2BNMA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPOXIDASE
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 46
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnmA02
3ACLA 2CAUA 1WGPA 5BV6A 1ZUGA 3MYXA 1XE8A 5FQ0A 2ICTA 2ATFA 2GC2A 3E6CC 1ZRRA 2CAVA 3HZIB 1DGWA 1GQGA 1OMIA 4J1XA 1DZRA 1Y3TA 2OZ6A 1Q43A 2IXHA 1OFNA 4MZUA 3H1MA 3I59B 4I02A 1ZZ8A 2IXIA 2PA7A 3S7IA 2MEZA 5KHHA 2JVLA 4LA2A 5LEKA 3E6BA 2OFYA 3BDNA 1LMB3 4FN3A 1POUA 4IEWA 4I2OA 4Q0VA 3PVBB 4WZCA 4MGYE 3JZVA 1UXDA 4XF3A 2GRLA 3G5GA 4BIFA 4X4GA 3CLPA 2IXJA 3UKTA 4MV2A 1YFXA 3ST7A 4F8DA 1QPZA 4OLLA 3UKNA 5KHGA 2AXVA 3NW4A 4YARA 1LRHA 3DL3A 3ELNA 1RPEL 5C6CA 1JUHA 1QWRA 1RL3A 1ZVFA 2PUFA 4XF1A 4BHPA 2D40A 3VK0A 4Z5DA 3OQNA 4IEYA 1H1MA 3QYXA 3WW1A 3SCGA 4LUKA 4GQMA 1RIOA 4D7TA 4N9HA 1DWKA 2AXUA 2B8MA 1Y9QA 4IEXA 1O3TA 4OB4A 2CGPA 2L49A 4L11A 1YSEA 2D5HA 2BNNA 1YFUA 5FCCA 3E6DA 4X4CA 2QNKA 1JH9A 1J1LA 1X8MA 4QXKA 2KEKA 3VHRA 1O3RA 3EUSA 3RZZA 4QGLA 4IERA 3KZ3A 3JXDL 3NL1A 1HF0A 2IVGA 3U10A 3U0ZA 2EF8A 2PUGA 1ADRA 4JV4A 1ZRDA 1XRUA 1ZZ6A 2AWIA 3UFDA 4KU7A 3USSA 4X4DA 2XGXA 2BEOA 2XLAA 3ES1A 4E2SA 4QMAA 1FT9A 4P9GA 2BNMA 3EBRA 1NE6A 3M3IA 4AVBA 4F8AA 1UIJA 1WA4A 1NE4A 2GZWA 2UY9A 4Q29A 4XF4A 1QP4A 1H1IA 2IXLA 1CAUA 3ROUA 2N7GA 3F6WA 3B02A 4IETA 3FFQA 1QXJA 1VP6A 3QF3A 1ZAYA 2D5FA 4Z59A 4QX5A 3QOPA 1NEQA 2LYJA 1SEFA 4HLTA 3RYRA 2IU7A 4R8HA 3FYMA 4HMZA 2ETEA 5KHKA 1O3QA 2LCVA 1CAXB 1X57A 5I0TA 1R63A 4IEPA 1LCCA 3OTFA 1SQ8A 3KSCA 2O4AA 3ZHMA 4Q0SA 3LWCA 3HQXA 2K0GA 3E97A 4O8BA 1QY4A 2PTMA 2QVSB 4XFIA 4Z82A 3D82A 4X6RB 4PU8A 1PRUA 4ONUA 4XEZA 3ZKCA 4X4IA 4UBGA 5HI0A 3I54A 4KWLA 2WUSR 1RUNA 5K8SA 3NJZA 3E5UA 4OFGA 2KPJA 2PUAA 2UYBA 4L2NA 2XJ3A 3BU7A 4XFAA 2PPXA 2IXCA 4KL1A 4JCYA 2VECA 2XSDC 2UYAA 3FHIB 5I0UA 1RTVA 4FT8A 4X4BA 1TQ5A 4EWEA 4QM8A 3E5QA 1ZZ9A 1B0NA 1UXCA 4XETA 1UCXA 3LZZA 4HN0A 2Q1ZB 4WBBA 3KCCA 5KHIA 4QGNA 3IDBB 1WLTA 1X8EA 2GC3A 4LA3A 4X4EA 3CF6E 2VPVA 3JXCL 4JVAA 4EWDA 4X4FA 1CAXA 2GU9A 5C8WA 4BYYA 3FMYA 4E2GA 2CSFA 1O4XA 4HVOA 1J59A 2ICPA 3DV8A 4HVRA 1UPIA 1EYBA 3LOIA 3FX3A 1YFYA 1GQHA 1YLLA 5JSRA 2H8RA 4HSJA 3OQMA 2L8NA 1WH8A 3LFPA 3LISA 2EAAA 4PIZA 4HZFA 1AU7A 2WIUB 1CAUB 3PXPA 3SMHA 3ZDSA 4HVQA 2HJIA 2PHDA 3EHKA 5I8YA 2MQKA 4XFFA 3D1NI 2D5VA 2FJRA 2LYRA 2QJVA 4META 5CADA 2LYKA 4YRDA 5AVPA 1UTXA 1NERA 1ZVVA 2XKPA 1ZRCA 3H5TA 4FBIA 4Z5CA 5E16A 1DW9A 2A6CA 1I6XA 3F51A 2PQQA 5KHJA 5EFUA 1OD5A 1HW5A 2ZKLA 4AVCA 2GAUA 4LTAA 2I45A 5I93A 5FLHA 4JTOA 1RZRA 2OYZA 1CAWA 3B7HA 2BYVE 3GYDA 4PIXA 1BDIA 1RC6A 2BGCA 3C3VA 4HBNA 4UXAA 1OI6A 3KJXA 5I0SA 1RUOA 3IBMA 3QACA 3L2HA 4NVPA 4XFHA 5CVRA 3NSTA 1IPKA 1ZPQA 4YG7B 2ET1A 4XFGA 2Z69A 4LULA 4YSFA 2PUCA 1G6NA 3UKVA 3MZHA 3ZHIA 3FJSA 1QXRA 2WC2A 1LCDA 1JWLA 2GZUA 4O9EA 2GH2A 3O9XA 4H7LA 3JXBC 1RZSA 2E9QA 3IIAA 2IC1A 2HKXA 4HN1A 2QCSB 5FPXA 3OP9A 2DCTA 4R52A 1X82A 2IVBA 4A2UA 3LA2A 3MPBA 4Q0PA 3OGJA 1PRVA 2KZ8A 1JFSA 2Z2SB 5BPXA 2WFPA 4FBFA 1L1MA 4Q0QA 2PAEA 5KBFA 4PIYA 4BH9A 3L1PA 3D0SA 3WW4A 4EV0A 4K8FA 1CQTA 2XLGA 4UBHA 4X6QB 3RYPA 1QP0A 4EROA 1SQ4A 1R69A 4FAGA 2XIUA 3TRBA 2XCJA 5A7LA 3LAGA 4IWRA 3CROL 2ZCWA 2XL7A 1BDHA 5JCTA 2R63A 1X2LA 3FWEA 3H1YA 2Q0AA 1WH6A 1OCTC 1YWKA 1X7NA 2O49A 3H7JA 2R1JL 5I0RA 2PFWA 1LQCA 1PERL 1VR3A 4YNIA 5I8SA 2UY8A 3S8QA 4PU4C 2Y0OA 3RDIA 3HT2A 5T3NA 1CAVA 3PLQA 2OPKA 5LEJA 1QQAA 1QP7A 3OQOA 1WETA 4ORFA 4QGMA 2MNGA 1VPWA 4MH0E 4RD7A 3WW3A 2KEIA 3GBFA 2AXZA 1J3QA 1YUDA 1V70A 3LA7A 3CLCA 5FLJA 3E5XA 2PHLA 3HT1A 4ZU7A 3KMHA 3G7DA 1CAWB 4MCXA 4KWKA 2MHFA 2OZJA 1JFTA 4PU7A 2H6CA 2PIJA 1UD1A 1ZS4A 5E1RA 2XL9A 2K9ZA 2BJCA 1SFNA 2XI8A 4Z58A 1O7FA 4D7SA 4E2QA 3OMTA 3H50A 2B5HA 4IEUA 5J7MA 3MDPA 2IVQA 1O5UA 5CU1A 4QM9A 1S7EA 3BCWA 3OF1A 5BXXA 1YHFA 2O1QA 1DGRA 3DKWA 3D0JA 1U12A 4XF9A 3U11A 2AUWA 4X4HA 4AQ2A 2EWTA 3H9AA 1J3PA 2PAKA 4MGZE 4N9IA 4YYOA 1ZZCA 5J48A 3DN7A 2HSGA 2XKOA 4Z07A 3F52A 3BD1A 1NXMA 4IVZA 4IA8A 1LLIA 2JCGA 1RGSA 1NYWA 4YG1A 2Q4SA 2GC0A 4LLOA 4YG4A 3H3ZA 2H0VA 1WIZA 4AVAA 4XFBA 4O9GA 5I91A 3TNQA 2PUBA 4MUVA 3GN5A 4XF0A 3RPQA 4CYDA 4I3PA 5JAXA 5BUVA 4I09A 4MGKE 3PNAA 2XHKA 5FLIA 2FMYA 2MPFA 2IUOA 3IVPA 2C0ZA 3LA3A 1Q3EA 4ZU5A 4ZU4A 1IPJA 1XE7A 4WVZA 4AQ6A 3DNVB 2AW6A 5K98B 2KEJA 1ZRFA 3CECA 2BNOA 4GHJA 1EP0A 3ES4A 3I7DA 2PYTA 1O4TA 3U3WA 3S0MA 3WW2A 4I01A 1CJGA 1O5LA 3SHRA 3TNPB 3SCFA 4JQDA 4PJYA 2GC1A 2HINA 3H1WA 3IWZA 4LUMA 3NVCA 1ZZ7A 3CEWA 1CAVB 2PAMA 4MCTA 3EJKA 3H7YA 4AXOA 3MLFA 3CL1A 1J58A 3SXWA 1YFWA 1E3OC 3NKTA 4Y42A 1J3RA 4YBAA 1ZX5A 1PNRA 1Q5OA 4LEJA 4I0BA 3O14A 3EQEA 1ZNPA 3BPZA 3I59A 2IV1A 1FXZA 1EFAA 2Q30A 2D93A 2PUEA 4IEZA 3IDCB 1PRAA 3H3UA 3CJXA 3BALA 4J1WA 4IESA 5LRRA 1CGPA 5J3UA 5JSOA 3RNSA 2LYSA 4EWAA 5FDBA 3OD0A 4GULA 4I8TA 3M70A 4MX3A 1PM7A 3KGZA 2FQPA 1FI2A 1UW8A 1VJ2A 5FQ0B 3R1FA 3BB6A 3KGLA 5EZWA 2F4PA 2PUDA 1EPZA 3KXAA 3RYKA 3S7EA 2V09A 4I6UA 4IEQA 1L3JA 4B29A 1PMIA 2CROA 3SCHA 2EBYA 2CV6A 3FZ3A 4HSLA 1ZREA 3HIFA 1ZZBA 1CX4A 4XFCA 5I8TA 2EVXA 1UIKA 2VQAA 5F1RA 2OA2A 4IEVA 5FPZA 1O3SA 3CO2A 1IC8A 2B9UA 3OCPA 3R6SA 4F7ZA 4Z5HA 4KU8A 2O38A 1EY2A 1QQBA 2EA7A 4MGIE 2H6BA 3N4MA 2O8QA 1Y7YA 4I6RA 3H8UA 1I5ZA 3ETQA 2B5AA 4I0AA 4JTNA 2LYLA 5JSPA 4TLFA 1XWRA 2LYPA 2OR1L 1LR5A 4IEOA 1DZTA 3QWGA 3FE5A 2ET7A 3BS3A 3EO6A 3GN5B 1NZCA 2GRMA 2KXLA 4KWJA 3FYAA 2LYQA 2P17A 5JR7B 1OSLA 5BY5A 3QQ6A 4NDWA 1LB2A 2QDRA 4PU3C 1RZRD 4FAHA 4I6TA 4Q0UA 4JCXA 5D1IA 2PE5A 2XLFA 2IXKA 5LRSA 1LKNA 4DINB 1GT0C
