3G5GA

Crystal structure of the wild-type restriction-modification controller protein c.esp1396i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the restriction-modification controller protein C.Esp1396I.
pubmed doi rcsb
source organism Enterobacter sp.
molecule tags Transcription regulator
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3g5gA00
2FJRA 4X4CA 2ICTA 1ZUGA 2HSGA 1WH6A 2AXVA 3F51A 1QPZA 4GHJA 4X4GA 4X4HA 4OB4A 2LCVA 2D5VA 4IA8A 2R63A 2LYLA 3FYAA 1BDHA 2LYKA 2GRLA 1EFAA 1QQBA 2PUDA 2WIUB 3GN5A 3KJXA 4JCYA 1ZZBA 1Y7YA 3PXPA 3VK0A 2KZ8A 3CLCA 1QP0A 4PU4C 2OFYA 1POUA 2EF8A 2BJCA 1JH9A 3G7DA 3L1PA 1ZPQA 2MEZA 1ZVVA 4NDWA 3G5GA 1UXDA 2XSDC 2JVLA 1PNRA 4PU3C 3QQ6A 4YARA 5K98B 3F6WA 5A7LA 2KEIA 1GT0C 1DWKA 1OSLA 1NERA 2XI8A 3D1NI 2EWTA 2PE5A 1LCDA 1QQAA 4YBAA 3OQOA 1ZZ7A 3F52A 1LCCA 3EUSA 2LYJA 4YG1A 1RPEL 2AW6A 2AXZA 4Y42A 1VPWA 4J1WA 1UXCA 2PIJA 3KZ3A 1WETA 1LLIA 3RZZA 3SCHA 2HINA 1PRVA 2XJ3A 1YSEA 4JCXA 2O38A 3R1FA 2MQKA 2LYQA 1RIOA 4X4DA 2PUBA 2IVQA 1LQCA 3OP9A 4GQMA 2BNNA 3S8QA 2H8RA 2WUSR 4FN3A 4YG7B 3JXDL 1JFTA 1BDIA 4Z59A 3BD1A 4Z5DA 2IVGA 2LYPA 3BS3A 1ZAYA 2JCGA 3HZIB 1CJGA 2IUOA 2PPXA 4PU7A 2IU7A 1DW9A 2GRMA 1ADRA 3JXBC 1CQTA 4X4IA 3LISA 2B5AA 4X4FA 3O9XA 2O4AA 2PUCA 4FBIA 4YG4A 3B7HA 3LFPA 4I6RA 4MCXA 1ZS4A 1IC8A 3CROL 3FYMA 2IVBA 1ZZ8A 3ZHMA 1X57A 1PRUA 4MCTA 3JXCL 1R63A 1OCTC 3H5TA 2PUEA 4IWRA 2PUFA 3UFDA 2GZUA 2IV1A 1NEQA 4I6UA 2O49A 2CROA 3IVPA 1ZZ9A 1X2LA 1PERL 1E3OC 2PUAA 1O4XA 4I8TA 3GN5B 4F8DA 2R1JL 3ZKCA 3OQNA 2AUWA 3KXAA 3CECA 3GBFA 3QF3A 1RZSA 1RZRD 1ZZ6A 3BDNA 4X4BA 1S7EA 2PUGA 2BNOA 3OQMA 3QYXA 2A6CA 2KEKA 2KEJA 4X4EA 1L1MA 2EBYA 1WH8A 2LYRA 1LMB3 4Z5HA 2CSFA 4O8BA 2LYSA 1XWRA 3FMYA 1AU7A 2AWIA 1ZZCA 1HF0A 2ICPA 3OMTA 2OR1L 1PRAA 1JFSA 1WIZA 2XIUA 2XCJA 4I6TA 2BNMA 3MLFA 4J1XA 3TRBA 4JQDA 2AXUA 2L8NA 1JWLA 1Y9QA 3DNVB 1UTXA 2L49A 1R69A 4Z58A 4IVZA 1QP4A 4Z5CA 3QWGA 3SCFA 1B0NA 3ZHIA 1RZRA 1SQ8A 4PU8A 2KPJA 1QP7A 3U3WA 3SCGA
chains in the Genus database with same CATH superfamily
