2BNMA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
b'KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPOXIDASE
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 46
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnmA02
4Q0UA 5CVRA 2L49A 2BJCA 1DGRA 1RZSA 1ZRRA 1LMB3 4MZUA 1DZRA 4QM9A 1OCTC 1Y7YA 3QWGA 1QXRA 4F7ZA 2OZ6A 4YYOA 3ROUA 4QMAA 4X6RB 2CGPA 1WH8A 4XFAA 2HJIA 1O4TA 4I6UA 4Z5CA 2AXZA 1QXJA 4LA3A 2EWTA 1PRAA 2Q0AA 3ELNA 2OFYA 4MGYE 1H1IA 5BY5A 4L11A 5JAXA 2L8NA 2XHKA 1ZZ8A 5AVPA 3G5GA 3ZDSA 1QP4A 3SCGA 4OLLA 2PUEA 3EBRA 1NERA 5C6CA 5FDBA 4MV2A 4IEVA 5I93A 2GH2A 2BEOA 2PAKA 3LAGA 3RPQA 1ZRCA 5EFUA 4LULA 2GRMA 3IDCB 3FE5A 4YNIA 2BNMA 2DCTA 2OYZA 4PU7A 2GC3A 1Q3EA 3LA7A 3LA2A 3OF1A 1PNRA 2CROA 2D93A 4X4FA 1UXDA 2WIUB 4YG1A 4Z59A 2O49A 4A2UA 1LLIA 4LUKA 2AW6A 1S7EA 2XL7A 3NKTA 2LYRA 4EV0A 1VJ2A 3DNVB 4AQ6A 1CAXB 4LA2A 1ZZ9A 2H0VA 1NYWA 2VQAA 2IXKA 5I0TA 3MZHA 4YRDA 3HT2A 2EBYA 1ZUGA 1NE6A 2GC0A 1BDIA 4QGMA 2IXCA 3CLCA 1I5ZA 2D40A 1R63A 4I0AA 3GYDA 3NJZA 4EWEA 1O3TA 4XF0A 4IEUA 1U12A 3UKTA 1L1MA 1ZZBA 1UCXA 4LUMA 5FLHA 2XJ3A 5KHIA 4X4EA 5BPXA 1LKNA 2XGXA 1RZRD 3JXDL 1B0NA 3JXCL 5J3UA 3G7DA 3KMHA 5FQ0B 4PIZA 1SQ4A 3I59A 2UY9A 3SMHA 1PERL 2MHFA 4NVPA 1XWRA 4XEZA 4I8TA 1CX4A 3H7JA 4B29A 1OFNA 3SCHA 3USSA 3OGJA 2O8QA 5FLJA 4FAHA 2IUOA 4IWRA 4HVRA 3CF6E 2PUCA 4JCXA 3PVBB 4X4HA 2IC1A 5I0UA 2PFWA 1RUNA 4YSFA 1WA4A 4FT8A 1WH6A 1Y3TA 3FZ3A 5JSOA 4Z5HA 1CAUA 4OFGA 1WETA 4QGLA 4IEZA 3HZIB 1OMIA 2EA7A 5FPXA 2PTMA 4I6RA 5BV6A 1ZZ6A 2EVXA 2XCJA 2Q4SA 1JUHA 4GULA 3MLFA 4KU8A 4X4GA 3E97A 3LZZA 4Z58A 1LR5A 1GT0C 4CYDA 1WGPA 2PHDA 2O38A 3M3IA 3U0ZA 1SEFA 1ZX5A 1JFTA 2LYPA 3RYRA 3TNPB 3TRBA 2FQPA 4JCYA 1J1LA 1PMIA 5K8SA 4KU7A 1SFNA 1JWLA 3H7YA 3GN5A 3FFQA 3OQNA 2K9ZA 3BB6A 1EPZA 3H3ZA 5J7MA 1G6NA 2PYTA 1X7NA 4X4CA 1ZVVA 4LTAA 3M70A 4UBGA 4PU8A 3BPZA 1CAVB 4R8HA 1ZPQA 4XFCA 5FPZA 4HSJA 3O14A 5F1RA 4X4DA 2IU7A 3DV8A 3U11A 3VHRA 1FT9A 4XF4A 3S7IA 2UY8A 2LCVA 2BNOA 2D5VA 1CAWA 2OZJA 3MPBA 2PUAA 1EY2A 2VPVA 3CROL 4PU4C 3OTFA 4OB4A 3EQEA 4PIXA 1E3OC 3BDNA 4ZU4A 1RIOA 4ORFA 3QOPA 1NXMA 3IBMA 1O7FA 5HI0A 5KBFA 3FWEA 1QP7A 1XRUA 3KZ3A 1EP0A 5KHHA 2ET1A 5JSRA 2KEIA 3S8QA 2EAAA 3F52A 3N4MA 1LCDA 3UKNA 4MUVA 3LA3A 4HN1A 3D82A 3NVCA 4D7TA 2PHLA 3H50A 3NL1A 3L2HA 5I8YA 5KHJA 4I0BA 2Q30A 4IEQA 4IEWA 1O5LA 3IWZA 4YARA 2ET7A 2IXHA 4KWKA 3E5QA 4MGKE 1XE8A 3ZHIA 3MDPA 4Q0VA 3JXBC 4RD7A 2C0ZA 4P9GA 1J58A 1IPKA 1QY4A 2HKXA 3CEWA 2LYLA 4IESA 3B02A 3PLQA 2PUBA 2IVBA 4HBNA 2XIUA 3PXPA 1FI2A 1X57A 4N9HA 4I3PA 5E1RA 3TNQA 4IVZA 3WW4A 3MYXA 5KHGA 1ZZCA 3KJXA 3CO2A 2OA2A 4JV4A 2FJRA 4L2NA 3EO6A 4Q0QA 1O3SA 4PJYA 1YUDA 5JSPA 2PIJA 3ACLA 4IA8A 4XFIA 4H7LA 4KWJA 1DGWA 1O4XA 4D7SA 1RUOA 1YSEA 5I8SA 4Y42A 2CSFA 3ZHMA 1V70A 4EROA 1X8EA 2B9UA 3LFPA 3U10A 1NEQA 1QQAA 3H8UA 3OP9A 3HQXA 4Z82A 3WW2A 2V09A 3BU7A 3R6SA 5I0RA 1Y9QA 3DN7A 4XETA 1HF0A 1CJGA 3OCPA 3WW1A 1ADRA 1Q5OA 2IV1A 4I02A 4JQDA 4MGZE 1X82A 2GZUA 2JVLA 4X6QB 5I8TA 1CAXA 2UYAA 3FJSA 2N7GA 5K98B 2AXVA 3OMTA 4HMZA 4GQMA 4HVOA 1RZRA 3HIFA 5J48A 1O3QA 2H8RA 4YG7B 2MPFA 3E6CC 3F51A 1QPZA 2ETEA 4XFBA 5CU1A 3S7EA 3SHRA 1LB2A 1YFYA 3CECA 1H1MA 2FMYA 4IEPA 4X4BA 4UXAA 4IEOA 1YLLA 3UKVA 4E2SA 2QNKA 4X4IA 1EFAA 3JZVA 4E2GA 1GQHA 2H6CA 1ZVFA 1OSLA 3IIAA 1UIJA 3ES4A 3H1MA 4HN0A 1ZRDA 3H1YA 4HSLA 1J3RA 1POUA 3QYXA 2E9QA 2IXLA 3DL3A 3RNSA 2PAMA 2D5FA 5JCTA 1YFWA 1QWRA 4QX5A 3I7DA 1JH9A 2EF8A 1VR3A 2PUDA 2VECA 1J3PA 2QCSB 4N9IA 3VK0A 4IETA 1FXZA 4F8DA 3ST7A 4FBIA 1NZCA 3NSTA 4UBHA 5FQ0A 4XFFA 2Z69A 4XFHA 4MGIE 2XKOA 1EYBA 4AVBA 2B5AA 3QQ6A 3OD0A 1RPEL 3RDIA 4J1XA 1WIZA 1ZRFA 3IDBB 5I0SA 2CAVA 5BXXA 5BUVA 3FMYA 2GC1A 1X8MA 3FX3A 4I09A 4PIYA 5D1IA 2A6CA 1YHFA 2O1QA 4I2OA 3H3UA 2IXIA 4IEXA 4META 3GBFA 3KGZA 3B7HA 3E5XA 1AU7A 1L3JA 1RC6A 1OD5A 2PQQA 2H6BA 2XKPA 2AXUA 4LLOA 4HVQA 4TLFA 2KPJA 2LYQA 4XFGA 5KHKA 2Z2SB 5LRSA 3PNAA 2XSDC 2UYBA 2AWIA 1YFXA 1CQTA 5JR7B 2GC2A 3CLPA 4K8FA 4AVAA 4BYYA 2XI8A 2IVGA 1RTVA 2PE5A 2CAUA 4DINB 4ZU7A 2QDRA 5C8WA 2PAEA 4EWDA 3KCCA 3EJKA 4O9EA 2IVQA 1RL3A 1VPWA 3FHIB 1UPIA 1ZZ7A 4WZCA 3O9XA 2WUSR 2ZKLA 4AQ2A 3DKWA 4XF9A 3FYAA 2IXJA 3I54A 4HLTA 2WC2A 1QQBA 3SCFA 2XLGA 2O4AA 1YWKA 4QM8A 3WW3A 1NE4A 3E5UA 4YG4A 1DWKA 1CAVA 1ZNPA 4F8AA 3QF3A 1RGSA 3RYPA 2B8MA 1VP6A 4JTOA 3I59B 1UW8A 3S0MA 3ETQA 1IC8A 1QP0A 2PUGA 4Z07A 2AUWA 1UIKA 1DW9A 4O8BA 4KWLA 2BGCA 2R1JL 3D1NI 4BHPA 1OI6A 2MNGA 3CJXA 5LRRA 3R1FA 4MCTA 1UXCA 2BYVE 2LYSA 5T3NA 2GZWA 2KXLA 2B5HA 4BH9A 3RZZA 4MX3A 5A7LA 4XF3A 1X2LA 2ATFA 1ZAYA 1O5UA 1O3RA 4O9GA 3D0SA 1CAUB 2XL9A 2PUFA 2WFPA 5CADA 4KL1A 3OQOA 2OPKA 1J59A 1LRHA 1CGPA 4Z5DA 1Q43A 3HT1A 4E2QA 1PRVA 3KXAA 2KEJA 4QXKA 1R69A 2GRLA 2CV6A 4Q29A 5FCCA 3LISA 2K0GA 5LEKA 3F6WA 1XE7A 2ZCWA 5FLIA 4WVZA 2MQKA 3E6DA 4PU3C 2MEZA 3QACA 2XLAA 5I91A 3GN5B 2D5HA 4YBAA 2R63A 1TQ5A 3ES1A 2QJVA 4I01A 2Q1ZB 2ICTA 4AVCA 3OQMA 4AXOA 3BS3A 3L1PA 2LYKA 3H5TA 4FAGA 1ZREA 1DZTA 2BNNA 1LQCA 2P17A 1PRUA 4Q0PA 2HSGA 4MCXA 4NDWA 3KSCA 4JTNA 4ONUA 3D0JA 2KEKA 3LOIA 4J1WA 2F4PA 2I45A 5EZWA 4GHJA 2PA7A 3H9AA 4I6TA 1UTXA 3U3WA 4QGNA 1WLTA 2Y0OA 3NW4A 2HINA 1CAWB 4XF1A 4R52A 2GU9A 4IEYA 3UFDA 2PPXA 5LEJA 2XLFA 3CL1A 3E6BA 3LWCA 3SXWA 2KZ8A 2JCGA 4FN3A 3RYKA 3EUSA 5E16A 4JVAA 2GAUA 3FYMA 3EHKA 3IVPA 4HZFA 4MH0E 3BCWA 2LYJA 3C3VA 4FBFA 3KGLA 1YFUA 1I6XA 4BIFA 1LCCA 1HW5A 3ZKCA 4IERA 1ZS4A 4LEJA 1BDHA 4Q0SA 2OR1L 4WBBA 1IPJA 3H1WA 2ICPA 4EWAA 1UD1A 2QVSB 1PM7A 3BD1A 1J3QA 1JFSA 4ZU5A 3BALA 1GQGA 1SQ8A
