6A 3USSA 3O9XA 4XETA 2K0GA 1J3RA 2Q4SA 4JTOA 3OP9A 1CAUA 3ACLA 1NEQA 4KWLA 2XL9A 2QCSB 3G7DA 1X82A 3H9AA 2MHFA 1PNRA 2XLGA 4F8AA 3OD0A 4QXKA 2PAKA 3H5TA 3WW3A 2BJCA 3JXBC 4LULA 3FYAA 1LLIA 1H1MA 5JR7B 3IVPA 3EUSA 4D7SA 3R1FA 3H1YA 1QWRA 2IU7A 1Y7YA 1SQ4A 5A7LA 2O4AA 3M3IA 4MGKE 1UXCA 3KSCA 1CGPA 2XLFA 2XKOA 2ET7A 3DL3A 1R63A 2Q1ZB 1SEFA 2GAUA 1QP7A 1E3OC 4R8HA 2E9QA 5EFUA 2H6BA 4XFBA 5BXXA 4IEZA 1CJGA 4LEJA 4HMZA 4MUVA 2WIUB 1GQHA 4KWKA 1L3JA 5BPXA 2XL7A 3H7JA 3LISA 1CAWA 2OZJA 3HQXA 3MPBA 5JAXA 2DCTA 5KHGA 2HSGA 1B0NA 5K98B 2ICTA 2AWIA 3RZZA 1XE7A 5JSOA 3H3ZA 4AVBA 1EP0A 3EQEA 2LYSA 3D1NI 4QGMA 2IVBA 1RUNA 1EFAA 2CGPA 2PUCA 1ZNPA 2GC1A 3I7DA 3FZ3A 1AU7A 5EZWA 4OFGA 2ATFA 2IV1A 1CAUB 2GZWA 4IEYA 4EWEA 4Q0VA 4F7ZA 4QX5A 4AQ2A 5FLHA 1O5LA 1QPZA 4I3PA 3PNAA 1HW5A 1SQ8A 4YG7B 3H1MA 4O9EA 4Z5HA 2PAMA 3C3VA 3DN7A 3G5GA 1UXDA 1EY2A 1NE6A 1QXRA 4X4GA 4X4BA 1X8MA 2F4PA 3KGZA 4PIZA 5E16A 1DW9A 4WVZA 4PU7A 1YSEA 2AXUA 3D0SA 3CLPA 4I6RA 3H1WA 4HN0A 3LZZA 2QDRA 3H8UA 2LYRA 3PVBB 2LYLA 2PUBA 5LRSA 2MNGA 1ZZCA 1BDIA 1X57A 4EV0A 2BNMA 2XKPA 4PU4C 3ZDSA 3CO2A 1RPEL 1OFNA 1UD1A 3GN5A 2P17A 4HN1A 4PJYA 3R6SA 4Z58A 1VP6A 3DNVB 2OFYA 4I02A 1I5ZA 5J3UA 1O3RA 2ZKLA 3SXWA 1ZZ6A 2C0ZA 4XEZA 4EWDA 1CAWB 1FT9A 4HVQA 3NSTA 4IEPA 4BHPA 3JXDL 1CAXA 4F8DA 2XLAA 2KXLA 4ONUA 4HVOA 3H50A 3S7EA 3QWGA 1H1IA 2XJ3A 4AVCA 1UIKA 3IWZA 2WC2A 5KHHA 5C8WA 3RDIA 3NJZA 1YLLA 5I0SA 4I2OA 3FX3A 2EA7A 1YFUA 2GC2A 1ZRCA 1ZVFA 1Q3EA 4IWRA 2GC3A 4KU7A 1O4XA 4Z07A 4PU8A 4AQ6A 3EBRA 2PHLA 4IEWA 2L49A 4IEUA 2GH2A 5KHJA 4UBHA 4QGLA 1OSLA 2FQPA 4NVPA 5CADA 3CL1A 2A6CA 2QVSB 1O3SA 2MPFA 3H3UA 3FWEA 4EWAA 4YG1A 3BPZA 3PXPA 1ZRFA 1RC6A 3FFQA 3D82A 5FQ0A 1WH8A 1NZCA 1FI2A 3GN5B 2CAUA 1LCCA 4XFHA 4L2NA 1V70A 1WETA 2PUAA 1ZUGA 1XWRA 3HT2A 4OLLA 2H6CA 4KWJA 3BD1A 4I8TA 5J48A 3SHRA 4GULA 3ES4A 3PLQA 2H0VA 1CAXB 4BH9A 3U10A 1BDHA 2PUEA 2PQQA 3FJSA 3JZVA 3NVCA 1Q5OA 4X6QB 3F51A 5KHIA 2PYTA 2HKXA 2WUSR 1Q43A 3E6CC 2CV6A 4I09A 2Z2SB 4FAHA 3HT1A 4UXAA 2LYPA 1VPWA 3TRBA 5I8SA 3OQOA 3MDPA 4PIXA 4Q0QA 1QXJA 3MLFA 3FE5A 3UKNA 4JV4A 2PA7A 3ROUA 3BALA 4YBAA 2OYZA 3MYXA 5LRRA 4NDWA 5J7MA 4HSJA 4IEXA 2IXKA 1I6XA 3RNSA 3HIFA 3D0JA 3O14A 4X4FA 2IC1A 3KXAA 2KPJA 3LA2A 1OD5A 3SMHA 2IXLA 2IXIA 3IDCB 4IEVA 5FQ0B 5C6CA 5I8YA 4GQMA 3OTFA 4QM9A 2GRLA 2B5HA 3OQNA 2ZCWA 3LA7A 5I0RA 4MCXA 5FLJA 2GC0A 1J3PA 1QQBA 5BY5A 2XGXA 2D93A 3U11A 3IDBB 2AXVA 4J1WA 4HVRA 1HF0A 4IERA 4RD7A 4ZU7A 4XF1A 2OZ6A 1J59A 1PM7A 3KCCA 4FN3A 3M70A 2KZ8A 3QF3A 2V09A 3ETQA 4XF3A 2R1JL 1RL3A 3LAGA 1RUOA 4JCYA 1NERA 4LTAA 1XE8A 2FMYA 4IA8A 2Y0OA 4N9HA 1Y9QA 4GHJA 4YRDA 1YUDA 1RTVA 4MZUA 5I93A 2MEZA 1ZREA 2EAAA 4Z5DA 3KJXA 1ZRRA 1OMIA 3I59A 1LQCA 3E5QA 1YFYA 3S8QA 4MV2A 1WH6A 1NYWA 3NL1A 4QMAA 4WBBA 5FPZA 5HI0A 1ZZ7A 5BUVA 3KMHA 2KEKA 4BYYA 2CAVA 4HZFA 1WGPA 2OR1L 2L8NA 1ADRA 4YNIA 3UKTA 3BCWA 3OCPA 2LYJA 3QYXA 1X8EA 2K9ZA 4Z82A 1PMIA 2UYBA 2VECA 2BEOA 3QOPA 1NXMA 1U12A 2O49A 2LYKA 2I45A 4IVZA 3VK0A 4H7LA 2IXHA 1ZZBA 2EBYA 1DZTA 3B7HA 4Q0UA 5K8SA 3S0MA 5CU1A 2XIUA 1ZRDA 2XHKA 1CQTA 1YFWA 1OI6A 1ZX5A 2AW6A 2BGCA 2BNOA 3BU7A 2IXJA 2VPVA 3LA3A 3LOIA 4MGYE 5KHKA 5I91A 1JWLA 2WFPA 4Q0PA 3SCGA 1RZRD 3I54A 1ZPQA 3NW4A 4YARA 4XFCA 5FCCA 1RIOA 1IPKA 1DWKA 4IESA 4K8FA 4LLOA 4WZCA 4XF0A 4X6RB 2MQKA 2PPXA 3EJKA 3L1PA 2PUGA 1O3TA 5T3NA 3WW1A 3BS3A 4QM8A 3GYDA 4JTNA 4I0AA 2IUOA 2XCJA 4J1XA 1J58A 1X2LA 1Y3TA 1OCTC 4XFAA 1QP4A 4I6TA 2FJRA 1GT0C 1O5UA 1TQ5A 4MCTA 2JVLA 2D5HA 1PRUA 3E5XA 2D40A 4CYDA 2B5AA 1SFNA 3OQMA 4IEOA 1PERL 4DINB 2O8QA 2ICPA 4E2GA 2GU9A 4A2UA 2LYQA 1DGWA 5I8TA 4LUMA 2XI8A 3I59B 3UKVA 4E2QA 3CROL 4HBNA 1IC8A 2PHDA 1JFSA 4OB4A 4LUKA 2QNKA 3DV8A 1R69A 4IEQA 3JXCL 4UBGA 4B29A 4E2SA 4YSFA 2PTMA 2CROA 1XRUA 4XFGA 2N7GA 2PUDA 1CAVA 2EF8A 4AVAA 3VHRA 1POUA 4IETA 2HJIA 5I0TA 3MZHA 3WW2A 4Z59A 2D5FA 4MX3A 1RZSA 2B9UA 4XF9A 5D1IA 2VQAA 2JCGA 1QQAA 4FBIA 3EHKA 3KGLA 4LA2A 3E6DA 2QJVA 4AXOA 4HLTA 1X7NA 4ZU5A 1VR3A 1L1MA 3ZHMA 1CX4A 4XFIA 4R52A 3IBMA 5E1RA 3WW4A 4X4CA 2PFWA 5FDBA 4I6UA 2R63A 1S7EA 1WA4A 4META 1O4TA 4YYOA 1DZRA 2EVXA 5JSRA 3CJXA 4EROA 3GBFA 2PUFA 3F52A 2IXCA 3OF1A 4TLFA 3NKTA 5CVRA 3CF6E 2LCVA 3SCHA 3RYPA 3U3WA 3HZIB 1IPJA 3QACA 3L2HA 2UYAA 3IIAA 4I01A 5AVPA 2O1QA 2AUWA 1PRAA 2IVGA 4YG4A 2OPKA 4FT8A 3RYKA 4X4EA 1JUHA 2BNNA
chains in the Genus database with same CATH superfamily
