3G5GA

Crystal structure of the wild-type restriction-modification controller protein c.esp1396i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the restriction-modification controller protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription regulator
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3g5gA00
2CROA 1UXCA 2O49A 1LCCA 1PERL 2L49A 3QF3A 1R69A 1NERA 2LYJA 3VK0A 1DWKA 2BJCA 1ZZBA 1AU7A 1X2LA 2AW6A 2JCGA 3DNVB 1WIZA 2HINA 2IUOA 4X4DA 1Y7YA 1LQCA 1ZZ8A 3QQ6A 3OMTA 1CJGA 2PUDA 2XJ3A 3CECA 3L1PA 2PIJA 3H5TA 1ZZ9A 1RPEL 4X4CA 3GBFA 1BDIA 3JXDL 1QP4A 2AXVA 2PUFA 3UFDA 1ZAYA 1O4XA 1QP0A 3EUSA 4Z5CA 3F6WA 2OFYA 4FN3A 4YG4A 3B7HA 4X4BA 1PRVA 1ZZ6A 2BNNA 2IU7A 3SCGA 3GN5B 1JFTA 3QYXA 1WETA 1RZSA 4Z5HA 1BDHA 3S8QA 3O9XA 1ADRA 2XIUA 4YBAA 3OP9A 4X4FA 2R1JL 4PU8A 1JH9A 4X4IA 1ZS4A 2LYKA 1Y9QA 2AXUA 1XWRA 2CSFA 2IVBA 2PUGA 2LYPA 4JQDA 4PU4C 3CROL 3F51A 4Y42A 2BNMA 2GRMA 4PU7A 3F52A 3G7DA 2PUAA 4MCXA 3OQOA 4IA8A 1RZRA 2EWTA 4O8BA 3ZHIA 2EF8A 4YARA 2O4AA 2WIUB 4JCYA 3FYAA 1UTXA 2HSGA 2XI8A 4X4HA 3SCFA 1E3OC 4PU3C 2L8NA 1LCDA 4NDWA 3CLCA 3FYMA 2FJRA 1YSEA 2LYLA 1L1MA 3FMYA 4I8TA 3QWGA 4JCXA 3OQMA 3BD1A 1CQTA 3JXBC 3ZKCA 1WH8A 4IVZA 2H8RA 3HZIB 2KZ8A 3TRBA 2GZUA 4Z59A 1QPZA 3OQNA 1DW9A 4FBIA 1LMB3 2A6CA 3RZZA 4F8DA 4J1XA 2XCJA 1EFAA 4I6UA 3ZHMA 2IVQA 2EBYA 3G5GA 2B5AA 2LYRA 1B0NA 4YG1A 2KEIA 2ICPA 1ZVVA 1ZUGA 5A7LA 1QQAA 2PUBA 1UXDA 1JFSA 3KJXA 1ZZ7A 2IV1A 1RZRD 1RIOA 1SQ8A 2MEZA 4GQMA 1JWLA 1PRUA 2WUSR 3SCHA 3MLFA 3R1FA 4X4GA 1IC8A 2KEJA 1PNRA 3D1NI 2PUEA 3KXAA 2R63A 2JVLA 4X4EA 3U3WA 2GRLA 2XSDC 4MCTA 1LLIA 1ZPQA 2ICTA 2AXZA 5K98B 3BS3A 1QQBA 1R63A 2LYQA 1QP7A 4I6TA 2BNOA 1OCTC 4J1WA 3IVPA 1OSLA 1WH6A 2AUWA 1GT0C 2PPXA 1POUA 4I6RA 1S7EA 3GN5A 1HF0A 2AWIA 2OR1L 3JXCL 2IVGA 4YG7B 2LYSA 1PRAA 3LISA 2MQKA 4Z5DA 1ZZCA 1X57A 2KEKA 2KPJA 1VPWA 3KZ3A 3PXPA 2PUCA 2PE5A 3BDNA 2D5VA 3LFPA 1NEQA 4Z58A 2O38A 2LCVA 4IWRA 4OB4A 4GHJA
chains in the Genus database with same CATH superfamily