chains in the Genus database with same CATH superfamily
1MZFA 4HFSA 3EB7A 4Q0UA 1D4M1 5CVRA 5F3EA 3ZXLA 2VQTA 3ALQA 1DGRA 1RZSA 1ZRRA 2PHXA 3HWJA 2PMWB 1YYNA 2GH8A 4F7ZA 1SBEA 2BQPA 3IIIA 3AZVA 1IS6A 1MEC3 5G05L 4FOVA 4A7ZA 5LK7B 2AXZA 3J8F3 1XBFA 1RUJ1 1D4VB 5JDBA 5LZ6A 4JAAA 3ELNA 3KHCA 5AC93 3WLUA 2DYCA 1SFYA 4JRLA 4L11A 4DY3A 5JAXA 2W1WA 4COZA 2L1PA 2ZJCA 2WO3A 3P6BA 1RUF1 2QQLA 2VZQA 2PHWA 3J4UH 1XNTA 2LRPA 1QP4A 4OLLA 2PUEA 5E8AA 3EBRA 5FDBA 1RUC2 1W6QA 4FPKA 1OH4A 1J1TA 1ZA4A 1VRBA 4IEVA 4YW4A 3PDQA 5FYYA 1RB8G 2EF6A 5I93A 4OI2A 1W0NA 4MG2A 4CE8A 3U75A 3ZDVA 1JZ2A 5CNAA 4LHKA 1MQTA 2W08A 2X5IA 1COV2 1B35B 3CJIA 3OB8A 5F5QA 3FUQA 4MXVA 5EFUA 2QQOA 3VHOA 5C3OA 1KXGA 4JGYC 3PIGA 4XVHA 3IDCB 2YYOA 4YVSC 4CCJA 2D43A 2BNMA 2DCTA 4XHBA 2OYZA 1NOVA 2GC3A 2ZGSA 3OF1A 3ZPOA 3VDBA 4W6XA 1UOFA 1LOBA 4A3XA 1S0FA 2O49A 4HONA 4FFHA 1GWLA 3WOGA 4A2UA 4LUKA 3WDVA 2QKDA 2KA3A 2ZACA 1RUH3 2ILMA 2XL7A 3NKTA 4WVMB 2EAKA 4DRRA 2BV4A 3N35A 1CAXB 1VBE1 4LA2A 1JOPA 2QQUA 2Q8OA 2XWBB 3IKWA 2H0VA 3AXDA 3WF4A 4CDUA 3RGBA 4G4FA 1SBFA 2IXKA 1ENRA 2QFEA 2CDPA 3HT2A 4R4ZA 4GALA 2BUKA 1NE6A 4ES8A 1BDIA 1D0HA 2IXCA 3I2IA 3POIA 4BCUA 3CLCA 3C7HA 4L8QA 5IWFA 4EN6B 3O0WA 3P3PA 2GNMA 4CDQA 5FK8A 4I0AA 4JQRA 1KFXL 1W2UA 3V0BA 2RJKA 3K75B 1O3TA 2NLRA 5JIAA 4XF0A 4QPIC 1G9DA 3TEPA 4WZFA 5A3MA 5JMOA 4OHXA 4A6SA 4BM8A 2VQ0A 4KMQA 2CY6A 2XOMA 3OPTA 4S2HA 4KBZA 2HWE3 1LKNA 1NX9A 1W8ZA 2PELA 3PIJA 3V56A 4RHV2 1JZ4A 2WZPP 3KMHA 4GWNA 3TN92 1RMU3 1UY4A 1AR82 1RUD3 1PERL 5FMBA 3RJRA 3O7OA 1XWRA 1VRH1 3ORJA 4K40A 1BKZA 3I3QA 5FJHA 2ARAA 1DYKA 2A7AA 3HNYM 5C4WA 4LKDA 1CZVA 1GNYA 5FLJA 3KZ4C 1OSGA 5DUVA 2IUOA 5GJ6A 4IWRA 2C24A 4CP9B 4RGGA 1GOHA 2WNUB 4LBQD 4ES9A 4JCXA 2WR9A 3K46A 1IKQA 2WT2A 3JD72 5I0UA 1OLMA 4JGZB 1PO23 1WW4A 4XUPA 4FPOB 5GLVA 3C7OA 1NY71 1UY1A 3AYAA 5DQ0A 4KNCA 3VKFC 2R063 4OFGA 5GZGA 4AR2A 1SLTA 3OPWA 3GXUA 5T5PA 2EA7A 4YW7A 4I6RA 3TFLA 4FPFA 4LBJA 4CPBA 2XCJA 3MV01 3MLFA 2CU5A 1QOTA 3IMMA 1W8NA 5DDJ3 2CWSA 4D8MA 2QQMA 5CIRA 2RMU2 2XBO2 2WLQA 2X8KA 1WGPA 5C3RA 2VZ3A 3M3IA 1JYTA 4CDXA 2R6QA 1UOGA 3WG4A 4OI0A 2FQPA 4JCYA 3KF5A 5K8SA 3BI3A 2P3KA 1YQ8A 1NZIA 1RUI1 4YFZA 3T08A 4HOOA 4D94A 3A4UA 2K9ZA 4Z8BA 1OPOA 3LSDA 2A1XA 2RJ2A 3DUIA 2YFUA 5J7MA 4IV3A 5K9YA 1G6NA 3AMHA 4AEDC 1OLQA 2RM22 1UU5A 1X7NA 1AYN1 4IGQA 2Q1MA 3VDDB 5BNPB 1RITA 4AL9A 4AE2A 2V3CC 4PU8A 4JC1A 3RZJA 3AKSA 5FPZA 1R082 2OKXA 3ME2A 4X4DA 1VB4A 2Z79A 3U11A 4AGRA 1GZWB 1TMF2 2O0OA 2UY8A 2LCVA 2WNVB 3KT4A 2D5VA 3T2QA 2B46X 2QQNA 3N7KA 5HCHA 2PUAA 4Q4Y2 2GALA 3VZOA 2PXPA 1F5JA 2R041 5H9QA 1DFQA 1PZ8A 2ARXA 2VPVA 3VD4A 2HYXA 4LBKA 4JHTA 4LO7A 1W8OA 2XVKA 4PU4C 1WBLA 2ZGMA 3D5OA 3OTFA 4BPZA 1PK6C 2AZ5A 1E3OC 2VQUA 3B94A 1N1TA 4M4RA 3O1RA 1IOAA 1UZ0A 2G19A 2R0FA 3JBG3 4LIVA 4SLIA 3O1UA 1QP7A 1YC61 3AL6A 1EP0A 3UWPA 2GN7A 4JX0A 1S0GA 1LGCA 2ET1A 2KM2A 1I3HA 1UQXA 4ASMB 3AMNA 2EAAA 4CP2A 3ZYHA 4MXWB 5FP9A 4CUBA 4DOUA 5LWBA 3B5LB 4UYBA 1NCQC 3D82A 4HN1A 4B8EA 2PHLA 4ZXKA 5ABJA 3NAPB 3JUUA 4ZS2A 4UFHA 2R073 4I0BA 4AWDA 1H1AA 2Q30A 4K20A 2TUNA 3VZNA 2ET7A 3SLIA 2JD9A 4HETA 1LOAA 2RS52 3LKJA 5LK5A 3DCQA 2RDQA 1UYXA 3NNFA 4BA6A 5LA1A 5GZFA 4S2GA 4RFRB 4GAZA 4OI1A 5HCAA 1HKDA 1PZ7A 1HN1A 4FOWA 1KRIA 2VXJA 4R9BA 1IHMA 1XYOA 4X8NA 4CCDA 2IVJA 2PUBA 4HBNA 5F9TA 2XIUA 3T2OA 3UETA 2WWUA 4Q8KA 4QQPA 3MO4A 5LW9A 3WF1A 2VMFA 3I2HA 1OOPA 2XJUA 4RQPB 2Y6HA 3U78A 3I49A 3CO2A 2OA2A 2VXRA 4ZZ8A 2ZS6B 3J8F1 1UKGA 3AYCA 1QMJA 3MEPA 1HXS2 4PJYA 3OGVA 4GWJA 5AC91 3J26N 2LLVA 4IA8A 1H8TB 5C3QA 4XACA 4XFIA 5IK5A 4KWJA 3I2KA 1GANA 4OCTA 1RUOA 5AVAA 1OH3A 2ZAAA 4H7MA 2D6OX 4N43B 1V70A 4MHRA 5DAVA 1NEQA 3H8XA 1OKQA 3R4UA 2XG3A 1HQLA 1E57A 3BGAA 3KVBA 1PGW2 2WRAA 2WINB 3WW2A 2EXIA 3BU7A 3R6SA 4CUCA 2ZABA 2P1BA 1N1YA 1VBA3 5BNNA 1HRI2 4XAAA 2JX9A 5I0RA 3OKZA 2RS31 3GZAA 2JG8B 3AZXA 1JZ5A 1HF0A 3OY8A 2FMDA 3OCPA 2DVAA 4UOJA 2ENRA 2ZX2A 2FD8A 3ZFFA 1Q5OA 1AX2A 1AXZA 2ZMLA 2VCAA 2VMHA 4Q4V3 5JXJA 3APBA 2WFF2 3WT3A 2DTWA 2P37A 4W4ZA 3AVSA 2ZBJA 3ME5A 3ZPXA 1B35C 3OMTA 1BJQA 1NLRA 3H42B 1RZRA 4HMZA 1YJKA 1Z7S2 2MPFA 1QPZA 3S7EA 1LB2A 1DQ2A 4LBMA 1RUH1 2YGLA 2FMYA 4IEOA 1GBGA 2YXSA 1YLLA 1XYPA 2Y0IA 3ZYPA 2QQJA 5DZEA 1GQHA 5A7SA 3H1MA 4M0HA 1AL22 5FPLA 3WP3A 4GH4B 4CZSA 2R7EB 2ZGLA 4GD4A 3QYXA 2ZGNA 5EJ3A 1AR92 2F17A 1CD3G 1K5MA 1PX4A 4HG6B 3I2DA 3NZLA 2PAMA 1H4GA 1QWRA 4QX5A 1PGL1 2EXKA 1JH9A 2WO2A 1ULFA 4RN5A 1JZ6A 1QJFA 2WDBA 5FBZA 1VPHA 1PX3A 1J3PA 1WLCA 2ORZA 2WZR2 5FY4A 3VK0A 1W6OA 1LCLA 2NMNA 2VTXJ 3KM5A 1GFF2 3FHQA 1NZCA 3NSTA 4IW3A 4UBHA 4AVVA 5FQ0A 3NO8A 2DFCA 4XYXA 