4D0QA 4XJWA 5FO9B 3BUCA 1ND3B 1DP0A 4XUPA 1AF9A 1C5IA 3QOXA 1H1AA 2XQRA 1HRI2 1XNTA 2ETEA 3E6BA 2JG8B 3LWCA 1UYZA 5JXJA 1SLAA 1YI9A 1QQP2 2VVFA 3U0ZA 1J84A 1GICA 1D2QA 2WNOA 2WYFA 1H2LA 1HKDA 4EQVA 1REDA 2D44A 2ZMNA 4K6BA 4OYUA 1ZVVA 1OA3A 1PMJX 4Q27A 5JMCA 2EWTA 5K7PA 1GKBA 3LIHA 1OKQA 2RS31 2AEZA 3B9IA 1I3HA 1W8TA 4PT6A 3OBTA 1CAVB 3CNAA 1O7FA 3MW4A 4GD4A 3ZYFA 1JYCA 2OW4A 1TME3 3BIEA 3ES1A 4PBPA 1RJ8A 3UFDA 1GZWB 4A3XA 2JDNA 4QQHA 3MI8A 4P9LA 2VL4A 1PRVA 3ZHIA 1LR5A 2BTVC 3A22A 4AG4A 1SLIA 1VBE2 2VEOA 4OI2A 4QXBA 4DXTA 3LPGA 1AR92 1AR61 1IS6A 3A9YA 2Q30A 1GQGA 4JGYB 4ISQA 4TTGA 2WIIB 3CBNA 4RQPA 5FZBA 5FPLA 3P5BA 2QQUA 1MPXA 1O91A 5DAXA 4OHZA 1J1LA 4AI3A 3I2OA 2Y60A 3O1SA 2QQJA 2E33A 2GMPA 1AXYA 3ZR5A 4Q0SA 1BBT3 2O0OA 2YMZA 4O9GA 1LKNA 1HLCA 2NQYA 5C8CC 1U5ZA 3C7HA 1SBFA 2WSVA 1ULCA 2GMMA 4FCAA 3WVJA 4DY5A 3KZ3A 1CQ9A 2E53A 5F6KA 4D7TA 2GN3A 1EYBA 4LE3A 4RS5C 3OEAA 3D3AA 5FK8A 5FUIA 3VKLA 1UPIA 3ZFFA 2GMEA 5CFDB 4P5HA 1UKGA 2KEIA 4S2HA 1FATA 1VRH3 3V0AA 3AK0A 2XSDC 5F3CA 2Z4FA 3LD8A 1EPWA 5F3IA 1QJY2 1JXNA 3O1PA 2B8MA 1SBEA 2AH2A 3ECQA 4ZU4A 2JEMA 3ZMNA 4BQ5A 3K51A 5A1LA 4CEWC 1ZS4A 4P14A 4KG8A 2W1SA 1W6NA 2KEJA 2CSFA 2WQZC 1ACCA 1O8PA 2NM1A 2WR9A 2PHRA 2Y64A 1W6OB 1VB4A 3RPQA 1HRV3 1RUJ1 4Y1XA 1XJAA 3QQ6A 3T0DA 3USSA 3O9XA 4XETA 1PGL2 1HB1A 1V00A 4LKFA 4NE9A 5A80A 1ASJ2 3WF3A 5JI9A 2AUYA 2XUEA 3VDBA 4O7XA 2WLPA 5IVEA 4Q4W3 4MO3M 5JLVA 1TVGA 4GH4C 3C7OA 2PXLA 1XQNA 2VNGA 4Q1RA 4TN7A 2DUQA 4RQPB 2EAKA 2V4AA 2A3YA 5A7OA 2VC9A 3A0NA 1FAYA 1C57A 3WDWA 1WUVA 1E5IA 4Q4X1 1XOYA 4NHKA 1SLTA 1Y9MA 2XLGA 4XBQA 4QXKA 4QX1A 2JQEA 4F8AA 3VBFC 2G9ZA 1A34A 5GJ6A 2WABA 4Q2JA 4NWVA 1ND2A 4HFSA 5DABA 1LLIA 1AL0G 2XONA 4YFWA 3EUSA 3B00A 3WNNA 1LGBA 1R092 1SQ4A 4URAA 3BTYA 1LTEA 2RS33 4IGQA 4CP9A 1CX1A 2PXQA 1DF0A 3HPNA 3ZFFB 1ZBA2 5FY5A 5IVFA 1P8JA 1W28A 4OVEA 4ATEA 3VD4A 1MS0A 2W2IA 1C8M2 5L7OC 3V0AB 5DAPA 4Z8BA 2Q1ZB 5T52A 1SEFA 5EHDA 5FYCA 1LOGA 1KITA 1DYOA 2RS11 2OVUA 3NNGA 2E9QA 1BVVA 2H6BA 5AVAA 5E6HA 4CU8A 4IEZA 1LULA 4FVVA 5DRYA 3AZWA 1AR63 4MUVA 2WIUB 2A3XA 1L3JA 3NAPC 3MEJA 3PIGA 2QQOA 2R30A 1VAKA 1K45A 1W6NB 3LISA 1CAWA 5FP4A 2PXBA 1JYWA 2DCTA 2HWC2 1W8HA 2CY6A 1ST8A 4LJHA 3AYEA 5K0UC 3GHNA 5K98B 4QDSA 3VDDC 4BMEA 1MFQC 2ZEYA 1ND3C 3H3ZA 2BWCA 3HEIA 2IVBA 2WQ8A 1RUNA 1XE0A 2JG8C 3I7DA 5DXDA 1R1A2 3RRDA 3AJYA 4H7MA 5DMYA 2GZWA 4IEYA 4YWAA 4EWEA 4GIQA 4TXWA 1DCSA 3PUAA 3SITA 1FV3A 3QLQA 1DYKA 1JHNA 4HXCA 1S0EA 5FLHA 1GBGA 1O5LA 2ZGLA 1QJX2 4CVUA 5KXCA 4A4AA 2PLV3 4WM7A 2DVDA 1I1EA 2R49A 3H1MA 3MIEA 1H9PA 2RDNA 1M06G 3VKMA 3VBHA 1ND2B 2JKBA 4GMP0 2F4PA 4X4BA 4DOUA 1T6BX 1X9PA 4XBNA 4NHLA 4UOJA 4YM2A 1RUF1 2W1WA 2ZHMA 3D0SA 2WBKA 1MR5A 3H1WA 4HN0A 1GWMA 3THCA 5IFTA 2QDRA 3S30A 2V5DA 4JGYC 4LBKA 1CWPA 2Q1FA 2A7AA 3LF7A 5CG9A 1XSRA 3POEA 3MEPA 1BDIA 1RUJ3 2ID4A 3X29B 3HMYA 4EV0A 2RDSA 3A9XA 2AACA 3ASIA 2FBEA 4EYUA 3R05A 4XVHA 4Z58A 5DUXA 3DNVB 3AP5A 5A7SA 2OFYA 5J3UA 2HEYF 2VH9A 2ZKLA 4P9XA 1ZZ6A 5JUWA 3SXWA 4EWDA 1CAWB 1FT9A 4IL7A 5ACA1 1GZCA 3ZYBA 5T5JA 5C5UA 1RUC2 4E4ZA 4BHPA 1JW6A 4XURA 4CU9A 3JXDL 1DGWX 1QJU1 1QHDA 2VQ0A 5TSWA 4DXSA 5CFDC 1F4AA 3ILRA 3BI3A 4Q4X3 2DU0A 4BXSV 3SH5A 5C9AA 1UPSA 3AXDA 2F6BA 2D6PA 4M3CF 4GA9A 4TSVA 1G9CA 4Z1VA 3IWZA 1VALA 2WC2A 4OI0A 3GBGA 1H0BA 2DWRA 4LKSA 1WCKA 1S0IA 5F5QA 2GP5A 1JU3A 3FX3A 3J7MA 5GAGi 3AP4A 1GP6A 1TME2 2BBVA 3ZFGA 3AKPA 3RI8A 4CXWA 1MVEA 4M0HA 3T08A 1WW5A 2HEVF 4WM7B 5DZEA 2PHLA 4EN8B 2IFRA 4IEUA 4CPBD 3VBHB 5KHJA 2RS13 2ZTNA 4AF9A 5C3OA 1DYPA 4E9KA 3I2IA 2A6CA 4QKBA 5GZEA 5A7QA 4E4DX 3TAYA 1BHGA 3T2TA 4XHBA 4L8QA 1AJOA 4YG1A 1C4RA 3LGRA 3LEKA 5HCHA 2XJVA 3NJXA 5IUQA 4DUXA 5FQ0A 4I0WB 1W06A 2CL2A 3WF4A 4C91A 4EN0A 5IVJA 3RZLA 1UY4A 1LOAA 1H4HA 1LCCA 2DYCA 3WX5A 1V70A 1KRIA 1LENA 1RUG1 1VLNA 4AFDA 5A7PA 3HT2A 3NQHA 2P34A 4KWJA 3RVHA 4I8TA 3ZOIA 4RGGA 3SHRA 1X33A 1OLQA 1V6NA 3OGGA 1VRH2 4DE8A 3ZFFC 2QUOA 4AK3A 3J4UH 1NCQA 3JZVA 1Q5OA 3OOXA 5C9AB 3MF9A 5LA9A 3KF5A 5KHIA 2VZ3A 4P9JA 5EPAA 1M4WA 4OHXA 4I09A 4FAHA 1E5SA 1MS9A 1RUF3 1W2AX 5F7UA 3AL6A 3HT1A 5FYSA 4BA6A 3VUOA 2LYPA 1AL21 2XUMA 3PUIA 4LBQD 4N8MA 1L7LA 4M01A 5FZHA 1RUH1 3LEMA 2VZQA 2VE1A 3ORJA 4YZ3A 1PX4A 3ZFGB 1HQWA 3MDPA 2VM9A 4IXLA 4Y5Z0 3LB9A 3VKNA 2MEV2 3ROUA 1I5PA 4AI1A 2OYZA 4PI2A 5HBAA 4RFT0 4NDWA 4GWNA 1RB8G 1IG0A 4DEQA 3UETA 1W3VA 2LS6A 4CYDA 4TYSA 1S0DA 3HIFA 3OUIA 3SX0A 3WNOA 1HRI1 5FY9A 2IC1A 3NWKA 1CZVA 2DCYA 1Y9GA 4LO4B 4GKYA 2KPJA 3VN4A 1QQP1 4C1WA 3JQXA 5ACA3 3VHNA 5CAZA 4DZGA 2BW8A 2B9VA 2PHUA 4AEMA 4LT5A 2IXIA 2VVEA 4JDOA 4IEVA 5K4LA 5FQ0B 5C4WA 5KXEA 4ISRA 4QM9A 2ZCWA 3SEEA 3POIA 2GNMA 3ZFEA 1D2SA 2WNUA 1J3PA 1VBC2 3PURA 4X8PA 3PMSA 3URFA 1ND2C 2YU1A 3WR0A 5C3RA 3LFIA 4IERA 1JZ2A 4OQ8A 2P6HA 4Q8LA 1VPHA 1J59A 1PM7A 3KCCA 3L2YA 3AP7A 3N9PA 2GP3A 3QF3A 4JQTA 1VBE1 2YUEA 1AR91 1X9TA 1XE8A 4FPGA 4MHUA 1V0AA 3CU7A 1NCQB 5L9VA 1MS4A 4JKKA 5FO8B 2XXQA 3ZPYA 3NJYA 4F83A 4YRDA 4ES9A 4QDQA 2VZPA 4L0PA 4Y24A 2K46A 4OHYA 2MEZA 3WG1A 4MVTA 3KJXA 2QQLA 2HLEA 3B94A 4WBBA 1MEC1 3RJRA 4UW5A 2Y26A 3NL1A 5FPZA 1ZZ7A 5L19A 4NO4A 4O65A 2KEKA 5FO7B 4IUGA 4C0BA 1ADRA 2EF6A 2VUAA 3TEXA 2A75A 1OXCA 5J98B 2VCMA 2YB7A 3OCPA 1UZZA 3QYXA 2K9ZA 4Y22A 2Q5TA 4FOWA 1ULGA 3W20A 3DUIA 1LGNA 2VECA 5F32A 3O1TA 3LDKA 1WCDJ 5D2AA 1HJFA 1XBFA 4IVZA 3VK0A 3I2GA 4GXLA 3V56A 3WDYA 2VO5A 4HT1T 1DZTA 3NZLA 2A6VA 1OVSA 2P1BA 2XXPA 2WL1A 1RUG3 2XHKA 4NRPA 1LHWA 1YFWA 