2BNMA

The structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Hydroxypropylphosphonic Acid Epoxidase in Fosfomycin Biosynthesis by a Cation- and Flavin-Dependent Mechanism.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords EPOXIDASE
total genus 46
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bnmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bnmA02
2IVGA 1J58A 2EWTA 1IC8A 2O49A 1LQCA 4FAHA 3FE5A 4AVBA 4IEWA 3I7DA 2PAMA 3S8QA 1AU7A 2WUSR 5D1IA 4X4HA 3LAGA 1RC6A 2WIUB 1JFTA 5FLJA 4J1XA 4X4DA 4MGIE 3H1YA 4F8AA 2L49A 2MEZA 1VPWA 4L11A 1ZVVA 1ZS4A 1ADRA 1ZNPA 1RUOA 4EWEA 4PIXA 4GHJA 2DCTA 1ZAYA 3DL3A 2LCVA 2ZCWA 4LUMA 1YFXA 4O9GA 2PIJA 4LUKA 2PUEA 3NKTA 2I45A 1O5UA 4XFGA 5I0UA 3KJXA 4CYDA 4I8TA 1QQAA 2XKOA 4MH0E 3RYPA 4HMZA 5FCCA 3FYAA 2XJ3A 2OZJA 3NL1A 4X6QB 5JAXA 5HI0A 3RNSA 4IA8A 5I8TA 4RD7A 4X4BA 3OTFA 2XIUA 4Z5CA 2FMYA 3H1WA 3VK0A 3WW4A 1LKNA 2GRLA 2CROA 3NW4A 4PU4C 4FBFA 1WLTA 2AW6A 5I0SA 1Q5OA 3LISA 2B9UA 4HZFA 3KXAA 4JTOA 2MNGA 4I01A 5FLIA 5JCTA 2XSDC 4MV2A 3WW3A 1SEFA 1X8MA 4BYYA 4IEOA 5J3UA 1JUHA 2PYTA 3SCFA 2PE5A 3FFQA 4BH9A 3D0SA 4X4GA 3DN7A 2HINA 3FZ3A 5JSRA 4PU7A 2GC1A 3FMYA 1LB2A 1RUNA 3RDIA 3PNAA 5I0RA 4UBGA 3OGJA 4HBNA 5LEKA 4QGNA 4NDWA 2OFYA 4XF4A 4O8BA 1ZRCA 3H50A 4ZU5A 3FYMA 2FJRA 4FBIA 1YFWA 2JVLA 4EWAA 2WFPA 1JFSA 1RIOA 4HVRA 5EFUA 4MCXA 5FQ0A 1HF0A 1EFAA 1DGWA 4GULA 2ETEA 1UTXA 3H3ZA 3H8UA 2PUFA 3OF1A 4K8FA 5KHKA 4XF3A 2Y0OA 1J59A 3D0JA 4YG7B 1FXZA 2ATFA 2OA2A 3HT2A 3I59B 2ET7A 4OFGA 2B5AA 2IC1A 1WGPA 2PQQA 4I6RA 1RZRA 1QP7A 1HW5A 1Q3EA 1RL3A 3KGLA 2XHKA 5I8YA 4JCYA 2WC2A 5LRRA 1UW8A 3H7YA 5I8SA 3HQXA 4R8HA 4XFCA 4E2QA 4IWRA 4J1WA 2GZWA 2R63A 2KEIA 2EVXA 1Y3TA 2XLGA 1X82A 4Z82A 1DZRA 1OD5A 3EQEA 1GQGA 3MYXA 2KEKA 1CGPA 2LYKA 3OP9A 3UKVA 1LR5A 3KZ3A 4FAGA 3RYRA 1UCXA 3FWEA 4UBHA 1ZUGA 4YG1A 4ORFA 4FN3A 3NJZA 3OMTA 3R1FA 3FX3A 3N4MA 1GT0C 4X4IA 1SQ4A 1JWLA 4X4FA 5BPXA 2O4AA 2PUAA 4QX5A 5I0TA 3VHRA 1XE8A 4XFAA 3IDBB 3KMHA 1OI6A 2PAEA 4IEUA 3TNPB 5I93A 1PM7A 2B8MA 4UXAA 2IXJA 2QDRA 3CEWA 2D40A 4OB4A 4QGMA 4LA2A 5FDBA 2E9QA 2AWIA 3LA3A 4L2NA 4MZUA 5F1RA 3CO2A 3NSTA 3SCGA 2O8QA 2QJVA 3BPZA 3IWZA 3NVCA 5J7MA 4MCTA 1PNRA 4I3PA 4Q29A 4F7ZA 1CX4A 4XF1A 3QOPA 1NEQA 1QXJA 2CSFA 1QWRA 1O3SA 3SXWA 4I09A 4AQ2A 2JCGA 3LWCA 1IPKA 5K98B 3MPBA 4HVOA 4HN1A 5KHHA 3U10A 5I91A 3UKTA 3CECA 2UY8A 3BB6A 4IEYA 3HIFA 2P17A 3OQOA 1Q43A 4HVQA 2O1QA 3ZDSA 2GC3A 4IERA 2BNNA 2GRMA 4Z58A 3KCCA 4A2UA 1L1MA 2Z2SB 4IEXA 4YARA 2D5FA 3GYDA 3EHKA 4XEZA 1CAWA 1WH6A 3JZVA 2PPXA 3SMHA 3SHRA 1IPJA 3F6WA 4XFBA 1LCCA 4IETA 2AXZA 3L1PA 4YG4A 5JSPA 1QP0A 2BNOA 3S7IA 3CL1A 4I0BA 1S7EA 4YBAA 2VQAA 3IBMA 3BCWA 3LOIA 4XF0A 4B29A 3ROUA 3JXCL 3BD1A 1O4TA 4H7LA 1YHFA 3HZIB 2PA7A 5KHGA 2QVSB 1DGRA 3IVPA 5E1RA 3ETQA 4MGKE 1UPIA 3BALA 4PIYA 4Q0SA 1QY4A 2XLAA 1O4XA 1PMIA 3USSA 3H7JA 1ZRRA 3QF3A 3B7HA 4MUVA 3LA7A 1POUA 5KHJA 1H1IA 1NERA 1LLIA 1QPZA 3CF6E 1ZZ9A 1TQ5A 4HN0A 4ZU4A 5CVRA 3I59A 1CJGA 1O3RA 2IXIA 4D7SA 1WIZA 3JXBC 4WBBA 4XETA 5KBFA 3IIAA 1QP4A 3E6BA 1WH8A 1WETA 1I5ZA 1R69A 4EWDA 2F4PA 4Q0QA 4R52A 1UIJA 3S7EA 3HT1A 4Z5HA 2C0ZA 2KPJA 4Q0VA 3BS3A 4LTAA 2GZUA 4MX3A 4JTNA 2R1JL 3DNVB 2XLFA 3EO6A 1EYBA 1UXDA 3E6DA 4DINB 1O5LA 1JH9A 3PVBB 2XCJA 2GAUA 4KWJA 3QYXA 1ZVFA 1XE7A 3M70A 4HLTA 4IESA 4BIFA 3BU7A 3I54A 1ZZ8A 3E5XA 5JR7B 2GC0A 4Q0PA 2LYLA 2O38A 1I6XA 5BUVA 3F51A 1Y7YA 3EJKA 4HSJA 1EP0A 1ZZ7A 3ELNA 4GQMA 2AXVA 4KL1A 3UKNA 1ZRDA 1X8EA 3R6SA 4JQDA 1V70A 5FPZA 1ZX5A 1DW9A 3PLQA 3U11A 2LYRA 1ZZ6A 1O7FA 4BHPA 2ICPA 2BGCA 1G6NA 4IVZA 3O9XA 1B0NA 3KGZA 4OLLA 4XFIA 4Q0UA 2K0GA 1CAVA 2XGXA 2KZ8A 1NE6A 4X4CA 3DV8A 3DKWA 4LLOA 2QNKA 4X6RB 5LRSA 2OZ6A 1VP6A 2LYJA 1OCTC 2AXUA 2HKXA 3GN5A 3SCHA 3L2HA 1J3RA 4PU3C 2BEOA 3MLFA 3ES1A 1O3TA 2KXLA 1CAXB 2PUBA 2PAKA 1CAVB 2CAVA 1YFUA 3F52A 3QWGA 2HJIA 1H1MA 1PRUA 3LZZA 5J48A 1DZTA 3B02A 4PJYA 2L8NA 1DWKA 1UXCA 5FQ0B 1YSEA 2IV1A 1RGSA 2D93A 2ET1A 4JVAA 2D5VA 1J3PA 1UIKA 5T3NA 3QQ6A 4I6UA 2PTMA 3D82A 2ICTA 4YNIA 2FQPA 4P9GA 2V09A 1NZCA 2OR1L 4XFHA 3ES4A 3C3VA 2XI8A 5EZWA 4Z5DA 2GC2A 1SQ8A 5CU1A 1YWKA 1NE4A 4QXKA 2CAUA 4XF9A 1SFNA 1YLLA 4IEPA 4AVCA 1LRHA 1ZZCA 3H5TA 4O9EA 2LYSA 2IVQA 2EA7A 3IDCB 5A7LA 5C6CA 3U3WA 1LCDA 4LA3A 3KSCA 3O14A 2BJCA 5K8SA 4I02A 3RZZA 2IXKA 3E97A 3ST7A 1CAUB 2A6CA 3CLCA 5KHIA 2H6BA 4TLFA 3LFPA 1NXMA 5FLHA 1X2LA 2VPVA 2UYBA 2EBYA 4Y42A 2N7GA 5E16A 2OYZA 1J1LA 2EAAA 1RPEL 4D7TA 2LYPA 2XKPA 1PRAA 4I0AA 3JXDL 2IXHA 4QGLA 1ZRFA 4YSFA 1ZPQA 1ZZBA 1BDHA 2XL7A 3EUSA 2H0VA 3ZKCA 5AVPA 2VECA 2IXCA 4N9IA 3FJSA 3S0MA 3E5QA 3ZHMA 2D5HA 4X4EA 4AQ6A 3LA2A 4ONUA 3CROL 3U0ZA 5LEJA 3ZHIA 2PHLA 1FI2A 1OSLA 4JCXA 3BDNA 3ACLA 2KEJA 4N9HA 4QM9A 1E3OC 5JSOA 4QMAA 1QQBA 4AVAA 1PERL 2Z69A 3H9AA 2PUCA 1XRUA 2PUGA 3PXPA 1EPZA 1NYWA 2HSGA 4META 2GU9A 5CADA 2LYQA 4KWLA 2BNMA 4EV0A 4KU8A 4E2GA 3GBFA 2IU7A 2PUDA 1GQHA 4I2OA 1YUDA 2IXLA 2PHDA 4WVZA 5BV6A 3TRBA 2H6CA 2MQKA 2UY9A 1R63A 1PRVA 2GH2A 1Y9QA 1OFNA 3CLPA 4IEVA 1BDIA 4Z07A 3UFDA 4WZCA 2B5HA 4F8DA 5BY5A 1VJ2A 4YYOA 2Q4SA 3M3IA 4NVPA 1WA4A 2PFWA 3GN5B 1EY2A 2BYVE 4JV4A 2UYAA 4FT8A 1OMIA 4MGZE 1CAXA 4YRDA 2EF8A 5FPXA 3TNQA 4E2SA 3H1MA 2MHFA 4PU8A 1RTVA 4KWKA 4HSLA 4MGYE 2QCSB 1QXRA 4AXOA 1X7NA 4XFFA 1CAWB 3WW1A 4I6TA 3G5GA 1VR3A 2Q30A 1FT9A 1J3QA 1XWRA 2ZKLA 4LULA 4EROA 3E6CC 4ZU7A 2IUOA 1RZRD 2IVBA 3G7DA 5BXXA 3RYKA 1YFYA 3WW2A 4IEQA 2OPKA 4KU7A 3RPQA 1RZSA 2MPFA 2Q1ZB 1CAUA 5C8WA 3EBRA 1LMB3 1X57A 3CJXA 3FHIB 3MZHA 3OCPA 2H8RA 4QM8A 3H3UA 3D1NI 4Z59A 1UD1A 1L3JA 2CV6A 3E5UA 1CQTA 1U12A 3OQNA 2XL9A 4LEJA 1O3QA 2AUWA 4PIZA 3OQMA 2CGPA 2Q0AA 1ZREA 4IEZA 3MDPA 2K9ZA 3QACA 3OD0A