5DAWA 3C7EA 4A45A 2UWBA 5CFCB 3ZPYA 3HD8B 3KT7A 3QQ6A 3OD0A 4JDOA 4UW5A 3HOBA 3KWVA 2XMLA 3RI8A 4CU6A 2HWE1 3ZSKA 3B00A 1SHWB 1RUC3 4DEVA 2B9VA 1KS5A 1SLCA 4LBNA 4XJ8A 5BUVA 1SBDA 5B2GB 1RMU1 1X8MA 1RUD1 1FYUA 3FX3A 4I09A 4LXLA 5FZOB 1ZM1A 3EMRA 1COV3 2RJLA 2EIGA 2O1QA 2XXZA 3OSDA 4LKSA 4NROA 1HB2A 2HWD2 4XJAA 4LHNA 1OHFA 3WNOA 4Y33A 2P3YA 1GYKA 1F2NA 2IXIA 1DIWA 4IEXA 3GBFA 5FZ3A 1US2A 1L3JA 5DUWA 1WCSA 1OD5A 4AI0A 2AENA 2PQQA 1Z0HA 2YB7A 1FNZA 4TWTA 3O1PA 3MW2A 3VBFA 1PO21 2DWRA 3KD4A 1UX6A 3ITQA 4NIIA 3C8XA 4ZHNA 1QB2A 4BQ4A 2IFRA 4RYDA 2Z2SB 4A42A 2WNUC 5LRSA 3JQXA 3TELA 5DZFA 5FMOS 1CQTA 5JR7B 4AVAA 1D2SA 4JGZC 2VCMA 1DHKB 4LLFA 5JIUA 1Q8OA 2B45X 2QDRA 3P1IA 5DDJ1 2D97A 1AXKA 5GALA 4CCNA 3LEMA 2IVQA 4O9EA 4COWA 1RL3A 2J7WA 2P5BA 3OUIA 4IE5A 1WMXA 3SKJE 4AFMA 1VPWA 5DRYA 1OVPA 4L0PA 1YQCA 1ZZ7A 4FCAA 1BBT2 4Y5SA 4AQ2A 4P9XA 2VM9A 3I54A 3RWKX 3SCFA 5FYCA 2PHFA 3M8LA 4QM8A 3WW3A 4QKBA 1C3HA 1VBD2 3RZLA 1ZNPA 2DBNA 3GZUC 4GB32 3WHUA 1S2BA 2JE8A 2VBBA 3FL7A 3MBWA 1RGSA 5EYXA 3RYPA 1QF3A 1CESA 3IAQA 3WDTA 2XJSA 3S0MA 1GLHA 1W9TA 4QAWA 1Q56A 1QP0A 1BCXA 2XVLA 4RHV3 3WQ0A 4DXSA 2BPA2 1OF4A 3B93A 4CCEA 1VBB2 2P6CA 3VBRA 3TN93 1Y4WA 4AOCA 5C8CB 1HRV2 1PNFA 3ACFA 5A3WA 2MNGA 2NMOA 3CJXA 2ZHMA 3PUSA 1LU1A 2OVUA 5CFDA 5T3NA 4AQSA 5JLVA 2MXDA 1LGBA 4XBNA 3VDDC 3SQOA 2KXLA 3FC0A 4BH9A 4CA9A 5BNPC 1HB1A 4ITCA 4XF3A 4IE0A 4C1WA 4EKIA 1J83A 3W5NA 2WO7A 2PHUA 5CKQA 3IM0A 3D0SA 4MADA 1PVXA 2XL9A 1G7YA 2WNVC 3H8OA 3JD73 3PHMA 5A7QA 2Y34A 5FXVA 3ZM8A 3OQOA 4YGDA 4LO4B 3I97A 1QJU2 3T2TA 4Z5DA 1BK0A 2LW8A 3UYJA 3U14A 3BUCA 1Y9MA 5IVVA 1GUIA 3KXAA 2KEJA 1AX0A 2ZGTA 3R4SA 2EIDA 3TB0A 4COVA 5FCCA 2K0GA 3F6WA 1OQDA 5FK7A 1IS5A 4LORA 1T6GC 4XZPA 5FZLA 2MQKA 2XBO3 3B9CA 3GZEA 4E9KA 4QT6A 1U5XA 2PXJA 1H9WA 1W8FA 3EYPA 1KJLA 1TQ5A 1MS4A 4I01A 2JG9B 3M2MA 3A21A 4D3WA 4UFKA 3LQXA 2VH9A 5KXEA 2LYKA 1ZREA 2FHRA 4GWMA 2BP6A 2DDUA 2HWF2 5FYMA 1O4YA 3O0XA 1RUE2 5FP7A 4AGVA 1W6PB 2HSGA 4NDWA 2JXAA 3INAA 3NAPC 4JTNA 4CPBD 3THTA 3D0JA 1VB2A 5F3IA 1E5HA 1QH6A 1LGNA 3TEYA 4FPYA 3AM2A 3LDBA 4AVSA 1K5JA 1R1ZA 2RM23 3H9AA 3O1TA 3LCPA 1CX1A 3QD6A 1WLTA 2Y0OA 3NW4A 1NQJA 1ST8A 5K7PA 4XF1A 5IFTA 1EUUA 2FDGA 1QGLA 4HPKA 2J7UA 1TMF3 4PQQA 2A75A 3D4KA 4QX1A 1UY3A 4Q4Y3 2L9LA 5IT6A 4FFIA 4XMIA 5D21A 2BDRA 3VD5A 4NIHA 4Y1VA 2GAUA 3IVPA 4RQPC 4O65A 2JDNA 4CXWA 3SR4A 4Y20A 1I6XA 4COUA 4BU2A 3NNJA 1SZBA 1MS8A 1LCCA 2ZGKA 2CWMA 1VBC2 3Q8EA 1Y43B 3QH6A 1HW5A 3ZKCA 1OUXA 1ZS4A 2B39A 1XSQA 4HANA 1BDHA 3MLLA 1H8TC 2O14A 1NQDA 1IPSA 3V0AB 4ZS3A 2DBIA 2QVSB 1WCDJ 4LE4A 3ZFGB 1VBA1 1J3QA 1MVEA 1QJEA 1RJ7A 4N43C 3BALA 3WUDA 3BTXA 5F5AA 3T0DA 1H2KA 5DAQA 4EK9A 1SDWA 4RR3C 4ATFA 1UL9A 4DRVA 4Q4W1 1PVC2 4Q4V1 4MZUA 1DZRA 1NUKA 1XU2A 4NPLA 4QM9A 1CPMA 1QXRA 5DPNA 4OZOA 2JG8C 1SLBA 2PLV2 4QMAA 1LODA 2KR2A 2VE1A 3BODA 5FZHA 1FATA 4W6WA 1MVQA 1YIFA 1XNBA 4I6UA 4OMDA 4Z5CA 2RS53 1QXPA 2YPJA 1QXJA 2XJQA 3R0RA 1NT0A 4HL0A 4LA3A 2QQPA 1LHUA 2EWTA 5A7OA 1JYIA 4FPEA 5FMDA 2OFYA 4MGYE 4YWAA 4JGYA 5C9AC 2HBTA 5AVPA 1ZZ8A 4AZZA 4S2DA 3WD5A 3G5GA 1C5IA 2Q1FA 3GCWA 3MLJA 3ZDSA 1NA1B 4FO9A 4BXFA 3I4IA 5FYUA 1WMDA 1BLZA 2PXTA 5A3TA 2VVDA 3OEBA 1XSRA 4GH4C 3USUA 3WNNA 4UWDA 4Y3OA 1WW5A 2GH2A 3ZFEB 1FV3A 5L73A 3PJQA 1KEXA 1K45A 2VO5A 3N3HA 4NMIA 3RPQA 2WLPA 1ZRCA 3MIHA 3THPA 2IVIB 1W0OA 5FTTC 4OI4A 1UWWA 3FE5A 4AHYA 5JOWA 4M3CE 4PU7A 1WKYA 1RUC1 1BEV2 3LA7A 3WUCA 4AQTA 1Q8QA 2D93A 4L92A 4XBLA 5A6YA 4YG1A 1ASJ2 3MFCA 1TME3 1VLNA 2A73B 1Z78A 5CFCC 5F3GA 4OUSA 1SPPA 1S7EA 3O1SA 1JS9A 4EV0A 1COV1 1VJ2A 1LNSA 3VZKA 2BTVC 2RS12 1NXD1 3NNMA 4QPIA 4UFJA 3ETPA 1UYPA 1ZZ9A 2J42A 2A70A 1RUG2 2AREA 4FQZA 2Y6KA 5FKCA 3UGFA 2BOJA 3WX5A 4YLZA 3GZTB 4P14A 2WFF3 2BERA 3U1XA 3JCIA 3KLSA 1SCRA 4XJZA 3DYOA 4C0HA 3FMGA 5K0UB 3AC0A 3GGLA 1HV1A 4N90A 4LNVA 1J84A 1ND3B 1QDOA 5CISA 3CZJA 1UZYA 3ABZA 2V73A 4CXXA 5CB7A 2YU1A 5CFDC 2WS91 1QHDA 1F31A 3A0NA 4IEUA 3SEEA 4KG0A 2ARCA 1ZZBA 1UCXA 2K46A 4CCOA 5J09A 3ZLIA 5A33A 1XOYA 1UY2A 5FO9B 1G9FA 4FPLA 1AR93 2C1FA 1H8VA 1UYYA 2J1RA 2WQZC 1POV3 4ER5A 1RZRD 4CVUA 3WCSA 1B0NA 2DVDA 3WY6A 3W21A 3ZIWA 3OD4A 1JYXA 2WZR3 1LEMA 2UURA 4URTA 1IQAA 1ENXA 1RHI2 4XEZA 2LTNA 4B29A 3N9OA 2HWC3 4WM8C 1FAYA 1OFNA 1ULPA 2O8QA 1PGSA 1FMD2 4CEYB 1JHJA 5JI7A 4HVRA 4RHV1 2ZXQA 4X4HA 2PFWA 5AFBA 3TN91 4AEMA 2OW4A 4XILA 4QQHA 3SEPA 5CEHA 1CAUA 4ER0A 4A7KA 4IEZA 3HZIB 2WSUA 1OMIA 1XPWA 5FPXA 1AR62 5BV6A 1ZZ6A 1GQPA 1FOD1 3I3MA 4KU8A 5C8CC 4QD2A 4PF1A 5LCWL 4AEDA 3PUQA 4HKOA 2VULA 4Z58A 1LR5A 1GT0C 4CYDA 4Y5Z0 2JDKA 1W6NB 3JD71 5IW0A 2PHDA 3NRUA 2O38A 5KC5A 3U0ZA 1OUSA 2VMDA 1SEFA 5HV4A 1EAH3 1FNYA 1ZBE2 2ZGRA 2JDYA 3WDUA 2QZ3A 3TRBA 5DAXA 3V65A 2NN8A 5FPUA 2WUHA 4KU7A 1GOFA 3R09A 1JWLA 2WL1A 2Y6LA 5A7WB 5JMCA 4EN7B 2R16A 1I5PA 5GM0A 2D6KA 4NE9A 3FFQA 2GNTA 4FOQA 4QB2A 5FZ8A 3PUAA 4XQDA 4DUVA 4K6BA 5DABA 4DUWA 2WN3A 3H3ZA 1S2EA 1TEIA 4NHYA 5FMCA 1V6NA 4ZZ5A 1KFUL 5HCFA 1PK6A 2GNDA 2PYTA 4QPGB 3M3CA 4X4CA 4EE2A 3S57A 4CCLA 4LR4A 2QBXA 5FWEA 1UMZA 1BBT3 2VZPA 4K8RB 3QCWA 4PBPA 2YBKA 