2PXLA

Variant 9 of ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4.5 S RNA
publication title A General Strategy to Solve the Phase Problem in RNA Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
total genus 20
structure length 69
sequence length 102
ec nomenclature
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 2pxlA00
3DM5A 3NDBB 1QZXA 2V3CC 2PXFA 2PXEA 1DULA 2PXKA 2JQEA 3KL4A 2PXLA 1QB2A 2PXVA 1HQ1A 2XXAA 2FFHA 1MFQC 5GAGi 3LQXA 5GAHi 2PXBA 2PXQA 2PXPA 2PXUA 2PXTA 2PXDA
chains in the Genus database with same CATH superfamily
5DTRA 4X4IA 2EBYA 2LYLA 4MCXA 2B5AA 3A9YA 3CROL 2PXFA 3RZZA 2IUOA 5DT2A 1DW9A 4PU7A 1AU7A 4YBAA 1BDHA 2EF8A 2HINA 3OQOA 3B7HA 2MXDA 1X2LA 1QPZA 1WH8A 4PU4C 2HCNA 1DULA 3TEPA 4X4EA 1LLIA 3GUUA 1CJGA 4Q2JA 1SQ8A 2PE5A 1R69A 2PXBA 4PU8A 2LYRA 2LYJA 4IA8A 3DM5A 2IVQA 1QZXA 4Y42A 2PUEA 4HRAA 1PRVA 4YARA 5K98B 2H8RA 1ZZ7A 4Z5DA 4Z5CA 1LCCA 2LYQA 2FFHA 3UFDA 2IVGA 2XCJA 4ER0A 1Y9QA 2PXQA 4DE8A 1RPEL 2VEOA 3S8QA 2MEZA 3ZHMA 2PUFA 3NDBB 4Z59A 2A6CA 2AW6A 3CLCA 5DSXA 2JCGA 2L8NA 3TRBA 2D5VA 3QQ6A 1BDIA 4J1WA 2IV1A 2EWTA 4O8BA 5A7LA 3NXHA 2GRLA 2PXTA 4J1XA 3NROA 1ZZBA 1ZAYA 1ZVVA 3G5GA 2J7WA 3KZ3A 1WIZA 3GBFA 3GZDC 3PXPA 2WUSR 1YSEA 2XXQA 4EZIA 5DTQA 1LCDA 5GAHi 4MCTA 1PRAA 1ZS4A 4X4FA 1UXCA 3SCFA 2XJ3A 3QWGA 2PXDA 4WVLA 1WH6A 2L49A 1R63A 3JXDL 1NEQA 1E3OC 2LLVA 2PPXA 2BJCA 2O38A 3VK0A 3G7DA 1ZZCA 2R63A 2YBDA 1QB2A 3QF3A 4X4DA 2LNMA 2XXPA 3ZPXA 4EKGA 3D1NI 2JVLA 3ME5A 2PXPA 3R1FA 2ICTA 1PERL 1JH9A 1X57A 4ER6A 3OQNA 3MEJA 2HCSA 1PNRA 1O4XA 4I6UA 3UWPA 1HQ1A 3SX0A 2KPJA 2HSGA 1ADRA 4YG7B 4F8DA 3GN5A 2PUBA 2LYKA 3FMYA 3SR4A 3KXAA 4OBMA 4FBIA 3A9ZA 1L1MA 5DRYA 2PXEA 3BD1A 4PU3C 4JQDA 2MQKA 2R1JL 4DE9A 2XI8A 3JXCL 3H5TA 2FJRA 4I6TA 2M4HA 3PE5A 3TELA 2PUCA 3CECA 1DWKA 3F52A 4GQMA 2BNOA 1B0NA 1S7EA 3ZHIA 2JQEA 2LLWA 1ZZ6A 1JWLA 2O49A 1LMB3 3QYXA 3L1PA 3ZKCA 1JFTA 2LYSA 2PUAA 2CROA 4ER3A 4X4CA 4X4HA 3TFLA 3BDNA 4IWRA 3O9XA 1XWRA 2HFZA 3HZIB 3F51A 3GZCA 3IVPA 3OKZA 2AXUA 4YG1A 3OQMA 2OFYA 4JCXA 3GN5B 4Z58A 1QP0A 2J7UA 3KL4A 2BNMA 2KEKA 4YG4A 3OWQA 1OCTC 1ZUGA 3LQXA 3M9LA 1NW3A 3BS3A 1RZSA 3SCHA 2KZ8A 4EK9A 3SCGA 3U3WA 2PUDA 4JCYA 3F6WA 2XSDC 1WETA 1ZZ8A 2AUWA 3MLFA 3DNVB 4I6RA 1PRUA 1QP7A 2AXZA 3OP9A 2AWIA 3QFIA 5JUWA 1RZRD 1EFAA 4NDWA 2OR1L 3G0TA 1IC8A 1HF0A 2PXKA 3QOXA 1RZRA 1ZPQA 