chains in the Genus database with same CATH superfamily
2IVGA 2O49A 2WA3A 3M1HA 3KL4A 2ZGPA 4DRVA 4RGGA 1AYN3 3MIEA 5D1IA 2VOKA 2GMEA 2R073 2WNEA 1EV13 3WNXA 3RS6A 1E5RA 1JU4A 1OH3A 4ASMB 1D0HA 4MGIE 3H1YA 5LY2A 3O0VA 1SZBA 2BQPA 4CTEA 1NQJA 2E31A 3KCYA 2RS12 4GH4B 1ZVVA 4N90A 1ADRA 2ES3A 1YQCA 1E57A 4GJYA 1ZAYA 4Q4Y1 1SLCA 1V6MA 3DL3A 4CP9A 2GMMA 4E4HA 2PIJA 2CGNA 4LUKA 4I3GA 3JCIA 2G4IA 5FZ4A 1Q56A 1WW5A 3WXPA 3MIDA 4XFGA 2YBSA 2XKOA 1EPWA 2X09A 5FCCA 3FYAA 1GWKA 2D98A 1SPPB 5FZKA 4ZZ5A 4X6QB 1HRI3 5FMCA 3LGRA 5HV4A 1REFA 2AYHA 5JAXA 2VOWA 5EHDA 1V6JA 5IVBA 1WW6A 1JYCA 4QQPA 2YDEA 3K2OA 4CEYC 2Y60A 1UF2C 3JD72 2BVVA 4RR3A 5T5LA 1VBD1 1RUG2 4CDUC 4EZHA 5IK8A 1NQDA 2K46A 5I0SA 3B9CA 3DUIA 3VBUC 2YY1A 3LISA 4Y4RA 2ZOEB 1UYZA 1X9PA 4YLZA 3SISA 2OKXA 3MHZA 3VKMA 5LA1A 4GWMA 2TBVA 2HWD1 2HWB1 5FP7A 1U0AA 2RJLA 4K21A 1H6XA 1JUHA 1QMJA 2PYTA 3SCFA 1ZRIA 3FFQA 3WF3A 4B4RA 3M3QA 4H3WA 3MLJA 4QX7A 3SH3A 1UKGA 2P37A 4X4GA 3DN7A 1KJLA 1DHKB 5AFEA 1RUH1 1LOGA 1H8TA 2GC1A 2R16A 4PBPA 5IJRA 1US3A 3VBSA 2DVGA 1EV11 5FYSA 3CU7A 1PVC1 3PDQA 3R4UA 3VGIA 1XSQA 4FPYA 4GIQA 5FDBA 4F83A 5LK5A 3GF6A 3U1XA 1ZRCA 1UZYA 1V00A 3PVOA 4ZU5A 5JOWA 1S2EA 2RDNA 2FHRA 4OYUA 4HT1T 3ECQA 4MLOA 3O1SA 5EFUA 5FQ0A 1UY0A 3TOJA 2JDKA 2VQTA 1DYKA 3KB5A 1R1A2 4LO6B 4CCKA 3H3ZA 3H8UA 1LOFC 4FPOB 3ZYRA 4RHV1 4UF0B 5J36A 5KHKA 2Y0OA 5D8AB 1JZ5A 3D0JA 3WCSA 1GYKA 2ZGMA 1U5IA 5F32A 2SLIA 4YGEA 5IAXA 1WGPA 1AR92 1RZRA 1GOGA 2DVAA 4YG0A 2Y8KA 4BMEA 3AJZA 2YU1A 4PLOA 3KGLA 2VZ3A 4WM8B 4JCYA 2ENRA 2R063 2WC2A 3C8XA 3H7YA 1LU1A 4QAWA 5I8YA 4IWRA 1H2LA 4Q27A 2GZWA 4AF9A 2KEIA 2EVXA 2QQKA 1GICA 2ZBJA 3BKZA 3WR0A 4M4PA 3I2HA 4OULA 4Z82A 3J8F2 3I3QA 1PO22 3HBZA 3ZN6B 4AHWA 4OHVA 4QXCA 1HLCA 5DAVA 1ENQA 4CUCA 3KZ3A 4KBBA 3O0WA 4LXLA 4QKDA 1ZUGA 2YROA 4CP1A 1UZVA 3OMTA 3R1FA 3LFIA 3NJZA 3SITA 1SQ4A 2DU1A 4HKLA 4X4FA 3JQWA 5FPAA 1W9FA 1CWPA 1KFXL 1LULA 3S30A 3SKVA 2LW8A 3V0BA 3F95A 2WZEA 1C4RA 4UAPA 4WM7A 3U37A 3VHRA 4QU1A 5CFCC 4RN5A 4AG4A 2Y34A 1QNWA 2PAEA 4ARYA 4IEUA 2XUMA 2GDFA 3MF9A 2X05A 1LGCA 2HCNA 1MPXA 2Y6FA 4OB4A 3CEWA 4LO8A 1PGL2 4HANA 1ND2A 3ZFEB 2A6VA 5JXGA 1VBA2 1LENA 5CB7A 1JZ2A 5B4XA 3VN4A 1FNZA 4JDOA 2OXBA 5F1RA 3RJRA 2HEYF 3AMQA 2B46X 2QJVA 3IWZA 2XVKA 4CU9A 1UMZA 4E8CA 1Q8OA 2NN8A 4I3PA 4XZPA 1C5HA 3IAPA 3KV5A 1LU2A 1NEQA 1HB4A 4XF1A 3ZXFA 3T1MA 4E27A 4NR1A 1HXS2 3ZMOA 1QWRA 2VNRA 4E9KA 1WD4A 4UT5A 5H9PA 4FPCA 1IPKA 1W6OB 4UFJA 2VCBA 4IXLA 1HJFA 1QJU3 2WZPP 2VMEA 3BB6A 4UW5A 3HIFA 1JOBA 4KGQA 2ZJCA 3HMYA 1OQDA 5LB6A 2O1QA 4K3UA 3VBOC 1BHGA 3QBQA 2V4AA 4AFAA 1QH6A 4BZ4A 1CESA 3ZSLA 4A2UA 1JZ4A 1OOPC 1L1MA 1RITA 2EIDA 2Z2SB 3MLLA 1MFQC 3KT7A 5DRYA 3EHKA 4DPNA 4JHZA 2JDPA 3ME2A 3I3DA 2PPXA 2B45X 1M06G 1AZDA 2D6OX 3SHRA 3VZNA 1YI7A 1XJAA 3RWNA 3UYJA 2RHPA 5FUIA 4E4SA 2DBIA 3I2JA 2AUYA 4N7IA 4XDQA 2BRTA 4BLIA 1V6OA 1MZFA 2BNOA 2E32A 3W20A 2VO5A 3CL1A 1S7EA 4JGYB 2XVGA 2VQAA 3IZOA 3A9XA 1QQP2 3ITQA 3PTRB 5GM0A 4RGAA 3JXCL 2LM3A 3T4HB 1RXGA 5FYUA 4M3CB 1YHFA 2PA7A 5KHGA 3O1OA 3TAYA 5E1RA 2RS52 2J1TA 2VMDA 1G86A 2O0OA 3CQOA 4MGKE 3VD4A 2WNVC 1F31A 3USSA 2VMFA 2W9XA 1AR71 1U5XA 4UW4A 2JDNA 1SLTA 2ZX2A 4P5HA 3AFKA 4RYDA 1H8TC 2VBPA 5T5OA 3THPA 3VBSC 1NERA 1UXXX 5DN2A 3THTA 3WCRA 4OUEA 3SNMA 4CP9B 2VTXJ 4HN0A 4DOUA 2W1SA 1CJGA 2AR6A 5CIRA 4OZOA 5FZOB 2CU5A 5A33A 4EN0A 1JN2P 3ASIA 2WQ4A 2ZEWA 1W0NA 4XETA 1N1VA 3S6PA 3E6BA 1I5ZA 1R69A 1AX2A 4ISRA 4Q0QA 2Y6KA 3U07A 4P00B 5BNNA 4CCCA 3OGSA 2EAKA 1YQ6A 3BS3A 2GZUA 2IFWA 4YVSC 3LEKA 4PBOA 3DNVB 1C28A 1RYYA 1EYBA 2DBNA 2PXJA 2QZ3A 3OGRA 5FPLA 1TME3 3AL6A 1G7YA 4CEYA 5T52A 1F2NA 1GQPA 3ZKUA 4ET7A 4AI2A 1CPNA 1OF4A 1SDWA 4P9JA 3U4XA 3J7HA 3PJQA 2XCJA 2PLV2 5GZEA 1XYPA 3ZYPA 4BISA 5IVEA 5IK7A 1DYPA 1DFQA 4UW3A 4W50A 5DAPA 5ANNA 1GP4A 1I5PA 1QQP3 3E5XA 1RUJ1 2Q1MA 1U2ZA 2LYLA 4M3CE 2R071 3J26N 2W5FA 3KHBA 3EJKA 4N43B 3ZFFA 1ZZ7A 4QB1A 4Y5Z0 5F2WA 4QHOA 4XIOA 1UWWA 4QPIC 4YW1A 3UNPA 3WT3A 2NQYA 1MS0A 2XH6A 3K4AA 2BERA 1ST8A 3PLQA 3Q9OA 2LYRA 4F3JA 4BHPA 2GP5A 4K40A 5FP4A 5HPOA 2OS2A 1R092 2ZKNA 3O9XA 3BTAA 3POSA 4P02B 2DFBA 3VBHC 4OLLA 2D3PA 1LOCA 2VNVA 4XFIA 3O1MA 3SKJE 4BQ1A 4EJRA 5C9AB 1E5IA 1NE6A 2VQUA 1ZBA1 3DV8A 3DKWA 5GLZA 1IQDC 4XBQA 4RFRB 5GAGi 4X6RB 1CONA 3VL9A 1W6PA 4XQDA 4AEDB 1RIRA 2LYJA 3WOGA 3M9LA 2NLRA 1R083 2WZ8A 3SCHA 1LOEA 1DCSA 4RSUA 2KXLA 1CAXB 4Z1VA 4V1PA 3TELA 1CAVB 1O4ZA 1O4YA 3F52A 4NIHA 2WO1A 1QJX2 3OY8A 2HJIA 2FDIA 4JGYA 3ZFGA 4CDUB 4PJYA 5J37A 2E7QA 5FPVA 