3QOXA 4X4CA 2ICTA 4Q2JA 4OB4A 2PUDA 2R63A 2LYLA 2PXUA 2LYKA 1QQBA 1ZZBA 2KZ8A 2EF8A 1ZPQA 4NDWA 2JVLA 1PNRA 4PU3C 5DSXA 2XXQA 1GT0C 3D1NI 2EWTA 3OQOA 3F52A 1RPEL 5DRYA 2PIJA 3KZ3A 2XJ3A 1YSEA 2FFHA 2O38A 2LYQA 1RIOA 2PUBA 4EQZA 3G0TA 2BNNA 3TEPA 4Z59A 4Z5DA 2JCGA 2JQEA 2IUOA 4PU7A 2GRMA 2PXPA 1CQTA 3LISA 4X4FA 4FBIA 3B7HA 4MCXA 1U2ZA 5DTMA 4ER7A 3NXHA 1X57A 1PRUA 3H5TA 2GZUA 2IV1A 2PUAA 3OKZA 2PXTA 4F8DA 3OQNA 2AUWA 3GBFA 1RZRD 3BDNA 2LNMA 2PUGA 2XXAA 2KEJA 2EBYA 1LMB3 2PXDA 1XWRA 3SX0A 2AWIA 1ZZCA 2PXFA 2XIUA 3A9XA 2XCJA 4I6TA 3TRBA 4JQDA 3DNVB 1R69A 3SCFA 1RZRA 3ME5A 2FJRA 4ER3A 1ZUGA 2HSGA 2AXVA 1QPZA 4X4GA 4X4HA 3NZLA 4IA8A 3FYAA 2J7UA 3GN5A 2BJCA 5K98B 3F6WA 5A7LA 3GZCA 1OSLA 1NERA 2PE5A 4YBAA 3EUSA 4YG1A 2AXZA 2ODRD 4Y42A 1VPWA 1LLIA 3SCHA 4JCXA 3R1FA 4EKGA 2IVQA 3DM5A 3OP9A 4ER0A 2H8RA 3S8QA 3BD1A 1ZAYA 2PXEA 3HZIB 1CJGA 2PPXA 2YBDA 2B5AA 3R09A 2LLWA 4ER5A 3GZDC 1R63A 5DT2A 2PUFA 2O49A 3GUUA 1PERL 1E3OC 2R1JL 1ZZ6A 4X4BA 3OQMA 3QYXA 3NDBB 1WH8A 2CSFA 3KL4A 1HF0A 2ICPA 3PE5A 1JWLA 2L49A 5GAHi 4Z58A 1QP4A 4Z5CA 3QWGA 3ZHIA 1QP7A 3MEJA 3A9YA 3F51A 4GHJA 3TFLA 2PXKA 1BDHA 2GRLA 2HCNA 4JCYA 4EK9A 1Y7YA 3PXPA 3VK0A 1QP0A 1POUA 1JH9A 3G7DA 1ZVVA 3G5GA 1UXDA 2XSDC 4YARA 2XI8A 3UWPA 1LCDA 1QB2A 4WVLA 1LCCA 2LYJA 1UXCA 2HINA 1PRVA 2MQKA 2PXVA 1LQCA 1NW3A 4YG7B 3JXDL 1BDIA 2IVGA 3BS3A 3VWSA 3TELA 4HRAA 3JXBC 3O9XA 2PUCA 4YG4A 3LFPA 4I6RA 1ZS4A 1IC8A 4IWRA 1OCTC 2PUEA 3UFDA 1NEQA 2PXLA 2V3CC 1QZXA 2L1PA 3ZKCA 5DRTA 3KXAA 4DE9A 1RZSA 2A6CA 2KEKA 2LYRA 4O8BA 2LYSA 2OR1L 1JFSA 2LLVA 1WIZA 5JUWA 3M9LA 4J1XA 2AXUA 1Y9QA 1UTXA 1SQ8A 4PU8A 2KPJA 3U3WA 3SCGA 3LQXA 2VEOA 1WH6A 2LCVA 2D5VA 1EFAA 2WIUB 3KJXA 1MFQC 3GZDA 3CLCA 4PU4C 2OFYA 2HFZA 3L1PA 2MXDA 2MEZA 3QOWA 3A9ZA 3QQ6A 2PXBA 2KEIA 4ER6A 1DWKA 1QQAA 1ZZ7A 4OBMA 3NROA 2AW6A 2HCSA 5DTRA 4J1WA 1WETA 3RZZA 1DULA 4X4DA 3ZPXA 4GQMA 2PXQA 2WUSR 4FN3A 1JFTA 2J7WA 2LYPA 5DTQA 2IU7A 1DW9A 4EKIA 1ADRA 4EZIA 4X4IA 2O4AA 4DE8A 3CROL 3FYMA 2IVBA 1ZZ8A 3ZHMA 2M4HA 4MCTA 3JXCL 4I6UA 3OWQA 2CROA 3IVPA 1HQ1A 1ZZ9A 1X2LA 4I8TA 1O4XA 3GN5B 3CECA 3QF3A 1S7EA 2BNOA 4X4EA 1L1MA 2XXPA 5GAGi 4Z5HA 3FMYA 1AU7A 3OMTA 1PRAA 3SR4A 2BNMA 3MLFA 2L8NA 4IVZA 1B0NA 3QFIA