2CROA 1LCCA 3OWQA 2L49A 3M9LA 1ZZBA 3KL4A 2JCGA 1LQCA 3SR4A 3QQ6A 1CJGA 2PXUA 2XJ3A 3NROA 2PIJA 1RPEL 3LQXA 2AXVA 2PUFA 1ZAYA 1QP0A 1JFTA 3MEJA 1BDHA 1ADRA 3OP9A 4ER6A 1JH9A 3OKZA 3F51A 4WVLA 1RZRA 2ODRD 2EF8A 2J7WA 3TELA 1E3OC 4NDWA 2FJRA 1YSEA 1U2ZA 4JCXA 1QB2A 1WH8A 2KZ8A 3TRBA 2GZUA 2XCJA 2EBYA 4YG1A 2LLWA 2ICPA 1QQAA 1JFSA 1RZRD 2MEZA 1JWLA 5DRYA 3KXAA 2JQEA 2LLVA 1MFQC 2AUWA 3NXHA 1POUA 1S7EA 4YG7B 3LISA 1ZZCA 2MXDA 2XXPA 5DTRA 2HCSA 3NDBB 4Z58A 1NEQA 4IWRA 2O38A 4GHJA 1UXCA 2O49A 1NW3A 1R69A 1NERA 2PXPA 2HCNA 1HQ1A 2HINA 4X4DA 2PUDA 3CECA 3A9YA 4X4CA 3JXDL 1QP4A 5DRTA 3UFDA 1O4XA 3F6WA 2OFYA 4X4BA 1ZZ6A 2BNNA 3A9ZA 4Z5HA 3O9XA 5GAHi 2LYKA 2AXUA 2CSFA 2XXQA 4Y42A 2BNMA 2EWTA 4O8BA 3ZHIA 2O4AA 4YARA 2WIUB 1UTXA 4X4HA 3VWSA 4PU3C 3GZCA 2L8NA 4I8TA 1L1MA 3ZKCA 3GZDA 4FBIA 4F8DA 4J1XA 2IVQA 2XXAA 3G5GA 2B5AA 1ZUGA 2PUBA 1UXDA 3KJXA 2IV1A 4ER0A 3MLFA 3D1NI 3A9XA 2R63A 4EKIA 3U3WA 2GRLA 1LLIA 1ZPQA 5K98B 1QQBA 2LYQA 3IVPA 1WH6A 2PPXA 4I6RA 1HF0A 2IVGA 1PRAA 1X57A 2KPJA 1VPWA 3KZ3A 3PXPA 2PUCA 3G0TA 4DE9A 3BDNA 4OB4A 2BJCA 3QFIA 3QF3A 1AU7A 2LYJA 3VK0A 1DWKA 1QZXA 1X2LA 3DNVB 1Y7YA 2PXQA 1ZZ8A 4ER7A 3L1PA 3GBFA 1BDIA 3GUUA 2L1PA 3EUSA 1PRVA 2IU7A 3QYXA 1WETA 5JUWA 3S8QA 2XIUA 4X4FA 2R1JL 4PU8A 3ZPXA 1ZS4A 3QOWA 4OBMA 3TFLA 4PU4C 4JQDA 2M4HA 2GRMA 3NZLA 4PU7A 3F52A 2PUAA 4MCXA 3UWPA 3OQOA 4IA8A 4EZIA 5DSXA 4JCYA 2HSGA 2XI8A 3CLCA 3FYMA 2LYLA 2J7UA 3JXBC 4IVZA 2H8RA 2HFZA 4Q2JA 3ME5A 2VEOA 2FFHA 2A6CA 1EFAA 4I6UA 3GZDC 4DE8A 2LYRA 1B0NA 1ZVVA 1ZZ7A 4EQZA 1SQ8A 3SX0A 2WUSR 3SCHA 3R1FA 1IC8A 4X4GA 2KEJA 5DTQA 1PNRA 2PUEA 1DULA 2JVLA 4ER3A 2XSDC 4MCTA 2ICTA 2V3CC 2AXZA 4I6TA 2BNOA 4J1WA 1OSLA 1GT0C 3QOXA 2MQKA 2KEKA 3PE5A 2LCVA 2PXEA 1PERL 2AW6A 1WIZA 2IUOA 5DTMA 3OMTA 3H5TA 1ZZ9A 4YG4A 4FN3A 3B7HA 2PXDA 3SCGA 3GN5B 1RZSA 2PXLA 4YBAA 4HRAA 4X4IA 1Y9QA 1XWRA 2IVBA 2PUGA 2LYPA 4ER5A 3CROL 3TEPA 3G7DA 3FYAA 3SCFA 1LCDA 3FMYA 3QWGA 3OQMA 3BD1A 1CQTA 5DT2A 4EK9A 3HZIB 4Z59A 1QPZA 3OQNA 1DW9A 1LMB3 3RZZA 3ZHMA 2KEIA 2PXVA 5A7LA 1RIOA 4GQMA 2PXTA 1PRUA 2PXFA 3R09A 4X4EA 3BS3A 2YBDA 1R63A 1QP7A 1OCTC 3DM5A 4EKGA 3GN5A 2AWIA 2OR1L 3JXCL 2LNMA 2LYSA 2PXBA 4Z5DA 2PXKA 5GAGi 2PE5A 2D5VA 3LFPA 4Z5CA