1OFSA 4XUTA 4AHXA 2Y26A 1YSEA 2G9GA 4JVAA 2D93A 4ZHNA 4YW2A 3QQ6A 2RS13 2WR9A 2ZHLA 3D82A 3MV11 3BVCA 1AR72 1UY4A 5JXJA 4CXYA 4ER6A 3CKHA 2FQPA 2XPJA 1LEDA 2C9KA 5EYYA 4YGCA 1MQTB 2R30A 1SLAA 3C3VA 4QPYA 5FYTA 2HYKA 5C5TA 2XI8A 5EZWA 2PHFA 5F2SA 2WNUB 2AZ5A 1W8UA 5C9AC 2ZGQA 4LE3A 1VBD3 1LTEA 1RJ8A 1QJZA 3WP5A 4RS5B 4COVA 2HWF1 4Q1PA 2WQ8A 1VB2A 1MEC1 3OUIA 1W2AX 4XJUA 2ZEZA 5F9TA 2DV9A 1YQ8A 1LCDA 1K5JA 2I07B 2R062 5BNPC 1PO13 3NJXA 3O14A 3POYA 1UZWA 3N9PA 2ODRD 3B94A 4I02A 4QX3A 1NY72 4TYSA 1AJKA 3BTXA 1UMIA 2VEOA 4IV1C 4UF0A 5C33A 2EXJA 2H6BA 4RS5A 5KHIA 4D0QA 4JGZA 5JUVA 1NXMA 2R0FA 4BDVB 4CPBD 4K7JA 1ND2C 3ZX7A 1QH7A 4BPZA 1OLME 3CZUA 4W4ZA 2RS11 4Y42A 4GKYA 3RJ2X 2EAAA 4EK9A 3VD9A 1WA6X 2D6KA 1OH4A 1QIQA 2QTWB 2VZSA 3AB0A 3PMSA 4WVVA 4GQ7A 1Q8SA 2WKKA 5JIAA 3VKFC 3WP6A 3FL7A 3JXDL 2IXHA 5IUQA 1VMHA 5KC6A 2WNVA 2JDZA 4MXWA 3VKLA 4QGLA 5C71A 4AI0A 4TTGA 5ISLA 4LT5A 3LSDA 1F9KA 1R081 3A4UA 1DG6A 1PX4A 2VVEA 3EUSA 2H0VA 3ACFA 2WYSA 3ZPOA 5DRTA 4QX0A 2IXCA 4N9IA 4L0PA 2JENA 2R32A 4BM8A 3WHTA 4BQ5A 1YQ5A 2VG9A 2YBDA 2DUOA 4LR4A 3R09A 4ONUA 3OBAA 4IQPA 3ZHIA 3AL5A 1LJ7A 1FI2A 4FXKB 4H14A 4Q26A 5B2GB 3BDNA 2EF6A 2GNBA 3PJYA 1E3OC 3WG4A 5JSOA 4RR3B 4FOYA 2VH9A 1PERL 5A3LA 3H9AA 1OSGA 4PI0A 2W94A 3T2TA 2PUGA 4GH4C 3POIA 2RM22 3OYWA 4FQ4A 1SFPA 2GU9A 2JG9A 4KWLA 2YG0A 3K4DA 5FJKA 4URAA 3ZXJA 5HCBA 1BKZA 4CCLA 1SPPA 3PUQA 4JX0A 2WSUA 5A1AA 4XJ9A 4QDQA 1RUJ3 4H7MA 4J6GA 2H6CA 2MQKA 5DSXA 3HNYM 2VTFA 5FY1A 1AX0A 5CYYA 4BIOA 1SHWB 3IKWA 5A3MA 3SLIA 1KS5A 1SLIA 2BTVC 4N8MA 1W2OA 5L7OB 2UWCA 3O1VA 1FV3A 1XC6A 3CLPA 4IEVA 4S2GA 1AL21 1BDIA 4WZFA 5CFCB 1MS8A 2P3JA 5LZ6A 2XVLA 1GUIA 1ND3C 4AYUA 5CA6A 4W65A 2QQOA 2WO3A 3A7QA 4NVPA 1WA4A 1OF3A 1RUG1 5LATA 2PFWA 3M3CA 3GN5B 2PLV1 4PLNA 3USUA 4OMDA 1SDDB 2P6HA 4FT8A 4RR3C 1OMIA 2GN3A 1CAXA 2PLV3 4MGZE 1S4CA 4P14A 1W6MB 1OLRA 2R043 2YFUA 5FY9A 3TNQA 1JH5A 4IDZA 1UYXA 4YG3A 4PU8A 2ZTNA 3TEYA 1W8ZA 2UWBA 4CEWB 2VUDA 3VBFA 1X7NA 1AYN2 1L7QA 4XFFA 2ZGSA 3WW1A 1AL23 2NZ9A 3HR9A 1VR3A 1HQ1A 1KD7A 1V9U3 1TE1B 1S0CA 4NHLA 3ILFA 2B7YA 1W8TA 3WLUA 2XJVA 2JDUA 2IVBA 1VRH3 5BXXA 4BXFA 3BTZA 3WW2A 2FDFA 3CIHA 2OPKA 2FFHA 3AKQA 2J7MA 1CAUA 1H2KA 1LMB3 1MS9A 2QDNA 1W2NA 3MW2A 5FREA 1QJFA 4B7KA 3FHIB 5LY1A 2D97A 2JG8C 3QCWA 3H3UA 1GWMA 2NM1A 1ASJ2 2CV6A 2WNOA 4N43A 4PCRA 4LO7A 1RUD2 4A6OA 3RI9A 4Q4W1 3ZR5A 1ODNA 4MGSA 1NLQA 3KQRA 4YW6A 3GZTB 4W8JA 3GZAA 5IFTA 4IE6A 2PQSA 3NNMA 4PLMA 2K2SA 1W90A 4IEZA 1VBC3 1VIWB 1XNBA 1AR61 3VBRB 5A3TA 4K6BA 3WF0A 1D2QA 2VR4A 4XE9A 1J58A 1IC8A 5J98B 1LQCA 4M01A 3I3MA 1ENSA 3MICA 2YU2A 4XUPA 2WIUB 1JFTA 5DG2A 4CDXA 3QH7A 4J1XA 1D4VB 4NRPA 4XTPA 3TEZA 1VAKA 3GALA 4JCKA 4F8AA 5F7UA 2YHJA 4L11A 2VAUA 1PNGA 1ZS4A 2A71A 2XJUA 3IPVA 4Z2AA 2JE8A 1RUOA 4IUGA 4IV1A 1CZSA 3VZKA 2J1AA 1H2MA 4NIDA 3ZSEA 1JYTA 4Q1RA 1JYWA 3NKTA 2YUEA 3Q8FA 2I45A 4WV8A 4XJ8A 3N3HA 4WVLA 3GDBA 1VBA1 4WM8C 4LQRA 3WEZA 1QZXA 2BGPA 2VUJA 5JUWA 5EJ1B 5I0UA 4CYDA 2HWD3 2HWB3 1IQAA 2Z79A 4FFGA 4BJ0A 3AM2A 2OZJA 4ER5A 3SH4A 1FAYA 1K5MA 1DQ4A 1NA1A 3RNSA 4IA8A 1A34A 2ZA9A 3N9MA 2CY6A 1WCSA 3FN9A 3OTFA 4FCAA 4PDWB 4YG6A 4CDXC 4Z5CA 2ZAHA 1A8MA 3OSDA 3WW4A 1LKNA 3AJYA 1TNRA 2HWE1 5CFCA 5EXOA 4PU4C 3K75B 3PHMA 1G9FA 4K1YA 4ASLA 5IYYA 3EYPA 1IS6A 3VZMA 4UW6A 1OT5A 1VALA 4AR2A 2Y6JA 5J96B 4HZFA 3KXAA 1HX6A 4LKSA 3CJIA 4OI1A 2JWPA 2XSDC 3K77A 1JYIA 1R1ZA 3NWKA 3OGVA 2P3YA 4IEOA 1HB1A 2JE7A 4BH9A 1LOAA 2WWUA 3EB7A 5FZHA 1RHI3 3FZ3A 2YC0A 3U75A 2WNUC 2YMZA 5JSRA 3POWA 3ME5A 1HB3A 4MHRA 3PNAA 4LO4B 1V6LA 4OHZA 4UBGA 4GD4A 1KRIA 4XURA 1IGOA 3AXEA 5A7SA 5LEKA 4NDWA 3ZVXA 1VBE1 5DZGA 2J7WA 3POFA 3H50A 4NJ4A 3FYMA 2P4EA 2FJRA 3GJAA 1QJY2 2ARAA 1YFWA 1YC61 1H4HA 2DTYA 3AC0A 3HNMA 5A32B 2A6ZA 1Z78A 4WVMB 2Q8OA 3O1TA 3MW3A 5BNPB 1Y43B 4CXWA 1PZ9A 4MCXA 2L1PA 2A70A 1TZOA 3KV4A 4GULA 4HOOA 1UTXA 3HOBA 1QOTA 2DUPA 1WWYA 4K8FA 5A7NA 1J59A 1JU3A 3PTYA 1XU2A 4YG7B 1FXZA 2ATFA 2OA2A 5F8PA 3BN6A 2RE9A 2F6BA 3FLTA 3HEIA 3VKNA 3JBG3 3NV1A 2DVDA 3CBNA 1G9BA 1KDMA 1DGLA 4JKLA 3JB4C 3AMHA 1NOVA 1HW5A 3ZYGA 4B4PA 2A6XA 1N47A 1RL3A 5CNAA 4CP0A 5FO8B 2NPIA 1FMD1 5LRRA 4XFCA 4ES9A 2CL2A 1G9AA 1HQWA 2BBVA 2RM21 1K3IA 4FPEA 2QQLA 2BPA2 4FTEA 2KEKA 2HYXA 1CGPA 1HRI1 3OP9A 3A0NA 1PZ8A 1A6CA 4FAGA 3HBKA 4GH4A 1UL9A 4S2DA 3FWEA 1D2SA 3A0KA 1SBEA 4UBHA 4Y22B 1VAMA 4NAMA 1RUE3 1GT0C 4X4IA 1N3QA 4OZXA 2KR2A 2O4AA 1APNA 4IGPA 4DUWA 2PUAA 3WP3A 1HRV2 4QX5A 5I0TA 1YYNA 1RUE1 1W8OA 3VBOB 3J4UH 3NNGA 3GBWA 5FKCA 2JG8A 3WDVA 4AGVA 1CR7A 3KMHA 2R49A 3KT4A 4EN7B 2LRPA 5I93A 2BBAA 3TNPB 2B8MA 2VJXA 2IXJA 2R0HA 2TUNA 2AENA 3PUIA 3K48A 3GZEA 1UX6A 5DTMA 2AWIA 2W92A 4QGMA 1S0BA 2E63A 5B4NA 4NMIA 4L2NA 1BZWA 5BNNC 3CO2A 3V65A 3SCGA 2RM23 5FYMA 3ZSKA 1WMFA 4CU7A 1GNYA 1PNRA 4XAAA 1D4M3 2PMWB 1UY3A 2XQXA 1W9SA 1CX4A 1LNSA 2W08A 4YWAA 4AEDC 4FO9A 2Q8DA 3WUCA 4BK5A 4OHWA 1QXJA 4Y1UA 5HXVA 3SXWA 4I09A 5A3NA 2JCGA 2LTNA 5FYHA 5A3PA 3LWCA 5D21A 2D3RA 1U5YA 5A3WA 5LBEA 3KS7A 4OI2A 4Q4Y3 1AF9A 4XDPA 3U10A 1YI9A 3F2ZA 4A42A 3CECA 1GOHA 1TEIA 1WBLA 2UY8A 4IEYA 