4OUMA 4XFCA 5F5CA 3VDAA 3AMMA 5IFPA 3AMQA 3VHRA 4QX2A 3DYMA 1RVF2 1KQRA 3Q9OA 4PCRA 3TOJA 1ZA7A 1CAWA 2OZJA 1VBD3 1ND2B 3MPBA 3X29B 4GB33 4AW7A 4BJ0A 2JG9C 3NNLA 3N9MA 5FZCA 1NCQA 4XTPA 5GZCA 2EALA 2LLWA 2RM21 4EZIA 1HX6A 4PIXA 1VBB3 4XC9A 2DF7A 1QJY1 3PMSA 1JH5A 1JODA 1HRV3 2HEWF 3QOPA 5AFEA 4IE6A 3IBMA 4U36A 5KBFA 3AKPA 1PO12 3FWEA 1TVGA 1CWPA 1TMF1 3M4FA 2Q5TA 3AFKA 3K4ZA 3VBSC 4WVVA 5JSRA 1MR5A 1DLCA 1MS1A 2JE7A 3JU9A 3BVCA 4NJ4A 4Q4Y1 1F4HA 3F52A 5EP9A 2WNEA 2JDHA 2YZ4A 1YRZA 2XJRA 3FFZA 2XQRA 3MV11 4QHOA 2Y33A 5F2SA 4MUVA 3VHPA 2BRTA 3NVCA 1Y7BA 1U5IA 3OYWB 4D7TA 1POQA 5ACA2 3H50A 1ENQA 1HDKA 3IPVB 3L2HA 2UWAA 4TSVA 1MS0A 3PVNA 3ZOIA 2PXLA 5ANQA 2MEV2 2R49A 4IEQA 4FP2A 1VAKA 5DAPA 2J1AA 2IXHA 4N8MA 3T09A 1D2QA 3E5QA 4MGKE 3VB9A 4ZY9A 3M9LA 3MDPA 1VMFA 2ZGPA 3BOPA 3JXBC 4RD7A 5JZGC 2VOXA 5FY1A 4LK6A 1IPKA 2FDKA 1QY4A 1YI7A 3CEWA 4NHKA 2W1QA 2LROA 3B02A 3AB0A 1OD3A 5HCBA 3MF6A 4LO8A 2IVBA 3J7LA 1UOJA 2DFBA 4OZXA 1IGOA 4CEWB 1FI2A 1VE0A 2HEYF 3TNQA 3LPFA 1AR71 2CTVA 1ZZCA 3KJXA 2UWCA 5KHGA 3CU7A 1S0CA 4JV4A 2RS51 5FYBA 2HWF3 3A0KA 4Q0QA 1RUE3 5FPVA 1QNWA 4D0QA 3M7AA 1YUDA 1DQ6A 2J22A 2NYYA 4MO3M 4FOYA 3BN6A 3HBKA 1JUIA 4H7LA 4YGEA 2M4HA 2X53S 3VGIA 3VD3A 4A44A 1B35A 2C9KA 2B9UA 3RG0A 2NPIA 1HV0A 3AXEA 1WCKA 5FJKA 3DPRB 3AYDA 4Z82A 1RIRA 4Y24A 4OVEA 3FN9A 4EQZA 3WNPA 2VUCA 1WLDA 1NA1C 2WJSA 4Y1YA 5FZ1A 4G3YC 4XETA 4IDZA 2CGOA 4XTMA 3SITA 1CJGA 4OQ8A 1V6KA 2VOWA 1DZQA 5HV0A 1UKRA 1ADRA 2W46A 5FXZA 2IV1A 1DU3D 1VMHA 4WVMA 5IAVA 3H0OA 3ZFEC 1QDCA 4I30A 1H2NA 1CAXA 3FJSA 1VBC3 4FQ4A 2N7GA 5K98B 3N36A 3W5MA 4CXYA 4GQMA 4M00A 2H8RA 1HJGA 1TME1 4UAPA 3POJA 1PGW1 3J7NA 1YFYA 5C5TA 5A7PA 1QQP2 1ACCA 4EN9B 3BPSA 5L36A 4OQ9A 4UFMA 4EZ4A 5FZFA 1S1AA 3ZR5A 5IK8A 1LAJA 3UKVA 2QNKA 4X4IA 1PMHX 3JZVA 2CYFA 3Q8CA 5LY2A 4E2GA 1GOGA 5EJ1B 1OSLA 1JOBA 3AKQA 3ES4A 3VBHB 1QZXA 3H1YA 1UF2C 1PVC3 2A6YA 5A3OA 1IG3A 3KQRA 2ADDA 2IXLA 3LDKA 2RR12 3LEGA 4OMCA 5IVEA 4Q4X2 5JCTA 2FBEA 2VCCA 2VW2A 3N9QA 1QEXA 2AEYA 4QU1A 2PUDA 4WM7B 4C91A 1GKBA 3RMXA 4KGGA 1DULA 1AZDA 1O8SA 1KS4A 4MOAA 4PLOA 3WVJA 2XKOA 4QPYA 3SC7X 5K0UC 3WF3A 1EYBA 1E5SA 4ZXEA 1D4M2 4BZ4A 4OHYA 2B5AA 1AR91 5FZMA 2DVFA 3A23A 4AFBA 2VZTA 1WIZA 1POV1 4DB5A 4PDWB 4E4DX 3IDBB 4XCBA 3ACGA 5ANNA 4LO6B 5F37A 4XE9A 4YW5A 4KH9A 3HBZA 3LE0A 3T4VA 1E5IA 5IVCA 2WZ8A 3AP6A 2QQKA 4CP9A 4PIYA 5D1IA 2WNUA 4BQ2A 2A6CA 2VOVA 2R1DA 1R092 1RUJ2 2HWC1 4D6SA 4JGZA 2VZSA 4Y1ZA 4XJUA 4P00B 1XJAA 2JWPA 3KGZA 4L99A 3NV2A 3SH3A 5EQUA 1AU7A 2AR6A 3MIDA 1CIYA 1RUF2 2XJPA 3A22A 4QQOA 2H6BA 3T1MA 1BEV3 4NPRA 5APAA 4FP3A 2BBVA 2ZZJA 3QH7A 2KPJA 4TLFA 5GLTA 3O1OA 1XYNA 1UN1A 2A3WA 4XFGA 4CEYC 4W50A 2WN2A 2WQ4A 4DUXA 3PNAA 2XSDC 2C5DA 4BYYA 1R1A2 1RTVA 1YQ5A 3L2YA 5GAGi 5D8AB 2CAUA 4ZU7A 1SLAA 5FBJA 3RJ2X 4M0NA 3EJKA 5C70A 3DM5A 4YM2A 5F8PA 3ILRA 2DURA 5FO7B 1I1EA 3TAYA 1JN2P 1UPIA 4BLIA 2Q8EA 2FCTA 4FTBA 4I3GA 1EAH1 3O9XA 2ZKLA 3ZN5A 5A1LA 4ER6A 1RYYA 4GMP0 2GDFA 2VZUA 3VDCA 1GMMA 2WA3A 3CKHA 4HLTA 5F39A 1QQBA 2XLGA 3VDDA 2XONA 5BNPA 1YWKA 1C57A 3T0BA 4YG4A 2FDIA 1DWKA 1VBE2 2B7YA 4DXRA 4F8AA 1US3A 4EJRA 4JTOA 3I59B 4J25A 1GZWA 1UW8A 1IS4A 2Q8CA 2WNVA 2RHPA 1QKQA 2GSYA 1HB3A 2PUGA 4KI5M 4C1XA 1MEC1 4Y4YA 4KWLA 1F8VA 1BBT1 4GQ7A 4BHPA 5IK4A 3GM8A 2VUDA 2XHNA 3POEA 3H3LA 4O7XA 4Y22B 1RHI3 4BB3A 4MCTA 2BYVE 2ZPXA 3AP7A 2LYSA 2FDJA 3HVDA 4QPGC 4EN0A 2VGDA 2GZWA 5IUQA 2DCKA 3F95A 4GB31 4R9AA 1FMD3 2W47A 1ZAYA 1TZOA 2RDSA 1JHNA 2W91A 3ZSMA 2JKBA 2YDEA 1WCQA 2PUFA 3ASIA 1VBB1 2JB4A 1ND2C 3IAPA 4MXWA 5FZ6A 1J59A 1Q43A 3KV4A 3HAGA 2F6BA 2D3SA 3SH4A 1BMV2 4BDVB 5FYZA 3NAPA 3PTRB 1R69A 1VRH2 1AR63 3IDEA 4N7IA 2ZX3A 4KQ7A 3A9XA 5JUWA 3PUHA 4K1YA 2D6LX 1XE7A 3P5BA 2V4AA 1OBNA 4J6GA 3U4XA 4NUBA 3WP5A 4LPLA 3NKGA 4QXCA 2MEZA 3QACA 2XLAA 3I8TA 4CDWB 2WYFA 3GN5B 2D5HA 4OUEA 4YBAA 2R63A 5DXDA 5G04L 1GNHA 4CCKA 4AVCA 2QJVA 3QOXA 1ZBE3 2ICTA 1ODNA 2Q1ZB 4YVWB 4DS0A 3OQMA 4LMFA 2GN3A 5KXCA 4FAGA 5FP3A 3AZWA 2BNNA 1BZWA 1YQ6A 2P17A 1PRUA 2HLEA 2OIIA 3I3EA 2J1SA 3MUZ1 4ONUA 5FOBB 4AHXA 5J36A 1F4AA 2A3XA 2DUPA 4RQPA 2A6VA 3NQHA 3LOIA 5A32B 4RS5B 2F4PA 4AAXA 2J1TA 1UU6A 2E31A 3MICA 1GR3A 3HR9A 4C0BA 3IMNA 3OGSA 2D6PA 2HWB2 2PA7A 4I6TA 3Q8FA 1UTXA 4RA0A 5LY1A 5C7GA 2JECA 2QDNA 1H8TA 1OLRA 4CCCA 3HN3A 1WA6X 4HRAA 2DVGA 3AP4A 3WCRA 2HWF1 4QQLA 2XLFA 4N43A 5F5IA 1RUE1 1RVF3 2R0HA 1IG0A 2JCGA 2IWGB 4PF5A 1BVVA 2WAOA 5A3UA 4CEWC 4RGAA 3EUSA 1RUI2 4RR3A 5E16A 4JVAA 4DPNA 1FPN2 4HZFA 4MH0E 4CDXC 3BCWA 3C3VA 3PE5A 2BW8A 3HMYA 2JG8A 1QJZA 3O1MA 3WF0A 4LEJA 3BIEA 3O12A 3ZYJB 2G9FA 1PO13 3H1WA 4SBVA 3UT0A 1VIWB 1X50A 4FPGA 2YBSA 5C9AA 4JKLA 5CKMA 1S4CA 2L49A 2BJCA 2R042 3DPRC 3KV6A 1XNKA 1LMB3 4NWWA 5ACA3 4EZHA 4R9DA 4NR1A 2TEPA 4TXWA 4LITA 1Y7YA 3OUHA 2WT1A 1WUVA 2OZ6A 3RRDA 1VBC1 1U5ZA 3ROUA 5JXIA 3DGTA 2CGPA 1WH8A 3ZYFA 3PU8A 4GH4A 4Z2WA 2FCVA 5HPOA 2HJIA 3LFMA 1RXFA 2R061 3ACHA 2QQVA 3NV4A 1PRAA 1PIV2 2Q0AA 2VTFA 4M3CF 2JDPA 2L8NA 1C8M2 4L97A 2ZEZA 3VBUB 4PI0A 2VVEA 2Z4FA 1PVC1 3POBA 2HBUA 2PHRA 1V9U2 4N53B 3NWKA 