1CPNA 1NXD1 2VQUA 4Y5SA 1I9RA 2BNOA 2BGCA 3JUUA 2PLV2 1B35A 4LPLA 4QKFA 4QX3A 5ABJA 2CWMA 5C4WB 3LOIA 3AX4A 1AYM2 5I91A 2NN8A 2WFPA 4WM7C 1W8UA 1TEIA 3SCGA 1RZRD 3ZFEB 3QBQA 4XFCA 4XZPA 5FCCA 1JTZX 3D8CA 2BRTA 5T5OA 1RIOA 1IPKA 3VBHC 4AQTA 3HQRA 2XG3A 3OY8A 3P6BA 4LBQA 4LLOA 2LLWA 4PF1A 2FDKA 3UJOA 5LY2A 3GCXA 5T3NA 5A70A 1AL23 1GWLA 1QH6A 1PGL1 4JTNA 5E88A 1XC6A 1RUH3 1Y3TA 1RITA 5A3OA 1V9U2 3WD5A 4AFBA 1TQ5A 4YW7A 2HWE2 1E5HA 1N1TA 1UY0A 1C5HA 4N7UA 4UW4A 5C7GA 2XWJB 2D40A 5CZKA 2XMLA 2B5AA 4YW2A 4DPNA 5FZFA 5GAHi 2O8QA 4D6RA 5AFBA 2HWF1 2LYQA 2W92A 3P1IA 2XI8A 1MS8A 5JOXA 1QH7A 1O8SA 3RQ0A 2PHDA 1HRI3 1YI7A 3K77A 4Y1ZA 3RSJA 1QQP3 3JXCL 2CGOA 4FOVA 1H8TA 5FJHA 4LO5B 4Y22B 2DUOA 5F39A 4YM0A 4LOTA 4AFCA 4BLIA 2CROA 5A6YA 1RMU2 5IFPA 1SLBA 3T1MA 1GSLA 1UN1A 1R091 4XFGA 4U36A 2EF8A 5C9AC 1IG3A 1F35A 2VZTA 3KVAA 3VHRA 4XDOA 1AXZA 3W21A 1ZBA1 3IKWA 3O0WA 4M0NA 3WW2A 3A7QA 4MX3A 2B9UA 4XF9A 4YG6A 5FZAA 2VQAA 4NRMA 2ZAAA 1C8M1 3EHKA 3KGLA 5DQ0A 1AX2A 4ZU5A 1OQDA 1GU3A 3BPSA 2PXUA 1TMF2 1VBE3 1B35B 2ZHLA 3FHAA 5E1RA 4YPJA 5ABJB 1AR93 4JDNA 1V6LA 2DCZA 2X53S 1WA4A 3JD72 4Q1PA 2E51A 1O4TA 1UOJA 3HVDA 2ODRD 5H9SA 2E31A 4EROA 2HWC1 5LY1A 3GBFA 3OF1A 3LQXA 4LBQB 4UWDA 3QFIA 2HCSA 4BQYA 3NKTA 5CVRA 1F8VA 4KBBA 2JDMA 1MEC3 3I3EA 3GZCA 4KQ7A 3ZSJA 3T2OA 3MV11 1C3HA 1T2XA 2R072 3QACA 5DZGA 3L2HA 1W3XA 1R1A1 1YQ6A 2UYAA 4Q26A 4N7IA 4Q4V2 5AVPA 5FZCA 4NIIA 1ULPA 2AUWA 1PRAA 2XOMA 1RUI1 2OPWA 2OPKA 1UX6A 4G4FA 4YG0A 3TOJA 2IUWA 4BQ1A 2PHFA 1UOFA 2G19A 4LBLA 4Z2WA 4UI9L 1QJX1 1OBNA 4EKIA 2EIBA 2XJUA 4QX2A 3VBUA 4OCTA 5I0UA 2BYVE 1ZAYA 1ONAA 1UXZA 3HD8B 5HCBA 1PNGA 5DPNA 5GM0A 3JBG2 2WT2A 1W90A 5GZDA 1H8TB 1RGSA 1UY3A 2JE8A 3FHQA 1RZRA 4P9GA 3N9LA 3RYRA 4EK9A 3PJYA 3BTXA 1GYKA 1UCXA 1O3QA 1NCQC 1HB4A 3PTRB 4YZ4A 3B5LB 4X4IA 3CIHA 1YHFA 3HNYM 1LOCA 1QY4A 1UZYA 3M4FA 3PVEA 3PU8A 3BODA 3T4VA 1W2OA 4ER0A 4LA3A 4LQRA 5DG1A 2P3YA 5EP9A 2VUCA 1RXFA 3FHIB 3S7IA 2C1FA 1UX7A 2J1VA 2ZGRA 1GFF2 4MGZE 3AKTA 3IAPA 1GUIA 1LRHA 4NAOA 1SACA 1ZRIA 2WKKA 3ALQA 1RUC1 3PVNA 2HWF3 3U37A 1DFQA 3FMYA 1E5RA 4RN5A 1LB2A 2RV9A 1MZFA 3OYWA 3W59A 2JKXA 3HNBM 1BYHA 2CDOA 2Y6FA 4UF0A 3ZKCA 5FJKA 3TNPB 3VBRA 4HSLA 4YFZA 1UW8A 2OS2A 2ZABA 4XDPA 3H7YA 5DUUA 5CYYA 4AVTA 2YDEA 4BIFA 5C4WC 1R093 1VBB2 2ZBJA 2RM21 3NROA 4MH0E 3WOGA 3ST7A 1WLTA 3O1RA 3ZFEC 2YV8A 2WNUC 1LMB3 1SHWB 1ZBA3 2VULA 3AMPA 3EMRA 2GH8A 4JQDA 1CVNA 1LCLA 1QNWA 3DYPA 4R4ZA 5DUWA 2DCJA 3BVCA 3VBUB 1C8M3 3N7KA 2AXZA 2ET1A 3EO6A 4K3UA 5EIYB 5LEKA 5FXWA 1COV2 1QIQA 3ETPA 3MIGA 1KDKA 3H42B 3OMTA 3BDNA 1H6XA 5FTTC 5FOBB 4JCXA 1UNBA 4Y42A 1BLZA 4CP0A 4JZRA 3DKWA 2HWC3 3OGJA 1Z0HA 3B3QE 3BB6A 4DUVA 3C8XA 4Q2FA 1QF3A 2HH9A 2GDFA 4M3CA 3W9AA 2JJ6A 3MO4A 4M4RA 4P9IA 4FTEA 2Q4SA 1OHFA 4GWIA 1N1SA 2RVAA 2DBNA 4JRLA 1U5XA 1CAUA 1R1A3 1OC1A 4GALA 4M3CE 5ERLA 3FC0A 1NEQA 4KMQA 4IV3A 3PUSA 3QH7A 4W4ZA 4CUBA 1RUI3 1NLRA 2XL9A 5JDBA 5CIRA 4LR4A 5IATA 4LHNA 4DIQA 1Y7BA 1UOBA 1X82A 2D3PA 3H9AA 5FYIA 2YC0A 5E89A 5JXHA 4GB31 1RUG2 2E32A 2LNMA 1VRH1 5FK7A 3VLBB 3H5TA 1QJX3 2C24A 4NPLA 1DU3D 2XWBB 4LULA 1FV2A 3UT0A 1QJFA 1HN1A 1US2A 3MIDA 4UF0B 3VBRB 3VZMA 3R1FA 2CSGA 1U5YA 2VXJA 1QWRA 5JOYA 3OKZA 2IU7A 1HB3A 3VDCA 1AUYA 5ABJC 4HRAA 1B35C 3WF0A 3JQWA 4A41A 1W9WA 4XXAA 1V6JA 2J1EA 2BPA2 2JIGA 5EJ1B 2QQVA 2LLVA 2VG9A 2HBUA 5CFCB 5T55A 5M0TA 4A7KA 1E3OC 2ZACA 4R8HA 1WLCA 5EFUA 3P3NA 2MEV1 2H0BA 3N7MA 3MPPG 4ZXEA 2HWD2 1CJGA 1YO8A 1S55A 3C7EA 4XTMA 4TWTA 4D69A 2FCUA 2WJSA 4CCJA 5ANQA 2KA3A 5KHGA 2OZJA 2VZUA 3HQXA 2CHHA 2PHWA 3N7JA 3O0XA 5JZGA 4QXHA 2DVFA 2ICTA 1RUC3 2LRPA 2WO2A 3ZIXA 1EP0A 3RZMA 3D1NI 4NPMA 4M3CB 3U78A 1JYNA 2CGPA 2PUCA 2GC1A 5K9YA 3FZ3A 1AU7A 3UGGA 5F9TA 5EZWA 4IE0A 1VBC1 1YIPA 3SLIA 1CAUB 1OQEA 3L9JT 3NJVA 4FPYA 4IV3B 1H8TC 2VAUA 4Q0VA 5A7WA 3ZVXA 3ME2A 2C4XA 5FY1A 4N90A 5FZ1A 1UMZA 2QQNA 1CJPA 1W8ZA 2JDYA 4QX5A 2RM23 3ZSLA 1H30A 3GGLA 3PNAA 4ZPIA 2P4EA 2R1BA 4YG7B 5GKAC 5CNAA 4Z5HA 3AC0A 1XNAA 3LE0A 3G5GA 1QXRA 1EY2A 2F4LA 4XCBA 2J1RA 4WVZA 2BBAA 1UMHA 4I6RA 3O12A 1UU5A 2X5IA 4PLNA 5T54A 4NHMA 5HXMA 4OULA 3WQ0A 2LYRA 3ABZA 4YZ1A 2WA4A 1CD3G 3O5SA 2LYLA 1WD4A 3BOWA 3PVBB 2FMDA 3KB5A 4DUWA 1RHI2 3VL8A 1MEC2 3R4SA 2ILMA 3WQBA 3WV6A 5FXVA 4BPZA 4CA9A 2XKPA 2A1XA 4K8RB 3ZDSA 4XQDA 1OFNA 1UD1A 3GN5A 2R062 2ZGOA 3ILNA 1R082 2ZZJA 3MIFA 3WXPA 2PELA 2JDUA 1W6PA 3IB3A 2P2KA 4I02A 4MXWB 3KCXA 1RYYA 5SV8A 3K4DA 4WVMA 3UV9A 5KR7A 1W8FA 1YCIA 1NG0A 3VBOA 2YY1A 1NZIA 3AYDA 5DRTA 3JU9A 4L97A 1Q8SA 1WW4A 2PLV1 4GB33 3H50A 5F37A 4P5YA 4N43A 2DVBA 1JYVA 3ACGA 4KWUA 1AYM1 1CJDA 1H1IA 4B1MA 3VBUC 1UIKA 3LSEA 2CDPA 3S6PA 1W0PA 3RDIA 1YQ8A 1CZSA 5A7WB 1YLLA 3AYAA 4WV8A 4ARXA 5I0SA 5C3SA 4ER6A 3VB9A 4DXZA 1NUKA 4X8NA 2EA7A 3KHBA 1YFUA 4BQ4A 4DQAA 4BZ4A 5IK7A 2GC3A 3CHXA 4PU8A 5BNPA 4BQ3A 5AC92 2FZ2A 1V9U1 4N53A 3MLKA 4IEWA 2HWE1 2GH2A 3MIBA 2W46A 1PK6A 2FDFA 4XE9A 2MEV3 