chains in the Genus database with same CATH superfamily
1Z0HA 3ACLA 3JBG1 1WGPA 3AZWA 3QFIA 5GAHi 3AZXA 5JZGA 1XE8A 2CY6A 1PGW2 5FQ0A 5J1XA 2GC2A 4B8EA 3E6CC 3AXDA 3BIEA 1GZ9A 1OMIA 4XCBA 4DY5A 2DTYA 1DZRA 1IS4A 2QQIA 1MACA 4DQAA 5BNQA 1RUD2 1B35C 2OZ6A 2CU5A 2AACA 2XUEA 4FCAA 3KF5A 1OFNA 3UGGA 3ENRA 1UY3A 1Y9GA 3V0AB 3I59B 1ZZ8A 2A1XA 2MEZA 1L7RA 3LDBA 4XHXA 5CFDB 3EYPA 1QXPA 3E6BA 2X8KA 5IHRA 4CXYA 4FN3A 1POUA 1PMJX 3PUHA 3S30A 3ZN4A 1RJ8A 2YXSA 3NXHA 2BFUL 4XMAA 3PE5A 2JB8A 5KXDA 3N9LA 2GRLA 1PGL2 4AWDA 3CLPA 5DG2A 2PHUA 4MV2A 2IVIB 1JYTA 1R64A 5JPMB 5FZDA 3UKNA 5KHGA 2BW8A 1E5HA 1LU2A 2WO7A 1S0EA 1LRHA 2CDPA 2PXBA 4ER7A 2W1UA 3WNKA 3ZN6A 4LHNA 2DVDA 1JBCA 2E7QA 2Y6GA 4PF5A 3ZOIA 4BWOA 5BNNA 1RUG2 3FHAA 1ZVFA 1LAJA 2VZUA 2GALA 3T0DA 4OULA 3MUY1 4AI8A 1RB8G 1V9U2 3Q8AA 4DS0A 4DRVA 1BEV3 1H1MA 5FY9A 3RZHA 4K1YA 1POQA 2BGPA 2Y6FA 3WW1A 4TYSA 1ULCA 1GP4A 4D7TA 3GGLA 4YZ1A 3WUDA 3LB9A 3SH4A 1O3TA 1Y9QA 1RIRA 4OB4A 2PHRA 5DAWA 4BU2A 1AYN2 4DY3A 5FPAA 3NNLA 1UN1A 2D5HA 1W6PA 1YFUA 2BVVA 2QE3A 1Q8PA 2QQJA 2QNKA 1X8MA 1UYPA 2R32A 3C7OA 2KEKA 2D6MA 4QXKA 5IFTA 2HWF3 3J8F1 3JD73 3RZZA 1H4GA 2WLQA 2W94A 2QFEA 2VH9A 1HF0A 1U2ZA 2IVGA 5DUWA 5T5LA 5IVBA 2BOIA 1MS0A 3U10A 2B45X 1UZZA 1OH4A 3KVAA 4R4XA 2HWB1 2VVEA 2E51A 4G4FA 5C9AA 1DF0A 2AWIA 3UFDA 1QEXA 1UY2A 2XGXA 1HRI2 4H7MA 3NV1A 3ZYIB 4Y1YA 5LA1A 3LIHA 1S0GA 4PCRA 2BRTA 1R081 2R072 2WBKA 1FT9A 3KLSA 4QKNA 3WP4A 4AG4A 1NQDA 5FZOA 2GMEA 3VBSC 4CDXC 2JEMA 3EBRA 5FMDA 1MVQA 3WDWA 1MS8A 2DUOA 2GZWA 1Q8OA 4AVVA 4H2AA 1BEV1 1LHVA 2IXLA 2P3YA 2WFF1 5FMBA 3F6WA 3MGUA 1J83A 1VMHA 4C0BA 4KBZA 2J1VA 1VP6A 3QF3A 2ZGKA 1T6GC 1HXS3 3HD8B 4K1ZA 2W46A 2VZTA 1OURA 4BQ5A 4EQVA 5C7GA 1KITA 2PXQA 2Y26A 5A32A 2BGOA 2J1EA 2WQZC 5I0TA 1VBA2 4PI0A 2FDGA 2J1UA 3DYPA 2VCMA 5FXXA 2C24A 1S0IA 1IKPA 4LJHA 4Q4Y2 4QXBA 4Y5SA 3VBSB 4CDXB 3SQOA 4D6RA 2FMDA 5C5TA 4Q0SA 2K0GA 1RINA 4XILA 2DUPA 1GU3A 5C33A 2ZX2A 3ZN6B 1GZTA 4Q4W3 4XFIA 4E27A 1JYCA 3D82A 4X6RB 1QH6A 2C4XA 5IVFA 1IHMA 1DFQA 3LPGA 3UV9A 4X4IA 1VRH3 4UBGA 1JU4A 1YJLA 1RUC3 1AXZA 3N35A 1T2XA 3KQ4B 5IUQA 4FTSA 2FDIA 4CDWC 3ZXDA 2LALA 1ASJ2 5BNOA 3WCRA 4GB33 4K3UA 2KPJA 2WNVC 4O61A 5FZ7A 2YROA 1BLZA 2UYBA 4Y1UA 1PHMA 4JRAA 3BU7A 1AR83 3ZFGA 1MR5A 3DYOA 1BMV2 4JCYA 1JZ2A 1AR91 2UYAA 4XAEA 5I0UA 1W6PB 3VDCA 4FT8A 5LA2A 1RHI2 2PXEA 1AJKA 1AR73 2WRAA 4IE4A 5IAVA 2HWF2 4XDPA 5T5JA 4CUGA 3JD72 5DAQA 1QJY2 1JHNA 4XETA 3AMQA 1KJLA 4KWUA 2MEV2 2Q1ZB 3HQUA 3MV01 5DTMA 2LLVA 4Y26A 5D8AA 1RMU3 3K77A 4AFBA 3O1PA 3OPWA 4XPVA 1V6MA 3CF6E 5F37A 3CKHA 4JVAA 4CCNA 2XJQA 5C8WA 2O14A 3O1MA 4P9WA 3K4DA 5FK7A 4BYYA 3O7OA 3WINE 4ET7A 5C9AB 4CXXA 4MGTA 4FOVA 4HVOA 1W2UA 4PLMA 4FPJA 1UPIA 3OGGA 2VZQA 4XC9A 4LKFA 5LK5A 4Y4RA 1YFYA 4RHV2 1RUJ1 2BWCA 2FZ1A 2BWAA 2ZJCA 5IT6A 1TME1 2PXFA 4NROA 1WD4A 4NHKA 4D6QA 1JXNA 3LEIA 4K9SA 5IVJA 1LOFA 4HZFA 5JUWA 2J1RA 4OI1A 3PTYA 1C8NA 2W52A 3OG2A 2DDUA 4GD4A 4GB31 4Q27A 3T1MA 5AC92 4RA0A 2FJRA 2LYRA 5EYXA 1CD3G 4LBJA 4UF0A 2G9FA 5AVPA 1AR81 1ZVVA 4YW1A 2XKPA 2XJTA 3GJAA 1ZRCA 2NQYA 5HXVA 4MOAA 3SH5A 4S2GA 2JKXA 4GXLA 4Z5CA 4BOWA 5BNOC 1AR71 3WNNA 2YDEA 5B2GB 2TEPA 2YFUA 1BK0A 5EFUA 3T0AA 1JTZX 2V5DA 4BQXA 1OD5A 2JECA 2ZKLA 3JQWA 3RJ2X 3GUUA 2ZACA 4OMDA 4CDUA 1CAWA 2J22A 2QKDA 2R063 5T50A 5K7PA 1JOJA 1W8OA 5A6YA 3H0OA 1LOEA 2YC2A 3WF4A 1V6IA 4YZ2A 1OI6A 3F2ZA 4JGZC 4YW4A 5DTQA 4V1PA 1Z7S1 5D8AC 5I0SA 1RUOA 2PXDA 2JDKA 4HETA 1UWWA 1KFUL 4JCKA 4W65A 5CVRA 5BNOB 1VBC1 1W6NB 1IPKA 2WS92 1GLHA 4LULA 4DE9A 4NPLA 1G6NA 1BXHA 1XNTA 2RS51 3UETA 4O9EA 1XSRA 5GJ6A 3O9XA 3GBGA 1H6YA 3N3HA 4KQ7A 1AR63 1RZSA 4IGQA 4UWDA 3IIAA 3OPTA 4QPIA 3WNMA 3QOXA 1QHDA 1NKGA 2DCTA 4HOOA 5IFPA 3OUIA 1RMU2 3OGJA 3WNXA 4JGZB 5ABJA 1JFSA 5D8AB 1CJDA 4DRRA 4WVMA 4IV3A 4Q0QA 2PAEA 4RFT0 4Y1XA 5FY8A 4BH9A 4C1XA 3VBRA 4XHBA 3L1PA 3D0SA 3VBHC 3WW4A 4EV0A 4L99A 4G9SB 1CQTA 1NY72 1H9PA 2OS2A 4UBHA 3RJRA 5A1FA 4EROA 5C3SA 1JZ4A 5ANQA 4M4RA 2X29A 2RMU2 4LHLA 2XONA 2QQKA 2ZX4A 4UFIA 4YVWA 5FZGA 3I2DA 3WQ0A 4JDNA 5F5IA 1UY4A 2JXAA 2YC4A 1H2NA 4IWRA 3I2IA 3I4IA 2ZCWA 4IXLA 3POFA 2R63A 1X2LA 1V6LA 4L0PA 3T30A 2W95A 1XNDA 5APAA 1DLCA 1X7NA 2O49A 4AEKA 3LIGA 3S6PA 4AI0A 1PNFA 5FMOS 2PFWA 1W3VA 5F8PA 3VBHB 2Y0OA 3S8QA 4PU4C 2YU2A 3SEEA 3WP5A 4CUBA 4UF0B 5CYYA 3WX5A 2OPKA 3PU3A 1AR61 3IDEA 2W2IA 3A0KA 4ZY9A 4AHXA 3OQOA 1WETA 4QGMA 4W6XA 3AL5A 5DZEA 5CFCA 1F9KA 2KEIA 1OHFA 2HYXA 4JC1A 4Q4X3 3I2OA 4ISRA 4AI9A 5DDJ1 5FZCA 2ZGMA 1V70A 4FO9A 5FLJA 4YGEA 5JR2A 1JN2P 2QQNA 3ZFEC 1CAWB 2BU9A 4AFAA 5A3PA 4QPIC 2HWE2 4UW3A 1JZ8A 1UD1A 1H8TA 4COYA 2IFWA 2FCVA 1SFNA 4CRQA 2XI8A 4Z58A 1O7FA 2DVGA 