2PXLA

Variant 9 of ribonucleoprotein core of the e. coli signal recognition particle
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
102
structure length
69
Chain Sequence
FDLNDFLEQKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A General Strategy to Solve the Phase Problem in RNA Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein/rna
molecule keywords 4.5 S RNA
total genus 20
structure length 69
sequence length 102
ec nomenclature
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.30 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) Signal recognition particle, SRP54 subunit, M-domain 2pxlA00
1QZXA 2PXUA 1MFQC 2FFHA 1DULA 2XXAA 2PXVA 3LQXA 2JQEA 2PXLA 2PXEA 2PXDA 5GAHi 3KL4A 2PXPA 2PXKA 3DM5A 2PXFA 2V3CC 2PXQA 2PXTA 3NDBB 5GAGi 1QB2A 1HQ1A 2PXBA
chains in the Genus database with same CATH superfamily
4I8TA 2VEOA 5DTMA 2L8NA 2XXAA 1UXCA 2XSDC 2ICPA 1PRVA 4FBIA 3OQOA 2LCVA 1CJGA 1UXDA 3TELA 2PXPA 2PUEA 4Z58A 2EBYA 2PUCA 4GQMA 1ZAYA 3QWGA 3GN5B 1QB2A 1HQ1A 3L1PA 3SR4A 3KJXA 3MLFA 4X4GA 4MCTA 4YBAA 2MQKA 1JH9A 2JQEA 3D1NI 1QP7A 5DTQA 1NERA 4EKGA 3CLCA 2PUBA 3GN5A 1PRUA 3SCGA 2PE5A 5K98B 1HF0A 2V3CC 3B7HA 2AWIA 3A9YA 2AXUA 2GRLA 2LYPA 4DE8A 3S8QA 2KZ8A 1AU7A 2PXLA 2HFZA 4ER5A 1VPWA 4MCXA 1ZZ6A 3G0TA 2IVBA 4J1XA 2LNMA 1QP0A 3UFDA 2XXPA 1E3OC 1QQAA 3F52A 3ZKCA 1ZVVA 2J7UA 1NEQA 1WIZA 3KZ3A 1X57A 2KEKA 3MEJA 1DULA 3FYAA 2IVQA 2PIJA 3QF3A 3A9ZA 1ZS4A 3SCFA 2YBDA 1O4XA 4EZIA 5DT2A 1OSLA 3G5GA 2GRMA 3SX0A 5JUWA 2XI8A 2PPXA 1B0NA 4GHJA 1WH8A 2MXDA 2L1PA 4YARA 4ER6A 3CECA 3LISA 4EK9A 4OBMA 1LMB3 1S7EA 1PNRA 4IWRA 1WETA 2HINA 1IC8A 1QZXA 3PE5A 3QQ6A 5DRYA 2IU7A 2BNOA 1ZZBA 3NZLA 1PERL 2BNMA 1RIOA 4YG4A 2XJ3A 2PXQA 3OQNA 1BDIA 3QOWA 2PXUA 1OCTC 4PU4C 4OB4A 2O49A 1RZRA 1SQ8A 3ME5A 2KEJA 1YSEA 4HRAA 4NDWA 2A6CA 2B5AA 2OFYA 3OWQA 2J7WA 2LYJA 3OMTA 2MEZA 4DE9A 4JCXA 2O4AA 3FYMA 3QYXA 1PRAA 4IA8A 1BDHA 2CROA 4WVLA 3PXPA 3R09A 2JCGA 2JVLA 1JFTA 2PXDA 1UTXA 3ZPXA 2LYRA 2LYSA 4PU3C 2PXBA 3O9XA 1X2LA 2FFHA 1L1MA 3TFLA 3TRBA 3OKZA 2EWTA 4JCYA 4ER0A 3BDNA 3BD1A 1JWLA 3ZHIA 2D5VA 4I6TA 4Q2JA 2IVGA 1DWKA 4Z5DA 2WUSR 2ODRD 4X4HA 3GZCA 2EF8A 4JQDA 5DSXA 1POUA 3QFIA 4YG1A 1RZRD 1QPZA 2R63A 3G7DA 2GZUA 4PU8A 4X4FA 1ZUGA 4EQZA 4YG7B 2OR1L 1NW3A 2LYLA 1ZZ7A 4IVZA 1U2ZA 2IUOA 4O8BA 1QQBA 3F6WA 3IVPA 5A7LA 1LCDA 2HSGA 3EUSA 2LLVA 2HCNA 2PUFA 4X4IA 1ZZ9A 3DM5A 2AW6A 2H8RA 3M9LA 1Y9QA 3LFPA 3KXAA 5GAGi 2KEIA 