2PUGA 1UTXA 1MFQC 1RIOA 3OMTA 1QQBA 1NERA 1UXDA 4GHJA 1POUA 4IVZA 1QP4A 2PIJA 2V3CC 4EKIA 4ER7A 4X4GA 4ER5A 2LCVA 3GZDA 2IU7A 3FYMA 3A9XA 1GT0C 4Z5HA 1LQCA 2ICPA 3KJXA 4I8TA 1CQTA 1QQAA 2BNNA 4OB4A 3LISA 2XIUA 4FN3A 2CSFA 3JXBC 1ZZ9A 2PXVA 4X4BA 5DRTA 2WIUB 1VPWA 1U2ZA 2PXUA 1Y7YA 2L1PA 5DTMA 3VWSA 1OSLA 2AXVA 2GRMA 3EUSA 2KEJA 2KEIA 3NZLA 2LYPA 2IVBA 2GZUA 4EQZA 2PXLA 1JFSA 3FYAA 2XXAA 5GAGi 2ODRD 3R09A 2O4AA 3QOWA 3LFPA
chains in the Genus database with same CATH topology
3DM5A 3NDBB 1QZXA 2V3CC 2PXFA 2PXEA 1DULA 2PXKA 2JQEA 3KL4A 2PXLA 1QB2A 2PXVA 1HQ1A 2XXAA 2FFHA 1MFQC 5GAGi 3LQXA 5GAHi 2PXBA 2PXQA 2PXPA 2PXUA 2PXTA 2PXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DM5 A;  3NDB B;  1QZX A;  2V3C C;  2PXF A;  2PXE A;  1DUL A;  2PXK A;  2JQE A;  3KL4 A;  2PXL A;  1QB2 A;  2PXV A;  1HQ1 A;  2XXA A;  2FFH A;  1MFQ C;  5GAG i;  3LQX A;  5GAH i;  2PXB A;  2PXQ A;  2PXP A;  2PXU A;  2PXT A;  2PXD A; 
#chains in the Genus database with same CATH topology
 5DTR A;  4X4I A;  2EBY A;  2LYL A;  4MCX A;  2B5A A;  3A9Y A;  3CRO L;  2PXF A;  3RZZ A;  2IUO A;  5DT2 A;  1DW9 A;  4PU7 A;  1AU7 A;  4YBA A;  1BDH A;  2EF8 A;  2HIN A;  3OQO A;  3B7H A;  2MXD A;  1X2L A;  1QPZ A;  1WH8 A;  4PU4 C;  2HCN A;  1DUL A;  3TEP A;  4X4E A;  1LLI A;  3GUU A;  1CJG A;  4Q2J A;  1SQ8 A;  2PE5 A;  1R69 A;  2PXB A;  4PU8 A;  2LYR A;  2LYJ A;  4IA8 A;  3DM5 A;  2IVQ A;  1QZX A;  4Y42 A;  2PUE A;  4HRA A;  1PRV A;  4YAR A;  5K98 B;  2H8R A;  1ZZ7 A;  4Z5D A;  4Z5C A;  1LCC A;  2LYQ A;  2FFH A;  3UFD A;  2IVG A;  2XCJ A;  4ER0 A;  1Y9Q A;  2PXQ A;  4DE8 A;  1RPE L;  2VEO A;  3S8Q A;  2MEZ A;  3ZHM A;  2PUF A;  3NDB B;  4Z59 A;  2A6C A;  2AW6 A;  3CLC A;  5DSX A;  2JCG A;  2L8N A;  3TRB A;  2D5V A;  3QQ6 A;  1BDI A;  4J1W A;  2IV1 A;  2EWT A;  4O8B A;  5A7L A;  3NXH A;  2GRL A;  2PXT A;  4J1X A;  3NRO A;  1ZZB A;  1ZAY A;  1ZVV A;  3G5G A;  2J7W A;  3KZ3 A;  1WIZ A;  3GBF A;  3GZD C;  3PXP A;  2WUS R;  1YSE A;  2XXQ A;  4EZI A;  5DTQ A;  1LCD A;  5GAH i;  4MCT A;  1PRA A;  1ZS4 A;  4X4F A;  1UXC A;  3SCF A;  2XJ3 A;  3QWG A;  2PXD A;  4WVL A;  1WH6 A;  2L49 A;  1R63 A;  3JXD L;  1NEQ A;  1E3O C;  2LLV A;  2PPX A;  2BJC A;  2O38 A;  3VK0 A;  3G7D A;  1ZZC A;  2R63 A;  2YBD A;  1QB2 A;  3QF3 A;  4X4D A;  2LNM A;  2XXP A;  3ZPX A;  4EKG