4E2QA 5ABJC 1XNCA 5IVVA 2YBDA 5JUVA 3MDPA 2IVQA 1HN1A 5A7OA 5JOWA 2A3YA 2VQUA 2Y0IA 4RR3C 3RZGA 3IAPA 1DGRA 3T4VA 1PO23 2R041 3M9LA 2VM9A 3HQRA 3ZFFA 1XJAA 4XF9A 3VGIA 4N53C 3K2OA 5LY2A 1YYNA 4XQWA 4S2DA 4YVWC 2L9LA 4QB1A 1GZWB 3ZFEB 5IVCA 1C8M2 5FYCA 2VQ0A 4QPIB 4YYOA 1ZZCA 5F3CA 5J48A 2QDNA 3MIGA 2PQSA 3F52A 3BD1A 4DO0A 1IZ3A 4MXVA 5ABJB 4OI4A 1BJQA 3PVEA 2JCGA 1RUH1 4YG1A 1UKRA 3ZSEA 1ZYBA 1QDOA 2JE8A 3M3QA 1SMVA 3GHMA 2XUMA 1A78A 4QT6A 4WVMB 1VB4A 2H0VA 4XURA 3BTXA 5C3QA 3VBRB 4Q2FA 4BZ4A 4N43A 3DXTA 4RR3B 5I91A 4OI2A 4PDWC 4W50A 3TNQA 2XXZA 3LFIA 4BDVB 1H2KA 5FYZA 4I3PA 4N53B 4YVWB 5C8CC 2EALA 2RDNA 4MGKE 3SC7X 4JRLA 4CDQC 1QQP3 2P6CA 5CZKA 5CFCC 3I3DA 3VKNA 4LBOA 1WW7A 2C5DA 2HWD1 1G9AA 4QXHA 4IE0A 1A34A 4LK7A 5CEHA 1HRV2 5J37A 4PT6A 4BLJA 3W9AA 5IATA 1UZYA 1COV1 1ZRFA 3OGRA 1NOVA 3VL9A 5T55A 2BQPA 2P1BA 4FXKB 4A7YA 1UNBA 3T2QA 4TTGA 4RS5C 1O5LA 3RI9A 3BPSA 1YIFA 1MEC1 4GH4A 5EJ1B 1QJX2 4JQDA 1NA1C 2RJKA 4PLOA 5KC5A 2PAMA 3EJKA 4MCTA 4AXOA 3PL0A 5EWSA 2QQPA 5C8CB 2F4LA 4FP3A 1QNYA 2GN7A 2VG9A 1UOGA 4K40A 4CDQB 5CFCB 2AREA 3LD8A 2Q8EA 4A41A 4AVTA 3EQEA 3POEA 4QPGC 1VPHA 1XYNA 5GLWA 1X36A 5FZ6A 1N1SA 1EFAA 2NMNA 4ER6A 2Q30A 5BNPC 4EKIA 4GJZA 3HMYA 2CDOA 2YUEA 2I74A 3CJXA 1CESA 4J1WA 5FZFA 2CYFA 4IESA 2QQMA 4OHXA 4RS5B 5DPNA 4NWVA 1H8TB 2PLV2 5JSOA 2LYSA 4M00A 3OYWB 2HWC2 2ZX1A 5JIUA 3P6BA 4GKYA 2WYFA 5JOZA 1NA1B 3D5OA 1D2QA 5GLVA 2VU9A 2FQPA 1MQTA 2V3CC 4XOGA 2E7TA 1VJ2A 2IZWA 3KGLA 5B4NA 4LIUA 2YC0A 4CPBD 1SLTA 2V09A 4I6UA 4N43C 5FXWA 4E8DA 3SLIA 3GF6A 4FPOB 4QPGB 4Q8LA 5LATA 3SEPA 5FWEA 3ZLIA 5IJRA 1H4HA 4FPYA 5BNPB 2OX0A 3HBZA 3OBAA 4ES8A 5F3GA 2RDSA 4AQTA 1Q8QA 2EVXA 1UIKA 1LEDA 2PN5A 2RM21 5FPZA 4EZIA 5DABA 3ITQA 2D98A 4YG0A 4Z5HA 2X09A 3GZCA 1STMA 4MGIE 2EA7A 5FMOL 2H6BA 3WDYA 1DLLA 1EAH1 1LENA 1HKDA 3M8LA 5LBEA 2VMGA 3BTAA 2JDPA 1F2NA 4FFGA 4JTNA 3ZIWA 4QPWA 1XWRA 3IKWA 4N43B 1LR5A 4CU9A 5A1AA 2ARBA 4BQ2A 5CISA 2UWCA 1FMD2 2GSYA 2PXUA 4EK9A 2FHRA 3B5LB 1GP6A 3M3CA 2GRMA 1QQP2 4KWJA 1TE1B 2IVJA 4HG6B 4E4DX 2G9ZA 4H55A 1JOPA 1F35A 1OSLA 2G1MA 2VZ1A 3C7FA 3I8TA 3QQ6A 2LM3A 4UFJA 4XUQA 3UJOA 2WZR1 4IW3A 1RZRD 1US2A 1B09A 1QJZA 2YGMA 1LOAA 3AJYA 4QX1A 4YLZA 2EXJA 4ZKTB 1R1A1 1H1AA 2LUWA 2RS31 4Q0UA 3VKMA 3K46A 3AFKA 3IMMA 1RUF2 2W68A 5F39A 2E31A 3GALA 2L1PA 1LKNA 3FJSA 4DINB 1ENRA 3VLBB 4GWNA 2CAUA 1YI7A 3KF3A 2IWGB 3MYXA 4NOTA 2YZ4A 2ZPXA 1DBNA 3B93A 1C5HA 3SKJE 1ULOA 1PO13 1MQTC 4Z1VA 3HZIB 1DGWA 1GQGA 4NPRA 4J1XA 5F7UA 5IK4A 1D4M3 1Y3TA 1DYPA 1Y9MA 2A3WA 2VTXJ 3LOBA 4M3CE 1IPSA 5EIYB 5LBFA 5T52A 2WZ8A 2IXHA 5FZBA 1WKYA 1R092 2VNVA 5FUPA 2NP0A 2WZEA 4HONA 2WNUA 1V6JA 2IXIA 2PA7A 1XXNA 3MIEA 2ES3A 3QBQA 4FI9A 4I02A 5KHHA 4B3NA 2XXQA 2UU8A 3PIGA 3BDNA 1LMB3 2DBNA 1UMIA 2D97A 3GCWA 3PMEA 4IEWA 5E6HA 5LCWL 3PVBB 2WT1A 3KT1A 4MGYE 4WZCA 1W05A 1OLME 5GAGi 2BJSA 2YPDA 2ID4A 3JZVA 1LCLA 4LOTA 4NHYA 4XF3A 3C8XA 2VVFA 1MQTB 2CHHA 3UKTA 3ZKYA 3OGSA 4LO8A 4F8DA 1CZTA 4XUNA 4OLLA 4BQYA 1JI6A 3BOPA 3IZOA 5FP7A 5G05L 2AXVA 3HPNA 3BGAA 3K48A 1GV9A 3VD7A 5FOBB 1LESA 4OQ9A 3POBA 3NNMA 3DL3A 4Y5Z0 3TYJA 1RPEL 2JG9A 2WLPA 4D69A 5LY1A 2PUFA 4MADA 4WM8A 1ODMA 1N3OA 1PIV1 5LBCA 3H8RA 1RUE1 3GHNA 1VBE2 4Z5DA 1W0PA 1XU1A 2PXJA 2JE7A 5AFEA 3NDBB 2WNOA 3NJYA 1NLRA 4JAAA 1JYXA 1Q8SA 4LUKA 2BTVC 4GQMA 1GNHA 5B4XA 4COVA 2ORXA 3WOGA 3KHCA 3M7AA 2D3SA 2AXUA 1PVC3 1DQ2A 5IK7A 5FBJA 2WNEA 5AVAA 3M1HA 3P3PA 3WCSA 4MO3M 1YQ8A 1RVF1 4BCUA 5E89A 5FCCA 1E5RA 5FY0A 2ZHLA 3KV9A 1U5IA 2GNDA 4D0QA 1JH9A 1J1LA 4DNYA 3AMNA 2R0FA 3VDAA 1WZXA 2OQ6A 3EUSA 2BP6A 2CWMA 4QGLA 3I2KA 4FXGB 3OGVA 3ZMNA 1K42A 3JXDL 2J7UA 5KXCA 1RXGA 3WLUA 1N47A 2WNUC 3AP6A 4BA6A 1OSGA 5JDBA 2G19A 1YXWA 3FHQA 1DQ6A 2AYHA 5L9RA 2PUGA 1W8TA 3JCIA 4JV4A 2RR12 2D6PA 2ZGLA 1XRUA 2Y6JA 2Y6KA 4C1WA 1PO12 3USSA 4X4DA 2BEOA 1OF3A 2VUJA 2Q8CA 1S0JA 4QMAA 1D4M2 1B35A 1QIQA 2VZPA 4OQ8A 4P9GA 1I3HA 4BXFA 4AVBA 3RZKA 2ZAHA 1DYKA 1UIJA 1WA4A 1NE4A 3NMBA 3POWA 4Q29A 1DULA 4XF4A 3U4SA 1OPMA 1HB3A 2N7GA 4MLOA 3ZSJA 4D94A 2JG9C 3RRDA 5BNPA 1XQNA 1LHNA 2WNUB 1WCUA 2GNBA 3UK9A 5LWBA 3U78A 4EZ4A 4ES9A 2ADEA 2D5FA 3FLTA 1AZDA 3T2TA 1WCDJ 2DUQA 1NQJA 3KWVA 4HLTA 2IU7A 2TBVA 3FYMA 1PM4A 3JUUA 4HMZA 3Q8BA 4Y3OA 1O3QA 1G9BA 4HKOA 2P37A 1W90A 1R63A 4K8RB 1QOTA 3M2MA 3I3EA 4DUWA 1N1YA 3OTFA 2BBAA 5C3PA 5DUXA 1SCSA 1GNZA 1YCIA 2VJXA 3I2JA 4XUTA 2NYYA 2O4AA 3B7MA 4F83A 3MF9A 4TZDA 4FOQA 2W1SA 3OKZA 2E33A 1AL21 2W1WA 3HQXA 5FKCA 4ASKA 4QXCA 2FD8A 3E97A 4FPKA 4AFCA 4BB3A 1CPNA 2RS12 4A45A 2JG9B 2P4EA 2QVSB 3BYWA 4ONUA 4E4SA 1AHSA 1U5XA 4WM8B 1JH5A 1DGWX 2FDJA 3ZVXA 4B1MA 1O91A 4LT5A 2D3RA 5DSXA 3I54A 4KWLA 4Q1PA 5FUIA 1PGW1 3UKVA 4O7XA 5K8SA 3KV5A 3W58A 3AP7A 3NJZA 3E5UA 2PELA 2EXKA 3PHMA 1PVXA 4L2NA 4P02B 4EN0A 4RL7A 5DT2A 3LF7A 3NAPA 4XFAA 2PPXA 1SLCA 2D7FA 3AKPA 3RZJA 1JMUB 1JZ5A 2HEYF 3AP9A 3FHIB 2UWAA 4LOSA 1HDKA 4YGCA 4KH9A 4ZXKA 1VALA 1Q56A 1QGLA 1TQ5A 5F2WA 4GWIA 1LOGA 3E5QA 4QM8A 3V0BB 3ZXKA 1B0NA 5JI9A 1JODA 5GLUA 1LEMA 2NLRA 1ZBA2 4BQWA 2Q5TA 5DZGA 3USUB 1GQPA 2R49A 