1QP4A 3FMYA 2AUWA 2XIUA 1ZZ8A 3CROL 2HCSA 3GBFA 1Y7YA 4Y42A 3RZZA 2PUDA 2KPJA 2PXFA 3BS3A 2LYQA 3F51A 3NROA 3VK0A 3GZDA 2XXQA 1LQCA 2BJCA 3VWSA 1DW9A 3QOXA 1R63A 1ZZCA 4ER7A 3DNVB 3R1FA 4Z59A 3JXCL 2LLWA 3UWPA 1JFSA 2AXVA 2M4HA 2IV1A 4EKIA 1ZPQA 3OP9A 4I6RA 2CSFA 1RZSA 1WH6A 1LCCA 1XWRA 1CQTA 5DRTA 4X4DA 4J1WA 5GAHi 3ZHMA 3GUUA 2R1JL 2PXKA 2PUAA 2PUGA 3NXHA 3NDBB 4Z5HA 4X4EA 4PU7A 2FJRA 1RPEL 2PXVA 4X4BA 3LQXA 1R69A 3GZDC 3JXBC 3H5TA 4X4CA 3KL4A 2LYKA 4I6UA 3HZIB 2L49A 4ER3A 2AXZA 2PXTA 2O38A 4F8DA 1GT0C 3A9XA 4Z5CA 1MFQC 3TEPA 3SCHA 3JXDL 1LLIA 2PXEA 3U3WA 2WIUB 3OQMA 4FN3A 2ICTA 1ADRA 1EFAA 5DTRA 2XCJA 2BNNA
chains in the Genus database with same CATH topology
1QZXA 2PXUA 1MFQC 2FFHA 1DULA 2XXAA 2PXVA 3LQXA 2JQEA 2PXLA 2PXEA 2PXDA 5GAHi 3KL4A 2PXPA 2PXKA 3DM5A 2PXFA 2V3CC 2PXQA 2PXTA 3NDBB 5GAGi 1QB2A 1HQ1A 2PXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZX A;  2PXU A;  1MFQ C;  2FFH A;  1DUL A;  2XXA A;  2PXV A;  3LQX A;  2JQE A;  2PXL A;  2PXE A;  2PXD A;  5GAH i;  3KL4 A;  2PXP A;  2PXK A;  3DM5 A;  2PXF A;  2V3C C;  2PXQ A;  2PXT A;  3NDB B;  5GAG i;  1QB2 A;  1HQ1 A;  2PXB A; 
#chains in the Genus database with same CATH topology
 4I8T A;  2VEO A;  5DTM A;  2L8N A;  2XXA A;  1UXC A;  2XSD C;  2ICP A;  1PRV A;  4FBI A;  3OQO A;  2LCV A;  1CJG A;  1UXD A;  3TEL A;  2PXP A;  2PUE A;  4Z58 A;  2EBY A;  2PUC A;  4GQM A;  1ZAY A;  3QWG A;  3GN5 B;  1QB2 A;  1HQ1 A;  3L1P A;  3SR4 A;  3KJX A;  3MLF A;  4X4G A;  4MCT A;  4YBA A;  2MQK A;  1JH9 A;  2JQE A;  3D1N I;  1QP7 A;  5DTQ A;  1NER A;  4EKG A;  3CLC A;  2PUB A;  3GN5 A;  1PRU A;  3SCG A;  2PE5 A;  5K98 B;  1HF0 A;  2V3C C;  3B7H A;  2AWI A;  3A9Y A;  2AXU A;  2GRL A;  2LYP A;  4DE8 A;  3S8Q A;  2KZ8 A;  1AU7 A;  2PXL A;  2HFZ A;  4ER5 A;  1VPW A;  4MCX A;  1ZZ6 A;  3G0T A;  2IVB A;  4J1X A;  2LNM A;  1QP0 A;  3UFD A;  2XXP A;  1E3O C;  1QQA A;  3F52 A;  3ZKC A;  1ZVV A;  2J7U A;  1NEQ A;  1WIZ A;  3KZ3 A;  1X57 A;  2KEK A;  3MEJ A;  1DUL A;  3FYA A;  2IVQ A;  2PIJ A;  3QF3 A;  3A9Z A;  1ZS4 A;  3SCF A;  2YBD A;  1O4X A;  4EZI A;  5DT2 A;  1OSL A;  3G5G A;  2GRM A;  3SX0 A;  5JUW A;  2XI8 A;  2PPX A;  1B0N A;  4GHJ A;  1WH8 A;  2MXD A;  2L1P A;  4YAR A;  4ER6 A;  3CEC A;  3LIS A;  4EK9 A;  4OBM A;  1LMB 3;  1S7E A;  1PNR A;  4IWR A;  1WET A;  2HIN A;  1IC8 A;  1QZX A;  3PE5 A;  3QQ6 A;  5DRY A;  2IU7 A;  2BNO A;  1ZZB A;  3NZL A;  1PER