chains in the Genus database with same CATH topology
2CROA 1UXCA 2O49A 1LCCA 1PERL 2L49A 3QF3A 1R69A 1NERA 2LYJA 3VK0A 1DWKA 2BJCA 1ZZBA 1AU7A 1X2LA 2AW6A 2JCGA 3DNVB 1WIZA 2HINA 2IUOA 4X4DA 1Y7YA 1LQCA 1ZZ8A 3QQ6A 3OMTA 1CJGA 2PUDA 2XJ3A 3CECA 3L1PA 2PIJA 3H5TA 1ZZ9A 1RPEL 4X4CA 3GBFA 1BDIA 3JXDL 1QP4A 2AXVA 2PUFA 3UFDA 1ZAYA 1O4XA 1QP0A 3EUSA 4Z5CA 3F6WA 2OFYA 4FN3A 4YG4A 3B7HA 4X4BA 1PRVA 1ZZ6A 2BNNA 2IU7A 3SCGA 3GN5B 1JFTA 3QYXA 1WETA 1RZSA 4Z5HA 1BDHA 3S8QA 3O9XA 1ADRA 2XIUA 4YBAA 3OP9A 4X4FA 2R1JL 4PU8A 1JH9A 4X4IA 1ZS4A 2LYKA 1Y9QA 2AXUA 1XWRA 2CSFA 2IVBA 2PUGA 2LYPA 4JQDA 4PU4C 3CROL 3F51A 4Y42A 2BNMA 2GRMA 4PU7A 3F52A 3G7DA 2PUAA 4MCXA 3OQOA 4IA8A 1RZRA 2EWTA 4O8BA 3ZHIA 2EF8A 4YARA 2O4AA 2WIUB 4JCYA 3FYAA 1UTXA 2HSGA 2XI8A 4X4HA 3SCFA 1E3OC 4PU3C 2L8NA 1LCDA 4NDWA 3CLCA 3FYMA 2FJRA 1YSEA 2LYLA 1L1MA 3FMYA 4I8TA 3QWGA 4JCXA 3OQMA 3BD1A 1CQTA 3JXBC 3ZKCA 1WH8A 4IVZA 2H8RA 3HZIB 2KZ8A 3TRBA 2GZUA 4Z59A 1QPZA 3OQNA 1DW9A 4FBIA 1LMB3 2A6CA 3RZZA 4F8DA 4J1XA 2XCJA 1EFAA 4I6UA 3ZHMA 2IVQA 2EBYA 3G5GA 2B5AA 2LYRA 1B0NA 4YG1A 2KEIA 2ICPA 1ZVVA 1ZUGA 5A7LA 1QQAA 2PUBA 1UXDA 1JFSA 3KJXA 1ZZ7A 2IV1A 1RZRD 1RIOA 1SQ8A 2MEZA 4GQMA 1JWLA 1PRUA 2WUSR 3SCHA 3MLFA 3R1FA 4X4GA 1IC8A 2KEJA 1PNRA 3D1NI 2PUEA 3KXAA 2R63A 2JVLA 4X4EA 3U3WA 2GRLA 2XSDC 4MCTA 1LLIA 1ZPQA 2ICTA 2AXZA 5K98B 3BS3A 1QQBA 1R63A 2LYQA 1QP7A 4I6TA 2BNOA 1OCTC 4J1WA 3IVPA 1OSLA 1WH6A 2AUWA 1GT0C 2PPXA 1POUA 4I6RA 1S7EA 3GN5A 1HF0A 2AWIA 2OR1L 3JXCL 2IVGA 4YG7B 2LYSA 1PRAA 3LISA 2MQKA 4Z5DA 1ZZCA 1X57A 2KEKA 2KPJA 1VPWA 3KZ3A 3PXPA 2PUCA 2PE5A 3BDNA 2D5VA 3LFPA 1NEQA 4Z58A 2O38A 2LCVA 4IWRA 4OB4A 4GHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRO A;  1UXC A;  2O49 A;  1LCC A;  1PER L;  2L49 A;  3QF3 A;  1R69 A;  1NER A;  2LYJ A;  3VK0 A;  1DWK A;  2BJC A;  1ZZB A;  1AU7 A;  1X2L A;  2AW6 A;  2JCG A;  