4QKBA 4WBBA 5CNAA 3KCCA 2DFCA 3IN9A 4CEYA 1W8UA 1WLTA 2WKKA 2A6YA 4LA3A 3J8F3 2DU1A 2VPVA 4EWDA 2VBBA 5FZKA 2IFRA 1ENSA 5A3WA 3ZM8A 3FMYA 2P6HA 2CSFA 3MLLA 4KI5M 1QDCA 4BQ3A 3H8OA 3JBG2 3VBSA 1RUG1 4CDXA 3LOIA 1U5ZA 2HWB3 2FBEA 2V72A 4QB6A 1XYPA 1ZA4A 4ARYA 1NG0A 1B35B 1KJRA 5JSRA 2H8RA 4R9CA 2OT7A 5KWRA 1MZEA 5FZ3A 3OQMA 2L8NA 4UW5A 3THDA 3LFPA 1RUI3 4JKLA 2EAAA 1R083 4PLNA 4PIZA 1N3PA 4D8MA 4UW6A 2WIUB 1WCQA 4HVQA 1LNSA 2VGDA 4FPEA 1VAMA 3EHKA 5DMYA 3ACGA 1MS9A 5DZFA 4DOUA 3N7MA 2QJVA 4META 2WFF3 2G4IA 3LEGA 1UTXA 2VXRA 1TMF3 4WM7C 3H5TA 1IG0A 3WF0A 1HQNA 1UY1A 2EIEA 4XXPA 5KHJA 5FYTA 4DB5A 5CKNA 2VOTA 3OPZA 5FZ4A 4CCLA 5J09A 1MZ6A 3AP4A 3NAPC 3QD6A 2DWRA 4QQ2A 2LRPA 4JTOA 4AVSA 1KS5A 2OYZA 5LA0A 3B7HA 3KL4A 5JXIA 3GJBA 3GZAA 4XYXA 4UW4A 1ULEA 5FO8B 1N1VA 3FMGA 4EJRA 2BGCA 2XJUA 4NN0A 4JZRA 4J25A 4HK9A 1HRI1 4COZA 4B1LA 2QQOA 1UU5A 4WM7B 4DMIA 4CEYC 2WNVA 2R071 4HPKA 2CNAA 4WVLA 1BKZA 2XMLA 3JB8A 3N9NA 4NIAA 3ETPA 1WUVA 3POGA 4YG7B 1MVEA 4XFGA 2Z69A 4YSFA 3D6EA 2WC2A 1LCDA 1RUI1 2GZUA 3NAPB 2GH2A 4Z2AA 4A3XA 1ND3C 3JXBC 1OT5A 2IC1A 4MGQA 4XDOA 3MIHA 3ALQA 5CG8A 5FPXA 4R9BA 1WD3A 2IVBA 1AR93 3MPBA 2XJPA 4JHZA 1TMF1 1VBA1 2Z2SB 5BPXA 1SPPA 2EAKA 2GH8A 5FZAA 4CEYB 2WFPA 4XBQA 1A6CA 5KBFA 4YW5A 4Q4Y1 3QLQA 1RXFA 4JKKA 2KD7A 1OQEA 4V2VA 3ZXFA 1A8MA 1BHGA 3DYMA 4FOYA 3ZYHA 3B69A 1YC61 1BBT3 2Y8KA 4LLFA 4CEWC 5L9VA 1GNYA 2AR6A 2HWB2 2VOVA 4UOJA 4GMP1 5A7WA 3RYPA 2WIIB 3WG1A 2DU0A 2DV9A 3TRBA 1OFSA 4YM2A 2J1TA 3VD3A 2PXVA 4ER0A 4NHXA 2YMZA 2XVGA 4YW3A 3I49A 3H1YA 3FWEA 3UGHA 1BK1A 4MXWA 5IYYA 3V0AA 1GYKA 1VBD3 1OCTC 1RUJ3 2JJ6A 3TWIA 1OD3A 1TME3 5L73A 2ENRA 3H7JA 2R1JL 1BEV2 2XJVA 3AYDA 4QAWA 2WFF2 5I0RA 3AK0A 1LQCA 1PERL 5I8SA 2VR4A 2UY8A 3HT2A 4AQSA 1BMV1 5T3NA 4CEWB 1PX4A 4XBNA 1F4AA 1CJPA 3VHNA 1AUYA 1W6NA 1WLCA 2P3IA 4LNVA 1IQAA 4Q5OA 3PURA 4ORFA 2NMOA 2Y60A 2WO3A 1QJY1 1VPWA 2VY0A 4MH0E 4B4RA 3WNLA 3VDBA 5A7PA 4IQPA 2MEV1 1S2KA 4L92A 1UOBA 1K5MC 3LA7A 2ZAAA 4BK4A 1Y43B 4OHZA 3DM5A 1KXGA 2WSUA 3HT1A 4ZU7A 4E8CA 4NIGA 3RG0A 1XYOA 4TWTA 4KWKA 1IS6A 1QKQA 3N9OA 4JGZA 3WG3A 3R4SA 1XOYA 4ZS3A 5HCAA 1JZ7A 3T09A 5H9SA 2ERFA 4HKWA 5FY1A 1OLQA 2BJCA 1BBT1 3POIA 1FV3A 3OMTA 1UMHA 4HT1T 2WNVB 3P5BA 3QH7A 1VAKA 4O65A 4HPKB 3PIJA 4RHV1 5K4LA 4BJ0A 1O5UA 2ADDA 4QDQA 5EJ3A 5GZEA 1AJOA 1S7EA 1REDA 1Z7S3 3BCWA 2O8OA 3KT7A 3OF1A 4NRMA 1OQ1A 3IAQA 1YHFA 5JXHA 5KXEA 3VBFC 1UU4A 1K5MB 2JX9A 3MW4A 3NNFA 1JZ3A 1VBD1 1VBC3 3AYCA 3O0XA 2AUWA 2E7AA 2HBTA 5AC91 2ZX0A 2XJSA 2RS53 3H9AA 4Q4V3 1J3PA 2PAKA 1AR92 2YG0A 4MGZE 1DZQA 5FPBA 4CCOA 4B7EA 1OPOA 4H3WA 2WO1A 4Z07A 1HXS2 1A3KA 4NR1A 2PXPA 1LLIA 1SPPB 1XNBA 2NM1A 3HJRA 5IK5A 4XJAA 3VBHA 4AZZA 4DIQA 4AI3A 4LLOA 3VBOC 3H3ZA 4K7JA 2VMDA 1W2OA 3A4UA 4XAAA 2ZOEB 4O9GA 5DTRA 4CDWB 4YW6A 4CZSA 1GFF2 2PUBA 3VBFB 4EYUA 5C5UA 3GN5A 2QZ2A 5A7WB 3RPQA 3MI8A 3CIHA 3HN3A 5JAXA 5BUVA 3H8XA 3ZPXA 4XIKA 1GBGA 4M4PA 3IVPA 1ACCA 1SHWB 4FQZA 4Q4W2 4WVVA 4ZU5A 3WQ7A 3QH6A 4UFHA 4ZU4A 4AQ6A 4E9KA 1S0FA 1RUJ2 2EXHA 2F6BA 4Q26A 1XE0A 4WVZA 1LTEA 5K98B 2KEJA 4N8MA 3MEJA 3VKLA 4MXWB 3CECA 2BNOA 1AL0G 1RYYA 1VRH2 4ZONA 1IQDC 1RUC2 1AYM1 1XNAA 2WS91 3H3LA 4I01A 2DCYA 3RMYA 3TB0A 3SCFA 3A21A 1ULGA 4GB32 1ZRIA 2GC1A 4HXCA 5EYYA 3H1WA 3IWZA 1DGRN 1POV3 3L2YA 3CEWA 3NVCA 2FDFA 5JLVA 4XW3A 4NIHA 2RE9A 1AR82 1J58A 2HLEA 2HYKA 3LDKA 5FP3A 1H8VA 3LSEA 4Q4V1 3OD4A 1J3RA 4QX0A 4YBAA 4FPLA 4YW2A 5FY7A 1AR72 3O14A 3ZFEA 1GZWA 3BPZA 2V4VA 1Y4WA 3BOWA 5FKBA 3ZYGA 3RMXA 5ISLA 4LBQD 1E57A 1WW6A 4Q2JA 2PUEA 2B39A 4IEZA 1PRAA 4GQ7A 2EIBA 3H3UA 5FAXA 5DDJ3 3BALA 1KDMA 3C7GA 2R7EB 1N3QA 5J3UA 2XBO3 2JIJA 1NY71 1WW4A 3M70A 3ORJA 1PM7A 2RMU1 3KGZA 1FI2A 2CGOA 5JR7B 1U0AA 4RR3A 4NMIA 1WCKA 5EZWA 2ZEXA 3NJXA 1EPZA 3VKOA 3WXPA 3RYKA 1NUKA 1VB2A 1EPWA 1REEA 3BN6A 4IEQA 5C70A 1L3JA 3FN9A 3FFZA 4N53A 2CROA 2RV9A 3VB9A 2AC1A 2VZOA 3FZ3A 2CV6A 4HSLA 4N90A 2Q1MA 1NLSA 3QCWA 2AZ5A 4WV8A 5G04L 1IS5A 1OVPA 1FATA 1VE0A 4LBLA 4QD2A 5DQ0A 3VL8A 4CCEA 2R043 4K6BA 2PHTA 2WA3A 2OA2A 3KHBA 4K20A 4XJ8A 1O3SA 3RZMA 3CO2A 1AF9A 1IC8A 4MHRA 2WABA 1POV1 1MS5A 4G3YC 1W2AX 4KU8A 4LQRA 1EY2A 4QQPA 1QQBA 4CU7A 5SV5A 4CUCA 2O8QA 3ZYFA 3N4MA 4I6RA 4PDWA 3OY8A 1EV13 4YWAA 5LA9A 2LYLA 5FZ1A 4R9AA 1RUH3 1DZTA 4CCKA 1OXCA 3QWGA 5C8CA 4I0WB 2ET7A 3FUQA 3OUJA 5A6QA 3GN5B 4CDQA 4W4ZA 2VW1A 2JDUA 2HWE1 2E53A 3FYAA 1OUSA 3NV3A 2LYQA 4CP1A 1BQPA 4LKEA 3MHZA 4QHBA 5BY5A 3B00A 2R062 3POYA 4LBNA 2D44A 2QDRA 2XBO1 4OHWA 1SBDA 2FZ2A 2HH9A 1VIWB 1YEWA 3X29B 4JCXA 4RS5A 1W6QB 3CHXA 2HWD3 3OYWA 4N7UA 1F4HA 1NXD1 5LRSA 1GT0C 1NA1A 1AXKA 4YM1A 1GKBA 1D7PM 1COV3 3OB8A 1ZUGA 5BV6A 2AGSA 3U75A 1MS4A 1Y7BA 3FC0A 2ICTA 2ATFA 5ERLA 1O4ZA 1OC1A 3AKQA 3ZR5A 1AXYA 3WV6A 1ZRRA 4DFSA 1C8M1 2JENA 5H9QA 1MEC3 1UF2C 4QPGA 3ATGA 2W87A 3DF0A 1AR62 1FPN1 3GZDA 3TFLA 1JYIA 4OUSA 5FO7B 3OWQA 1YJKA 3H1MA 3VD5A 1KRIA 1SBFA 3B3QE 5DDJ2 4A42A 4BISA 4LA2A 5ACA3 3O5SA 2OFYA 1S2BA 1ZBE3 2B42B 3AZYA 2XQRA 4I2OA 1EV11 3ZSMA 1LJ7A 3ZX7A 1W9YA 3I3BA 4Q0VA 1S0BA 4L97A 2WINB 4LE3A 2R30A 2E6VA 