4IQPA 4QGLA 2FDHA 5C71A 1POQA 5FPVA 2XBO2 1FMD2 1UYXA 3B7MA 3P3PA 2YPJA 4B7KA 2QVSB 2YC2A 3ZXDA 1O3SA 2MPFA 3ACFA 4C1XA 4AI9A 2ZOEB 3FWEA 5HV4A 5J96B 1CN1A 3M3CA 1PIV2 3PXPA 2HWF2 3BPZA 4QXCA 1U2ZA 1ZRFA 2WWSA 5FMCA 3D82A 3KVBA 4XIOA 4ZZ8A 3NV3A 1JYTA 5DAQA 1NZCA 2DV9A 1RMU1 2VMDA 2VZVA 3RGBA 3GN5B 1WLWA 2YBPA 5KXDA 2XR4A 3J7NA 4INDA 4XJ8A 3AMMA 4XFHA 1JZ5A 1W6PB 1VBC3 4YGCA 1W0NA 5DTRA 3VBRC 1G8WA 1N47A 4WVMB 5JUVA 1SFPA 3VBOB 1WKYA 2HFZA 3M3QA 4DY3A 4GULA 2JWPA 3PLQA 3VZJA 1EAH2 5IT6A 2RS52 1DQ4A 1U0AA 5D8AA 3GJBA 3T0AA 1TMF1 2PQQA 4DE9A 5KC5A 2RMU2 2WAOA 3OD4A 2IZWA 1GOGA 1KS5A 3HOBA 3I3DA 2PYTA 4JKMA 4N43B 5CFCC 4UFIA 3D4KA 5FY7A 2A6XA 3ZXKA 1OH3A 2WUSR 3JD71 4ITCA 1Q8PA 1Q43A 1V6IA 1XYNA 5IW0A 3WUCA 4AGGA 1KD7A 4LBNA 2DVAA 2Z2SB 4ZS3A 2KR2A 1XYOA 4UXAA 3M7AA 4EZIA 1VPWA 1ENXA 2CWSA 3UK9A 2XPJA 4A42A 4Y1YA 1REFA 1DQ6A 3NMBA 4PIXA 1US3A 1WMXA 2VR4A 4Q0QA 4AEDA 5BNPB 1DLLA 1PGW1 2R071 1QXJA 4N53B 4Q4V1 3O1MA 1W9TA 1AYN3 2R042 3BALA 5JVVA 1PK6B 3RJ2X 1KEXA 5J7MA 4XMIA 2WZPP 4XHXA 2IXKA 3KM5A 5A32A 5KWRA 1KFXL 1RUI2 3M1HA 1UZWA 4X4FA 4LOSA 3TRSB 5BYNA 2EXIA 1BQPA 3LQCA 4IV3C 3VHOA 3WDTA 4RYDA 3LA2A 3HR9A 1OD5A 3RS6A 1XU2A 3JBG1 2IXLA 4GAZA 4V2VA 3SMHA 2BGOA 3IDCB 2W95A 3LEGA 1EV12 2A5ZA 2W0XA 4GQMA 2HCNA 2GRLA 4QD2A 3OQNA 3LA7A 4LBJA 5F3EA 4C8DA 1AYM3 2E7TA 1W8NA 1UU4A 1WW6A 5BY5A 3LEIA 4ET7A 2B4KA 3U11A 3IDBB 4J1WA 4QB2A 2UWCA 3ZKUA 4ZU7A 4XF1A 2OZ6A 2ZMKA 3M70A 1ENRA 1LEDA 1LU1A 3UGHA 4CP9B 3AP6A 5LB6A 3ETQA 5ANNA 2P3IA 3AM2A 3O0VA 4JCYA 5CG8A 2JB8A 2X8KA 2FMYA 5D8AB 3VHPA 5FREA 1ALYA 1V9U3 3DM5A 2BERA 1QEXA 3OPTA 1Y9QA 3EB7A 3O7OA 1NY72 2HWE3 1HJGA 2YROA 3CZJA 3SH4A 3TYJA 2FDIA 2C26A 5I93A 1UKRA 2B45X 1F5FA 4LHLA 3E5QA 3PUQA 3S8QA 2A70A 2Z42A 1NYWA 1XB9A 3MIHA 5A3TA 1XSQA 3FN9A 4CE8A 2ZX4A 1ZREA 1KXGA 4MSVA 3CJIA 2CAVA 4E4SA 2L8NA 2VCCA 4EQZA 3HBKA 3N3HA 3BCWA 1PO12 5JZGC 4AEDB 1RXGA 4Z82A 1QGLA 2UYBA 4MHRA 4LKEA 2BEOA 2ZS6B 2VJXA 3WG3A 2O49A 1RMU3 2I45A 1HN0A 2VW0A 3KS7A 3MF6A 4H7LA 2IXHA 1VBB1 4MOAA 2K2SA 2EBYA 5F5IA 3T4HB 3KL4A 5K8SA 4Q0UA 1O4YA 5A32B 1OPMA 4LBOA 4AW7A 3NKGA 3IMMA 1ZRDA 5LK7B 1JZ8A 5GZFA 3TB0A 2ZA9A 3ZPOA 2WDBA 4HKOA 2RM22 4J6GA 1V6KA 2XQXA 2Q8DA 1DQ2A 1HQ1A 1JS9A 1NQDA 2GNTA 1COV1 2VPVA 2P3JA 1LGCA 1TMF3 5KHKA 5FPAA 3TN91 3VV1A 4Q0PA 1W2TA 2XJQA 3I54A 3I49A 4YARA 2JDPA 2WSUA 1DDLA 1TZOA 4IESA 3JD73 3CMGA 4YGDA 3VZLA 3BYWA 3DEMA 5LZ6A 2PUGA 2OXBA 3DF0A 3HNMA 4CXYA 3GYDA 2FFHA 3KQRA 2X5IC 2BWAA 1C1LA 3F95A 4XFAA 4XYXA 4UFHA 1O5UA 5FZ7A 4DXRA 2R073 2D5HA 3B01A 3QD6A 1PRUA 3E5XA 4Q4V3 2MXDA 4XCAA 3J8F2 5E8AA 3V0BA 2VCBA 3KV9A 1F4HA 1WCUA 2JENA 5H9RA 4DINB 4E2GA 5L73A 3ZN6A 1H9WA 4CEYA 4D6QA 4XAAA 3UKVA 5FZ6A 1WBLA 3WP6A 1MQTA 3N9NA 4E27A 1W9SA 4HBNA 4XMAA 4CDWA 1JYIA 2Y6HA 4E8CA 2VVDA 3CJIB 4A44A 5C5TA 1D0HA 2QNKA 5FRAA 2YG0A 4B29A 3KQ4B 2PTMA 3INAA 3JBG3 4GB32 3VBOC 1MZ6A 4H55A 3J9SA 4OUEA 1A8DA 5LW9A 4K1ZA 1NAEA 1RUE2 1POUA 4N43C 4DO0A 4IETA 5I0TA 3MZHA 5IAXA 2J22A 3OGRA 3ZLIA 1PM4A 3IT8A 4FBIA 1D7PM 2VTXJ 5L9RA 4R9AA 2QJVA 3B9CA 2QQMA 3ZHMA 1CX4A 5KXBA 4XZUG 4E4HA 5C3PA 4HPKA 5DUVA 1CIYA 3KV5A 1FNYA 2HWD1 3IBMA 4R52A 4W8JA 4ZONA 4X4CA 4QHBA 2PFWA 3FLTA 5IAVA 3WW4A 5BNPC 3RZKA 2D6KA 4BCUA 1TG7A 2WA3A 2WT1A 3C2UA 4N53C 2UU8A 5LWBA 1F5JA 1H2NA 1LOEA 1XU1A 2BVBA 1UQXA 3F52A 1PK6C 2IXCA 4L99A 4TLFA 1OA2A 3CF6E 3H3LA 2LCVA 4PQQA 3N7LA 4NAMA 4AHYA 4I3GA 1AR73 3AP9A 5FYVA 3TEYA 1ULOA 5C3QA 4XJAA 1SFYA 1A3KA 1NT0A 4Q8KA 3N9QA 5LA1A 2O1QA 2Y6JA 3SR4A 5FY8A 4EZ4A 4GWJA 3DKQA 3T30A 3B93A 4X4EA 3LOBA 1JUHA 5FPBA 2BNNA 4KU8A 3IPVA 2V73A 4LIUA 3ZN6B 4AGVA 4JC1A 4CEYB 1VBB3 5KBFA 2NLRA 3GBWA 4COZA 1MQTB 1SLCA 4FFHA 4M00A 2WNVA 2LTNA 2VW2A 4CDWB 4CXXA 5FPXA 3ZYRA 4COYA 4XFFA 2VOTA 2DTWA 3VZKA 1YNAA 3LFPA 1COV3 3OUHA 4XJ9A 1LCDA 2VTFA 1VMJA 1G6NA 4JVAA 4YG3A 5T5LA 5D8AC 3SKVA 3TN93 4PHZA 4FBFA 2VNOA 4N9IA 1REEA 5FYUA 4OUMA 3NNFA 1DQ5A 4HG6B 1RHI1 1JYXA 4K40A 1YFXA 5GLWA 3R09A 2P3KA 2ZX0A 1OUSA 3CLCA 2R061 4OHVA 5APAA 3SH3A 3B02A 4HPKB 3E97A 3THPA 1R081 4KGGA 3ZYIB 1LECA 3AL5A 4FQZA 4AQSA 4B8EA 2GALA 2VZ1A 1AYN2 1SDDB 1RVF2 4AEDC 5L36A 5FP9A 4FSJA 5F3GA 3CECA 4MGIE 2GZUA 5JXGA 2VD7A 4JKLA 4QX7A 4UFJA 2JG9A 4PU3C 2QBXA 2XH6A 1HXS2 3FFZA 3A21A 4UFKA 3KLSA 4BK5A 4I0BA 4CCDA 2DF7A 4ZKTB 2YBKA 3JXSA 1GNZA 3O1VA 2GSYA 1UU6A 4YZ2A 1MVQA 4QQLA 2UY8A 2HINA 5FLIA 5J36A 5FPUA 4Z5CA 3KT1A 3UWPA 3OB8A 5BV6A 5DAWA 4IE6A 4AI0A 1UL9A 2LUWA 2J42A 2RJKA 1OQ1A 5IK5A 4X4HA 1LOBA 3DCQA 2O38A 3OPZA 2VQTA 4KL1A 2ES3A 3IPVB 4Y33A 1S1AA 2WNUB 2IVQA 2OA2A 4FPKA 1XNBA 3SCFA 1WMFA 1W9FA 4QQPA 4O8BA 3UJQA 3WCRA 4Y1UA 3MGUA 5AC91 2ZHKA 5F1RA 5JOWA 2WNVB 1S0FA 3MBWA 2RJ2A 3WLUA 4QWNA 5LEJA 2PIJA 3AFKA 5HCFA 2OQ6A 3NDBB 4IGPA 3CZUA 2ZPXA 2RDQA 1UZVA 1S0JA 1QP0A 3D6EA 3ELNA 1J1TA 1XNCA 2HWD3 1SCSA 3AZXA 4NHXA 2XBO1 3NNMA 3PL0A 1FMD1 4LBMA 4RR3A 1GP4A 5F8PA 4ORFA 4CTEA 3IDEA 2WS92 