chains in the Genus database with same CATH topology
2FJRA 4X4CA 2ICTA 1ZUGA 2HSGA 1WH6A 2AXVA 3F51A 1QPZA 4GHJA 4X4GA 4X4HA 4OB4A 2LCVA 2D5VA 4IA8A 2R63A 2LYLA 3FYAA 1BDHA 2LYKA 2GRLA 1EFAA 1QQBA 2PUDA 2WIUB 3GN5A 3KJXA 4JCYA 1ZZBA 1Y7YA 3PXPA 3VK0A 2KZ8A 3CLCA 1QP0A 4PU4C 2OFYA 1POUA 2EF8A 2BJCA 1JH9A 3G7DA 3L1PA 1ZPQA 2MEZA 1ZVVA 4NDWA 3G5GA 1UXDA 2XSDC 2JVLA 1PNRA 4PU3C 3QQ6A 4YARA 5K98B 3F6WA 5A7LA 2KEIA 1GT0C 1DWKA 1OSLA 1NERA 2XI8A 3D1NI 2EWTA 2PE5A 1LCDA 1QQAA 4YBAA 3OQOA 1ZZ7A 3F52A 1LCCA 3EUSA 2LYJA 4YG1A 1RPEL 2AW6A 2AXZA 4Y42A 1VPWA 4J1WA 1UXCA 2PIJA 3KZ3A 1WETA 1LLIA 3RZZA 3SCHA 2HINA 1PRVA 2XJ3A 1YSEA 4JCXA 2O38A 3R1FA 2MQKA 2LYQA 1RIOA 4X4DA 2PUBA 2IVQA 1LQCA 3OP9A 4GQMA 2BNNA 3S8QA 2H8RA 2WUSR 4FN3A 4YG7B 3JXDL 1JFTA 1BDIA 4Z59A 3BD1A 4Z5DA 2IVGA 2LYPA 3BS3A 1ZAYA 2JCGA 3HZIB 1CJGA 2IUOA 2PPXA 4PU7A 2IU7A 1DW9A 2GRMA 1ADRA 3JXBC 1CQTA 4X4IA 3LISA 2B5AA 4X4FA 3O9XA 2O4AA 2PUCA 4FBIA 4YG4A 3B7HA 3LFPA 4I6RA 4MCXA 1ZS4A 1IC8A 3CROL 3FYMA 2IVBA 1ZZ8A 3ZHMA 1X57A 1PRUA 4MCTA 3JXCL 1R63A 1OCTC 3H5TA 2PUEA 4IWRA 2PUFA 3UFDA 2GZUA 2IV1A 1NEQA 4I6UA 2O49A 2CROA 3IVPA 1ZZ9A 1X2LA 1PERL 1E3OC 2PUAA 1O4XA 4I8TA 3GN5B 4F8DA 2R1JL 3ZKCA 3OQNA 2AUWA 3KXAA 3CECA 3GBFA 3QF3A 1RZSA 1RZRD 1ZZ6A 3BDNA 4X4BA 1S7EA 2PUGA 2BNOA 3OQMA 3QYXA 2A6CA 2KEKA 2KEJA 4X4EA 1L1MA 2EBYA 1WH8A 2LYRA 1LMB3 4Z5HA 2CSFA 4O8BA 2LYSA 1XWRA 3FMYA 1AU7A 2AWIA 1ZZCA 1HF0A 2ICPA 3OMTA 2OR1L 1PRAA 1JFSA 1WIZA 2XIUA 2XCJA 4I6TA 2BNMA 3MLFA 4J1XA 3TRBA 4JQDA 2AXUA 2L8NA 1JWLA 1Y9QA 3DNVB 1UTXA 2L49A 1R69A 4Z58A 4IVZA 1QP4A 4Z5CA 3QWGA 3SCFA 1B0NA 3ZHIA 1RZRA 1SQ8A 4PU8A 2KPJA 1QP7A 3U3WA 3SCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJR A;  4X4C A;  2ICT A;  1ZUG A;  2HSG A;  1WH6 A;  2AXV A;  3F51 A;  1QPZ A;  4GHJ A;  4X4G A;  4X4H A;  4OB4 A;  2LCV A;  2D5V A;  4IA8 A;  