1UXDA 4EN8B 5J36A 5EPAA 3G5GA 4BIFA 3IPVB 5HXMA 2IXJA 3TN93 3BTZA 1YFXA 3CJIC 4QKFA 4IE6A 4S2FA 2ZGQA 4P5YA 4P5HA 2ZX3A 1NT0A 4YARA 1FYUA 1HRV1 1ND2A 1TEIA 4RGKA 4CCCA 3LQCA 3ELNA 1GOFA 5F6LB 1EUTA 4KMQA 1JHJA 1JUHA 2WQ4A 1J84A 1QWRA 1RL3A 1W2TA 2P3JA 3IM0A 4Y5TA 4XF1A 3WY6A 3I2GA 4P14A 3UGFA 3VBUC 2D40A 1IS3A 4A4AA 3VK0A 3OQNA 4QQHA 2KM2A 4WVWA 4IEYA 5CKQA 4FPCA 3VDDC 1SCRA 3QYXA 5L9BA 4F3JA 3ZPYA 2SBAA 3DECA 4NAOA 1LU1A 3SCGA 4CSWA 1MS1A 2D6KA 2RM23 3CJIB 4PDWB 2QQWA 3CMGA 3OY8B 2B8MA 4IEXA 1XPWA 5A3LA 2XR4A 4QWNA 2CGPA 3PUIA 3AMMA 1WBLA 1OVSA 1CONA 1O4YA 3DCQA 1YSEA 1EAH3 3M4FA 3K3NA 4Q4X2 2J1AA 4LKSA 4NUBA 3OUHA 4BK5A 4XQDA 3B94A 5ACA1 2ODRD 1MPXA 1ZBE1 1XU2A 1X50A 2VOKA 2PLV1 1ENQA 1PK6A 1PNGA 2DBIA 4JDMA 4SBVA 3VBUB 3E1F1 3C7HA 3ZN5A 1H9WA 3GZDC 3KZ3A 2OUHA 3PDQA 4IERA 3V65A 3VDDB 4ER5A 1QJU3 2F17A 1PZ7A 4Y20B 1J1TA 1UYZA 4PQQA 5F5CA 3ZDVA 1W6OB 1WMEA 3TN91 2WZR3 3VZKA 3U0ZA 1COV2 1ADRA 4HANA 3EB7A 1R1A3 2G9GA 2RS33 2OKXA 3NV2A 1SLBA 4KU7A 1PZ9A 5GALA 3RZLA 4TLGA 2QBXA 1MEC2 1WA6X 5K0UC 4LIVA 1A8DA 2FDHA 1PO22 1EUUA 3R4DB 3TRSB 3GZEA 3LSDA 3UYJA 4DXTA 2A5ZA 5A33B 3I2FA 1SFYA 3J26N 2XWJB 4LITA 1QP4A 1ND2C 3GZTB 3ROUA 1CAUA 4IETA 1FOD3 3W59A 2XVKA 5JMCA 5C71A 3LQXA 4IE5A 1SG3A 4AI2A 1LGNA 1QXJA 1R1ZA 2LTNA 3G6JB 4JQTA 1ZAYA 1HQ1A 5FYUA 3NROA 4AL9A 3BUCA 3QOPA 4LK6A 5A3OA 4RQPA 2LYJA 4BQ1A 1QF3A 1X33A 2ETEA 4SLIA 5FZ9A 1CAXB 3IMNA 3WHUA 3UNPA 3A0NA 2Y64A 4YM3A 1LCCA 5K0UB 2VVDA 4XMIA 2C9AA 2X10A 3KSCA 1GSLA 2E63A 1WWYA 3RSJA 1W28A 5KR7A 3W20A 1ND2B 1TNRA 4O8BA 1QY4A 1QJU1 2YHJA 5CIRA 1YNAA 4Z82A 4QHZA 2BV4A 1ULPA 4OBMA 1BYHA 3KM5A 4LKDA 1DQ1A 1GP5A 1GOGA 2DFBA 3ZKCA 1YO8A 4XEZA 4YGBA 3ZSKA 1PK6C 1WLDA 2BDRA 3MLJA 1ULDA 3FLRA 2VBDA 1V0AA 3WT3A 5T5OA 2ZGNA 2ZZQA 1W8NA 1QOSA 1DYOA 2RDQA 4YZ3A 1PIV3 1RUE3 1JU3A 2JG8A 2ZMNA 4WZFA 4D7YA 1DHKB 3ME2A 4UI9L 2PUAA 4FPFA 4P9JA 1US3A 1OOPC 3PMSA 4GKXA 2E32A 4CVUA 2IXCA 1W2NA 3NKGA 5IAXA 2BOJA 2VECA 3Q9OA 3AVSA 4QX3A 1FOD1 5HPOA 4EWEA 1ZZ9A 3N9QA 3B01A 5E88A 1OUXA 3ME5A 1UCXA 1PK6B 1RVF3 2A71A 3LZZA 1LHUA 1C1FA 5T54A 4EKGA 3IDBB 3O12A 1X8EA 5FREA 3MF6A 2JDAA 4XCAA 3JXCL 2HFZA 4ER3A 4X4FA 2GU9A 4RQPC 2VMIA 4CPBA 3AP5A 1OOPB 2WSVA 3HWJA 4E2GA 1YQCA 3N7KA 4Y33A 3ILFA 1J59A 4HVRA 1UXXX 4IUGA 2WT2A 2NPIA 1IKQA 5JVVA 3RVHA 1OA3A 1VBB1 4KG0A 1GQHA 1UAIA 3ACIA 3WEZA 3AVRA 4HSJA 1CPMA 1D0GA 2EIGA 1WH8A 3CNAA 4W8JA 4AFDA 1K5JA 5E8AA 5HV0A 4P9IA 1CAUB 3SMHA 4UAPA 3PXPA 1QB2A 1JW6A 2PHDA 2VE1A 2VTXA 1W3XA 4AI1A 5FWJA 2UWBA 3D1NI 2V4AA 2D5VA 4B4PA 1BCXA 4JKMA 2VUAA 4RQPB 2XXPA 4YVSC 5GZDA 2ZABA 1NERA 3AMHA 3GZUC 4D6SA 2P34A 5E16A 1DW9A 5FZMA 5A7SA 2DVBA 2JG8C 3F51A 2JDYA 2PQQA 2QQLA 2X5IA 2VAUA 2ZBJA 3R09A 5JMOA 1HW5A 4AVCA 1BVP1 4LTAA 3WVJA 5GZCA 4QU1A 2YYOA 1Q8VA 3ZO0B 2AENA 3J7LA 5FLHA 1RZRA 3CZUA 3V0BA 4HRAA 5F32A 2YPJA 2BYVE 3ZYPA 2VZ3A 3IDAA 4PIXA 2JIGA 1UOJA 2ILMA 3CU7A 3USUA 3HR9A 2BVBA 1AL23 2RR11 3SITA 3C3VA 2ZHKA 1CN1A 1DQ5A 4HBNA 4UXAA 4YVSB 3IB3A 3KJXA 1S55A 1QMJA 3ZXEA 2Z79A 4AEDA 4YG3A 2AH2A 1RUE2 1F8VA 3VZMA 1TNFA 4A3ZA 3QACA 3L2HA 4NVPA 2VMCA 1OA2A 2JG8B 5F3IA 4BLIA 1ZPQA 2ET1A 2QTWB 3B9CA 4XXAA 2Z4FA 3PTRB 5L7OA 1JWLA 2VNOA 5FP8A 3AMPA 5HCBA 1WMXA 3CZJA 3AZZA 4NAMA 2E9QA 4TXWA 1CWPA 2VUDA 3U1XA 3ZSLA 2WAAA 2HKXA 1GR3A 4HN1A 2XQXA 1NCQC 2BERA 4JHTA 3DPRC 2Q8DA 2GP3A 3PVNA 2WZPP 3TAYA 4A2UA 1M4WA 5DAPA 1DIWA 5FPLA 1PRVA 4X8NA 1SLAA 3SH3A 4Y4YA 4N7IA 4OMCA 3RWNA 2WL1A 4CP2A 4FBFA 5EXOA 1L1MA 2XPJA 4BQ4A 3MW2A 1G8WA 1JYWA 1RITA 3S5QA 4K8FA 3UL2A 3W5MA 3JU9A 5DN2A 1ALYA 2XLGA 3VHOA 4X6QB 2RS11 4DZGA 1QP0A 1C28A 1UU6A 1R69A 4Z8BA 4W6WA 2XIUA 4BPZA 3ZXJA 2ZHNA 2XCJA 2X5IC 3KVBA 2RVAA 1SBEA 3WG4A 3DPRB 3Q8EA 2DTWA 1AX0A 1RUG3 2YBPA 4EN9B 3CQOA 4U36A 3EMRA 2JQEA 5FFOC 3TEXA 2EXIA 4NJ4A 2ZTNA 1V9U3 4HKLA 3KV6A 4AR2A 4U2AA 1PZ8A 4NRQA 3UESA 5FV3A 2NN8A 4ATEA 2MXDA 1XNKA 1UZWA 1VR3A 3LE0A 4PF1A 4WM7A 4OZOA 4PHZA 3RDIA 5CBLA 3U4XA 2P5BA 3MO4A 4OI0A 5DUVA 1CAVA 4AEDC 4AW7A 1PVC2 3PLQA 4QQLA 1RUD1 1QQAA 2VL4A 2A75A 3DXUA 2WWSA 2EICA 1AYN3 2Y6HA 4FP2A 2A7AA 3RS6A 3WW3A 2X5IB 4AHZA 2HBUA 1YUDA 1J3QA 1ZBA1 4YFZA 1HQWA 2AEYA 4EQZA 4FFHA 5L7OC 3CLCA 2J42A 2WDBA 4OCTA 5A3NA 4JX0A 3KMHA 3G7DA 1VAVA 2ZMLA 3NO8A 1QU0A 1HB2A 2MHFA 5F3EA 5C3OA 4XDQA 5F5AA 2WWJA 2YB7A 3NRUA 5CFDC 4ISQA 3HAGA 1ZS4A 4XJZA 4OVEA 4QQOA 5E1RA 2XL9A 2IUWA 1DQ4A 2K9ZA 3O1TA 1PGL1 4AAPA 4D7SA 1K45A 1VLNA 5A7QA 1UO9A 1POV0 2B5HA 2VC9A 4AEDB 4CU8A 3AYEA 3OBRA 1HRI3 1UQXA 4QM9A 1PX3A 4XZPA 3A9ZA 1XSQA 2R16A 1ND3A 2O1QA 2R073 4XACA 4ASMB 4YZ5A 5L7OB 3VUOA 1DDLA 2OXBA 2OVUA 1U12A 2YV8A 1D2SA 4X4HA 1RJ7A 1V9U1 2EWTA 3HBKA 4NPMA 4P9YA 1UX7A 2VTFA 4IDZA 4JQRA 2ZGRA 3DN7A 4UFMA 5JI7A 2XKOA 2DF7A 1UXZA 1K12A 3GCXA 3LEMA 3R05A 4NIIA 3POJA 4FSJA 4LBKA 4IA8A 2Q4SA 1NYWA 2D6LX 1H0BA 1SZBA 1S0DA 3SX0A 2GC0A 1AYN1 4YG4A 1QOOA 3ASIA 4R4ZA 4P08A 3VHPA 4AVAA 4XFBA 4CEWA 4EN7B 5A6XA 1VBA3 1T6BX 5FJHA 4AK3A 4QPYA 2GNTA 4MUVA 1M06G 4LO4B 4Q4Y3 3WZ1A 4XF0A 3MIDA 4ATFA 4CP9A 4CYDA 3I3MA 2YFZA 2WAOA 3JXSA 2W39A 