5G05L 3LPFA 2TNFA 1NQJA 4PIYA 1PIV1 2BFUS 3MLJA 1R1ZA 1SCRA 2QFEA 1J3RA 4QKDA 1W99A 5IJRA 4W50A 4UFMA 3CJIC 2AEYA 4Y3OA 3ACLA 2JE9A 4KWLA 1JN2P 4XQ4A 2D6NA 2XDVA 3MUY1 2W1QA 3GJAA 1DGRN 2CNAA 4J25A 2ADDA 3G7DA 4RA0A 3OGVA 2JG9B 4AI2A 1EAH1 1JMUB 2BJSA 1N3QA 2RS51 3OD0A 3WSOA 2PAKA 2E63A 2RHPA 5GLZA 3U75A 3WW3A 3WY6A 2RMU1 4O61A 1W2NA 3RWNA 2JECA 3VL9A 4D7SA 3KV4A 1JOJA 5T50A 3H0OA 2PQSA 1Y7YA 2ZHNA 2AYHA 1CGPA 1G7YA 3FBYA 2XLFA 5EXOA 2VY0A 4Y1VA 3KCYA 1R63A 1OVPA 1O6UA 3T3YA 1MS1A 3PDQA 3OY8B 1KJLA 3NV2A 4QB1A 4OUSA 1RHI3 4UFLA 4IV1A 4E8DA 1HB2A 2Y33A 4WM8A 4XFBA 1H6YA 2R041 4FQ4A 2Q8EA 4BQWA 4Y4RA 4JDMA 4Y4YA 2R063 4LEJA 5FZLA 4AEKA 1GQHA 1PGW2 1WA6X 1R083 2FZ1A 2VTXA 4KWKA 4LHSA 3H7JA 2ARCA 3MPBA 4G3YC 5HV0A 4BQ2A 4P02B 3MFCA 2ARAA 3POSA 4URTA 3LCPA 2HSGA 5A6QA 1B0NA 4QPGA 1CIWA 4YVWA 3ZXLA 2AWIA 3ZXGA 3RZZA 3RI9A 1XE7A 4CEYC 4AVBA 3H8RA 5CKQA 2VMGA 3EQEA 1AX1A 1HIXA 3CQOA 1EV11 4QGMA 4XOGA 1XPWA 1MQTC 5IVBA 2CGNA 3TEPA 1OFSA 1OOPA 1YJLA 2HEWF 2P5BA 1FPN2 3ACIA 1KGYA 3I3BA 4UAPA 2ATFA 4CDWC 1KDMA 4CUGA 4ER3A 1PGSA 5FY0A 4JHTA 1SPPA 2VOXA 3ZYHA 1DG6A 1GZ9A 3I4IA 1URXA 2BFUL 4GJZA 4KH9A 5A3NA 3G6JB 3ZN5A 4AQ2A 5T5PA 5FXZA 3IAQA 1HW5A 2DDUA 1ENQA 1N3OA 4QAWA 5AC93 1UWWA 5BNNA 4O9EA 1AXKA 4XDQA 1SLLA 2PAMA 3DN7A 5CFCA 5LCWL 2ZEZA 2X09A 1UXDA 1H2MA 1NE6A 1NOVA 1NY71 1VRBA 2AC1A 3KGZA 4PIZA 4C90A 3UESA 2YGLA 5E16A 1DW9A 4EE2A 2QE3A 1H2KA 1RINA 3KD4A 4S2FA 4Z2AA 2VNRA 2XBO3 3ZX7A 1FMD3 3LZZA 1IZ3A 4JX0A 3H8UA 4LO6B 1JUIA 3RMYA 3ACHA 2PUBA 4AFAA 4BMBA 5LRSA 2MNGA 3SC7X 1ZZCA 3WCSA 1GV9A 1PO11 3OPWA 1X57A 1PIV3 4IW3A 4RHV2 4YM3A 5B2GB 2BNMA 1IGOA 2W68A 4IV1B 1EUUA 1BK0A 3CO2A 2P17A 2A6ZA 4PF5A 3LKJA 1AR72 4HN1A 4SLIA 1F2NA 1JODA 4PJYA 4WM8B 5BNOA 2LW8A 1OSGA 3R6SA 2WO7A 1G9AA 3WQ7A 1O3RA 4FP3A 4FOQA 2C0ZA 1UZ0A 3J7LA 1WD3A 4HL0A 3VZNA 2WT0A 3RZGA 4A6SA 1YQ2A 3NSTA 2I74A 3OBRA 3U07A 1CAXA 1QKQA 2AENA 4YVWB 3GF6A 3I2HA 1PZ8A 1HQNA 3FLPA 4ONUA 1HV0A 4XUOA 1EAH3 4HVOA 3S7EA 2RS53 5CEHA 4XILA 3IZOA 3K48A 5EYYA 2WWJA 2RMU3 2XJ3A 3GZAA 1GWKA 2WNVC 1OOPB 5FYTA 3WNXA 4AVCA 4B4PA 5FMDA 1JZ7A 5EJZB 3AVRA 5KHHA 5C8WA 3WZ1A 5FZMA 1SPPB 2YYOA 3K46A 1DZQA 4XTPA 3TN92 2W9XA 4NPRA 2A73B 3WNPA 4DS0A 1ZVFA 1Q3EA 4IWRA 1ZRCA 4MGTA 4AQ6A 2VOKA 4EN7B 3H8OA 4PDWA 1BKZA 3KZ4C 3WHUA 2V72A 2VZSA 4LO7A 2Y38A 3A0KA 4NIDA 5BNNB 2L49A 2EXHA 4YW5A 3GDBA 3WHTA 2E6VA 3J8F1 1YXWA 5EYXA 4PBOA 2R043 1OSLA 2RR13 2FQPA 3GHMA 2EIEA 4AOCA 3CL1A 1WCQA 1N3PA 3WINE 1LNSA 1IKQA 2YBDA 1D4M2 1S2BA 4FP2A 4KGQA 3ZO0B 3GZEA 3H3UA 2PHXA 4HOOA 2NPIA 4AGRA 1Z78A 1BVP1 1DIWA 1G86A 2QQIA 1RC6A 3B69A 4XJZA 1QJEA 3K4AA 2JG9C 4NWWA 4ATFA 1FI2A 1YQ5A 1OA4A 2VMEA 1EV13 5BNOB 3OYWB 2CAUA 2NYYA 2L9LA 2CYFA 1RUE1 2C9KA 1WCSA 4L2NA 2DBIA 1WETA 4OQ9A 1ZUGA 4F3JA 1LHVA 4BXFA 3BD1A 1ULDA 3ILFA 4NOTA 3ES4A 3HN1A 5KC6A 2H0VA 4IE5A 1CAXB 3GZUC 4NR1A 4QKNA 4QDRA 3U10A 3NNJA 3RMXA 4BH9A 1HX6A 3KF3A 1IQDC 4X6QB 3FJSA 3MW2A 3NVCA 4FTSA 3POBA 3C7FA 2FD8A 1OLRA 5FFOC 4CDXB 5BNQA 2EIDA 4NMIA 3E6CC 4Z92B 2AR6A 1LOFA 1K5MA 1J83A 2CV6A 2O14A 1CR7A 1GP5A 2TBVA 1Z7S2 3IIIA 4NN0A 4CPBA 2V3CC 1R64A 1L7QA 1NCRA 2OIIA 2OKXA 2XJRA 3IDAA 4RR3C 2Y8KA 2RG4A 3JB8A 4WVLA 3VDDB 3GZTB 3VD5A 2LM3A 3MLFA 1PO13 3FE5A 4BLJA 2YFZA 5HCAA 2XJSA 2JIJA 1FNZA 2Y0IA 3MYXA 4IE7A 5LRRA 2A3WA 4GKXA 4AWDA 3FUOA 5C33A 4IEXA 1AHSA 2Z79A 3NO8A 3RNSA 2A6WA 2HYKA 1BEV2 2VUJA 3D0JA 2W52A 3GM8A 2J7WA 2PMWB 3O14A 1ZA4A 5FZKA 2VU9A 1Q8QA 1WMDA 3HBZA 3V65A 2ZX2A 4AFMA 4EN9B 5F6LB 3RG0A 1O4ZA 3POFA 4AE2A 4V1PA 5I8YA 1VBD2 5FMOS 3OTFA 2ORZA 5FZOA 1W0OA 2B5HA 2W3JA 3UL2A 1S2KA 4CCKA 5FLJA 3SQOA 2UURA 1DHKB 2RJLA 1QQBA 3R4UA 4S2DA 2D93A 1S4CA 2Q8CA 3UYJA 1ZBE2 3WDUA 2AXVA 4HVRA 2WQ4A 1HF0A 3LSDA 3QH6A 4IDZA 4CCOA 4B3NA 4CCLA 2KZ8A 1WBFA 3WT3A 4OZOA 2W87A 4Q5OA 2V09A 4CCMA 2G9GA 3LAGA 4P08A 3PE5A 1NERA 4LTAA 5A33A 1ZA7A 4IA8A 2PXVA 2Y0OA 2A71A 2W91A 5LBEA 2BUKA 2YZ4A 1QMJA 2VMIA 1AYN1 3KV6A 3VBSA 1RVF1 1W6OA 2J7MA 1YUDA 1RTVA 2YHJA 4JAAA 1Q56A 3J8F3 2EAAA 3M3EA 3R4DB 1ZRRA 4IV1C 5IVYA 1OMIA 3OBAA 1K5MB 4RFRB 2OX0A 3I59A 4WM8C 5EWSA 1YFYA 1POV0 4FXKB 1WH6A 5FP7A 5A3PA 2VZOA 1HXS1 5HI0A 1QZXA 4RSUA 1NCRB 3K75B 3CKHA 4QHZA 1WGPA 2OR1L 2DU1A 4R9DA 5JZGB 3RZHA 4FFIA 2JXAA 4NRQA 1GNHA 3T0BA 4A45A 1TNRA 3CDZB 3QOPA 1NX9A 2LALA 2WZR2 4M4PA 4QPGC 4YVWC 3OSDA 5F2SA 4YW4A 2LYKA 3ZXFA 4FTBA 4QQOA 3WNKA 4ASKA 3B7HA 3S0MA 1RUE3 1OOPC 4KG0A 4OMCA 1BXHA 1A6CA 1U5IA 2NZ9A 3AXEA 1F9KA 5B4NA 1CQTA 1KJRA 2ZX1A 3THDA 1OI6A 3SEPA 4LMFA 2AW6A 5FYYA 2WAAA 2IXJA 1IS4A 4OZXA 3AKRA 1FYUA 5FZOB 2P37A 2BGPA 4AYUA 1WW7A 2WINB 3WF1A 5BNNC 4MADA 1DWKA 4K8FA 4XF0A 3N35A 4X6RB 2QZ3A 2WS91 2PHTA 2MQKA 2XJTA 2PPXA 3AKQA 3EJKA 4MGSA 3L1PA 1B09A 3RFRA 3WW1A 4ZXKA 1H8VA 2JX9A 4YLZA 2X5IB 2XCJA 3RWKX 4CP2A 1J58A 2R1DA 5FMOL 4AHXA 1X2LA 4ARYA 1N1YA 1QP4A 1X50A 4I6TA 1YJKA 2FJRA 1GT0C 5FP8A 1NA1A 2ZX3A 5FZIA 2JVLA 4LORA 2YXSA 