2R63 A;  2LYL A;  3FYA A;  1BDH A;  2LYK A;  2GRL A;  1EFA A;  1QQB A;  2PUD A;  2WIU B;  3GN5 A;  3KJX A;  4JCY A;  1ZZB A;  1Y7Y A;  3PXP A;  3VK0 A;  2KZ8 A;  3CLC A;  1QP0 A;  4PU4 C;  2OFY A;  1POU A;  2EF8 A;  2BJC A;  1JH9 A;  3G7D A;  3L1P A;  1ZPQ A;  2MEZ A;  1ZVV A;  4NDW A;  3G5G A;  1UXD A;  2XSD C;  2JVL A;  1PNR A;  4PU3 C;  3QQ6 A;  4YAR A;  5K98 B;  3F6W A;  5A7L A;  2KEI A;  1GT0 C;  1DWK A;  1OSL A;  1NER A;  2XI8 A;  3D1N I;  2EWT A;  2PE5 A;  1LCD A;  1QQA A;  4YBA A;  3OQO A;  1ZZ7 A;  3F52 A;  1LCC A;  3EUS A;  2LYJ A;  4YG1 A;  1RPE L;  2AW6 A;  2AXZ A;  4Y42 A;  1VPW A;  4J1W A;  1UXC A;  2PIJ A;  3KZ3 A;  1WET A;  1LLI A;  3RZZ A;  3SCH A;  2HIN A;  1PRV A;  2XJ3 A;  1YSE A;  4JCX A;  2O38 A;  3R1F A;  2MQK A;  2LYQ A;  1RIO A;  4X4D A;  2PUB A;  2IVQ A;  1LQC A;  3OP9 A;  4GQM A;  2BNN A;  3S8Q A;  2H8R A;  2WUS R;  4FN3 A;  4YG7 B;  3JXD L;  1JFT A;  1BDI A;  4Z59 A;  3BD1 A;  4Z5D A;  2IVG A;  2LYP A;  3BS3 A;  1ZAY A;  2JCG A;  3HZI B;  1CJG A;  2IUO A;  2PPX A;  4PU7 A;  2IU7 A;  1DW9 A;  2GRM A;  1ADR A;  3JXB C;  1CQT A;  4X4I A;  3LIS A;  2B5A A;  4X4F A;  3O9X A;  2O4A A;  2PUC A;  4FBI A;  4YG4 A;  3B7H A;  3LFP A;  4I6R A;  4MCX A;  1ZS4 A;  1IC8 A;  3CRO L;  3FYM A;  2IVB A;  1ZZ8 A;  3ZHM A;  1X57 A;  1PRU A;  4MCT A;  3JXC L;  1R63 A;  1OCT C;  3H5T A;  2PUE A;  4IWR A;  2PUF A;  3UFD A;  2GZU A;  2IV1 A;  1NEQ A;  4I6U A;  2O49 A;  2CRO A;  3IVP A;  1ZZ9 A;  1X2L A;  1PER L;  1E3O C;  2PUA A;  1O4X A;  4I8T A;  3GN5 B;  4F8D A;  2R1J L;  3ZKC A;  3OQN A;  2AUW A;  3KXA A;  3CEC A;  3GBF A;  3QF3 A;  1RZS A;  1RZR D;  1ZZ6 A;  3BDN A;  4X4B A;  1S7E A;  2PUG A;  2BNO A;  3OQM A;  3QYX A;  2A6C A;  2KEK A;  2KEJ A;  4X4E A;  1L1M A;  2EBY A;  1WH8 A;  2LYR A;  1LMB 3;  4Z5H A;  2CSF A;  4O8B A;  2LYS A;  1XWR A;  3FMY A;  1AU7 A;  2AWI A;  1ZZC A;  1HF0 A;  2ICP A;  3OMT A;  2OR1 L;  1PRA A;  1JFS A;  1WIZ A;  2XIU A;  2XCJ A;  4I6T A;  2BNM A;  3MLF A;  4J1X A;  3TRB A;  4JQD A;  2AXU A;  2L8N A;  1JWL A;  1Y9Q A;  3DNV B;  1UTX A;  2L49 A;  1R69 A;  4Z58 A;  4IVZ A;  1QP4 A;  4Z5C A;  3QWG A;  3SCF A;  1B0N A;  3ZHI A;  1RZR A;  1SQ8 A;  4PU8 A;  2KPJ A;  1QP7 A;  3U3W A;  3SCG A; 