4I09A 4YW7A 1GWKA 2XWBB 3PNAA 4BMEA 2XHKA 5C4WC 3AB0A 3VD9A 3WHTA 2FMYA 4RYDA 2C0ZA 2PHFA 5EHDA 3WDUA 2W92A 4GMP3 2VULA 3DNVB 2GN3A 4A7KA 3G0TA 4QDRA 4AE2A 4Y24A 2EIDA 2VW2A 3MPPG 5CAZA 5FPUA 1EP0A 2J1SA 2RJLA 1KFXL 3I7DA 4ZZ8A 1GANA 1O4TA 4BXSV 4EN6B 2JDMA 3WW2A 1LGCA 1CJGA 5FYMA 5JIAA 5HCHA 1OF4A 4Y22B 1ASJ3 3R0RA 2HINA 2VNRA 4A44A 4DE8A 4CP0A 1ZZ7A 1CAVB 5JZGC 3CL1A 3FBYA 1GZCA 2I2SA 2VQTA 3P3NA 4IV1A 1YFWA 1E3OC 1XBFA 5C4WB 1K5MA 4DXSA 4GZ9A 4XBLA 3WG2A 3BIWE 1PNRA 1Q5OA 5FYVA 2QUOA 1BZWA 3WQBA 5CKMA 1RHI3 3DUIA 1FNZA 5KXBA 3ILNA 1MZFA 1E5IA 3C7EA 1FXZA 1QJY3 5FTTC 1DQ0A 3IDCB 4CA9A 2MEV3 2VD7A 2ZZJA 1W8ZA 2W1QA 3RGBA 5A70A 3RNSA 3O1UA 1S4CA 3J8F2 3OD0A 2CGNA 2DYCA 4GULA 3ZXAC 4EWAA 5FDBA 3WF1A 1DP0A 1OBNA 4EZHA 5L36A 4QX7A 3GDBA 5LASA 1W6MA 5JZGB 1G86A 1UW8A 5FXZA 3WNOA 4CDWA 5FQ0B 3R1FA 5LW9A 1WBFA 3BB6A 4V2WA 2PUDA 3VBFA 4TSVA 3I2HA 3TEWA 4BMBA 4NHMA 3AKTA 4GALA 2HEVF 4B29A 2ZEYA 1PMIA 1DGLA 1ND3B 4FVVA 3AL6A 2R6QA 4NO4A 4RHV3 2X05A 3T2PA 2JDHA 4MGSA 1ZREA 4XQ4A 3D4KA 5GLZA 1RUI2 2FCTA 1D4VB 2VOXA 3GNEA 1R082 1CX4A 2DVFA 2WWUA 2P3KA 4XFCA 3URFA 5BNNC 2XVLA 2XH6A 5I8TA 4KGGA 1FX5A 4LE4A 3HNMA 3MUZ1 3J7MA 3BTYA 1ASJ1 3CBNA 5LB6A 1JUIA 1FAYA 2B9UA 3LEKA 3FLPA 3OCPA 3R6SA 4CCDA 4F7ZA 3VBOA 4AFMA 1UMZA 4M0NA 1TMF2 1ST8A 1Y7YA 3MFAA 3ETQA 4I0AA 2M4HA 5FZ8A 1UYXA 3DKQA 3FL7A 4TLFA 3VV1A 3DEMA 1UKGA 5JSPA 1RHI1 4X8PA 2WO2A 3KQRA 2HWF1 2Y6LA 3JD71 3NV4A 3BS3A 3EO6A 3PUAA 1NZCA 4CP9B 4DEQA 4IV1C 2EF6A 3S5AA 1W99A 4NIDA 5FO9B 2P17A 5C3RA 5BNNB 4OHYA 5FOJB 3AKSA 1C57A 1V6KA 4CU6A 1XB9A 4PU3C 4M01A 2LNMA 4QDSA 5CB7A 4FAHA 4LORA 4NE9A 4I6TA 1PMHX 3PJYA 1HV0A 3RFRA 2CTVA 3TBDA 5D1IA 2RJ2A 2PE5A 4LO5B 4UT5A 2XLFA 4Q8KA 3ACFA 2W91A 5TSWA 2W3JA 5A3TA 5F2SA 1HJFA 5F5QA 2CSGA 3LPFA 5A80A 4BE3A 4AYUA 1AYM3 5C9AC 2WS93 4Y1VA 2CAVA 2OPWA 5J96B 4IV1B 3PUQA 3WR0A 3WD5A 1Q43A 2ZGUA 5FYBA 2ZGOA 1OKQA 3WF3A 1HXS1 5FP4A 3KT4A 4MZUA 3S57A 2A6XA 3WNPA 5FIXA 4PI2A 5FR3A 5DAVA 3S7IA 4IGPA 2JVLA 1HX6A 5LEKA 2VW0A 1C5IA 5CG9A 3HN1A 5M0TA 4Q1RA 4FPGA 1HB4A 1I1EA 2PMWB 3O1OA 1LODA 1NAEA 5A7NA 4AAXA 2ARAA 5GZFA 3A22A 1N1TA 1GUIA 5H9RA 2DCJA 3THPA 1W6MB 4X4GA 2A6WA 5FRAA 1BBT2 3D8CA 5F9TA 3BKZA 3ST7A 1QPZA 2ZGSA 3FUOA 4Q4W1 1TZOA 2B9VA 4XIOA 2W0XA 3NW4A 2RMU3 5FZOB 4JGYA 3PU8A 1HB1A 5I0DA 1VRH1 1QZXA 1RUC1 1TG7A 2W5FA 3KV4A 4QX8A 4AF9A 5C6CA 3LFMA 2FDKA 1SDWA 2W47A 4BHPA 3KCYA 1VBD2 3PVOA 1TME2 1W0OA 2WT0A 2D6NA 3MIBA 5DAXA 4XVHA 4GAZA 1W6QA 4INDA 1O8PA 4CE8A 3VBOB 4TN7A 5FYYA 1RIOA 5A32B 4N9HA 5LZ6A 1OH3A 1V6NA 3M3OA 5EP9A 1URXA 1DWKA 1G7YA 3MEPA 2OUJA 2L49A 2VCCA 3N36A 4L11A 5JWPA 3J9SA 4S2HA 2BNNA 3ZFGC 1W39A 2PXTA 3E6DA 1QJEA 4X4CA 1HLCA 1RMU1 2WYSA 2XJRA 3MIFA 3ZPOA 5JPNB 1YQ5A 2Y38A 3VHRA 4AOCA 1O3RA 4AGGA 3AJZA 2VMHA 2B7YA 3A9XA 1W0NA 4H14A 3NL1A 2HWE3 4NHLA 2TUNA 1ZA7A 4PBOA 3T4HB 3T3YA 3OBTA 3B9IA 2VNGA 2JDNA 4RGGA 4GJYA 2DVAA 1VMJA 2QZ3A 2WUHA 2EF8A 4QHOA 5EV7A 4C0HA 5LBBA 5L19A 1ZRDA 1AYM2 5JOYA 1CVNA 1ZZ6A 2JICA 3V64A 3IPVA 4E4ZA 1JZ6A 1HN0A 2VMEA 2XLAA 3ES1A 3KCXA 1Z7S2 4W6YA 3T08A 3W21A 4E2SA 4RFRB 3ZFGB 2VZRA 4URAA 1JYNA 4YPJA 2WQ8A 5DG1A 2BNMA 1C1LA 1VBC2 1NE6A 2B4KA 3M3IA 3BU0A 4MYEA 4F8AA 4BIOA 4XUPA 2RS52 2UY9A 4JGYC 4Q4V2 1H1IA 1C8M3 1UX6A 3HOBA 3U37A 4A7ZA 3B02A 2A3XA 4AEJA 3FFQA 5FXVA 5H9PA 3O1RA 1LOFC 1KD7A 1FPN3 2WA4A 4QX5A 4Z59A 1NEQA 3I97A 1SEFA 2VZVA 4GIQA 4RGAA 3RYRA 1IG3A 4R8HA 3WP3A 5KHKA 2VZSA 1QJFA 2LCVA 1X57A 4LO7A 2GNMA 1V6OA 3CJIA 5IWFA 4LBMA 1W9SA 4IEPA 2CWSA 3ZXGA 4LR4A 1SQ8A 2WR9A 2R061 3LGRA 4K21A 4IGOA 2V5YA 3ZHMA 1GOHA 1LOCA 4XTMA 5IVEA 4KNCA 4P00B 3LWCA 1UL9A 1H2MA 4JGYB 1PGSA 1REFA 2PTMA 4AGVA 3KS7A 1E5SA 4GA9A 3VBUA 3F95A 4PU8A 1W9WA 1PRUA 1XC6A 3NWKA 4CDUC 4QX2A 5SV8A 4AHWA 1HRV3 2WN3A 5ANNA 3VDDA 1KS4A 5HI0A 4Y20A 1P8JA 2WUSR 3BI3A 2D43A 1YQ2A 2XOMA 1W6OA 4B4QA 1RUNA 2SLIA 3WF2A 1L7QA 1DU3D 3NJVA 5FUNA 2D6OX 5K9YA 4OFGA 1IOAA 3HNYM 1OA4A 1QJX3 5FBZA 2ZHMA 5FZEA 2GMMA 1I9RA 4LHSA 2ZS6B 2DCZA 2XJ3A 2OIIA 1L7LA 1F31A 2ZEWA 2AEZA 1G9DA 3O0VA 4KL1A 3V56A 5A33A 2XSDC 1HV1A 3C2UA 1WMDA 1BVVA 4LBQA 1RTVA 4P9LA 4XUOA 3OOXA 4X4BA 3SKVA 2Y33A 1YQ6A 2J7WA 2OW4A 1H2LA 4CDUB 3J7NA 5AC93 1UXCA 2VXJA 2XB6C 5IVYA 2RDRA 4HN0A 4DXRA 3EXUA 4XE9A 3J4UH 3LKJA 5KHIA 4QGNA 2GC3A 1W8HA 3RI8A 1GWLA 4DXZA 4X4EA 2PLV3 2XBO2 4QB2A 5CA6A 1O8SA 2HWC3 4IV3C 1CAXA 3UWPA 1SDDB 3JB4C 2C6SA 2BUKA 3VBRC 2X53S 5K0UA 1O6UA 1O4XA 3M3EA 2ICPA 3DV8A 5A1LA 1SACA 1EYBA 3FX3A 3HVDA 4JDOA 1YLLA 2O0OA 2JB4A 4IE7A 1UPSA 2RG4A 2A70A 2JD9A 2RHPA 1D0HA 5GZGA 3LISA 1FV2A 1W8WA 2J7MA 2R042 1AU7A 3ZDSA 1FPN2 2HJIA 3H42B 5DXDA 1KDKA 1YIPA 3LDRA 1QJX1 5I8YA 2MQKA 4XFFA 3N9MA 5A3MA 4IV3B 1UZVA 2LYKA 4YRDA 5CADA 4C90A 4ZZ5A 4PBPA 2Q1FA 1F15A 1YRZA 3ECQA 4Q4X1 4XZUG 2PXKA 3QOWA 1EV12 2LS6A 1U5YA 4FBIA 3I3QA 5FY5A 5KC6A 2A6CA 1I6XA 1K3IA 1RUH2 1SLIA 2CL2A 2R1DA 3AM2A 5HV4A 1W06A 1FMD3 4UFKA 5DUUA 1C4RA 2GAUA 4CUAA 2I45A 3WP6A 5I93A 1GWMA 2DURA 5DRYA 1GICA 2ZGPA 3GYDA 3VD4A 1WW5A 5BYNA 3P1IA 4CTEA 3L9JT 3SISA 2HWC1 2C9KA 3K3OA 1BDIA 