3DNV B;  1WIZ A;  2HIN A;  2IUO A;  4X4D A;  1Y7Y A;  1LQC A;  1ZZ8 A;  3QQ6 A;  3OMT A;  1CJG A;  2PUD A;  2XJ3 A;  3CEC A;  3L1P A;  2PIJ A;  3H5T A;  1ZZ9 A;  1RPE L;  4X4C A;  3GBF A;  1BDI A;  3JXD L;  1QP4 A;  2AXV A;  2PUF A;  3UFD A;  1ZAY A;  1O4X A;  1QP0 A;  3EUS A;  4Z5C A;  3F6W A;  2OFY A;  4FN3 A;  4YG4 A;  3B7H A;  4X4B A;  1PRV A;  1ZZ6 A;  2BNN A;  2IU7 A;  3SCG A;  3GN5 B;  1JFT A;  3QYX A;  1WET A;  1RZS A;  4Z5H A;  1BDH A;  3S8Q A;  3O9X A;  1ADR A;  2XIU A;  4YBA A;  3OP9 A;  4X4F A;  2R1J L;  4PU8 A;  1JH9 A;  4X4I A;  1ZS4 A;  2LYK A;  1Y9Q A;  2AXU A;  1XWR A;  2CSF A;  2IVB A;  2PUG A;  2LYP A;  4JQD A;  4PU4 C;  3CRO L;  3F51 A;  4Y42 A;  2BNM A;  2GRM A;  4PU7 A;  3F52 A;  3G7D A;  2PUA A;  4MCX A;  3OQO A;  4IA8 A;  1RZR A;  2EWT A;  4O8B A;  3ZHI A;  2EF8 A;  4YAR A;  2O4A A;  2WIU B;  4JCY A;  3FYA A;  1UTX A;  2HSG A;  2XI8 A;  4X4H A;  3SCF A;  1E3O C;  4PU3 C;  2L8N A;  1LCD A;  4NDW A;  3CLC A;  3FYM A;  2FJR A;  1YSE A;  2LYL A;  1L1M A;  3FMY A;  4I8T A;  3QWG A;  4JCX A;  3OQM A;  3BD1 A;  1CQT A;  3JXB C;  3ZKC A;  1WH8 A;  4IVZ A;  2H8R A;  3HZI B;  2KZ8 A;  3TRB A;  2GZU A;  4Z59 A;  1QPZ A;  3OQN A;  1DW9 A;  4FBI A;  1LMB 3;  2A6C A;  3RZZ A;  4F8D A;  4J1X A;  2XCJ A;  1EFA A;  4I6U A;  3ZHM A;  2IVQ A;  2EBY A;  3G5G A;  2B5A A;  2LYR A;  1B0N A;  4YG1 A;  2KEI A;  2ICP A;  1ZVV A;  1ZUG A;  5A7L A;  1QQA A;  2PUB A;  1UXD A;  1JFS A;  3KJX A;  1ZZ7 A;  2IV1 A;  1RZR D;  1RIO A;  1SQ8 A;  2MEZ A;  4GQM A;  1JWL A;  1PRU A;  2WUS R;  3SCH A;  3MLF A;  3R1F A;  4X4G A;  1IC8 A;  2KEJ A;  1PNR A;  3D1N I;  2PUE A;  3KXA A;  2R63 A;  2JVL A;  4X4E A;  3U3W A;  2GRL A;  2XSD C;  4MCT A;  1LLI A;  1ZPQ A;  2ICT A;  2AXZ A;  5K98 B;  3BS3 A;  1QQB A;  1R63 A;  2LYQ A;  1QP7 A;  4I6T A;  2BNO A;  1OCT C;  4J1W A;  3IVP A;  1OSL A;  1WH6 A;  2AUW A;  1GT0 C;  2PPX A;  1POU A;  4I6R A;  1S7E A;  3GN5 A;  1HF0 A;  2AWI A;  2OR1 L;  3JXC L;  2IVG A;  4YG7 B;  2LYS A;  1PRA A;  3LIS A;  2MQK A;  4Z5D A;  1ZZC A;  1X57 A;  2KEK A;  2KPJ A;  1VPW A;  3KZ3 A;  3PXP A;  2PUC A;  2PE5 A;  3BDN A;  2D5V A;  3LFP A;  1NEQ A;  4Z58 A;  2O38 A;  2LCV A;  4IWR A;  4OB4 A;  4GHJ A; 