A;  3D1N I;  2JVL A;  3ME5 A;  2PXP A;  3R1F A;  2ICT A;  1PER L;  1JH9 A;  1X57 A;  4ER6 A;  3OQN A;  3MEJ A;  2HCS A;  1PNR A;  1O4X A;  4I6U A;  3UWP A;  1HQ1 A;  3SX0 A;  2KPJ A;  2HSG A;  1ADR A;  4YG7 B;  4F8D A;  3GN5 A;  2PUB A;  2LYK A;  3FMY A;  3SR4 A;  3KXA A;  4OBM A;  4FBI A;  3A9Z A;  1L1M A;  5DRY A;  2PXE A;  3BD1 A;  4PU3 C;  4JQD A;  2MQK A;  2R1J L;  4DE9 A;  2XI8 A;  3JXC L;  3H5T A;  2FJR A;  4I6T A;  2M4H A;  3PE5 A;  3TEL A;  2PUC A;  3CEC A;  1DWK A;  3F52 A;  4GQM A;  2BNO A;  1B0N A;  1S7E A;  3ZHI A;  2JQE A;  2LLW A;  1ZZ6 A;  1JWL A;  2O49 A;  1LMB 3;  3QYX A;  3L1P A;  3ZKC A;  1JFT A;  2LYS A;  2PUA A;  2CRO A;  4ER3 A;  4X4C A;  4X4H A;  3TFL A;  3BDN A;  4IWR A;  3O9X A;  1XWR A;  2HFZ A;  3HZI B;  3F51 A;  3GZC A;  3IVP A;  3OKZ A;  2AXU A;  4YG1 A;  3OQM A;  2OFY A;  4JCX A;  3GN5 B;  4Z58 A;  1QP0 A;  2J7U A;  3KL4 A;  2BNM A;  2KEK A;  4YG4 A;  3OWQ A;  1OCT C;  1ZUG A;  3LQX A;  3M9L A;  1NW3 A;  3BS3 A;  1RZS A;  3SCH A;  2KZ8 A;  4EK9 A;  3SCG A;  3U3W A;  2PUD A;  4JCY A;  3F6W A;  2XSD C;  1WET A;  1ZZ8 A;  2AUW A;  3MLF A;  3DNV B;  4I6R A;  1PRU A;  1QP7 A;  2AXZ A;  3OP9 A;  2AWI A;  3QFI A;  5JUW A;  1RZR D;  1EFA A;  4NDW A;  2OR1 L;  3G0T A;  1IC8 A;  1HF0 A;  2PXK A;  3QOX A;  1RZR A;  1ZPQ A;  2PUG A;  1UTX A;  1MFQ C;  1RIO A;  3OMT A;  1QQB A;  1NER A;  1UXD A;  4GHJ A;  1POU A;  4IVZ A;  1QP4 A;  2PIJ A;  2V3C C;  4EKI A;  4ER7 A;  4X4G A;  4ER5 A;  2LCV A;  3GZD A;  2IU7 A;  3FYM A;  3A9X A;  1GT0 C;  4Z5H A;  1LQC A;  2ICP A;  3KJX A;  4I8T A;  1CQT A;  1QQA A;  2BNN A;  4OB4 A;  3LIS A;  2XIU A;  4FN3 A;  2CSF A;  3JXB C;  1ZZ9 A;  2PXV A;  4X4B A;  5DRT A;  2WIU B;  1VPW A;  1U2Z A;  2PXU A;  1Y7Y A;  2L1P A;  5DTM A;  3VWS A;  1OSL A;  2AXV A;  2GRM A;  3EUS A;  2KEJ A;  2KEI A;  3NZL A;  2LYP A;  2IVB A;  2GZU A;  4EQZ A;  2PXL A;  1JFS A;  3FYA A;  2XXA A;  5GAG i;  2ODR D;  3R09 A;  2O4A A;  3QOW A;  3LFP A; 
#chains in the Genus database with same CATH homology
 3DM5 A;  3NDB B;  1QZX A;  2V3C C;  2PXF A;  2PXE A;  1DUL A;  2PXK A;  2JQE A;  3KL4 A;  2PXL A;  1QB2 A;  2PXV A;  1HQ1 A;  2XXA A;  2FFH A;  1MFQ C;  5GAG i;  3LQX A;  5GAH i;  2PXB A;  2PXQ A;  2PXP A;  2PXU A;  2PXT A;  2PXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...