#chains in the Genus database with same CATH topology
 3QOX A;  4X4C A;  2ICT A;  4Q2J A;  4OB4 A;  2PUD A;  2R63 A;  2LYL A;  2PXU A;  2LYK A;  1QQB A;  1ZZB A;  2KZ8 A;  2EF8 A;  1ZPQ A;  4NDW A;  2JVL A;  1PNR A;  4PU3 C;  5DSX A;  2XXQ A;  1GT0 C;  3D1N I;  2EWT A;  3OQO A;  3F52 A;  1RPE L;  5DRY A;  2PIJ A;  3KZ3 A;  2XJ3 A;  1YSE A;  2FFH A;  2O38 A;  2LYQ A;  1RIO A;  2PUB A;  4EQZ A;  3G0T A;  2BNN A;  3TEP A;  4Z59 A;  4Z5D A;  2JCG A;  2JQE A;  2IUO A;  4PU7 A;  2GRM A;  2PXP A;  1CQT A;  3LIS A;  4X4F A;  4FBI A;  3B7H A;  4MCX A;  1U2Z A;  5DTM A;  4ER7 A;  3NXH A;  1X57 A;  1PRU A;  3H5T A;  2GZU A;  2IV1 A;  2PUA A;  3OKZ A;  2PXT A;  4F8D A;  3OQN A;  2AUW A;  3GBF A;  1RZR D;  3BDN A;  2LNM A;  2PUG A;  2XXA A;  2KEJ A;  2EBY A;  1LMB 3;  2PXD A;  1XWR A;  3SX0 A;  2AWI A;  1ZZC A;  2PXF A;  2XIU A;  3A9X A;  2XCJ A;  4I6T A;  3TRB A;  4JQD A;  3DNV B;  1R69 A;  3SCF A;  1RZR A;  3ME5 A;  2FJR A;  4ER3 A;  1ZUG A;  2HSG A;  2AXV A;  1QPZ A;  4X4G A;  4X4H A;  3NZL A;  4IA8 A;  3FYA A;  2J7U A;  3GN5 A;  2BJC A;  5K98 B;  3F6W A;  5A7L A;  3GZC A;  1OSL A;  1NER A;  2PE5 A;  4YBA A;  3EUS A;  4YG1 A;  2AXZ A;  2ODR D;  4Y42 A;  1VPW A;  1LLI A;  3SCH A;  4JCX A;  3R1F A;  4EKG A;  2IVQ A;  3DM5 A;  3OP9 A;  4ER0 A;  2H8R A;  3S8Q A;  3BD1 A;  1ZAY A;  2PXE A;  3HZI B;  1CJG A;  2PPX A;  2YBD A;  2B5A A;  3R09 A;  2LLW A;  4ER5 A;  3GZD C;  1R63 A;  5DT2 A;  2PUF A;  2O49 A;  3GUU A;  1PER L;  1E3O C;  2R1J L;  1ZZ6 A;  4X4B A;  3OQM A;  3QYX A;  3NDB B;  1WH8 A;  2CSF A;  3KL4 A;  1HF0 A;  2ICP A;  3PE5 A;  1JWL A;  2L49 A;  5GAH i;  4Z58 A;  1QP4 A;  4Z5C A;  3QWG A;  3ZHI A;  1QP7 A;  3MEJ A;  3A9Y A;  3F51 A;  4GHJ A;  3TFL A;  2PXK A;  1BDH A;  2GRL A;  2HCN A;  4JCY A;  4EK9 A;  1Y7Y A;  3PXP