3MUY1 1YO8A 3MPPG 1NERA 5C6CA 4BQXA 1V6OA 5EXOA 5CFCA 4PLNA 5E89A 3VBHC 3VHNA 2VNRA 2ZHNA 4FFFA 2ZOEB 1T6BX 3M3OA 3LEIA 1OA4A 3ECQA 1G8WA 4KBBA 4LULA 5FUPA 2LS6A 4XCAA 1Q8SA 3D8CA 3FLPA 4DEQA 3HJRA 2VZOA 4H55A 2EXJA 2VMGA 4WM7C 4H3WA 4YNIA 3MIEA 3S30A 2W1SA 2YGMA 1Q3EA 3LA2A 1T2XA 1XQNA 2WABA 4X4FA 4Y1XA 5EV7A 2WIUB 1AR83 1QNYA 2J1UA 4IUGA 4YM3A 5J37A 3W58A 5E88A 3M3EA 3PVEA 5K4LA 1LOFA 4P5YA 1LHNA 2VTXA 3MLKA 4Q2FA 2YG0A 4PDWC 4AQ6A 1NCRB 5BNOB 2SBAA 3JB8A 1CIWA 2D3RA 3BU0A 1NYWA 5H9PA 4B1MA 2VQAA 4NHMA 2F4LA 3MZHA 2ZGQA 5LBCA 5DTRA 3MIBA 2EBYA 1ZUGA 5DUXA 1BEV1 2PXKA 1UMIA 4QGMA 4UF0B 1S0BA 1R63A 2D40A 2ZHKA 3JBG1 2FDFA 1QQP3 2ORXA 3GYDA 5JZGB 1Q8PA 4LKFA 3AX4A 4WM8A 4XXPA 1XB9A 5M0TA 4Y26A 3VBOB 1OT5A 4LBQB 5A6QA 5IVBA 2RS32 1U12A 1W04A 3UKTA 4LUMA 5FLHA 5FZAA 4BXSV 5KHIA 1VAMA 3M3QA 2RMU3 3ZN6B 1H0BA 4JZRA 1DLLA 3WP4A 1W9FA 5IVYA 2XXQA 2XGXA 3LB9A 4IV1B 1JOJA 2R071 5J3UA 3GZCA 1MS9A 1SQ4A 5D8AC 4XPVA 2UY9A 3LEKA 2W95A 3DYPA 4I8TA 3H7JA 3NJVA 5EHDA 5TSWA 3POWA 4ZKTB 5T5JA 3SCHA 1XNCA 5SV8A 5IJRA 3USSA 5C8CA 4E4SA 2YV8A 4QQ2A 2RDNA 4FAHA 5GLUA 5FZ7A 2WSVA 2PUCA 1X33A 3PVBB 3ZYBA 2IC1A 4QX8A 3ZSLA 2NM1A 1RUNA 3WV6A 1S55A 1WA4A 2OPWA 3QBQA 3VUOA 1WH6A 1R083 1Y3TA 1PGL2 3FZ3A 4YG6A 1PNGA 1PM4A 3N9PA 4XMAA 1YXWA 1RHI1 1R093 4BQYA 2HCNA 4F83A 1HN0A 1S0IA 1UXZA 2AGSA 2YMZA 2PTMA 4URAA 2Q4SA 2EVXA 4GULA 4A7YA 4JRAA 4X4GA 2D6MA 5JOXA 4K1ZA 3LZZA 1Q8VA 1RUF3 3OBZA 4YW2A 3WNXA 4GKYA 5DTMA 2HH9A 3LQCA 3NMBA 4IE4A 5DUUA 3VKMA 4BQ1A 4Q2JA 4K21A 3NV3A 4NOTA 3T2PA 1JFTA 2LYPA 5L19A 4AI3A 1RMU2 1VMJA 1J1LA 1PMIA 1RUD2 2RG4A 2RVAA 4YVSB 5IATA 2A5ZA 3H7YA 4PT6A 4ZONA 5F3CA 2XPJA 4B4RA 1S2KA 1R1A3 2GMMA 1P8JA 2JG9A 2ZX4A 4E8CA 5FPBA 2YC2A 4AFAA 4XUQA 3BB6A 3W20A 1LESA 3CHXA 3QFIA 1JI6A 1W6PA 2BOIA 5FRAA 3MHZA 1ZVVA 4CU8A 4MHUA 4LTAA 3ILFA 3KS7A 4PBOA 3R05A 4F3JA 4BE3A 1UPSA 1CAVB 1PO22 4R8HA 1W0PA 1LOEA 2V5YA 4GWIA 4P5HA 2YC0A 5F1RA 3DV8A 1MFQC 5A1AA 3S7IA 2P3IA 3RS6A 3VBSA 2QZ2A 4YW6A 4BLJA 4CDWC 4DO0A 1UXXX 1R64A 4A6OA 2FZ2A 2DU0A 3J7MA 2ZA9A 1W8UA 3FLRA 3RI9A 1EY2A 4FTEA 4XDOA 1GWMA 3NROA 2LALA 3N9NA 4NWVA 5FXXA 2K2SA 3WF2A 3CQOA 3AKRA 1H9PA 3EQEA 4FPHA 4V1PA 2KD7A 3BIWE 1DF0A 3BDNA 3HEIA 4ZU4A 4LKEA 3TEZA 4BK5A 4ORFA 4C8DA 3PJYA 4YGBA 1NXMA 1AHSA 1MACA 1VALA 1O7FA 2CHHA 1SFPA 2VZRA 3PTYA 4RS5C 4TYSA 1HXS3 5FYVA 1IQDC 5JWPA 3IZOA 1RVF1 2VNOA 3I3BA 4AHZA 1AVBA 2KEIA 1XXNA 3GJBA 4XABA 2B4KA 3V0AA 5T50A 3WHTA 4YZ5A 1LCDA 2XJVA 4XBQA 3UKNA 5L7OB 1LOCA 1LHVA 3NL1A 1SACA 1NW3A 2OQ7A 5J96B 1YI9A 1REEA 5KHJA 5CBLA 2BZDA 3VZJA 3TEWA 4IEWA 4YARA 2E51A 2V72A 3O5SA 4KWKA 3ZMOA 1HRI3 3L9JT 3ENRA 3ZHIA 1ONAA 2V5DA 1VRH3 1RJ8A 4COYA 1HIXA 4P9GA 1J58A 3GZDC 3N9LA 4NO4A 2HKXA 1A34A 2GP5A 3UGGA 3WP6A 2GP3A 1W6MB 3ZKYA 5ACA1 2VBDA 4A41A 3PXPA 1Z7S3 4YW1A 3WW4A 1WD4A 3JB4C 4K7JA 4YZ1A 4QX0A 3U37A 3POGA 3S6PA 1V0AA 2HEVF 2Y8KA 4L2NA 1NA1A 1LOFC 1O3SA 1YQ2A 1AL23 5GZEA 4LO5B 5LBEA 4XUTA 1O4XA 2HWB3 3ZFEA 1YSEA 5I8SA 4Y42A 1K3IA 3ZXEA 1APNA 1MS3A 5FPAA 4NIGA 3UESA 4EROA 1X8EA 3U10A 2X29A 1XNDA 1QQAA 5C33A 4AFDA 3H8UA 3S5QA 4Q26A 5IVFA 5KR7A 4P9WA 2O8OA 2W9XA 3VBUC 5JOZA 1W9YA 3HQXA 5HXVA 1DQ5A 5JOYA 4XXAA 3KB5A 4N53C 5JXGA 4AEDB 1UNBA 1Y9QA 2XDVA 1LULA 1FPN3 4DE8A 3TYJA 3WW1A 4Y4RA 5JR2A 3ZSJA 4GJYA 3VKLA 1WMEA 2PN5A 2E33A 4XHXA 5A6ZA 2GZUA 2JVLA 3SX0A 2CGNA 2WZEA 2ZX0A 2ZEWA 4HVOA 1O3QA 4GJZA 3HIFA 4UI9L 2BJSA 1AR81 4AF9A 2X05A 3E6CC 1JYCA 2ETEA 1C28A 3SHRA 1BVP1 1H1MA 4IEPA 2JEMA 4UXAA 2CL2A 2HWD3 4V2VA 4E2SA 1A3KA 3OGRA 1EFAA 1S0EA 4QB6A 2P3JA 3IN9A 2H6CA 5K0UA 2VEOA 1TNFA 1UIJA 3MIGA 1ND3A 2R043 4HN0A 2VUAA 5GZDA 3CNAA 1J3RA 2OUJA 1POUA 1MS5A 1PMJX 3BOWA 3VLBB 2CNAA 2XR4A 3DL3A 2W1UA 3RNSA 5BNOC 5FR3A 4CUAA 1NCRC 3AZYA 4FSJA 3OBAA 2DUOA 3I7DA 2EF8A 1VR3A 3B7MA 1YCIA 2XQXA 2QCSB 3GBWA 1QQP1 4N9IA 4NN0A 3E1F1 3ZVXA 4IETA 1BK1A 3VZMA 3THCA 1PIV3 1YJLA 2W94A 4A3ZA 4B7EA 4EKGA 1C8M3 1W6QB 2Z69A 4XFHA 1YEWA 3WDXA 5C3PA 4AVBA 2VD7A 2RMU1 1V9U3 2XBO1 3GNEA 1PHMA 1RPEL 1W03A 4Q4W2 3RDIA 4Z1VA 4H2AA 1EV12 1MQTB 2X5IB 2YUEA 3CJIB 5FP4A 1W99A 3VBOC 1K42A 3WZ1A 4Q1RA 5LA9A 2GC1A 1JMUB 3WG2A 1K12A 3BTZA 4CEYA 1SLLA 4YZ2A 4M3CA 5IAXA 1CJDA 1YHFA 3AYEA 4IV1C 1A8MA 1REDA 5FZ0A 4TZDA 4I2OA 1OLME 1HLCA 1AUYA 4QXBA 4ZPIA 3ZMNA 4EN8B 3S5AA 2ZMKA 3UV9A 1AXYA 5ERLA 3B7HA 3VL8A 4QKNA 4CTEA 5A80A 1RC6A 2NZ9A 3AFGA 1OKOA 2BU9A 2AXUA 1FX5A 1LU2A 2JE9A 4HVQA 1R081 4CDUB 2AYHA 2BGPA 2VBPA 4TTGA 5KHKA 3GBGA 5LBFA 3AK0A 2X10A 1KDMA 1R091 4XURA 4W8JA 1W6NA 4MYEA 2Q8DA 2GC2A 2XI8A 2IVGA 5HXMA 2W92A 2JB8A 1O6UA 3OUJA 1AF9A 2VMCA 3ZXAC 4CDQB 4DINB 2D44A 2PAEA 5A7WA 3KCCA 3V0BB 2VMEA 4AK3A 1REFA 1X9PA 4AVTA 3PUIA 2D7FA 4KG8A 3FHIB 1AL0G 4OHVA 3KT1A 4R4XA 1HQWA 2UU8A 5LA2A 2XXPA 1QJU3 3LF7A 3HN1A 2VU9A 3TBDA 5FV3A 3DKWA 2G4IA 3FYAA 2WC2A 4OBMA 4QPGA 3ATGA 3C7FA 2O4AA 5A3PA 1OURA 2A6WA 1R1A1 2RS33 3CMGA 3E5UA 4M01A 5SV5A 4CU9A 4D7YA 3MW3A 4LE3A 3QF3A 1EUTA 2FZ1A 4NIAA 2B8MA 1VP6A 3K3NA 3ZFGC 3KL4A 1V00A 1X9TA 1ND2A 3DKQA 5FZDA 3BKZA 1DW9A 4O8BA 2ZKNA 5C4WB 1JZ7A 