4YW6A 4EN6B 5A33B 3RZJA 5GZGA 2DVGA 1A8MA 3R0RA 3OWQA 3VBSB 2EICA 5DSXA 3SKJE 1SFNA 3OQMA 4IEOA 1PERL 1NLSA 2Z5WA 4BISA 2FCTA 1FOD1 5HXVA 1BZWA 4A2UA 5BNOC 3I59B 4E2QA 3J7HA 2C9AA 5JR2A 1NLQA 5AFEA 2SLIA 3S57A 1GZTA 1IC8A 2WZEA 1JFSA 4GQ7A 4ZZ5A 4EZHA 5FZ8A 3ZXAC 4LUKA 3DV8A 1JZ3A 4IEQA 1UY2A 4K7JA 4UBGA 4A7ZA 3AMQA 4BQXA 1YEWA 4JQRA 1K3IA 1WWYA 4K21A 3MICA 3K3NA 3SNMA 4Q4Y2 1IQAA 2ZGUA 3T1LA 4OI1A 3LDRA 4H3WA 1LAJA 2HJIA 2VUDA 3WP3A 4CDXC 3PJQA 1VMFA 5D1IA 4CZSA 2JCGA 2W08A 1ODMA 4LA2A 2D98A 5FUPA 3VD3A 4BE3A 4C0HA 4AXOA 4HLTA 1G9DA 1VR3A 2QQPA 3EYPA 1L1MA 4NJ4A 3TFLA 2BU9A 3POJA 2FCVA 2YU2A 1K42A 2QQKA 1LESA 1SMVA 4XBLA 2IFWA 3BU0A 2J1UA 3MUZ1 1LEMA 4I6UA 2R63A 3QCWA 4PDWC 3VKOA 2I2SA 4LK7A 4META 1OURA 4XQWA 4B7EA 4YYOA 4XAEA 1RVF3 2RR12 3CJXA 4CP1A 1AR62 4L92A 2PUFA 2BP6A 2Y6KA 4LIVA 5GLUA 4XIKA 3BGAA 4WZFA 3SCHA 2HWB2 5A3LA 2D6MA 5FV3A 1HXS3 3RYPA 2A6YA 5EJ3A 3U3WA 3HZIB 1UO9A 5FAXA 1IPJA 2ARXA 2D7FA 5DDJ1 4AVVA 5J09A 2XJPA 3IIAA 1FPN1 1NA1B 4OBMA 1XYPA 2W47A 2GNDA 4YG4A 1W04A 3AZVA 4UW6A 3VKFC 3RYKA 2AGSA 1KFUL 2QKDA 4AVSA 1O59A 3CEWA 3JB4C 1AJKA 4K9SA 3ME5A 1VJ2A 4UYBA 4I2OA 1S0GA 2WZ8A 1VBA2 1ZYBA 4HKLA 4W6WA 3THTA 2UY9A 4CUAA 3Q8BA 4NUBA 1PVC2 2ZXQA 2X05A 4A6OA 4YZ5A 1IPSA 3M8LA 2J1SA 1WZXA 5JSPA 4HKWA 4QU1A 3ZSEA 2PXFA 3E1F1 2H8RA 4ASMB 1AVBA 4BM8A 4DRVA 3I3MA 4QU2A 3ZXJA 1V6OA 2KD7A 2ZEWA 3PHMA 4XABA 1AZDA 1GR3A 4NIHA 5LATA 2WN2A 5LASA 4MG2A 2DFBA 3ZR6A 1E57A 2D6LX 2WS93 4CDUA 1DLCA 1WIZA 1AR82 1LOFC 1K5MC 4RHV1 3BN6A 3HJRA 2ZGNA 4A3ZA 4FPEA 5JMOA 2BOJA 3F6WA 2VBBA 1ZZ8A 3M2MA 1NCRC 1UIJA 4HK9A 1AR71 4LKDA 4XF4A 5SV5A 3NV4A 3W5NA 4COVA 1WLDA 1PNFA 3LDBA 3AZYA 1D4VB 2SBAA 2OT7A 4CUCA 2FDGA 3AMHA 3ZSMA 2Z69A 2WN3A 2D5VA 1L7RA 1RUD2 5FBJA 2EIGA 1FX5A 2D3SA 4AR2A 1FOD3 1YWKA 3FBMA 5JCTA 1S0CA 1RIRA 2ADEA 2Y6GA 4YW3A 1POV1 4BU2A 1XXNA 5A7NA 2FHRA 1GLHA 2P6CA 1EPZA 3GXUA 5A6XA 2WFF2 4HETA 1S0BA 2PAEA 2Q1MA 2PE5A 1JFTA 1BJQA 2PXDA 2WRAA 4KNCA 3DYOA 2GRMA 2QTWB 5A1AA 1DGRA 1XNDA 4QPWA 5GLTA 1HDKA 1UOGA 1YYNA 2E26A 3FYMA 5A3MA 5A3UA 2JDKA 1NKGA 1TE1B 4ER5A 1W8OA 4CCEA 1UTXA 2J1TA 5FYZA 4QGNA 2XXAA 2R0FA 1BMV2 2DCKA 2Q0AA 3NNLA 4I30A 5C70A 5J1XA 4YM1A 1QOTA 1FXZA 1W2UA 2ZGQA 4JGZA 5DZFA 4WVVA 1J3QA 1LODA 2Q8OA 3I2FA 4DRRA 4Q29A 1JH9A 1JBCA 1OT5A 4L11A 4FO9A 3ZDVA 2R6QA 3VWSA 2BVVA 1ZZ9A 4B1LA 5J37A 4FOYA 1C8NA 2GNBA 3TNQA 4FI9A 4COWA 1D4M1 2R0HA 2EXJA 4GWMA 2YFUA 4FAGA 2QQWA 3AKSA 3N4MA 5A1FA 3E5UA 4X4DA 3NXHA 1NE4A 1ODNA 3S5QA 3VBSC 5IVVA 1GANA 4CDUB 5LA0A 2GN7A 4MGQA 5A3WA 3DECA 2K0GA 4G9SB 1DQ1A 2W5FA 1YQCA 4CRQA 3ATGA 4JTOA 2WO3A 3JCIA 5JPNB 3OP9A 5DDJ3 3IM0A 2RDRA 5FZ3A 5JIUA 1FPN3 1KS4A 3KHCA 4FFFA 4AL9A 2QCSB 2ZZQA 4RQPC 2VMCA 4QPYA 3ZN4A 1GOFA 3AMNA 1PO21 2B42B 3F2ZA 2MHFA 1VMHA 4XW3A 1PNRA 1SG3A 4H14A 4JHZA 1BBT2 3MHZA 4FPCA 5LBBA 5DDJ2 3WG4A 4MYEA 4P9YA 4AHZA 2BJCA 3VD9A 3JXBC 5CFDA 4PCRA 3FYAA 2ZGMA 4LLFA 1H1MA 2VBDA 5FKCA 1AX0A 3IVPA 4FPLA 4LITA 5FP3A 1C1FA 5JR7B 3WP4A 3H1YA 3ZSKA 4QHOA 2W39A 1F31A 5A7LA 2O4AA 3M3IA 4MGKE 1UXCA 1Z7S1 3KSCA 5FZ0A 1UYPA 1IHMA 2QDNA 2ERFA 2VXRA 3PU3A 1Q8VA 1YIFA 3PVOA 5JIAA 1ULEA 5FZGA 1C28A 1MS3A 1APNA 2ET7A 2XKOA 1T6GC 2ZKNA 3DL3A 2ZEXA 2GAUA 1QP7A 4JGZB 5CA6A 4LK6A 1SDWA 4RHV3 3N36A 5BXXA 4AAPA 1LHNA 1KQRA 4K20A 4K1YA 1W9YA 2V4VA 1D0GA 4HMZA 1PMHX 5BPXA 3ZIWA 3U14A 2XL7A 2VW1A 1QB2A 1DGLA 1NA1C 1BEV1 5JAXA 1HRV2 5JI7A 3V0BB 2YC4A 4WVWA 5FIXA 2E7AA 2PN5A 2XB6C 4PLMA 3T2QA 5JSOA 4XUTA 4DMIA 4B4QA 4LHKA 1GQPA 4ES8A 2LYSA 5IK8A 1POV3 4BWOA 2R32A 3NRUA 1VBD1 1JZ4A 1EFAA 1ZNPA 4Q4W2 4PLOA 3I2JA 4OFGA 4W6YA 2VGDA 2IV1A 4Y5TA 1CZTA 1JI6A 1WMEA 2VOWA 1ZBE1 4F7ZA 3USUA 2WUHA 4AHWA 4OI4A 1UXXX 3AYCA 5G04L 3ZYJB 1QJU3 1JU4A 3U4XA 1QPZA 1HV1A 4I3PA 2PXTA 1BK1A 1X36A 1SQ8A 4RL7A 1PVXA 5FOJB 3DXUA 4W6XA 1W6MA 3Q9OA 3C3VA 2ENRA 4SBVA 1X8MA 2TEPA 3APBA 4NHYA 4X4GA 1QOSA 1Y43B 4UW3A 1HQLA 3S5AA 4B4RA 3AB0A 4BIOA 3BTAA 2RS32 4PU7A 1YSEA 2AXUA 4BK4A 3CLPA 2DUPA 3W58A 5A6ZA 3GALA 4YGEA 5IK4A 1D4M3 1PZ9A 4LO8A 3ZPXA 1JH5A 1JOPA 2FDJA 2BQPA 4NROA 4COUA 4PU4C 4XC9A 1RPEL 2WZR1 1OPOA 2G1MA 3PMEA 2WLQA 4GMP1 4U2AA 5LBFA 2E7QA 4LE4A 2IVIB 5GALA 3U1XA 1OLMA 1VP6A 3ZM8A 4D7YA 3WNMA 1I5ZA 3WNLA 4RGAA 2IWGB 3M9LA 2DFCA 1N1VA 4XEZA 1OLME 2ARBA 3V64A 3O1OA 4HVQA 5HPOA 1G9FA 4IEPA 1PO23 2VOVA 4F8DA 1YRZA 2L1PA 4XPVA 2XLAA 2KXLA 1TNFA 2PXPA 1DULA 2ZGSA 3DGTA 3QWGA 2ZGPA 3GUUA 3WP5A 3HAGA 1Y4WA 3K2OA 5FUNA 2CU5A 4BJ0A 4YVSA 3NJZA 1DQ0A 5FWEA 5FXXA 3AJZA 2D3RA 3Q8AA 3USUB 1QJY1 1G9BA 1Z7S3 5FYHA 4D6SA 5IHRA 1DBNA 2D43A 3DXTA 4KI5M 2GC2A 3BTZA 2XVGA 5GLVA 4KU7A 5D21A 1O4XA 4Z07A 2YBSA 1PZ7A 3EBRA 3GZDA 5FKBA 1Q8OA 4FFGA 1W6MB 3BKZA 4CDUC 3DPRA 4HK8A 4UBHA 1K12A 2PXKA 1S2EA 3D5OA 4QPIA 1OKOA 5CADA 4NVPA 5CISA 2JE7A 4RGKA 2WO1A 3T09A 4ZY9A 2AZ5A 1ASJ1 2LROA 2B46X 4W65A 1BEV3 4EWAA 3FUQA 1OD3A 1RUJ2 3C7GA 3QOWA 1UF2C 1FOD2 4EKGA 1W03A 4EJRA 3ZYGA 