3ZIXA 2ORZA 3THCA 1JYVA 5FYIA 1RC6A 2GP5A 1ZM1A 4AGRA 1NCRA 2HWD2 4E4HA 1H8TC 3A23A 3TELA 1RUF3 2GMPA 3FBMA 3IBMA 4RSUA 5FYHA 5IW0A 4MG2A 4XABA 5J7MA 1PO21 1CR7A 4XFHA 3VN4A 3ZKUA 2Q8OA 1OOPA 1VMFA 3NSTA 4C91A 3PJQA 2PUCA 2YU1A 1S2EA 2YY1A 4HFSA 3ZHIA 4LO6B 4LMFA 1QXRA 4GWMA 3MZHA 4ZS2A 5GKAC 4H7LA 3AZVA 1APNA 1S0CA 4LBQB 3ZFFC 3OSDA 4I30A 1R093 2QCSB 1CZVA 2JE9A 2XHNA 3OP9A 3ILRA 4ITCA 1X82A 3AFGA 4R52A 4DUVA 5JXGA 3ACHA 2WN2A 3AXEA 3LA2A 4OZXA 4Q0PA 5ACA2 1ZBE2 2KZ8A 3TOJA 3O1SA 2BPA2 4J6GA 5HCFA 4BM8A 3MLKA 3AKRA 3HNBM 1CQ9A 1WCSA 3KZ4C 4FPHA 1SFPA 4PIYA 4YZ4A 2XXAA 3ZMOA 1JOBA 1FMD1 3TN92 1QQP1 4QKDA 5FZ0A 4HL0A 3OBZA 2ZGTA 1SQ4A 4UYBA 1HIXA 4FAGA 3BODA 3ZFFB 2JKBA 5A7LA 1CIYA 3NZLA 3LAGA 2BBVA 4FOWA 3CROL 2XL7A 1BDHA 2H0BA 5JCTA 4D3WA 2Q0AA 1GMMA 2YBSA 1RUF1 1VBB3 1WH6A 1OLRA 4NRPA 1YWKA 1VBE3 5FYSA 4XJWA 4YVSA 2ZKNA 2LROA 1X9TA 2D3PA 1NX9A 3VZOA 4YNIA 2HEWF 2VEOA 2YGLA 1LHWA 3KB5A 1NCRC 4P9XA 4IL7A 2RM22 2A6ZA 1KEXA 4FFIA 3U07A 3RWKX 4ZHNA 4FTBA 1DG6A 4ARXA 4GH4C 4COUA 4KG8A 5LEJA 3U14A 1LECA 3NQHA 1QNWA 4URTA 5FY4A 3OEAA 1QP7A 4YFWA 2MNGA 1R091 4RD7A 1EAH2 5FJKA 3MW3A 3GBFA 2AXZA 2PXLA 3GBWA 5FP9A 4GMP0 2A6VA 2PHWA 4LHKA 4XTPA 3E5XA 2PHLA 2K2SA 3BVCA 4MCXA 4OHVA 3PUSA 2OZJA 1JFTA 4PU7A 2H6CA 4OUMA 5FZIA 2PIJA 2YBKA 1QJU2 1I5PA 5GM0A 5D2AA 1AX2A 2DCKA 4L8QA 1NCRB 2WZR2 1TVGA 2JWPA 3ON7A 5FZHA 3H50A 4COWA 4IEUA 2XG3A 2RR13 1R1A2 2VCBA 2RS32 4GH4B 4R9DA 3WDXA 2FCUA 2ZEZA 2UURA 2Z5WA 5CU1A 3RQ0A 3WQ1A 4KBBA 4Y1ZA 4FFFA 5IK8A 5BXXA 2C26A 4I3GA 3VZLA 3K51A 3AC0A 4DUXA 3DKWA 3D0JA 4AHYA 2ARCA 3APBA 5FK8A 4KGQA 4OUEA 3U11A 3UJQA 2QQVA 1NCQA 1LHOA 1VBE1 2B46X 3DPRA 4AQ2A 4ZPIA 4DPNA 3W5NA 2JDZA 2VOWA 4N9IA 2ZMKA 3A7QA 3ZYRA 5AFBA 1FOD2 3IT8A 1H6XA 4M3CA 3K4AA 2HSGA 5A3UA 1AVBA 4B7KA 2BFUS 4UFLA 5EQUA 3THTA 1NXMA 4MVTA 4A6SA 4IVZA 4MSVA 1RGSA 1YI9A 1H30A 1UOFA 2BZDA 3K4ZA 1MZ5A 4YM0A 5FMCA 3WUCA 4Z92B 1KQRA 1KGYA 1WIZA 4YGDA 2R0HA 3KD4A 3ZYBA 4C8DA 1ONAA 1C3HA 2OQ7A 1OLMA 2W9XA 2QQUA 3N9PA 1MS3A 3ABZA 3IIIA 4RN5A 3O1VA 1W03A 2XDVA 2MPFA 5FLIA 2IUOA 1W9TA 2VMFA 3D3AA 2RS13 3LA3A 1Q3EA 3WDTA 1IPJA 1VBB2 1XE7A 2GDFA 3NNJA 2AW6A 2KR2A 3O0WA 2JD4A 4AEMA 4YG6A 1CIWA 3INAA 4GHJA 3ES4A 2PYTA 3VZJA 3MBWA 2R1BA 3U3WA 1PO11 3S0MA 4GWJA 4XJUA 3TNPB 3SHRA 1PIV2 4OYUA 2VCAA 1D4M1 4PJYA 3Q8CA 3N7LA 1OQDA 4ASLA 4LUMA 1JS9A 2VBPA 3H7YA 3ZXLA 3MLFA 1NW3A 2HCSA 1W8FA 4LPLA 3SXWA 3JQXA 1WMFA 4Y42A 3NKTA 1ZX5A 1VRBA 4DEVA 4LEJA 4I0BA 5F6KA 5EJZB 1RUD3 1ZNPA 1S1AA 2TNFA 3I59A 4FQ4A 2IV1A 2P2KA 1NZIA 1W04A 2AUYA 3OEBA 2D93A 4CCJA 4L9BA 1RVF2 5CFDA 1ZBA3 3GXUA 1W9FA 3SNMA 3SR4A 2NZ9A 2W08A 3POSA 2Y34A 5LRRA 1CGPA 3TEPA 1UY0A 2I07B 1MFQC 5FPVA 4I8TA 2ARXA 1SLLA 1ULFA 2ZXQA 4MX3A 1OKOA 1DCSA 3OJBA 3AX4A 3MV11 3MFCA 2VUCA 5LK7B 2F4PA 3KXAA 1F5JA 3S7EA 5HBAA 3JBG3 3J7HA 4HK8A 5FZLA 3DGTA 4PQ9A 1QH7A 3AYAA 3SCHA 2EBYA 4NWWA 1WLWA 2E26A 2LW8A 3HIFA 1UYYA 1NCQB 3N7JA 1ZZBA 1IGOA 3HEIA 1NLQA 3NNGA 4Z2WA 5J98B 2VQAA 5F1RA 4WM8C 4M3CB 5T5PA 4IEVA 5JXJA 5JOXA 1F5FA 1X9PA 1PVC1 3VWSA 1Z78A 3GM8A 3T1LA 1CZSA 2PHXA 3ZYJB 3UT0A 2O38A 4A6OA 3VKFC 4LXLA 4Y22A 2FFHA 1LOBA 1G9FA 1I5ZA 3H8UA 1FNYA 2B5AA 3A9YA 3CDZB 5GLTA 3VZNA 5DRTA 3TEZA 4FTEA 2LLWA 2LYPA 2OR1L 4IEOA 5D21A 4ZXEA 3T2OA 3FE5A 4CXWA 5C4WA 1HJGA 1O59A 2VO5A 2KXLA 4M3CF 4EE2A 3LCPA 1HQLA 3Q8FA 2KA3A 1LULA 4NDWA 2A73B 3WSOA 1LB2A 4QU2A 3TEYA 3ZR6A 2Z42A 2WJSA 3WDVA 2K46A 3R4UA 4M0HA 1AL22 1V00A 2C1FA 2ZA9A 4MHUA 3T0BA 5A6ZA 1UZ0A 3K75B 2V73A 2HCNA 3MICA 1ODNA 1G9CA 1AX1A 1ENXA 4CCMA 2IXKA 1LGBA 1CX1A 4XJ9A
chains in the Genus database with same CATH topology
1Z0HA 3ACLA 3JBG1 1WGPA 3AZWA 3AZXA 5JZGA 1XE8A 2CY6A 1PGW2 5FQ0A 2GC2A 4B8EA 3E6CC 3AXDA 1GZ9A 1OMIA 4DY5A 2DTYA 1DZRA 1IS4A 4DQAA 1MACA 5BNQA 1RUD2 1B35C 2OZ6A 4FCAA 1OFNA 3ENRA 3V0AB 3I59B 1ZZ8A 2MEZA 4XHXA 5CFDB 1QXPA 3E6BA 2X8KA 4FN3A 1POUA 3S30A 3ZN4A 1RJ8A 2YXSA 2BFUL 4XMAA 5KXDA 2GRLA 1PGL2 4AWDA 3CLPA 5DG2A 2PHUA 4MV2A 5JPMB 3UKNA 5KHGA 2BW8A 1LU2A 1S0EA 1LRHA 3ZN6A 4LHNA 2DVDA 1JBCA 2E7QA 4BWOA 4PF5A 5BNNA 1RUG2 1ZVFA 2GALA 4OULA 4AI8A 1RB8G 1V9U2 4DS0A 4DRVA 1BEV3 1H1MA 4K1YA 3WW1A 4TYSA 1ULCA 4D7TA 4YZ1A 3WUDA 3LB9A 3SH4A 1O3TA 1Y9QA 1RIRA 4OB4A 2PHRA 4DY3A 1AYN2 1UN1A 2D5HA 1W6PA 1YFUA 2BVVA 2QE3A 1Q8PA 2QNKA 1X8MA 2R32A 4QXKA 2KEKA 2D6MA 2HWF3 3J8F1 3JD73 3RZZA 1H4GA 2WLQA 2QFEA 2VH9A 1HF0A 5T5LA 2IVGA 5DUWA 1MS0A 3U10A 2B45X 1UZZA 4R4XA 2HWB1 2VVEA 2E51A 4G4FA 5C9AA 1DF0A 2AWIA 3UFDA 2XGXA 1HRI2 4H7MA 3NV1A 3ZYIB 4Y1YA 1S0GA 4PCRA 1R081 2R072 3KLSA 1FT9A 3WP4A 4AG4A 1NQDA 3VBSC 2GMEA 4CDXC 2JEMA 3EBRA 1MVQA 3WDWA 1MS8A 2DUOA 2GZWA 1Q8OA 4AVVA 1BEV1 1LHVA 2IXLA 2WFF1 3F6WA 3MGUA 4C0BA 1VP6A 3QF3A 2ZGKA 1T6GC 1HXS3 3HD8B 4K1ZA 1KITA 2Y26A 5A32A 2WQZC 5I0TA 1VBA2 1S0IA 1IKPA 4Q4Y2 3VBSB 4CDXB 5FO9B 2FMDA 4Q0SA 2K0GA 1RINA 4XILA 2DUPA 5C33A 2ZX2A 3ZN6B 4Q4W3 4E27A 4XFIA 1JYCA 3D82A 4X6RB 1QH6A 1DFQA 1IHMA 3UV9A 4X4IA 1VRH3 4UBGA 1YJLA 1RUC3 1AXZA 3N35A 5IUQA 4FTSA 3ZXDA 2LALA 1ASJ2 5BNOA 3WCRA 4GB33 