2R1JL 3D1NI 3SKVA 3K3OA 1OI6A 4XJ9A 1W28A 2D98A 2G1MA 4BQWA 4JCKA 2WQ8A 4AEKA 5GKAC 2WS92 4Y1UA 2WNOA 3ZKUA 1OFSA 2WT0A 2PQSA 5A7LA 3UJOA 2E63A 1GICA 5GAHi 1E5RA 2BVBA 5DTQA 1O5UA 3VV1A 1O3RA 1PZ9A 5A1FA 3PVOA 3WNMA 3K4DA 1V6JA 5A70A 5FZIA 3HQRA 2WFPA 2R1BA 1OA2A 5FFOC 4PI2A 4Q8LA 4V2WA 3MGUA 2Y60A 3GHNA 4KL1A 4AI2A 2OPKA 1DGWX 1LRHA 1CGPA 4BQ3A 3D3AA 3B69A 1HXS1 3OYWA 4GA9A 4E2QA 1BQPA 4DZGA 1C5HA 3IPVA 4QXKA 4DQAA 2W3JA 3WNKA 2WBKA 5FP8A 3NJXA 2DCJA 1STMA 3C7GA 4CDXB 1AX1A 2ZCWA 3ILNA 2NP0A 4WVLA 4PU3C 1MZEA 4UW3A 5LA0A 1UMHA 4DMIA 5B4XA 1N3OA 1ZBA2 3DEMA 3WINE 2W39A 4LJHA 3WDYA 5H9RA 2ZX1A 1QJX2 3AP9A 3BS3A 3L1PA 2WO1A 3SNMA 1HRI1 4IV3B 5L7OC 1BMV1 3U4SA 3LGRA 4CEWA 2VL4A 2W52A 4MCXA 2WYSA 3KSCA 4P9YA 3VL9A 1H4HA 2FFHA 2KEKA 2PXBA 1FOD2 4NRQA 2I45A 3ZX7A 3KCYA 1KITA 4GHJA 3A9ZA 2EICA 1HQNA 2WFF1 4JDMA 4AI1A 5CYYA 2PLV3 3U3WA 3OOXA 4RSUA 1C4RA 2YBDA 4D69A 1Z7S1 1V6IA 2JJ6A 2HINA 4E8DA 5A6XA 3MI8A 2E6VA 1WBFA 4I0WB 3MIFA 2HYKA 4KGQA 5HBAA 1M06G 4FVVA 4R52A 1DQ1A 2GU9A 3GUUA 2EIBA 4HKWA 4IEYA 2PPXA 2ZGUA 4XIOA 2YROA 5FREA 5LEJA 3CL1A 3E6BA 3LWCA 3SXWA 2KZ8A 3KCXA 1SDDB 5H9SA 3ZN4A 4ET7A 1AYM2 1XNAA 4HXCA 4ARYA 1AL21 3IB3A 5JPMB 3AJZA 3DPRA 5FIXA 1DP0A 1ND3C 3WDWA 2LYJA 2VNVA 2JENA 3ZXFA 2HWB1 1WMFA 2OXBA 3KGLA 5E6HA 1GV9A 4BIFA 2H0BA 4HT1T 3UJQA 1QOOA 4GXLA 4LHLA 4IXLA 2GNBA 3IT8A 3W9AA 3LOBA 4LBOA 5FY5A 2WIIB 3JQWA 2OR1L 2WZR1 4Q0SA 1OC1A 2ICPA 1O91A 3GALA 5F6LB 4AFCA 2XUEA 2DCYA 2ERFA 1PM7A 2CDOA 3D6EA 1GQGA 4PQ9A 5JXHA 1V6MA 1L7QA 1KD7A 2XJTA 3RQ0A 3ZYGA 5ABJB 4BMBA 1FPN1 4YFWA 5IVJA 1OCTC 3QWGA 4QX3A 4BWOA 1S0DA 2PHTA 2ODRD 1ASJ3 2YU2A 4YYOA 4AAPA 4X6RB 2J7MA 1QJY2 4QWNA 4XFAA 3VBHA 3PL0A 1O4TA 3B3QE 4QU2A 3I3DA 2LNMA 2RS13 2HWD1 3VWSA 4S2FA 3T3YA 4CU7A 3UNPA 1RUG3 2XXAA 1CONA 1H1IA 4WV8A 4AYUA 4H14A 5T5LA 4EYUA 5BY5A 2XHKA 3C2UA 4WM7A 1N3PA 1OOPB 4NRMA 1KJRA 3RSJA 1TNRA 2A6XA 1OQEA 2YHJA 3SCGA 3VD7A 4NHLA 1SMVA 2AH2A 4MV2A 1CZTA 2XH6A 4BK4A 5FO8B 2JQEA 1LJ7A 2VAUA 1GSLA 4ISRA 4QKDA 4LOSA 1ULOA 1GZCA 4PDWA 3M1HA 1PIV1 1ODMA 2BEOA 2PAKA 3LAGA 4L9BA 2Y38A 3AMPA 3URFA 2J1VA 3WEZA 1C8M1 3ACIA 4Q27A 2JDZA 2GRMA 3CDZB 2TNFA 1JZ8A 2Y6JA 1V9U1 1N47A 2R30A 5BNNB 1UYZA 4X8PA 1ALYA 5FY7A 2W87A 1PNRA 1W9WA 2CROA 2VJXA 4GMP3 1UXDA 2YY1A 4Z59A 2OQ6A 1W2AX 2Y6FA 3OY8B 1LLIA 3POFA 3GDBA 4XW3A 3ZFFB 2AW6A 1DBNA 4QXHA 1AR72 1ULEA 1JU4A 1YNAA 2LYRA 4ER7A 3O0VA 3OPZA 4AEJA 5FUIA 4NPMA 3DNVB 1JU3A 1MQTC 1TE1B 1VBD1 2TBVA 2X5IC 3CJIC 3KF3A 5L9RA 4IL7A 4N7UA 5I0TA 3SH5A 2QTWB 3AKTA 3PMEA 4YRDA 3JXSA 2VZ1A 4U2AA 3VZLA 2GC0A 1M4WA 3WXPA 1KDKA 2Y64A 4DIQA 1I5ZA 1HRV1 5D8AA 4LIUA 4ARXA 2E32A 5IK7A 4CCMA 3RMYA 2YC4A 5DZGA 1C8NA 2VC9A 2YFZA 2XB6C 1GP6A 3NJZA 5FKBA 4EWEA 1UAIA 1ZRIA 1W8WA 5FOJB 3BTAA 1K5MB 3K4AA 2VOKA 3RZKA 1L1MA 2ZAHA 5CAZA 2XJ3A 3OGGA 4CDUC 4E4ZA 1OQ1A 3KVAA 4Z92B 2VCBA 4X4EA 2P34A 5C3SA 4MGTA 2JDUA 3HNBM 5BPXA 1W6OB 3I2JA 2WWSA 5GLZA 1DCSA 1GP4A 1URXA 1Y9GA 1YIPA 4YG0A 3JXDL 3I2OA 3JXCL 5T52A 3G7DA 4BOWA 3SISA 3ZSEA 5FQ0B 4PIZA 4RR3B 1QJU1 5FY0A 1NY72 3I59A 3SMHA 1TME2 4CDQC 2MHFA 4IGOA 4NVPA 1H2MA 2ZGOA 3ZXJA 4RGKA 4QDSA 1CX4A 5FZKA 5F7UA 3WSOA 4XQWA 2E7TA 3OGJA 1W2OA 1WW7A 4CRQA 4NRPA 1ULDA 1L7LA 4Y22A 1ULCA 2YPDA 3IDAA 5FZGA 4Q4W3 5IHRA 2PXEA 2LUWA 1EV13 3CF6E 3LDRA 3NJYA 5T55A 3OWQA 4YSFA 3RZGA 2DV9A 4FT8A 5C9AB 1O59A 5JSOA 2JIJA 4M4PA 3LIHA 4Z5HA 4JQTA 3AJYA 1CVNA 4ISQA 3ZXKA 1UO9A 1WETA 4QGLA 5EPAA 4FPJA 5IYYA 3VBFB 1JUHA 3MF9A 5C4WC 3RZHA 3R4DB 4DE9A 3E97A 1CJPA 3DXTA 2A6ZA 2C4XA 5KWRA 1JTZX 3VKNA 1AYN2 2BGOA 3DF0A 4HKLA 1JXNA 1ZX5A 1F15A 5A7NA 3T0AA 3RYRA 3TNPB 3UL2A 1W8HA 4CDWA 1SFNA 4DNYA 3GN5A 2WA4A 4YG3A 1F35A 2HWC2 3OQNA 4YVWA 3TRSB 4YM1A 4FFGA 2JICA 3I2GA 1EPZA 4B7KA 3OBTA 1EPWA 2JDAA 2W5FA 2E53A 4LOTA 4XAEA 2MEV3 2I2SA 4GIQA 2Z42A 5A32A 2VY0A 3M70A 2VW1A 1OA3A 1B09A 3BPZA 1IS3A 1ZPQA 3PURA 4RS5A 4UBGA 4HSJA 1GNZA 3O14A 5FAXA 4BIOA 4B4QA 2IU7A 2A3YA 2WKKA 1FT9A 4XF4A 3EXUA 4LQRA 1N1VA 2BNOA 1G9CA 4PLMA 1A6CA 3CIHA 3VBRB 2P6HA 2EXHA 3TWIA 4D6RA 2XUMA 3GHMA 5F32A 3CROL 1W90A 4IV3C 3MFAA 4OYUA 5FY9A 4OB4A 2PLV1 5CFDB 2YBPA 2W68A 1RIOA 5LATA 5HI0A 1EAH2 1NKGA 1XRUA 4Z2AA 3J7HA 3KZ3A 3THDA 1HQ1A 5FY8A 1W3XA 1UZZA 2WS93 5KHHA 3GZDA 4XJWA 3S8QA 5CKNA 4E27A 2A71A 5FZOA 4W6YA 3N4MA 4NAOA 1H6XA 2PXVA 3NXHA 3LA3A 4Q1PA 4YPJA 5C71A 1D0GA 2JDMA 2G9GA 1W3VA 4UFLA 5LASA 4RL7A 3VN4A 4LK7A 2ARBA 4P9LA 4WM8B 3T30A 5I8YA 5CG9A 2NQYA 4QX7A 5DRTA 1MEC2 2IZWA 1O5LA 3IWZA 4IQPA 2VOTA 3HNMA 4XZUG 1HJFA 1XE8A 1NAEA 3J8F2 2I07B 1G9BA 5FYSA 2OT7A 1UX7A 4Q0VA 4MLOA 5T5OA 1BXHA 2C0ZA 5AC92 5FXWA 1IZ3A 2JIGA 1LOGA 3G0TA 1GZTA 2LYLA 2BWCA 2QE3A 4IESA 4YZ4A 4BQ5A 2GMEA 5J1XA 3PLQA 1NG0A 4QB1A 4YGCA 4CP1A 3FLTA 5DG1A 3RZMA 5CG8A 1OVSA 3U07A 1JYNA 4GZ9A 1ASJ1 1ZBA3 1X57A 5ABJC 2W2IA 2VZVA 4I3PA 4N9HA 4IVZA 3FHAA 5E1RA 3VBUA 3MYXA 1QJX3 5EYYA 2BBAA 3N7LA 4N53A 2FJRA 3EO6A 3POYA 2RS11 5DN2A 4AG4A 1X36A 2DTYA 3CZUA 1RUG1 1W9SA 3LD8A 5F2WA 1W39A 5JSPA 4FTSA 2PIJA 1FOD3 1U0AA 3ACLA 3OBRA 4C90A 1UZVA 2ZEYA 4E4HA 3BTYA 