4XBNA 3VWSA 4CUAA 3RZLA 5FOJB 1NLSA 3ZDSA 2GC3A 2RG4A 3INAA 4XJZA 2BNNA 3JD73 3MF6A 4JRAA 2ERFA 2YGMA 2JD9A 4CSWA 1R093 4FPGA 2Y33A 3FMGA 3DYOA 2BJSA 2D5FA 2PELA 3GYDA 5FZBA 2B39A 5CAZA 4XEZA 5A3UA 2CDPA 1CAWA 1WH6A 4D8MA 1LHVA 5ACA1 5FUPA 3BUCA 3SMHA 1IKQA 4OHXA 3F6WA 2QQWA 4WVMA 4XAEA 4AI9A 4IETA 2AXZA 5A32A 1JUIA 4CRQA 3SEEA 3OGGA 5LBCA 2PN5A 2BVBA 1S0FA 4LHLA 5JOXA 2ZX1A 3HQUA 5FOBB 1TME1 4Z2WA 3IBMA 3LOIA 4GMP3 1N1YA 4UFHA 1BYHA 4QQOA 3BD1A 5T50A 4YGDA 4BE3A 2FDKA 4EQVA 4D6QA 5C7GA 2ARCA 3QLQA 2QQJA 4N53A 1V6IA 1UPIA 1QY4A 4CCOA 1RVF2 2JXAA 4NPMA 5GLWA 4CCNA 3H7JA 1RVF3 1ZRRA 5JMOA 1B35B 3ZFGC 2W47A 2ADEA 3UGGA 1LHOA 4A45A 2J1RA 5KHJA 2BW8A 1LLIA 1AL22 3CF6E 2VTXA 5K7PA 1TQ5A 5DQ0A 4FPJA 4BU2A 4ZU4A 1HXS1 2AEYA 3I59A 1O3RA 4XC9A 3NV4A 3MIFA 4XBLA 4DE9A 3ZIXA 5ABJA 2LUWA 5ANQA 4WBBA 5KBFA 1QP4A 2VZQA 4OVEA 5LW9A 1H2NA 1WH8A 2XJSA 2VBBA 1K5MB 1NA1B 4XCBA 4XTMA 1CX1A 2ZGOA 4R52A 2VCAA 3S7EA 1PGL1 2RMU1 4NPLA 3OEAA 4Q0VA 1RUI3 1YO8A 5DZEA 4ARXA 4XZUG 1Y7BA 4LHSA 1HRV1 1ND2B 1WLDA 2ZHMA 3C7HA 1W05A 5IVJA 2P3KA 4DINB 3PVBB 4A44A 5JI9A 1W3VA 3WY6A 4BQ4A 2ZACA 4KWJA 4NIGA 2NMOA 5CG9A 1WCUA 1LHUA 1QJY3 4PI2A 4YSFA 5FZ3A 2HFZA 2FMDA 3I4IA 4TXWA 1FX5A 5JR7B 2PXFA 1GSLA 1NCQC 2A3YA 2OUJA 2EIEA 2V5DA 1I6XA 2O38A 4O7XA 3T4VA 1VBC1 2IUWA 1MVQA 1Y7YA 4HSJA 4QB6A 2Q1FA 4EQZA 4OI0A 5J09A 4GWJA 3JQXA 5A7PA 3ZKYA 2G9FA 1WCKA 3R6SA 4DUVA 1LHNA 1RUD1 1V70A 1ZX5A 1DW9A 3AMMA 4URTA 4C1XA 1BEV3 1O7FA 3NNLA 1QJU1 2BGCA 1G6NA 4Q4V1 2LS6A 3K3NA 3T0BA 1BVVA 4CZSA 3ETPA 1A8DA 1WW7A 4GB33 2K0GA 4Q0UA 3VZJA 2IVJA 4L99A 5CKNA 1NCRC 3W5MA 5GZGA 1BMV1 2QNKA 5LRSA 5C4WB 4ER0A 4YM0A 3BODA 3X29B 1CQ9A 1UMHA 2OZ6A 2WZR1 4JQRA 4INDA 1OCTC 1W6OA 2AXUA 2HKXA 2RS32 4AEKA 1FPN2 3ES1A 4LBJA 4QX8A 4BWOA 1VMFA 4CCEA 5IVFA 2BP6A 1W6MA 1YFUA 2VZOA 4U2AA 1PGW2 4KGGA 3KF5A 3QWGA 2PHXA 2UU8A 1H1MA 2R041 2PXTA 1DZTA 2JG9C 3VD3A 3ZFFB 4RQPC 2R7EB 1VBB3 1UXCA 1UKRA 4HFSA 5FQ0B 2WBKA 5A80A 5HCHA 4AI1A 2LLWA 2PHUA 1UIKA 5FMBA 4I6UA 2V72A 1DULA 1E5HA 4S2HA 2IZWA 2O14A 2ICTA 1PIV1 1IS5A 2AEZA 4Y1ZA 3HPNA 4P9GA 3T30A 4CDQB 3DYPA 3ZXLA 2FDHA 1XNAA 4XFHA 2KA3A 3ES4A 1TME2 1VAVA 4PQ9A 4R9DA 4C0HA 3WX5A 5CFDA 1SCSA 3WF2A 4YVSB 4YFWA 1PMJX 2GC2A 1GLHA 1YJLA 3NXHA 4BXSV 4QPGB 2CAUA 2NMNA 1LOFA 1A3KA 1K45A 2WFF3 3LDKA 4IV3C 4RFT0 3WDTA 1S2BA 1GP6A 5DT2A 3QFIA 1SFNA 3T0AA 5FO9B 4CDWA 1ONAA 2XR4A 4IEPA 2YZ4A 3H0OA 4UWDA 1UN1A 4QXBA 4XILA 3WQBA 3RZMA 4O9EA 4CEWC 4L8QA 4YVWB 4NOTA 1GZCA 3U3WA 2V4VA 4Z8BA 4LA3A 2CYFA 4ZS3A 4CP2A 1DQ1A 4JDMA 2BJCA 3E1F1 4WVWA 1J84A 5EP9A 3RZZA 4C1WA 3ZMNA 3CLCA 4Q4W2 2ZXQA 4YFZA 4TLFA 4W6XA 4AI3A 2JICA 5CFDC 5FUNA 1X2LA 5F3GA 2UYBA 2EBYA 3RZGA 4L97A 1SMVA 5A7WA 5K0UB 3B3QE 1UOJA 5LA9A 1WMXA 2XKPA 1PGSA 4XQ4A 2CWMA 1OOPA 3LIGA 4LK7A 4CDWC 4G3YC 1NAEA 3PVEA 3BIEA 1PNFA 1VLNA 4C8DA 2W1WA 4N7UA 4HETA 2VE1A 1ZPQA 4CUGA 1ZZBA 2QFEA 2GP3A 3AZXA 1RUC3 3ZKCA 3A9YA 3WP4A 2HCSA 5FZLA 5CEHA 4LBOA 4JC1A 2E53A 3FJSA 1OQEA 1AYN1 3VL8A 1LEMA 5K0UC 3FBMA 3S0MA 3IAQA 1H9WA 1DQ6A 3NJYA 4IE7A 3ZXKA 2FZ1A 4GAZA 4CU6A 3AMNA 5DTQA 3K51A 3U0ZA 2HBTA 3A22A 1JW6A 2QQUA 4EKIA 2DFCA 3TRSB 1OSLA 1W06A 1D7PM 4JCXA 2VC9A 2PXEA 3LKJA 3N7KA 5A3OA 4LBKA 4QQ2A 3VZLA 2D6MA 3CNAA 1PM4A 1JBCA 1NT0A 2VMHA 1AXKA 2XG3A 2P1BA 5H9RA 2HSGA 1DGWX 4META 4EN9B 1Z7S3 4KU8A 4E2GA 3GBFA 1POV0 2PUDA 4OCTA 1RINA 4NUBA 4I2OA 1YUDA 4FSJA 3CMGA 4YW5A 2WUHA 4ER3A 4QPGC 3UT0A 1EAH3 1QDOA 1COV3 1UOFA 3R0RA 3I49A 1PRVA 2GH2A 2JDAA 2DVBA 2D44A 4AW7A 1OFNA 1STMA 3UETA 3WG2A 1FPN1 1RMU1 5F5AA 3N9OA 2RS31 3WNPA 1L7LA 2JIGA 1PK6A 2JB8A 1OVSA 1F5FA 4WZCA 2B5HA 4YGBA 2YB7A 3ACIA 4F8DA 1W9YA 1VJ2A 3NZLA 3NDBB 2VNOA 3GZCA 1HRI2 1JTZX 1FOD2 4XXPA 2WRAA 4NWVA 5A6ZA 4JV4A 5FZ6A 4UFMA 4A3ZA 4XYXA 4Z92B 2ZAAA 2EF8A 4BK4A 3RGBA 4E2SA 3W9AA 3H1MA 2GNTA 2YPJA 4NHYA 3AVSA 3UGHA 5FYYA 5KWRA 1H8TB 2GH8A 3VBSB 2ZHKA 3H3LA 2BWAA 5L73A 1CAWB 2DYCA 3SC7X 4D6RA 4COUA 3PVNA 2Q30A 4A6SA 3NRUA 2ZS6B 2VW0A 2WL1A 4EROA 1H8VA 5LA0A 3E6CC 3VDAA 1LAJA 1W0PA 3RYKA 1YQ2A 1XQNA 1YFYA 3AP7A 1MEC2 4GJZA 4C90A 3WDUA 3T0DA 1TG7A 3ZPYA 1OA2A 1IZ3A 5C8WA 3EBRA 1VBE2 1W28A 2VGDA 2WO2A 4GB31 2PXQA 4ZXKA 2YFZA 5HBAA 4M3CF 1QDCA 2JDHA 4MO3M 3OCPA 4QM8A 5D8AA 1VRH2 2WAAA 1UNBA 1CQTA 1UX7A 3KD4A 2EICA 3ACGA 3QD6A 4IV3B 5IW0A 3TBDA 2F17A 3N7JA 1YXWA 1W8HA 3AFGA 1O8SA 1OC1A 4DEVA 3J8F1 4QHBA 1OA3A 1PO12 2K9ZA 1DQ2A 1MR5A 4YVWC 3UGFA 3OD0A 2VL4A 1SACA 3IM0A 3V0BB 1AR91 2RS53 4FAHA 2QE3A 2JG8B 5SV8A 4E4ZA 1XNCA 1HJGA 4M3CA 2MEV3 2WWSA 2PAMA 4K8RB 4LBMA 1FMD2 4X4HA 3LAGA 5JDBA 3JU9A 3GM8A 5FLJA 2JJ6A 5FXZA 5ACA3 5C4WC 3MGUA 4HKWA 3HJRA 4Y1YA 5KXCA 5FZ0A 2MEZA 3GZDA 1VPWA 3UWPA 1PVXA 4WM7C 1DGRN 4YPJA 4ATEA 3RSJA 4GHJA 3FLPA 1HDKA 1RUI1 1R1A1 2ZCWA 1MZ5A 1YFXA 5HV0A 1WCQA 2XMLA 2NYYA 1GFF2 3NNJA 2PUEA 4O9GA 1QU0A 4C91A 2X5IC 5IVVA 4OQ8A 1O5UA 2ORZA 2JX9A 5EQUA 1NCRB 4I8TA 1QQAA 4MH0E 2XWBB 4MHUA 4OBMA 1CN1A 2PHWA 1AL0G 2W1QA 2NP0A 2XJ3A 3NL1A 1MVEA 3N9QA 4LIVA 1GU3A 2ZPXA 1YNAA 4RD7A 4X4BA 2XB6C 2XIUA 3OKZA 1NCQB 3VDDA 1PO11 3CZJA 3KHCA 1JZ7A 3VK0A 5JZGA 