A;  3VK0 A;  1QP0 A;  1POU A;  1JH9 A;  3G7D A;  1ZVV A;  3G5G A;  1UXD A;  2XSD C;  4YAR A;  2XI8 A;  3UWP A;  1LCD A;  1QB2 A;  4WVL A;  1LCC A;  2LYJ A;  1UXC A;  2HIN A;  1PRV A;  2MQK A;  2PXV A;  1LQC A;  1NW3 A;  4YG7 B;  3JXD L;  1BDI A;  2IVG A;  3BS3 A;  3VWS A;  3TEL A;  4HRA A;  3JXB C;  3O9X A;  2PUC A;  4YG4 A;  3LFP A;  4I6R A;  1ZS4 A;  1IC8 A;  4IWR A;  1OCT C;  2PUE A;  3UFD A;  1NEQ A;  2PXL A;  2V3C C;  1QZX A;  2L1P A;  3ZKC A;  5DRT A;  3KXA A;  4DE9 A;  1RZS A;  2A6C A;  2KEK A;  2LYR A;  4O8B A;  2LYS A;  2OR1 L;  1JFS A;  2LLV A;  1WIZ A;  5JUW A;  3M9L A;  4J1X A;  2AXU A;  1Y9Q A;  1UTX A;  1SQ8 A;  4PU8 A;  2KPJ A;  3U3W A;  3SCG A;  3LQX A;  2VEO A;  1WH6 A;  2LCV A;  2D5V A;  1EFA A;  2WIU B;  3KJX A;  1MFQ C;  3GZD A;  3CLC A;  4PU4 C;  2OFY A;  2HFZ A;  3L1P A;  2MXD A;  2MEZ A;  3QOW A;  3A9Z A;  3QQ6 A;  2PXB A;  2KEI A;  4ER6 A;  1DWK A;  1QQA A;  1ZZ7 A;  4OBM A;  3NRO A;  2AW6 A;  2HCS A;  5DTR A;  4J1W A;  1WET A;  3RZZ A;  1DUL A;  4X4D A;  3ZPX A;  4GQM A;  2PXQ A;  2WUS R;  4FN3 A;  1JFT A;  2J7W A;  2LYP A;  5DTQ A;  2IU7 A;  1DW9 A;  4EKI A;  1ADR A;  4EZI A;  4X4I A;  2O4A A;  4DE8 A;  3CRO L;  3FYM A;  2IVB A;  1ZZ8 A;  3ZHM A;  2M4H A;  4MCT A;  3JXC L;  4I6U A;  3OWQ A;  2CRO A;  3IVP A;  1HQ1 A;  1ZZ9 A;  1X2L A;  4I8T A;  1O4X A;  3GN5 B;  3CEC A;  3QF3 A;  1S7E A;  2BNO A;  4X4E A;  1L1M A;  2XXP A;  5GAG i;  4Z5H A;  3FMY A;  1AU7 A;  3OMT A;  1PRA A;  3SR4 A;  2BNM A;  3MLF A;  2L8N A;  4IVZ A;  1B0N A;  3QFI A; 
#chains in the Genus database with same CATH homology
 2FJR A;  4X4C A;  2ICT A;  1ZUG A;  2HSG A;  1WH6 A;  2AXV A;  3F51 A;  1QPZ A;  4GHJ A;  4X4G A;  4X4H A;  4OB4 A;  2LCV A;  2D5V A;  4IA8 A;  2R63 A;  2LYL A;  3FYA A;  1BDH A;  2LYK A;  2GRL A;  1EFA A;  1QQB A;  2PUD A;  2WIU B;  3GN5 A;  3KJX A;  4JCY A;  1ZZB A;  1Y7Y A;  3PXP A;  3VK0 A;  2KZ8 A;  3CLC A;  1QP0 A;  4PU4 C;  2OFY A;  1POU A;  2EF8 A;  2BJC A;  1JH9 A;  3G7D A;  3L1P A;  1ZPQ A;  