4K3UA 2KPJA 2WNVC 2YROA 2UYBA 4Y1UA 1PHMA 4JRAA 3BU7A 1AR83 3ZFGA 1MR5A 1BMV2 4JCYA 1AR91 2UYAA 5I0UA 5JLVA 1W6PB 4FT8A 1RHI2 1AR73 1AJKA 5T5JA 2HWF2 3JD72 1QJY2 1JHNA 4XETA 3AMQA 1KJLA 2MEV2 2Q1ZB 4Y26A 5D8AA 1RMU3 4AFBA 4XPVA 1V6MA 3CF6E 4JVAA 2XJQA 5C8WA 4P9WA 4BYYA 3O7OA 5C9AB 4FOVA 4HVOA 1W2UA 4PLMA 4FPJA 1UPIA 3OGGA 5LK5A 1YFYA 4RHV2 1RUJ1 2BWCA 2FZ1A 2BWAA 2ZJCA 5IT6A 1TME1 1WD4A 4NHKA 1JXNA 4K9SA 1LOFA 4HZFA 4OI1A 3PTYA 1C8NA 2W52A 3T1MA 4GB31 4Q27A 5AC92 4RA0A 2FJRA 2LYRA 5EYXA 1CD3G 4LBJA 5AVPA 2G9FA 1AR81 1ZVVA 4YW1A 2XKPA 2XJTA 1ZRCA 2NQYA 5HXVA 3SH5A 4S2GA 4GXLA 4Z5CA 4BOWA 5BNOC 1AR71 2YDEA 5B2GB 2TEPA 5EFUA 1JTZX 1OD5A 2JECA 2ZKLA 3JQWA 3RJ2X 2ZACA 4CDUA 1CAWA 2QKDA 2R063 5T50A 5K7PA 1JOJA 3H0OA 1LOEA 1V6IA 4YZ2A 1OI6A 4JGZC 4YW4A 4V1PA 1Z7S1 5D8AC 5I0SA 1RUOA 4HETA 5CVRA 1KFUL 4JCKA 4W65A 5BNOB 1VBC1 1W6NB 1IPKA 2WS92 1GLHA 4LULA 1G6NA 1BXHA 2RS51 4O9EA 5GJ6A 3O9XA 3GBGA 3N3HA 4KQ7A 1AR63 1RZSA 3IIAA 4QPIA 1QHDA 2DCTA 1RMU2 3OGJA 3WNXA 4JGZB 5ABJA 1JFSA 5D8AB 1CJDA 4DRRA 4WVMA 4IV3A 4Q0QA 2PAEA 4RFT0 4Y1XA 4BH9A 4C1XA 3VBRA 4XHBA 3L1PA 3D0SA 3VBHC 3WW4A 4EV0A 4L99A 4G9SB 1CQTA 1NY72 1H9PA 4UBHA 3RJRA 4EROA 4YVWA 2X29A 2RMU2 4LHLA 2ZX4A 3I2DA 3WQ0A 4JDNA 2JXAA 1H2NA 4IWRA 3I4IA 2ZCWA 4IXLA 2R63A 1X2LA 1V6LA 1XNDA 1X7NA 2O49A 4AEKA 3S6PA 4AI0A 1PNFA 5FMOS 2PFWA 3VBHB 2Y0OA 3S8QA 4PU4C 3WP5A 3WX5A 2OPKA 1AR61 3IDEA 3A0KA 4AHXA 3OQOA 1WETA 4QGMA 4W6XA 5DZEA 5CFCA 1F9KA 2KEIA 1OHFA 4Q4X3 4JC1A 4ISRA 5DDJ1 2ZGMA 1V70A 4FO9A 5FLJA 4YGEA 1JN2P 3ZFEC 1CAWB 4AFAA 4QPIC 2HWE2 4UW3A 1UD1A 1H8TA 4COYA 2IFWA 1SFNA 4CRQA 2XI8A 4Z58A 1O7FA 2DVGA 4E2QA 5ABJC 1XNCA 3MDPA 2IVQA 5JOWA 2A3YA 2Y0IA 4RR3C 1DGRA 1PO23 2R041 3ZFFA 4XF9A 3VGIA 4N53C 5BNPA 1YYNA 4XQWA 4S2DA 4YVWC 3ZFEB 1GZWB 1C8M2 2VQ0A 4QPIB 4YYOA 1ZZCA 5J48A 2QDNA 3MIGA 3F52A 3BD1A 1IZ3A 4MXVA 5ABJB 4OI4A 1BJQA 3PVEA 2JCGA 1RUH1 4YG1A 1UKRA 3ZSEA 1ZYBA 1QDOA 4QT6A 3M3QA 1SMVA 3GHMA 2XUMA 1A78A 4WVMB 3WINE 1VB4A 2H0VA 3VBRB 4Q2FA 4BZ4A 4N43A 4RR3B 5I91A 4OI2A 4PDWC 3TNQA 1H2KA 4I3PA 4N53B 4YVWB 5C8CC 2EALA 4MGKE 4JRLA 4CDQC 1QQP3 5CFCC 3VKNA 4LBOA 1WW7A 2C5DA 2HWD1 1G9AA 5J37A 1ZRFA 1HRV2 4BLJA 3W9AA 1UZYA 1COV1 1NOVA 3VL9A 5T55A 2BQPA 4FXKB 4A7YA 4RS5C 1O5LA 3RI9A 1YIFA 1MEC1 4GH4A 1QJX2 4JQDA 1NA1C 2RJKA 4PLOA 5KC5A 2PAMA 3EJKA 4MCTA 4AXOA 5EWSA 2QQPA 5C8CB 4FP3A 1QNYA 2GN7A 2VG9A 4K40A 4CDQB 5CFCB 2AREA 4AVTA 3EQEA 4QPGC 1XYNA 5GLWA 1X36A 1N1SA 1EFAA 2NMNA 2Q30A 5BNPC 3HMYA 2YUEA 2I74A 3CJXA 1CESA 4J1WA 2CYFA 4IESA 4OHXA 4RS5B 4NWVA 1H8TB 2PLV2 5JSOA 2LYSA 4M00A 3OYWB 2HWC2 2ZX1A 5JIUA 4GKYA 5JOZA 1NA1B 3D5OA 1D2QA 5GLVA 2VU9A 2FQPA 1MQTA 4XOGA 2E7TA 1VJ2A 2IZWA 3KGLA 2YC0A 1SLTA 2V09A 4I6UA 4N43C 3SLIA 3GF6A 4FPOB 4QPGB 4Q8LA 1H4HA 4FPYA 5BNPB 3HBZA 4ES8A 4AQTA 1Q8QA 2EVXA 1UIKA 1LEDA 2PN5A 2RM21 5FPZA 2D98A 4YG0A 4Z5HA 4MGIE 2EA7A 5FMOL 2H6BA 3WDYA 1DLLA 1EAH1 1LENA 1HKDA 3M8LA 2VMGA 3BTAA 1F2NA 4JTNA 3ZIWA 1XWRA 3IKWA 4N43B 1LR5A 2ARBA 2UWCA 1FMD2 2GSYA 2FHRA 3B5LB 3M3CA 2GRMA 1QQP2 4KWJA 1TE1B 4E4DX 4H55A 5JR7B 1OSLA 3I8TA 3UJOA 3QQ6A 2LM3A 2WZR1 1RZRD 1B09A 1QJZA 2YGMA 1LOAA 3AJYA 4ZKTB 4YLZA 2EXJA 1R1A1 1H1AA 2LUWA 2RS31 4Q0UA 3VKMA 3AFKA 1RUF2 2W68A 3GALA 1LKNA 3FJSA 4DINB 1ENRA 3VLBB 4GWNA 2CAUA 1YI7A 2IWGB 3MYXA 4NOTA 2YZ4A 2ZPXA 1DBNA 3B93A 1C5HA 1PO13 1MQTC 4Z1VA 3HZIB 1DGWA 1GQGA 4NPRA 4J1XA 5IK4A 4FTBA 1D4M3 1Y3TA 1DYPA 3LOBA 2A3WA 4M3CE 5T52A 2IXHA 1R092 2NP0A 2WNUA 1V6JA 2IXIA 2PA7A 1XXNA 3MIEA 2ES3A 3QBQA 4I02A 5KHHA 4B3NA 2UU8A 3BDNA 1LMB3 3PMEA 2D97A 4IEWA 3PVBB 2WT1A 3KT1A 4MGYE 4WZCA 3JZVA 4XF3A 1LCLA 2VVFA 1MQTB 3UKTA 4LO8A 4F8DA 4OLLA 3BOPA 2AXVA 3K48A 1GV9A 5FOBB 1LESA 3DL3A 4Y5Z0 3TYJA 1RPEL 2JG9A 2WLPA 4D69A 2PUFA 4WM8A 1N3OA 1PIV1 1RUE1 3GHNA 1VBE2 4Z5DA 1W0PA 1XU1A 2JE7A 5AFEA 1NLRA 4JAAA 1Q8SA 4LUKA 2BTVC 4GQMA 1GNHA 4COVA 3WOGA 3M7AA 2D3SA 2AXUA 1PVC3 1DQ2A 5IK7A 2WNEA 5AVAA 3M1HA 3P3PA 3WCSA 1RVF1 4BCUA 5E89A 5FCCA 2ZHLA 1U5IA 2GNDA 1JH9A 1J1LA 4DNYA 3AMNA 2R0FA 3EUSA 2CWMA 4QGLA 4FXGB 3ZMNA 3JXDL 5KXCA 3WLUA 1N47A 2WNUC 3AP6A 4BA6A 1OSGA 5JDBA 1YXWA 1DQ6A 2AYHA 2PUGA 3JCIA 4JV4A 2RR12 2D6PA 2ZGLA 1XRUA 4C1WA 1PO12 3USSA 4X4DA 2BEOA 2VUJA 1S0JA 4QMAA 1D4M2 1B35A 4P9GA 1I3HA 4AVBA 2ZAHA 1DYKA 1UIJA 1WA4A 1NE4A 3POWA 4Q29A 4XF4A 1OPMA 2N7GA 4MLOA 3ZSJA 4D94A 2JG9C 3RRDA 1XQNA 1LHNA 2WNUB 2GNBA 3UK9A 4ES9A 2D5FA 3FLTA 1AZDA 3T2TA 1WCDJ 2DUQA 1NQJA 4HLTA 2IU7A 2TBVA 3FYMA 4HMZA 3JUUA 1O3QA 1G9BA 4HKOA 2P37A 1R63A 1QOTA 3M2MA 1N1YA 3OTFA 5DUXA 1SCSA 1GNZA 1YCIA 2NYYA 2O4AA 3B7MA 4F83A 3MF9A 4TZDA 4FOQA 1AL21 3HQXA 3E97A 4FPKA 4AFCA 1CPNA 2RS12 2JG9B 2QVSB 4ONUA 4E4SA 1AHSA 1U5XA 4WM8B 1JH5A 1DGWX 3ZVXA 4LT5A 1O91A 2D3RA 3I54A 4KWLA 4Q1PA 1PGW1 5K8SA 3W58A 3AP7A 3NJZA 3E5UA 2PELA 2EXKA 3PHMA 1PVXA 4L2NA 4EN0A 4RL7A 3NAPA 4XFAA 2PPXA 1SLCA 2D7FA 3AKPA 2HEYF 3AP9A 3FHIB 2UWAA 4YGCA 1HDKA 4ZXKA 4KH9A 1VALA 1Q56A 1QGLA 1TQ5A 3V0BB 4QM8A 1LOGA 3E5QA 3ZXKA 1B0NA 5JI9A 5GLUA 1LEMA 2NLRA 1ZBA2 2Q5TA 5DZGA 3USUB