3FFQA 3Q8FA 1OF3A 1CPMA 4CDQA 4R9BA 1WH8A 2WYSA 4YGBA 4DFSA 5JPMB 1SBDA 1MS5A 1VBD3 2OUHA 1MACA 1W05A 5I0DA 4Q4Y1 3AZZA 3K3OA 3HQUA 3WG2A 1GOHA 2XHNA 4R9CA 2PUAA 2BDRA 1XWRA 2EXKA 4OLLA 1ZBE3 5FMBA 2H6CA 5DT2A 2VZRA 4GZ9A 3TWIA 2ZAHA 5B4XA 5J48A 4NIGA 3ZKYA 1OH4A 4Q4X2 3KT4A 4BB3A 5FZEA 3ZXEA 2X29A 4QT6A 1BDHA 2DURA 2PUEA 4XACA 3I2DA 5LBCA 3F51A 2J1AA 3MLLA 5ISLA 3HWJA 2HKXA 4YW1A 2R7EB 4LNVA 2VMHA 4HONA 4JGZC 5K0UB 2XVKA 2RR11 3FMGA 5DAVA 3KWVA 5IWFA 4YVSB 3VGIA 2PXJA 3POWA 4OMDA 4BDVB 3O1UA 2R16A 1XNKA 3EXUA 3UNPA 1QOOA 4RR3B 4Y26A 2F17A 1H4GA 2HWB1 3TRBA 3A4UA 2BZDA 5I8SA 3OQOA 5F5AA 3ZFGC 2IVJA 4FXGB 4OHWA 3TBDA 3WF2A 5CBLA 2RS12 2AREA 3UKNA 2JICA 4JV4A 2PA7A 5L9BA 3DPRB 4YBAA 4D94A 5JOZA 3W5MA 2WZR3 4GMP3 5GZCA 3PIJA 4QPIB 2V5YA 2WNEA 4HSJA 5IVCA 3OGSA 4CDXA 1VE0A 1I6XA 2D6OX 2JDZA 3I3QA 5C8CA 1JHJA 3WQ1A 5H9PA 3KXAA 2ZGTA 1VBA1 1IS3A 4JRAA 1PVC1 2JDAA 4RS5A 4Y20A 3H8XA 4H2AA 4S2GA 1CONA 3MV01 4CDQB 5C6CA 3A23A 3U4SA 1A78A 5I0RA 2DTYA 4MCXA 3VD7A 2GC0A 3BIWE 3I8TA 2XXZA 3VZOA 2EALA 1JZ6A 2XGXA 5JWPA 1JOBA 1W6QA 4RD7A 4XXPA 5FZ9A 4IE4A 2TUNA 3GNEA 4FN3A 1AR81 1QJY3 2NMNA 4MXVA 4CEWA 3ITQA 4XF3A 2R1JL 5DN2A 1RL3A 3MW3A 5FZ4A 1RUOA 1SZBA 3POGA 2Y6LA 2NMOA 1MZ5A 5LK5A 3WUDA 4N9HA 2HBTA 3DYMA 3ZMOA 4A7YA 5F5CA 4CSWA 4GHJA 4MLOA 1VB2A 1K5JA 4TZDA 4MZUA 4AI8A 4ASLA 3TEZA 1RUF2 3I2KA 4Z5DA 1RUD1 1RJ7A 2KM2A 2VBPA 3OUJA 4TLGA 1LQCA 4QMAA 4MV2A 4D3WA 3TEWA 3OBZA 1MZEA 4BOWA 5BUVA 3KMHA 1W39A 1ENSA 4BYYA 1ASJ3 2OQ7A 4HZFA 1LHOA 1QU0A 2YGMA 4YNIA 3UKTA 4R4XA 4GH4A 2JD9A 3AVSA 2LYJA 1X8EA 4FPHA 2WFF1 4QPGB 1PMIA 4IGOA 4QQ2A 4QX0A 2I07B 1NXMA 2BV4A 1U12A 1OF4A 4L9BA 4DEVA 4ZHNA 1ZZBA 2C5DA 2VMFA 4P00B 4Q4Y3 3VBFA 3G0TA 1F15A 2RE9A 5CU1A 2XIUA 3OG2A 2HYXA 3LIGA 1BMV1 5ACA2 5C8CB 1OUXA 4DNYA 4PQ9A 2UWBA 5DTQA 1QJU2 1PX3A 1ZX5A 4UT5A 1PHMA 1IKPA 3BOPA 4RS5B 4Y20B 3BU7A 5CKMA 3LA3A 5FY4A 4MGYE 1EUTA 1JWLA 4NIAA 4FPJA 3N9MA 2J7UA 3M3OA 4XUQA 1VAVA 2ZJCA 3PUHA 4KBZA 1ZPQA 3NW4A 1BCXA 2D97A 2UWAA 5IYYA 5L7OA 4QB6A 1TME1 4WZCA 3I97A 2JDHA 1UAIA 3N9OA 4JCKA 5DG2A 1VIWB 1W6QB 4ZS2A 4XJUA 5LA2A 1QDOA 5H9QA 3ON7A 1O3TA 3BS3A 4LXLA 4QM8A 2O8OA 4I0AA 2IUOA 2HWB3 4J1XA 3T2PA 3NAPA 1CESA 4HANA 4CEWB 1OCTC 1ZM1A 3AFGA 2ZMLA 3A9ZA 1UMIA 4MCTA 4AAXA 4FPFA 5FR3A 3SISA 4AEJA 2Y34A 5K0UA 3NV1A 3VDDA 2PXEA 2ICPA 3K4ZA 1ND3A 2GU9A 1DGWA 5FWJA 1UYYA 4LUMA 5I8TA 1STMA 5JXIA 4QX8A 2JG8A 1V6MA 1BBT1 3CROL 1YC61 2X10A 2ZGKA 4DB5A 4OB4A 4XUNA 5EQUA 1VBA3 1UY1A 2B7YA 3KT7A 1R69A 1PO22 4GH4B 4E2SA 3OEBA 2G4IA 1PVC3 4YSFA 3Q8CA 2W1UA 3MFAA 4V2WA 2WWUA 1QDCA 1XRUA 3TELA 2OUJA 2ORXA 4P9WA 2N7GA 2PUDA 2VCAA 1CAVA 2BOIA 3GCWA 4CCCA 4AVAA 3WDVA 4CU7A 4CU6A 1QXPA 2YPDA 3VBFB 2C6SA 1GMMA 4Z59A 1GZWA 2D5FA 1RZSA 2XVLA 3UGFA 3VDAA 3WEZA 3IN9A 1QQAA 2JB4A 2VNVA 3E6DA 3J26N 4YVSC 5FBZA 1AR83 1X7NA 2NP0A 4D8MA 5FYMA 1LHUA 2W94A 1QNYA 4CCNA 4XFIA 3POYA 3FLRA 1NW3A 2QZ2A 4FPOB 4JGYA 2JD4A 4PDWB 5FDBA 3GZDC 5FZDA 1S7EA 4ER7A 5JSRA 2CTVA 1DZRA 2EVXA 3WDXA 1ULFA 2G9FA 5CKNA 5L7OB 5F2WA 1HRV1 3DPRC 4AZZA 1IS5A 1RUD3 3HN3A 5CB7A 1GNYA 4QPIC 1AL22 3OJBA 4GJYA 4PI0A 3ZYPA 1RUH2 2B39A 3NAPB 4Q4W1 4MXWA 1IOAA 5EV7A 4I01A 1QJZA 1LJ7A 2WFF3 5FYBA 5DTMA 2IVGA 3LFMA 3IMNA 3ENRA 3FL7A 3PTYA 3Q8EA 4FT8A 1VAMA 2M4HA 4CDQC 1LU2A 1W8WA
chains in the Genus database with same CATH topology
5FO9B 4XJWA 1ND3B 1AF9A 1C5IA 1H1AA 3E6BA 1HRI2 2ETEA 2JG8B 3LWCA 1SLAA 1YI9A 1QQP2 2VVFA 3U0ZA 1GICA 1D2QA 1H2LA 1HKDA 1REDA 2D44A 2ZMNA 4K6BA 1ZVVA 1OA3A 4Q27A 5JMCA 2EWTA 5K7PA 1GKBA 1OKQA 2RS31 3B9IA 1I3HA 3OBTA 1CAVB 3CNAA 1O7FA 3MW4A 1JYCA 2OW4A 1TME3 3ES1A 4PBPA 1RJ8A 3UFDA 1GZWB 4A3XA 4QQHA 3MI8A 4P9LA 1PRVA 3ZHIA 1LR5A 2BTVC 4AG4A 1SLIA 1VBE2 4OI2A 1AR92 1AR61 1IS6A 2Q30A 1GQGA 4JGYB 4ISQA 2WIIB 4RQPA 1O91A 4OHZA 4AI3A 1J1LA 2GMPA 1AXYA 4Q0SA 1BBT3 2O0OA 2YMZA 4O9GA 1LKNA 1HLCA 2NQYA 5C8CC 1U5ZA 1SBFA 2WSVA 1ULCA 2GMMA 4FCAA 3WVJA 4DY5A 3KZ3A 1CQ9A 2E53A 5F6KA 4D7TA 2GN3A 1EYBA 4LE3A 4RS5C 3VKLA 5CFDB 1UPIA 3ZFFA 2GMEA 4P5HA 1UKGA 2KEIA 4S2HA 1FATA 1VRH3 3V0AA 3AK0A 2XSDC 1EPWA 1QJY2 1JXNA 2B8MA 1SBEA 2AH2A 3ECQA 4ZU4A 2JEMA 3ZMNA 3K51A 4CEWC 1ZS4A 4P14A 4KG8A 1W6NA 2KEJA 2CSFA 2WQZC 2NM1A 2PHRA 1W6OB 1VB4A 3RPQA 1HRV3 1RUJ1 4Y1XA 3QQ6A 3USSA 3O9XA 4XETA 1PGL2 1V00A 5JI9A 1ASJ2 2AUYA 2WLPA 4Q4W3 5JLVA 4GH4C 1XQNA 2VNGA 4Q1RA 2DUQA 4RQPB 2EAKA 2A3YA 3A0NA 1FAYA 1C57A 3WDWA 1WUVA 4Q4X1 4NHKA 1SLTA 2XLGA 4XBQA 4F8AA 4QXKA 3VBFC 5GJ6A 4NWVA 1ND2A 4HFSA 1LLIA 1AL0G 4YFWA 3EUSA 3B00A 1LGBA 1R092 1SQ4A 1LTEA 2RS33 1DF0A 3ZFFB 1ZBA2 4OVEA 4ATEA 1MS0A 5L7OC 1C8M2 3V0AB 4Z8BA 2Q1ZB 5T52A 1SEFA 1LOGA 1KITA 2RS11 2OVUA 2E9QA 1BVVA 2H6BA 5AVAA 4IEZA 1LULA 4FVVA 3AZWA 1AR63 4MUVA 2WIUB 2A3XA 1L3JA 3NAPC 2R30A 1VAKA 1W6NB 3LISA 1CAWA 2DCTA 2HWC2 2CY6A 3AYEA 5K0UC 3GHNA 5K98B 3VDDC 4BMEA 3H3ZA 1ND3C 2BWCA 2IVBA 1RUNA 2JG8C 3I7DA 5DXDA 1R1A2 3RRDA 3AJYA 