2MEZ A;  1ZVV A;  4NDW A;  3G5G A;  1UXD A;  2XSD C;  2JVL A;  1PNR A;  4PU3 C;  3QQ6 A;  4YAR A;  5K98 B;  3F6W A;  5A7L A;  2KEI A;  1GT0 C;  1DWK A;  1OSL A;  1NER A;  2XI8 A;  3D1N I;  2EWT A;  2PE5 A;  1LCD A;  1QQA A;  4YBA A;  3OQO A;  1ZZ7 A;  3F52 A;  1LCC A;  3EUS A;  2LYJ A;  4YG1 A;  1RPE L;  2AW6 A;  2AXZ A;  4Y42 A;  1VPW A;  4J1W A;  1UXC A;  2PIJ A;  3KZ3 A;  1WET A;  1LLI A;  3RZZ A;  3SCH A;  2HIN A;  1PRV A;  2XJ3 A;  1YSE A;  4JCX A;  2O38 A;  3R1F A;  2MQK A;  2LYQ A;  1RIO A;  4X4D A;  2PUB A;  2IVQ A;  1LQC A;  3OP9 A;  4GQM A;  2BNN A;  3S8Q A;  2H8R A;  2WUS R;  4FN3 A;  4YG7 B;  3JXD L;  1JFT A;  1BDI A;  4Z59 A;  3BD1 A;  4Z5D A;  2IVG A;  2LYP A;  3BS3 A;  1ZAY A;  2JCG A;  3HZI B;  1CJG A;  2IUO A;  2PPX A;  4PU7 A;  2IU7 A;  1DW9 A;  2GRM A;  1ADR A;  3JXB C;  1CQT A;  4X4I A;  3LIS A;  2B5A A;  4X4F A;  3O9X A;  2O4A A;  2PUC A;  4FBI A;  4YG4 A;  3B7H A;  3LFP A;  4I6R A;  4MCX A;  1ZS4 A;  1IC8 A;  3CRO L;  3FYM A;  2IVB A;  1ZZ8 A;  3ZHM A;  1X57 A;  1PRU A;  4MCT A;  3JXC L;  1R63 A;  1OCT C;  3H5T A;  2PUE A;  4IWR A;  2PUF A;  3UFD A;  2GZU A;  2IV1 A;  1NEQ A;  4I6U A;  2O49 A;  2CRO A;  3IVP A;  1ZZ9 A;  1X2L A;  1PER L;  1E3O C;  2PUA A;  1O4X A;  4I8T A;  3GN5 B;  4F8D A;  2R1J L;  3ZKC A;  3OQN A;  2AUW A;  3KXA A;  3CEC A;  3GBF A;  3QF3 A;  1RZS A;  1RZR D;  1ZZ6 A;  3BDN A;  4X4B A;  1S7E A;  2PUG A;  2BNO A;  3OQM A;  3QYX A;  2A6C A;  2KEK A;  2KEJ A;  4X4E A;  1L1M A;  2EBY A;  1WH8 A;  2LYR A;  1LMB 3;  4Z5H A;  2CSF A;  4O8B A;  2LYS A;  1XWR A;  3FMY A;  1AU7 A;  2AWI A;  1ZZC A;  1HF0 A;  2ICP A;  3OMT A;  2OR1 L;  1PRA A;  1JFS A;  1WIZ A;  2XIU A;  2XCJ A;  4I6T A;  2BNM A;  3MLF A;  4J1X A;  3TRB A;  4JQD A;  2AXU A;  2L8N A;  1JWL A;  1Y9Q A;  3DNV B;  1UTX A;  2L49 A;  1R69 A;  4Z58 A;  4IVZ A;  1QP4 A;  4Z5C A;  3QWG A;  3SCF A;  1B0N A;  3ZHI A;  1RZR A;  1SQ8 A;  4PU8 A;  2KPJ A;  1QP7 A;  3U3W A;  3SCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...