1DGWA 4D7SA 1F9KA 4HPKB 2BFUS 4RFT0 3W59A 2RR13 3GF6A 2CSFA 3ZHMA 1W8TA 4Q4X3 2E26A 5FZBA 3HQUA 4K3UA 4A4AA 5DMYA 4QPWA 3LFPA 1GP5A 2WAAA 2E7QA 1QU0A 4ER3A 3OP9A 1OOPC 2V09A 5I8TA 3LPGA 1G86A 1RUH2 4DFSA 1WCUA 3B01A 1AYM3 2WWJA 3DN7A 2ID4A 1AJKA 4Y20B 5ISLA 1D4M3 3H8RA 3WQBA 2GMPA 3WQ1A 2FCUA 5EWSA 4I02A 4JQDA 2OS2A 1MZ6A 4MGZE 1X82A 3KV9A 4JHZA 1KGYA 4X6QB 2AC1A 2DCZA 2UYAA 1NCRA 1S0JA 1H6YA 5BNOA 1WLWA 2AXVA 5BYNA 1W06A 5J48A 4GMP1 4XIKA 1U5YA 4YG7B 3MW4A 5I0DA 3F51A 4XFBA 1F5FA 4MSVA 2LM3A 5CU1A 1DGLA 1I9RA 3GCXA 3CECA 3K48A 1QIQA 1RUJ3 4X4BA 1CPNA 2IUWA 3DXUA 5BNNC 3KHBA 4LHSA 4Y5TA 1O4ZA 3IIAA 1ZVFA 4UF0A 3WR0A 3ZR6A 1FMD1 4CP0A 5KXBA 1ZRDA 4HSLA 3AP5A 3ZFFC 3T1LA 3Q8AA 5JZGA 2RDRA 4MVTA 4LBQA 1UOBA 2E9QA 2HWE2 3VBOA 2D5FA 3VBSB 1YFWA 2PXQA 2XWJB 3WG3A 1QJY3 5DT2A 2Y6GA 4P9IA 4JGYB 4XOGA 2VECA 3ZN6A 5JI9A 3NDBB 4F8DA 1FXZA 1W2TA 4FXKB 4IV1A 3WQ7A 1AR61 4G9SB 1GZ9A 4QHZA 4HK8A 3OJBA 2ZHLA 4FBIA 4UW4A 5GLWA 2B42B 3ST7A 3ZXDA 4XFFA 4EQVA 3N7MA 4MGIE 3K51A 3OG2A 4ASKA 3TEXA 5B4NA 3USUB 1WWYA 5BNQA 4OHWA 4J1XA 4O61A 4LT5A 2SLIA 4JKMA 5FUNA 1DGRN 1ZRFA 1K5MC 5EIYB 5I0SA 3G6JB 2PXDA 5F6KA 2CAVA 3FUOA 1ZBE1 3FBYA 3FMYA 1DYOA 2VNGA 5BXXA 3QLQA 5KC6A 4P08A 2X09A 2AUYA 2R062 2C6SA 4IE7A 1JW6A 1VBE3 3QOWA 1GWKA 3H3UA 2PXUA 1FV2A 4YVWC 2E7AA 1C1LA 4META 3LFIA 1AJOA 2XVGA 3E5XA 4YW3A 5DSXA 1LEDA 1SPPB 5DDJ2 1C1FA 1GU3A 1VAVA 5JPNB 1EV11 2XKPA 5FYTA 5FZEA 4QPIB 1WZXA 2ZZQA 4AHWA 4LLOA 2DU1A 4XUNA 3UK9A 2LYQA 4WVWA 1NLQA 4HK9A 1AR73 3VD9A 3HPNA 4ASLA 5FMOL 3VKOA 2BWAA 5FYHA 4NIDA 3UGHA 3ZO0B 2UYBA 2AWIA 1YFXA 2PXFA 2Z5WA 2QUOA 3CLPA 3F2ZA 4INDA 4K8FA 4DY5A 4FI9A 2HCSA 4DXTA 2PE5A 1ULGA 4QDQA 3NNGA 2RV9A 4XDPA 5CA6A 4YVSA 3ZFGA 5C8WA 4EWDA 4TLGA 3V64A 3GJAA 1DDLA 5T54A 1HB4A 1SG3A 4NHXA 1UZWA 2VMIA 4B3NA 4P02B 4WZCA 3VBFC 4YM0A 1WD3A 1PO11 2WUSR 5LB6A 2ZMNA 1XE0A 2VW0A 4XF9A 1DYPA 2IXJA 5A33B 4LBLA 1A8DA 1QOSA 1XU1A 1OXCA 1BYHA 1NE4A 4QDRA 4QHBA 4GKXA 1CAVA 3B9IA 5EJZB 3ZXGA 4AI9A 4B4PA 1U2ZA 2D3PA 4MGQA 4AGGA 1A78A 4ATEA 4K9SA 3FBMA 3ETQA 1IC8A 1ZYBA 5L9BA 5C5UA 2MEV1 4OHZA 4Z07A 2AUWA 1UIKA 2VVFA 1OF3A 2BGCA 1LTEA 1JBCA 2DUQA 3JBG2 2D6NA 2C26A 3KQ4B 3R1FA 4XDQA 5LRRA 1DQ0A 1UXCA 3DECA 3ZIXA 1N1SA 4D6QA 3BYWA 2B5HA 3RZZA 4MX3A 4R9CA 5JVVA 3LIGA 3PU3A 1X2LA 2BFUL 5A3LA 2JD4A 2ATFA 4O9GA 1N3QA 1V6LA 5CZKA 4JKKA 1LHOA 1CAUB 4B1LA 1JYVA 5LBBA 4W65A 5FZ4A 4UT5A 2R072 3A7QA 1WW6A 3VBRC 3AZZA 1POV0 2OX0A 4UW6A 5CADA 3I2FA 5L7OA 2AACA 3HT1A 1LHWA 3MEJA 2P4EA 1PRVA 1ENSA 4XQ4A 1H30A 1RUI3 2GRLA 3N7JA 2CV6A 2Y26A 3P3NA 1BHGA 4Q29A 5JUVA 4BMEA 3ON7A 3LISA 5LEKA 5J98B 2RE9A 4Q5OA 5FLIA 4WVZA 4UFIA 3E6DA 2ZTNA 1AYN3 1W05A 5I91A 1RXGA 1O8PA 3ES1A 2J1EA 2C9AA 4AXOA 1W6MA 2BVVA 3H5TA 4MGSA 1DG6A 1CN1A 1DZTA 1LQCA 1PK6B 3AL5A 1SLIA 4NAMA 4Q0PA 1JYWA 3J9SA 2JKXA 4OULA 2QQIA 4TN7A 4FPCA 4FXGB 4J1WA 1L7RA 1DQ4A 1QH7A 1TG7A 1JZ3A 5EZWA 1H2LA 4JDNA 4CSWA 1CZSA 2ADEA 3RVHA 3LSEA 3Q8BA 3WG1A 1CR7A 3WNLA 2CSGA 3O1VA 4QGNA 3CBNA 4M3CB 3T4HB 1ZBA1 1CAWB 1CQ9A 1W2NA 3K77A 4CUGA 5FWJA 4QKFA 1MPXA 1OPMA 1QJX1 3OEAA 2VR4A 3POSA 2W0XA 3UFDA 4AI8A 1RINA 5L9VA 1NCQB 1XC6A 2IFWA 3AVRA 1VBA2 4FN3A 3RYKA 2OUHA 2R32A 1LENA 1MZ5A 4P9JA 4XUOA 5FYIA 3EHKA 3FYMA 1LECA 2EIEA 4KWUA 2ZEXA 5DG2A 5FZ9A 3RWNA 4Q4V2 4BISA 4DXZA 4FBFA 1UU4A 1YFUA 2DVBA 2RR11 2VUJA 1UY0A 4Q4X1 4PHZA 2P2KA 5D2AA 5A3NA 2V4VA 3K2OA 3NV1A 4IERA 3A9YA 2G9ZA 3ZYRA 4WBBA 3ZYIB 1IPJA 1SCSA 2ES3A 2I74A 4YZ3A 4EWAA 2HFZA 1UD1A 3KV5A 2VG9A 3BD1A 1JFSA 1D7PM 2QQWA 5KXDA 4ZU5A 1IKPA 1AYM1 4IGPA 1SQ8A 1G9AA 3RFRA 1NLSA 2AEZA 2FDHA
chains in the Genus database with same CATH topology
1MZFA 4HFSA 4Q0UA 3ZXLA 1D4M1 5CVRA 3ALQA 1DGRA 1RZSA 1ZRRA 2PHXA 3HWJA 1YYNA 2GH8A 4F7ZA 1SBEA 2BQPA 3AZVA 1IS6A 1MEC3 4FOVA 4A7ZA 5LK7B 2AXZA 3J8F3 1RUJ1 1D4VB 5JDBA 4JAAA 3ELNA 5AC93 3WLUA 2DYCA 1SFYA 4JRLA 4L11A 4DY3A 5JAXA 4COZA 2ZJCA 1RUF1 3J4UH 2PHWA 1QP4A 4OLLA 2PUEA 5E8AA 3EBRA 5FDBA 1RUC2 1W6QA 4FPKA 4YW4A 1J1TA 1ZA4A 4IEVA 1RB8G 2EF6A 5I93A 4OI2A 5CNAA 4LHKA 1MQTA 2W08A 2X5IA 1COV2 1B35B 3CJIA 5F5QA 3FUQA 4MXVA 5EFUA 3VHOA 1KXGA 4JGYC 3IDCB 2YYOA 4YVSC 2D43A 2BNMA 2DCTA 4XHBA 2OYZA 1NOVA 2GC3A 2ZGSA 3OF1A 4W6XA 1LOBA 4A3XA 1S0FA 2O49A 3WOGA 4A2UA 4LUKA 3WDVA 2QKDA 2KA3A 2ZACA 1RUH3 2ILMA 2XL7A 3NKTA 4WVMB 2EAKA 4DRRA 3N35A 1CAXB 1VBE1 4LA2A 2Q8OA 2XWBB 3IKWA 2H0VA 3AXDA 4CDUA 4G4FA 1SBFA 2IXKA 1ENRA 2QFEA 3HT2A 4R4ZA 4GALA 2BUKA 1NE6A 4ES8A 1BDIA 1D0HA 2IXCA 4BCUA 3CLCA 4L8QA 4EN6B 3O0WA 3P3PA 2GNMA 4CDQA 4I0AA 4JQRA 1KFXL 1W2UA 3V0BA 2RJKA 1O3TA 2NLRA 5JIAA 4XF0A 4QPIC 4WZFA 5A3MA 4OHXA 4BM8A 2VQ0A 2CY6A 4S2HA 2HWE3 1LKNA 2PELA 3V56A 4RHV2 2WZPP 3KMHA 4GWNA 3TN92 1RMU3 1AR82 1RUD3 1PERL 3RJRA 3O7OA 1XWRA 1VRH1 4K40A 1BKZA 1DYKA 2A7AA 5C4WA 5FLJA 3KZ4C 1OSGA 5DUVA 2IUOA 5GJ6A 4IWRA 4RGGA 2WNUB 4LBQD 4ES9A 4JCXA 1IKQA 2WT2A 3JD72 5I0UA 4JGZB 1PO23 1WW4A 4FPOB 5GLVA 1NY71 3AYAA 4KNCA 3VKFC 2R063 4OFGA 5GZGA 1SLTA 5T5PA 2EA7A 4I6RA 4FPFA 4LBJA 2XCJA 3MLFA 1QOTA 5DDJ3 2CWSA 5CIRA 2RMU2 2XBO2 2WLQA 