3GZDC 1ZA7A 3THDA 1VRBA 3TN91 1PHMA 1LOBA 1NG0A 1ZBE2 4FBFA 1WLTA 2AW6A 2VXJA 3VUOA 1S55A 4RS5C 4XHBA 1W0OA 3BPSA 3A9ZA 2HWF3 3M7AA 4LORA 5KXEA 3LIHA 3T2OA 2MNGA 2RJKA 4I01A 5FLIA 4A3XA 5JCTA 3WW3A 5DTRA 2D43A 1SEFA 1X8MA 3NQHA 1MS5A 3OBZA 5FMOS 3TWIA 5J3UA 1ALYA 1UU4A 4FOVA 2HWC2 1NLRA 1LGNA 3D0SA 4DXTA 1ULPA 2WLPA 3MO4A 3TEXA 2ARBA 1DYOA 1GZWB 2VOTA 2YBKA 3FMYA 2XJRA 3D5OA 4CXXA 3RDIA 4EYUA 1C8M1 1WLCA 5I0RA 4HBNA 4UI9L 2XBO3 4QGNA 3W21A 4GWNA 5C8CC 4OUSA 1Z0HA 4O8BA 2JE9A 2BDRA 3AP5A 4KI5M 4V2WA 1ND3B 1WZXA 2VZTA 4W6WA 4LIUA 5J1XA 3MEJA 2JVLA 5L9VA 3G6JB 3P3PA 1G9CA 1SBDA 1RIOA 1R091 1TMF1 3BIWE 3OG2A 4AI8A 2X53S 3WD5A 5C9AA 1HF0A 1RUC1 3PUHA 1EFAA 1DGWA 1OLQA 5JI7A 3V0AB 2ETEA 2PUFA 3OF1A 1UYPA 4XF3A 3URFA 4ZONA 5FTTC 1Z7S1 2X29A 2XJTA 4QWNA 4DY3A 3RMYA 4Q4X1 3T3YA 2DCZA 4IGQA 2IC1A 2C4XA 4OFGA 4QDRA 1W99A 2CSGA 1WMEA 5CKQA 4AL9A 5BNPA 1QP7A 2FD8A 5C8CA 4YZ4A 3LQXA 1Q3EA 3J7LA 1HB2A 5FZMA 3HQXA 4R8HA 1XXNA 4E2QA 2OW4A 2EALA 2ADDA 2R042 1D4M1 1KQRA 4AVVA 2E6VA 1DBNA 3DCQA 3DPRC 5F3EA 5AC91 1DU3D 1Y3TA 1X82A 2XLGA 1DZRA 1OD5A 1AR62 2B4KA 1LGBA 4NPRA 1W9WA 3S5QA 2LYKA 2OQ6A 3ZLIA 4Y4YA 4UFIA 3R05A 1LR5A 1S0EA 2YGLA 3RYRA 1W6QB 1EUUA 4UYBA 4AQTA 1NKGA 2GMPA 4GA9A 1ASJ1 4NROA 3KCXA 5EJZB 3WNOA 4KG8A 1C1LA 2I74A 5BPXA 4YW3A 3P3NA 5IWFA 4XQWA 3VHNA 5FK8A 3RRDA 2RR11 4LBNA 2C5DA 3PMEA 4IW3A 3IDBB 1W8WA 5DDJ3 4MSVA 1OI6A 1QJU2 2Y64A 5FY5A 1I3HA 4IL7A 3I3BA 4Q8LA 2J7UA 1JODA 1JXNA 1ACCA 3VBFC 1ENRA 4LA2A 1ULFA 2E9QA 1OQ1A 3LQCA 1VPHA 3TN92 3ZN4A 3TFLA 2Y6GA 3HVDA 5JLVA 3LOBA 2BFUL 5E8AA 3N9NA 3FHQA 3NVCA 4QPIA 4YW4A 5J7MA 5F5CA 4QKNA 5K9YA 5CZKA 3UJQA 3LSEA 5FZ1A 4Q29A 1QJX3 4A7YA 3ZIWA 2W87A 3QOPA 1DP0A 5BNQA 3ZN6A 5F3CA 4D6SA 2WS93 4Y20A 2CSFA 1O3SA 1FV2A 2RV9A 1H9PA 1T2XA 2PXPA 2HEVF 3AKPA 1OA4A 2Y38A 3VBHA 3MLKA 5T5JA 5K98B 2WZR3 1E5SA 5FZ7A 4HVOA 1JYNA 4HN1A 5KHHA 2DWRA 3O0XA 1TVGA 3QOWA 3ZPXA 1H6YA 2WN2A 4DS0A 4AAPA 4YZ5A 4QPIB 4EN8B 3KWVA 2WWJA 2P17A 1NCQA 4QX2A 3OQOA 1Q43A 3NV3A 5JOYA 1VBA3 1BEV2 3DXTA 3LF7A 4HVQA 2RDRA 3OYWB 3WNNA 2RR13 4Y1VA 2ZX3A 2RMU2 4KH9A 1RUF1 5L9BA 3OUHA 4MADA 4Z58A 4IE5A 3KCCA 2LNMA 4YW7A 3LCPA 1M4WA 3HAGA 3B7MA 2Q8CA 3ZFEA 4B7EA 5KXDA 4YARA 1QJX1 1LHWA 3WQ0A 1ZYBA 3GZUC 1JHNA 4J25A 4Q5OA 1IPSA 2A73B 4LKDA 1RUC2 3A21A 1UPSA 3JB8A 2ARXA 3OPZA 4XACA 2QKDA 1BQPA 5CFDB 3KVBA 4EE2A 4KWUA 2BOIA 4XFBA 1LCCA 1DQ5A 1BLZA 1QP0A 3SEPA 1UZZA 3S7IA 3KT1A 5LWBA 3MUZ1 3H8OA 4I0BA 4BQYA 5I0DA 2D6PA 3BCWA 5FZFA 4XF0A 4Y3OA 3ROUA 4MG2A 2O8OA 2P5BA 1O4TA 4H7LA 5EJ3A 1AYM3 2QVSB 2VM9A 1BXHA 3ZFFC 4YVWA 1HRV3 5D2AA 4FFHA 2VMCA 4Q0SA 4PIYA 4BQ2A 2XLAA 4DXSA 1PMIA 2C6SA 3QF3A 2R1BA 3T2PA 5H9SA 4MUVA 4Y5TA 2YC2A 3LA7A 1POUA 3AP9A 1H30A 1VBD2 3AMPA 1K5MC 1NA1C 1H1IA 2BU9A 3B5LB 2I2SA 1QPZA 1ZZ9A 4QQLA 5AC93 4QT6A 1KGYA 1SLLA 5G05L 5FV3A 5FZIA 2EIGA 4ZY9A 2IXIA 2WFF2 3JBG2 4D7SA 1XU1A 3JXBC 1V9U1 4NWWA 4AQSA 5DG1A 2VW1A 1OBNA 4AVTA 3S5AA 5EPAA 4A41A 5ERLA 2EXIA 4EWDA 3C2UA 1RXFA 4FPHA 1RUH2 1UIJA 4Q4X3 3PU3A 3PUSA 4LTAA 3BI3A 2P6CA 4MX3A 3OD4A 3POBA 4I30A 2R1JL 2XLFA 1K12A 1NY71 1K42A 2C26A 3KLSA 2W52A 2D6NA 1UXDA 5L7OC 2LLVA 2VCCA 1UU6A 4OMCA 2WNVB 2EXKA 1GP5A 1JH9A 1O5LA 1WLWA 2GAUA 5A7QA 4BQ3A 3ZXDA 3VBRC 3AZYA 5E6HA 3ZYBA 1AX1A 4BIFA 1XE7A 3M70A 4IESA 4ITCA 1HKDA 3BU7A 4TWTA 1ZZ8A 3UV9A 5IFPA 4PDWC 2GC0A 1AR81 2XBO1 3OY8B 4YM1A 2J42A 3LPFA 1PVC2 1GV9A 1W04A 3B93A 1HXS3 4MXVA 3WSOA 4ZZ8A 2JDYA 2AXVA 1R082 3UKNA 1FATA 1ZRDA 2X10A 4CE8A 1OXCA 4JQDA 2A7AA 5FPZA 2VCMA 3C7OA 4NRQA 3W5NA 5FBJA 1W6PB 2CGOA 3CJIB 5IT6A 4Q4V3 1RVF1 4IVZA 5L7OA 1Y9MA 1B0NA 3KGZA 1FNYA 4W6YA 4XCAA 1ZBE3 4M0HA 4X8PA 3U4SA 1J83A 4AFCA 2JKXA 5C3SA 5IK4A 3NJVA 3I2GA 4LBLA 2XGXA 2KZ8A 5IK5A 3ZDVA 3LDRA 4X4CA 2HWF2 2ZGUA 3VLBB 1MACA 3KV6A 1Y9GA 4FFIA 4LMFA 4P9IA 1N1TA 5DUWA 3AKRA 3POGA 1I1EA 4BB3A 5G04L 3WF1A 3A23A 2B42B 2BV4A 3IT8A 4CPBA 3I8TA 2PUBA 2KM2A 2MEV2 2PAKA 3AYCA 1W8FA 4KG0A 1AR83 5LBBA 5DUXA 1Q8VA 5DPNA 3B02A 4B4QA 4XUOA 1DWKA 2BFUS 5HCAA 1V6NA 2IV1A 3DEMA 2XXAA 1LODA 2ET1A 4AEJA 2D5VA 4PT6A 1S0GA 5GAHi 2WLQA 4SBVA 5T3NA 4AE2A 3PL0A 2VY0A 4YNIA 5T54A 4D69A 4D7YA 1JI6A 1B09A 3NV2A 1US2A 1NZCA 1N3OA 1GANA 4AFDA 5L36A 1ULCA 4XOGA 4H2AA 3ZYJB 1SQ8A 5CU1A 3IMNA 1NE4A 2E26A 2GN7A 3GBGA 5ACA2 3Q8EA 4XF9A 1VBC2 1ZBA2 1YLLA 2B9VA 2D7FA 5FMOL 3OPTA 5GZDA 3M8LA 3H5TA 2LYSA 2IVQA 2EA7A 2ILMA 5A7LA 3IDCB 4BQXA 5C6CA 2W95A 2Y0IA 1Q8QA 2ZEXA 1OURA 4PQQA 3KM5A 3J8F3 5K8SA 3RG0A 4HONA 3ST7A 3WDXA 2FCTA 3V0AA 1ULOA 2G19A 1F5JA 3HD8B 3LFPA 2WT1A 3B00A 5FLHA 2GNDA 4ATFA 1XYNA 4YM2A 5E88A 1JS9A 4NN0A 3U14A 3VKOA 4AZZA 4CU8A 4ZXEA 1S2KA 5FP9A 4BLJA 1C8M2 5E16A 1J1LA 2RVAA 4D7TA 4XUNA 2LYPA 1W9TA 4L9BA 1ND3A 4XVHA 3ZYIB 4I0AA 1GMMA 1JHJA 1AR82 2VU9A 4YVSA 2WAOA 4COWA 3UK9A 5DAWA 4CUBA 3O12A 4E4DX 3TEWA 3BYWA 2RS33 3RI8A 4K1ZA 1TMF2 4CCDA 1DZQA 3LEMA 3I2FA 5BNOA 2VECA 5D8AC 1XBFA 1DIWA 3KZ4C 1BBT1 2BGOA 2GNMA 2VZ1A 3CHXA 2WYFA 1OOPB 2YXSA 4GMP0 2JDMA 2VD7A 1RUJ2 1EAH1 1VBB2 1C1FA 1FOD3 2D5HA 2XHNA 4X4EA 3DYMA 3M3EA 3NNFA 4Y22A 3LA2A 4CDXB 5JXHA 