L;  2BNM A;  1RIO A;  4YG4 A;  2XJ3 A;  2PXQ A;  3OQN A;  1BDI A;  3QOW A;  2PXU A;  1OCT C;  4PU4 C;  4OB4 A;  2O49 A;  1RZR A;  1SQ8 A;  3ME5 A;  2KEJ A;  1YSE A;  4HRA A;  4NDW A;  2A6C A;  2B5A A;  2OFY A;  3OWQ A;  2J7W A;  2LYJ A;  3OMT A;  2MEZ A;  4DE9 A;  4JCX A;  2O4A A;  3FYM A;  3QYX A;  1PRA A;  4IA8 A;  1BDH A;  2CRO A;  4WVL A;  3PXP A;  3R09 A;  2JCG A;  2JVL A;  1JFT A;  2PXD A;  1UTX A;  3ZPX A;  2LYR A;  2LYS A;  4PU3 C;  2PXB A;  3O9X A;  1X2L A;  2FFH A;  1L1M A;  3TFL A;  3TRB A;  3OKZ A;  2EWT A;  4JCY A;  4ER0 A;  3BDN A;  3BD1 A;  1JWL A;  3ZHI A;  2D5V A;  4I6T A;  4Q2J A;  2IVG A;  1DWK A;  4Z5D A;  2WUS R;  2ODR D;  4X4H A;  3GZC A;  2EF8 A;  4JQD A;  5DSX A;  1POU A;  3QFI A;  4YG1 A;  1RZR D;  1QPZ A;  2R63 A;  3G7D A;  2GZU A;  4PU8 A;  4X4F A;  1ZUG A;  4EQZ A;  4YG7 B;  2OR1 L;  1NW3 A;  2LYL A;  1ZZ7 A;  4IVZ A;  1U2Z A;  2IUO A;  4O8B A;  1QQB A;  3F6W A;  3IVP A;  5A7L A;  1LCD A;  2HSG A;  3EUS A;  2LLV A;  2HCN A;  2PUF A;  4X4I A;  1ZZ9 A;  3DM5 A;  2AW6 A;  2H8R A;  3M9L A;  1Y9Q A;  3LFP A;  3KXA A;  5GAG i;  2KEI A;  1QP4 A;  3FMY A;  2AUW A;  2XIU A;  1ZZ8 A;  3CRO L;  2HCS A;  3GBF A;  1Y7Y A;  4Y42 A;  3RZZ A;  2PUD A;  2KPJ A;  2PXF A;  3BS3 A;  2LYQ A;  3F51 A;  3NRO A;  3VK0 A;  3GZD A;  2XXQ A;  1LQC A;  2BJC A;  3VWS A;  1DW9 A;  3QOX A;  1R63 A;  1ZZC A;  4ER7 A;  3DNV B;  3R1F A;  4Z59 A;  3JXC L;  2LLW A;  3UWP A;  1JFS A;  2AXV A;  2M4H A;  2IV1 A;  4EKI A;  1ZPQ A;  3OP9 A;  4I6R A;  2CSF A;  1RZS A;  1WH6 A;  1LCC A;  1XWR A;  1CQT A;  5DRT A;  4X4D A;  4J1W A;  5GAH i;  3ZHM A;  3GUU A;  2R1J L;  2PXK A;  2PUA A;  2PUG A;  3NXH A;  3NDB B;  4Z5H A;  4X4E A;  4PU7 A;  2FJR A;  1RPE L;  2PXV A;  4X4B A;  3LQX A;  1R69 A;  3GZD C;  3JXB C;  3H5T A;  4X4C A;  3KL4 A;  2LYK A;  4I6U A;  3HZI B;  2L49 A;  4ER3 A;  2AXZ A;  2PXT A;  2O38 A;  4F8D A;  1GT0 C;  3A9X A;  4Z5C A;  1MFQ C;  3TEP A;  3SCH A;  3JXD L;  1LLI A;  2PXE A;  3U3W A;  2WIU B;  3OQM A;  4FN3 A;  2ICT A;  1ADR A;  1EFA A;  5DTR A;  2XCJ A;  2BNN A; 
#chains in the Genus database with same CATH homology
 1QZX A;  2PXU A;  1MFQ C;  2FFH A;  1DUL A;  2XXA A;  2PXV A;  3LQX A;  2JQE A;  2PXL A;  2PXE A;  2PXD A;  5GAH i;  3KL4 A;  2PXP A;  2PXK A;  3DM5 A;  2PXF A;  2V3C C;  2PXQ A;  2PXT A;  3NDB B;  5GAG i;  1QB2 A;  1HQ1 A;  2PXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...