2X8KA 1WGPA 3M3IA 4CDXA 2R6QA 3WG4A 4OI0A 2FQPA 4JCYA 5K8SA 2P3KA 1RUI1 4YFZA 4D94A 3A4UA 2K9ZA 4Z8BA 1OPOA 3LSDA 3DUIA 5J7MA 4IV3A 5K9YA 1G6NA 3AMHA 4AEDC 1OLQA 2RM22 1UU5A 1X7NA 1AYN1 3VDDB 2Q1MA 5BNPB 1RITA 4AE2A 4PU8A 4JC1A 3AKSA 5FPZA 1R082 3ME2A 4X4DA 1VB4A 2Z79A 3U11A 4AGRA 1GZWB 1TMF2 2O0OA 2UY8A 2LCVA 2WNVB 3KT4A 2D5VA 2B46X 3N7KA 2PUAA 4Q4Y2 2GALA 3VZOA 1F5JA 2R041 5H9QA 1DFQA 1PZ8A 2ARXA 2VPVA 4LO7A 4LBKA 2XVKA 4PU4C 1WBLA 2ZGMA 3D5OA 3OTFA 4BPZA 1PK6C 2AZ5A 1E3OC 3B94A 1N1TA 1IOAA 2R0FA 3JBG3 4SLIA 1QP7A 1EP0A 2GN7A 1S0GA 1LGCA 2ET1A 2KM2A 1I3HA 4ASMB 3AMNA 2EAAA 4CP2A 4MXWB 4DOUA 3B5LB 1NCQC 3D82A 4HN1A 4B8EA 2PHLA 4ZXKA 5ABJA 3NAPB 3JUUA 2R073 4I0BA 4AWDA 1H1AA 2Q30A 4K20A 2TUNA 3VZNA 2ET7A 3SLIA 4HETA 1LOAA 2RS52 3LKJA 5LK5A 4BA6A 5GZFA 4S2GA 4OI1A 5HCAA 1HKDA 1PZ7A 4FOWA 1KRIA 4R9BA 1IHMA 1XYOA 4X8NA 2PUBA 4HBNA 5F9TA 2XIUA 4Q8KA 4QQPA 1OOPA 2XJUA 4RQPB 3CO2A 2OA2A 2VXRA 2ZS6B 3J8F1 1UKGA 3AYCA 1QMJA 3MEPA 1HXS2 4PJYA 5AC91 3J26N 4IA8A 1H8TB 4XFIA 5IK5A 4KWJA 1GANA 1RUOA 5AVAA 2ZAAA 4H7MA 2D6OX 4N43B 1V70A 1NEQA 1OKQA 3R4UA 2XG3A 1HQLA 1E57A 1PGW2 2WINB 3WW2A 2EXIA 3BU7A 3R6SA 2ZABA 5BNNA 1N1YA 1VBA3 5I0RA 1HRI2 2JX9A 2RS31 3GZAA 2JG8B 3AZXA 1HF0A 3OY8A 2FMDA 3OCPA 2DVAA 2ENRA 2ZX2A 3ZFFA 1Q5OA 1AX2A 1AXZA 2ZMLA 2VMHA 4Q4V3 3APBA 2WFF2 3WT3A 2DTWA 2P37A 2ZBJA 1B35C 1BJQA 1NLRA 3OMTA 4HMZA 3WP6A 1RZRA 1YJKA 1Z7S2 2MPFA 1QPZA 3S7EA 1LB2A 1DQ2A 4LBMA 1RUH1 2YGLA 2FMYA 4IEOA 1GBGA 2YXSA 1YLLA 1XYPA 2Y0IA 3ZYPA 5DZEA 1GQHA 3H1MA 4M0HA 1AL22 3WP3A 4GH4B 4CZSA 2ZGLA 3QYXA 2ZGNA 5EJ3A 1AR92 1CD3G 1K5MA 3I2DA 2PAMA 1H4GA 1QWRA 4QX5A 1PGL1 2EXKA 1JH9A 1ULFA 5FBZA 1J3PA 1WLCA 2WZR2 3VK0A 1W6OA 1LCLA 2NMNA 3KM5A 1GFF2 1NZCA 3NSTA 4AVVA 4UBHA 5FQ0A 3NO8A 2DFCA 4XYXA 5CFCB 2UWBA 3HD8B 3KT7A 3QQ6A 3OD0A 4JDOA 4UW5A 3RI8A 2HWE1 3ZSKA 3B00A 1RUC3 1KS5A 1SLCA 4LBNA 4XJ8A 5BUVA 1SBDA 1RMU1 1X8MA 1RUD1 1FYUA 3FX3A 4I09A 1ZM1A 1COV3 2RJLA 2EIGA 2O1QA 2HWD2 4XJAA 4LHNA 1OHFA 1GYKA 1F2NA 2IXIA 1DIWA 4IEXA 3GBFA 1L3JA 5DUWA 1WCSA 1OD5A 4AI0A 2AENA 2PQQA 1Z0HA 1FNZA 4TWTA 3MW2A 3VBFA 1PO21 2DWRA 3KD4A 1UX6A 2IFRA 2Z2SB 2WNUC 5LRSA 3JQXA 5DZFA 5FMOS 5JR7B 1CQTA 4AVAA 1D2SA 4JGZC 1DHKB 4LLFA 5JIUA 1Q8OA 2B45X 2QDRA 5DDJ1 2D97A 1AXKA 5GALA 4COWA 4O9EA 2IVQA 1RL3A 4AFMA 1VPWA 1ZZ7A 4FCAA 1BBT2 4AQ2A 4P9XA 3I54A 3SCFA 2PHFA 3M8LA 4QM8A 3WW3A 1C3HA 1VBD2 1ZNPA 3GZUC 4GB32 3WHUA 1S2BA 5EYXA 1RGSA 3RYPA 1QF3A 1CESA 3WDTA 3S0MA 2XJSA 1GLHA 1Q56A 1QP0A 1BCXA 2XVLA 4RHV3 3WQ0A 2BPA2 3B93A 1VBB2 3VBRA 3TN93 5C8CB 1HRV2 1PNFA 2MNGA 2NMOA 3CJXA 2ZHMA 1LU1A 2OVUA 5CFDA 5T3NA 4AQSA 5JLVA 1LGBA 4XBNA 3VDDC 2KXLA 3FC0A 4BH9A 5BNPC 4ITCA 4XF3A 4C1WA 2PHUA 3IM0A 3D0SA 1PVXA 2XL9A 1G7YA 2WNVC 3JD73 3PHMA 3OQOA 4YGDA 4LO4B 3T2TA 1QJU2 4Z5DA 3KXAA 2KEJA 1AX0A 2ZGTA 3R4SA 3TB0A 4COVA 5FCCA 2K0GA 3F6WA 1OQDA 1IS5A 1T6GC 4XZPA 2MQKA 2XBO3 3B9CA 4E9KA 4QT6A 1U5XA 1H9WA 1KJLA 1TQ5A 1MS4A 4I01A 2JG9B 3M2MA 4D3WA 2VH9A 5KXEA 2LYKA 1ZREA 2FHRA 4GWMA 2HWF2 1O4YA 3O0XA 1RUE2 4AGVA 1W6PB 2HSGA 4NDWA 2JXAA 3INAA 3NAPC 4JTNA 3THTA 3D0JA 1VB2A 1QH6A 1LGNA 4FPYA 3AM2A 4AVSA 1R1ZA 2RM23 3H9AA 3LCPA 3QD6A 1WLTA 2Y0OA 3NW4A 1NQJA 5K7PA 4XF1A 1QGLA 4HPKA 1TMF3 2A75A 3D4KA 4Q4Y3 5IT6A 4XMIA 4Y1VA 2GAUA 3IVPA 4RQPC 4Y20A 1I6XA 4COUA 1MS8A 1LCCA 2ZGKA 2CWMA 1VBC2 3ZPYA 1Y43B 3QH6A 1HW5A 3ZKCA 2B39A 1ZS4A 4HANA 1BDHA 3MLLA 1H8TC 3V0AB 1NQDA 2QVSB 1WCDJ 4LE4A 3ZFGB 1J3QA 1RJ7A 1MVEA 1VBA1 3WUDA 4N43C 3BALA 1H2KA 4RR3C 1SDWA 4ATFA 1UL9A 4DRVA 4Q4W1 1PVC2 4Q4V1 4MZUA 1DZRA 1XU2A 4QM9A 1CPMA 1QXRA 2JG8C 1SLBA 2PLV2 4QMAA 1LODA 3BODA 1FATA 4W6WA 1MVQA 1YIFA 1XNBA 4I6UA 4Z5CA 2RS53 1QXPA 2YPJA 1QXJA 2XJQA 3R0RA 4HL0A 4LA3A 2QQPA 1LHUA 2EWTA 1JYIA 4FPEA 2OFYA 4MGYE 4JGYA 5C9AC 5AVPA 1ZZ8A 4S2DA 3WD5A 3G5GA 1C5IA 3MLJA 3ZDSA 1NA1B 4FO9A 3I4IA 1WMDA 2VVDA 4GH4C 3USUA 1WW5A 2GH2A 3ZFEB 1FV3A 5L73A 3PJQA 3N3HA 3RPQA 2WLPA 1ZRCA 3MIHA 3THPA 1W0OA 5FTTC 4OI4A 3FE5A 4AHYA 5JOWA 4M3CE 4PU7A 1RUC1 1BEV2 3LA7A 3WUCA 4AQTA 1Q8QA 2D93A 4L92A 4XBLA 4YG1A 1ASJ2 3MFCA 1TME3 1VLNA 2A73B 1Z78A 5CFCC 4OUSA 1S7EA 4EV0A 1COV1 1VJ2A 3VZKA 2BTVC 2RS12 1NXD1 4QPIA 1ZZ9A 2A70A 1RUG2 2AREA 4FQZA 3WX5A 4YLZA 3GZTB 4P14A 2WFF3 3JCIA 3KLSA 1SCRA 4XJZA 4C0HA 3FMGA 5K0UB 1HV1A 4N90A 4LNVA 1ND3B 1QDOA 1UZYA 2V73A 5CB7A 5CFDC 2WS91 1QHDA 1F31A 3A0NA 4IEUA 4KG0A 1ZZBA 1UCXA 5J09A 5A33A 5FO9B 1G9FA 4FPLA 1AR93 2C1FA 1H8VA 2WQZC 1POV3 1RZRD 3WCSA 1B0NA 2DVDA 3WY6A 3ZIWA 3OD4A 2WZR3 1LEMA 2UURA 4URTA 1IQAA 1ENXA 1RHI2 4XEZA 2LTNA 4B29A 2HWC3 4WM8C 1FAYA 1OFNA 2O8QA 1PGSA 1FMD2 4CEYB 5JI7A 4HVRA 4RHV1 4X4HA 2PFWA 5AFBA 3TN91 4AEMA 2OW4A 4XILA 4QQHA 1CAUA 4A7KA 4IEZA 3HZIB 2WSUA 1OMIA 5FPXA 1AR62 5BV6A 1ZZ6A 1FOD1 4KU8A 5C8CC 4QD2A 4AEDA 4HKOA 2VULA 4Z58A 1LR5A 1GT0C 4CYDA 4Y5Z0 3JD71 1W6NB 2PHDA 2O38A 5KC5A 3U0ZA 1SEFA 1EAH3 1FNYA 1ZBE2 2ZGRA 3WDUA 2QZ3A 3TRBA 3V65A 2NN8A 4KU7A 2WL1A 1JWLA 5JMCA 4EN7B 2R16A 5GM0A 2D6KA 3FFQA 2GNTA 4FOQA 4XQDA 4K6BA 3H3ZA 1TEIA 1V6NA 1KFUL 5HCFA 1PK6A 2GNDA