3CROL 5LEJA 2WABA 2AC1A 2PHLA 2VOXA 4PF1A 4BQWA 5FWEA 3NROA 3L9JT 2KEJA 5IATA 1BMV2 4FP3A 4GXLA 4R4XA 4LHKA 3WNMA 3ZO0B 5JZGB 1AXZA 2Z69A 1RHI1 4AHYA 3VHOA 1S0IA 3VDBA 3IDAA 3PXPA 1EPZA 1NYWA 2OVUA 4OUMA 4DEQA 1PMHX 2OPWA 2LYQA 5JPNB 2BNMA 1W2UA 2XONA 4Q4V2 5FYZA 5C4WA 2DCYA 4EV0A 2IU7A 3RFRA 1GQHA 3FUOA 1KXGA 5FXWA 3T09A 2PHDA 4COYA 2C1FA 3DECA 2PXLA 5KR7A 1WW4A 2UY9A 4Q2FA 4JGZC 2GALA 2CWSA 4XMIA 1R63A 1F4HA 1OD3A 1PIV2 1W2TA 1C8NA 1Y9QA 3J7MA 3LPGA 3M3OA 5HXMA 1YEWA 4GB32 4O61A 3UJOA 1XNTA 3VBHB 4Z07A 3RMXA 1MZ6A 2V3CC 3NKGA 2A3XA 4GALA 1HV0A 2ZZQA 5FK7A 5BY5A 2WFF1 4YYOA 1CIWA 1GBGA 1PGW1 3M3IA 1EUTA 5KC5A 5JXIA 1EY2A 4QPWA 4QU2A 2W91A 2XJPA 5LASA 4XABA 5JZGC 1RUI2 2X8KA 2QQVA 1RMU3 2E7AA 2OX0A 1GZWA 3PURA 2W1UA 4KWKA 1ASJ3 2CNAA 3GHMA 2QCSB 4LBQA 4MGYE 3RWKX 1T6GC 3KF3A 1SFYA 3AKTA 4I6TA 4U36A 3GGLA 3AZVA 3HN1A 4HK8A 2E51A 1ULEA 1FT9A 3VD5A 4DMIA 2ZABA 1XWRA 2Z5WA 2ZKLA 4LULA 4M00A 4AEMA 3G7DA 1DLCA 5FBZA 4AAXA 4P9WA 4IEQA 1OLMA 5CG8A 3RPQA 3BU0A 1RZSA 4ZS2A 5FY0A 3IMMA 1RUF3 4XW3A 4ZPIA 4P08A 4IE0A 4HXCA 1RUF2 4AGGA 1KDKA 4DRRA 5A6YA 1UY1A 3ZYHA 1AYM1 1PO23 5FZAA 3Q8BA 2H8RA 1CZTA 4NIIA 1UD1A 1L3JA 4QHZA 1WD3A 2CTVA 5H9QA 4P9LA 2XL9A 4LEJA 4NO4A 2AUWA 4GKXA 3RZHA 4IE4A 4RHV2 3ZN5A 4DUXA 1QJEA 4KNCA 2XUEA 5E89A 2VQ0A 3OQMA 5LK7B 2Q0AA 3UL2A 5C8CB 2DCJA 1ZREA 1XPWA 3TB0A 2Q8EA 3FFZA 3QACA 1DLLA 1QGLA 1S0DA 4G9SB 3C7GA 3MPPG 2EWTA 5IHRA 3C7EA 3FE5A 3W58A 3PUAA 4IEWA 1BBT3 3I7DA 3K3OA 4AVBA 1F15A 2D3SA 3S8QA 1AU7A 2WUSR 1P8JA 1RC6A 4X4DA 2RR12 4ASKA 1QJY1 3O7OA 1AXYA 2L49A 1W6QA 4JHTA 4LOSA 4KBZA 3B01A 1ZNPA 2ZMLA 4ISQA 4B1LA 4PIXA 4EWEA 1DDLA 4OHYA 1AHSA 2DCTA 5DAXA 1IS3A 2JQEA 2LCVA 4LLFA 3NO8A 4LUMA 4B3NA 4FVVA 1W39A 3GUUA 3Q8CA 3I97A 3KJXA 2Z4FA 3V64A 2DU0A 3RYPA 2WT0A 4HMZA 1BEV1 1QOOA 1RUG3 2J1EA 4H55A 1RHI2 4JQTA 3DXUA 4CDQC 4AEDA 1IG0A 5HI0A 3THCA 5I8TA 3WDYA 4KMQA 1IOAA 5T5PA 5FWJA 2PXBA 1SG3A 2ORXA 3GXUA 3TN93 3FLRA 2FMYA 2XXQA 3H1WA 5IAVA 5CISA 5JPMB 2GRLA 2CROA 1D4M2 2P3IA 4QDSA 3NW4A 4P9XA 3ZXAC 1NCRA 5BYNA 2JG9B 1T6BX 4QKFA 1XE0A 2ZGTA 3IN9A 4RGKA 4FTBA 3FUQA 1Q5OA 2PHRA 5K4LA 2B9UA 2HLEA 4K20A 1NZIA 1XB9A 3AP6A 4JTOA 4BOWA 5KXBA 2FDJA 4MV2A 3LDBA 4LJHA 1Q8PA 1Y4WA 5FO7B 1F4AA 2QQNA 4BYYA 2C24A 3OPWA 2VUCA 2PE5A 3VHPA 2A6WA 1IS4A 5FFOC 4MOAA 2HINA 4FFFA 5CKMA 4EN6B 4YZ2A 1TMF3 1HN0A 4PU7A 3N9LA 4LBQB 1LB2A 1RUNA 3GNEA 1UXZA 3NAPA 4GMP1 2ZGLA 2RDSA 2ZX4A 5EWSA 2ZMNA 3OGJA 5LCWL 2P34A 2OFYA 2ZGNA 4MGQA 4XF4A 5K0UA 5A7WB 1LECA 3T2QA 3ZSJA 3USUB 1BVP1 4FBIA 1ULDA 2ZZJA 1VB4A 2WFPA 1JFSA 4HRAA 3ZXGA 4LPLA 4OI4A 1JMUB 5A7OA 3MFCA 1MZEA 4HVRA 1AR93 2RS51 3IIIA 1HQNA 3LD8A 3DM5A 3K46A 1X9TA 4YM3A 2EIBA 1URXA 5C3QA 5GZCA 1SLBA 3LEIA 4ZKTB 2IFRA 4P5YA 5FY7A 3HT2A 3I59B 3B9IA 4R9BA 4CDUA 5A33B 4V2VA 3BOPA 3WZ1A 2ET7A 1W3XA 4X8NA 2B5AA 1RUD3 2PQQA 4I6RA 5AFBA 1AYM2 3S57A 1YJKA 3TEPA 1GKBA 4C0BA 3BOWA 2Z42A 2RDQA 4XPVA 2XHKA 4N43C 1LCLA 4IGOA 4XDOA 1UW8A 4Q2JA 3N7LA 2UWAA 5I8SA 4RHV3 5T55A 3O1PA 3M2MA 3W59A 4J1WA 2R63A 3WINE 3N35A 1UZ0A 5C3PA 5JIUA 3QOXA 2RJ2A 2M4HA 2G1MA 1REDA 2BZDA 1SCRA 3CJIC 2ZGRA 3EQEA 4HG6B 1GQGA 3MYXA 1N3PA 4WM7B 4ES8A 4BCUA 1G8WA 4LITA 3UKVA 3WV6A 4LNVA 1JZ8A 3DF0A 4AOCA 3IDEA 1UCXA 3K4ZA 3OUJA 4YZ3A 5A1FA 4YG1A 4ORFA 4FN3A 5JVVA 3FX3A 3N4MA 2FZ2A 1JWLA 4LKFA 4UOJA 3ZOIA 3KV9A 1VE0A 5A6XA 3PE5A 1R1A3 2RMU3 4XIKA 1A78A 3KVAA 3J9SA 1RMU2 4E8DA 5FZDA 1OPMA 1XE8A 2ZEYA 4UFKA 4Y26A 1CJPA 4XFAA 2WSVA 2W39A 3WG1A 1C5IA 3RZKA 2PXKA 1PM7A 2J1SA 2R1DA 3ENRA 4Q4Y2 4UXAA 2J1VA 2QDRA 4EKGA 2D40A 2WQZC 3AYEA 5EYXA 3WQ1A 1L7RA 3R4DB 1S1AA 2YBPA 1SBFA 4AFMA 4CEYB 2XBO2 4K9SA 4WM8A 4MGTA 2ZHNA 3LA3A 3FHAA 4MZUA 1MS1A 2KD7A 1IHMA 3ILNA 5C3RA 2OUHA 1FPN3 2VZRA 2E33A 2O8QA 1V0AA 3NSTA 3BPZA 1N1SA 2J1UA 1ULGA 2QQPA 4MCTA 2VZVA 2Y6LA 1REEA 3HNBM 4AK3A 2YPDA 3ORJA 4F7ZA 1POV3 3MFAA 4CA9A 2QQMA 5DAQA 2TEPA 3D8CA 1ZA4A 1IG3A 1BK1A 4ER7A 4AQ2A 4QB2A 4NHMA 3PIGA 1OUSA 4RL7A 2ZGKA 3ALQA 2X5IB 3FC0A 1R64A 3HWJA 1POQA 3MPBA 1VMJA 4DNYA 2BUKA 5I91A 3UKTA 3WF4A 2IWGB 2WN3A 1OKQA 1GOFA 2FCUA 4PDWA 4JKKA 3ATGA 2ID4A 1B35C 3ZFGB 4AFBA 5JOZA 4Y33A 1HV1A 4HPKA 2ZMKA 4IERA 2GRMA 2PXDA 2QUOA 4CCMA 2HWD2 2HWB2 5IVYA 5FR3A 4DE8A 3OBRA 1DQ0A 4G4FA 4XJAA 4IEXA 1O8PA 2DDUA 5GLUA 1OPOA 1WUVA 4RA0A 5IVCA 5F3IA 1WMDA 3WHUA 4LKEA 5C3OA 3DGTA 4MVTA 3JZVA 4CDQA 2WDBA 3MW4A 1MQTA 1IPJA 4AVSA 4N53B 2Q5TA 3L1PA 3WDWA 4YG4A 5JSPA 4FP2A 1NUKA 2W2IA 3N36A 3WG3A 1MS4A 1RUH3 5FP3A 1PK6B 4YBAA 2AGSA 4OQ9A 3LB9A 2GSYA 1FMD3 4B29A 5DUUA 2VOVA 1BBT2 5FP8A 3EMRA 3HZIB 1ZM1A 4QD2A 2VW2A 5FAXA 4Y1XA 3T1LA 1DGRA 2L9LA 3IVPA 2VMGA 3ETQA 4CVUA 3BALA 4QQHA 5FMDA 3HQRA 5ABJB 1O4XA 3MIGA 2VUAA 3B7HA 1UYYA 2XJQA 1QOSA 3ZR6A 4Y5SA 3PIJA 1MQTC 2JKBA 5GZFA 2DUQA 3WNLA 1COV1 2A3WA 3ZXEA 4NIAA 3MI8A 5F37A 3SX0A 2CDOA 4NHKA 1MEC3 5CVRA 3AP4A 3WUDA 3JUUA 4TSVA 2JEMA 1GNZA 3APBA 1POV1 1X50A 5FZGA 3I3EA 5LBFA 3KQ4B 1VBE3 4A7KA 1I9RA 2JECA 3POEA 1WIZA 3IIAA 5FYBA 2JIJA 1WETA 1CVNA 1KS4A 3OEBA 2FDGA 2FBEA 2F4PA 5FYVA 3VDDB 2VVDA 5F39A 1O91A 3HT1A 4Z5HA 2C0ZA 1W8NA 