#chains in the Genus database with same CATH topology
 2CRO A;  1LCC A;  3OWQ A;  2L49 A;  3M9L A;  1ZZB A;  3KL4 A;  2JCG A;  1LQC A;  3SR4 A;  3QQ6 A;  1CJG A;  2PXU A;  2XJ3 A;  3NRO A;  2PIJ A;  1RPE L;  3LQX A;  2AXV A;  2PUF A;  1ZAY A;  1QP0 A;  1JFT A;  3MEJ A;  1BDH A;  1ADR A;  3OP9 A;  4ER6 A;  1JH9 A;  3OKZ A;  3F51 A;  4WVL A;  1RZR A;  2ODR D;  2EF8 A;  2J7W A;  3TEL A;  1E3O C;  4NDW A;  2FJR A;  1YSE A;  1U2Z A;  4JCX A;  1QB2 A;  1WH8 A;  2KZ8 A;  3TRB A;  2GZU A;  2XCJ A;  2EBY A;  4YG1 A;  2LLW A;  2ICP A;  1QQA A;  1JFS A;  1RZR D;  2MEZ A;  1JWL A;  5DRY A;  3KXA A;  2JQE A;  2LLV A;  1MFQ C;  2AUW A;  3NXH A;  1POU A;  1S7E A;  4YG7 B;  3LIS A;  1ZZC A;  2MXD A;  2XXP A;  5DTR A;  2HCS A;  3NDB B;  4Z58 A;  1NEQ A;  4IWR A;  2O38 A;  4GHJ A;  1UXC A;  2O49 A;  1NW3 A;  1R69 A;  1NER A;  2PXP A;  2HCN A;  1HQ1 A;  2HIN A;  4X4D A;  2PUD A;  3CEC A;  3A9Y A;  4X4C A;  3JXD L;  1QP4 A;  5DRT A;  3UFD A;  1O4X A;  3F6W A;  2OFY A;  4X4B A;  1ZZ6 A;  2BNN A;  3A9Z A;  4Z5H A;  3O9X A;  5GAH i;  2LYK A;  2AXU A;  2CSF A;  2XXQ A;  4Y42 A;  2BNM A;  2EWT A;  4O8B A;  3ZHI A;  2O4A A;  4YAR A;  2WIU B;  1UTX A;  4X4H A;  3VWS A;  4PU3 C;  3GZC A;  2L8N A;  4I8T A;  1L1M A;  3ZKC A;  3GZD A;  4FBI A;  4F8D A;  4J1X A;  2IVQ A;  2XXA A;  3G5G A;  2B5A A;  1ZUG A;  2PUB A;  1UXD A;  3KJX A;  2IV1 A;  4ER0 A;  3MLF A;  3D1N I;  3A9X A;  2R63 A;  4EKI A;  3U3W A;  2GRL A;  1LLI A;  1ZPQ A;  5K98 B;  1QQB A;  2LYQ A;  3IVP A;  1WH6 A;  2PPX A;  4I6R A;  1HF0 A;  2IVG A;  1PRA A;  1X57 A;  2KPJ A;  1VPW A;  3KZ3 A;  3PXP A;  2PUC A;  3G0T A;  4DE9 A;  3BDN A;  4OB4 A;  2BJC A;  3QFI A;  3QF3 A;  1AU7 A;  2LYJ A;  3VK0 A;  1DWK A;  1QZX A;  1X2L A;  3DNV B;  1Y7Y A;  2PXQ A;  1ZZ8 A;  4ER7 A;  3L1P A;  3GBF A;  1BDI