4H7MA 2GZWA 4IEYA 4EWEA 4GIQA 3SITA 1FV3A 3QLQA 1DYKA 1JHNA 1S0EA 5FLHA 1GBGA 1O5LA 2ZGLA 1QJX2 5KXCA 2PLV3 4WM7A 2DVDA 1I1EA 2R49A 3H1MA 3MIEA 1H9PA 1M06G 3VKMA 3VBHA 1ND2B 2JKBA 4GMP0 2F4PA 4X4BA 4DOUA 4XBNA 4NHLA 4YM2A 1RUF1 2ZHMA 3D0SA 1MR5A 3H1WA 4HN0A 2QDRA 3S30A 4JGYC 4LBKA 2A7AA 5CG9A 3MEPA 1BDIA 1RUJ3 3X29B 3HMYA 4EV0A 3ASIA 2FBEA 3R05A 4Z58A 5DUXA 3DNVB 3AP5A 2OFYA 5J3UA 2HEYF 2VH9A 2ZKLA 4P9XA 1ZZ6A 3SXWA 4EWDA 1CAWB 1FT9A 4IL7A 5ACA1 1GZCA 5T5JA 1RUC2 4E4ZA 4BHPA 1JW6A 3JXDL 1DGWX 1QJU1 1QHDA 2VQ0A 5TSWA 5CFDC 3ILRA 4Q4X3 2DU0A 3SH5A 5C9AA 1UPSA 3AXDA 2F6BA 2D6PA 4M3CF 4GA9A 4TSVA 1G9CA 4Z1VA 3IWZA 1VALA 2WC2A 4OI0A 3GBGA 1H0BA 2DWRA 1WCKA 1S0IA 5F5QA 3FX3A 3AP4A 1TME2 2BBVA 3ZFGA 3AKPA 3RI8A 1MVEA 4M0HA 1WW5A 2HEVF 4WM7B 5DZEA 2PHLA 4EN8B 2IFRA 4IEUA 5KHJA 3VBHB 2RS13 2ZTNA 4AF9A 1DYPA 4E9KA 2A6CA 5GZEA 4E4DX 3TAYA 3T2TA 4XHBA 4L8QA 1AJOA 4YG1A 1C4RA 3LGRA 2XJVA 5IUQA 5FQ0A 4I0WB 2CL2A 4EN0A 4C91A 1LOAA 1H4HA 1LCCA 2DYCA 3WX5A 1V70A 1KRIA 1LENA 1RUG1 1VLNA 4AFDA 3HT2A 2P34A 4KWJA 4I8TA 4RGGA 3SHRA 1X33A 1OLQA 1V6NA 3OGGA 1VRH2 4AK3A 3ZFFC 2QUOA 3J4UH 1NCQA 3JZVA 1Q5OA 5C9AB 3MF9A 5KHIA 4P9JA 1M4WA 4OHXA 4I09A 4FAHA 1MS9A 1RUF3 3HT1A 4BA6A 3VUOA 2LYPA 1AL21 2XUMA 4LBQD 4M01A 1RUH1 4YZ3A 3ZFGB 1HQWA 3MDPA 4IXLA 4Y5Z0 3LB9A 3VKNA 2MEV2 3ROUA 4AI1A 2OYZA 5HBAA 4RFT0 4NDWA 4GWNA 1RB8G 4TYSA 1S0DA 3HIFA 1HRI1 2IC1A 3NWKA 2DCYA 4LO4B 3VN4A 4GKYA 2KPJA 4C1WA 1QQP1 5ACA3 3JQXA 3VHNA 5CAZA 2BW8A 2PHUA 4AEMA 4LT5A 2IXIA 2VVEA 4JDOA 4IEVA 5C4WA 5FQ0B 5KXEA 4ISRA 4QM9A 2ZCWA 2GNMA 3ZFEA 1D2SA 2WNUA 1J3PA 1VBC2 4X8PA 3PMSA 3URFA 1ND2C 3WR0A 4IERA 4Q8LA 1J59A 1PM7A 3KCCA 3L2YA 3AP7A 3QF3A 1VBE1 2YUEA 1AR91 1XE8A 4FPGA 3CU7A 1NCQB 1MS4A 5FO8B 3ZPYA 4F83A 4YRDA 4ES9A 4Y24A 4OHYA 2MEZA 3WG1A 4MVTA 3KJXA 3B94A 4WBBA 1MEC1 3RJRA 4UW5A 2Y26A 3NL1A 5FPZA 1ZZ7A 5L19A 4NO4A 5FO7B 2KEKA 4C0BA 1ADRA 2EF6A 2VUAA 2A75A 5J98B 3OCPA 1UZZA 3QYXA 2K9ZA 4Y22A 2Q5TA 4FOWA 1ULGA 3DUIA 1LGNA 2VECA 1WCDJ 4IVZA 3VK0A 4GXLA 3V56A 3WDYA 4HT1T 1DZTA 2A6VA 2WL1A 1RUG3 2XHKA 1LHWA 1YFWA 1CPNA 1NXD1 4DZGA 1I9RA 2BNOA 2BGCA 3JUUA 2PLV2 1B35A 5ABJA 5C4WB 2CWMA 3LOIA 3AX4A 1AYM2 5I91A 2NN8A 2WFPA 4WM7C 1TEIA 3SCGA 1RZRD 3ZFEB 3QBQA 4XFCA 4XZPA 5FCCA 1JTZX 3D8CA 5T5OA 4BQ1A 1RIOA 1IPKA 3VBHC 3OY8A 2XG3A 4LLOA 4LBQA 3UJOA 5T3NA 1PGL1 1AL23 1QH6A 4JTNA 5E88A 1RUH3 1Y3TA 1RITA 1V9U2 3WD5A 1TQ5A 2HWE2 1N1TA 4N7UA 1C5HA 4UW4A 2XWJB 2D40A 2B5AA 4YW2A 4DPNA 2O8QA 5AFBA 2HWF1 2LYQA 2XI8A 1MS8A 5JOXA 1QH7A 3RQ0A 2PHDA 1HRI3 1YI7A 4Y1ZA 3RSJA 1QQP3 3JXCL 2CGOA 4FOVA 1H8TA 4LO5B 4Y22B 2DUOA 4AFCA 4YM0A 2CROA 1RMU2 1SLBA 3T1MA 1GSLA 1UN1A 1R091 4XFGA 4U36A 2EF8A 5C9AC 3VHRA 1AXZA 1ZBA1 3IKWA 3O0WA 4M0NA 3WW2A 4MX3A 2B9UA 4XF9A 4YG6A 2VQAA 2ZAAA 1C8M1 3EHKA 3KGLA 1AX2A 4ZU5A 1OQDA 5ABJB 1VBE3 1TMF2 2ZHLA 1B35B 5E1RA 1AR93 4JDNA 1V6LA 2DCZA 2X53S 1WA4A 3JD72 4Q1PA 2E51A 1O4TA 5H9SA 4EROA 2HWC1 3GBFA 3OF1A 4LBQB 3NKTA 5CVRA 1F8VA 4KBBA 1MEC3 4KQ7A 3ZSJA 1C3HA 3QACA 2R072 5DZGA 3L2HA 1R1A1 2UYAA 4Q26A 5AVPA 4N7IA 4Q4V2 2AUWA 1PRAA 1RUI1 2OPKA 1UX6A 4G4FA 4YG0A 3TOJA 2PHFA 4LBLA 4Z2WA 1QJX1 2XJUA 3VBUA 5I0UA 2BYVE 1ZAYA 1ONAA 5HCBA 3HD8B 1PNGA 5GM0A 3JBG2 2WT2A 5GZDA 1H8TB 1RGSA 1RZRA 4P9GA 3RYRA 3PJYA 1GYKA 1UCXA 1O3QA 1NCQC 4YZ4A 3B5LB 4X4IA 1YHFA 1LOCA 1QY4A 1UZYA 3M4FA 3PVEA 3BODA 4LA3A 5DG1A 3FHIB 3S7IA 2C1FA 2ZGRA 1GFF2 4MGZE 3AKTA 1LRHA 1SACA 2WKKA 3ALQA 1RUC1 3PVNA 2HWF3 1DFQA 3FMYA 1LB2A 1MZFA 3OYWA 3W59A 1BYHA 3VBRA 3ZKCA 3TNPB 4HSLA 4YFZA 1UW8A 2ZABA 5DUUA 4AVTA 3H7YA 5C4WC 2YDEA 4BIFA 1R093 1VBB2 2ZBJA 2RM21 4MH0E 3WOGA 3ST7A 1WLTA 3ZFEC 2YV8A 2WNUC 1LMB3 1ZBA3 2VULA 3AMPA 5CFCA 2GH8A 4JQDA 1CVNA 1LCLA 1QNWA 5DUWA 4R4ZA 3VBUB 2DCJA 1C8M3 3N7KA 2AXZA 2ET1A 3EO6A 4K3UA 5LEKA 1COV2 3MIGA 1KDKA 3OMTA 3BDNA 5FTTC 5FOBB 4JCXA 4Y42A 4CP0A 3DKWA 2HWC3 3OGJA 1Z0HA 3B3QE 3BB6A 4Q2FA 1QF3A 2GDFA 4M3CA 3W9AA 2JJ6A 4P9IA 4FTEA 2Q4SA 1OHFA 1N1SA 4JRLA 1U5XA 1CAUA 1R1A3 4GALA 4M3CE 3FC0A 1NEQA 4IV3A 3QH7A 5JDBA 1RUI3 1NLRA 2XL9A 5CIRA 4LR4A 4LHNA 1Y7BA 2D3PA 1X82A 3H9AA 2YC0A 5E89A 4GB31 1RUG2 1VRH1 3VLBB 3H5TA 1QJX3 1DU3D 2XWBB 4LULA 1FV2A 3MIDA 3VBRB 3VZMA 3R1FA 1U5YA 5JOYA 1QWRA 2IU7A 1AUYA 5ABJC 1B35C 3JQWA 4XXAA 1V6JA 2BPA2 5CFCB 2VG9A 5T55A 4A7KA 1E3OC 2ZACA 4R8HA 1WLCA 5EFUA 3P3NA 2MEV1 2H0BA 3N7MA 3MPPG 2HWD2 1CJGA 1YO8A 1S55A 4XTMA 4TWTA 4D69A 2WJSA 2KA3A 5KHGA 2OZJA 3HQXA 3O0XA 2PHWA 3N7JA 5JZGA 2DVFA 2ICTA 1RUC3 3ZIXA 1EP0A 3D1NI 4M3CB 2CGPA 2PUCA 2GC1A 5K9YA 3FZ3A 1AU7A 5F9TA 5EZWA 1VBC1 1YIPA 3SLIA 1CAUB 1OQEA 3L9JT 4FPYA 4IV3B 1H8TC 4Q0VA 3ZVXA 3ME2A 4N90A 1UMZA 4QX5A 1CJPA 2RM23 3ZSLA 1H30A 3PNAA 2R1BA 4YG7B 5GKAC 5CNAA 4Z5HA 3G5GA 1QXRA 1EY2A 4WVZA 4I6RA 3O12A 1UU5A 2X5IA 4PLNA 5T54A 4NHMA 4OULA 3WQ0A 2LYRA 4YZ1A 2WA4A 1CD3G 3O5SA 2LYLA 1WD4A 3BOWA 3PVBB 2FMDA 3KB5A 1RHI2 3VL8A 1MEC2 3R4SA