2KPJA 1GZTA 1AR73 2QBXA 3LEGA 4NHXA 2UURA 4SLIA 3GHNA 3RVHA 1WBFA 1UAIA 1UU5A 3ACHA 2D6LX 3EO6A 4FOQA 1O59A 4JTNA 4LHNA 4RQPA 5DDJ1 3RQ0A 3WVJA 3AVRA 4EZ4A 3AXDA 4DZGA 1BJQA 3VBUB 3E6DA 5DXDA 4FPFA 3POJA 1PIV3 4L92A 4DXZA 2WT2A 3WNKA 3ZYFA 2AACA 1CPMA 2WIIB 4Q8KA 3GJBA 1OUXA 2HWC3 4MXWB 3QYXA 2PXVA 3MV01 1ZVFA 3T08A 4HLTA 1EAH2 1UO9A 2AREA 1ODMA 1VBB1 5A6QA 2A75A 3I54A 1QNYA 4HK9A 1G9DA 5CBLA 3OWQA 4Q0PA 1U5ZA 5BUVA 2HWE3 1JOPA 2G9ZA 2C9AA 3F51A 1GZ9A 3LE0A 2W0XA 3GCXA 1COV2 4XJWA 3AYAA 4IV3A 3VBOA 1EP0A 4GWIA 1JYXA 3ELNA 4GQMA 4A7ZA 4KL1A 2XXPA 1X8EA 2P2KA 2YYOA 3U11A 3EXUA 1BK0A 1QHDA 1X36A 3JBG1 3VZOA 1ZZ6A 1YCIA 2ICPA 2YV8A 5A1LA 1OKOA 4DY5A 5BNOC 2WJSA 3VV1A 1GR3A 5DZFA 4BA6A 1CAVA 3MIBA 3P1IA 4QXHA 5FZEA 5F5QA 3SR4A 1KFUL 2DCKA 2WS91 3NMBA 4LLOA 4QPGA 1Z7S2 2VULA 5GALA 4DQAA 5ABJC 5DDJ2 1RJ7A 2VBDA 5C5UA 1VP6A 2OIIA 1GWLA 3DPRA 5DABA 5F6KA 5FPBA 2V5YA 3GN5A 3L2HA 1J3RA 4PU3C 2BEOA 3MLFA 1QQP1 2E7TA 4S2FA 3H8RA 1O3TA 1HQLA 2CAVA 4EWAA 2YC4A 3BGAA 4TN7A 5HCFA 5FY8A 2DURA 3LZZA 1PRUA 3O5SA 5J48A 1GNHA 1QF3A 1JZ3A 1DF0A 2F4LA 2L8NA 5FKBA 1C8M3 2R072 1RGSA 2AH2A 1AR63 4JGZB 5FYCA 1J3PA 5DUVA 2FCVA 3ON7A 2VMIA 1OVPA 4B8EA 2PTMA 5GKAC 2QZ2A 2VZUA 1XNKA 5FXVA 4Q4W3 2V09A 4FOWA 2OR1L 1AUYA 5JWPA 3ABZA 2VXRA 4Z5DA 1B35A 3P5BA 1YWKA 3PU8A 5SV5A 3VD7A 4QXKA 4FTSA 2W46A 1PX3A 4LBQD 4D3WA 2OQ7A 2IVIB 3O1UA 5APAA 1KITA 2XXZA 5M0TA 4JRLA 1NXD1 1YRZA 1QB2A 4AVCA 3OBTA 4XMAA 3C7FA 3DPRB 4FPLA 1LRHA 4LO5B 4DXRA 1ZZCA 1AJOA 3LFMA 3U78A 4DB5A 5FRAA 4KQ7A 4FPKA 1NW3A 4DIQA 3KSCA 1QXPA 2HBUA 2VZPA 4BMBA 1F8VA 2XDVA 2IXKA 3E97A 1MS3A 1OHFA 2XOMA 5BNNB 1CAUB 2A6CA 1KEXA 4XUQA 4CCJA 1UQXA 5FY4A 1HIXA 1F35A 2VPVA 2J22A 1D0GA 4B1MA 4TZDA 2N7GA 5LA2A 3I2OA 2OYZA 2LROA 1RPEL 2PHTA 5FZOA 3IB3A 4NRMA 1PK6C 2V73A 1CIYA 1FOD1 2DVFA 3ZFEC 1PRAA 1HN1A 4LOTA 1JOJA 1LESA 1ZRFA 2H0BA 1NX9A 2WNUA 4QX1A 4D94A 3HN3A 1VRH1 3MEPA 4HKOA 1CD3G 1J1TA 4IV1B 3IPVB 2SBAA 4EZIA 1BDHA 1CJDA 2A5ZA 2QQIA 3D3AA 2XL7A 5F5IA 4QKBA 5FYIA 1TNFA 4DO0A 1AVBA 2TNFA 2VVFA 4P9YA 5AVPA 1V9U2 2LALA 2BOJA 5FXXA 3BTYA 5FPUA 3Q8AA 5C70A 3E5QA 3ZHMA 2VNGA 5TSWA 3VBUA 5A70A 4AQ6A 3MBWA 3QH6A 5EIYB 3RZJA 2DTWA 2R061 4COZA 2X5IA 5L19A 1XSRA 4HL0A 3ACLA 4N9HA 1H0BA 4QM9A 2OT7A 3MUY1 5FZ8A 1C57A 4QMAA 1ENXA 1QQBA 4YZ1A 4AVAA 5DMYA 2A1XA 5FIXA 5GLTA 2PUCA 1XRUA 2HEWF 2JB4A 4JKMA 4M4RA 2CHHA 2W3JA 2BWCA 4PF5A 4JGYC 5CADA 4M0NA 4GZ9A 3AYDA 4CEWA 3O1RA 4Y24A 1PO21 4LE4A 3VDDC 1FYUA 2HWE2 3B69A 3R4SA 4AGRA 4XHXA 2IXLA 4WVZA 5BV6A 1IKPA 3MIHA 3TRBA 3JXSA 4FI9A 3G0TA 4R4ZA 4R9CA 4TLGA 1UOBA 1C3HA 2WS92 1BCXA 1W6NB 3FBYA 5FZ9A 1XOYA 2WZR2 4Y20B 1WCDJ 1RUE2 4JZRA 3UFDA 4R9AA 1PVC3 1KJRA 2HWC1 3VDCA 2JD4A 3VBFB 4A4AA 2Q4SA 2WINB 3H8XA 3AZWA 2DF7A 1O6UA 3CDZB 2BYVE 3L2YA 1EV12 3AX4A 3D4KA 2UYAA 3I2IA 2A6YA 1V6KA 1W6NA 2XWJB 4MYEA 4YRDA 1JYVA 4NAOA 5FPXA 4Q4X2 2R6QA 2MHFA 3VBRA 3OB8A 1RTVA 1H1AA 4LK6A 4AHZA 3H42B 4HSLA 4PHZA 1XNDA 5JMCA 1QXRA 3NAPB 2PXUA 2MEV1 2ZX0A 2WA4A 3AKSA 4UFLA 1UY2A 4AXOA 3WQ7A 2MXDA 3G5GA 3SH5A 4RQPB 1J3QA 1QEXA 5GJ6A 1S0JA 4ZU7A 2Y6HA 2IUOA 1RZRD 1CZVA 1H4GA 2HH9A 4JAAA 4N53C 3TYJA 3VB9A 1JZ6A 1X33A 5EV7A 4KU7A 4HPKB 2MPFA 2W68A 2WO7A 3AK0A 3JD71 2Q1ZB 4NE9A 2EXHA 3I2KA 3N7MA 1ZBE1 1X57A 3NAPC 3CJXA 5FZCA 3GCWA 4CDWB 3P6BA 3MZHA 1W03A 4XXAA 3ZSMA 1ZBA3 3I2DA 3D1NI 4Z59A 3DKQA 3E5UA 5AVAA 5FJHA 5GLVA 4DFSA 1U12A 3V56A 3OQNA 1RB8G 1UOGA 4FQZA 1YIPA 1O3QA 4PIZA 1PZ7A 4FXGB 3J7NA 5L9RA 1WKYA 3AZZA 3OJBA 4O65A 1YIFA 5JR2A 3D6EA 2CGPA 3M4FA 4I0WB 5AC92 3OOXA 4AWDA 3UESA 3SQOA 3MDPA 3ZM8A 4JDNA 3ILRA 5F6LB 1XYOA 5BNOB 2XQRA 1QKQA
chains in the Genus database with same CATH topology
2IVGA 2O49A 2WA3A 3M1HA 2ZGPA 4DRVA 4RGGA 1AYN3 3MIEA 5D1IA 2VOKA 2GMEA 2R073 2WNEA 1EV13 3WNXA 3RS6A 4ASMB 1D0HA 4MGIE 3H1YA 3O0VA 2BQPA 4CTEA 1NQJA 3KCYA 2RS12 4GH4B 1ZVVA 4N90A 1ADRA 2ES3A 1E57A 1ZAYA 4Q4Y1 1SLCA 1V6MA 3DL3A 2GMMA 2PIJA 2CGNA 4LUKA 4I3GA 3JCIA 2G4IA 1Q56A 1WW5A 3WXPA 3MIDA 4XFGA 2XKOA 1EPWA 5FCCA 3FYAA 2D98A 4X6QB 1HRI3 3LGRA 1REFA 2AYHA 5JAXA 2VOWA 1V6JA 1WW6A 1JYCA 4QQPA 2YDEA 4CEYC 1UF2C 3JD72 2BVVA 4RR3A 5T5LA 1VBD1 1RUG2 4CDUC 5IK8A 1NQDA 5I0SA 3B9CA 3DUIA 3VBUC 2YY1A 3LISA 2ZOEB 4YLZA 3SISA 3VKMA 4GWMA 2TBVA 2HWD1 2HWB1 1U0AA 2RJLA 4K21A 1JUHA 1QMJA 2PYTA 4B4RA 3SCFA 3FFQA 3M3QA 4H3WA 3MLJA 3SH3A 1UKGA 2P37A 4X4GA 3DN7A 1KJLA 1DHKB 5AFEA 1RUH1 1LOGA 1H8TA 2GC1A 2R16A 4PBPA 3VBSA 2DVGA 1EV11 3CU7A 1PVC1 3R4UA 3VGIA 4FPYA 4GIQA 4F83A 5LK5A 3GF6A 1ZRCA 1UZYA 1V00A 3PVOA 4ZU5A 5JOWA 2FHRA 4HT1T 3ECQA 4MLOA 5EFUA 5FQ0A 1DYKA 3KB5A 1R1A2 4LO6B 3H3ZA 3H8UA 1LOFC 4FPOB 3ZYRA 4RHV1 5J36A 5KHKA 2Y0OA 5D8AB 3D0JA 3WCSA 1GYKA 2ZGMA 1U5IA 2SLIA 4YGEA 1WGPA 1AR92 1RZRA 2DVAA 4YG0A 4BMEA 3AJZA 4PLOA 3KGLA 4WM8B 5I8YA 4JCYA 2ENRA 2R063 2WC2A 3H7YA 1LU1A 4IWRA 1H2LA 4Q27A 2GZWA 4AF9A 2KEIA 2EVXA 1GICA 2ZBJA 3WR0A 4OULA 4Z82A 3J8F2 1PO22 3HBZA 3ZN6B 4AHWA 4OHVA 1HLCA 1ENQA 3KZ3A 4KBBA 3O0WA 1ZUGA 2YROA 4CP1A 3NJZA 3OMTA 3R1FA 3SITA 1SQ4A 2DU1A 4HKLA 4X4FA 3JQWA 1KFXL 1LULA 3S30A 