A;  3GUU A;  2L1P A;  3EUS A;  1PRV A;  2IU7 A;  3QYX A;  1WET A;  5JUW A;  3S8Q A;  2XIU A;  4X4F A;  2R1J L;  4PU8 A;  3ZPX A;  1ZS4 A;  3QOW A;  4OBM A;  3TFL A;  4PU4 C;  4JQD A;  2M4H A;  2GRM A;  3NZL A;  4PU7 A;  3F52 A;  2PUA A;  4MCX A;  3UWP A;  3OQO A;  4IA8 A;  4EZI A;  5DSX A;  4JCY A;  2HSG A;  2XI8 A;  3CLC A;  3FYM A;  2LYL A;  2J7U A;  3JXB C;  4IVZ A;  2H8R A;  2HFZ A;  4Q2J A;  3ME5 A;  2VEO A;  2FFH A;  2A6C A;  1EFA A;  4I6U A;  3GZD C;  4DE8 A;  2LYR A;  1B0N A;  1ZVV A;  1ZZ7 A;  4EQZ A;  1SQ8 A;  3SX0 A;  2WUS R;  3SCH A;  3R1F A;  1IC8 A;  4X4G A;  2KEJ A;  5DTQ A;  1PNR A;  2PUE A;  1DUL A;  2JVL A;  4ER3 A;  2XSD C;  4MCT A;  2ICT A;  2V3C C;  2AXZ A;  4I6T A;  2BNO A;  4J1W A;  1OSL A;  1GT0 C;  3QOX A;  2MQK A;  2KEK A;  3PE5 A;  2LCV A;  2PXE A;  1PER L;  2AW6 A;  1WIZ A;  2IUO A;  5DTM A;  3OMT A;  3H5T A;  1ZZ9 A;  4YG4 A;  4FN3 A;  3B7H A;  2PXD A;  3SCG A;  3GN5 B;  1RZS A;  2PXL A;  4YBA A;  4HRA A;  4X4I A;  1Y9Q A;  1XWR A;  2IVB A;  2PUG A;  2LYP A;  4ER5 A;  3CRO L;  3TEP A;  3G7D A;  3FYA A;  3SCF A;  1LCD A;  3FMY A;  3QWG A;  3OQM A;  3BD1 A;  1CQT A;  5DT2 A;  4EK9 A;  3HZI B;  4Z59 A;  1QPZ A;  3OQN A;  1DW9 A;  1LMB 3;  3RZZ A;  3ZHM A;  2KEI A;  2PXV A;  5A7L A;  1RIO A;  4GQM A;  2PXT A;  1PRU A;  2PXF A;  3R09 A;  4X4E A;  3BS3 A;  2YBD A;  1R63 A;  1QP7 A;  1OCT C;  3DM5 A;  4EKG A;  3GN5 A;  2AWI A;  2OR1 L;  3JXC L;  2LNM A;  2LYS A;  2PXB A;  4Z5D A;  2PXK A;  5GAG i;  2PE5 A;  2D5V A;  3LFP A;  4Z5C A; 
#chains in the Genus database with same CATH homology
 2CRO A;  1UXC A;  2O49 A;  1LCC A;  1PER L;  2L49 A;  3QF3 A;  1R69 A;  1NER A;  2LYJ A;  3VK0 A;  1DWK A;  2BJC A;  1ZZB A;  1AU7 A;  1X2L A;  2AW6 A;  2JCG A;  3DNV B;  1WIZ A;  2HIN A;  2IUO A;  4X4D A;  1Y7Y A;  1LQC A;  1ZZ8 A;  3QQ6 A;  3OMT A;  1CJG A;  2PUD A;  2XJ3 A;  3CEC A;  3L1P A;  2PIJ A;  3H5T A;  1ZZ9 A;  1RPE L;  4X4C A;  3GBF A;  1BDI A;  3JXD L;  1QP4 A;  2AXV A;  2PUF A;  3UFD A;  1ZAY A;  1O4X A;  1QP0 A;  3EUS A;  4Z5C A;  3F6W A;  2OFY A;  4FN3 A;  4YG4 A;  3B7H A;  4X4B A;  1PRV A;  1ZZ6 A;  2BNN A;  2IU7 A;  3SCG A;  3GN5 B;  1JFT A;  3QYX A;  1WET A;  1RZS A;  4Z5H A;  1BDH A;  3S8Q A;  3O9X A;  1ADR A;  2XIU A;  4YBA A;  3OP9 A;  4X4F A;  2R1J L;  4PU8 A;  1JH9 A;  4X4I A;  1ZS4 A;  2LYK A;  1Y9Q A;  2AXU A;  1XWR A;  2CSF A;  2IVB A;  2PUG A;  2LYP A;  4JQD A;  4PU4 C;  3CRO L;  3F51 A;  4Y42 A;  2BNM A;  2GRM A;  4PU7 A;  3F52 A;  3G7D A;  2PUA A;  4MCX A;  3OQO A;  4IA8 A;  1RZR A;  2EWT A;  4O8B A;  3ZHI A;  2EF8 A;  4YAR A;  2O4A A;  2WIU B;  4JCY A;  3FYA A;  1UTX A;  2HSG A;  2XI8 A;  4X4H A;  3SCF A;  1E3O C;  4PU3 C;  2L8N A;  1LCD A;  4NDW A;  3CLC A;  3FYM A;  2FJR A;  1YSE A;  2LYL A;  1L1M A;  3FMY A;  4I8T A;  3QWG A;  4JCX A;  3OQM A;  3BD1 A;  1CQT A;  3JXB C;  3ZKC A;  1WH8 A;  4IVZ A;  2H8R A;  3HZI B;  2KZ8 A;  3TRB A;  2GZU A;  4Z59 A;  1QPZ A;  3OQN A;  1DW9 A;  4FBI A;  1LMB 3;  2A6C A;  3RZZ A;  4F8D A;  4J1X A;  2XCJ A;  1EFA A;  4I6U A;  3ZHM A;  2IVQ A;  2EBY A;  3G5G A;  2B5A A;  2LYR A;  1B0N A;  4YG1 A;  2KEI A;  2ICP A;  1ZVV A;  1ZUG A;  5A7L A;  1QQA A;  2PUB A;  1UXD A;  1JFS A;  3KJX A;  1ZZ7 A;  2IV1 A;  1RZR D;  1RIO A;  1SQ8 A;  2MEZ A;  4GQM A;  1JWL A;  1PRU A;  2WUS R;  3SCH A;  3MLF A;  3R1F A;  4X4G A;  1IC8 A;  2KEJ A;  1PNR A;  3D1N I;  2PUE A;  3KXA A;  2R63 A;  2JVL A;  4X4E A;  3U3W A;  2GRL A;  2XSD C;  4MCT A;  1LLI A;  1ZPQ A;  2ICT A;  2AXZ A;  5K98 B;  3BS3 A;  1QQB A;  1R63 A;  2LYQ A;  1QP7 A;  4I6T A;  2BNO A;  1OCT C;  4J1W A;  3IVP A;  1OSL A;  1WH6 A;  2AUW A;  1GT0 C;  2PPX A;  1POU A;  4I6R A;  1S7E A;  3GN5 A;  1HF0 A;  2AWI A;  2OR1 L;  3JXC L;  2IVG A;  4YG7 B;  2LYS A;  1PRA A;  3LIS A;  2MQK A;  4Z5D A;  1ZZC A;  1X57 A;  2KEK A;  2KPJ A;  1VPW A;  3KZ3 A;  3PXP A;  2PUC A;  2PE5 A;  3BDN A;  2D5V A;  3LFP A;  1NEQ A;  4Z58 A;  2O38 A;  2LCV A;  4IWR A;  4OB4 A;  4GHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...