3V0BA 3VHRA 4WM7A 1C4RA 5CFCC 4AG4A 1QNWA 2PAEA 4IEUA 2XUMA 2GDFA 3MF9A 1LGCA 3CEWA 4OB4A 1PGL2 4LO8A 4HANA 1ND2A 2A6VA 1VBA2 1LENA 5CB7A 3VN4A 1FNZA 4JDOA 5F1RA 3RJRA 2HEYF 3AMQA 2B46X 2QJVA 3IWZA 2XVKA 1UMZA 1Q8OA 2NN8A 4I3PA 4XZPA 1C5HA 4XF1A 1LU2A 1NEQA 3ZXFA 3T1MA 4E27A 4NR1A 1HXS2 3ZMOA 1QWRA 2VNRA 4E9KA 1WD4A 5H9PA 4FPCA 1IPKA 1W6OB 4IXLA 1QJU3 2WZPP 3BB6A 4UW5A 3HIFA 4KGQA 2ZJCA 3HMYA 1OQDA 2O1QA 4K3UA 3VBOC 3QBQA 4AFAA 1QH6A 4BZ4A 1CESA 3ZSLA 4A2UA 1OOPC 1L1MA 1RITA 2Z2SB 3MLLA 3KT7A 4DPNA 3EHKA 3ME2A 2PPXA 2B45X 1M06G 1AZDA 2D6OX 3SHRA 3VZNA 1YI7A 3RWNA 4E4SA 2RHPA 2AUYA 4XDQA 4BLIA 1V6OA 1MZFA 2BNOA 3CL1A 4JGYB 1S7EA 5GM0A 2XVGA 2VQAA 4CDUA 1QQP2 4RGAA 3JXCL 2LM3A 4M3CB 1YHFA 2PA7A 5KHGA 3TAYA 5E1RA 2RS52 1G86A 2O0OA 4MGKE 2WNVC 1F31A 3USSA 1AR71 1U5XA 4UW4A 1SLTA 2ZX2A 4P5HA 3AFKA 1H8TC 5T5OA 3THPA 3VBSC 3WCRA 1NERA 3THTA 3SNMA 4HN0A 4DOUA 1CJGA 2AR6A 5CIRA 5A33A 4EN0A 1JN2P 3ASIA 2WQ4A 4XETA 1N1VA 3S6PA 3E6BA 1I5ZA 1R69A 1AX2A 4ISRA 4Q0QA 3U07A 5BNNA 2EAKA 3BS3A 2GZUA 2IFWA 4YVSC 4PBOA 3DNVB 1C28A 1EYBA 2QZ3A 1TME3 1G7YA 4CEYA 5T52A 1F2NA 3U4XA 4AI2A 1CPNA 1SDWA 4P9JA 3PJQA 2XCJA 2PLV2 5GZEA 1XYPA 3ZYPA 5IK7A 1DYPA 1DFQA 4UW3A 1QQP3 3E5XA 1RUJ1 2Q1MA 2LYLA 4M3CE 2R071 3J26N 3EJKA 4N43B 3ZFFA 1ZZ7A 4Y5Z0 4XIOA 4QPIC 4YW1A 3WT3A 2NQYA 1MS0A 2XH6A 3PLQA 3Q9OA 2LYRA 4F3JA 4BHPA 4K40A 3BTAA 1R092 2ZKNA 3O9XA 3POSA 3VBHC 2DFBA 4OLLA 2D3PA 1LOCA 4XFIA 4BQ1A 4EJRA 5C9AB 1NE6A 1ZBA1 3DV8A 3DKWA 5GLZA 4XBQA 4X6RB 1CONA 3VL9A 1W6PA 4XQDA 4AEDB 1RIRA 2LYJA 3WOGA 2NLRA 1R083 3SCHA 1LOEA 4RSUA 2KXLA 1CAXB 4Z1VA 4V1PA 1CAVB 1O4ZA 1O4YA 3F52A 3OY8A 1QJX2 2HJIA 4JGYA 3ZFGA 4CDUB 4PJYA 5J37A 2E7QA 1OFSA 4AHXA 2Y26A 1YSEA 2G9GA 4JVAA 2D93A 4YW2A 3QQ6A 2RS13 2ZHLA 3D82A 1AR72 2XPJA 2FQPA 1LEDA 5EYYA 4YGCA 1MQTB 2R30A 1SLAA 3C3VA 4QPYA 2HYKA 2XI8A 5EZWA 2PHFA 2WNUB 2AZ5A 5C9AC 2ZGQA 4LE3A 1VBD3 1LTEA 1RJ8A 1QJZA 3WP5A 4RS5B 4COVA 2HWF1 4Q1PA 1VB2A 1MEC1 4XJUA 5F9TA 2DV9A 1LCDA 2I07B 2R062 5BNPC 1PO13 3O14A 3POYA 4I02A 4TYSA 3B94A 1NY72 1AJKA 4IV1C 5C33A 2EXJA 2H6BA 4RS5A 5KHIA 4JGZA 1NXMA 2R0FA 4K7JA 1ND2C 3ZX7A 1QH7A 4BPZA 2RS11 4Y42A 4GKYA 3RJ2X 2EAAA 2D6KA 3AB0A 3PMSA 4WVVA 4GQ7A 1Q8SA 2WKKA 5JIAA 3VKFC 3WP6A 3JXDL 2IXHA 5IUQA 5KC6A 2WNVA 2JDZA 4MXWA 3VKLA 4QGLA 4AI0A 3LSDA 1F9KA 1R081 3A4UA 1DG6A 2VVEA 3EUSA 2H0VA 2IXCA 4N9IA 2JENA 2R32A 4BM8A 3WHTA 2VG9A 2DUOA 4LR4A 4ONUA 4IQPA 3ZHIA 1LJ7A 1FI2A 4FXKB 4H14A 4Q26A 3BDNA 2EF6A 2GNBA 3PJYA 1E3OC 3WG4A 5JSOA 4RR3B 4FOYA 2VH9A 1PERL 5A3LA 3H9AA 1OSGA 3T2TA 2PUGA 4GH4C 2RM22 3OYWA 4FQ4A 2GU9A 2JG9A 4KWLA 3ZXJA 5HCBA 1BKZA 2WSUA 4XJ9A 1RUJ3 4H7MA 4J6GA 2H6CA 2MQKA 4BIOA 1AX0A 5A3MA 3IKWA 3SLIA 1KS5A 1SLIA 2BTVC 5L7OB 2UWCA 1FV3A 4WZFA 3CLPA 4IEVA 4S2GA 1AL21 1BDIA 5CFCB 1MS8A 2P3JA 2XVLA 1ND3C 4AYUA 5CA6A 4W65A 4NVPA 1WA4A 1RUG1 3USUA 2PFWA 3M3CA 3GN5B 2PLV1 4PLNA 4FT8A 4RR3C 1OMIA 2GN3A 1CAXA 2PLV3 4MGZE 4P14A 1W6MB 1OLRA 2R043 3TNQA 1JH5A 4YG3A 4PU8A 2ZTNA 2UWBA 4CEWB 3VBFA 1X7NA 1AYN2 4XFFA 2ZGSA 3WW1A 1AL23 2NZ9A 3HR9A 1VR3A 1V9U3 1KD7A 1S0CA 1TE1B 4NHLA 3ILFA 2B7YA 3WLUA 2XJVA 2IVBA 1VRH3 5BXXA 3WW2A 2OPKA 3AKQA 1CAUA 1H2KA 1LMB3 1MS9A 2QDNA 3MW2A 5FREA 4B7KA 3FHIB 2D97A 2JG8C 3QCWA 3H3UA 2NM1A 1ASJ2 2CV6A 4PCRA 4N43A 4LO7A 1RUD2 3RI9A 4Q4W1 3KQRA 3GZTB 3GZAA 4PLMA 2K2SA 4IEZA 1VBC3 1VIWB 1XNBA 1AR61 3VBRB 4K6BA 1D2QA 4XE9A 1J58A 1IC8A 5J98B 1LQCA 4M01A 1ENSA 3MICA 2WIUB 1JFTA 5DG2A 4CDXA 3QH7A 4J1XA 1D4VB 4XTPA 1VAKA 3GALA 4JCKA 4F8AA 2YHJA 4L11A 1PNGA 1ZS4A 2A71A 2XJUA 3IPVA 1RUOA 4IV1A 3VZKA 1H2MA 3ZSEA 4Q1RA 3NKTA 2YUEA 2I45A 4WV8A 4XJ8A 3N3HA 5B2GB 1VBA1 4WM8C 2VUJA 5I0UA 4CYDA 2HWD3 2HWB3 1IQAA 2Z79A 3AM2A 2OZJA 3SH4A 1FAYA 1K5MA 1DQ4A 1NA1A 3RNSA 4IA8A 2ZA9A 4YG6A 2CY6A 1WCSA 3OTFA 4FCAA 4CDXC 4PDWB 4Z5CA 2ZAHA 1A8MA 3WW4A 1LKNA 3AJYA 1TNRA 2HWE1 5CFCA 5EXOA 4PU4C 3PHMA 1G9FA 4K1YA 4ASLA 1IS6A 3VZMA 4UW6A 1VALA 5J96B 4HZFA 3KXAA 1HX6A 4OI1A 3CJIA 2XSDC 1JYIA 1R1ZA 3NWKA 4IEOA 2JE7A 4BH9A 1LOAA 1RHI3 3FZ3A 2YC0A 2WNUC 2YMZA 5JSRA 3POWA 3PNAA 4LO4B 1V6LA 4OHZA 4UBGA 1KRIA 1IGOA 3AXEA 5LEKA 4NDWA 3ZVXA 1VBE1 5DZGA 3H50A 3FYMA 2FJRA 1QJY2 1YFWA 4EWAA 1H4HA 2DTYA 5A32B 2Q8OA 4LT5A 2A6ZA 1Z78A 4WVMB 3MW3A 5BNPB 1Y43B 1PZ9A 4MCXA 2A70A 4GULA 1UTXA 1QOTA 2DUPA 4K8FA 1J59A 3PTYA 1XU2A 4YG7B 1FXZA 2ATFA 2OA2A 3VKNA 2RE9A 2F6BA 3FLTA 3JBG3 3NV1A 2DVDA 1G9BA 1KDMA 1DGLA 3JB4C 3AMHA 1NOVA 1HW5A 3ZYGA 4B4PA 2A6XA 1N47A 1RL3A 5CNAA 4CP0A 5FO8B 2NPIA 1FMD1 5LRRA 4XFCA 4ES9A 2CL2A 1G9AA 1HQWA 2BBVA 2RM21 4FPEA 2BPA2 4FTEA 2KEKA 1CGPA 1HRI1 3OP9A 3A0NA 1PZ8A 1A6CA 4FAGA 4GH4A 1UL9A 4S2DA 3FWEA 1D2SA 3A0KA 1SBEA 4UBHA 4Y22B 1VAMA 1RUE3 1GT0C 4X4IA 1N3QA 4OZXA 2O4AA 1APNA 2PUAA 3WP3A 1HRV2 4QX5A 5I0TA 1YYNA 1RUE1 3VBOB 3J4UH 3WDVA 3GBWA 2JG8A 4AGVA 1CR7A 3KMHA 2R49A 3KT4A 4EN7B 5I93A 3TNPB 2B8MA 2IXJA 2R0HA 2TUNA 2AENA 4QGMA 3K48A 5FDBA 1UX6A 5KXCA 2AWIA 1S0BA 2E63A 4L2NA 1BZWA 5BNNC 3CO2A 3V65A 3SCGA 2RM23 3ZSKA 1WMFA 1PNRA 1D4M3 4AEDC 2W08A 1CX4A 4FO9A 3WUCA 4OHWA 1QXJA 4Y1UA